data_1HLS
# 
_entry.id   1HLS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HLS         
WWPDB D_1000173902 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HLS 
_pdbx_database_status.recvd_initial_deposition_date   1995-06-28 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ludvigsen, S.'   1 
'Kaarsholm, N.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
;High-resolution structure of an engineered biologically potent insulin monomer, B16 Tyr-->His, as determined by nuclear magnetic resonance spectroscopy.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            33 
_citation.page_first                7998 
_citation.page_last                 8006 
_citation.year                      1994 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8025104 
_citation.pdbx_database_id_DOI      10.1021/bi00192a003 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ludvigsen, S.'   1 
primary 'Roy, M.'         2 
primary 'Thogersen, H.'   3 
primary 'Kaarsholm, N.C.' 4 
# 
_cell.entry_id           1HLS 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HLS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man INSULIN 2383.698 1 ? 'TYR 16 B HIS' ? ? 
2 polymer man INSULIN 3408.926 1 ? 'TYR 16 B HIS' ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALHLVCGERGFFYTPKT FVNQHLCGSHLVEALHLVCGERGFFYTPKT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 HIS n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? PANCREAS ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INS_HUMAN P01308 1 90 ? ? 
2 UNP INS_HUMAN P01308 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HLS A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2 2 1HLS B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1HLS 
_struct_ref_seq_dif.mon_id                       HIS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      16 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01308 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          40 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            16 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1HLS 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.0 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1HLS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1HLS 
_struct.title                     'NMR STRUCTURE OF THE HUMAN INSULIN-HIS(B16)' 
_struct.pdbx_descriptor           INSULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HLS 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            HORMONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 ILE A 2  ? SER A 9  ? ILE A 2  SER A 9  1 ? 8  
HELX_P HELX_P2 H2 SER A 12 ? TYR A 19 ? SER A 12 TYR A 19 1 ? 8  
HELX_P HELX_P3 H3 SER B 9  ? CYS B 19 ? SER B 9  CYS B 19 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.018 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HLS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HLS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -2.414  8.071   6.020   1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -2.818  6.735   6.545   1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -1.591  5.828   6.634   1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -0.762  5.969   7.512   1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -1.391  8.204   6.164   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? -2.631  8.126   5.006   1.00 0.00 ? 1  GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? -2.935  8.814   6.525   1.00 0.00 ? 1  GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? -3.256  6.851   7.526   1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? -3.542  6.290   5.877   1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10    N N    . ILE A 1 2  ? -1.471  4.899   5.729   1.00 0.00 ? 2  ILE A N    1  
ATOM 11    C CA   . ILE A 1 2  ? -0.304  3.975   5.746   1.00 0.00 ? 2  ILE A CA   1  
ATOM 12    C C    . ILE A 1 2  ? 0.829   4.569   4.908   1.00 0.00 ? 2  ILE A C    1  
ATOM 13    O O    . ILE A 1 2  ? 1.809   3.913   4.616   1.00 0.00 ? 2  ILE A O    1  
ATOM 14    C CB   . ILE A 1 2  ? -0.740  2.632   5.162   1.00 0.00 ? 2  ILE A CB   1  
ATOM 15    C CG1  . ILE A 1 2  ? 0.276   1.546   5.518   1.00 0.00 ? 2  ILE A CG1  1  
ATOM 16    C CG2  . ILE A 1 2  ? -0.856  2.738   3.640   1.00 0.00 ? 2  ILE A CG2  1  
ATOM 17    C CD1  . ILE A 1 2  ? -0.254  0.185   5.059   1.00 0.00 ? 2  ILE A CD1  1  
ATOM 18    H H    . ILE A 1 2  ? -2.155  4.807   5.032   1.00 0.00 ? 2  ILE A H    1  
ATOM 19    H HA   . ILE A 1 2  ? 0.033   3.834   6.764   1.00 0.00 ? 2  ILE A HA   1  
ATOM 20    H HB   . ILE A 1 2  ? -1.701  2.370   5.573   1.00 0.00 ? 2  ILE A HB   1  
ATOM 21    H HG12 . ILE A 1 2  ? 1.214   1.756   5.023   1.00 0.00 ? 2  ILE A HG12 1  
ATOM 22    H HG13 . ILE A 1 2  ? 0.427   1.531   6.586   1.00 0.00 ? 2  ILE A HG13 1  
ATOM 23    H HG21 . ILE A 1 2  ? -0.988  3.773   3.358   1.00 0.00 ? 2  ILE A HG21 1  
ATOM 24    H HG22 . ILE A 1 2  ? 0.044   2.353   3.182   1.00 0.00 ? 2  ILE A HG22 1  
ATOM 25    H HG23 . ILE A 1 2  ? -1.705  2.162   3.301   1.00 0.00 ? 2  ILE A HG23 1  
ATOM 26    H HD11 . ILE A 1 2  ? -0.790  0.301   4.125   1.00 0.00 ? 2  ILE A HD11 1  
ATOM 27    H HD12 . ILE A 1 2  ? 0.573   -0.493  4.919   1.00 0.00 ? 2  ILE A HD12 1  
ATOM 28    H HD13 . ILE A 1 2  ? -0.924  -0.212  5.809   1.00 0.00 ? 2  ILE A HD13 1  
ATOM 29    N N    . VAL A 1 3  ? 0.699   5.807   4.521   1.00 0.00 ? 3  VAL A N    1  
ATOM 30    C CA   . VAL A 1 3  ? 1.762   6.451   3.703   1.00 0.00 ? 3  VAL A CA   1  
ATOM 31    C C    . VAL A 1 3  ? 2.897   6.908   4.621   1.00 0.00 ? 3  VAL A C    1  
ATOM 32    O O    . VAL A 1 3  ? 4.058   6.860   4.264   1.00 0.00 ? 3  VAL A O    1  
ATOM 33    C CB   . VAL A 1 3  ? 1.172   7.660   2.974   1.00 0.00 ? 3  VAL A CB   1  
ATOM 34    C CG1  . VAL A 1 3  ? 2.167   8.169   1.931   1.00 0.00 ? 3  VAL A CG1  1  
ATOM 35    C CG2  . VAL A 1 3  ? -0.127  7.245   2.278   1.00 0.00 ? 3  VAL A CG2  1  
ATOM 36    H H    . VAL A 1 3  ? -0.100  6.316   4.770   1.00 0.00 ? 3  VAL A H    1  
ATOM 37    H HA   . VAL A 1 3  ? 2.144   5.744   2.981   1.00 0.00 ? 3  VAL A HA   1  
ATOM 38    H HB   . VAL A 1 3  ? 0.965   8.444   3.688   1.00 0.00 ? 3  VAL A HB   1  
ATOM 39    H HG11 . VAL A 1 3  ? 2.441   7.359   1.271   1.00 0.00 ? 3  VAL A HG11 1  
ATOM 40    H HG12 . VAL A 1 3  ? 1.713   8.962   1.358   1.00 0.00 ? 3  VAL A HG12 1  
ATOM 41    H HG13 . VAL A 1 3  ? 3.050   8.542   2.428   1.00 0.00 ? 3  VAL A HG13 1  
ATOM 42    H HG21 . VAL A 1 3  ? -0.067  6.205   1.993   1.00 0.00 ? 3  VAL A HG21 1  
ATOM 43    H HG22 . VAL A 1 3  ? -0.958  7.385   2.953   1.00 0.00 ? 3  VAL A HG22 1  
ATOM 44    H HG23 . VAL A 1 3  ? -0.273  7.852   1.397   1.00 0.00 ? 3  VAL A HG23 1  
ATOM 45    N N    . GLU A 1 4  ? 2.572   7.345   5.807   1.00 0.00 ? 4  GLU A N    1  
ATOM 46    C CA   . GLU A 1 4  ? 3.631   7.800   6.750   1.00 0.00 ? 4  GLU A CA   1  
ATOM 47    C C    . GLU A 1 4  ? 4.436   6.593   7.243   1.00 0.00 ? 4  GLU A C    1  
ATOM 48    O O    . GLU A 1 4  ? 5.392   6.732   7.979   1.00 0.00 ? 4  GLU A O    1  
ATOM 49    C CB   . GLU A 1 4  ? 2.978   8.499   7.946   1.00 0.00 ? 4  GLU A CB   1  
ATOM 50    C CG   . GLU A 1 4  ? 4.046   9.236   8.757   1.00 0.00 ? 4  GLU A CG   1  
ATOM 51    C CD   . GLU A 1 4  ? 3.747   10.735  8.757   1.00 0.00 ? 4  GLU A CD   1  
ATOM 52    O OE1  . GLU A 1 4  ? 2.613   11.093  8.485   1.00 0.00 ? 4  GLU A OE1  1  
ATOM 53    O OE2  . GLU A 1 4  ? 4.657   11.501  9.030   1.00 0.00 ? 4  GLU A OE2  1  
ATOM 54    H H    . GLU A 1 4  ? 1.630   7.371   6.076   1.00 0.00 ? 4  GLU A H    1  
ATOM 55    H HA   . GLU A 1 4  ? 4.290   8.491   6.246   1.00 0.00 ? 4  GLU A HA   1  
ATOM 56    H HB2  . GLU A 1 4  ? 2.243   9.209   7.590   1.00 0.00 ? 4  GLU A HB2  1  
ATOM 57    H HB3  . GLU A 1 4  ? 2.494   7.766   8.571   1.00 0.00 ? 4  GLU A HB3  1  
ATOM 58    H HG2  . GLU A 1 4  ? 4.043   8.866   9.773   1.00 0.00 ? 4  GLU A HG2  1  
ATOM 59    H HG3  . GLU A 1 4  ? 5.016   9.064   8.315   1.00 0.00 ? 4  GLU A HG3  1  
ATOM 60    N N    . GLN A 1 5  ? 4.055   5.407   6.846   1.00 0.00 ? 5  GLN A N    1  
ATOM 61    C CA   . GLN A 1 5  ? 4.797   4.195   7.297   1.00 0.00 ? 5  GLN A CA   1  
ATOM 62    C C    . GLN A 1 5  ? 5.322   3.426   6.080   1.00 0.00 ? 5  GLN A C    1  
ATOM 63    O O    . GLN A 1 5  ? 6.307   2.719   6.163   1.00 0.00 ? 5  GLN A O    1  
ATOM 64    C CB   . GLN A 1 5  ? 3.852   3.294   8.097   1.00 0.00 ? 5  GLN A CB   1  
ATOM 65    C CG   . GLN A 1 5  ? 4.103   3.495   9.593   1.00 0.00 ? 5  GLN A CG   1  
ATOM 66    C CD   . GLN A 1 5  ? 2.990   2.814   10.394  1.00 0.00 ? 5  GLN A CD   1  
ATOM 67    O OE1  . GLN A 1 5  ? 1.822   3.037   10.143  1.00 0.00 ? 5  GLN A OE1  1  
ATOM 68    N NE2  . GLN A 1 5  ? 3.307   1.990   11.355  1.00 0.00 ? 5  GLN A NE2  1  
ATOM 69    H H    . GLN A 1 5  ? 3.279   5.313   6.258   1.00 0.00 ? 5  GLN A H    1  
ATOM 70    H HA   . GLN A 1 5  ? 5.626   4.492   7.923   1.00 0.00 ? 5  GLN A HA   1  
ATOM 71    H HB2  . GLN A 1 5  ? 2.827   3.550   7.864   1.00 0.00 ? 5  GLN A HB2  1  
ATOM 72    H HB3  . GLN A 1 5  ? 4.035   2.262   7.838   1.00 0.00 ? 5  GLN A HB3  1  
ATOM 73    H HG2  . GLN A 1 5  ? 5.056   3.060   9.860   1.00 0.00 ? 5  GLN A HG2  1  
ATOM 74    H HG3  . GLN A 1 5  ? 4.113   4.550   9.818   1.00 0.00 ? 5  GLN A HG3  1  
ATOM 75    H HE21 . GLN A 1 5  ? 4.248   1.811   11.556  1.00 0.00 ? 5  GLN A HE21 1  
ATOM 76    H HE22 . GLN A 1 5  ? 2.602   1.550   11.876  1.00 0.00 ? 5  GLN A HE22 1  
ATOM 77    N N    . CYS A 1 6  ? 4.674   3.553   4.955   1.00 0.00 ? 6  CYS A N    1  
ATOM 78    C CA   . CYS A 1 6  ? 5.138   2.819   3.741   1.00 0.00 ? 6  CYS A CA   1  
ATOM 79    C C    . CYS A 1 6  ? 5.832   3.789   2.780   1.00 0.00 ? 6  CYS A C    1  
ATOM 80    O O    . CYS A 1 6  ? 6.901   3.516   2.272   1.00 0.00 ? 6  CYS A O    1  
ATOM 81    C CB   . CYS A 1 6  ? 3.937   2.181   3.042   1.00 0.00 ? 6  CYS A CB   1  
ATOM 82    S SG   . CYS A 1 6  ? 3.320   0.803   4.040   1.00 0.00 ? 6  CYS A SG   1  
ATOM 83    H H    . CYS A 1 6  ? 3.878   4.122   4.910   1.00 0.00 ? 6  CYS A H    1  
ATOM 84    H HA   . CYS A 1 6  ? 5.833   2.047   4.033   1.00 0.00 ? 6  CYS A HA   1  
ATOM 85    H HB2  . CYS A 1 6  ? 3.158   2.919   2.923   1.00 0.00 ? 6  CYS A HB2  1  
ATOM 86    H HB3  . CYS A 1 6  ? 4.239   1.816   2.071   1.00 0.00 ? 6  CYS A HB3  1  
ATOM 87    N N    . CYS A 1 7  ? 5.234   4.919   2.518   1.00 0.00 ? 7  CYS A N    1  
ATOM 88    C CA   . CYS A 1 7  ? 5.871   5.890   1.588   1.00 0.00 ? 7  CYS A CA   1  
ATOM 89    C C    . CYS A 1 7  ? 7.193   6.374   2.190   1.00 0.00 ? 7  CYS A C    1  
ATOM 90    O O    . CYS A 1 7  ? 8.182   6.526   1.500   1.00 0.00 ? 7  CYS A O    1  
ATOM 91    C CB   . CYS A 1 7  ? 4.929   7.078   1.367   1.00 0.00 ? 7  CYS A CB   1  
ATOM 92    S SG   . CYS A 1 7  ? 5.828   8.448   0.592   1.00 0.00 ? 7  CYS A SG   1  
ATOM 93    H H    . CYS A 1 7  ? 4.370   5.126   2.931   1.00 0.00 ? 7  CYS A H    1  
ATOM 94    H HA   . CYS A 1 7  ? 6.066   5.406   0.642   1.00 0.00 ? 7  CYS A HA   1  
ATOM 95    H HB2  . CYS A 1 7  ? 4.118   6.776   0.720   1.00 0.00 ? 7  CYS A HB2  1  
ATOM 96    H HB3  . CYS A 1 7  ? 4.527   7.400   2.313   1.00 0.00 ? 7  CYS A HB3  1  
ATOM 97    N N    . THR A 1 8  ? 7.221   6.616   3.473   1.00 0.00 ? 8  THR A N    1  
ATOM 98    C CA   . THR A 1 8  ? 8.481   7.086   4.115   1.00 0.00 ? 8  THR A CA   1  
ATOM 99    C C    . THR A 1 8  ? 9.431   5.902   4.303   1.00 0.00 ? 8  THR A C    1  
ATOM 100   O O    . THR A 1 8  ? 10.579  5.945   3.904   1.00 0.00 ? 8  THR A O    1  
ATOM 101   C CB   . THR A 1 8  ? 8.161   7.704   5.478   1.00 0.00 ? 8  THR A CB   1  
ATOM 102   O OG1  . THR A 1 8  ? 7.223   6.882   6.160   1.00 0.00 ? 8  THR A OG1  1  
ATOM 103   C CG2  . THR A 1 8  ? 7.567   9.100   5.280   1.00 0.00 ? 8  THR A CG2  1  
ATOM 104   H H    . THR A 1 8  ? 6.414   6.487   4.014   1.00 0.00 ? 8  THR A H    1  
ATOM 105   H HA   . THR A 1 8  ? 8.950   7.827   3.485   1.00 0.00 ? 8  THR A HA   1  
ATOM 106   H HB   . THR A 1 8  ? 9.065   7.783   6.062   1.00 0.00 ? 8  THR A HB   1  
ATOM 107   H HG1  . THR A 1 8  ? 7.712   6.200   6.626   1.00 0.00 ? 8  THR A HG1  1  
ATOM 108   H HG21 . THR A 1 8  ? 7.551   9.337   4.227   1.00 0.00 ? 8  THR A HG21 1  
ATOM 109   H HG22 . THR A 1 8  ? 6.560   9.122   5.671   1.00 0.00 ? 8  THR A HG22 1  
ATOM 110   H HG23 . THR A 1 8  ? 8.173   9.825   5.802   1.00 0.00 ? 8  THR A HG23 1  
ATOM 111   N N    . SER A 1 9  ? 8.964   4.843   4.906   1.00 0.00 ? 9  SER A N    1  
ATOM 112   C CA   . SER A 1 9  ? 9.842   3.656   5.117   1.00 0.00 ? 9  SER A CA   1  
ATOM 113   C C    . SER A 1 9  ? 9.285   2.468   4.331   1.00 0.00 ? 9  SER A C    1  
ATOM 114   O O    . SER A 1 9  ? 8.140   2.463   3.927   1.00 0.00 ? 9  SER A O    1  
ATOM 115   C CB   . SER A 1 9  ? 9.879   3.308   6.605   1.00 0.00 ? 9  SER A CB   1  
ATOM 116   O OG   . SER A 1 9  ? 11.165  3.620   7.128   1.00 0.00 ? 9  SER A OG   1  
ATOM 117   H H    . SER A 1 9  ? 8.036   4.827   5.218   1.00 0.00 ? 9  SER A H    1  
ATOM 118   H HA   . SER A 1 9  ? 10.841  3.881   4.774   1.00 0.00 ? 9  SER A HA   1  
ATOM 119   H HB2  . SER A 1 9  ? 9.134   3.882   7.131   1.00 0.00 ? 9  SER A HB2  1  
ATOM 120   H HB3  . SER A 1 9  ? 9.675   2.252   6.731   1.00 0.00 ? 9  SER A HB3  1  
ATOM 121   H HG   . SER A 1 9  ? 11.810  3.069   6.678   1.00 0.00 ? 9  SER A HG   1  
ATOM 122   N N    . ILE A 1 10 ? 10.081  1.459   4.112   1.00 0.00 ? 10 ILE A N    1  
ATOM 123   C CA   . ILE A 1 10 ? 9.588   0.278   3.351   1.00 0.00 ? 10 ILE A CA   1  
ATOM 124   C C    . ILE A 1 10 ? 8.863   -0.673  4.306   1.00 0.00 ? 10 ILE A C    1  
ATOM 125   O O    . ILE A 1 10 ? 9.477   -1.441  5.019   1.00 0.00 ? 10 ILE A O    1  
ATOM 126   C CB   . ILE A 1 10 ? 10.773  -0.441  2.705   1.00 0.00 ? 10 ILE A CB   1  
ATOM 127   C CG1  . ILE A 1 10 ? 11.654  0.586   1.987   1.00 0.00 ? 10 ILE A CG1  1  
ATOM 128   C CG2  . ILE A 1 10 ? 10.259  -1.466  1.695   1.00 0.00 ? 10 ILE A CG2  1  
ATOM 129   C CD1  . ILE A 1 10 ? 12.664  -0.139  1.097   1.00 0.00 ? 10 ILE A CD1  1  
ATOM 130   H H    . ILE A 1 10 ? 11.002  1.479   4.447   1.00 0.00 ? 10 ILE A H    1  
ATOM 131   H HA   . ILE A 1 10 ? 8.904   0.606   2.581   1.00 0.00 ? 10 ILE A HA   1  
ATOM 132   H HB   . ILE A 1 10 ? 11.351  -0.942  3.468   1.00 0.00 ? 10 ILE A HB   1  
ATOM 133   H HG12 . ILE A 1 10 ? 11.034  1.229   1.379   1.00 0.00 ? 10 ILE A HG12 1  
ATOM 134   H HG13 . ILE A 1 10 ? 12.182  1.181   2.717   1.00 0.00 ? 10 ILE A HG13 1  
ATOM 135   H HG21 . ILE A 1 10 ? 9.233   -1.716  1.925   1.00 0.00 ? 10 ILE A HG21 1  
ATOM 136   H HG22 . ILE A 1 10 ? 10.314  -1.051  0.699   1.00 0.00 ? 10 ILE A HG22 1  
ATOM 137   H HG23 . ILE A 1 10 ? 10.866  -2.358  1.747   1.00 0.00 ? 10 ILE A HG23 1  
ATOM 138   H HD11 . ILE A 1 10 ? 12.980  -1.052  1.580   1.00 0.00 ? 10 ILE A HD11 1  
ATOM 139   H HD12 . ILE A 1 10 ? 12.205  -0.373  0.148   1.00 0.00 ? 10 ILE A HD12 1  
ATOM 140   H HD13 . ILE A 1 10 ? 13.522  0.498   0.935   1.00 0.00 ? 10 ILE A HD13 1  
ATOM 141   N N    . CYS A 1 11 ? 7.558   -0.622  4.326   1.00 0.00 ? 11 CYS A N    1  
ATOM 142   C CA   . CYS A 1 11 ? 6.788   -1.514  5.239   1.00 0.00 ? 11 CYS A CA   1  
ATOM 143   C C    . CYS A 1 11 ? 6.752   -2.935  4.667   1.00 0.00 ? 11 CYS A C    1  
ATOM 144   O O    . CYS A 1 11 ? 7.357   -3.223  3.653   1.00 0.00 ? 11 CYS A O    1  
ATOM 145   C CB   . CYS A 1 11 ? 5.359   -0.986  5.381   1.00 0.00 ? 11 CYS A CB   1  
ATOM 146   S SG   . CYS A 1 11 ? 4.665   -0.674  3.738   1.00 0.00 ? 11 CYS A SG   1  
ATOM 147   H H    . CYS A 1 11 ? 7.084   0.009   3.744   1.00 0.00 ? 11 CYS A H    1  
ATOM 148   H HA   . CYS A 1 11 ? 7.263   -1.530  6.208   1.00 0.00 ? 11 CYS A HA   1  
ATOM 149   H HB2  . CYS A 1 11 ? 4.754   -1.718  5.895   1.00 0.00 ? 11 CYS A HB2  1  
ATOM 150   H HB3  . CYS A 1 11 ? 5.371   -0.067  5.948   1.00 0.00 ? 11 CYS A HB3  1  
ATOM 151   N N    . SER A 1 12 ? 6.050   -3.824  5.316   1.00 0.00 ? 12 SER A N    1  
ATOM 152   C CA   . SER A 1 12 ? 5.973   -5.226  4.820   1.00 0.00 ? 12 SER A CA   1  
ATOM 153   C C    . SER A 1 12 ? 4.636   -5.446  4.106   1.00 0.00 ? 12 SER A C    1  
ATOM 154   O O    . SER A 1 12 ? 3.799   -4.568  4.049   1.00 0.00 ? 12 SER A O    1  
ATOM 155   C CB   . SER A 1 12 ? 6.078   -6.186  6.004   1.00 0.00 ? 12 SER A CB   1  
ATOM 156   O OG   . SER A 1 12 ? 5.650   -5.523  7.186   1.00 0.00 ? 12 SER A OG   1  
ATOM 157   H H    . SER A 1 12 ? 5.573   -3.569  6.134   1.00 0.00 ? 12 SER A H    1  
ATOM 158   H HA   . SER A 1 12 ? 6.785   -5.410  4.131   1.00 0.00 ? 12 SER A HA   1  
ATOM 159   H HB2  . SER A 1 12 ? 5.451   -7.044  5.833   1.00 0.00 ? 12 SER A HB2  1  
ATOM 160   H HB3  . SER A 1 12 ? 7.106   -6.510  6.113   1.00 0.00 ? 12 SER A HB3  1  
ATOM 161   H HG   . SER A 1 12 ? 4.932   -6.034  7.568   1.00 0.00 ? 12 SER A HG   1  
ATOM 162   N N    . LEU A 1 13 ? 4.428   -6.614  3.562   1.00 0.00 ? 13 LEU A N    1  
ATOM 163   C CA   . LEU A 1 13 ? 3.144   -6.888  2.856   1.00 0.00 ? 13 LEU A CA   1  
ATOM 164   C C    . LEU A 1 13 ? 2.041   -7.137  3.888   1.00 0.00 ? 13 LEU A C    1  
ATOM 165   O O    . LEU A 1 13 ? 0.868   -7.111  3.575   1.00 0.00 ? 13 LEU A O    1  
ATOM 166   C CB   . LEU A 1 13 ? 3.301   -8.125  1.969   1.00 0.00 ? 13 LEU A CB   1  
ATOM 167   C CG   . LEU A 1 13 ? 2.934   -7.773  0.526   1.00 0.00 ? 13 LEU A CG   1  
ATOM 168   C CD1  . LEU A 1 13 ? 1.481   -7.296  0.469   1.00 0.00 ? 13 LEU A CD1  1  
ATOM 169   C CD2  . LEU A 1 13 ? 3.855   -6.657  0.024   1.00 0.00 ? 13 LEU A CD2  1  
ATOM 170   H H    . LEU A 1 13 ? 5.115   -7.311  3.620   1.00 0.00 ? 13 LEU A H    1  
ATOM 171   H HA   . LEU A 1 13 ? 2.880   -6.038  2.245   1.00 0.00 ? 13 LEU A HA   1  
ATOM 172   H HB2  . LEU A 1 13 ? 4.325   -8.468  2.008   1.00 0.00 ? 13 LEU A HB2  1  
ATOM 173   H HB3  . LEU A 1 13 ? 2.647   -8.908  2.323   1.00 0.00 ? 13 LEU A HB3  1  
ATOM 174   H HG   . LEU A 1 13 ? 3.050   -8.646  -0.097  1.00 0.00 ? 13 LEU A HG   1  
ATOM 175   H HD11 . LEU A 1 13 ? 0.999   -7.494  1.415   1.00 0.00 ? 13 LEU A HD11 1  
ATOM 176   H HD12 . LEU A 1 13 ? 1.458   -6.235  0.268   1.00 0.00 ? 13 LEU A HD12 1  
ATOM 177   H HD13 . LEU A 1 13 ? 0.960   -7.824  -0.317  1.00 0.00 ? 13 LEU A HD13 1  
ATOM 178   H HD21 . LEU A 1 13 ? 4.183   -6.057  0.860   1.00 0.00 ? 13 LEU A HD21 1  
ATOM 179   H HD22 . LEU A 1 13 ? 4.714   -7.093  -0.464  1.00 0.00 ? 13 LEU A HD22 1  
ATOM 180   H HD23 . LEU A 1 13 ? 3.318   -6.036  -0.677  1.00 0.00 ? 13 LEU A HD23 1  
ATOM 181   N N    . TYR A 1 14 ? 2.410   -7.375  5.118   1.00 0.00 ? 14 TYR A N    1  
ATOM 182   C CA   . TYR A 1 14 ? 1.383   -7.624  6.168   1.00 0.00 ? 14 TYR A CA   1  
ATOM 183   C C    . TYR A 1 14 ? 0.714   -6.305  6.554   1.00 0.00 ? 14 TYR A C    1  
ATOM 184   O O    . TYR A 1 14 ? -0.409  -6.281  7.020   1.00 0.00 ? 14 TYR A O    1  
ATOM 185   C CB   . TYR A 1 14 ? 2.055   -8.235  7.402   1.00 0.00 ? 14 TYR A CB   1  
ATOM 186   C CG   . TYR A 1 14 ? 1.082   -8.232  8.555   1.00 0.00 ? 14 TYR A CG   1  
ATOM 187   C CD1  . TYR A 1 14 ? 0.078   -9.205  8.626   1.00 0.00 ? 14 TYR A CD1  1  
ATOM 188   C CD2  . TYR A 1 14 ? 1.181   -7.253  9.551   1.00 0.00 ? 14 TYR A CD2  1  
ATOM 189   C CE1  . TYR A 1 14 ? -0.828  -9.200  9.694   1.00 0.00 ? 14 TYR A CE1  1  
ATOM 190   C CE2  . TYR A 1 14 ? 0.275   -7.248  10.619  1.00 0.00 ? 14 TYR A CE2  1  
ATOM 191   C CZ   . TYR A 1 14 ? -0.728  -8.222  10.690  1.00 0.00 ? 14 TYR A CZ   1  
ATOM 192   O OH   . TYR A 1 14 ? -1.621  -8.216  11.743  1.00 0.00 ? 14 TYR A OH   1  
ATOM 193   H H    . TYR A 1 14 ? 3.362   -7.390  5.350   1.00 0.00 ? 14 TYR A H    1  
ATOM 194   H HA   . TYR A 1 14 ? 0.640   -8.307  5.790   1.00 0.00 ? 14 TYR A HA   1  
ATOM 195   H HB2  . TYR A 1 14 ? 2.354   -9.249  7.184   1.00 0.00 ? 14 TYR A HB2  1  
ATOM 196   H HB3  . TYR A 1 14 ? 2.923   -7.650  7.664   1.00 0.00 ? 14 TYR A HB3  1  
ATOM 197   H HD1  . TYR A 1 14 ? 0.002   -9.959  7.857   1.00 0.00 ? 14 TYR A HD1  1  
ATOM 198   H HD2  . TYR A 1 14 ? 1.955   -6.504  9.495   1.00 0.00 ? 14 TYR A HD2  1  
ATOM 199   H HE1  . TYR A 1 14 ? -1.601  -9.952  9.750   1.00 0.00 ? 14 TYR A HE1  1  
ATOM 200   H HE2  . TYR A 1 14 ? 0.351   -6.494  11.387  1.00 0.00 ? 14 TYR A HE2  1  
ATOM 201   H HH   . TYR A 1 14 ? -1.589  -9.079  12.164  1.00 0.00 ? 14 TYR A HH   1  
ATOM 202   N N    . GLN A 1 15 ? 1.391   -5.207  6.367   1.00 0.00 ? 15 GLN A N    1  
ATOM 203   C CA   . GLN A 1 15 ? 0.792   -3.892  6.729   1.00 0.00 ? 15 GLN A CA   1  
ATOM 204   C C    . GLN A 1 15 ? -0.317  -3.539  5.735   1.00 0.00 ? 15 GLN A C    1  
ATOM 205   O O    . GLN A 1 15 ? -1.229  -2.800  6.049   1.00 0.00 ? 15 GLN A O    1  
ATOM 206   C CB   . GLN A 1 15 ? 1.875   -2.813  6.692   1.00 0.00 ? 15 GLN A CB   1  
ATOM 207   C CG   . GLN A 1 15 ? 2.803   -2.980  7.896   1.00 0.00 ? 15 GLN A CG   1  
ATOM 208   C CD   . GLN A 1 15 ? 2.756   -1.716  8.756   1.00 0.00 ? 15 GLN A CD   1  
ATOM 209   O OE1  . GLN A 1 15 ? 1.705   -1.136  8.947   1.00 0.00 ? 15 GLN A OE1  1  
ATOM 210   N NE2  . GLN A 1 15 ? 3.858   -1.259  9.283   1.00 0.00 ? 15 GLN A NE2  1  
ATOM 211   H H    . GLN A 1 15 ? 2.296   -5.248  5.994   1.00 0.00 ? 15 GLN A H    1  
ATOM 212   H HA   . GLN A 1 15 ? 0.377   -3.948  7.723   1.00 0.00 ? 15 GLN A HA   1  
ATOM 213   H HB2  . GLN A 1 15 ? 2.444   -2.907  5.779   1.00 0.00 ? 15 GLN A HB2  1  
ATOM 214   H HB3  . GLN A 1 15 ? 1.412   -1.840  6.730   1.00 0.00 ? 15 GLN A HB3  1  
ATOM 215   H HG2  . GLN A 1 15 ? 2.481   -3.829  8.484   1.00 0.00 ? 15 GLN A HG2  1  
ATOM 216   H HG3  . GLN A 1 15 ? 3.813   -3.143  7.552   1.00 0.00 ? 15 GLN A HG3  1  
ATOM 217   H HE21 . GLN A 1 15 ? 4.705   -1.726  9.128   1.00 0.00 ? 15 GLN A HE21 1  
ATOM 218   H HE22 . GLN A 1 15 ? 3.838   -0.449  9.834   1.00 0.00 ? 15 GLN A HE22 1  
ATOM 219   N N    . LEU A 1 16 ? -0.247  -4.052  4.537   1.00 0.00 ? 16 LEU A N    1  
ATOM 220   C CA   . LEU A 1 16 ? -1.301  -3.734  3.531   1.00 0.00 ? 16 LEU A CA   1  
ATOM 221   C C    . LEU A 1 16 ? -2.471  -4.707  3.674   1.00 0.00 ? 16 LEU A C    1  
ATOM 222   O O    . LEU A 1 16 ? -3.476  -4.584  3.002   1.00 0.00 ? 16 LEU A O    1  
ATOM 223   C CB   . LEU A 1 16 ? -0.718  -3.836  2.117   1.00 0.00 ? 16 LEU A CB   1  
ATOM 224   C CG   . LEU A 1 16 ? 0.368   -2.769  1.890   1.00 0.00 ? 16 LEU A CG   1  
ATOM 225   C CD1  . LEU A 1 16 ? 0.360   -2.353  0.420   1.00 0.00 ? 16 LEU A CD1  1  
ATOM 226   C CD2  . LEU A 1 16 ? 0.104   -1.527  2.753   1.00 0.00 ? 16 LEU A CD2  1  
ATOM 227   H H    . LEU A 1 16 ? 0.498   -4.643  4.297   1.00 0.00 ? 16 LEU A H    1  
ATOM 228   H HA   . LEU A 1 16 ? -1.657  -2.727  3.697   1.00 0.00 ? 16 LEU A HA   1  
ATOM 229   H HB2  . LEU A 1 16 ? -0.285  -4.817  1.982   1.00 0.00 ? 16 LEU A HB2  1  
ATOM 230   H HB3  . LEU A 1 16 ? -1.509  -3.695  1.395   1.00 0.00 ? 16 LEU A HB3  1  
ATOM 231   H HG   . LEU A 1 16 ? 1.335   -3.184  2.140   1.00 0.00 ? 16 LEU A HG   1  
ATOM 232   H HD11 . LEU A 1 16 ? -0.300  -3.004  -0.134  1.00 0.00 ? 16 LEU A HD11 1  
ATOM 233   H HD12 . LEU A 1 16 ? 0.009   -1.334  0.339   1.00 0.00 ? 16 LEU A HD12 1  
ATOM 234   H HD13 . LEU A 1 16 ? 1.359   -2.426  0.017   1.00 0.00 ? 16 LEU A HD13 1  
ATOM 235   H HD21 . LEU A 1 16 ? -0.022  -1.823  3.783   1.00 0.00 ? 16 LEU A HD21 1  
ATOM 236   H HD22 . LEU A 1 16 ? 0.940   -0.848  2.673   1.00 0.00 ? 16 LEU A HD22 1  
ATOM 237   H HD23 . LEU A 1 16 ? -0.794  -1.035  2.409   1.00 0.00 ? 16 LEU A HD23 1  
ATOM 238   N N    . GLU A 1 17 ? -2.359  -5.670  4.545   1.00 0.00 ? 17 GLU A N    1  
ATOM 239   C CA   . GLU A 1 17 ? -3.478  -6.637  4.722   1.00 0.00 ? 17 GLU A CA   1  
ATOM 240   C C    . GLU A 1 17 ? -4.699  -5.894  5.263   1.00 0.00 ? 17 GLU A C    1  
ATOM 241   O O    . GLU A 1 17 ? -5.818  -6.144  4.863   1.00 0.00 ? 17 GLU A O    1  
ATOM 242   C CB   . GLU A 1 17 ? -3.059  -7.729  5.706   1.00 0.00 ? 17 GLU A CB   1  
ATOM 243   C CG   . GLU A 1 17 ? -1.988  -8.608  5.058   1.00 0.00 ? 17 GLU A CG   1  
ATOM 244   C CD   . GLU A 1 17 ? -1.869  -9.925  5.826   1.00 0.00 ? 17 GLU A CD   1  
ATOM 245   O OE1  . GLU A 1 17 ? -2.721  -10.181 6.662   1.00 0.00 ? 17 GLU A OE1  1  
ATOM 246   O OE2  . GLU A 1 17 ? -0.928  -10.658 5.566   1.00 0.00 ? 17 GLU A OE2  1  
ATOM 247   H H    . GLU A 1 17 ? -1.545  -5.756  5.084   1.00 0.00 ? 17 GLU A H    1  
ATOM 248   H HA   . GLU A 1 17 ? -3.720  -7.083  3.769   1.00 0.00 ? 17 GLU A HA   1  
ATOM 249   H HB2  . GLU A 1 17 ? -2.661  -7.274  6.601   1.00 0.00 ? 17 GLU A HB2  1  
ATOM 250   H HB3  . GLU A 1 17 ? -3.915  -8.335  5.957   1.00 0.00 ? 17 GLU A HB3  1  
ATOM 251   H HG2  . GLU A 1 17 ? -2.261  -8.810  4.032   1.00 0.00 ? 17 GLU A HG2  1  
ATOM 252   H HG3  . GLU A 1 17 ? -1.042  -8.094  5.081   1.00 0.00 ? 17 GLU A HG3  1  
ATOM 253   N N    . ASN A 1 18 ? -4.492  -4.974  6.166   1.00 0.00 ? 18 ASN A N    1  
ATOM 254   C CA   . ASN A 1 18 ? -5.644  -4.211  6.724   1.00 0.00 ? 18 ASN A CA   1  
ATOM 255   C C    . ASN A 1 18 ? -6.280  -3.374  5.611   1.00 0.00 ? 18 ASN A C    1  
ATOM 256   O O    . ASN A 1 18 ? -7.380  -2.877  5.744   1.00 0.00 ? 18 ASN A O    1  
ATOM 257   C CB   . ASN A 1 18 ? -5.156  -3.287  7.843   1.00 0.00 ? 18 ASN A CB   1  
ATOM 258   C CG   . ASN A 1 18 ? -5.473  -3.916  9.201   1.00 0.00 ? 18 ASN A CG   1  
ATOM 259   O OD1  . ASN A 1 18 ? -6.564  -3.760  9.715   1.00 0.00 ? 18 ASN A OD1  1  
ATOM 260   N ND2  . ASN A 1 18 ? -4.560  -4.623  9.809   1.00 0.00 ? 18 ASN A ND2  1  
ATOM 261   H H    . ASN A 1 18 ? -3.580  -4.783  6.472   1.00 0.00 ? 18 ASN A H    1  
ATOM 262   H HA   . ASN A 1 18 ? -6.376  -4.900  7.119   1.00 0.00 ? 18 ASN A HA   1  
ATOM 263   H HB2  . ASN A 1 18 ? -4.088  -3.145  7.752   1.00 0.00 ? 18 ASN A HB2  1  
ATOM 264   H HB3  . ASN A 1 18 ? -5.653  -2.333  7.765   1.00 0.00 ? 18 ASN A HB3  1  
ATOM 265   H HD21 . ASN A 1 18 ? -3.681  -4.748  9.395   1.00 0.00 ? 18 ASN A HD21 1  
ATOM 266   H HD22 . ASN A 1 18 ? -4.755  -5.030  10.680  1.00 0.00 ? 18 ASN A HD22 1  
ATOM 267   N N    . TYR A 1 19 ? -5.595  -3.218  4.508   1.00 0.00 ? 19 TYR A N    1  
ATOM 268   C CA   . TYR A 1 19 ? -6.159  -2.417  3.384   1.00 0.00 ? 19 TYR A CA   1  
ATOM 269   C C    . TYR A 1 19 ? -7.011  -3.322  2.489   1.00 0.00 ? 19 TYR A C    1  
ATOM 270   O O    . TYR A 1 19 ? -7.262  -3.016  1.340   1.00 0.00 ? 19 TYR A O    1  
ATOM 271   C CB   . TYR A 1 19 ? -5.015  -1.815  2.565   1.00 0.00 ? 19 TYR A CB   1  
ATOM 272   C CG   . TYR A 1 19 ? -4.609  -0.492  3.166   1.00 0.00 ? 19 TYR A CG   1  
ATOM 273   C CD1  . TYR A 1 19 ? -5.226  0.694   2.742   1.00 0.00 ? 19 TYR A CD1  1  
ATOM 274   C CD2  . TYR A 1 19 ? -3.616  -0.453  4.146   1.00 0.00 ? 19 TYR A CD2  1  
ATOM 275   C CE1  . TYR A 1 19 ? -4.848  1.920   3.306   1.00 0.00 ? 19 TYR A CE1  1  
ATOM 276   C CE2  . TYR A 1 19 ? -3.238  0.767   4.708   1.00 0.00 ? 19 TYR A CE2  1  
ATOM 277   C CZ   . TYR A 1 19 ? -3.853  1.956   4.290   1.00 0.00 ? 19 TYR A CZ   1  
ATOM 278   O OH   . TYR A 1 19 ? -3.482  3.164   4.848   1.00 0.00 ? 19 TYR A OH   1  
ATOM 279   H H    . TYR A 1 19 ? -4.710  -3.629  4.420   1.00 0.00 ? 19 TYR A H    1  
ATOM 280   H HA   . TYR A 1 19 ? -6.775  -1.624  3.781   1.00 0.00 ? 19 TYR A HA   1  
ATOM 281   H HB2  . TYR A 1 19 ? -4.171  -2.489  2.577   1.00 0.00 ? 19 TYR A HB2  1  
ATOM 282   H HB3  . TYR A 1 19 ? -5.335  -1.659  1.550   1.00 0.00 ? 19 TYR A HB3  1  
ATOM 283   H HD1  . TYR A 1 19 ? -5.993  0.661   1.983   1.00 0.00 ? 19 TYR A HD1  1  
ATOM 284   H HD2  . TYR A 1 19 ? -3.137  -1.368  4.465   1.00 0.00 ? 19 TYR A HD2  1  
ATOM 285   H HE1  . TYR A 1 19 ? -5.321  2.840   2.980   1.00 0.00 ? 19 TYR A HE1  1  
ATOM 286   H HE2  . TYR A 1 19 ? -2.474  0.790   5.467   1.00 0.00 ? 19 TYR A HE2  1  
ATOM 287   H HH   . TYR A 1 19 ? -4.197  3.462   5.414   1.00 0.00 ? 19 TYR A HH   1  
ATOM 288   N N    . CYS A 1 20 ? -7.460  -4.435  3.006   1.00 0.00 ? 20 CYS A N    1  
ATOM 289   C CA   . CYS A 1 20 ? -8.296  -5.357  2.188   1.00 0.00 ? 20 CYS A CA   1  
ATOM 290   C C    . CYS A 1 20 ? -9.664  -5.526  2.851   1.00 0.00 ? 20 CYS A C    1  
ATOM 291   O O    . CYS A 1 20 ? -9.790  -5.454  4.058   1.00 0.00 ? 20 CYS A O    1  
ATOM 292   C CB   . CYS A 1 20 ? -7.607  -6.720  2.088   1.00 0.00 ? 20 CYS A CB   1  
ATOM 293   S SG   . CYS A 1 20 ? -6.103  -6.566  1.093   1.00 0.00 ? 20 CYS A SG   1  
ATOM 294   H H    . CYS A 1 20 ? -7.247  -4.663  3.935   1.00 0.00 ? 20 CYS A H    1  
ATOM 295   H HA   . CYS A 1 20 ? -8.425  -4.944  1.198   1.00 0.00 ? 20 CYS A HA   1  
ATOM 296   H HB2  . CYS A 1 20 ? -7.350  -7.066  3.077   1.00 0.00 ? 20 CYS A HB2  1  
ATOM 297   H HB3  . CYS A 1 20 ? -8.276  -7.428  1.621   1.00 0.00 ? 20 CYS A HB3  1  
ATOM 298   N N    . ASN A 1 21 ? -10.687 -5.750  2.075   1.00 0.00 ? 21 ASN A N    1  
ATOM 299   C CA   . ASN A 1 21 ? -12.045 -5.923  2.664   1.00 0.00 ? 21 ASN A CA   1  
ATOM 300   C C    . ASN A 1 21 ? -12.185 -7.342  3.217   1.00 0.00 ? 21 ASN A C    1  
ATOM 301   O O    . ASN A 1 21 ? -12.149 -8.270  2.426   1.00 0.00 ? 21 ASN A O    1  
ATOM 302   C CB   . ASN A 1 21 ? -13.103 -5.688  1.585   1.00 0.00 ? 21 ASN A CB   1  
ATOM 303   C CG   . ASN A 1 21 ? -14.366 -5.110  2.226   1.00 0.00 ? 21 ASN A CG   1  
ATOM 304   O OD1  . ASN A 1 21 ? -15.014 -5.766  3.015   1.00 0.00 ? 21 ASN A OD1  1  
ATOM 305   N ND2  . ASN A 1 21 ? -14.742 -3.899  1.917   1.00 0.00 ? 21 ASN A ND2  1  
ATOM 306   O OXT  . ASN A 1 21 ? -12.327 -7.477  4.422   1.00 0.00 ? 21 ASN A OXT  1  
ATOM 307   H H    . ASN A 1 21 ? -10.564 -5.802  1.104   1.00 0.00 ? 21 ASN A H    1  
ATOM 308   H HA   . ASN A 1 21 ? -12.183 -5.210  3.463   1.00 0.00 ? 21 ASN A HA   1  
ATOM 309   H HB2  . ASN A 1 21 ? -12.720 -4.993  0.850   1.00 0.00 ? 21 ASN A HB2  1  
ATOM 310   H HB3  . ASN A 1 21 ? -13.342 -6.625  1.105   1.00 0.00 ? 21 ASN A HB3  1  
ATOM 311   H HD21 . ASN A 1 21 ? -14.219 -3.370  1.280   1.00 0.00 ? 21 ASN A HD21 1  
ATOM 312   H HD22 . ASN A 1 21 ? -15.551 -3.519  2.321   1.00 0.00 ? 21 ASN A HD22 1  
ATOM 313   N N    . PHE B 2 1  ? 6.306   -7.501  -4.847  1.00 0.00 ? 1  PHE B N    1  
ATOM 314   C CA   . PHE B 2 1  ? 6.608   -7.157  -3.428  1.00 0.00 ? 1  PHE B CA   1  
ATOM 315   C C    . PHE B 2 1  ? 8.103   -6.871  -3.280  1.00 0.00 ? 1  PHE B C    1  
ATOM 316   O O    . PHE B 2 1  ? 8.769   -7.421  -2.424  1.00 0.00 ? 1  PHE B O    1  
ATOM 317   C CB   . PHE B 2 1  ? 6.219   -8.330  -2.524  1.00 0.00 ? 1  PHE B CB   1  
ATOM 318   C CG   . PHE B 2 1  ? 7.198   -9.465  -2.715  1.00 0.00 ? 1  PHE B CG   1  
ATOM 319   C CD1  . PHE B 2 1  ? 7.357   -10.049 -3.979  1.00 0.00 ? 1  PHE B CD1  1  
ATOM 320   C CD2  . PHE B 2 1  ? 7.950   -9.932  -1.630  1.00 0.00 ? 1  PHE B CD2  1  
ATOM 321   C CE1  . PHE B 2 1  ? 8.263   -11.100 -4.157  1.00 0.00 ? 1  PHE B CE1  1  
ATOM 322   C CE2  . PHE B 2 1  ? 8.857   -10.985 -1.808  1.00 0.00 ? 1  PHE B CE2  1  
ATOM 323   C CZ   . PHE B 2 1  ? 9.014   -11.568 -3.071  1.00 0.00 ? 1  PHE B CZ   1  
ATOM 324   H H1   . PHE B 2 1  ? 7.149   -7.917  -5.290  1.00 0.00 ? 1  PHE B H1   1  
ATOM 325   H H2   . PHE B 2 1  ? 5.525   -8.185  -4.881  1.00 0.00 ? 1  PHE B H2   1  
ATOM 326   H H3   . PHE B 2 1  ? 6.034   -6.637  -5.361  1.00 0.00 ? 1  PHE B H3   1  
ATOM 327   H HA   . PHE B 2 1  ? 6.045   -6.280  -3.144  1.00 0.00 ? 1  PHE B HA   1  
ATOM 328   H HB2  . PHE B 2 1  ? 6.237   -8.010  -1.492  1.00 0.00 ? 1  PHE B HB2  1  
ATOM 329   H HB3  . PHE B 2 1  ? 5.226   -8.666  -2.779  1.00 0.00 ? 1  PHE B HB3  1  
ATOM 330   H HD1  . PHE B 2 1  ? 6.777   -9.688  -4.817  1.00 0.00 ? 1  PHE B HD1  1  
ATOM 331   H HD2  . PHE B 2 1  ? 7.829   -9.482  -0.656  1.00 0.00 ? 1  PHE B HD2  1  
ATOM 332   H HE1  . PHE B 2 1  ? 8.384   -11.551 -5.131  1.00 0.00 ? 1  PHE B HE1  1  
ATOM 333   H HE2  . PHE B 2 1  ? 9.436   -11.344 -0.971  1.00 0.00 ? 1  PHE B HE2  1  
ATOM 334   H HZ   . PHE B 2 1  ? 9.712   -12.380 -3.208  1.00 0.00 ? 1  PHE B HZ   1  
ATOM 335   N N    . VAL B 2 2  ? 8.637   -6.016  -4.106  1.00 0.00 ? 2  VAL B N    1  
ATOM 336   C CA   . VAL B 2 2  ? 10.090  -5.697  -4.012  1.00 0.00 ? 2  VAL B CA   1  
ATOM 337   C C    . VAL B 2 2  ? 10.305  -4.609  -2.955  1.00 0.00 ? 2  VAL B C    1  
ATOM 338   O O    . VAL B 2 2  ? 9.440   -3.795  -2.704  1.00 0.00 ? 2  VAL B O    1  
ATOM 339   C CB   . VAL B 2 2  ? 10.592  -5.199  -5.368  1.00 0.00 ? 2  VAL B CB   1  
ATOM 340   C CG1  . VAL B 2 2  ? 12.118  -5.301  -5.419  1.00 0.00 ? 2  VAL B CG1  1  
ATOM 341   C CG2  . VAL B 2 2  ? 9.990   -6.061  -6.481  1.00 0.00 ? 2  VAL B CG2  1  
ATOM 342   H H    . VAL B 2 2  ? 8.083   -5.584  -4.790  1.00 0.00 ? 2  VAL B H    1  
ATOM 343   H HA   . VAL B 2 2  ? 10.635  -6.584  -3.729  1.00 0.00 ? 2  VAL B HA   1  
ATOM 344   H HB   . VAL B 2 2  ? 10.295  -4.170  -5.507  1.00 0.00 ? 2  VAL B HB   1  
ATOM 345   H HG11 . VAL B 2 2  ? 12.473  -5.819  -4.540  1.00 0.00 ? 2  VAL B HG11 1  
ATOM 346   H HG12 . VAL B 2 2  ? 12.412  -5.851  -6.303  1.00 0.00 ? 2  VAL B HG12 1  
ATOM 347   H HG13 . VAL B 2 2  ? 12.544  -4.311  -5.452  1.00 0.00 ? 2  VAL B HG13 1  
ATOM 348   H HG21 . VAL B 2 2  ? 9.687   -7.015  -6.073  1.00 0.00 ? 2  VAL B HG21 1  
ATOM 349   H HG22 . VAL B 2 2  ? 9.131   -5.560  -6.900  1.00 0.00 ? 2  VAL B HG22 1  
ATOM 350   H HG23 . VAL B 2 2  ? 10.727  -6.219  -7.253  1.00 0.00 ? 2  VAL B HG23 1  
ATOM 351   N N    . ASN B 2 3  ? 11.452  -4.592  -2.333  1.00 0.00 ? 3  ASN B N    1  
ATOM 352   C CA   . ASN B 2 3  ? 11.721  -3.558  -1.293  1.00 0.00 ? 3  ASN B CA   1  
ATOM 353   C C    . ASN B 2 3  ? 11.690  -2.171  -1.932  1.00 0.00 ? 3  ASN B C    1  
ATOM 354   O O    . ASN B 2 3  ? 12.701  -1.654  -2.365  1.00 0.00 ? 3  ASN B O    1  
ATOM 355   C CB   . ASN B 2 3  ? 13.097  -3.801  -0.671  1.00 0.00 ? 3  ASN B CB   1  
ATOM 356   C CG   . ASN B 2 3  ? 13.193  -5.250  -0.190  1.00 0.00 ? 3  ASN B CG   1  
ATOM 357   O OD1  . ASN B 2 3  ? 12.377  -5.699  0.591   1.00 0.00 ? 3  ASN B OD1  1  
ATOM 358   N ND2  . ASN B 2 3  ? 14.163  -6.006  -0.628  1.00 0.00 ? 3  ASN B ND2  1  
ATOM 359   H H    . ASN B 2 3  ? 12.137  -5.259  -2.550  1.00 0.00 ? 3  ASN B H    1  
ATOM 360   H HA   . ASN B 2 3  ? 10.963  -3.617  -0.525  1.00 0.00 ? 3  ASN B HA   1  
ATOM 361   H HB2  . ASN B 2 3  ? 13.863  -3.614  -1.408  1.00 0.00 ? 3  ASN B HB2  1  
ATOM 362   H HB3  . ASN B 2 3  ? 13.235  -3.137  0.170   1.00 0.00 ? 3  ASN B HB3  1  
ATOM 363   H HD21 . ASN B 2 3  ? 14.820  -5.644  -1.259  1.00 0.00 ? 3  ASN B HD21 1  
ATOM 364   H HD22 . ASN B 2 3  ? 14.232  -6.937  -0.327  1.00 0.00 ? 3  ASN B HD22 1  
ATOM 365   N N    . GLN B 2 4  ? 10.539  -1.563  -1.993  1.00 0.00 ? 4  GLN B N    1  
ATOM 366   C CA   . GLN B 2 4  ? 10.445  -0.208  -2.605  1.00 0.00 ? 4  GLN B CA   1  
ATOM 367   C C    . GLN B 2 4  ? 9.523   0.666   -1.754  1.00 0.00 ? 4  GLN B C    1  
ATOM 368   O O    . GLN B 2 4  ? 8.641   0.178   -1.078  1.00 0.00 ? 4  GLN B O    1  
ATOM 369   C CB   . GLN B 2 4  ? 9.876   -0.325  -4.020  1.00 0.00 ? 4  GLN B CB   1  
ATOM 370   C CG   . GLN B 2 4  ? 10.518  -1.518  -4.731  1.00 0.00 ? 4  GLN B CG   1  
ATOM 371   C CD   . GLN B 2 4  ? 11.910  -1.127  -5.232  1.00 0.00 ? 4  GLN B CD   1  
ATOM 372   O OE1  . GLN B 2 4  ? 12.882  -1.800  -4.952  1.00 0.00 ? 4  GLN B OE1  1  
ATOM 373   N NE2  . GLN B 2 4  ? 12.048  -0.055  -5.965  1.00 0.00 ? 4  GLN B NE2  1  
ATOM 374   H H    . GLN B 2 4  ? 9.736   -1.996  -1.638  1.00 0.00 ? 4  GLN B H    1  
ATOM 375   H HA   . GLN B 2 4  ? 11.429  0.237   -2.647  1.00 0.00 ? 4  GLN B HA   1  
ATOM 376   H HB2  . GLN B 2 4  ? 8.807   -0.469  -3.967  1.00 0.00 ? 4  GLN B HB2  1  
ATOM 377   H HB3  . GLN B 2 4  ? 10.093  0.578   -4.570  1.00 0.00 ? 4  GLN B HB3  1  
ATOM 378   H HG2  . GLN B 2 4  ? 10.601  -2.345  -4.042  1.00 0.00 ? 4  GLN B HG2  1  
ATOM 379   H HG3  . GLN B 2 4  ? 9.904   -1.809  -5.570  1.00 0.00 ? 4  GLN B HG3  1  
ATOM 380   H HE21 . GLN B 2 4  ? 11.265  0.489   -6.192  1.00 0.00 ? 4  GLN B HE21 1  
ATOM 381   H HE22 . GLN B 2 4  ? 12.936  0.205   -6.290  1.00 0.00 ? 4  GLN B HE22 1  
ATOM 382   N N    . HIS B 2 5  ? 9.720   1.955   -1.778  1.00 0.00 ? 5  HIS B N    1  
ATOM 383   C CA   . HIS B 2 5  ? 8.853   2.854   -0.966  1.00 0.00 ? 5  HIS B CA   1  
ATOM 384   C C    . HIS B 2 5  ? 7.523   3.072   -1.690  1.00 0.00 ? 5  HIS B C    1  
ATOM 385   O O    . HIS B 2 5  ? 7.481   3.269   -2.889  1.00 0.00 ? 5  HIS B O    1  
ATOM 386   C CB   . HIS B 2 5  ? 9.558   4.193   -0.762  1.00 0.00 ? 5  HIS B CB   1  
ATOM 387   C CG   . HIS B 2 5  ? 10.703  4.005   0.195   1.00 0.00 ? 5  HIS B CG   1  
ATOM 388   N ND1  . HIS B 2 5  ? 11.864  3.342   -0.167  1.00 0.00 ? 5  HIS B ND1  1  
ATOM 389   C CD2  . HIS B 2 5  ? 10.874  4.373   1.506   1.00 0.00 ? 5  HIS B CD2  1  
ATOM 390   C CE1  . HIS B 2 5  ? 12.677  3.332   0.906   1.00 0.00 ? 5  HIS B CE1  1  
ATOM 391   N NE2  . HIS B 2 5  ? 12.123  3.947   1.952   1.00 0.00 ? 5  HIS B NE2  1  
ATOM 392   H H    . HIS B 2 5  ? 10.439  2.332   -2.328  1.00 0.00 ? 5  HIS B H    1  
ATOM 393   H HA   . HIS B 2 5  ? 8.665   2.398   -0.005  1.00 0.00 ? 5  HIS B HA   1  
ATOM 394   H HB2  . HIS B 2 5  ? 9.933   4.553   -1.709  1.00 0.00 ? 5  HIS B HB2  1  
ATOM 395   H HB3  . HIS B 2 5  ? 8.862   4.911   -0.353  1.00 0.00 ? 5  HIS B HB3  1  
ATOM 396   H HD1  . HIS B 2 5  ? 12.059  2.953   -1.045  1.00 0.00 ? 5  HIS B HD1  1  
ATOM 397   H HD2  . HIS B 2 5  ? 10.150  4.907   2.102   1.00 0.00 ? 5  HIS B HD2  1  
ATOM 398   H HE1  . HIS B 2 5  ? 13.654  2.874   0.919   1.00 0.00 ? 5  HIS B HE1  1  
ATOM 399   N N    . LEU B 2 6  ? 6.438   3.032   -0.970  1.00 0.00 ? 6  LEU B N    1  
ATOM 400   C CA   . LEU B 2 6  ? 5.109   3.228   -1.609  1.00 0.00 ? 6  LEU B CA   1  
ATOM 401   C C    . LEU B 2 6  ? 4.644   4.671   -1.407  1.00 0.00 ? 6  LEU B C    1  
ATOM 402   O O    . LEU B 2 6  ? 4.067   5.011   -0.395  1.00 0.00 ? 6  LEU B O    1  
ATOM 403   C CB   . LEU B 2 6  ? 4.100   2.269   -0.975  1.00 0.00 ? 6  LEU B CB   1  
ATOM 404   C CG   . LEU B 2 6  ? 4.633   0.837   -1.065  1.00 0.00 ? 6  LEU B CG   1  
ATOM 405   C CD1  . LEU B 2 6  ? 3.586   -0.132  -0.515  1.00 0.00 ? 6  LEU B CD1  1  
ATOM 406   C CD2  . LEU B 2 6  ? 4.927   0.493   -2.526  1.00 0.00 ? 6  LEU B CD2  1  
ATOM 407   H H    . LEU B 2 6  ? 6.497   2.867   -0.005  1.00 0.00 ? 6  LEU B H    1  
ATOM 408   H HA   . LEU B 2 6  ? 5.183   3.021   -2.665  1.00 0.00 ? 6  LEU B HA   1  
ATOM 409   H HB2  . LEU B 2 6  ? 3.957   2.535   0.062   1.00 0.00 ? 6  LEU B HB2  1  
ATOM 410   H HB3  . LEU B 2 6  ? 3.161   2.336   -1.499  1.00 0.00 ? 6  LEU B HB3  1  
ATOM 411   H HG   . LEU B 2 6  ? 5.540   0.753   -0.483  1.00 0.00 ? 6  LEU B HG   1  
ATOM 412   H HD11 . LEU B 2 6  ? 3.149   0.282   0.381   1.00 0.00 ? 6  LEU B HD11 1  
ATOM 413   H HD12 . LEU B 2 6  ? 2.814   -0.285  -1.254  1.00 0.00 ? 6  LEU B HD12 1  
ATOM 414   H HD13 . LEU B 2 6  ? 4.055   -1.076  -0.283  1.00 0.00 ? 6  LEU B HD13 1  
ATOM 415   H HD21 . LEU B 2 6  ? 4.617   1.312   -3.157  1.00 0.00 ? 6  LEU B HD21 1  
ATOM 416   H HD22 . LEU B 2 6  ? 5.986   0.322   -2.651  1.00 0.00 ? 6  LEU B HD22 1  
ATOM 417   H HD23 . LEU B 2 6  ? 4.385   -0.399  -2.802  1.00 0.00 ? 6  LEU B HD23 1  
ATOM 418   N N    . CYS B 2 7  ? 4.894   5.521   -2.366  1.00 0.00 ? 7  CYS B N    1  
ATOM 419   C CA   . CYS B 2 7  ? 4.470   6.945   -2.235  1.00 0.00 ? 7  CYS B CA   1  
ATOM 420   C C    . CYS B 2 7  ? 3.465   7.284   -3.338  1.00 0.00 ? 7  CYS B C    1  
ATOM 421   O O    . CYS B 2 7  ? 3.654   6.943   -4.490  1.00 0.00 ? 7  CYS B O    1  
ATOM 422   C CB   . CYS B 2 7  ? 5.695   7.853   -2.367  1.00 0.00 ? 7  CYS B CB   1  
ATOM 423   S SG   . CYS B 2 7  ? 6.798   7.590   -0.956  1.00 0.00 ? 7  CYS B SG   1  
ATOM 424   H H    . CYS B 2 7  ? 5.362   5.223   -3.175  1.00 0.00 ? 7  CYS B H    1  
ATOM 425   H HA   . CYS B 2 7  ? 4.011   7.096   -1.270  1.00 0.00 ? 7  CYS B HA   1  
ATOM 426   H HB2  . CYS B 2 7  ? 6.220   7.621   -3.282  1.00 0.00 ? 7  CYS B HB2  1  
ATOM 427   H HB3  . CYS B 2 7  ? 5.378   8.885   -2.387  1.00 0.00 ? 7  CYS B HB3  1  
ATOM 428   N N    . GLY B 2 8  ? 2.398   7.953   -2.997  1.00 0.00 ? 8  GLY B N    1  
ATOM 429   C CA   . GLY B 2 8  ? 1.382   8.317   -4.026  1.00 0.00 ? 8  GLY B CA   1  
ATOM 430   C C    . GLY B 2 8  ? 0.557   7.083   -4.395  1.00 0.00 ? 8  GLY B C    1  
ATOM 431   O O    . GLY B 2 8  ? 0.334   6.208   -3.583  1.00 0.00 ? 8  GLY B O    1  
ATOM 432   H H    . GLY B 2 8  ? 2.266   8.219   -2.063  1.00 0.00 ? 8  GLY B H    1  
ATOM 433   H HA2  . GLY B 2 8  ? 0.731   9.083   -3.631  1.00 0.00 ? 8  GLY B HA2  1  
ATOM 434   H HA3  . GLY B 2 8  ? 1.882   8.688   -4.908  1.00 0.00 ? 8  GLY B HA3  1  
ATOM 435   N N    . SER B 2 9  ? 0.100   7.008   -5.616  1.00 0.00 ? 9  SER B N    1  
ATOM 436   C CA   . SER B 2 9  ? -0.710  5.831   -6.036  1.00 0.00 ? 9  SER B CA   1  
ATOM 437   C C    . SER B 2 9  ? 0.148   4.567   -5.963  1.00 0.00 ? 9  SER B C    1  
ATOM 438   O O    . SER B 2 9  ? -0.348  3.462   -6.048  1.00 0.00 ? 9  SER B O    1  
ATOM 439   C CB   . SER B 2 9  ? -1.200  6.032   -7.471  1.00 0.00 ? 9  SER B CB   1  
ATOM 440   O OG   . SER B 2 9  ? -2.217  7.024   -7.483  1.00 0.00 ? 9  SER B OG   1  
ATOM 441   H H    . SER B 2 9  ? 0.292   7.724   -6.256  1.00 0.00 ? 9  SER B H    1  
ATOM 442   H HA   . SER B 2 9  ? -1.561  5.726   -5.378  1.00 0.00 ? 9  SER B HA   1  
ATOM 443   H HB2  . SER B 2 9  ? -0.380  6.355   -8.090  1.00 0.00 ? 9  SER B HB2  1  
ATOM 444   H HB3  . SER B 2 9  ? -1.589  5.097   -7.850  1.00 0.00 ? 9  SER B HB3  1  
ATOM 445   H HG   . SER B 2 9  ? -2.005  7.658   -8.174  1.00 0.00 ? 9  SER B HG   1  
ATOM 446   N N    . HIS B 2 10 ? 1.434   4.721   -5.803  1.00 0.00 ? 10 HIS B N    1  
ATOM 447   C CA   . HIS B 2 10 ? 2.319   3.527   -5.723  1.00 0.00 ? 10 HIS B CA   1  
ATOM 448   C C    . HIS B 2 10 ? 1.792   2.580   -4.646  1.00 0.00 ? 10 HIS B C    1  
ATOM 449   O O    . HIS B 2 10 ? 1.687   1.387   -4.849  1.00 0.00 ? 10 HIS B O    1  
ATOM 450   C CB   . HIS B 2 10 ? 3.740   3.967   -5.368  1.00 0.00 ? 10 HIS B CB   1  
ATOM 451   C CG   . HIS B 2 10 ? 4.438   4.450   -6.610  1.00 0.00 ? 10 HIS B CG   1  
ATOM 452   N ND1  . HIS B 2 10 ? 4.245   5.724   -7.118  1.00 0.00 ? 10 HIS B ND1  1  
ATOM 453   C CD2  . HIS B 2 10 ? 5.327   3.838   -7.459  1.00 0.00 ? 10 HIS B CD2  1  
ATOM 454   C CE1  . HIS B 2 10 ? 5.002   5.839   -8.224  1.00 0.00 ? 10 HIS B CE1  1  
ATOM 455   N NE2  . HIS B 2 10 ? 5.682   4.717   -8.477  1.00 0.00 ? 10 HIS B NE2  1  
ATOM 456   H H    . HIS B 2 10 ? 1.815   5.621   -5.735  1.00 0.00 ? 10 HIS B H    1  
ATOM 457   H HA   . HIS B 2 10 ? 2.327   3.019   -6.676  1.00 0.00 ? 10 HIS B HA   1  
ATOM 458   H HB2  . HIS B 2 10 ? 3.700   4.767   -4.643  1.00 0.00 ? 10 HIS B HB2  1  
ATOM 459   H HB3  . HIS B 2 10 ? 4.283   3.130   -4.953  1.00 0.00 ? 10 HIS B HB3  1  
ATOM 460   H HD1  . HIS B 2 10 ? 3.661   6.417   -6.740  1.00 0.00 ? 10 HIS B HD1  1  
ATOM 461   H HD2  . HIS B 2 10 ? 5.695   2.828   -7.353  1.00 0.00 ? 10 HIS B HD2  1  
ATOM 462   H HE1  . HIS B 2 10 ? 5.055   6.730   -8.833  1.00 0.00 ? 10 HIS B HE1  1  
ATOM 463   N N    . LEU B 2 11 ? 1.450   3.100   -3.498  1.00 0.00 ? 11 LEU B N    1  
ATOM 464   C CA   . LEU B 2 11 ? 0.922   2.228   -2.414  1.00 0.00 ? 11 LEU B CA   1  
ATOM 465   C C    . LEU B 2 11 ? -0.348  1.538   -2.902  1.00 0.00 ? 11 LEU B C    1  
ATOM 466   O O    . LEU B 2 11 ? -0.645  0.421   -2.524  1.00 0.00 ? 11 LEU B O    1  
ATOM 467   C CB   . LEU B 2 11 ? 0.603   3.073   -1.181  1.00 0.00 ? 11 LEU B CB   1  
ATOM 468   C CG   . LEU B 2 11 ? 0.939   2.276   0.078   1.00 0.00 ? 11 LEU B CG   1  
ATOM 469   C CD1  . LEU B 2 11 ? 1.534   3.213   1.132   1.00 0.00 ? 11 LEU B CD1  1  
ATOM 470   C CD2  . LEU B 2 11 ? -0.338  1.629   0.625   1.00 0.00 ? 11 LEU B CD2  1  
ATOM 471   H H    . LEU B 2 11 ? 1.537   4.066   -3.354  1.00 0.00 ? 11 LEU B H    1  
ATOM 472   H HA   . LEU B 2 11 ? 1.661   1.481   -2.160  1.00 0.00 ? 11 LEU B HA   1  
ATOM 473   H HB2  . LEU B 2 11 ? 1.192   3.980   -1.205  1.00 0.00 ? 11 LEU B HB2  1  
ATOM 474   H HB3  . LEU B 2 11 ? -0.446  3.324   -1.178  1.00 0.00 ? 11 LEU B HB3  1  
ATOM 475   H HG   . LEU B 2 11 ? 1.658   1.508   -0.164  1.00 0.00 ? 11 LEU B HG   1  
ATOM 476   H HD11 . LEU B 2 11 ? 0.949   4.121   1.177   1.00 0.00 ? 11 LEU B HD11 1  
ATOM 477   H HD12 . LEU B 2 11 ? 1.517   2.727   2.096   1.00 0.00 ? 11 LEU B HD12 1  
ATOM 478   H HD13 . LEU B 2 11 ? 2.553   3.455   0.865   1.00 0.00 ? 11 LEU B HD13 1  
ATOM 479   H HD21 . LEU B 2 11 ? -1.140  2.351   0.618   1.00 0.00 ? 11 LEU B HD21 1  
ATOM 480   H HD22 . LEU B 2 11 ? -0.607  0.785   0.005   1.00 0.00 ? 11 LEU B HD22 1  
ATOM 481   H HD23 . LEU B 2 11 ? -0.167  1.291   1.638   1.00 0.00 ? 11 LEU B HD23 1  
ATOM 482   N N    . VAL B 2 12 ? -1.101  2.188   -3.747  1.00 0.00 ? 12 VAL B N    1  
ATOM 483   C CA   . VAL B 2 12 ? -2.343  1.555   -4.263  1.00 0.00 ? 12 VAL B CA   1  
ATOM 484   C C    . VAL B 2 12 ? -1.959  0.333   -5.099  1.00 0.00 ? 12 VAL B C    1  
ATOM 485   O O    . VAL B 2 12 ? -2.689  -0.636  -5.177  1.00 0.00 ? 12 VAL B O    1  
ATOM 486   C CB   . VAL B 2 12 ? -3.111  2.555   -5.131  1.00 0.00 ? 12 VAL B CB   1  
ATOM 487   C CG1  . VAL B 2 12 ? -4.203  1.817   -5.910  1.00 0.00 ? 12 VAL B CG1  1  
ATOM 488   C CG2  . VAL B 2 12 ? -3.753  3.617   -4.237  1.00 0.00 ? 12 VAL B CG2  1  
ATOM 489   H H    . VAL B 2 12 ? -0.844  3.085   -4.045  1.00 0.00 ? 12 VAL B H    1  
ATOM 490   H HA   . VAL B 2 12 ? -2.961  1.248   -3.431  1.00 0.00 ? 12 VAL B HA   1  
ATOM 491   H HB   . VAL B 2 12 ? -2.430  3.025   -5.825  1.00 0.00 ? 12 VAL B HB   1  
ATOM 492   H HG11 . VAL B 2 12 ? -4.560  0.982   -5.324  1.00 0.00 ? 12 VAL B HG11 1  
ATOM 493   H HG12 . VAL B 2 12 ? -5.021  2.493   -6.110  1.00 0.00 ? 12 VAL B HG12 1  
ATOM 494   H HG13 . VAL B 2 12 ? -3.797  1.454   -6.843  1.00 0.00 ? 12 VAL B HG13 1  
ATOM 495   H HG21 . VAL B 2 12 ? -3.983  3.186   -3.274  1.00 0.00 ? 12 VAL B HG21 1  
ATOM 496   H HG22 . VAL B 2 12 ? -3.069  4.443   -4.109  1.00 0.00 ? 12 VAL B HG22 1  
ATOM 497   H HG23 . VAL B 2 12 ? -4.664  3.973   -4.698  1.00 0.00 ? 12 VAL B HG23 1  
ATOM 498   N N    . GLU B 2 13 ? -0.811  0.375   -5.724  1.00 0.00 ? 13 GLU B N    1  
ATOM 499   C CA   . GLU B 2 13 ? -0.365  -0.780  -6.551  1.00 0.00 ? 13 GLU B CA   1  
ATOM 500   C C    . GLU B 2 13 ? -0.012  -1.949  -5.631  1.00 0.00 ? 13 GLU B C    1  
ATOM 501   O O    . GLU B 2 13 ? 0.041   -3.089  -6.052  1.00 0.00 ? 13 GLU B O    1  
ATOM 502   C CB   . GLU B 2 13 ? 0.868   -0.380  -7.367  1.00 0.00 ? 13 GLU B CB   1  
ATOM 503   C CG   . GLU B 2 13 ? 0.429   0.439   -8.582  1.00 0.00 ? 13 GLU B CG   1  
ATOM 504   C CD   . GLU B 2 13 ? 0.474   -0.441  -9.834  1.00 0.00 ? 13 GLU B CD   1  
ATOM 505   O OE1  . GLU B 2 13 ? 0.252   -1.633  -9.702  1.00 0.00 ? 13 GLU B OE1  1  
ATOM 506   O OE2  . GLU B 2 13 ? 0.729   0.093   -10.900 1.00 0.00 ? 13 GLU B OE2  1  
ATOM 507   H H    . GLU B 2 13 ? -0.240  1.166   -5.642  1.00 0.00 ? 13 GLU B H    1  
ATOM 508   H HA   . GLU B 2 13 ? -1.161  -1.074  -7.220  1.00 0.00 ? 13 GLU B HA   1  
ATOM 509   H HB2  . GLU B 2 13 ? 1.530   0.211   -6.752  1.00 0.00 ? 13 GLU B HB2  1  
ATOM 510   H HB3  . GLU B 2 13 ? 1.381   -1.269  -7.701  1.00 0.00 ? 13 GLU B HB3  1  
ATOM 511   H HG2  . GLU B 2 13 ? -0.578  0.799   -8.430  1.00 0.00 ? 13 GLU B HG2  1  
ATOM 512   H HG3  . GLU B 2 13 ? 1.097   1.277   -8.712  1.00 0.00 ? 13 GLU B HG3  1  
ATOM 513   N N    . ALA B 2 14 ? 0.219   -1.679  -4.376  1.00 0.00 ? 14 ALA B N    1  
ATOM 514   C CA   . ALA B 2 14 ? 0.555   -2.777  -3.428  1.00 0.00 ? 14 ALA B CA   1  
ATOM 515   C C    . ALA B 2 14 ? -0.697  -3.146  -2.631  1.00 0.00 ? 14 ALA B C    1  
ATOM 516   O O    . ALA B 2 14 ? -0.792  -4.215  -2.060  1.00 0.00 ? 14 ALA B O    1  
ATOM 517   C CB   . ALA B 2 14 ? 1.653   -2.310  -2.468  1.00 0.00 ? 14 ALA B CB   1  
ATOM 518   H H    . ALA B 2 14 ? 0.164   -0.754  -4.054  1.00 0.00 ? 14 ALA B H    1  
ATOM 519   H HA   . ALA B 2 14 ? 0.900   -3.639  -3.979  1.00 0.00 ? 14 ALA B HA   1  
ATOM 520   H HB1  . ALA B 2 14 ? 1.347   -1.390  -1.992  1.00 0.00 ? 14 ALA B HB1  1  
ATOM 521   H HB2  . ALA B 2 14 ? 1.818   -3.066  -1.715  1.00 0.00 ? 14 ALA B HB2  1  
ATOM 522   H HB3  . ALA B 2 14 ? 2.566   -2.144  -3.019  1.00 0.00 ? 14 ALA B HB3  1  
ATOM 523   N N    . LEU B 2 15 ? -1.659  -2.265  -2.590  1.00 0.00 ? 15 LEU B N    1  
ATOM 524   C CA   . LEU B 2 15 ? -2.909  -2.556  -1.835  1.00 0.00 ? 15 LEU B CA   1  
ATOM 525   C C    . LEU B 2 15 ? -3.778  -3.530  -2.635  1.00 0.00 ? 15 LEU B C    1  
ATOM 526   O O    . LEU B 2 15 ? -4.222  -4.541  -2.128  1.00 0.00 ? 15 LEU B O    1  
ATOM 527   C CB   . LEU B 2 15 ? -3.677  -1.254  -1.610  1.00 0.00 ? 15 LEU B CB   1  
ATOM 528   C CG   . LEU B 2 15 ? -2.929  -0.397  -0.589  1.00 0.00 ? 15 LEU B CG   1  
ATOM 529   C CD1  . LEU B 2 15 ? -3.706  0.896   -0.339  1.00 0.00 ? 15 LEU B CD1  1  
ATOM 530   C CD2  . LEU B 2 15 ? -2.797  -1.174  0.722   1.00 0.00 ? 15 LEU B CD2  1  
ATOM 531   H H    . LEU B 2 15 ? -1.559  -1.411  -3.058  1.00 0.00 ? 15 LEU B H    1  
ATOM 532   H HA   . LEU B 2 15 ? -2.659  -2.995  -0.881  1.00 0.00 ? 15 LEU B HA   1  
ATOM 533   H HB2  . LEU B 2 15 ? -3.758  -0.717  -2.544  1.00 0.00 ? 15 LEU B HB2  1  
ATOM 534   H HB3  . LEU B 2 15 ? -4.665  -1.476  -1.235  1.00 0.00 ? 15 LEU B HB3  1  
ATOM 535   H HG   . LEU B 2 15 ? -1.946  -0.159  -0.970  1.00 0.00 ? 15 LEU B HG   1  
ATOM 536   H HD11 . LEU B 2 15 ? -4.609  0.894   -0.932  1.00 0.00 ? 15 LEU B HD11 1  
ATOM 537   H HD12 . LEU B 2 15 ? -3.964  0.964   0.708   1.00 0.00 ? 15 LEU B HD12 1  
ATOM 538   H HD13 . LEU B 2 15 ? -3.096  1.743   -0.615  1.00 0.00 ? 15 LEU B HD13 1  
ATOM 539   H HD21 . LEU B 2 15 ? -3.553  -1.943  0.760   1.00 0.00 ? 15 LEU B HD21 1  
ATOM 540   H HD22 . LEU B 2 15 ? -1.821  -1.629  0.774   1.00 0.00 ? 15 LEU B HD22 1  
ATOM 541   H HD23 . LEU B 2 15 ? -2.926  -0.500  1.554   1.00 0.00 ? 15 LEU B HD23 1  
ATOM 542   N N    . HIS B 2 16 ? -4.022  -3.236  -3.882  1.00 0.00 ? 16 HIS B N    1  
ATOM 543   C CA   . HIS B 2 16 ? -4.862  -4.144  -4.711  1.00 0.00 ? 16 HIS B CA   1  
ATOM 544   C C    . HIS B 2 16 ? -4.188  -5.518  -4.791  1.00 0.00 ? 16 HIS B C    1  
ATOM 545   O O    . HIS B 2 16 ? -4.834  -6.532  -4.968  1.00 0.00 ? 16 HIS B O    1  
ATOM 546   C CB   . HIS B 2 16 ? -5.017  -3.549  -6.119  1.00 0.00 ? 16 HIS B CB   1  
ATOM 547   C CG   . HIS B 2 16 ? -3.789  -3.836  -6.939  1.00 0.00 ? 16 HIS B CG   1  
ATOM 548   N ND1  . HIS B 2 16 ? -3.837  -4.555  -8.121  1.00 0.00 ? 16 HIS B ND1  1  
ATOM 549   C CD2  . HIS B 2 16 ? -2.473  -3.506  -6.754  1.00 0.00 ? 16 HIS B CD2  1  
ATOM 550   C CE1  . HIS B 2 16 ? -2.582  -4.634  -8.598  1.00 0.00 ? 16 HIS B CE1  1  
ATOM 551   N NE2  . HIS B 2 16 ? -1.710  -4.010  -7.803  1.00 0.00 ? 16 HIS B NE2  1  
ATOM 552   H H    . HIS B 2 16 ? -3.655  -2.414  -4.272  1.00 0.00 ? 16 HIS B H    1  
ATOM 553   H HA   . HIS B 2 16 ? -5.836  -4.248  -4.257  1.00 0.00 ? 16 HIS B HA   1  
ATOM 554   H HB2  . HIS B 2 16 ? -5.880  -3.982  -6.601  1.00 0.00 ? 16 HIS B HB2  1  
ATOM 555   H HB3  . HIS B 2 16 ? -5.146  -2.480  -6.040  1.00 0.00 ? 16 HIS B HB3  1  
ATOM 556   H HD1  . HIS B 2 16 ? -4.639  -4.937  -8.536  1.00 0.00 ? 16 HIS B HD1  1  
ATOM 557   H HD2  . HIS B 2 16 ? -2.092  -2.940  -5.919  1.00 0.00 ? 16 HIS B HD2  1  
ATOM 558   H HE1  . HIS B 2 16 ? -2.311  -5.142  -9.512  1.00 0.00 ? 16 HIS B HE1  1  
ATOM 559   N N    . LEU B 2 17 ? -2.890  -5.551  -4.666  1.00 0.00 ? 17 LEU B N    1  
ATOM 560   C CA   . LEU B 2 17 ? -2.162  -6.847  -4.734  1.00 0.00 ? 17 LEU B CA   1  
ATOM 561   C C    . LEU B 2 17 ? -2.399  -7.637  -3.445  1.00 0.00 ? 17 LEU B C    1  
ATOM 562   O O    . LEU B 2 17 ? -2.452  -8.851  -3.450  1.00 0.00 ? 17 LEU B O    1  
ATOM 563   C CB   . LEU B 2 17 ? -0.666  -6.571  -4.897  1.00 0.00 ? 17 LEU B CB   1  
ATOM 564   C CG   . LEU B 2 17 ? 0.096   -7.891  -5.009  1.00 0.00 ? 17 LEU B CG   1  
ATOM 565   C CD1  . LEU B 2 17 ? -0.351  -8.634  -6.270  1.00 0.00 ? 17 LEU B CD1  1  
ATOM 566   C CD2  . LEU B 2 17 ? 1.596   -7.601  -5.095  1.00 0.00 ? 17 LEU B CD2  1  
ATOM 567   H H    . LEU B 2 17 ? -2.392  -4.719  -4.526  1.00 0.00 ? 17 LEU B H    1  
ATOM 568   H HA   . LEU B 2 17 ? -2.518  -7.419  -5.579  1.00 0.00 ? 17 LEU B HA   1  
ATOM 569   H HB2  . LEU B 2 17 ? -0.505  -5.986  -5.792  1.00 0.00 ? 17 LEU B HB2  1  
ATOM 570   H HB3  . LEU B 2 17 ? -0.307  -6.022  -4.041  1.00 0.00 ? 17 LEU B HB3  1  
ATOM 571   H HG   . LEU B 2 17 ? -0.107  -8.499  -4.140  1.00 0.00 ? 17 LEU B HG   1  
ATOM 572   H HD11 . LEU B 2 17 ? -0.156  -8.020  -7.137  1.00 0.00 ? 17 LEU B HD11 1  
ATOM 573   H HD12 . LEU B 2 17 ? 0.196   -9.561  -6.353  1.00 0.00 ? 17 LEU B HD12 1  
ATOM 574   H HD13 . LEU B 2 17 ? -1.408  -8.843  -6.207  1.00 0.00 ? 17 LEU B HD13 1  
ATOM 575   H HD21 . LEU B 2 17 ? 1.792   -6.602  -4.731  1.00 0.00 ? 17 LEU B HD21 1  
ATOM 576   H HD22 . LEU B 2 17 ? 2.136   -8.315  -4.490  1.00 0.00 ? 17 LEU B HD22 1  
ATOM 577   H HD23 . LEU B 2 17 ? 1.920   -7.680  -6.121  1.00 0.00 ? 17 LEU B HD23 1  
ATOM 578   N N    . VAL B 2 18 ? -2.544  -6.958  -2.340  1.00 0.00 ? 18 VAL B N    1  
ATOM 579   C CA   . VAL B 2 18 ? -2.779  -7.670  -1.052  1.00 0.00 ? 18 VAL B CA   1  
ATOM 580   C C    . VAL B 2 18 ? -4.225  -8.166  -1.004  1.00 0.00 ? 18 VAL B C    1  
ATOM 581   O O    . VAL B 2 18 ? -4.538  -9.127  -0.331  1.00 0.00 ? 18 VAL B O    1  
ATOM 582   C CB   . VAL B 2 18 ? -2.531  -6.712  0.115   1.00 0.00 ? 18 VAL B CB   1  
ATOM 583   C CG1  . VAL B 2 18 ? -2.418  -7.509  1.415   1.00 0.00 ? 18 VAL B CG1  1  
ATOM 584   C CG2  . VAL B 2 18 ? -1.229  -5.944  -0.123  1.00 0.00 ? 18 VAL B CG2  1  
ATOM 585   H H    . VAL B 2 18 ? -2.498  -5.979  -2.358  1.00 0.00 ? 18 VAL B H    1  
ATOM 586   H HA   . VAL B 2 18 ? -2.105  -8.511  -0.978  1.00 0.00 ? 18 VAL B HA   1  
ATOM 587   H HB   . VAL B 2 18 ? -3.354  -6.016  0.190   1.00 0.00 ? 18 VAL B HB   1  
ATOM 588   H HG11 . VAL B 2 18 ? -1.820  -8.393  1.245   1.00 0.00 ? 18 VAL B HG11 1  
ATOM 589   H HG12 . VAL B 2 18 ? -1.952  -6.899  2.174   1.00 0.00 ? 18 VAL B HG12 1  
ATOM 590   H HG13 . VAL B 2 18 ? -3.405  -7.803  1.745   1.00 0.00 ? 18 VAL B HG13 1  
ATOM 591   H HG21 . VAL B 2 18 ? -0.786  -6.265  -1.054  1.00 0.00 ? 18 VAL B HG21 1  
ATOM 592   H HG22 . VAL B 2 18 ? -1.438  -4.885  -0.170  1.00 0.00 ? 18 VAL B HG22 1  
ATOM 593   H HG23 . VAL B 2 18 ? -0.543  -6.140  0.687   1.00 0.00 ? 18 VAL B HG23 1  
ATOM 594   N N    . CYS B 2 19 ? -5.109  -7.514  -1.708  1.00 0.00 ? 19 CYS B N    1  
ATOM 595   C CA   . CYS B 2 19 ? -6.534  -7.943  -1.699  1.00 0.00 ? 19 CYS B CA   1  
ATOM 596   C C    . CYS B 2 19 ? -6.846  -8.714  -2.983  1.00 0.00 ? 19 CYS B C    1  
ATOM 597   O O    . CYS B 2 19 ? -7.081  -9.905  -2.962  1.00 0.00 ? 19 CYS B O    1  
ATOM 598   C CB   . CYS B 2 19 ? -7.426  -6.704  -1.624  1.00 0.00 ? 19 CYS B CB   1  
ATOM 599   S SG   . CYS B 2 19 ? -6.679  -5.487  -0.512  1.00 0.00 ? 19 CYS B SG   1  
ATOM 600   H H    . CYS B 2 19 ? -4.836  -6.739  -2.242  1.00 0.00 ? 19 CYS B H    1  
ATOM 601   H HA   . CYS B 2 19 ? -6.718  -8.573  -0.843  1.00 0.00 ? 19 CYS B HA   1  
ATOM 602   H HB2  . CYS B 2 19 ? -7.523  -6.276  -2.611  1.00 0.00 ? 19 CYS B HB2  1  
ATOM 603   H HB3  . CYS B 2 19 ? -8.401  -6.983  -1.254  1.00 0.00 ? 19 CYS B HB3  1  
ATOM 604   N N    . GLY B 2 20 ? -6.852  -8.039  -4.099  1.00 0.00 ? 20 GLY B N    1  
ATOM 605   C CA   . GLY B 2 20 ? -7.153  -8.726  -5.387  1.00 0.00 ? 20 GLY B CA   1  
ATOM 606   C C    . GLY B 2 20 ? -8.487  -8.214  -5.932  1.00 0.00 ? 20 GLY B C    1  
ATOM 607   O O    . GLY B 2 20 ? -8.797  -7.042  -5.838  1.00 0.00 ? 20 GLY B O    1  
ATOM 608   H H    . GLY B 2 20 ? -6.662  -7.078  -4.090  1.00 0.00 ? 20 GLY B H    1  
ATOM 609   H HA2  . GLY B 2 20 ? -6.367  -8.517  -6.099  1.00 0.00 ? 20 GLY B HA2  1  
ATOM 610   H HA3  . GLY B 2 20 ? -7.220  -9.789  -5.222  1.00 0.00 ? 20 GLY B HA3  1  
ATOM 611   N N    . GLU B 2 21 ? -9.281  -9.079  -6.498  1.00 0.00 ? 21 GLU B N    1  
ATOM 612   C CA   . GLU B 2 21 ? -10.594 -8.635  -7.044  1.00 0.00 ? 21 GLU B CA   1  
ATOM 613   C C    . GLU B 2 21 ? -11.435 -8.034  -5.915  1.00 0.00 ? 21 GLU B C    1  
ATOM 614   O O    . GLU B 2 21 ? -12.296 -7.209  -6.140  1.00 0.00 ? 21 GLU B O    1  
ATOM 615   C CB   . GLU B 2 21 ? -11.330 -9.833  -7.646  1.00 0.00 ? 21 GLU B CB   1  
ATOM 616   C CG   . GLU B 2 21 ? -11.062 -9.891  -9.152  1.00 0.00 ? 21 GLU B CG   1  
ATOM 617   C CD   . GLU B 2 21 ? -12.276 -9.348  -9.908  1.00 0.00 ? 21 GLU B CD   1  
ATOM 618   O OE1  . GLU B 2 21 ? -13.206 -8.906  -9.254  1.00 0.00 ? 21 GLU B OE1  1  
ATOM 619   O OE2  . GLU B 2 21 ? -12.254 -9.383  -11.127 1.00 0.00 ? 21 GLU B OE2  1  
ATOM 620   H H    . GLU B 2 21 ? -9.016  -10.020 -6.563  1.00 0.00 ? 21 GLU B H    1  
ATOM 621   H HA   . GLU B 2 21 ? -10.433 -7.888  -7.808  1.00 0.00 ? 21 GLU B HA   1  
ATOM 622   H HB2  . GLU B 2 21 ? -10.977 -10.743 -7.180  1.00 0.00 ? 21 GLU B HB2  1  
ATOM 623   H HB3  . GLU B 2 21 ? -12.390 -9.727  -7.475  1.00 0.00 ? 21 GLU B HB3  1  
ATOM 624   H HG2  . GLU B 2 21 ? -10.193 -9.292  -9.385  1.00 0.00 ? 21 GLU B HG2  1  
ATOM 625   H HG3  . GLU B 2 21 ? -10.885 -10.914 -9.446  1.00 0.00 ? 21 GLU B HG3  1  
ATOM 626   N N    . ARG B 2 22 ? -11.189 -8.443  -4.701  1.00 0.00 ? 22 ARG B N    1  
ATOM 627   C CA   . ARG B 2 22 ? -11.973 -7.895  -3.559  1.00 0.00 ? 22 ARG B CA   1  
ATOM 628   C C    . ARG B 2 22 ? -11.877 -6.368  -3.561  1.00 0.00 ? 22 ARG B C    1  
ATOM 629   O O    . ARG B 2 22 ? -12.870 -5.674  -3.474  1.00 0.00 ? 22 ARG B O    1  
ATOM 630   C CB   . ARG B 2 22 ? -11.408 -8.440  -2.246  1.00 0.00 ? 22 ARG B CB   1  
ATOM 631   C CG   . ARG B 2 22 ? -11.676 -9.944  -2.164  1.00 0.00 ? 22 ARG B CG   1  
ATOM 632   C CD   . ARG B 2 22 ? -13.172 -10.185 -1.955  1.00 0.00 ? 22 ARG B CD   1  
ATOM 633   N NE   . ARG B 2 22 ? -13.366 -11.324 -1.015  1.00 0.00 ? 22 ARG B NE   1  
ATOM 634   C CZ   . ARG B 2 22 ? -14.528 -11.516 -0.450  1.00 0.00 ? 22 ARG B CZ   1  
ATOM 635   N NH1  . ARG B 2 22 ? -15.525 -10.711 -0.707  1.00 0.00 ? 22 ARG B NH1  1  
ATOM 636   N NH2  . ARG B 2 22 ? -14.694 -12.515 0.373   1.00 0.00 ? 22 ARG B NH2  1  
ATOM 637   H H    . ARG B 2 22 ? -10.489 -9.109  -4.540  1.00 0.00 ? 22 ARG B H    1  
ATOM 638   H HA   . ARG B 2 22 ? -13.006 -8.192  -3.656  1.00 0.00 ? 22 ARG B HA   1  
ATOM 639   H HB2  . ARG B 2 22 ? -10.343 -8.260  -2.210  1.00 0.00 ? 22 ARG B HB2  1  
ATOM 640   H HB3  . ARG B 2 22 ? -11.887 -7.945  -1.414  1.00 0.00 ? 22 ARG B HB3  1  
ATOM 641   H HG2  . ARG B 2 22 ? -11.357 -10.416 -3.082  1.00 0.00 ? 22 ARG B HG2  1  
ATOM 642   H HG3  . ARG B 2 22 ? -11.127 -10.363 -1.333  1.00 0.00 ? 22 ARG B HG3  1  
ATOM 643   H HD2  . ARG B 2 22 ? -13.625 -9.295  -1.543  1.00 0.00 ? 22 ARG B HD2  1  
ATOM 644   H HD3  . ARG B 2 22 ? -13.632 -10.419 -2.902  1.00 0.00 ? 22 ARG B HD3  1  
ATOM 645   H HE   . ARG B 2 22 ? -12.621 -11.931 -0.820  1.00 0.00 ? 22 ARG B HE   1  
ATOM 646   H HH11 . ARG B 2 22 ? -15.400 -9.943  -1.336  1.00 0.00 ? 22 ARG B HH11 1  
ATOM 647   H HH12 . ARG B 2 22 ? -16.413 -10.861 -0.272  1.00 0.00 ? 22 ARG B HH12 1  
ATOM 648   H HH21 . ARG B 2 22 ? -13.933 -13.133 0.568   1.00 0.00 ? 22 ARG B HH21 1  
ATOM 649   H HH22 . ARG B 2 22 ? -15.583 -12.663 0.807   1.00 0.00 ? 22 ARG B HH22 1  
ATOM 650   N N    . GLY B 2 23 ? -10.688 -5.841  -3.664  1.00 0.00 ? 23 GLY B N    1  
ATOM 651   C CA   . GLY B 2 23 ? -10.530 -4.360  -3.675  1.00 0.00 ? 23 GLY B CA   1  
ATOM 652   C C    . GLY B 2 23 ? -9.900  -3.900  -2.359  1.00 0.00 ? 23 GLY B C    1  
ATOM 653   O O    . GLY B 2 23 ? -9.516  -4.699  -1.529  1.00 0.00 ? 23 GLY B O    1  
ATOM 654   H H    . GLY B 2 23 ? -9.899  -6.419  -3.734  1.00 0.00 ? 23 GLY B H    1  
ATOM 655   H HA2  . GLY B 2 23 ? -9.892  -4.073  -4.499  1.00 0.00 ? 23 GLY B HA2  1  
ATOM 656   H HA3  . GLY B 2 23 ? -11.496 -3.895  -3.789  1.00 0.00 ? 23 GLY B HA3  1  
ATOM 657   N N    . PHE B 2 24 ? -9.793  -2.614  -2.162  1.00 0.00 ? 24 PHE B N    1  
ATOM 658   C CA   . PHE B 2 24 ? -9.188  -2.098  -0.903  1.00 0.00 ? 24 PHE B CA   1  
ATOM 659   C C    . PHE B 2 24 ? -9.669  -0.669  -0.656  1.00 0.00 ? 24 PHE B C    1  
ATOM 660   O O    . PHE B 2 24 ? -10.229 -0.034  -1.528  1.00 0.00 ? 24 PHE B O    1  
ATOM 661   C CB   . PHE B 2 24 ? -7.664  -2.104  -1.031  1.00 0.00 ? 24 PHE B CB   1  
ATOM 662   C CG   . PHE B 2 24 ? -7.269  -1.482  -2.346  1.00 0.00 ? 24 PHE B CG   1  
ATOM 663   C CD1  . PHE B 2 24 ? -7.290  -2.255  -3.510  1.00 0.00 ? 24 PHE B CD1  1  
ATOM 664   C CD2  . PHE B 2 24 ? -6.886  -0.138  -2.401  1.00 0.00 ? 24 PHE B CD2  1  
ATOM 665   C CE1  . PHE B 2 24 ? -6.928  -1.684  -4.735  1.00 0.00 ? 24 PHE B CE1  1  
ATOM 666   C CE2  . PHE B 2 24 ? -6.523  0.435   -3.626  1.00 0.00 ? 24 PHE B CE2  1  
ATOM 667   C CZ   . PHE B 2 24 ? -6.544  -0.338  -4.793  1.00 0.00 ? 24 PHE B CZ   1  
ATOM 668   H H    . PHE B 2 24 ? -10.108 -1.988  -2.846  1.00 0.00 ? 24 PHE B H    1  
ATOM 669   H HA   . PHE B 2 24 ? -9.484  -2.727  -0.075  1.00 0.00 ? 24 PHE B HA   1  
ATOM 670   H HB2  . PHE B 2 24 ? -7.229  -1.539  -0.219  1.00 0.00 ? 24 PHE B HB2  1  
ATOM 671   H HB3  . PHE B 2 24 ? -7.305  -3.120  -0.996  1.00 0.00 ? 24 PHE B HB3  1  
ATOM 672   H HD1  . PHE B 2 24 ? -7.586  -3.292  -3.461  1.00 0.00 ? 24 PHE B HD1  1  
ATOM 673   H HD2  . PHE B 2 24 ? -6.867  0.456   -1.500  1.00 0.00 ? 24 PHE B HD2  1  
ATOM 674   H HE1  . PHE B 2 24 ? -6.946  -2.280  -5.635  1.00 0.00 ? 24 PHE B HE1  1  
ATOM 675   H HE2  . PHE B 2 24 ? -6.227  1.473   -3.670  1.00 0.00 ? 24 PHE B HE2  1  
ATOM 676   H HZ   . PHE B 2 24 ? -6.264  0.103   -5.738  1.00 0.00 ? 24 PHE B HZ   1  
ATOM 677   N N    . PHE B 2 25 ? -9.455  -0.154  0.523   1.00 0.00 ? 25 PHE B N    1  
ATOM 678   C CA   . PHE B 2 25 ? -9.900  1.236   0.817   1.00 0.00 ? 25 PHE B CA   1  
ATOM 679   C C    . PHE B 2 25 ? -8.681  2.095   1.158   1.00 0.00 ? 25 PHE B C    1  
ATOM 680   O O    . PHE B 2 25 ? -8.380  2.339   2.309   1.00 0.00 ? 25 PHE B O    1  
ATOM 681   C CB   . PHE B 2 25 ? -10.875 1.230   1.999   1.00 0.00 ? 25 PHE B CB   1  
ATOM 682   C CG   . PHE B 2 25 ? -10.230 0.571   3.193   1.00 0.00 ? 25 PHE B CG   1  
ATOM 683   C CD1  . PHE B 2 25 ? -10.123 -0.823  3.250   1.00 0.00 ? 25 PHE B CD1  1  
ATOM 684   C CD2  . PHE B 2 25 ? -9.740  1.354   4.245   1.00 0.00 ? 25 PHE B CD2  1  
ATOM 685   C CE1  . PHE B 2 25 ? -9.525  -1.435  4.359   1.00 0.00 ? 25 PHE B CE1  1  
ATOM 686   C CE2  . PHE B 2 25 ? -9.145  0.743   5.354   1.00 0.00 ? 25 PHE B CE2  1  
ATOM 687   C CZ   . PHE B 2 25 ? -9.035  -0.651  5.411   1.00 0.00 ? 25 PHE B CZ   1  
ATOM 688   H H    . PHE B 2 25 ? -8.999  -0.681  1.212   1.00 0.00 ? 25 PHE B H    1  
ATOM 689   H HA   . PHE B 2 25 ? -10.393 1.644   -0.053  1.00 0.00 ? 25 PHE B HA   1  
ATOM 690   H HB2  . PHE B 2 25 ? -11.138 2.247   2.249   1.00 0.00 ? 25 PHE B HB2  1  
ATOM 691   H HB3  . PHE B 2 25 ? -11.766 0.686   1.726   1.00 0.00 ? 25 PHE B HB3  1  
ATOM 692   H HD1  . PHE B 2 25 ? -10.499 -1.428  2.439   1.00 0.00 ? 25 PHE B HD1  1  
ATOM 693   H HD2  . PHE B 2 25 ? -9.824  2.430   4.200   1.00 0.00 ? 25 PHE B HD2  1  
ATOM 694   H HE1  . PHE B 2 25 ? -9.442  -2.511  4.404   1.00 0.00 ? 25 PHE B HE1  1  
ATOM 695   H HE2  . PHE B 2 25 ? -8.767  1.349   6.165   1.00 0.00 ? 25 PHE B HE2  1  
ATOM 696   H HZ   . PHE B 2 25 ? -8.575  -1.121  6.266   1.00 0.00 ? 25 PHE B HZ   1  
ATOM 697   N N    . TYR B 2 26 ? -7.980  2.561   0.163   1.00 0.00 ? 26 TYR B N    1  
ATOM 698   C CA   . TYR B 2 26 ? -6.786  3.409   0.427   1.00 0.00 ? 26 TYR B CA   1  
ATOM 699   C C    . TYR B 2 26 ? -7.253  4.753   0.985   1.00 0.00 ? 26 TYR B C    1  
ATOM 700   O O    . TYR B 2 26 ? -8.409  5.108   0.874   1.00 0.00 ? 26 TYR B O    1  
ATOM 701   C CB   . TYR B 2 26 ? -6.025  3.622   -0.884  1.00 0.00 ? 26 TYR B CB   1  
ATOM 702   C CG   . TYR B 2 26 ? -4.645  4.174   -0.609  1.00 0.00 ? 26 TYR B CG   1  
ATOM 703   C CD1  . TYR B 2 26 ? -3.901  3.718   0.488   1.00 0.00 ? 26 TYR B CD1  1  
ATOM 704   C CD2  . TYR B 2 26 ? -4.104  5.140   -1.465  1.00 0.00 ? 26 TYR B CD2  1  
ATOM 705   C CE1  . TYR B 2 26 ? -2.620  4.229   0.726   1.00 0.00 ? 26 TYR B CE1  1  
ATOM 706   C CE2  . TYR B 2 26 ? -2.824  5.652   -1.225  1.00 0.00 ? 26 TYR B CE2  1  
ATOM 707   C CZ   . TYR B 2 26 ? -2.081  5.196   -0.131  1.00 0.00 ? 26 TYR B CZ   1  
ATOM 708   O OH   . TYR B 2 26 ? -0.819  5.701   0.104   1.00 0.00 ? 26 TYR B OH   1  
ATOM 709   H H    . TYR B 2 26 ? -8.240  2.357   -0.759  1.00 0.00 ? 26 TYR B H    1  
ATOM 710   H HA   . TYR B 2 26 ? -6.147  2.920   1.146   1.00 0.00 ? 26 TYR B HA   1  
ATOM 711   H HB2  . TYR B 2 26 ? -5.935  2.679   -1.402  1.00 0.00 ? 26 TYR B HB2  1  
ATOM 712   H HB3  . TYR B 2 26 ? -6.571  4.320   -1.504  1.00 0.00 ? 26 TYR B HB3  1  
ATOM 713   H HD1  . TYR B 2 26 ? -4.313  2.972   1.149   1.00 0.00 ? 26 TYR B HD1  1  
ATOM 714   H HD2  . TYR B 2 26 ? -4.676  5.493   -2.309  1.00 0.00 ? 26 TYR B HD2  1  
ATOM 715   H HE1  . TYR B 2 26 ? -2.047  3.877   1.569   1.00 0.00 ? 26 TYR B HE1  1  
ATOM 716   H HE2  . TYR B 2 26 ? -2.409  6.396   -1.888  1.00 0.00 ? 26 TYR B HE2  1  
ATOM 717   H HH   . TYR B 2 26 ? -0.338  5.696   -0.729  1.00 0.00 ? 26 TYR B HH   1  
ATOM 718   N N    . THR B 2 27 ? -6.375  5.505   1.588   1.00 0.00 ? 27 THR B N    1  
ATOM 719   C CA   . THR B 2 27 ? -6.803  6.816   2.148   1.00 0.00 ? 27 THR B CA   1  
ATOM 720   C C    . THR B 2 27 ? -5.889  7.934   1.635   1.00 0.00 ? 27 THR B C    1  
ATOM 721   O O    . THR B 2 27 ? -5.281  8.641   2.415   1.00 0.00 ? 27 THR B O    1  
ATOM 722   C CB   . THR B 2 27 ? -6.741  6.762   3.676   1.00 0.00 ? 27 THR B CB   1  
ATOM 723   O OG1  . THR B 2 27 ? -6.845  8.080   4.197   1.00 0.00 ? 27 THR B OG1  1  
ATOM 724   C CG2  . THR B 2 27 ? -5.417  6.139   4.118   1.00 0.00 ? 27 THR B CG2  1  
ATOM 725   H H    . THR B 2 27 ? -5.447  5.208   1.676   1.00 0.00 ? 27 THR B H    1  
ATOM 726   H HA   . THR B 2 27 ? -7.815  7.013   1.842   1.00 0.00 ? 27 THR B HA   1  
ATOM 727   H HB   . THR B 2 27 ? -7.558  6.163   4.048   1.00 0.00 ? 27 THR B HB   1  
ATOM 728   H HG1  . THR B 2 27 ? -7.750  8.376   4.077   1.00 0.00 ? 27 THR B HG1  1  
ATOM 729   H HG21 . THR B 2 27 ? -5.251  5.221   3.570   1.00 0.00 ? 27 THR B HG21 1  
ATOM 730   H HG22 . THR B 2 27 ? -4.610  6.829   3.916   1.00 0.00 ? 27 THR B HG22 1  
ATOM 731   H HG23 . THR B 2 27 ? -5.455  5.926   5.176   1.00 0.00 ? 27 THR B HG23 1  
ATOM 732   N N    . PRO B 2 28 ? -5.828  8.064   0.335   1.00 0.00 ? 28 PRO B N    1  
ATOM 733   C CA   . PRO B 2 28 ? -5.006  9.095   -0.343  1.00 0.00 ? 28 PRO B CA   1  
ATOM 734   C C    . PRO B 2 28 ? -5.500  10.494  0.031   1.00 0.00 ? 28 PRO B C    1  
ATOM 735   O O    . PRO B 2 28 ? -6.298  10.664  0.931   1.00 0.00 ? 28 PRO B O    1  
ATOM 736   C CB   . PRO B 2 28 ? -5.193  8.858   -1.846  1.00 0.00 ? 28 PRO B CB   1  
ATOM 737   C CG   . PRO B 2 28 ? -6.237  7.737   -2.013  1.00 0.00 ? 28 PRO B CG   1  
ATOM 738   C CD   . PRO B 2 28 ? -6.566  7.202   -0.615  1.00 0.00 ? 28 PRO B CD   1  
ATOM 739   H HA   . PRO B 2 28 ? -3.967  8.980   -0.082  1.00 0.00 ? 28 PRO B HA   1  
ATOM 740   H HB2  . PRO B 2 28 ? -5.546  9.765   -2.318  1.00 0.00 ? 28 PRO B HB2  1  
ATOM 741   H HB3  . PRO B 2 28 ? -4.259  8.551   -2.289  1.00 0.00 ? 28 PRO B HB3  1  
ATOM 742   H HG2  . PRO B 2 28 ? -7.129  8.135   -2.476  1.00 0.00 ? 28 PRO B HG2  1  
ATOM 743   H HG3  . PRO B 2 28 ? -5.831  6.943   -2.618  1.00 0.00 ? 28 PRO B HG3  1  
ATOM 744   H HD2  . PRO B 2 28 ? -7.629  7.266   -0.432  1.00 0.00 ? 28 PRO B HD2  1  
ATOM 745   H HD3  . PRO B 2 28 ? -6.229  6.182   -0.522  1.00 0.00 ? 28 PRO B HD3  1  
ATOM 746   N N    . LYS B 2 29 ? -5.034  11.497  -0.660  1.00 0.00 ? 29 LYS B N    1  
ATOM 747   C CA   . LYS B 2 29 ? -5.478  12.888  -0.352  1.00 0.00 ? 29 LYS B CA   1  
ATOM 748   C C    . LYS B 2 29 ? -5.421  13.739  -1.619  1.00 0.00 ? 29 LYS B C    1  
ATOM 749   O O    . LYS B 2 29 ? -6.270  14.574  -1.861  1.00 0.00 ? 29 LYS B O    1  
ATOM 750   C CB   . LYS B 2 29 ? -4.565  13.496  0.715   1.00 0.00 ? 29 LYS B CB   1  
ATOM 751   C CG   . LYS B 2 29 ? -4.916  14.974  0.905   1.00 0.00 ? 29 LYS B CG   1  
ATOM 752   C CD   . LYS B 2 29 ? -6.368  15.100  1.368   1.00 0.00 ? 29 LYS B CD   1  
ATOM 753   C CE   . LYS B 2 29 ? -6.584  16.476  2.001   1.00 0.00 ? 29 LYS B CE   1  
ATOM 754   N NZ   . LYS B 2 29 ? -6.775  17.492  0.927   1.00 0.00 ? 29 LYS B NZ   1  
ATOM 755   H H    . LYS B 2 29 ? -4.395  11.334  -1.384  1.00 0.00 ? 29 LYS B H    1  
ATOM 756   H HA   . LYS B 2 29 ? -6.486  12.866  0.008   1.00 0.00 ? 29 LYS B HA   1  
ATOM 757   H HB2  . LYS B 2 29 ? -4.703  12.970  1.648   1.00 0.00 ? 29 LYS B HB2  1  
ATOM 758   H HB3  . LYS B 2 29 ? -3.536  13.408  0.402   1.00 0.00 ? 29 LYS B HB3  1  
ATOM 759   H HG2  . LYS B 2 29 ? -4.260  15.405  1.648   1.00 0.00 ? 29 LYS B HG2  1  
ATOM 760   H HG3  . LYS B 2 29 ? -4.791  15.495  -0.031  1.00 0.00 ? 29 LYS B HG3  1  
ATOM 761   H HD2  . LYS B 2 29 ? -7.027  14.985  0.521   1.00 0.00 ? 29 LYS B HD2  1  
ATOM 762   H HD3  . LYS B 2 29 ? -6.581  14.333  2.099   1.00 0.00 ? 29 LYS B HD3  1  
ATOM 763   H HE2  . LYS B 2 29 ? -7.461  16.449  2.630   1.00 0.00 ? 29 LYS B HE2  1  
ATOM 764   H HE3  . LYS B 2 29 ? -5.722  16.739  2.596   1.00 0.00 ? 29 LYS B HE3  1  
ATOM 765   H HZ1  . LYS B 2 29 ? -7.265  17.058  0.120   1.00 0.00 ? 29 LYS B HZ1  1  
ATOM 766   H HZ2  . LYS B 2 29 ? -7.346  18.280  1.293   1.00 0.00 ? 29 LYS B HZ2  1  
ATOM 767   H HZ3  . LYS B 2 29 ? -5.848  17.850  0.620   1.00 0.00 ? 29 LYS B HZ3  1  
ATOM 768   N N    . THR B 2 30 ? -4.426  13.530  -2.422  1.00 0.00 ? 30 THR B N    1  
ATOM 769   C CA   . THR B 2 30 ? -4.297  14.316  -3.681  1.00 0.00 ? 30 THR B CA   1  
ATOM 770   C C    . THR B 2 30 ? -4.753  13.460  -4.866  1.00 0.00 ? 30 THR B C    1  
ATOM 771   O O    . THR B 2 30 ? -5.127  14.033  -5.876  1.00 0.00 ? 30 THR B O    1  
ATOM 772   C CB   . THR B 2 30 ? -2.834  14.723  -3.880  1.00 0.00 ? 30 THR B CB   1  
ATOM 773   O OG1  . THR B 2 30 ? -1.987  13.708  -3.355  1.00 0.00 ? 30 THR B OG1  1  
ATOM 774   C CG2  . THR B 2 30 ? -2.564  16.040  -3.153  1.00 0.00 ? 30 THR B CG2  1  
ATOM 775   O OXT  . THR B 2 30 ? -4.722  12.248  -4.741  1.00 0.00 ? 30 THR B OXT  1  
ATOM 776   H H    . THR B 2 30 ? -3.763  12.850  -2.196  1.00 0.00 ? 30 THR B H    1  
ATOM 777   H HA   . THR B 2 30 ? -4.911  15.201  -3.617  1.00 0.00 ? 30 THR B HA   1  
ATOM 778   H HB   . THR B 2 30 ? -2.635  14.850  -4.932  1.00 0.00 ? 30 THR B HB   1  
ATOM 779   H HG1  . THR B 2 30 ? -2.416  12.861  -3.498  1.00 0.00 ? 30 THR B HG1  1  
ATOM 780   H HG21 . THR B 2 30 ? -3.460  16.643  -3.152  1.00 0.00 ? 30 THR B HG21 1  
ATOM 781   H HG22 . THR B 2 30 ? -2.266  15.835  -2.135  1.00 0.00 ? 30 THR B HG22 1  
ATOM 782   H HG23 . THR B 2 30 ? -1.772  16.574  -3.658  1.00 0.00 ? 30 THR B HG23 1  
ATOM 783   N N    . GLY A 1 1  ? -3.235  7.782   6.418   1.00 0.00 ? 1  GLY A N    2  
ATOM 784   C CA   . GLY A 1 1  ? -3.223  6.330   6.078   1.00 0.00 ? 1  GLY A CA   2  
ATOM 785   C C    . GLY A 1 1  ? -1.807  5.774   6.251   1.00 0.00 ? 1  GLY A C    2  
ATOM 786   O O    . GLY A 1 1  ? -1.020  6.283   7.023   1.00 0.00 ? 1  GLY A O    2  
ATOM 787   H H1   . GLY A 1 1  ? -2.330  8.212   6.138   1.00 0.00 ? 1  GLY A H1   2  
ATOM 788   H H2   . GLY A 1 1  ? -4.010  8.250   5.906   1.00 0.00 ? 1  GLY A H2   2  
ATOM 789   H H3   . GLY A 1 1  ? -3.374  7.898   7.442   1.00 0.00 ? 1  GLY A H3   2  
ATOM 790   H HA2  . GLY A 1 1  ? -3.902  5.803   6.735   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 791   H HA3  . GLY A 1 1  ? -3.535  6.197   5.054   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 792   N N    . ILE A 1 2  ? -1.481  4.733   5.536   1.00 0.00 ? 2  ILE A N    2  
ATOM 793   C CA   . ILE A 1 2  ? -0.117  4.142   5.657   1.00 0.00 ? 2  ILE A CA   2  
ATOM 794   C C    . ILE A 1 2  ? 0.810   4.806   4.643   1.00 0.00 ? 2  ILE A C    2  
ATOM 795   O O    . ILE A 1 2  ? 1.853   4.287   4.304   1.00 0.00 ? 2  ILE A O    2  
ATOM 796   C CB   . ILE A 1 2  ? -0.192  2.626   5.409   1.00 0.00 ? 2  ILE A CB   2  
ATOM 797   C CG1  . ILE A 1 2  ? -0.156  2.296   3.898   1.00 0.00 ? 2  ILE A CG1  2  
ATOM 798   C CG2  . ILE A 1 2  ? -1.486  2.094   6.015   1.00 0.00 ? 2  ILE A CG2  2  
ATOM 799   C CD1  . ILE A 1 2  ? -1.512  2.585   3.236   1.00 0.00 ? 2  ILE A CD1  2  
ATOM 800   H H    . ILE A 1 2  ? -2.133  4.341   4.922   1.00 0.00 ? 2  ILE A H    2  
ATOM 801   H HA   . ILE A 1 2  ? 0.261   4.322   6.652   1.00 0.00 ? 2  ILE A HA   2  
ATOM 802   H HB   . ILE A 1 2  ? 0.645   2.150   5.900   1.00 0.00 ? 2  ILE A HB   2  
ATOM 803   H HG12 . ILE A 1 2  ? 0.607   2.884   3.416   1.00 0.00 ? 2  ILE A HG12 2  
ATOM 804   H HG13 . ILE A 1 2  ? 0.078   1.249   3.775   1.00 0.00 ? 2  ILE A HG13 2  
ATOM 805   H HG21 . ILE A 1 2  ? -1.526  2.349   7.063   1.00 0.00 ? 2  ILE A HG21 2  
ATOM 806   H HG22 . ILE A 1 2  ? -2.328  2.541   5.501   1.00 0.00 ? 2  ILE A HG22 2  
ATOM 807   H HG23 . ILE A 1 2  ? -1.525  1.021   5.900   1.00 0.00 ? 2  ILE A HG23 2  
ATOM 808   H HD11 . ILE A 1 2  ? -2.254  2.787   3.988   1.00 0.00 ? 2  ILE A HD11 2  
ATOM 809   H HD12 . ILE A 1 2  ? -1.419  3.441   2.586   1.00 0.00 ? 2  ILE A HD12 2  
ATOM 810   H HD13 . ILE A 1 2  ? -1.820  1.725   2.654   1.00 0.00 ? 2  ILE A HD13 2  
ATOM 811   N N    . VAL A 1 3  ? 0.435   5.953   4.158   1.00 0.00 ? 3  VAL A N    2  
ATOM 812   C CA   . VAL A 1 3  ? 1.286   6.656   3.161   1.00 0.00 ? 3  VAL A CA   2  
ATOM 813   C C    . VAL A 1 3  ? 2.410   7.405   3.879   1.00 0.00 ? 3  VAL A C    2  
ATOM 814   O O    . VAL A 1 3  ? 3.519   7.492   3.394   1.00 0.00 ? 3  VAL A O    2  
ATOM 815   C CB   . VAL A 1 3  ? 0.419   7.642   2.380   1.00 0.00 ? 3  VAL A CB   2  
ATOM 816   C CG1  . VAL A 1 3  ? 1.134   8.037   1.085   1.00 0.00 ? 3  VAL A CG1  2  
ATOM 817   C CG2  . VAL A 1 3  ? -0.921  6.978   2.044   1.00 0.00 ? 3  VAL A CG2  2  
ATOM 818   H H    . VAL A 1 3  ? -0.410  6.351   4.449   1.00 0.00 ? 3  VAL A H    2  
ATOM 819   H HA   . VAL A 1 3  ? 1.712   5.934   2.481   1.00 0.00 ? 3  VAL A HA   2  
ATOM 820   H HB   . VAL A 1 3  ? 0.247   8.524   2.981   1.00 0.00 ? 3  VAL A HB   2  
ATOM 821   H HG11 . VAL A 1 3  ? 1.815   7.251   0.797   1.00 0.00 ? 3  VAL A HG11 2  
ATOM 822   H HG12 . VAL A 1 3  ? 0.404   8.186   0.303   1.00 0.00 ? 3  VAL A HG12 2  
ATOM 823   H HG13 . VAL A 1 3  ? 1.685   8.952   1.243   1.00 0.00 ? 3  VAL A HG13 2  
ATOM 824   H HG21 . VAL A 1 3  ? -0.744  6.083   1.464   1.00 0.00 ? 3  VAL A HG21 2  
ATOM 825   H HG22 . VAL A 1 3  ? -1.434  6.714   2.959   1.00 0.00 ? 3  VAL A HG22 2  
ATOM 826   H HG23 . VAL A 1 3  ? -1.530  7.662   1.474   1.00 0.00 ? 3  VAL A HG23 2  
ATOM 827   N N    . GLU A 1 4  ? 2.137   7.945   5.033   1.00 0.00 ? 4  GLU A N    2  
ATOM 828   C CA   . GLU A 1 4  ? 3.197   8.685   5.777   1.00 0.00 ? 4  GLU A CA   2  
ATOM 829   C C    . GLU A 1 4  ? 4.183   7.688   6.397   1.00 0.00 ? 4  GLU A C    2  
ATOM 830   O O    . GLU A 1 4  ? 5.127   8.069   7.059   1.00 0.00 ? 4  GLU A O    2  
ATOM 831   C CB   . GLU A 1 4  ? 2.552   9.522   6.883   1.00 0.00 ? 4  GLU A CB   2  
ATOM 832   C CG   . GLU A 1 4  ? 1.905   10.767  6.271   1.00 0.00 ? 4  GLU A CG   2  
ATOM 833   C CD   . GLU A 1 4  ? 2.962   11.570  5.509   1.00 0.00 ? 4  GLU A CD   2  
ATOM 834   O OE1  . GLU A 1 4  ? 4.027   11.785  6.062   1.00 0.00 ? 4  GLU A OE1  2  
ATOM 835   O OE2  . GLU A 1 4  ? 2.685   11.957  4.386   1.00 0.00 ? 4  GLU A OE2  2  
ATOM 836   H H    . GLU A 1 4  ? 1.237   7.864   5.413   1.00 0.00 ? 4  GLU A H    2  
ATOM 837   H HA   . GLU A 1 4  ? 3.725   9.335   5.095   1.00 0.00 ? 4  GLU A HA   2  
ATOM 838   H HB2  . GLU A 1 4  ? 1.797   8.934   7.386   1.00 0.00 ? 4  GLU A HB2  2  
ATOM 839   H HB3  . GLU A 1 4  ? 3.307   9.824   7.594   1.00 0.00 ? 4  GLU A HB3  2  
ATOM 840   H HG2  . GLU A 1 4  ? 1.119   10.467  5.591   1.00 0.00 ? 4  GLU A HG2  2  
ATOM 841   H HG3  . GLU A 1 4  ? 1.488   11.380  7.055   1.00 0.00 ? 4  GLU A HG3  2  
ATOM 842   N N    . GLN A 1 5  ? 3.969   6.416   6.194   1.00 0.00 ? 5  GLN A N    2  
ATOM 843   C CA   . GLN A 1 5  ? 4.892   5.402   6.780   1.00 0.00 ? 5  GLN A CA   2  
ATOM 844   C C    . GLN A 1 5  ? 5.412   4.467   5.682   1.00 0.00 ? 5  GLN A C    2  
ATOM 845   O O    . GLN A 1 5  ? 6.450   3.851   5.818   1.00 0.00 ? 5  GLN A O    2  
ATOM 846   C CB   . GLN A 1 5  ? 4.137   4.578   7.825   1.00 0.00 ? 5  GLN A CB   2  
ATOM 847   C CG   . GLN A 1 5  ? 4.096   5.344   9.147   1.00 0.00 ? 5  GLN A CG   2  
ATOM 848   C CD   . GLN A 1 5  ? 5.128   4.755   10.110  1.00 0.00 ? 5  GLN A CD   2  
ATOM 849   O OE1  . GLN A 1 5  ? 6.281   4.601   9.761   1.00 0.00 ? 5  GLN A OE1  2  
ATOM 850   N NE2  . GLN A 1 5  ? 4.760   4.418   11.315  1.00 0.00 ? 5  GLN A NE2  2  
ATOM 851   H H    . GLN A 1 5  ? 3.199   6.127   5.664   1.00 0.00 ? 5  GLN A H    2  
ATOM 852   H HA   . GLN A 1 5  ? 5.725   5.901   7.252   1.00 0.00 ? 5  GLN A HA   2  
ATOM 853   H HB2  . GLN A 1 5  ? 3.129   4.398   7.479   1.00 0.00 ? 5  GLN A HB2  2  
ATOM 854   H HB3  . GLN A 1 5  ? 4.641   3.635   7.973   1.00 0.00 ? 5  GLN A HB3  2  
ATOM 855   H HG2  . GLN A 1 5  ? 4.322   6.385   8.967   1.00 0.00 ? 5  GLN A HG2  2  
ATOM 856   H HG3  . GLN A 1 5  ? 3.110   5.259   9.582   1.00 0.00 ? 5  GLN A HG3  2  
ATOM 857   H HE21 . GLN A 1 5  ? 3.830   4.542   11.597  1.00 0.00 ? 5  GLN A HE21 2  
ATOM 858   H HE22 . GLN A 1 5  ? 5.415   4.039   11.939  1.00 0.00 ? 5  GLN A HE22 2  
ATOM 859   N N    . CYS A 1 6  ? 4.694   4.345   4.599   1.00 0.00 ? 6  CYS A N    2  
ATOM 860   C CA   . CYS A 1 6  ? 5.140   3.439   3.504   1.00 0.00 ? 6  CYS A CA   2  
ATOM 861   C C    . CYS A 1 6  ? 5.796   4.255   2.385   1.00 0.00 ? 6  CYS A C    2  
ATOM 862   O O    . CYS A 1 6  ? 6.685   3.786   1.704   1.00 0.00 ? 6  CYS A O    2  
ATOM 863   C CB   . CYS A 1 6  ? 3.930   2.696   2.945   1.00 0.00 ? 6  CYS A CB   2  
ATOM 864   S SG   . CYS A 1 6  ? 3.521   1.307   4.032   1.00 0.00 ? 6  CYS A SG   2  
ATOM 865   H H    . CYS A 1 6  ? 3.855   4.842   4.511   1.00 0.00 ? 6  CYS A H    2  
ATOM 866   H HA   . CYS A 1 6  ? 5.847   2.727   3.890   1.00 0.00 ? 6  CYS A HA   2  
ATOM 867   H HB2  . CYS A 1 6  ? 3.092   3.371   2.897   1.00 0.00 ? 6  CYS A HB2  2  
ATOM 868   H HB3  . CYS A 1 6  ? 4.156   2.326   1.956   1.00 0.00 ? 6  CYS A HB3  2  
ATOM 869   N N    . CYS A 1 7  ? 5.365   5.469   2.188   1.00 0.00 ? 7  CYS A N    2  
ATOM 870   C CA   . CYS A 1 7  ? 5.966   6.307   1.110   1.00 0.00 ? 7  CYS A CA   2  
ATOM 871   C C    . CYS A 1 7  ? 7.275   6.922   1.616   1.00 0.00 ? 7  CYS A C    2  
ATOM 872   O O    . CYS A 1 7  ? 8.280   6.907   0.933   1.00 0.00 ? 7  CYS A O    2  
ATOM 873   C CB   . CYS A 1 7  ? 4.975   7.412   0.723   1.00 0.00 ? 7  CYS A CB   2  
ATOM 874   S SG   . CYS A 1 7  ? 5.820   8.701   -0.231  1.00 0.00 ? 7  CYS A SG   2  
ATOM 875   H H    . CYS A 1 7  ? 4.643   5.831   2.746   1.00 0.00 ? 7  CYS A H    2  
ATOM 876   H HA   . CYS A 1 7  ? 6.171   5.689   0.249   1.00 0.00 ? 7  CYS A HA   2  
ATOM 877   H HB2  . CYS A 1 7  ? 4.184   6.989   0.124   1.00 0.00 ? 7  CYS A HB2  2  
ATOM 878   H HB3  . CYS A 1 7  ? 4.554   7.845   1.616   1.00 0.00 ? 7  CYS A HB3  2  
ATOM 879   N N    . THR A 1 8  ? 7.276   7.462   2.803   1.00 0.00 ? 8  THR A N    2  
ATOM 880   C CA   . THR A 1 8  ? 8.523   8.072   3.342   1.00 0.00 ? 8  THR A CA   2  
ATOM 881   C C    . THR A 1 8  ? 9.607   6.998   3.452   1.00 0.00 ? 8  THR A C    2  
ATOM 882   O O    . THR A 1 8  ? 10.771  7.246   3.207   1.00 0.00 ? 8  THR A O    2  
ATOM 883   C CB   . THR A 1 8  ? 8.250   8.669   4.725   1.00 0.00 ? 8  THR A CB   2  
ATOM 884   O OG1  . THR A 1 8  ? 7.447   7.769   5.478   1.00 0.00 ? 8  THR A OG1  2  
ATOM 885   C CG2  . THR A 1 8  ? 7.518   10.001  4.569   1.00 0.00 ? 8  THR A CG2  2  
ATOM 886   H H    . THR A 1 8  ? 6.456   7.464   3.342   1.00 0.00 ? 8  THR A H    2  
ATOM 887   H HA   . THR A 1 8  ? 8.858   8.853   2.674   1.00 0.00 ? 8  THR A HA   2  
ATOM 888   H HB   . THR A 1 8  ? 9.184   8.835   5.239   1.00 0.00 ? 8  THR A HB   2  
ATOM 889   H HG1  . THR A 1 8  ? 7.935   6.951   5.582   1.00 0.00 ? 8  THR A HG1  2  
ATOM 890   H HG21 . THR A 1 8  ? 7.542   10.306  3.533   1.00 0.00 ? 8  THR A HG21 2  
ATOM 891   H HG22 . THR A 1 8  ? 6.492   9.889   4.886   1.00 0.00 ? 8  THR A HG22 2  
ATOM 892   H HG23 . THR A 1 8  ? 8.001   10.753  5.175   1.00 0.00 ? 8  THR A HG23 2  
ATOM 893   N N    . SER A 1 9  ? 9.233   5.801   3.815   1.00 0.00 ? 9  SER A N    2  
ATOM 894   C CA   . SER A 1 9  ? 10.239  4.709   3.937   1.00 0.00 ? 9  SER A CA   2  
ATOM 895   C C    . SER A 1 9  ? 9.594   3.379   3.538   1.00 0.00 ? 9  SER A C    2  
ATOM 896   O O    . SER A 1 9  ? 8.437   3.327   3.172   1.00 0.00 ? 9  SER A O    2  
ATOM 897   C CB   . SER A 1 9  ? 10.731  4.626   5.382   1.00 0.00 ? 9  SER A CB   2  
ATOM 898   O OG   . SER A 1 9  ? 12.148  4.501   5.389   1.00 0.00 ? 9  SER A OG   2  
ATOM 899   H H    . SER A 1 9  ? 8.289   5.620   4.005   1.00 0.00 ? 9  SER A H    2  
ATOM 900   H HA   . SER A 1 9  ? 11.074  4.914   3.281   1.00 0.00 ? 9  SER A HA   2  
ATOM 901   H HB2  . SER A 1 9  ? 10.453  5.522   5.911   1.00 0.00 ? 9  SER A HB2  2  
ATOM 902   H HB3  . SER A 1 9  ? 10.281  3.770   5.865   1.00 0.00 ? 9  SER A HB3  2  
ATOM 903   H HG   . SER A 1 9  ? 12.377  3.767   5.963   1.00 0.00 ? 9  SER A HG   2  
ATOM 904   N N    . ILE A 1 10 ? 10.330  2.305   3.604   1.00 0.00 ? 10 ILE A N    2  
ATOM 905   C CA   . ILE A 1 10 ? 9.751   0.982   3.227   1.00 0.00 ? 10 ILE A CA   2  
ATOM 906   C C    . ILE A 1 10 ? 9.017   0.388   4.431   1.00 0.00 ? 10 ILE A C    2  
ATOM 907   O O    . ILE A 1 10 ? 9.457   0.503   5.559   1.00 0.00 ? 10 ILE A O    2  
ATOM 908   C CB   . ILE A 1 10 ? 10.874  0.039   2.796   1.00 0.00 ? 10 ILE A CB   2  
ATOM 909   C CG1  . ILE A 1 10 ? 11.678  0.687   1.668   1.00 0.00 ? 10 ILE A CG1  2  
ATOM 910   C CG2  . ILE A 1 10 ? 10.269  -1.275  2.298   1.00 0.00 ? 10 ILE A CG2  2  
ATOM 911   C CD1  . ILE A 1 10 ? 12.656  -0.335  1.083   1.00 0.00 ? 10 ILE A CD1  2  
ATOM 912   H H    . ILE A 1 10 ? 11.261  2.364   3.902   1.00 0.00 ? 10 ILE A H    2  
ATOM 913   H HA   . ILE A 1 10 ? 9.057   1.115   2.412   1.00 0.00 ? 10 ILE A HA   2  
ATOM 914   H HB   . ILE A 1 10 ? 11.522  -0.158  3.637   1.00 0.00 ? 10 ILE A HB   2  
ATOM 915   H HG12 . ILE A 1 10 ? 11.005  1.025   0.893   1.00 0.00 ? 10 ILE A HG12 2  
ATOM 916   H HG13 . ILE A 1 10 ? 12.231  1.529   2.055   1.00 0.00 ? 10 ILE A HG13 2  
ATOM 917   H HG21 . ILE A 1 10 ? 9.219   -1.308  2.552   1.00 0.00 ? 10 ILE A HG21 2  
ATOM 918   H HG22 . ILE A 1 10 ? 10.382  -1.341  1.227   1.00 0.00 ? 10 ILE A HG22 2  
ATOM 919   H HG23 . ILE A 1 10 ? 10.778  -2.105  2.765   1.00 0.00 ? 10 ILE A HG23 2  
ATOM 920   H HD11 . ILE A 1 10 ? 13.108  -0.900  1.885   1.00 0.00 ? 10 ILE A HD11 2  
ATOM 921   H HD12 . ILE A 1 10 ? 12.125  -1.006  0.425   1.00 0.00 ? 10 ILE A HD12 2  
ATOM 922   H HD13 . ILE A 1 10 ? 13.426  0.182   0.527   1.00 0.00 ? 10 ILE A HD13 2  
ATOM 923   N N    . CYS A 1 11 ? 7.898   -0.241  4.202   1.00 0.00 ? 11 CYS A N    2  
ATOM 924   C CA   . CYS A 1 11 ? 7.132   -0.837  5.334   1.00 0.00 ? 11 CYS A CA   2  
ATOM 925   C C    . CYS A 1 11 ? 6.931   -2.334  5.089   1.00 0.00 ? 11 CYS A C    2  
ATOM 926   O O    . CYS A 1 11 ? 7.534   -2.916  4.210   1.00 0.00 ? 11 CYS A O    2  
ATOM 927   C CB   . CYS A 1 11 ? 5.772   -0.149  5.440   1.00 0.00 ? 11 CYS A CB   2  
ATOM 928   S SG   . CYS A 1 11 ? 5.052   0.013   3.786   1.00 0.00 ? 11 CYS A SG   2  
ATOM 929   H H    . CYS A 1 11 ? 7.557   -0.320  3.285   1.00 0.00 ? 11 CYS A H    2  
ATOM 930   H HA   . CYS A 1 11 ? 7.680   -0.693  6.254   1.00 0.00 ? 11 CYS A HA   2  
ATOM 931   H HB2  . CYS A 1 11 ? 5.116   -0.740  6.062   1.00 0.00 ? 11 CYS A HB2  2  
ATOM 932   H HB3  . CYS A 1 11 ? 5.896   0.832   5.875   1.00 0.00 ? 11 CYS A HB3  2  
ATOM 933   N N    . SER A 1 12 ? 6.083   -2.961  5.858   1.00 0.00 ? 12 SER A N    2  
ATOM 934   C CA   . SER A 1 12 ? 5.839   -4.418  5.668   1.00 0.00 ? 12 SER A CA   2  
ATOM 935   C C    . SER A 1 12 ? 4.476   -4.619  5.002   1.00 0.00 ? 12 SER A C    2  
ATOM 936   O O    . SER A 1 12 ? 3.580   -3.811  5.150   1.00 0.00 ? 12 SER A O    2  
ATOM 937   C CB   . SER A 1 12 ? 5.850   -5.119  7.027   1.00 0.00 ? 12 SER A CB   2  
ATOM 938   O OG   . SER A 1 12 ? 4.783   -4.624  7.821   1.00 0.00 ? 12 SER A OG   2  
ATOM 939   H H    . SER A 1 12 ? 5.604   -2.473  6.559   1.00 0.00 ? 12 SER A H    2  
ATOM 940   H HA   . SER A 1 12 ? 6.612   -4.835  5.040   1.00 0.00 ? 12 SER A HA   2  
ATOM 941   H HB2  . SER A 1 12 ? 5.726   -6.180  6.888   1.00 0.00 ? 12 SER A HB2  2  
ATOM 942   H HB3  . SER A 1 12 ? 6.797   -4.932  7.518   1.00 0.00 ? 12 SER A HB3  2  
ATOM 943   H HG   . SER A 1 12 ? 5.160   -4.140  8.560   1.00 0.00 ? 12 SER A HG   2  
ATOM 944   N N    . LEU A 1 13 ? 4.310   -5.685  4.270   1.00 0.00 ? 13 LEU A N    2  
ATOM 945   C CA   . LEU A 1 13 ? 3.004   -5.928  3.598   1.00 0.00 ? 13 LEU A CA   2  
ATOM 946   C C    . LEU A 1 13 ? 1.935   -6.217  4.654   1.00 0.00 ? 13 LEU A C    2  
ATOM 947   O O    . LEU A 1 13 ? 0.755   -6.041  4.420   1.00 0.00 ? 13 LEU A O    2  
ATOM 948   C CB   . LEU A 1 13 ? 3.126   -7.124  2.652   1.00 0.00 ? 13 LEU A CB   2  
ATOM 949   C CG   . LEU A 1 13 ? 2.072   -7.008  1.550   1.00 0.00 ? 13 LEU A CG   2  
ATOM 950   C CD1  . LEU A 1 13 ? 2.512   -5.956  0.529   1.00 0.00 ? 13 LEU A CD1  2  
ATOM 951   C CD2  . LEU A 1 13 ? 1.914   -8.359  0.850   1.00 0.00 ? 13 LEU A CD2  2  
ATOM 952   H H    . LEU A 1 13 ? 5.046   -6.325  4.162   1.00 0.00 ? 13 LEU A H    2  
ATOM 953   H HA   . LEU A 1 13 ? 2.723   -5.050  3.034   1.00 0.00 ? 13 LEU A HA   2  
ATOM 954   H HB2  . LEU A 1 13 ? 4.111   -7.132  2.210   1.00 0.00 ? 13 LEU A HB2  2  
ATOM 955   H HB3  . LEU A 1 13 ? 2.969   -8.039  3.203   1.00 0.00 ? 13 LEU A HB3  2  
ATOM 956   H HG   . LEU A 1 13 ? 1.129   -6.712  1.984   1.00 0.00 ? 13 LEU A HG   2  
ATOM 957   H HD11 . LEU A 1 13 ? 3.504   -6.192  0.176   1.00 0.00 ? 13 LEU A HD11 2  
ATOM 958   H HD12 . LEU A 1 13 ? 1.825   -5.950  -0.303  1.00 0.00 ? 13 LEU A HD12 2  
ATOM 959   H HD13 . LEU A 1 13 ? 2.519   -4.983  0.997   1.00 0.00 ? 13 LEU A HD13 2  
ATOM 960   H HD21 . LEU A 1 13 ? 2.889   -8.788  0.668   1.00 0.00 ? 13 LEU A HD21 2  
ATOM 961   H HD22 . LEU A 1 13 ? 1.341   -9.026  1.478   1.00 0.00 ? 13 LEU A HD22 2  
ATOM 962   H HD23 . LEU A 1 13 ? 1.401   -8.221  -0.089  1.00 0.00 ? 13 LEU A HD23 2  
ATOM 963   N N    . TYR A 1 14 ? 2.336   -6.655  5.815   1.00 0.00 ? 14 TYR A N    2  
ATOM 964   C CA   . TYR A 1 14 ? 1.341   -6.948  6.884   1.00 0.00 ? 14 TYR A CA   2  
ATOM 965   C C    . TYR A 1 14 ? 0.518   -5.691  7.164   1.00 0.00 ? 14 TYR A C    2  
ATOM 966   O O    . TYR A 1 14 ? -0.646  -5.760  7.501   1.00 0.00 ? 14 TYR A O    2  
ATOM 967   C CB   . TYR A 1 14 ? 2.073   -7.379  8.160   1.00 0.00 ? 14 TYR A CB   2  
ATOM 968   C CG   . TYR A 1 14 ? 1.110   -7.376  9.322   1.00 0.00 ? 14 TYR A CG   2  
ATOM 969   C CD1  . TYR A 1 14 ? -0.233  -7.715  9.120   1.00 0.00 ? 14 TYR A CD1  2  
ATOM 970   C CD2  . TYR A 1 14 ? 1.560   -7.030  10.602  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 971   C CE1  . TYR A 1 14 ? -1.126  -7.710  10.199  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 972   C CE2  . TYR A 1 14 ? 0.666   -7.025  11.680  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 973   C CZ   . TYR A 1 14 ? -0.677  -7.366  11.478  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 974   O OH   . TYR A 1 14 ? -1.557  -7.360  12.540  1.00 0.00 ? 14 TYR A OH   2  
ATOM 975   H H    . TYR A 1 14 ? 3.291   -6.787  5.986   1.00 0.00 ? 14 TYR A H    2  
ATOM 976   H HA   . TYR A 1 14 ? 0.683   -7.742  6.558   1.00 0.00 ? 14 TYR A HA   2  
ATOM 977   H HB2  . TYR A 1 14 ? 2.473   -8.374  8.025   1.00 0.00 ? 14 TYR A HB2  2  
ATOM 978   H HB3  . TYR A 1 14 ? 2.880   -6.691  8.359   1.00 0.00 ? 14 TYR A HB3  2  
ATOM 979   H HD1  . TYR A 1 14 ? -0.580  -7.982  8.132   1.00 0.00 ? 14 TYR A HD1  2  
ATOM 980   H HD2  . TYR A 1 14 ? 2.595   -6.767  10.759  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 981   H HE1  . TYR A 1 14 ? -2.162  -7.973  10.042  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 982   H HE2  . TYR A 1 14 ? 1.012   -6.757  12.668  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 983   H HH   . TYR A 1 14 ? -1.079  -7.644  13.323  1.00 0.00 ? 14 TYR A HH   2  
ATOM 984   N N    . GLN A 1 15 ? 1.116   -4.540  7.024   1.00 0.00 ? 15 GLN A N    2  
ATOM 985   C CA   . GLN A 1 15 ? 0.370   -3.279  7.278   1.00 0.00 ? 15 GLN A CA   2  
ATOM 986   C C    . GLN A 1 15 ? -0.584  -3.012  6.111   1.00 0.00 ? 15 GLN A C    2  
ATOM 987   O O    . GLN A 1 15 ? -1.614  -2.388  6.270   1.00 0.00 ? 15 GLN A O    2  
ATOM 988   C CB   . GLN A 1 15 ? 1.361   -2.120  7.407   1.00 0.00 ? 15 GLN A CB   2  
ATOM 989   C CG   . GLN A 1 15 ? 2.252   -2.347  8.629   1.00 0.00 ? 15 GLN A CG   2  
ATOM 990   C CD   . GLN A 1 15 ? 1.744   -1.497  9.797   1.00 0.00 ? 15 GLN A CD   2  
ATOM 991   O OE1  . GLN A 1 15 ? 1.498   -2.007  10.872  1.00 0.00 ? 15 GLN A OE1  2  
ATOM 992   N NE2  . GLN A 1 15 ? 1.576   -0.214  9.629   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 993   H H    . GLN A 1 15 ? 2.056   -4.508  6.749   1.00 0.00 ? 15 GLN A H    2  
ATOM 994   H HA   . GLN A 1 15 ? -0.197  -3.374  8.192   1.00 0.00 ? 15 GLN A HA   2  
ATOM 995   H HB2  . GLN A 1 15 ? 1.973   -2.070  6.518   1.00 0.00 ? 15 GLN A HB2  2  
ATOM 996   H HB3  . GLN A 1 15 ? 0.819   -1.195  7.523   1.00 0.00 ? 15 GLN A HB3  2  
ATOM 997   H HG2  . GLN A 1 15 ? 2.227   -3.390  8.903   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 998   H HG3  . GLN A 1 15 ? 3.266   -2.060  8.393   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 999   H HE21 . GLN A 1 15 ? 1.777   0.197   8.761   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 1000  H HE22 . GLN A 1 15 ? 1.251   0.339   10.369  1.00 0.00 ? 15 GLN A HE22 2  
ATOM 1001  N N    . LEU A 1 16 ? -0.248  -3.481  4.939   1.00 0.00 ? 16 LEU A N    2  
ATOM 1002  C CA   . LEU A 1 16 ? -1.137  -3.253  3.765   1.00 0.00 ? 16 LEU A CA   2  
ATOM 1003  C C    . LEU A 1 16 ? -2.244  -4.307  3.747   1.00 0.00 ? 16 LEU A C    2  
ATOM 1004  O O    . LEU A 1 16 ? -3.166  -4.238  2.959   1.00 0.00 ? 16 LEU A O    2  
ATOM 1005  C CB   . LEU A 1 16 ? -0.320  -3.352  2.474   1.00 0.00 ? 16 LEU A CB   2  
ATOM 1006  C CG   . LEU A 1 16 ? 0.720   -2.226  2.425   1.00 0.00 ? 16 LEU A CG   2  
ATOM 1007  C CD1  . LEU A 1 16 ? 1.200   -2.044  0.985   1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1008  C CD2  . LEU A 1 16 ? 0.092   -0.916  2.911   1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1009  H H    . LEU A 1 16 ? 0.587   -3.980  4.833   1.00 0.00 ? 16 LEU A H    2  
ATOM 1010  H HA   . LEU A 1 16 ? -1.579  -2.270  3.836   1.00 0.00 ? 16 LEU A HA   2  
ATOM 1011  H HB2  . LEU A 1 16 ? 0.184   -4.307  2.440   1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1012  H HB3  . LEU A 1 16 ? -0.981  -3.265  1.624   1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1013  H HG   . LEU A 1 16 ? 1.558   -2.482  3.054   1.00 0.00 ? 16 LEU A HG   2  
ATOM 1014  H HD11 . LEU A 1 16 ? 0.672   -2.729  0.339   1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1015  H HD12 . LEU A 1 16 ? 1.007   -1.030  0.668   1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1016  H HD13 . LEU A 1 16 ? 2.260   -2.243  0.931   1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1017  H HD21 . LEU A 1 16 ? -0.955  -0.900  2.648   1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1018  H HD22 . LEU A 1 16 ? 0.194   -0.846  3.983   1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1019  H HD23 . LEU A 1 16 ? 0.593   -0.081  2.446   1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1020  N N    . GLU A 1 17 ? -2.167  -5.282  4.611   1.00 0.00 ? 17 GLU A N    2  
ATOM 1021  C CA   . GLU A 1 17 ? -3.224  -6.332  4.637   1.00 0.00 ? 17 GLU A CA   2  
ATOM 1022  C C    . GLU A 1 17 ? -4.544  -5.698  5.082   1.00 0.00 ? 17 GLU A C    2  
ATOM 1023  O O    . GLU A 1 17 ? -5.614  -6.157  4.735   1.00 0.00 ? 17 GLU A O    2  
ATOM 1024  C CB   . GLU A 1 17 ? -2.828  -7.436  5.618   1.00 0.00 ? 17 GLU A CB   2  
ATOM 1025  C CG   . GLU A 1 17 ? -1.670  -8.247  5.033   1.00 0.00 ? 17 GLU A CG   2  
ATOM 1026  C CD   . GLU A 1 17 ? -1.667  -9.649  5.648   1.00 0.00 ? 17 GLU A CD   2  
ATOM 1027  O OE1  . GLU A 1 17 ? -1.524  -9.743  6.855   1.00 0.00 ? 17 GLU A OE1  2  
ATOM 1028  O OE2  . GLU A 1 17 ? -1.809  -10.602 4.899   1.00 0.00 ? 17 GLU A OE2  2  
ATOM 1029  H H    . GLU A 1 17 ? -1.418  -5.324  5.241   1.00 0.00 ? 17 GLU A H    2  
ATOM 1030  H HA   . GLU A 1 17 ? -3.340  -6.751  3.649   1.00 0.00 ? 17 GLU A HA   2  
ATOM 1031  H HB2  . GLU A 1 17 ? -2.521  -6.991  6.554   1.00 0.00 ? 17 GLU A HB2  2  
ATOM 1032  H HB3  . GLU A 1 17 ? -3.672  -8.088  5.788   1.00 0.00 ? 17 GLU A HB3  2  
ATOM 1033  H HG2  . GLU A 1 17 ? -1.789  -8.323  3.962   1.00 0.00 ? 17 GLU A HG2  2  
ATOM 1034  H HG3  . GLU A 1 17 ? -0.735  -7.756  5.258   1.00 0.00 ? 17 GLU A HG3  2  
ATOM 1035  N N    . ASN A 1 18 ? -4.470  -4.642  5.845   1.00 0.00 ? 18 ASN A N    2  
ATOM 1036  C CA   . ASN A 1 18 ? -5.715  -3.969  6.315   1.00 0.00 ? 18 ASN A CA   2  
ATOM 1037  C C    . ASN A 1 18 ? -6.441  -3.356  5.115   1.00 0.00 ? 18 ASN A C    2  
ATOM 1038  O O    . ASN A 1 18 ? -7.610  -3.031  5.184   1.00 0.00 ? 18 ASN A O    2  
ATOM 1039  C CB   . ASN A 1 18 ? -5.352  -2.862  7.305   1.00 0.00 ? 18 ASN A CB   2  
ATOM 1040  C CG   . ASN A 1 18 ? -5.546  -3.368  8.735   1.00 0.00 ? 18 ASN A CG   2  
ATOM 1041  O OD1  . ASN A 1 18 ? -6.519  -4.032  9.032   1.00 0.00 ? 18 ASN A OD1  2  
ATOM 1042  N ND2  . ASN A 1 18 ? -4.652  -3.080  9.641   1.00 0.00 ? 18 ASN A ND2  2  
ATOM 1043  H H    . ASN A 1 18 ? -3.594  -4.289  6.109   1.00 0.00 ? 18 ASN A H    2  
ATOM 1044  H HA   . ASN A 1 18 ? -6.357  -4.691  6.797   1.00 0.00 ? 18 ASN A HA   2  
ATOM 1045  H HB2  . ASN A 1 18 ? -4.321  -2.573  7.160   1.00 0.00 ? 18 ASN A HB2  2  
ATOM 1046  H HB3  . ASN A 1 18 ? -5.992  -2.006  7.139   1.00 0.00 ? 18 ASN A HB3  2  
ATOM 1047  H HD21 . ASN A 1 18 ? -3.867  -2.544  9.401   1.00 0.00 ? 18 ASN A HD21 2  
ATOM 1048  H HD22 . ASN A 1 18 ? -4.765  -3.398  10.560  1.00 0.00 ? 18 ASN A HD22 2  
ATOM 1049  N N    . TYR A 1 19 ? -5.755  -3.198  4.017   1.00 0.00 ? 19 TYR A N    2  
ATOM 1050  C CA   . TYR A 1 19 ? -6.398  -2.609  2.811   1.00 0.00 ? 19 TYR A CA   2  
ATOM 1051  C C    . TYR A 1 19 ? -7.094  -3.716  2.023   1.00 0.00 ? 19 TYR A C    2  
ATOM 1052  O O    . TYR A 1 19 ? -6.922  -3.850  0.827   1.00 0.00 ? 19 TYR A O    2  
ATOM 1053  C CB   . TYR A 1 19 ? -5.329  -1.936  1.941   1.00 0.00 ? 19 TYR A CB   2  
ATOM 1054  C CG   . TYR A 1 19 ? -5.044  -0.568  2.493   1.00 0.00 ? 19 TYR A CG   2  
ATOM 1055  C CD1  . TYR A 1 19 ? -5.906  0.490   2.193   1.00 0.00 ? 19 TYR A CD1  2  
ATOM 1056  C CD2  . TYR A 1 19 ? -3.931  -0.361  3.308   1.00 0.00 ? 19 TYR A CD2  2  
ATOM 1057  C CE1  . TYR A 1 19 ? -5.653  1.764   2.710   1.00 0.00 ? 19 TYR A CE1  2  
ATOM 1058  C CE2  . TYR A 1 19 ? -3.676  0.911   3.824   1.00 0.00 ? 19 TYR A CE2  2  
ATOM 1059  C CZ   . TYR A 1 19 ? -4.538  1.977   3.526   1.00 0.00 ? 19 TYR A CZ   2  
ATOM 1060  O OH   . TYR A 1 19 ? -4.288  3.232   4.039   1.00 0.00 ? 19 TYR A OH   2  
ATOM 1061  H H    . TYR A 1 19 ? -4.816  -3.468  3.987   1.00 0.00 ? 19 TYR A H    2  
ATOM 1062  H HA   . TYR A 1 19 ? -7.126  -1.873  3.117   1.00 0.00 ? 19 TYR A HA   2  
ATOM 1063  H HB2  . TYR A 1 19 ? -4.427  -2.527  1.952   1.00 0.00 ? 19 TYR A HB2  2  
ATOM 1064  H HB3  . TYR A 1 19 ? -5.688  -1.839  0.930   1.00 0.00 ? 19 TYR A HB3  2  
ATOM 1065  H HD1  . TYR A 1 19 ? -6.763  0.321   1.560   1.00 0.00 ? 19 TYR A HD1  2  
ATOM 1066  H HD2  . TYR A 1 19 ? -3.265  -1.181  3.535   1.00 0.00 ? 19 TYR A HD2  2  
ATOM 1067  H HE1  . TYR A 1 19 ? -6.318  2.584   2.478   1.00 0.00 ? 19 TYR A HE1  2  
ATOM 1068  H HE2  . TYR A 1 19 ? -2.816  1.073   4.448   1.00 0.00 ? 19 TYR A HE2  2  
ATOM 1069  H HH   . TYR A 1 19 ? -3.807  3.733   3.374   1.00 0.00 ? 19 TYR A HH   2  
ATOM 1070  N N    . CYS A 1 20 ? -7.883  -4.514  2.690   1.00 0.00 ? 20 CYS A N    2  
ATOM 1071  C CA   . CYS A 1 20 ? -8.598  -5.620  1.993   1.00 0.00 ? 20 CYS A CA   2  
ATOM 1072  C C    . CYS A 1 20 ? -10.053 -5.660  2.464   1.00 0.00 ? 20 CYS A C    2  
ATOM 1073  O O    . CYS A 1 20 ? -10.361 -5.321  3.591   1.00 0.00 ? 20 CYS A O    2  
ATOM 1074  C CB   . CYS A 1 20 ? -7.918  -6.949  2.318   1.00 0.00 ? 20 CYS A CB   2  
ATOM 1075  S SG   . CYS A 1 20 ? -6.890  -7.453  0.917   1.00 0.00 ? 20 CYS A SG   2  
ATOM 1076  H H    . CYS A 1 20 ? -8.001  -4.387  3.653   1.00 0.00 ? 20 CYS A H    2  
ATOM 1077  H HA   . CYS A 1 20 ? -8.570  -5.453  0.928   1.00 0.00 ? 20 CYS A HA   2  
ATOM 1078  H HB2  . CYS A 1 20 ? -7.302  -6.833  3.197   1.00 0.00 ? 20 CYS A HB2  2  
ATOM 1079  H HB3  . CYS A 1 20 ? -8.671  -7.699  2.501   1.00 0.00 ? 20 CYS A HB3  2  
ATOM 1080  N N    . ASN A 1 21 ? -10.951 -6.074  1.612   1.00 0.00 ? 21 ASN A N    2  
ATOM 1081  C CA   . ASN A 1 21 ? -12.386 -6.136  2.013   1.00 0.00 ? 21 ASN A CA   2  
ATOM 1082  C C    . ASN A 1 21 ? -12.737 -7.564  2.434   1.00 0.00 ? 21 ASN A C    2  
ATOM 1083  O O    . ASN A 1 21 ? -13.623 -8.138  1.825   1.00 0.00 ? 21 ASN A O    2  
ATOM 1084  C CB   . ASN A 1 21 ? -13.264 -5.721  0.829   1.00 0.00 ? 21 ASN A CB   2  
ATOM 1085  C CG   . ASN A 1 21 ? -13.341 -4.194  0.762   1.00 0.00 ? 21 ASN A CG   2  
ATOM 1086  O OD1  . ASN A 1 21 ? -12.608 -3.568  0.023   1.00 0.00 ? 21 ASN A OD1  2  
ATOM 1087  N ND2  . ASN A 1 21 ? -14.208 -3.566  1.510   1.00 0.00 ? 21 ASN A ND2  2  
ATOM 1088  O OXT  . ASN A 1 21 ? -12.115 -8.057  3.361   1.00 0.00 ? 21 ASN A OXT  2  
ATOM 1089  H H    . ASN A 1 21 ? -10.683 -6.344  0.710   1.00 0.00 ? 21 ASN A H    2  
ATOM 1090  H HA   . ASN A 1 21 ? -12.558 -5.463  2.841   1.00 0.00 ? 21 ASN A HA   2  
ATOM 1091  H HB2  . ASN A 1 21 ? -12.835 -6.101  -0.087  1.00 0.00 ? 21 ASN A HB2  2  
ATOM 1092  H HB3  . ASN A 1 21 ? -14.257 -6.125  0.957   1.00 0.00 ? 21 ASN A HB3  2  
ATOM 1093  H HD21 . ASN A 1 21 ? -14.801 -4.071  2.106   1.00 0.00 ? 21 ASN A HD21 2  
ATOM 1094  H HD22 . ASN A 1 21 ? -14.265 -2.588  1.474   1.00 0.00 ? 21 ASN A HD22 2  
ATOM 1095  N N    . PHE B 2 1  ? 6.181   -10.482 -4.275  1.00 0.00 ? 1  PHE B N    2  
ATOM 1096  C CA   . PHE B 2 1  ? 6.151   -9.241  -3.453  1.00 0.00 ? 1  PHE B CA   2  
ATOM 1097  C C    . PHE B 2 1  ? 7.479   -8.492  -3.619  1.00 0.00 ? 1  PHE B C    2  
ATOM 1098  O O    . PHE B 2 1  ? 8.461   -9.053  -4.063  1.00 0.00 ? 1  PHE B O    2  
ATOM 1099  C CB   . PHE B 2 1  ? 5.932   -9.613  -1.975  1.00 0.00 ? 1  PHE B CB   2  
ATOM 1100  C CG   . PHE B 2 1  ? 7.248   -9.994  -1.331  1.00 0.00 ? 1  PHE B CG   2  
ATOM 1101  C CD1  . PHE B 2 1  ? 8.214   -10.688 -2.072  1.00 0.00 ? 1  PHE B CD1  2  
ATOM 1102  C CD2  . PHE B 2 1  ? 7.504   -9.645  0.000   1.00 0.00 ? 1  PHE B CD2  2  
ATOM 1103  C CE1  . PHE B 2 1  ? 9.434   -11.031 -1.482  1.00 0.00 ? 1  PHE B CE1  2  
ATOM 1104  C CE2  . PHE B 2 1  ? 8.726   -9.987  0.589   1.00 0.00 ? 1  PHE B CE2  2  
ATOM 1105  C CZ   . PHE B 2 1  ? 9.692   -10.680 -0.151  1.00 0.00 ? 1  PHE B CZ   2  
ATOM 1106  H H1   . PHE B 2 1  ? 7.122   -10.588 -4.708  1.00 0.00 ? 1  PHE B H1   2  
ATOM 1107  H H2   . PHE B 2 1  ? 5.982   -11.304 -3.670  1.00 0.00 ? 1  PHE B H2   2  
ATOM 1108  H H3   . PHE B 2 1  ? 5.459   -10.422 -5.021  1.00 0.00 ? 1  PHE B H3   2  
ATOM 1109  H HA   . PHE B 2 1  ? 5.341   -8.609  -3.787  1.00 0.00 ? 1  PHE B HA   2  
ATOM 1110  H HB2  . PHE B 2 1  ? 5.511   -8.767  -1.454  1.00 0.00 ? 1  PHE B HB2  2  
ATOM 1111  H HB3  . PHE B 2 1  ? 5.250   -10.449 -1.916  1.00 0.00 ? 1  PHE B HB3  2  
ATOM 1112  H HD1  . PHE B 2 1  ? 8.016   -10.960 -3.097  1.00 0.00 ? 1  PHE B HD1  2  
ATOM 1113  H HD2  . PHE B 2 1  ? 6.760   -9.109  0.569   1.00 0.00 ? 1  PHE B HD2  2  
ATOM 1114  H HE1  . PHE B 2 1  ? 10.179  -11.562 -2.055  1.00 0.00 ? 1  PHE B HE1  2  
ATOM 1115  H HE2  . PHE B 2 1  ? 8.924   -9.717  1.616   1.00 0.00 ? 1  PHE B HE2  2  
ATOM 1116  H HZ   . PHE B 2 1  ? 10.634  -10.945 0.306   1.00 0.00 ? 1  PHE B HZ   2  
ATOM 1117  N N    . VAL B 2 2  ? 7.523   -7.242  -3.258  1.00 0.00 ? 2  VAL B N    2  
ATOM 1118  C CA   . VAL B 2 2  ? 8.796   -6.477  -3.390  1.00 0.00 ? 2  VAL B CA   2  
ATOM 1119  C C    . VAL B 2 2  ? 8.767   -5.271  -2.451  1.00 0.00 ? 2  VAL B C    2  
ATOM 1120  O O    . VAL B 2 2  ? 7.950   -4.383  -2.589  1.00 0.00 ? 2  VAL B O    2  
ATOM 1121  C CB   . VAL B 2 2  ? 8.962   -6.002  -4.834  1.00 0.00 ? 2  VAL B CB   2  
ATOM 1122  C CG1  . VAL B 2 2  ? 10.246  -5.177  -4.955  1.00 0.00 ? 2  VAL B CG1  2  
ATOM 1123  C CG2  . VAL B 2 2  ? 9.051   -7.219  -5.758  1.00 0.00 ? 2  VAL B CG2  2  
ATOM 1124  H H    . VAL B 2 2  ? 6.724   -6.807  -2.893  1.00 0.00 ? 2  VAL B H    2  
ATOM 1125  H HA   . VAL B 2 2  ? 9.625   -7.117  -3.126  1.00 0.00 ? 2  VAL B HA   2  
ATOM 1126  H HB   . VAL B 2 2  ? 8.115   -5.394  -5.115  1.00 0.00 ? 2  VAL B HB   2  
ATOM 1127  H HG11 . VAL B 2 2  ? 10.986  -5.561  -4.270  1.00 0.00 ? 2  VAL B HG11 2  
ATOM 1128  H HG12 . VAL B 2 2  ? 10.622  -5.242  -5.965  1.00 0.00 ? 2  VAL B HG12 2  
ATOM 1129  H HG13 . VAL B 2 2  ? 10.035  -4.146  -4.716  1.00 0.00 ? 2  VAL B HG13 2  
ATOM 1130  H HG21 . VAL B 2 2  ? 9.720   -7.952  -5.326  1.00 0.00 ? 2  VAL B HG21 2  
ATOM 1131  H HG22 . VAL B 2 2  ? 8.070   -7.653  -5.876  1.00 0.00 ? 2  VAL B HG22 2  
ATOM 1132  H HG23 . VAL B 2 2  ? 9.428   -6.912  -6.723  1.00 0.00 ? 2  VAL B HG23 2  
ATOM 1133  N N    . ASN B 2 3  ? 9.652   -5.237  -1.493  1.00 0.00 ? 3  ASN B N    2  
ATOM 1134  C CA   . ASN B 2 3  ? 9.677   -4.094  -0.539  1.00 0.00 ? 3  ASN B CA   2  
ATOM 1135  C C    . ASN B 2 3  ? 10.202  -2.846  -1.251  1.00 0.00 ? 3  ASN B C    2  
ATOM 1136  O O    . ASN B 2 3  ? 11.368  -2.754  -1.586  1.00 0.00 ? 3  ASN B O    2  
ATOM 1137  C CB   . ASN B 2 3  ? 10.594  -4.434  0.639   1.00 0.00 ? 3  ASN B CB   2  
ATOM 1138  C CG   . ASN B 2 3  ? 9.935   -5.511  1.505   1.00 0.00 ? 3  ASN B CG   2  
ATOM 1139  O OD1  . ASN B 2 3  ? 8.998   -5.237  2.227   1.00 0.00 ? 3  ASN B OD1  2  
ATOM 1140  N ND2  . ASN B 2 3  ? 10.392  -6.733  1.463   1.00 0.00 ? 3  ASN B ND2  2  
ATOM 1141  H H    . ASN B 2 3  ? 10.300  -5.967  -1.398  1.00 0.00 ? 3  ASN B H    2  
ATOM 1142  H HA   . ASN B 2 3  ? 8.677   -3.907  -0.175  1.00 0.00 ? 3  ASN B HA   2  
ATOM 1143  H HB2  . ASN B 2 3  ? 11.539  -4.799  0.266   1.00 0.00 ? 3  ASN B HB2  2  
ATOM 1144  H HB3  . ASN B 2 3  ? 10.758  -3.548  1.235   1.00 0.00 ? 3  ASN B HB3  2  
ATOM 1145  H HD21 . ASN B 2 3  ? 11.147  -6.955  0.880   1.00 0.00 ? 3  ASN B HD21 2  
ATOM 1146  H HD22 . ASN B 2 3  ? 9.977   -7.430  2.013   1.00 0.00 ? 3  ASN B HD22 2  
ATOM 1147  N N    . GLN B 2 4  ? 9.352   -1.885  -1.484  1.00 0.00 ? 4  GLN B N    2  
ATOM 1148  C CA   . GLN B 2 4  ? 9.802   -0.644  -2.174  1.00 0.00 ? 4  GLN B CA   2  
ATOM 1149  C C    . GLN B 2 4  ? 9.006   0.547   -1.641  1.00 0.00 ? 4  GLN B C    2  
ATOM 1150  O O    . GLN B 2 4  ? 7.910   0.399   -1.138  1.00 0.00 ? 4  GLN B O    2  
ATOM 1151  C CB   . GLN B 2 4  ? 9.569   -0.783  -3.679  1.00 0.00 ? 4  GLN B CB   2  
ATOM 1152  C CG   . GLN B 2 4  ? 10.247  0.376   -4.411  1.00 0.00 ? 4  GLN B CG   2  
ATOM 1153  C CD   . GLN B 2 4  ? 10.765  -0.108  -5.765  1.00 0.00 ? 4  GLN B CD   2  
ATOM 1154  O OE1  . GLN B 2 4  ? 10.187  -0.986  -6.373  1.00 0.00 ? 4  GLN B OE1  2  
ATOM 1155  N NE2  . GLN B 2 4  ? 11.843  0.431   -6.267  1.00 0.00 ? 4  GLN B NE2  2  
ATOM 1156  H H    . GLN B 2 4  ? 8.419   -1.980  -1.205  1.00 0.00 ? 4  GLN B H    2  
ATOM 1157  H HA   . GLN B 2 4  ? 10.855  -0.487  -1.985  1.00 0.00 ? 4  GLN B HA   2  
ATOM 1158  H HB2  . GLN B 2 4  ? 9.984   -1.720  -4.023  1.00 0.00 ? 4  GLN B HB2  2  
ATOM 1159  H HB3  . GLN B 2 4  ? 8.507   -0.764  -3.882  1.00 0.00 ? 4  GLN B HB3  2  
ATOM 1160  H HG2  . GLN B 2 4  ? 9.531   1.173   -4.562  1.00 0.00 ? 4  GLN B HG2  2  
ATOM 1161  H HG3  . GLN B 2 4  ? 11.072  0.742   -3.820  1.00 0.00 ? 4  GLN B HG3  2  
ATOM 1162  H HE21 . GLN B 2 4  ? 12.311  1.141   -5.777  1.00 0.00 ? 4  GLN B HE21 2  
ATOM 1163  H HE22 . GLN B 2 4  ? 12.185  0.128   -7.133  1.00 0.00 ? 4  GLN B HE22 2  
ATOM 1164  N N    . HIS B 2 5  ? 9.547   1.730   -1.747  1.00 0.00 ? 5  HIS B N    2  
ATOM 1165  C CA   . HIS B 2 5  ? 8.817   2.928   -1.245  1.00 0.00 ? 5  HIS B CA   2  
ATOM 1166  C C    . HIS B 2 5  ? 7.487   3.059   -1.988  1.00 0.00 ? 5  HIS B C    2  
ATOM 1167  O O    . HIS B 2 5  ? 7.439   3.059   -3.202  1.00 0.00 ? 5  HIS B O    2  
ATOM 1168  C CB   . HIS B 2 5  ? 9.660   4.181   -1.486  1.00 0.00 ? 5  HIS B CB   2  
ATOM 1169  C CG   . HIS B 2 5  ? 10.940  4.080   -0.703  1.00 0.00 ? 5  HIS B CG   2  
ATOM 1170  N ND1  . HIS B 2 5  ? 10.966  3.656   0.617   1.00 0.00 ? 5  HIS B ND1  2  
ATOM 1171  C CD2  . HIS B 2 5  ? 12.245  4.338   -1.041  1.00 0.00 ? 5  HIS B CD2  2  
ATOM 1172  C CE1  . HIS B 2 5  ? 12.251  3.672   1.021   1.00 0.00 ? 5  HIS B CE1  2  
ATOM 1173  N NE2  . HIS B 2 5  ? 13.071  4.080   0.049   1.00 0.00 ? 5  HIS B NE2  2  
ATOM 1174  H H    . HIS B 2 5  ? 10.432  1.831   -2.156  1.00 0.00 ? 5  HIS B H    2  
ATOM 1175  H HA   . HIS B 2 5  ? 8.629   2.819   -0.188  1.00 0.00 ? 5  HIS B HA   2  
ATOM 1176  H HB2  . HIS B 2 5  ? 9.887   4.267   -2.538  1.00 0.00 ? 5  HIS B HB2  2  
ATOM 1177  H HB3  . HIS B 2 5  ? 9.110   5.052   -1.164  1.00 0.00 ? 5  HIS B HB3  2  
ATOM 1178  H HD1  . HIS B 2 5  ? 10.192  3.394   1.157   1.00 0.00 ? 5  HIS B HD1  2  
ATOM 1179  H HD2  . HIS B 2 5  ? 12.580  4.688   -2.006  1.00 0.00 ? 5  HIS B HD2  2  
ATOM 1180  H HE1  . HIS B 2 5  ? 12.577  3.389   2.011   1.00 0.00 ? 5  HIS B HE1  2  
ATOM 1181  N N    . LEU B 2 6  ? 6.406   3.164   -1.266  1.00 0.00 ? 6  LEU B N    2  
ATOM 1182  C CA   . LEU B 2 6  ? 5.077   3.290   -1.929  1.00 0.00 ? 6  LEU B CA   2  
ATOM 1183  C C    . LEU B 2 6  ? 4.623   4.750   -1.889  1.00 0.00 ? 6  LEU B C    2  
ATOM 1184  O O    . LEU B 2 6  ? 4.008   5.191   -0.939  1.00 0.00 ? 6  LEU B O    2  
ATOM 1185  C CB   . LEU B 2 6  ? 4.060   2.421   -1.189  1.00 0.00 ? 6  LEU B CB   2  
ATOM 1186  C CG   . LEU B 2 6  ? 4.634   1.018   -0.989  1.00 0.00 ? 6  LEU B CG   2  
ATOM 1187  C CD1  . LEU B 2 6  ? 3.774   0.252   0.017   1.00 0.00 ? 6  LEU B CD1  2  
ATOM 1188  C CD2  . LEU B 2 6  ? 4.637   0.275   -2.325  1.00 0.00 ? 6  LEU B CD2  2  
ATOM 1189  H H    . LEU B 2 6  ? 6.467   3.159   -0.289  1.00 0.00 ? 6  LEU B H    2  
ATOM 1190  H HA   . LEU B 2 6  ? 5.153   2.963   -2.955  1.00 0.00 ? 6  LEU B HA   2  
ATOM 1191  H HB2  . LEU B 2 6  ? 3.844   2.860   -0.228  1.00 0.00 ? 6  LEU B HB2  2  
ATOM 1192  H HB3  . LEU B 2 6  ? 3.154   2.357   -1.767  1.00 0.00 ? 6  LEU B HB3  2  
ATOM 1193  H HG   . LEU B 2 6  ? 5.644   1.093   -0.614  1.00 0.00 ? 6  LEU B HG   2  
ATOM 1194  H HD11 . LEU B 2 6  ? 3.649   0.845   0.910   1.00 0.00 ? 6  LEU B HD11 2  
ATOM 1195  H HD12 . LEU B 2 6  ? 2.806   0.049   -0.418  1.00 0.00 ? 6  LEU B HD12 2  
ATOM 1196  H HD13 . LEU B 2 6  ? 4.258   -0.680  0.268   1.00 0.00 ? 6  LEU B HD13 2  
ATOM 1197  H HD21 . LEU B 2 6  ? 4.994   0.933   -3.103  1.00 0.00 ? 6  LEU B HD21 2  
ATOM 1198  H HD22 . LEU B 2 6  ? 5.282   -0.588  -2.257  1.00 0.00 ? 6  LEU B HD22 2  
ATOM 1199  H HD23 . LEU B 2 6  ? 3.633   -0.046  -2.560  1.00 0.00 ? 6  LEU B HD23 2  
ATOM 1200  N N    . CYS B 2 7  ? 4.923   5.505   -2.911  1.00 0.00 ? 7  CYS B N    2  
ATOM 1201  C CA   . CYS B 2 7  ? 4.509   6.936   -2.924  1.00 0.00 ? 7  CYS B CA   2  
ATOM 1202  C C    . CYS B 2 7  ? 3.523   7.180   -4.068  1.00 0.00 ? 7  CYS B C    2  
ATOM 1203  O O    . CYS B 2 7  ? 3.513   6.474   -5.054  1.00 0.00 ? 7  CYS B O    2  
ATOM 1204  C CB   . CYS B 2 7  ? 5.742   7.819   -3.120  1.00 0.00 ? 7  CYS B CB   2  
ATOM 1205  S SG   . CYS B 2 7  ? 6.812   7.688   -1.668  1.00 0.00 ? 7  CYS B SG   2  
ATOM 1206  H H    . CYS B 2 7  ? 5.422   5.132   -3.667  1.00 0.00 ? 7  CYS B H    2  
ATOM 1207  H HA   . CYS B 2 7  ? 4.036   7.182   -1.985  1.00 0.00 ? 7  CYS B HA   2  
ATOM 1208  H HB2  . CYS B 2 7  ? 6.282   7.494   -3.997  1.00 0.00 ? 7  CYS B HB2  2  
ATOM 1209  H HB3  . CYS B 2 7  ? 5.433   8.846   -3.249  1.00 0.00 ? 7  CYS B HB3  2  
ATOM 1210  N N    . GLY B 2 8  ? 2.694   8.181   -3.943  1.00 0.00 ? 8  GLY B N    2  
ATOM 1211  C CA   . GLY B 2 8  ? 1.710   8.473   -5.023  1.00 0.00 ? 8  GLY B CA   2  
ATOM 1212  C C    . GLY B 2 8  ? 0.735   7.305   -5.159  1.00 0.00 ? 8  GLY B C    2  
ATOM 1213  O O    . GLY B 2 8  ? 0.174   6.836   -4.190  1.00 0.00 ? 8  GLY B O    2  
ATOM 1214  H H    . GLY B 2 8  ? 2.719   8.741   -3.138  1.00 0.00 ? 8  GLY B H    2  
ATOM 1215  H HA2  . GLY B 2 8  ? 1.165   9.373   -4.777  1.00 0.00 ? 8  GLY B HA2  2  
ATOM 1216  H HA3  . GLY B 2 8  ? 2.233   8.612   -5.957  1.00 0.00 ? 8  GLY B HA3  2  
ATOM 1217  N N    . SER B 2 9  ? 0.528   6.831   -6.357  1.00 0.00 ? 9  SER B N    2  
ATOM 1218  C CA   . SER B 2 9  ? -0.412  5.693   -6.554  1.00 0.00 ? 9  SER B CA   2  
ATOM 1219  C C    . SER B 2 9  ? 0.351   4.371   -6.438  1.00 0.00 ? 9  SER B C    2  
ATOM 1220  O O    . SER B 2 9  ? -0.229  3.304   -6.487  1.00 0.00 ? 9  SER B O    2  
ATOM 1221  C CB   . SER B 2 9  ? -1.050  5.793   -7.940  1.00 0.00 ? 9  SER B CB   2  
ATOM 1222  O OG   . SER B 2 9  ? -1.230  7.163   -8.276  1.00 0.00 ? 9  SER B OG   2  
ATOM 1223  H H    . SER B 2 9  ? 0.991   7.224   -7.127  1.00 0.00 ? 9  SER B H    2  
ATOM 1224  H HA   . SER B 2 9  ? -1.184  5.730   -5.800  1.00 0.00 ? 9  SER B HA   2  
ATOM 1225  H HB2  . SER B 2 9  ? -0.403  5.333   -8.670  1.00 0.00 ? 9  SER B HB2  2  
ATOM 1226  H HB3  . SER B 2 9  ? -2.004  5.284   -7.935  1.00 0.00 ? 9  SER B HB3  2  
ATOM 1227  H HG   . SER B 2 9  ? -1.823  7.207   -9.031  1.00 0.00 ? 9  SER B HG   2  
ATOM 1228  N N    . HIS B 2 10 ? 1.647   4.431   -6.288  1.00 0.00 ? 10 HIS B N    2  
ATOM 1229  C CA   . HIS B 2 10 ? 2.437   3.174   -6.171  1.00 0.00 ? 10 HIS B CA   2  
ATOM 1230  C C    . HIS B 2 10 ? 1.918   2.355   -4.987  1.00 0.00 ? 10 HIS B C    2  
ATOM 1231  O O    . HIS B 2 10 ? 1.927   1.142   -5.010  1.00 0.00 ? 10 HIS B O    2  
ATOM 1232  C CB   . HIS B 2 10 ? 3.912   3.513   -5.947  1.00 0.00 ? 10 HIS B CB   2  
ATOM 1233  C CG   . HIS B 2 10 ? 4.621   3.557   -7.273  1.00 0.00 ? 10 HIS B CG   2  
ATOM 1234  N ND1  . HIS B 2 10 ? 3.937   3.620   -8.476  1.00 0.00 ? 10 HIS B ND1  2  
ATOM 1235  C CD2  . HIS B 2 10 ? 5.954   3.543   -7.597  1.00 0.00 ? 10 HIS B CD2  2  
ATOM 1236  C CE1  . HIS B 2 10 ? 4.855   3.644   -9.460  1.00 0.00 ? 10 HIS B CE1  2  
ATOM 1237  N NE2  . HIS B 2 10 ? 6.099   3.599   -8.980  1.00 0.00 ? 10 HIS B NE2  2  
ATOM 1238  H H    . HIS B 2 10 ? 2.097   5.299   -6.252  1.00 0.00 ? 10 HIS B H    2  
ATOM 1239  H HA   . HIS B 2 10 ? 2.333   2.598   -7.078  1.00 0.00 ? 10 HIS B HA   2  
ATOM 1240  H HB2  . HIS B 2 10 ? 3.991   4.476   -5.464  1.00 0.00 ? 10 HIS B HB2  2  
ATOM 1241  H HB3  . HIS B 2 10 ? 4.363   2.758   -5.320  1.00 0.00 ? 10 HIS B HB3  2  
ATOM 1242  H HD1  . HIS B 2 10 ? 2.965   3.645   -8.589  1.00 0.00 ? 10 HIS B HD1  2  
ATOM 1243  H HD2  . HIS B 2 10 ? 6.769   3.498   -6.889  1.00 0.00 ? 10 HIS B HD2  2  
ATOM 1244  H HE1  . HIS B 2 10 ? 4.613   3.693   -10.512 1.00 0.00 ? 10 HIS B HE1  2  
ATOM 1245  N N    . LEU B 2 11 ? 1.462   3.009   -3.952  1.00 0.00 ? 11 LEU B N    2  
ATOM 1246  C CA   . LEU B 2 11 ? 0.943   2.258   -2.777  1.00 0.00 ? 11 LEU B CA   2  
ATOM 1247  C C    . LEU B 2 11 ? -0.354  1.549   -3.161  1.00 0.00 ? 11 LEU B C    2  
ATOM 1248  O O    . LEU B 2 11 ? -0.587  0.420   -2.781  1.00 0.00 ? 11 LEU B O    2  
ATOM 1249  C CB   . LEU B 2 11 ? 0.682   3.220   -1.617  1.00 0.00 ? 11 LEU B CB   2  
ATOM 1250  C CG   . LEU B 2 11 ? 1.028   2.523   -0.302  1.00 0.00 ? 11 LEU B CG   2  
ATOM 1251  C CD1  . LEU B 2 11 ? 1.545   3.548   0.707   1.00 0.00 ? 11 LEU B CD1  2  
ATOM 1252  C CD2  . LEU B 2 11 ? -0.225  1.840   0.257   1.00 0.00 ? 11 LEU B CD2  2  
ATOM 1253  H H    . LEU B 2 11 ? 1.460   3.990   -3.950  1.00 0.00 ? 11 LEU B H    2  
ATOM 1254  H HA   . LEU B 2 11 ? 1.672   1.522   -2.473  1.00 0.00 ? 11 LEU B HA   2  
ATOM 1255  H HB2  . LEU B 2 11 ? 1.296   4.102   -1.734  1.00 0.00 ? 11 LEU B HB2  2  
ATOM 1256  H HB3  . LEU B 2 11 ? -0.361  3.504   -1.609  1.00 0.00 ? 11 LEU B HB3  2  
ATOM 1257  H HG   . LEU B 2 11 ? 1.791   1.781   -0.480  1.00 0.00 ? 11 LEU B HG   2  
ATOM 1258  H HD11 . LEU B 2 11 ? 2.330   4.138   0.255   1.00 0.00 ? 11 LEU B HD11 2  
ATOM 1259  H HD12 . LEU B 2 11 ? 0.739   4.197   1.011   1.00 0.00 ? 11 LEU B HD12 2  
ATOM 1260  H HD13 . LEU B 2 11 ? 1.936   3.032   1.570   1.00 0.00 ? 11 LEU B HD13 2  
ATOM 1261  H HD21 . LEU B 2 11 ? -1.094  2.444   0.037   1.00 0.00 ? 11 LEU B HD21 2  
ATOM 1262  H HD22 . LEU B 2 11 ? -0.339  0.866   -0.199  1.00 0.00 ? 11 LEU B HD22 2  
ATOM 1263  H HD23 . LEU B 2 11 ? -0.127  1.726   1.328   1.00 0.00 ? 11 LEU B HD23 2  
ATOM 1264  N N    . VAL B 2 12 ? -1.197  2.191   -3.921  1.00 0.00 ? 12 VAL B N    2  
ATOM 1265  C CA   . VAL B 2 12 ? -2.464  1.529   -4.333  1.00 0.00 ? 12 VAL B CA   2  
ATOM 1266  C C    . VAL B 2 12 ? -2.116  0.309   -5.185  1.00 0.00 ? 12 VAL B C    2  
ATOM 1267  O O    . VAL B 2 12 ? -2.872  -0.636  -5.277  1.00 0.00 ? 12 VAL B O    2  
ATOM 1268  C CB   . VAL B 2 12 ? -3.322  2.500   -5.145  1.00 0.00 ? 12 VAL B CB   2  
ATOM 1269  C CG1  . VAL B 2 12 ? -4.539  1.759   -5.704  1.00 0.00 ? 12 VAL B CG1  2  
ATOM 1270  C CG2  . VAL B 2 12 ? -3.796  3.636   -4.236  1.00 0.00 ? 12 VAL B CG2  2  
ATOM 1271  H H    . VAL B 2 12 ? -0.993  3.099   -4.229  1.00 0.00 ? 12 VAL B H    2  
ATOM 1272  H HA   . VAL B 2 12 ? -3.007  1.212   -3.454  1.00 0.00 ? 12 VAL B HA   2  
ATOM 1273  H HB   . VAL B 2 12 ? -2.739  2.904   -5.958  1.00 0.00 ? 12 VAL B HB   2  
ATOM 1274  H HG11 . VAL B 2 12 ? -4.843  0.989   -5.009  1.00 0.00 ? 12 VAL B HG11 2  
ATOM 1275  H HG12 . VAL B 2 12 ? -5.350  2.457   -5.846  1.00 0.00 ? 12 VAL B HG12 2  
ATOM 1276  H HG13 . VAL B 2 12 ? -4.282  1.309   -6.652  1.00 0.00 ? 12 VAL B HG13 2  
ATOM 1277  H HG21 . VAL B 2 12 ? -3.835  3.288   -3.213  1.00 0.00 ? 12 VAL B HG21 2  
ATOM 1278  H HG22 . VAL B 2 12 ? -3.109  4.466   -4.307  1.00 0.00 ? 12 VAL B HG22 2  
ATOM 1279  H HG23 . VAL B 2 12 ? -4.781  3.957   -4.544  1.00 0.00 ? 12 VAL B HG23 2  
ATOM 1280  N N    . GLU B 2 13 ? -0.961  0.321   -5.799  1.00 0.00 ? 13 GLU B N    2  
ATOM 1281  C CA   . GLU B 2 13 ? -0.545  -0.839  -6.632  1.00 0.00 ? 13 GLU B CA   2  
ATOM 1282  C C    . GLU B 2 13 ? -0.177  -2.001  -5.709  1.00 0.00 ? 13 GLU B C    2  
ATOM 1283  O O    . GLU B 2 13 ? -0.292  -3.156  -6.066  1.00 0.00 ? 13 GLU B O    2  
ATOM 1284  C CB   . GLU B 2 13 ? 0.668   -0.452  -7.478  1.00 0.00 ? 13 GLU B CB   2  
ATOM 1285  C CG   . GLU B 2 13 ? 0.287   0.676   -8.438  1.00 0.00 ? 13 GLU B CG   2  
ATOM 1286  C CD   . GLU B 2 13 ? 0.032   0.097   -9.831  1.00 0.00 ? 13 GLU B CD   2  
ATOM 1287  O OE1  . GLU B 2 13 ? -1.087  -0.315  -10.084 1.00 0.00 ? 13 GLU B OE1  2  
ATOM 1288  O OE2  . GLU B 2 13 ? 0.963   0.076   -10.620 1.00 0.00 ? 13 GLU B OE2  2  
ATOM 1289  H H    . GLU B 2 13 ? -0.362  1.089   -5.699  1.00 0.00 ? 13 GLU B H    2  
ATOM 1290  H HA   . GLU B 2 13 ? -1.359  -1.134  -7.278  1.00 0.00 ? 13 GLU B HA   2  
ATOM 1291  H HB2  . GLU B 2 13 ? 1.466   -0.118  -6.827  1.00 0.00 ? 13 GLU B HB2  2  
ATOM 1292  H HB3  . GLU B 2 13 ? 1.003   -1.307  -8.045  1.00 0.00 ? 13 GLU B HB3  2  
ATOM 1293  H HG2  . GLU B 2 13 ? -0.610  1.164   -8.081  1.00 0.00 ? 13 GLU B HG2  2  
ATOM 1294  H HG3  . GLU B 2 13 ? 1.091   1.394   -8.489  1.00 0.00 ? 13 GLU B HG3  2  
ATOM 1295  N N    . ALA B 2 14 ? 0.255   -1.698  -4.515  1.00 0.00 ? 14 ALA B N    2  
ATOM 1296  C CA   . ALA B 2 14 ? 0.618   -2.776  -3.556  1.00 0.00 ? 14 ALA B CA   2  
ATOM 1297  C C    . ALA B 2 14 ? -0.597  -3.082  -2.679  1.00 0.00 ? 14 ALA B C    2  
ATOM 1298  O O    . ALA B 2 14 ? -0.657  -4.096  -2.011  1.00 0.00 ? 14 ALA B O    2  
ATOM 1299  C CB   . ALA B 2 14 ? 1.784   -2.314  -2.678  1.00 0.00 ? 14 ALA B CB   2  
ATOM 1300  H H    . ALA B 2 14 ? 0.331   -0.760  -4.245  1.00 0.00 ? 14 ALA B H    2  
ATOM 1301  H HA   . ALA B 2 14 ? 0.903   -3.665  -4.100  1.00 0.00 ? 14 ALA B HA   2  
ATOM 1302  H HB1  . ALA B 2 14 ? 1.690   -1.256  -2.484  1.00 0.00 ? 14 ALA B HB1  2  
ATOM 1303  H HB2  . ALA B 2 14 ? 1.766   -2.854  -1.743  1.00 0.00 ? 14 ALA B HB2  2  
ATOM 1304  H HB3  . ALA B 2 14 ? 2.715   -2.506  -3.188  1.00 0.00 ? 14 ALA B HB3  2  
ATOM 1305  N N    . LEU B 2 15 ? -1.573  -2.212  -2.684  1.00 0.00 ? 15 LEU B N    2  
ATOM 1306  C CA   . LEU B 2 15 ? -2.790  -2.451  -1.860  1.00 0.00 ? 15 LEU B CA   2  
ATOM 1307  C C    . LEU B 2 15 ? -3.725  -3.394  -2.621  1.00 0.00 ? 15 LEU B C    2  
ATOM 1308  O O    . LEU B 2 15 ? -4.275  -4.321  -2.061  1.00 0.00 ? 15 LEU B O    2  
ATOM 1309  C CB   . LEU B 2 15 ? -3.502  -1.121  -1.592  1.00 0.00 ? 15 LEU B CB   2  
ATOM 1310  C CG   . LEU B 2 15 ? -2.695  -0.300  -0.580  1.00 0.00 ? 15 LEU B CG   2  
ATOM 1311  C CD1  . LEU B 2 15 ? -3.523  0.897   -0.110  1.00 0.00 ? 15 LEU B CD1  2  
ATOM 1312  C CD2  . LEU B 2 15 ? -2.345  -1.176  0.625   1.00 0.00 ? 15 LEU B CD2  2  
ATOM 1313  H H    . LEU B 2 15 ? -1.506  -1.405  -3.235  1.00 0.00 ? 15 LEU B H    2  
ATOM 1314  H HA   . LEU B 2 15 ? -2.506  -2.906  -0.923  1.00 0.00 ? 15 LEU B HA   2  
ATOM 1315  H HB2  . LEU B 2 15 ? -3.590  -0.567  -2.517  1.00 0.00 ? 15 LEU B HB2  2  
ATOM 1316  H HB3  . LEU B 2 15 ? -4.485  -1.312  -1.193  1.00 0.00 ? 15 LEU B HB3  2  
ATOM 1317  H HG   . LEU B 2 15 ? -1.787  0.052   -1.048  1.00 0.00 ? 15 LEU B HG   2  
ATOM 1318  H HD11 . LEU B 2 15 ? -4.559  0.747   -0.377  1.00 0.00 ? 15 LEU B HD11 2  
ATOM 1319  H HD12 . LEU B 2 15 ? -3.438  0.994   0.962   1.00 0.00 ? 15 LEU B HD12 2  
ATOM 1320  H HD13 . LEU B 2 15 ? -3.155  1.795   -0.583  1.00 0.00 ? 15 LEU B HD13 2  
ATOM 1321  H HD21 . LEU B 2 15 ? -3.031  -2.008  0.676   1.00 0.00 ? 15 LEU B HD21 2  
ATOM 1322  H HD22 . LEU B 2 15 ? -1.336  -1.548  0.519   1.00 0.00 ? 15 LEU B HD22 2  
ATOM 1323  H HD23 . LEU B 2 15 ? -2.421  -0.590  1.528   1.00 0.00 ? 15 LEU B HD23 2  
ATOM 1324  N N    . HIS B 2 16 ? -3.902  -3.174  -3.897  1.00 0.00 ? 16 HIS B N    2  
ATOM 1325  C CA   . HIS B 2 16 ? -4.793  -4.070  -4.687  1.00 0.00 ? 16 HIS B CA   2  
ATOM 1326  C C    . HIS B 2 16 ? -4.083  -5.413  -4.884  1.00 0.00 ? 16 HIS B C    2  
ATOM 1327  O O    . HIS B 2 16 ? -4.707  -6.444  -5.049  1.00 0.00 ? 16 HIS B O    2  
ATOM 1328  C CB   . HIS B 2 16 ? -5.106  -3.423  -6.049  1.00 0.00 ? 16 HIS B CB   2  
ATOM 1329  C CG   . HIS B 2 16 ? -4.042  -3.761  -7.063  1.00 0.00 ? 16 HIS B CG   2  
ATOM 1330  N ND1  . HIS B 2 16 ? -4.268  -4.654  -8.098  1.00 0.00 ? 16 HIS B ND1  2  
ATOM 1331  C CD2  . HIS B 2 16 ? -2.749  -3.331  -7.213  1.00 0.00 ? 16 HIS B CD2  2  
ATOM 1332  C CE1  . HIS B 2 16 ? -3.134  -4.732  -8.819  1.00 0.00 ? 16 HIS B CE1  2  
ATOM 1333  N NE2  . HIS B 2 16 ? -2.176  -3.945  -8.323  1.00 0.00 ? 16 HIS B NE2  2  
ATOM 1334  H H    . HIS B 2 16 ? -3.444  -2.426  -4.335  1.00 0.00 ? 16 HIS B H    2  
ATOM 1335  H HA   . HIS B 2 16 ? -5.712  -4.228  -4.144  1.00 0.00 ? 16 HIS B HA   2  
ATOM 1336  H HB2  . HIS B 2 16 ? -6.060  -3.787  -6.403  1.00 0.00 ? 16 HIS B HB2  2  
ATOM 1337  H HB3  . HIS B 2 16 ? -5.157  -2.351  -5.930  1.00 0.00 ? 16 HIS B HB3  2  
ATOM 1338  H HD1  . HIS B 2 16 ? -5.100  -5.140  -8.274  1.00 0.00 ? 16 HIS B HD1  2  
ATOM 1339  H HD2  . HIS B 2 16 ? -2.251  -2.623  -6.568  1.00 0.00 ? 16 HIS B HD2  2  
ATOM 1340  H HE1  . HIS B 2 16 ? -3.013  -5.355  -9.693  1.00 0.00 ? 16 HIS B HE1  2  
ATOM 1341  N N    . LEU B 2 17 ? -2.779  -5.401  -4.863  1.00 0.00 ? 17 LEU B N    2  
ATOM 1342  C CA   . LEU B 2 17 ? -2.012  -6.662  -5.043  1.00 0.00 ? 17 LEU B CA   2  
ATOM 1343  C C    . LEU B 2 17 ? -2.201  -7.551  -3.813  1.00 0.00 ? 17 LEU B C    2  
ATOM 1344  O O    . LEU B 2 17 ? -2.331  -8.754  -3.918  1.00 0.00 ? 17 LEU B O    2  
ATOM 1345  C CB   . LEU B 2 17 ? -0.528  -6.330  -5.211  1.00 0.00 ? 17 LEU B CB   2  
ATOM 1346  C CG   . LEU B 2 17 ? 0.226   -7.564  -5.705  1.00 0.00 ? 17 LEU B CG   2  
ATOM 1347  C CD1  . LEU B 2 17 ? -0.390  -8.049  -7.017  1.00 0.00 ? 17 LEU B CD1  2  
ATOM 1348  C CD2  . LEU B 2 17 ? 1.694   -7.199  -5.935  1.00 0.00 ? 17 LEU B CD2  2  
ATOM 1349  H H    . LEU B 2 17 ? -2.302  -4.556  -4.728  1.00 0.00 ? 17 LEU B H    2  
ATOM 1350  H HA   . LEU B 2 17 ? -2.367  -7.180  -5.923  1.00 0.00 ? 17 LEU B HA   2  
ATOM 1351  H HB2  . LEU B 2 17 ? -0.419  -5.529  -5.929  1.00 0.00 ? 17 LEU B HB2  2  
ATOM 1352  H HB3  . LEU B 2 17 ? -0.122  -6.017  -4.261  1.00 0.00 ? 17 LEU B HB3  2  
ATOM 1353  H HG   . LEU B 2 17 ? 0.159   -8.348  -4.964  1.00 0.00 ? 17 LEU B HG   2  
ATOM 1354  H HD11 . LEU B 2 17 ? -0.673  -7.199  -7.620  1.00 0.00 ? 17 LEU B HD11 2  
ATOM 1355  H HD12 . LEU B 2 17 ? 0.332   -8.647  -7.555  1.00 0.00 ? 17 LEU B HD12 2  
ATOM 1356  H HD13 . LEU B 2 17 ? -1.263  -8.648  -6.807  1.00 0.00 ? 17 LEU B HD13 2  
ATOM 1357  H HD21 . LEU B 2 17 ? 1.787   -6.127  -6.028  1.00 0.00 ? 17 LEU B HD21 2  
ATOM 1358  H HD22 . LEU B 2 17 ? 2.285   -7.539  -5.097  1.00 0.00 ? 17 LEU B HD22 2  
ATOM 1359  H HD23 . LEU B 2 17 ? 2.045   -7.672  -6.839  1.00 0.00 ? 17 LEU B HD23 2  
ATOM 1360  N N    . VAL B 2 18 ? -2.219  -6.968  -2.645  1.00 0.00 ? 18 VAL B N    2  
ATOM 1361  C CA   . VAL B 2 18 ? -2.404  -7.782  -1.412  1.00 0.00 ? 18 VAL B CA   2  
ATOM 1362  C C    . VAL B 2 18 ? -3.766  -8.477  -1.463  1.00 0.00 ? 18 VAL B C    2  
ATOM 1363  O O    . VAL B 2 18 ? -3.926  -9.584  -0.987  1.00 0.00 ? 18 VAL B O    2  
ATOM 1364  C CB   . VAL B 2 18 ? -2.338  -6.874  -0.182  1.00 0.00 ? 18 VAL B CB   2  
ATOM 1365  C CG1  . VAL B 2 18 ? -2.574  -7.707  1.080   1.00 0.00 ? 18 VAL B CG1  2  
ATOM 1366  C CG2  . VAL B 2 18 ? -0.958  -6.216  -0.106  1.00 0.00 ? 18 VAL B CG2  2  
ATOM 1367  H H    . VAL B 2 18 ? -2.114  -5.995  -2.581  1.00 0.00 ? 18 VAL B H    2  
ATOM 1368  H HA   . VAL B 2 18 ? -1.622  -8.525  -1.351  1.00 0.00 ? 18 VAL B HA   2  
ATOM 1369  H HB   . VAL B 2 18 ? -3.099  -6.108  -0.258  1.00 0.00 ? 18 VAL B HB   2  
ATOM 1370  H HG11 . VAL B 2 18 ? -2.639  -8.750  0.812   1.00 0.00 ? 18 VAL B HG11 2  
ATOM 1371  H HG12 . VAL B 2 18 ? -1.753  -7.561  1.766   1.00 0.00 ? 18 VAL B HG12 2  
ATOM 1372  H HG13 . VAL B 2 18 ? -3.496  -7.396  1.549   1.00 0.00 ? 18 VAL B HG13 2  
ATOM 1373  H HG21 . VAL B 2 18 ? -0.577  -6.060  -1.104  1.00 0.00 ? 18 VAL B HG21 2  
ATOM 1374  H HG22 . VAL B 2 18 ? -1.039  -5.265  0.402   1.00 0.00 ? 18 VAL B HG22 2  
ATOM 1375  H HG23 . VAL B 2 18 ? -0.283  -6.858  0.441   1.00 0.00 ? 18 VAL B HG23 2  
ATOM 1376  N N    . CYS B 2 19 ? -4.747  -7.838  -2.041  1.00 0.00 ? 19 CYS B N    2  
ATOM 1377  C CA   . CYS B 2 19 ? -6.094  -8.464  -2.127  1.00 0.00 ? 19 CYS B CA   2  
ATOM 1378  C C    . CYS B 2 19 ? -6.209  -9.251  -3.433  1.00 0.00 ? 19 CYS B C    2  
ATOM 1379  O O    . CYS B 2 19 ? -6.025  -10.452 -3.463  1.00 0.00 ? 19 CYS B O    2  
ATOM 1380  C CB   . CYS B 2 19 ? -7.166  -7.378  -2.098  1.00 0.00 ? 19 CYS B CB   2  
ATOM 1381  S SG   . CYS B 2 19 ? -8.192  -7.582  -0.621  1.00 0.00 ? 19 CYS B SG   2  
ATOM 1382  H H    . CYS B 2 19 ? -4.594  -6.947  -2.421  1.00 0.00 ? 19 CYS B H    2  
ATOM 1383  H HA   . CYS B 2 19 ? -6.241  -9.128  -1.294  1.00 0.00 ? 19 CYS B HA   2  
ATOM 1384  H HB2  . CYS B 2 19 ? -6.695  -6.405  -2.081  1.00 0.00 ? 19 CYS B HB2  2  
ATOM 1385  H HB3  . CYS B 2 19 ? -7.781  -7.467  -2.975  1.00 0.00 ? 19 CYS B HB3  2  
ATOM 1386  N N    . GLY B 2 20 ? -6.514  -8.586  -4.514  1.00 0.00 ? 20 GLY B N    2  
ATOM 1387  C CA   . GLY B 2 20 ? -6.642  -9.299  -5.814  1.00 0.00 ? 20 GLY B CA   2  
ATOM 1388  C C    . GLY B 2 20 ? -7.946  -8.886  -6.496  1.00 0.00 ? 20 GLY B C    2  
ATOM 1389  O O    . GLY B 2 20 ? -8.126  -7.750  -6.885  1.00 0.00 ? 20 GLY B O    2  
ATOM 1390  H H    . GLY B 2 20 ? -6.660  -7.618  -4.468  1.00 0.00 ? 20 GLY B H    2  
ATOM 1391  H HA2  . GLY B 2 20 ? -5.807  -9.045  -6.449  1.00 0.00 ? 20 GLY B HA2  2  
ATOM 1392  H HA3  . GLY B 2 20 ? -6.652  -10.364 -5.643  1.00 0.00 ? 20 GLY B HA3  2  
ATOM 1393  N N    . GLU B 2 21 ? -8.859  -9.806  -6.645  1.00 0.00 ? 21 GLU B N    2  
ATOM 1394  C CA   . GLU B 2 21 ? -10.153 -9.475  -7.304  1.00 0.00 ? 21 GLU B CA   2  
ATOM 1395  C C    . GLU B 2 21 ? -11.116 -8.885  -6.272  1.00 0.00 ? 21 GLU B C    2  
ATOM 1396  O O    . GLU B 2 21 ? -12.012 -8.134  -6.603  1.00 0.00 ? 21 GLU B O    2  
ATOM 1397  C CB   . GLU B 2 21 ? -10.761 -10.745 -7.897  1.00 0.00 ? 21 GLU B CB   2  
ATOM 1398  C CG   . GLU B 2 21 ? -10.911 -10.582 -9.411  1.00 0.00 ? 21 GLU B CG   2  
ATOM 1399  C CD   . GLU B 2 21 ? -11.950 -11.576 -9.933  1.00 0.00 ? 21 GLU B CD   2  
ATOM 1400  O OE1  . GLU B 2 21 ? -13.075 -11.529 -9.464  1.00 0.00 ? 21 GLU B OE1  2  
ATOM 1401  O OE2  . GLU B 2 21 ? -11.603 -12.370 -10.792 1.00 0.00 ? 21 GLU B OE2  2  
ATOM 1402  H H    . GLU B 2 21 ? -8.689  -10.717 -6.325  1.00 0.00 ? 21 GLU B H    2  
ATOM 1403  H HA   . GLU B 2 21 ? -9.984  -8.755  -8.091  1.00 0.00 ? 21 GLU B HA   2  
ATOM 1404  H HB2  . GLU B 2 21 ? -10.116 -11.586 -7.686  1.00 0.00 ? 21 GLU B HB2  2  
ATOM 1405  H HB3  . GLU B 2 21 ? -11.734 -10.918 -7.458  1.00 0.00 ? 21 GLU B HB3  2  
ATOM 1406  H HG2  . GLU B 2 21 ? -11.233 -9.575  -9.634  1.00 0.00 ? 21 GLU B HG2  2  
ATOM 1407  H HG3  . GLU B 2 21 ? -9.963  -10.771 -9.889  1.00 0.00 ? 21 GLU B HG3  2  
ATOM 1408  N N    . ARG B 2 22 ? -10.942 -9.223  -5.025  1.00 0.00 ? 22 ARG B N    2  
ATOM 1409  C CA   . ARG B 2 22 ? -11.849 -8.685  -3.974  1.00 0.00 ? 22 ARG B CA   2  
ATOM 1410  C C    . ARG B 2 22 ? -11.911 -7.160  -4.078  1.00 0.00 ? 22 ARG B C    2  
ATOM 1411  O O    . ARG B 2 22 ? -12.847 -6.603  -4.617  1.00 0.00 ? 22 ARG B O    2  
ATOM 1412  C CB   . ARG B 2 22 ? -11.319 -9.077  -2.593  1.00 0.00 ? 22 ARG B CB   2  
ATOM 1413  C CG   . ARG B 2 22 ? -11.693 -10.530 -2.295  1.00 0.00 ? 22 ARG B CG   2  
ATOM 1414  C CD   . ARG B 2 22 ? -13.214 -10.658 -2.205  1.00 0.00 ? 22 ARG B CD   2  
ATOM 1415  N NE   . ARG B 2 22 ? -13.568 -11.873 -1.417  1.00 0.00 ? 22 ARG B NE   2  
ATOM 1416  C CZ   . ARG B 2 22 ? -14.779 -12.024 -0.954  1.00 0.00 ? 22 ARG B CZ   2  
ATOM 1417  N NH1  . ARG B 2 22 ? -15.684 -11.110 -1.172  1.00 0.00 ? 22 ARG B NH1  2  
ATOM 1418  N NH2  . ARG B 2 22 ? -15.083 -13.092 -0.268  1.00 0.00 ? 22 ARG B NH2  2  
ATOM 1419  H H    . ARG B 2 22 ? -10.215 -9.832  -4.779  1.00 0.00 ? 22 ARG B H    2  
ATOM 1420  H HA   . ARG B 2 22 ? -12.838 -9.096  -4.105  1.00 0.00 ? 22 ARG B HA   2  
ATOM 1421  H HB2  . ARG B 2 22 ? -10.246 -8.969  -2.576  1.00 0.00 ? 22 ARG B HB2  2  
ATOM 1422  H HB3  . ARG B 2 22 ? -11.759 -8.435  -1.847  1.00 0.00 ? 22 ARG B HB3  2  
ATOM 1423  H HG2  . ARG B 2 22 ? -11.324 -11.167 -3.090  1.00 0.00 ? 22 ARG B HG2  2  
ATOM 1424  H HG3  . ARG B 2 22 ? -11.251 -10.831 -1.359  1.00 0.00 ? 22 ARG B HG3  2  
ATOM 1425  H HD2  . ARG B 2 22 ? -13.619 -9.784  -1.716  1.00 0.00 ? 22 ARG B HD2  2  
ATOM 1426  H HD3  . ARG B 2 22 ? -13.630 -10.741 -3.199  1.00 0.00 ? 22 ARG B HD3  2  
ATOM 1427  H HE   . ARG B 2 22 ? -12.890 -12.560 -1.248  1.00 0.00 ? 22 ARG B HE   2  
ATOM 1428  H HH11 . ARG B 2 22 ? -15.455 -10.291 -1.697  1.00 0.00 ? 22 ARG B HH11 2  
ATOM 1429  H HH12 . ARG B 2 22 ? -16.611 -11.228 -0.815  1.00 0.00 ? 22 ARG B HH12 2  
ATOM 1430  H HH21 . ARG B 2 22 ? -14.391 -13.792 -0.098  1.00 0.00 ? 22 ARG B HH21 2  
ATOM 1431  H HH22 . ARG B 2 22 ? -16.011 -13.209 0.087   1.00 0.00 ? 22 ARG B HH22 2  
ATOM 1432  N N    . GLY B 2 23 ? -10.923 -6.480  -3.566  1.00 0.00 ? 23 GLY B N    2  
ATOM 1433  C CA   . GLY B 2 23 ? -10.925 -4.992  -3.634  1.00 0.00 ? 23 GLY B CA   2  
ATOM 1434  C C    . GLY B 2 23 ? -10.190 -4.424  -2.419  1.00 0.00 ? 23 GLY B C    2  
ATOM 1435  O O    . GLY B 2 23 ? -9.645  -5.154  -1.616  1.00 0.00 ? 23 GLY B O    2  
ATOM 1436  H H    . GLY B 2 23 ? -10.178 -6.951  -3.135  1.00 0.00 ? 23 GLY B H    2  
ATOM 1437  H HA2  . GLY B 2 23 ? -10.428 -4.672  -4.540  1.00 0.00 ? 23 GLY B HA2  2  
ATOM 1438  H HA3  . GLY B 2 23 ? -11.942 -4.633  -3.636  1.00 0.00 ? 23 GLY B HA3  2  
ATOM 1439  N N    . PHE B 2 24 ? -10.164 -3.125  -2.278  1.00 0.00 ? 24 PHE B N    2  
ATOM 1440  C CA   . PHE B 2 24 ? -9.460  -2.518  -1.114  1.00 0.00 ? 24 PHE B CA   2  
ATOM 1441  C C    . PHE B 2 24 ? -9.779  -1.024  -1.039  1.00 0.00 ? 24 PHE B C    2  
ATOM 1442  O O    . PHE B 2 24 ? -9.720  -0.316  -2.023  1.00 0.00 ? 24 PHE B O    2  
ATOM 1443  C CB   . PHE B 2 24 ? -7.951  -2.702  -1.283  1.00 0.00 ? 24 PHE B CB   2  
ATOM 1444  C CG   . PHE B 2 24 ? -7.506  -2.012  -2.545  1.00 0.00 ? 24 PHE B CG   2  
ATOM 1445  C CD1  . PHE B 2 24 ? -7.660  -2.652  -3.776  1.00 0.00 ? 24 PHE B CD1  2  
ATOM 1446  C CD2  . PHE B 2 24 ? -6.941  -0.731  -2.486  1.00 0.00 ? 24 PHE B CD2  2  
ATOM 1447  C CE1  . PHE B 2 24 ? -7.254  -2.014  -4.953  1.00 0.00 ? 24 PHE B CE1  2  
ATOM 1448  C CE2  . PHE B 2 24 ? -6.534  -0.092  -3.663  1.00 0.00 ? 24 PHE B CE2  2  
ATOM 1449  C CZ   . PHE B 2 24 ? -6.691  -0.735  -4.897  1.00 0.00 ? 24 PHE B CZ   2  
ATOM 1450  H H    . PHE B 2 24 ? -10.608 -2.552  -2.937  1.00 0.00 ? 24 PHE B H    2  
ATOM 1451  H HA   . PHE B 2 24 ? -9.782  -3.003  -0.203  1.00 0.00 ? 24 PHE B HA   2  
ATOM 1452  H HB2  . PHE B 2 24 ? -7.437  -2.274  -0.437  1.00 0.00 ? 24 PHE B HB2  2  
ATOM 1453  H HB3  . PHE B 2 24 ? -7.723  -3.755  -1.354  1.00 0.00 ? 24 PHE B HB3  2  
ATOM 1454  H HD1  . PHE B 2 24 ? -8.094  -3.639  -3.816  1.00 0.00 ? 24 PHE B HD1  2  
ATOM 1455  H HD2  . PHE B 2 24 ? -6.820  -0.237  -1.535  1.00 0.00 ? 24 PHE B HD2  2  
ATOM 1456  H HE1  . PHE B 2 24 ? -7.374  -2.510  -5.904  1.00 0.00 ? 24 PHE B HE1  2  
ATOM 1457  H HE2  . PHE B 2 24 ? -6.100  0.896   -3.619  1.00 0.00 ? 24 PHE B HE2  2  
ATOM 1458  H HZ   . PHE B 2 24 ? -6.376  -0.242  -5.806  1.00 0.00 ? 24 PHE B HZ   2  
ATOM 1459  N N    . PHE B 2 25 ? -10.109 -0.536  0.127   1.00 0.00 ? 25 PHE B N    2  
ATOM 1460  C CA   . PHE B 2 25 ? -10.419 0.913   0.266   1.00 0.00 ? 25 PHE B CA   2  
ATOM 1461  C C    . PHE B 2 25 ? -9.128  1.672   0.581   1.00 0.00 ? 25 PHE B C    2  
ATOM 1462  O O    . PHE B 2 25 ? -8.518  1.475   1.611   1.00 0.00 ? 25 PHE B O    2  
ATOM 1463  C CB   . PHE B 2 25 ? -11.421 1.116   1.405   1.00 0.00 ? 25 PHE B CB   2  
ATOM 1464  C CG   . PHE B 2 25 ? -10.762 0.778   2.719   1.00 0.00 ? 25 PHE B CG   2  
ATOM 1465  C CD1  . PHE B 2 25 ? -10.695 -0.553  3.147   1.00 0.00 ? 25 PHE B CD1  2  
ATOM 1466  C CD2  . PHE B 2 25 ? -10.215 1.796   3.512   1.00 0.00 ? 25 PHE B CD2  2  
ATOM 1467  C CE1  . PHE B 2 25 ? -10.082 -0.868  4.365   1.00 0.00 ? 25 PHE B CE1  2  
ATOM 1468  C CE2  . PHE B 2 25 ? -9.600  1.481   4.730   1.00 0.00 ? 25 PHE B CE2  2  
ATOM 1469  C CZ   . PHE B 2 25 ? -9.536  0.149   5.157   1.00 0.00 ? 25 PHE B CZ   2  
ATOM 1470  H H    . PHE B 2 25 ? -10.144 -1.123  0.911   1.00 0.00 ? 25 PHE B H    2  
ATOM 1471  H HA   . PHE B 2 25 ? -10.841 1.284   -0.657  1.00 0.00 ? 25 PHE B HA   2  
ATOM 1472  H HB2  . PHE B 2 25 ? -11.747 2.147   1.418   1.00 0.00 ? 25 PHE B HB2  2  
ATOM 1473  H HB3  . PHE B 2 25 ? -12.274 0.469   1.254   1.00 0.00 ? 25 PHE B HB3  2  
ATOM 1474  H HD1  . PHE B 2 25 ? -11.118 -1.337  2.536   1.00 0.00 ? 25 PHE B HD1  2  
ATOM 1475  H HD2  . PHE B 2 25 ? -10.266 2.823   3.181   1.00 0.00 ? 25 PHE B HD2  2  
ATOM 1476  H HE1  . PHE B 2 25 ? -10.032 -1.895  4.693   1.00 0.00 ? 25 PHE B HE1  2  
ATOM 1477  H HE2  . PHE B 2 25 ? -9.179  2.266   5.341   1.00 0.00 ? 25 PHE B HE2  2  
ATOM 1478  H HZ   . PHE B 2 25 ? -9.061  -0.094  6.096   1.00 0.00 ? 25 PHE B HZ   2  
ATOM 1479  N N    . TYR B 2 26 ? -8.704  2.537   -0.299  1.00 0.00 ? 26 TYR B N    2  
ATOM 1480  C CA   . TYR B 2 26 ? -7.449  3.301   -0.049  1.00 0.00 ? 26 TYR B CA   2  
ATOM 1481  C C    . TYR B 2 26 ? -7.781  4.622   0.648   1.00 0.00 ? 26 TYR B C    2  
ATOM 1482  O O    . TYR B 2 26 ? -8.873  5.142   0.528   1.00 0.00 ? 26 TYR B O    2  
ATOM 1483  C CB   . TYR B 2 26 ? -6.754  3.583   -1.382  1.00 0.00 ? 26 TYR B CB   2  
ATOM 1484  C CG   . TYR B 2 26 ? -5.381  4.157   -1.128  1.00 0.00 ? 26 TYR B CG   2  
ATOM 1485  C CD1  . TYR B 2 26 ? -4.574  3.625   -0.114  1.00 0.00 ? 26 TYR B CD1  2  
ATOM 1486  C CD2  . TYR B 2 26 ? -4.914  5.221   -1.909  1.00 0.00 ? 26 TYR B CD2  2  
ATOM 1487  C CE1  . TYR B 2 26 ? -3.299  4.159   0.116   1.00 0.00 ? 26 TYR B CE1  2  
ATOM 1488  C CE2  . TYR B 2 26 ? -3.640  5.754   -1.678  1.00 0.00 ? 26 TYR B CE2  2  
ATOM 1489  C CZ   . TYR B 2 26 ? -2.833  5.222   -0.665  1.00 0.00 ? 26 TYR B CZ   2  
ATOM 1490  O OH   . TYR B 2 26 ? -1.576  5.746   -0.437  1.00 0.00 ? 26 TYR B OH   2  
ATOM 1491  H H    . TYR B 2 26 ? -9.209  2.680   -1.127  1.00 0.00 ? 26 TYR B H    2  
ATOM 1492  H HA   . TYR B 2 26 ? -6.796  2.716   0.582   1.00 0.00 ? 26 TYR B HA   2  
ATOM 1493  H HB2  . TYR B 2 26 ? -6.663  2.664   -1.940  1.00 0.00 ? 26 TYR B HB2  2  
ATOM 1494  H HB3  . TYR B 2 26 ? -7.340  4.291   -1.948  1.00 0.00 ? 26 TYR B HB3  2  
ATOM 1495  H HD1  . TYR B 2 26 ? -4.934  2.806   0.488   1.00 0.00 ? 26 TYR B HD1  2  
ATOM 1496  H HD2  . TYR B 2 26 ? -5.537  5.632   -2.689  1.00 0.00 ? 26 TYR B HD2  2  
ATOM 1497  H HE1  . TYR B 2 26 ? -2.677  3.748   0.899   1.00 0.00 ? 26 TYR B HE1  2  
ATOM 1498  H HE2  . TYR B 2 26 ? -3.280  6.574   -2.281  1.00 0.00 ? 26 TYR B HE2  2  
ATOM 1499  H HH   . TYR B 2 26 ? -1.149  5.871   -1.289  1.00 0.00 ? 26 TYR B HH   2  
ATOM 1500  N N    . THR B 2 27 ? -6.844  5.170   1.372   1.00 0.00 ? 27 THR B N    2  
ATOM 1501  C CA   . THR B 2 27 ? -7.103  6.458   2.075   1.00 0.00 ? 27 THR B CA   2  
ATOM 1502  C C    . THR B 2 27 ? -5.882  7.371   1.926   1.00 0.00 ? 27 THR B C    2  
ATOM 1503  O O    . THR B 2 27 ? -5.191  7.645   2.886   1.00 0.00 ? 27 THR B O    2  
ATOM 1504  C CB   . THR B 2 27 ? -7.361  6.190   3.560   1.00 0.00 ? 27 THR B CB   2  
ATOM 1505  O OG1  . THR B 2 27 ? -7.077  7.365   4.306   1.00 0.00 ? 27 THR B OG1  2  
ATOM 1506  C CG2  . THR B 2 27 ? -6.460  5.049   4.037   1.00 0.00 ? 27 THR B CG2  2  
ATOM 1507  H H    . THR B 2 27 ? -5.971  4.734   1.456   1.00 0.00 ? 27 THR B H    2  
ATOM 1508  H HA   . THR B 2 27 ? -7.968  6.939   1.640   1.00 0.00 ? 27 THR B HA   2  
ATOM 1509  H HB   . THR B 2 27 ? -8.393  5.912   3.702   1.00 0.00 ? 27 THR B HB   2  
ATOM 1510  H HG1  . THR B 2 27 ? -7.843  7.561   4.851   1.00 0.00 ? 27 THR B HG1  2  
ATOM 1511  H HG21 . THR B 2 27 ? -5.465  5.183   3.639   1.00 0.00 ? 27 THR B HG21 2  
ATOM 1512  H HG22 . THR B 2 27 ? -6.419  5.053   5.117   1.00 0.00 ? 27 THR B HG22 2  
ATOM 1513  H HG23 . THR B 2 27 ? -6.862  4.107   3.697   1.00 0.00 ? 27 THR B HG23 2  
ATOM 1514  N N    . PRO B 2 28 ? -5.656  7.813   0.715   1.00 0.00 ? 28 PRO B N    2  
ATOM 1515  C CA   . PRO B 2 28 ? -4.525  8.705   0.371   1.00 0.00 ? 28 PRO B CA   2  
ATOM 1516  C C    . PRO B 2 28 ? -4.610  9.999   1.184   1.00 0.00 ? 28 PRO B C    2  
ATOM 1517  O O    . PRO B 2 28 ? -5.539  10.770  1.051   1.00 0.00 ? 28 PRO B O    2  
ATOM 1518  C CB   . PRO B 2 28 ? -4.665  9.005   -1.127  1.00 0.00 ? 28 PRO B CB   2  
ATOM 1519  C CG   . PRO B 2 28 ? -5.896  8.235   -1.641  1.00 0.00 ? 28 PRO B CG   2  
ATOM 1520  C CD   . PRO B 2 28 ? -6.502  7.480   -0.455  1.00 0.00 ? 28 PRO B CD   2  
ATOM 1521  H HA   . PRO B 2 28 ? -3.587  8.208   0.557   1.00 0.00 ? 28 PRO B HA   2  
ATOM 1522  H HB2  . PRO B 2 28 ? -4.803  10.066  -1.276  1.00 0.00 ? 28 PRO B HB2  2  
ATOM 1523  H HB3  . PRO B 2 28 ? -3.785  8.670   -1.651  1.00 0.00 ? 28 PRO B HB3  2  
ATOM 1524  H HG2  . PRO B 2 28 ? -6.621  8.931   -2.044  1.00 0.00 ? 28 PRO B HG2  2  
ATOM 1525  H HG3  . PRO B 2 28 ? -5.598  7.533   -2.405  1.00 0.00 ? 28 PRO B HG3  2  
ATOM 1526  H HD2  . PRO B 2 28 ? -7.519  7.805   -0.285  1.00 0.00 ? 28 PRO B HD2  2  
ATOM 1527  H HD3  . PRO B 2 28 ? -6.475  6.415   -0.636  1.00 0.00 ? 28 PRO B HD3  2  
ATOM 1528  N N    . LYS B 2 29 ? -3.645  10.242  2.030   1.00 0.00 ? 29 LYS B N    2  
ATOM 1529  C CA   . LYS B 2 29 ? -3.667  11.485  2.852   1.00 0.00 ? 29 LYS B CA   2  
ATOM 1530  C C    . LYS B 2 29 ? -2.473  12.364  2.478   1.00 0.00 ? 29 LYS B C    2  
ATOM 1531  O O    . LYS B 2 29 ? -1.412  12.274  3.063   1.00 0.00 ? 29 LYS B O    2  
ATOM 1532  C CB   . LYS B 2 29 ? -3.579  11.114  4.334   1.00 0.00 ? 29 LYS B CB   2  
ATOM 1533  C CG   . LYS B 2 29 ? -4.976  10.768  4.859   1.00 0.00 ? 29 LYS B CG   2  
ATOM 1534  C CD   . LYS B 2 29 ? -5.012  10.960  6.377   1.00 0.00 ? 29 LYS B CD   2  
ATOM 1535  C CE   . LYS B 2 29 ? -6.209  11.833  6.751   1.00 0.00 ? 29 LYS B CE   2  
ATOM 1536  N NZ   . LYS B 2 29 ? -7.235  11.003  7.440   1.00 0.00 ? 29 LYS B NZ   2  
ATOM 1537  H H    . LYS B 2 29 ? -2.904  9.607   2.122   1.00 0.00 ? 29 LYS B H    2  
ATOM 1538  H HA   . LYS B 2 29 ? -4.584  12.024  2.667   1.00 0.00 ? 29 LYS B HA   2  
ATOM 1539  H HB2  . LYS B 2 29 ? -2.928  10.262  4.454   1.00 0.00 ? 29 LYS B HB2  2  
ATOM 1540  H HB3  . LYS B 2 29 ? -3.186  11.951  4.892   1.00 0.00 ? 29 LYS B HB3  2  
ATOM 1541  H HG2  . LYS B 2 29 ? -5.705  11.419  4.396   1.00 0.00 ? 29 LYS B HG2  2  
ATOM 1542  H HG3  . LYS B 2 29 ? -5.205  9.741   4.621   1.00 0.00 ? 29 LYS B HG3  2  
ATOM 1543  H HD2  . LYS B 2 29 ? -5.103  9.996   6.858   1.00 0.00 ? 29 LYS B HD2  2  
ATOM 1544  H HD3  . LYS B 2 29 ? -4.102  11.440  6.702   1.00 0.00 ? 29 LYS B HD3  2  
ATOM 1545  H HE2  . LYS B 2 29 ? -5.885  12.626  7.410   1.00 0.00 ? 29 LYS B HE2  2  
ATOM 1546  H HE3  . LYS B 2 29 ? -6.636  12.262  5.855   1.00 0.00 ? 29 LYS B HE3  2  
ATOM 1547  H HZ1  . LYS B 2 29 ? -6.766  10.337  8.087   1.00 0.00 ? 29 LYS B HZ1  2  
ATOM 1548  H HZ2  . LYS B 2 29 ? -7.875  11.620  7.980   1.00 0.00 ? 29 LYS B HZ2  2  
ATOM 1549  H HZ3  . LYS B 2 29 ? -7.781  10.467  6.735   1.00 0.00 ? 29 LYS B HZ3  2  
ATOM 1550  N N    . THR B 2 30 ? -2.636  13.220  1.504   1.00 0.00 ? 30 THR B N    2  
ATOM 1551  C CA   . THR B 2 30 ? -1.508  14.105  1.096   1.00 0.00 ? 30 THR B CA   2  
ATOM 1552  C C    . THR B 2 30 ? -1.648  15.462  1.788   1.00 0.00 ? 30 THR B C    2  
ATOM 1553  O O    . THR B 2 30 ? -0.681  15.898  2.391   1.00 0.00 ? 30 THR B O    2  
ATOM 1554  C CB   . THR B 2 30 ? -1.538  14.300  -0.422  1.00 0.00 ? 30 THR B CB   2  
ATOM 1555  O OG1  . THR B 2 30 ? -2.430  15.359  -0.745  1.00 0.00 ? 30 THR B OG1  2  
ATOM 1556  C CG2  . THR B 2 30 ? -2.007  13.011  -1.096  1.00 0.00 ? 30 THR B CG2  2  
ATOM 1557  O OXT  . THR B 2 30 ? -2.719  16.039  1.706   1.00 0.00 ? 30 THR B OXT  2  
ATOM 1558  H H    . THR B 2 30 ? -3.497  13.280  1.044   1.00 0.00 ? 30 THR B H    2  
ATOM 1559  H HA   . THR B 2 30 ? -0.572  13.650  1.382   1.00 0.00 ? 30 THR B HA   2  
ATOM 1560  H HB   . THR B 2 30 ? -0.547  14.545  -0.773  1.00 0.00 ? 30 THR B HB   2  
ATOM 1561  H HG1  . THR B 2 30 ? -2.115  15.776  -1.550  1.00 0.00 ? 30 THR B HG1  2  
ATOM 1562  H HG21 . THR B 2 30 ? -1.938  12.192  -0.395  1.00 0.00 ? 30 THR B HG21 2  
ATOM 1563  H HG22 . THR B 2 30 ? -3.032  13.125  -1.416  1.00 0.00 ? 30 THR B HG22 2  
ATOM 1564  H HG23 . THR B 2 30 ? -1.384  12.805  -1.954  1.00 0.00 ? 30 THR B HG23 2  
ATOM 1565  N N    . GLY A 1 1  ? -2.527  7.592   7.810   1.00 0.00 ? 1  GLY A N    3  
ATOM 1566  C CA   . GLY A 1 1  ? -2.745  6.383   6.966   1.00 0.00 ? 1  GLY A CA   3  
ATOM 1567  C C    . GLY A 1 1  ? -1.415  5.675   6.725   1.00 0.00 ? 1  GLY A C    3  
ATOM 1568  O O    . GLY A 1 1  ? -0.390  6.048   7.262   1.00 0.00 ? 1  GLY A O    3  
ATOM 1569  H H1   . GLY A 1 1  ? -1.559  7.944   7.668   1.00 0.00 ? 1  GLY A H1   3  
ATOM 1570  H H2   . GLY A 1 1  ? -3.206  8.333   7.541   1.00 0.00 ? 1  GLY A H2   3  
ATOM 1571  H H3   . GLY A 1 1  ? -2.663  7.344   8.811   1.00 0.00 ? 1  GLY A H3   3  
ATOM 1572  H HA2  . GLY A 1 1  ? -3.424  5.709   7.469   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 1573  H HA3  . GLY A 1 1  ? -3.165  6.675   6.016   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 1574  N N    . ILE A 1 2  ? -1.426  4.660   5.912   1.00 0.00 ? 2  ILE A N    3  
ATOM 1575  C CA   . ILE A 1 2  ? -0.176  3.916   5.614   1.00 0.00 ? 2  ILE A CA   3  
ATOM 1576  C C    . ILE A 1 2  ? 0.828   4.877   4.965   1.00 0.00 ? 2  ILE A C    3  
ATOM 1577  O O    . ILE A 1 2  ? 2.016   4.808   5.209   1.00 0.00 ? 2  ILE A O    3  
ATOM 1578  C CB   . ILE A 1 2  ? -0.531  2.755   4.668   1.00 0.00 ? 2  ILE A CB   3  
ATOM 1579  C CG1  . ILE A 1 2  ? -0.138  1.424   5.312   1.00 0.00 ? 2  ILE A CG1  3  
ATOM 1580  C CG2  . ILE A 1 2  ? 0.175   2.896   3.316   1.00 0.00 ? 2  ILE A CG2  3  
ATOM 1581  C CD1  . ILE A 1 2  ? -1.249  0.396   5.073   1.00 0.00 ? 2  ILE A CD1  3  
ATOM 1582  H H    . ILE A 1 2  ? -2.265  4.385   5.489   1.00 0.00 ? 2  ILE A H    3  
ATOM 1583  H HA   . ILE A 1 2  ? 0.239   3.524   6.531   1.00 0.00 ? 2  ILE A HA   3  
ATOM 1584  H HB   . ILE A 1 2  ? -1.593  2.765   4.502   1.00 0.00 ? 2  ILE A HB   3  
ATOM 1585  H HG12 . ILE A 1 2  ? 0.784   1.070   4.875   1.00 0.00 ? 2  ILE A HG12 3  
ATOM 1586  H HG13 . ILE A 1 2  ? -0.003  1.565   6.375   1.00 0.00 ? 2  ILE A HG13 3  
ATOM 1587  H HG21 . ILE A 1 2  ? -0.081  3.851   2.881   1.00 0.00 ? 2  ILE A HG21 3  
ATOM 1588  H HG22 . ILE A 1 2  ? 1.244   2.840   3.461   1.00 0.00 ? 2  ILE A HG22 3  
ATOM 1589  H HG23 . ILE A 1 2  ? -0.143  2.102   2.658   1.00 0.00 ? 2  ILE A HG23 3  
ATOM 1590  H HD11 . ILE A 1 2  ? -1.539  0.412   4.032   1.00 0.00 ? 2  ILE A HD11 3  
ATOM 1591  H HD12 . ILE A 1 2  ? -0.889  -0.589  5.332   1.00 0.00 ? 2  ILE A HD12 3  
ATOM 1592  H HD13 . ILE A 1 2  ? -2.103  0.639   5.689   1.00 0.00 ? 2  ILE A HD13 3  
ATOM 1593  N N    . VAL A 1 3  ? 0.345   5.762   4.131   1.00 0.00 ? 3  VAL A N    3  
ATOM 1594  C CA   . VAL A 1 3  ? 1.243   6.733   3.442   1.00 0.00 ? 3  VAL A CA   3  
ATOM 1595  C C    . VAL A 1 3  ? 2.356   7.181   4.392   1.00 0.00 ? 3  VAL A C    3  
ATOM 1596  O O    . VAL A 1 3  ? 3.476   7.405   3.988   1.00 0.00 ? 3  VAL A O    3  
ATOM 1597  C CB   . VAL A 1 3  ? 0.421   7.943   3.004   1.00 0.00 ? 3  VAL A CB   3  
ATOM 1598  C CG1  . VAL A 1 3  ? 1.338   8.977   2.348   1.00 0.00 ? 3  VAL A CG1  3  
ATOM 1599  C CG2  . VAL A 1 3  ? -0.643  7.490   2.001   1.00 0.00 ? 3  VAL A CG2  3  
ATOM 1600  H H    . VAL A 1 3  ? -0.618  5.783   3.951   1.00 0.00 ? 3  VAL A H    3  
ATOM 1601  H HA   . VAL A 1 3  ? 1.680   6.261   2.571   1.00 0.00 ? 3  VAL A HA   3  
ATOM 1602  H HB   . VAL A 1 3  ? -0.057  8.381   3.869   1.00 0.00 ? 3  VAL A HB   3  
ATOM 1603  H HG11 . VAL A 1 3  ? 2.162   8.472   1.863   1.00 0.00 ? 3  VAL A HG11 3  
ATOM 1604  H HG12 . VAL A 1 3  ? 0.780   9.540   1.616   1.00 0.00 ? 3  VAL A HG12 3  
ATOM 1605  H HG13 . VAL A 1 3  ? 1.723   9.646   3.103   1.00 0.00 ? 3  VAL A HG13 3  
ATOM 1606  H HG21 . VAL A 1 3  ? -0.279  6.631   1.451   1.00 0.00 ? 3  VAL A HG21 3  
ATOM 1607  H HG22 . VAL A 1 3  ? -1.545  7.221   2.527   1.00 0.00 ? 3  VAL A HG22 3  
ATOM 1608  H HG23 . VAL A 1 3  ? -0.854  8.294   1.311   1.00 0.00 ? 3  VAL A HG23 3  
ATOM 1609  N N    . GLU A 1 4  ? 2.059   7.299   5.654   1.00 0.00 ? 4  GLU A N    3  
ATOM 1610  C CA   . GLU A 1 4  ? 3.112   7.718   6.625   1.00 0.00 ? 4  GLU A CA   3  
ATOM 1611  C C    . GLU A 1 4  ? 3.892   6.482   7.082   1.00 0.00 ? 4  GLU A C    3  
ATOM 1612  O O    . GLU A 1 4  ? 4.184   6.313   8.250   1.00 0.00 ? 4  GLU A O    3  
ATOM 1613  C CB   . GLU A 1 4  ? 2.455   8.386   7.835   1.00 0.00 ? 4  GLU A CB   3  
ATOM 1614  C CG   . GLU A 1 4  ? 3.508   9.167   8.625   1.00 0.00 ? 4  GLU A CG   3  
ATOM 1615  C CD   . GLU A 1 4  ? 3.945   10.393  7.820   1.00 0.00 ? 4  GLU A CD   3  
ATOM 1616  O OE1  . GLU A 1 4  ? 4.762   10.231  6.928   1.00 0.00 ? 4  GLU A OE1  3  
ATOM 1617  O OE2  . GLU A 1 4  ? 3.455   11.472  8.110   1.00 0.00 ? 4  GLU A OE2  3  
ATOM 1618  H H    . GLU A 1 4  ? 1.152   7.107   5.967   1.00 0.00 ? 4  GLU A H    3  
ATOM 1619  H HA   . GLU A 1 4  ? 3.789   8.415   6.149   1.00 0.00 ? 4  GLU A HA   3  
ATOM 1620  H HB2  . GLU A 1 4  ? 1.683   9.062   7.497   1.00 0.00 ? 4  GLU A HB2  3  
ATOM 1621  H HB3  . GLU A 1 4  ? 2.019   7.631   8.471   1.00 0.00 ? 4  GLU A HB3  3  
ATOM 1622  H HG2  . GLU A 1 4  ? 3.087   9.486   9.567   1.00 0.00 ? 4  GLU A HG2  3  
ATOM 1623  H HG3  . GLU A 1 4  ? 4.364   8.536   8.808   1.00 0.00 ? 4  GLU A HG3  3  
ATOM 1624  N N    . GLN A 1 5  ? 4.229   5.615   6.164   1.00 0.00 ? 5  GLN A N    3  
ATOM 1625  C CA   . GLN A 1 5  ? 4.988   4.386   6.530   1.00 0.00 ? 5  GLN A CA   3  
ATOM 1626  C C    . GLN A 1 5  ? 5.459   3.692   5.251   1.00 0.00 ? 5  GLN A C    3  
ATOM 1627  O O    . GLN A 1 5  ? 6.628   3.399   5.087   1.00 0.00 ? 5  GLN A O    3  
ATOM 1628  C CB   . GLN A 1 5  ? 4.081   3.443   7.324   1.00 0.00 ? 5  GLN A CB   3  
ATOM 1629  C CG   . GLN A 1 5  ? 4.250   3.709   8.821   1.00 0.00 ? 5  GLN A CG   3  
ATOM 1630  C CD   . GLN A 1 5  ? 4.676   2.421   9.525   1.00 0.00 ? 5  GLN A CD   3  
ATOM 1631  O OE1  . GLN A 1 5  ? 5.740   2.357   10.111  1.00 0.00 ? 5  GLN A OE1  3  
ATOM 1632  N NE2  . GLN A 1 5  ? 3.887   1.382   9.494   1.00 0.00 ? 5  GLN A NE2  3  
ATOM 1633  H H    . GLN A 1 5  ? 3.982   5.772   5.230   1.00 0.00 ? 5  GLN A H    3  
ATOM 1634  H HA   . GLN A 1 5  ? 5.843   4.657   7.132   1.00 0.00 ? 5  GLN A HA   3  
ATOM 1635  H HB2  . GLN A 1 5  ? 3.053   3.611   7.041   1.00 0.00 ? 5  GLN A HB2  3  
ATOM 1636  H HB3  . GLN A 1 5  ? 4.352   2.420   7.110   1.00 0.00 ? 5  GLN A HB3  3  
ATOM 1637  H HG2  . GLN A 1 5  ? 5.004   4.470   8.968   1.00 0.00 ? 5  GLN A HG2  3  
ATOM 1638  H HG3  . GLN A 1 5  ? 3.312   4.049   9.234   1.00 0.00 ? 5  GLN A HG3  3  
ATOM 1639  H HE21 . GLN A 1 5  ? 3.028   1.433   9.023   1.00 0.00 ? 5  GLN A HE21 3  
ATOM 1640  H HE22 . GLN A 1 5  ? 4.151   0.552   9.941   1.00 0.00 ? 5  GLN A HE22 3  
ATOM 1641  N N    . CYS A 1 6  ? 4.562   3.432   4.336   1.00 0.00 ? 6  CYS A N    3  
ATOM 1642  C CA   . CYS A 1 6  ? 4.966   2.766   3.066   1.00 0.00 ? 6  CYS A CA   3  
ATOM 1643  C C    . CYS A 1 6  ? 5.284   3.822   2.006   1.00 0.00 ? 6  CYS A C    3  
ATOM 1644  O O    . CYS A 1 6  ? 5.066   3.621   0.832   1.00 0.00 ? 6  CYS A O    3  
ATOM 1645  C CB   . CYS A 1 6  ? 3.839   1.861   2.569   1.00 0.00 ? 6  CYS A CB   3  
ATOM 1646  S SG   . CYS A 1 6  ? 4.453   0.163   2.437   1.00 0.00 ? 6  CYS A SG   3  
ATOM 1647  H H    . CYS A 1 6  ? 3.627   3.682   4.483   1.00 0.00 ? 6  CYS A H    3  
ATOM 1648  H HA   . CYS A 1 6  ? 5.848   2.168   3.246   1.00 0.00 ? 6  CYS A HA   3  
ATOM 1649  H HB2  . CYS A 1 6  ? 3.017   1.894   3.267   1.00 0.00 ? 6  CYS A HB2  3  
ATOM 1650  H HB3  . CYS A 1 6  ? 3.504   2.200   1.601   1.00 0.00 ? 6  CYS A HB3  3  
ATOM 1651  N N    . CYS A 1 7  ? 5.807   4.942   2.420   1.00 0.00 ? 7  CYS A N    3  
ATOM 1652  C CA   . CYS A 1 7  ? 6.163   6.017   1.455   1.00 0.00 ? 7  CYS A CA   3  
ATOM 1653  C C    . CYS A 1 7  ? 7.472   6.649   1.921   1.00 0.00 ? 7  CYS A C    3  
ATOM 1654  O O    . CYS A 1 7  ? 8.487   6.563   1.260   1.00 0.00 ? 7  CYS A O    3  
ATOM 1655  C CB   . CYS A 1 7  ? 5.059   7.070   1.438   1.00 0.00 ? 7  CYS A CB   3  
ATOM 1656  S SG   . CYS A 1 7  ? 5.591   8.502   0.466   1.00 0.00 ? 7  CYS A SG   3  
ATOM 1657  H H    . CYS A 1 7  ? 5.974   5.077   3.372   1.00 0.00 ? 7  CYS A H    3  
ATOM 1658  H HA   . CYS A 1 7  ? 6.289   5.598   0.467   1.00 0.00 ? 7  CYS A HA   3  
ATOM 1659  H HB2  . CYS A 1 7  ? 4.168   6.644   1.001   1.00 0.00 ? 7  CYS A HB2  3  
ATOM 1660  H HB3  . CYS A 1 7  ? 4.848   7.379   2.448   1.00 0.00 ? 7  CYS A HB3  3  
ATOM 1661  N N    . THR A 1 8  ? 7.461   7.257   3.074   1.00 0.00 ? 8  THR A N    3  
ATOM 1662  C CA   . THR A 1 8  ? 8.710   7.863   3.605   1.00 0.00 ? 8  THR A CA   3  
ATOM 1663  C C    . THR A 1 8  ? 9.709   6.731   3.864   1.00 0.00 ? 8  THR A C    3  
ATOM 1664  O O    . THR A 1 8  ? 10.901  6.939   3.946   1.00 0.00 ? 8  THR A O    3  
ATOM 1665  C CB   . THR A 1 8  ? 8.404   8.595   4.913   1.00 0.00 ? 8  THR A CB   3  
ATOM 1666  O OG1  . THR A 1 8  ? 8.417   7.666   5.988   1.00 0.00 ? 8  THR A OG1  3  
ATOM 1667  C CG2  . THR A 1 8  ? 7.026   9.253   4.823   1.00 0.00 ? 8  THR A CG2  3  
ATOM 1668  H H    . THR A 1 8  ? 6.635   7.294   3.601   1.00 0.00 ? 8  THR A H    3  
ATOM 1669  H HA   . THR A 1 8  ? 9.119   8.555   2.882   1.00 0.00 ? 8  THR A HA   3  
ATOM 1670  H HB   . THR A 1 8  ? 9.148   9.355   5.086   1.00 0.00 ? 8  THR A HB   3  
ATOM 1671  H HG1  . THR A 1 8  ? 9.320   7.362   6.107   1.00 0.00 ? 8  THR A HG1  3  
ATOM 1672  H HG21 . THR A 1 8  ? 6.831   9.537   3.799   1.00 0.00 ? 8  THR A HG21 3  
ATOM 1673  H HG22 . THR A 1 8  ? 6.272   8.554   5.154   1.00 0.00 ? 8  THR A HG22 3  
ATOM 1674  H HG23 . THR A 1 8  ? 7.004   10.130  5.451   1.00 0.00 ? 8  THR A HG23 3  
ATOM 1675  N N    . SER A 1 9  ? 9.211   5.529   3.980   1.00 0.00 ? 9  SER A N    3  
ATOM 1676  C CA   . SER A 1 9  ? 10.095  4.355   4.222   1.00 0.00 ? 9  SER A CA   3  
ATOM 1677  C C    . SER A 1 9  ? 9.392   3.100   3.701   1.00 0.00 ? 9  SER A C    3  
ATOM 1678  O O    . SER A 1 9  ? 8.238   3.141   3.321   1.00 0.00 ? 9  SER A O    3  
ATOM 1679  C CB   . SER A 1 9  ? 10.364  4.211   5.718   1.00 0.00 ? 9  SER A CB   3  
ATOM 1680  O OG   . SER A 1 9  ? 11.631  4.778   6.025   1.00 0.00 ? 9  SER A OG   3  
ATOM 1681  H H    . SER A 1 9  ? 8.243   5.394   3.900   1.00 0.00 ? 9  SER A H    3  
ATOM 1682  H HA   . SER A 1 9  ? 11.028  4.491   3.695   1.00 0.00 ? 9  SER A HA   3  
ATOM 1683  H HB2  . SER A 1 9  ? 9.600   4.726   6.277   1.00 0.00 ? 9  SER A HB2  3  
ATOM 1684  H HB3  . SER A 1 9  ? 10.354  3.161   5.985   1.00 0.00 ? 9  SER A HB3  3  
ATOM 1685  H HG   . SER A 1 9  ? 11.732  4.782   6.980   1.00 0.00 ? 9  SER A HG   3  
ATOM 1686  N N    . ILE A 1 10 ? 10.068  1.984   3.674   1.00 0.00 ? 10 ILE A N    3  
ATOM 1687  C CA   . ILE A 1 10 ? 9.421   0.739   3.169   1.00 0.00 ? 10 ILE A CA   3  
ATOM 1688  C C    . ILE A 1 10 ? 8.648   0.060   4.304   1.00 0.00 ? 10 ILE A C    3  
ATOM 1689  O O    . ILE A 1 10 ? 9.225   -0.465  5.234   1.00 0.00 ? 10 ILE A O    3  
ATOM 1690  C CB   . ILE A 1 10 ? 10.497  -0.213  2.643   1.00 0.00 ? 10 ILE A CB   3  
ATOM 1691  C CG1  . ILE A 1 10 ? 11.271  0.473   1.515   1.00 0.00 ? 10 ILE A CG1  3  
ATOM 1692  C CG2  . ILE A 1 10 ? 9.838   -1.485  2.105   1.00 0.00 ? 10 ILE A CG2  3  
ATOM 1693  C CD1  . ILE A 1 10 ? 12.178  -0.546  0.821   1.00 0.00 ? 10 ILE A CD1  3  
ATOM 1694  H H    . ILE A 1 10 ? 10.999  1.968   3.980   1.00 0.00 ? 10 ILE A H    3  
ATOM 1695  H HA   . ILE A 1 10 ? 8.740   0.988   2.369   1.00 0.00 ? 10 ILE A HA   3  
ATOM 1696  H HB   . ILE A 1 10 ? 11.175  -0.471  3.444   1.00 0.00 ? 10 ILE A HB   3  
ATOM 1697  H HG12 . ILE A 1 10 ? 10.573  0.882   0.798   1.00 0.00 ? 10 ILE A HG12 3  
ATOM 1698  H HG13 . ILE A 1 10 ? 11.874  1.269   1.925   1.00 0.00 ? 10 ILE A HG13 3  
ATOM 1699  H HG21 . ILE A 1 10 ? 9.264   -1.953  2.892   1.00 0.00 ? 10 ILE A HG21 3  
ATOM 1700  H HG22 . ILE A 1 10 ? 9.184   -1.231  1.284   1.00 0.00 ? 10 ILE A HG22 3  
ATOM 1701  H HG23 . ILE A 1 10 ? 10.600  -2.169  1.762   1.00 0.00 ? 10 ILE A HG23 3  
ATOM 1702  H HD11 . ILE A 1 10 ? 12.833  -1.000  1.549   1.00 0.00 ? 10 ILE A HD11 3  
ATOM 1703  H HD12 . ILE A 1 10 ? 11.572  -1.308  0.355   1.00 0.00 ? 10 ILE A HD12 3  
ATOM 1704  H HD13 . ILE A 1 10 ? 12.770  -0.045  0.067   1.00 0.00 ? 10 ILE A HD13 3  
ATOM 1705  N N    . CYS A 1 11 ? 7.341   0.064   4.233   1.00 0.00 ? 11 CYS A N    3  
ATOM 1706  C CA   . CYS A 1 11 ? 6.540   -0.584  5.309   1.00 0.00 ? 11 CYS A CA   3  
ATOM 1707  C C    . CYS A 1 11 ? 6.414   -2.084  5.018   1.00 0.00 ? 11 CYS A C    3  
ATOM 1708  O O    . CYS A 1 11 ? 6.911   -2.573  4.024   1.00 0.00 ? 11 CYS A O    3  
ATOM 1709  C CB   . CYS A 1 11 ? 5.148   0.076   5.391   1.00 0.00 ? 11 CYS A CB   3  
ATOM 1710  S SG   . CYS A 1 11 ? 3.994   -0.681  4.212   1.00 0.00 ? 11 CYS A SG   3  
ATOM 1711  H H    . CYS A 1 11 ? 6.891   0.491   3.475   1.00 0.00 ? 11 CYS A H    3  
ATOM 1712  H HA   . CYS A 1 11 ? 7.049   -0.452  6.254   1.00 0.00 ? 11 CYS A HA   3  
ATOM 1713  H HB2  . CYS A 1 11 ? 4.758   -0.042  6.392   1.00 0.00 ? 11 CYS A HB2  3  
ATOM 1714  H HB3  . CYS A 1 11 ? 5.244   1.130   5.171   1.00 0.00 ? 11 CYS A HB3  3  
ATOM 1715  N N    . SER A 1 12 ? 5.761   -2.817  5.876   1.00 0.00 ? 12 SER A N    3  
ATOM 1716  C CA   . SER A 1 12 ? 5.615   -4.281  5.645   1.00 0.00 ? 12 SER A CA   3  
ATOM 1717  C C    . SER A 1 12 ? 4.293   -4.561  4.924   1.00 0.00 ? 12 SER A C    3  
ATOM 1718  O O    . SER A 1 12 ? 3.351   -3.799  5.011   1.00 0.00 ? 12 SER A O    3  
ATOM 1719  C CB   . SER A 1 12 ? 5.629   -5.010  6.988   1.00 0.00 ? 12 SER A CB   3  
ATOM 1720  O OG   . SER A 1 12 ? 5.348   -4.085  8.029   1.00 0.00 ? 12 SER A OG   3  
ATOM 1721  H H    . SER A 1 12 ? 5.371   -2.407  6.676   1.00 0.00 ? 12 SER A H    3  
ATOM 1722  H HA   . SER A 1 12 ? 6.435   -4.631  5.036   1.00 0.00 ? 12 SER A HA   3  
ATOM 1723  H HB2  . SER A 1 12 ? 4.880   -5.784  6.989   1.00 0.00 ? 12 SER A HB2  3  
ATOM 1724  H HB3  . SER A 1 12 ? 6.603   -5.455  7.141   1.00 0.00 ? 12 SER A HB3  3  
ATOM 1725  H HG   . SER A 1 12 ? 6.084   -4.101  8.645   1.00 0.00 ? 12 SER A HG   3  
ATOM 1726  N N    . LEU A 1 13 ? 4.218   -5.654  4.210   1.00 0.00 ? 13 LEU A N    3  
ATOM 1727  C CA   . LEU A 1 13 ? 2.962   -5.988  3.483   1.00 0.00 ? 13 LEU A CA   3  
ATOM 1728  C C    . LEU A 1 13 ? 1.844   -6.264  4.491   1.00 0.00 ? 13 LEU A C    3  
ATOM 1729  O O    . LEU A 1 13 ? 0.689   -6.392  4.133   1.00 0.00 ? 13 LEU A O    3  
ATOM 1730  C CB   . LEU A 1 13 ? 3.190   -7.236  2.624   1.00 0.00 ? 13 LEU A CB   3  
ATOM 1731  C CG   . LEU A 1 13 ? 2.802   -6.940  1.174   1.00 0.00 ? 13 LEU A CG   3  
ATOM 1732  C CD1  . LEU A 1 13 ? 1.344   -6.480  1.118   1.00 0.00 ? 13 LEU A CD1  3  
ATOM 1733  C CD2  . LEU A 1 13 ? 3.706   -5.835  0.621   1.00 0.00 ? 13 LEU A CD2  3  
ATOM 1734  H H    . LEU A 1 13 ? 4.991   -6.253  4.154   1.00 0.00 ? 13 LEU A H    3  
ATOM 1735  H HA   . LEU A 1 13 ? 2.680   -5.160  2.847   1.00 0.00 ? 13 LEU A HA   3  
ATOM 1736  H HB2  . LEU A 1 13 ? 4.233   -7.516  2.667   1.00 0.00 ? 13 LEU A HB2  3  
ATOM 1737  H HB3  . LEU A 1 13 ? 2.583   -8.045  2.999   1.00 0.00 ? 13 LEU A HB3  3  
ATOM 1738  H HG   . LEU A 1 13 ? 2.920   -7.835  0.581   1.00 0.00 ? 13 LEU A HG   3  
ATOM 1739  H HD11 . LEU A 1 13 ? 1.129   -5.858  1.975   1.00 0.00 ? 13 LEU A HD11 3  
ATOM 1740  H HD12 . LEU A 1 13 ? 1.181   -5.913  0.213   1.00 0.00 ? 13 LEU A HD12 3  
ATOM 1741  H HD13 . LEU A 1 13 ? 0.695   -7.343  1.127   1.00 0.00 ? 13 LEU A HD13 3  
ATOM 1742  H HD21 . LEU A 1 13 ? 3.840   -5.071  1.370   1.00 0.00 ? 13 LEU A HD21 3  
ATOM 1743  H HD22 . LEU A 1 13 ? 4.667   -6.255  0.360   1.00 0.00 ? 13 LEU A HD22 3  
ATOM 1744  H HD23 . LEU A 1 13 ? 3.250   -5.403  -0.258  1.00 0.00 ? 13 LEU A HD23 3  
ATOM 1745  N N    . TYR A 1 14 ? 2.178   -6.361  5.749   1.00 0.00 ? 14 TYR A N    3  
ATOM 1746  C CA   . TYR A 1 14 ? 1.138   -6.633  6.782   1.00 0.00 ? 14 TYR A CA   3  
ATOM 1747  C C    . TYR A 1 14 ? 0.275   -5.387  6.994   1.00 0.00 ? 14 TYR A C    3  
ATOM 1748  O O    . TYR A 1 14 ? -0.923  -5.478  7.173   1.00 0.00 ? 14 TYR A O    3  
ATOM 1749  C CB   . TYR A 1 14 ? 1.817   -7.012  8.098   1.00 0.00 ? 14 TYR A CB   3  
ATOM 1750  C CG   . TYR A 1 14 ? 0.811   -7.688  8.995   1.00 0.00 ? 14 TYR A CG   3  
ATOM 1751  C CD1  . TYR A 1 14 ? -0.308  -6.982  9.439   1.00 0.00 ? 14 TYR A CD1  3  
ATOM 1752  C CD2  . TYR A 1 14 ? 0.997   -9.020  9.378   1.00 0.00 ? 14 TYR A CD2  3  
ATOM 1753  C CE1  . TYR A 1 14 ? -1.247  -7.603  10.268  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 1754  C CE2  . TYR A 1 14 ? 0.060   -9.645  10.209  1.00 0.00 ? 14 TYR A CE2  3  
ATOM 1755  C CZ   . TYR A 1 14 ? -1.064  -8.937  10.657  1.00 0.00 ? 14 TYR A CZ   3  
ATOM 1756  O OH   . TYR A 1 14 ? -1.989  -9.551  11.474  1.00 0.00 ? 14 TYR A OH   3  
ATOM 1757  H H    . TYR A 1 14 ? 3.116   -6.259  6.015   1.00 0.00 ? 14 TYR A H    3  
ATOM 1758  H HA   . TYR A 1 14 ? 0.512   -7.448  6.457   1.00 0.00 ? 14 TYR A HA   3  
ATOM 1759  H HB2  . TYR A 1 14 ? 2.637   -7.687  7.899   1.00 0.00 ? 14 TYR A HB2  3  
ATOM 1760  H HB3  . TYR A 1 14 ? 2.192   -6.122  8.581   1.00 0.00 ? 14 TYR A HB3  3  
ATOM 1761  H HD1  . TYR A 1 14 ? -0.451  -5.956  9.140   1.00 0.00 ? 14 TYR A HD1  3  
ATOM 1762  H HD2  . TYR A 1 14 ? 1.862   -9.565  9.033   1.00 0.00 ? 14 TYR A HD2  3  
ATOM 1763  H HE1  . TYR A 1 14 ? -2.112  -7.054  10.610  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 1764  H HE2  . TYR A 1 14 ? 0.201   -10.674 10.508  1.00 0.00 ? 14 TYR A HE2  3  
ATOM 1765  H HH   . TYR A 1 14 ? -1.593  -10.355 11.819  1.00 0.00 ? 14 TYR A HH   3  
ATOM 1766  N N    . GLN A 1 15 ? 0.868   -4.228  6.982   1.00 0.00 ? 15 GLN A N    3  
ATOM 1767  C CA   . GLN A 1 15 ? 0.067   -2.989  7.189   1.00 0.00 ? 15 GLN A CA   3  
ATOM 1768  C C    . GLN A 1 15 ? -0.934  -2.831  6.042   1.00 0.00 ? 15 GLN A C    3  
ATOM 1769  O O    . GLN A 1 15 ? -2.049  -2.385  6.235   1.00 0.00 ? 15 GLN A O    3  
ATOM 1770  C CB   . GLN A 1 15 ? 1.002   -1.780  7.226   1.00 0.00 ? 15 GLN A CB   3  
ATOM 1771  C CG   . GLN A 1 15 ? 1.988   -1.931  8.387   1.00 0.00 ? 15 GLN A CG   3  
ATOM 1772  C CD   . GLN A 1 15 ? 1.533   -1.063  9.561   1.00 0.00 ? 15 GLN A CD   3  
ATOM 1773  O OE1  . GLN A 1 15 ? 1.009   0.015   9.367   1.00 0.00 ? 15 GLN A OE1  3  
ATOM 1774  N NE2  . GLN A 1 15 ? 1.710   -1.492  10.782  1.00 0.00 ? 15 GLN A NE2  3  
ATOM 1775  H H    . GLN A 1 15 ? 1.836   -4.172  6.840   1.00 0.00 ? 15 GLN A H    3  
ATOM 1776  H HA   . GLN A 1 15 ? -0.468  -3.062  8.126   1.00 0.00 ? 15 GLN A HA   3  
ATOM 1777  H HB2  . GLN A 1 15 ? 1.548   -1.716  6.295   1.00 0.00 ? 15 GLN A HB2  3  
ATOM 1778  H HB3  . GLN A 1 15 ? 0.423   -0.880  7.365   1.00 0.00 ? 15 GLN A HB3  3  
ATOM 1779  H HG2  . GLN A 1 15 ? 2.024   -2.967  8.694   1.00 0.00 ? 15 GLN A HG2  3  
ATOM 1780  H HG3  . GLN A 1 15 ? 2.971   -1.615  8.069   1.00 0.00 ? 15 GLN A HG3  3  
ATOM 1781  H HE21 . GLN A 1 15 ? 2.133   -2.362  10.939  1.00 0.00 ? 15 GLN A HE21 3  
ATOM 1782  H HE22 . GLN A 1 15 ? 1.421   -0.943  11.541  1.00 0.00 ? 15 GLN A HE22 3  
ATOM 1783  N N    . LEU A 1 16 ? -0.547  -3.187  4.846   1.00 0.00 ? 16 LEU A N    3  
ATOM 1784  C CA   . LEU A 1 16 ? -1.476  -3.053  3.690   1.00 0.00 ? 16 LEU A CA   3  
ATOM 1785  C C    . LEU A 1 16 ? -2.625  -4.053  3.829   1.00 0.00 ? 16 LEU A C    3  
ATOM 1786  O O    . LEU A 1 16 ? -3.611  -3.975  3.126   1.00 0.00 ? 16 LEU A O    3  
ATOM 1787  C CB   . LEU A 1 16 ? -0.722  -3.322  2.384   1.00 0.00 ? 16 LEU A CB   3  
ATOM 1788  C CG   . LEU A 1 16 ? 0.415   -2.307  2.197   1.00 0.00 ? 16 LEU A CG   3  
ATOM 1789  C CD1  . LEU A 1 16 ? 0.684   -2.125  0.703   1.00 0.00 ? 16 LEU A CD1  3  
ATOM 1790  C CD2  . LEU A 1 16 ? 0.028   -0.950  2.799   1.00 0.00 ? 16 LEU A CD2  3  
ATOM 1791  H H    . LEU A 1 16 ? 0.356   -3.540  4.708   1.00 0.00 ? 16 LEU A H    3  
ATOM 1792  H HA   . LEU A 1 16 ? -1.877  -2.049  3.670   1.00 0.00 ? 16 LEU A HA   3  
ATOM 1793  H HB2  . LEU A 1 16 ? -0.309  -4.318  2.410   1.00 0.00 ? 16 LEU A HB2  3  
ATOM 1794  H HB3  . LEU A 1 16 ? -1.408  -3.242  1.554   1.00 0.00 ? 16 LEU A HB3  3  
ATOM 1795  H HG   . LEU A 1 16 ? 1.308   -2.676  2.680   1.00 0.00 ? 16 LEU A HG   3  
ATOM 1796  H HD11 . LEU A 1 16 ? 0.001   -2.741  0.139   1.00 0.00 ? 16 LEU A HD11 3  
ATOM 1797  H HD12 . LEU A 1 16 ? 0.538   -1.088  0.437   1.00 0.00 ? 16 LEU A HD12 3  
ATOM 1798  H HD13 . LEU A 1 16 ? 1.700   -2.415  0.483   1.00 0.00 ? 16 LEU A HD13 3  
ATOM 1799  H HD21 . LEU A 1 16 ? -1.019  -0.759  2.612   1.00 0.00 ? 16 LEU A HD21 3  
ATOM 1800  H HD22 . LEU A 1 16 ? 0.206   -0.968  3.865   1.00 0.00 ? 16 LEU A HD22 3  
ATOM 1801  H HD23 . LEU A 1 16 ? 0.623   -0.173  2.348   1.00 0.00 ? 16 LEU A HD23 3  
ATOM 1802  N N    . GLU A 1 17 ? -2.511  -4.987  4.732   1.00 0.00 ? 17 GLU A N    3  
ATOM 1803  C CA   . GLU A 1 17 ? -3.611  -5.975  4.913   1.00 0.00 ? 17 GLU A CA   3  
ATOM 1804  C C    . GLU A 1 17 ? -4.861  -5.230  5.377   1.00 0.00 ? 17 GLU A C    3  
ATOM 1805  O O    . GLU A 1 17 ? -5.974  -5.605  5.075   1.00 0.00 ? 17 GLU A O    3  
ATOM 1806  C CB   . GLU A 1 17 ? -3.217  -7.007  5.970   1.00 0.00 ? 17 GLU A CB   3  
ATOM 1807  C CG   . GLU A 1 17 ? -1.894  -7.665  5.577   1.00 0.00 ? 17 GLU A CG   3  
ATOM 1808  C CD   . GLU A 1 17 ? -1.648  -8.881  6.469   1.00 0.00 ? 17 GLU A CD   3  
ATOM 1809  O OE1  . GLU A 1 17 ? -2.266  -9.905  6.225   1.00 0.00 ? 17 GLU A OE1  3  
ATOM 1810  O OE2  . GLU A 1 17 ? -0.848  -8.772  7.380   1.00 0.00 ? 17 GLU A OE2  3  
ATOM 1811  H H    . GLU A 1 17 ? -1.712  -5.033  5.295   1.00 0.00 ? 17 GLU A H    3  
ATOM 1812  H HA   . GLU A 1 17 ? -3.812  -6.472  3.974   1.00 0.00 ? 17 GLU A HA   3  
ATOM 1813  H HB2  . GLU A 1 17 ? -3.107  -6.518  6.927   1.00 0.00 ? 17 GLU A HB2  3  
ATOM 1814  H HB3  . GLU A 1 17 ? -3.983  -7.763  6.040   1.00 0.00 ? 17 GLU A HB3  3  
ATOM 1815  H HG2  . GLU A 1 17 ? -1.941  -7.978  4.546   1.00 0.00 ? 17 GLU A HG2  3  
ATOM 1816  H HG3  . GLU A 1 17 ? -1.090  -6.958  5.703   1.00 0.00 ? 17 GLU A HG3  3  
ATOM 1817  N N    . ASN A 1 18 ? -4.672  -4.168  6.113   1.00 0.00 ? 18 ASN A N    3  
ATOM 1818  C CA   . ASN A 1 18 ? -5.835  -3.380  6.609   1.00 0.00 ? 18 ASN A CA   3  
ATOM 1819  C C    . ASN A 1 18 ? -6.597  -2.790  5.420   1.00 0.00 ? 18 ASN A C    3  
ATOM 1820  O O    . ASN A 1 18 ? -7.763  -2.464  5.517   1.00 0.00 ? 18 ASN A O    3  
ATOM 1821  C CB   . ASN A 1 18 ? -5.331  -2.242  7.499   1.00 0.00 ? 18 ASN A CB   3  
ATOM 1822  C CG   . ASN A 1 18 ? -6.196  -2.155  8.758   1.00 0.00 ? 18 ASN A CG   3  
ATOM 1823  O OD1  . ASN A 1 18 ? -7.358  -1.809  8.688   1.00 0.00 ? 18 ASN A OD1  3  
ATOM 1824  N ND2  . ASN A 1 18 ? -5.673  -2.461  9.914   1.00 0.00 ? 18 ASN A ND2  3  
ATOM 1825  H H    . ASN A 1 18 ? -3.758  -3.892  6.342   1.00 0.00 ? 18 ASN A H    3  
ATOM 1826  H HA   . ASN A 1 18 ? -6.491  -4.021  7.178   1.00 0.00 ? 18 ASN A HA   3  
ATOM 1827  H HB2  . ASN A 1 18 ? -4.306  -2.432  7.778   1.00 0.00 ? 18 ASN A HB2  3  
ATOM 1828  H HB3  . ASN A 1 18 ? -5.390  -1.309  6.960   1.00 0.00 ? 18 ASN A HB3  3  
ATOM 1829  H HD21 . ASN A 1 18 ? -4.736  -2.741  9.968   1.00 0.00 ? 18 ASN A HD21 3  
ATOM 1830  H HD22 . ASN A 1 18 ? -6.218  -2.409  10.725  1.00 0.00 ? 18 ASN A HD22 3  
ATOM 1831  N N    . TYR A 1 19 ? -5.943  -2.644  4.299   1.00 0.00 ? 19 TYR A N    3  
ATOM 1832  C CA   . TYR A 1 19 ? -6.622  -2.068  3.104   1.00 0.00 ? 19 TYR A CA   3  
ATOM 1833  C C    . TYR A 1 19 ? -7.406  -3.159  2.369   1.00 0.00 ? 19 TYR A C    3  
ATOM 1834  O O    . TYR A 1 19 ? -7.836  -2.976  1.248   1.00 0.00 ? 19 TYR A O    3  
ATOM 1835  C CB   . TYR A 1 19 ? -5.573  -1.473  2.161   1.00 0.00 ? 19 TYR A CB   3  
ATOM 1836  C CG   . TYR A 1 19 ? -5.274  -0.058  2.579   1.00 0.00 ? 19 TYR A CG   3  
ATOM 1837  C CD1  . TYR A 1 19 ? -6.142  0.973   2.207   1.00 0.00 ? 19 TYR A CD1  3  
ATOM 1838  C CD2  . TYR A 1 19 ? -4.135  0.221   3.337   1.00 0.00 ? 19 TYR A CD2  3  
ATOM 1839  C CE1  . TYR A 1 19 ? -5.874  2.290   2.596   1.00 0.00 ? 19 TYR A CE1  3  
ATOM 1840  C CE2  . TYR A 1 19 ? -3.865  1.536   3.727   1.00 0.00 ? 19 TYR A CE2  3  
ATOM 1841  C CZ   . TYR A 1 19 ? -4.734  2.571   3.358   1.00 0.00 ? 19 TYR A CZ   3  
ATOM 1842  O OH   . TYR A 1 19 ? -4.465  3.869   3.744   1.00 0.00 ? 19 TYR A OH   3  
ATOM 1843  H H    . TYR A 1 19 ? -5.001  -2.908  4.247   1.00 0.00 ? 19 TYR A H    3  
ATOM 1844  H HA   . TYR A 1 19 ? -7.303  -1.291  3.419   1.00 0.00 ? 19 TYR A HA   3  
ATOM 1845  H HB2  . TYR A 1 19 ? -4.671  -2.062  2.205   1.00 0.00 ? 19 TYR A HB2  3  
ATOM 1846  H HB3  . TYR A 1 19 ? -5.953  -1.471  1.154   1.00 0.00 ? 19 TYR A HB3  3  
ATOM 1847  H HD1  . TYR A 1 19 ? -7.019  0.749   1.619   1.00 0.00 ? 19 TYR A HD1  3  
ATOM 1848  H HD2  . TYR A 1 19 ? -3.461  -0.578  3.619   1.00 0.00 ? 19 TYR A HD2  3  
ATOM 1849  H HE1  . TYR A 1 19 ? -6.543  3.090   2.311   1.00 0.00 ? 19 TYR A HE1  3  
ATOM 1850  H HE2  . TYR A 1 19 ? -2.991  1.751   4.314   1.00 0.00 ? 19 TYR A HE2  3  
ATOM 1851  H HH   . TYR A 1 19 ? -4.759  4.455   3.041   1.00 0.00 ? 19 TYR A HH   3  
ATOM 1852  N N    . CYS A 1 20 ? -7.600  -4.291  2.987   1.00 0.00 ? 20 CYS A N    3  
ATOM 1853  C CA   . CYS A 1 20 ? -8.359  -5.381  2.314   1.00 0.00 ? 20 CYS A CA   3  
ATOM 1854  C C    . CYS A 1 20 ? -9.814  -5.353  2.783   1.00 0.00 ? 20 CYS A C    3  
ATOM 1855  O O    . CYS A 1 20 ? -10.098 -5.180  3.952   1.00 0.00 ? 20 CYS A O    3  
ATOM 1856  C CB   . CYS A 1 20 ? -7.733  -6.732  2.662   1.00 0.00 ? 20 CYS A CB   3  
ATOM 1857  S SG   . CYS A 1 20 ? -6.790  -7.337  1.240   1.00 0.00 ? 20 CYS A SG   3  
ATOM 1858  H H    . CYS A 1 20 ? -7.249  -4.423  3.893   1.00 0.00 ? 20 CYS A H    3  
ATOM 1859  H HA   . CYS A 1 20 ? -8.324  -5.237  1.247   1.00 0.00 ? 20 CYS A HA   3  
ATOM 1860  H HB2  . CYS A 1 20 ? -7.076  -6.619  3.511   1.00 0.00 ? 20 CYS A HB2  3  
ATOM 1861  H HB3  . CYS A 1 20 ? -8.515  -7.435  2.900   1.00 0.00 ? 20 CYS A HB3  3  
ATOM 1862  N N    . ASN A 1 21 ? -10.737 -5.516  1.877   1.00 0.00 ? 21 ASN A N    3  
ATOM 1863  C CA   . ASN A 1 21 ? -12.177 -5.493  2.263   1.00 0.00 ? 21 ASN A CA   3  
ATOM 1864  C C    . ASN A 1 21 ? -12.746 -6.913  2.211   1.00 0.00 ? 21 ASN A C    3  
ATOM 1865  O O    . ASN A 1 21 ? -13.361 -7.320  3.182   1.00 0.00 ? 21 ASN A O    3  
ATOM 1866  C CB   . ASN A 1 21 ? -12.948 -4.597  1.292   1.00 0.00 ? 21 ASN A CB   3  
ATOM 1867  C CG   . ASN A 1 21 ? -14.379 -4.406  1.795   1.00 0.00 ? 21 ASN A CG   3  
ATOM 1868  O OD1  . ASN A 1 21 ? -14.923 -5.269  2.457   1.00 0.00 ? 21 ASN A OD1  3  
ATOM 1869  N ND2  . ASN A 1 21 ? -15.015 -3.303  1.511   1.00 0.00 ? 21 ASN A ND2  3  
ATOM 1870  O OXT  . ASN A 1 21 ? -12.556 -7.568  1.199   1.00 0.00 ? 21 ASN A OXT  3  
ATOM 1871  H H    . ASN A 1 21 ? -10.485 -5.650  0.939   1.00 0.00 ? 21 ASN A H    3  
ATOM 1872  H HA   . ASN A 1 21 ? -12.274 -5.103  3.267   1.00 0.00 ? 21 ASN A HA   3  
ATOM 1873  H HB2  . ASN A 1 21 ? -12.457 -3.636  1.224   1.00 0.00 ? 21 ASN A HB2  3  
ATOM 1874  H HB3  . ASN A 1 21 ? -12.972 -5.059  0.317   1.00 0.00 ? 21 ASN A HB3  3  
ATOM 1875  H HD21 . ASN A 1 21 ? -14.576 -2.608  0.977   1.00 0.00 ? 21 ASN A HD21 3  
ATOM 1876  H HD22 . ASN A 1 21 ? -15.932 -3.170  1.829   1.00 0.00 ? 21 ASN A HD22 3  
ATOM 1877  N N    . PHE B 2 1  ? 5.710   -9.394  -5.391  1.00 0.00 ? 1  PHE B N    3  
ATOM 1878  C CA   . PHE B 2 1  ? 5.940   -8.437  -4.273  1.00 0.00 ? 1  PHE B CA   3  
ATOM 1879  C C    . PHE B 2 1  ? 7.411   -8.003  -4.268  1.00 0.00 ? 1  PHE B C    3  
ATOM 1880  O O    . PHE B 2 1  ? 8.290   -8.756  -4.632  1.00 0.00 ? 1  PHE B O    3  
ATOM 1881  C CB   . PHE B 2 1  ? 5.577   -9.111  -2.938  1.00 0.00 ? 1  PHE B CB   3  
ATOM 1882  C CG   . PHE B 2 1  ? 6.766   -9.875  -2.392  1.00 0.00 ? 1  PHE B CG   3  
ATOM 1883  C CD1  . PHE B 2 1  ? 7.452   -10.783 -3.207  1.00 0.00 ? 1  PHE B CD1  3  
ATOM 1884  C CD2  . PHE B 2 1  ? 7.184   -9.665  -1.072  1.00 0.00 ? 1  PHE B CD2  3  
ATOM 1885  C CE1  . PHE B 2 1  ? 8.555   -11.482 -2.702  1.00 0.00 ? 1  PHE B CE1  3  
ATOM 1886  C CE2  . PHE B 2 1  ? 8.289   -10.364 -0.568  1.00 0.00 ? 1  PHE B CE2  3  
ATOM 1887  C CZ   . PHE B 2 1  ? 8.973   -11.273 -1.383  1.00 0.00 ? 1  PHE B CZ   3  
ATOM 1888  H H1   . PHE B 2 1  ? 6.609   -9.851  -5.647  1.00 0.00 ? 1  PHE B H1   3  
ATOM 1889  H H2   . PHE B 2 1  ? 5.026   -10.118 -5.093  1.00 0.00 ? 1  PHE B H2   3  
ATOM 1890  H H3   . PHE B 2 1  ? 5.334   -8.883  -6.214  1.00 0.00 ? 1  PHE B H3   3  
ATOM 1891  H HA   . PHE B 2 1  ? 5.314   -7.568  -4.415  1.00 0.00 ? 1  PHE B HA   3  
ATOM 1892  H HB2  . PHE B 2 1  ? 5.277   -8.359  -2.227  1.00 0.00 ? 1  PHE B HB2  3  
ATOM 1893  H HB3  . PHE B 2 1  ? 4.757   -9.797  -3.098  1.00 0.00 ? 1  PHE B HB3  3  
ATOM 1894  H HD1  . PHE B 2 1  ? 7.129   -10.947 -4.224  1.00 0.00 ? 1  PHE B HD1  3  
ATOM 1895  H HD2  . PHE B 2 1  ? 6.656   -8.964  -0.443  1.00 0.00 ? 1  PHE B HD2  3  
ATOM 1896  H HE1  . PHE B 2 1  ? 9.084   -12.183 -3.332  1.00 0.00 ? 1  PHE B HE1  3  
ATOM 1897  H HE2  . PHE B 2 1  ? 8.611   -10.202 0.450   1.00 0.00 ? 1  PHE B HE2  3  
ATOM 1898  H HZ   . PHE B 2 1  ? 9.824   -11.813 -0.994  1.00 0.00 ? 1  PHE B HZ   3  
ATOM 1899  N N    . VAL B 2 2  ? 7.685   -6.797  -3.848  1.00 0.00 ? 2  VAL B N    3  
ATOM 1900  C CA   . VAL B 2 2  ? 9.100   -6.329  -3.816  1.00 0.00 ? 2  VAL B CA   3  
ATOM 1901  C C    . VAL B 2 2  ? 9.229   -5.161  -2.837  1.00 0.00 ? 2  VAL B C    3  
ATOM 1902  O O    . VAL B 2 2  ? 8.361   -4.317  -2.743  1.00 0.00 ? 2  VAL B O    3  
ATOM 1903  C CB   . VAL B 2 2  ? 9.519   -5.873  -5.215  1.00 0.00 ? 2  VAL B CB   3  
ATOM 1904  C CG1  . VAL B 2 2  ? 10.945  -5.323  -5.165  1.00 0.00 ? 2  VAL B CG1  3  
ATOM 1905  C CG2  . VAL B 2 2  ? 9.465   -7.065  -6.172  1.00 0.00 ? 2  VAL B CG2  3  
ATOM 1906  H H    . VAL B 2 2  ? 6.964   -6.203  -3.553  1.00 0.00 ? 2  VAL B H    3  
ATOM 1907  H HA   . VAL B 2 2  ? 9.738   -7.138  -3.495  1.00 0.00 ? 2  VAL B HA   3  
ATOM 1908  H HB   . VAL B 2 2  ? 8.847   -5.101  -5.559  1.00 0.00 ? 2  VAL B HB   3  
ATOM 1909  H HG11 . VAL B 2 2  ? 11.211  -5.103  -4.142  1.00 0.00 ? 2  VAL B HG11 3  
ATOM 1910  H HG12 . VAL B 2 2  ? 11.628  -6.058  -5.564  1.00 0.00 ? 2  VAL B HG12 3  
ATOM 1911  H HG13 . VAL B 2 2  ? 11.005  -4.420  -5.755  1.00 0.00 ? 2  VAL B HG13 3  
ATOM 1912  H HG21 . VAL B 2 2  ? 9.957   -7.914  -5.719  1.00 0.00 ? 2  VAL B HG21 3  
ATOM 1913  H HG22 . VAL B 2 2  ? 8.434   -7.315  -6.378  1.00 0.00 ? 2  VAL B HG22 3  
ATOM 1914  H HG23 . VAL B 2 2  ? 9.965   -6.810  -7.094  1.00 0.00 ? 2  VAL B HG23 3  
ATOM 1915  N N    . ASN B 2 3  ? 10.307  -5.110  -2.104  1.00 0.00 ? 3  ASN B N    3  
ATOM 1916  C CA   . ASN B 2 3  ? 10.494  -3.999  -1.129  1.00 0.00 ? 3  ASN B CA   3  
ATOM 1917  C C    . ASN B 2 3  ? 10.757  -2.695  -1.883  1.00 0.00 ? 3  ASN B C    3  
ATOM 1918  O O    . ASN B 2 3  ? 11.863  -2.422  -2.304  1.00 0.00 ? 3  ASN B O    3  
ATOM 1919  C CB   . ASN B 2 3  ? 11.685  -4.312  -0.220  1.00 0.00 ? 3  ASN B CB   3  
ATOM 1920  C CG   . ASN B 2 3  ? 11.175  -4.775  1.147   1.00 0.00 ? 3  ASN B CG   3  
ATOM 1921  O OD1  . ASN B 2 3  ? 11.734  -4.424  2.168   1.00 0.00 ? 3  ASN B OD1  3  
ATOM 1922  N ND2  . ASN B 2 3  ? 10.131  -5.556  1.211   1.00 0.00 ? 3  ASN B ND2  3  
ATOM 1923  H H    . ASN B 2 3  ? 10.995  -5.801  -2.195  1.00 0.00 ? 3  ASN B H    3  
ATOM 1924  H HA   . ASN B 2 3  ? 9.600   -3.894  -0.529  1.00 0.00 ? 3  ASN B HA   3  
ATOM 1925  H HB2  . ASN B 2 3  ? 12.283  -5.093  -0.666  1.00 0.00 ? 3  ASN B HB2  3  
ATOM 1926  H HB3  . ASN B 2 3  ? 12.285  -3.423  -0.095  1.00 0.00 ? 3  ASN B HB3  3  
ATOM 1927  H HD21 . ASN B 2 3  ? 9.679   -5.840  0.389   1.00 0.00 ? 3  ASN B HD21 3  
ATOM 1928  H HD22 . ASN B 2 3  ? 9.797   -5.857  2.082   1.00 0.00 ? 3  ASN B HD22 3  
ATOM 1929  N N    . GLN B 2 4  ? 9.748   -1.888  -2.058  1.00 0.00 ? 4  GLN B N    3  
ATOM 1930  C CA   . GLN B 2 4  ? 9.940   -0.602  -2.783  1.00 0.00 ? 4  GLN B CA   3  
ATOM 1931  C C    . GLN B 2 4  ? 9.122   0.494   -2.099  1.00 0.00 ? 4  GLN B C    3  
ATOM 1932  O O    . GLN B 2 4  ? 8.074   0.239   -1.540  1.00 0.00 ? 4  GLN B O    3  
ATOM 1933  C CB   . GLN B 2 4  ? 9.469   -0.756  -4.231  1.00 0.00 ? 4  GLN B CB   3  
ATOM 1934  C CG   . GLN B 2 4  ? 9.895   -2.122  -4.770  1.00 0.00 ? 4  GLN B CG   3  
ATOM 1935  C CD   . GLN B 2 4  ? 9.057   -2.467  -6.003  1.00 0.00 ? 4  GLN B CD   3  
ATOM 1936  O OE1  . GLN B 2 4  ? 8.074   -3.177  -5.905  1.00 0.00 ? 4  GLN B OE1  3  
ATOM 1937  N NE2  . GLN B 2 4  ? 9.403   -1.990  -7.167  1.00 0.00 ? 4  GLN B NE2  3  
ATOM 1938  H H    . GLN B 2 4  ? 8.863   -2.127  -1.711  1.00 0.00 ? 4  GLN B H    3  
ATOM 1939  H HA   . GLN B 2 4  ? 10.986  -0.333  -2.772  1.00 0.00 ? 4  GLN B HA   3  
ATOM 1940  H HB2  . GLN B 2 4  ? 8.392   -0.674  -4.267  1.00 0.00 ? 4  GLN B HB2  3  
ATOM 1941  H HB3  . GLN B 2 4  ? 9.909   0.022   -4.835  1.00 0.00 ? 4  GLN B HB3  3  
ATOM 1942  H HG2  . GLN B 2 4  ? 10.941  -2.093  -5.042  1.00 0.00 ? 4  GLN B HG2  3  
ATOM 1943  H HG3  . GLN B 2 4  ? 9.741   -2.877  -4.013  1.00 0.00 ? 4  GLN B HG3  3  
ATOM 1944  H HE21 . GLN B 2 4  ? 10.195  -1.418  -7.246  1.00 0.00 ? 4  GLN B HE21 3  
ATOM 1945  H HE22 . GLN B 2 4  ? 8.872   -2.204  -7.962  1.00 0.00 ? 4  GLN B HE22 3  
ATOM 1946  N N    . HIS B 2 5  ? 9.587   1.711   -2.140  1.00 0.00 ? 5  HIS B N    3  
ATOM 1947  C CA   . HIS B 2 5  ? 8.829   2.816   -1.492  1.00 0.00 ? 5  HIS B CA   3  
ATOM 1948  C C    . HIS B 2 5  ? 7.499   3.015   -2.219  1.00 0.00 ? 5  HIS B C    3  
ATOM 1949  O O    . HIS B 2 5  ? 7.401   2.847   -3.419  1.00 0.00 ? 5  HIS B O    3  
ATOM 1950  C CB   . HIS B 2 5  ? 9.646   4.108   -1.555  1.00 0.00 ? 5  HIS B CB   3  
ATOM 1951  C CG   . HIS B 2 5  ? 10.744  4.060   -0.529  1.00 0.00 ? 5  HIS B CG   3  
ATOM 1952  N ND1  . HIS B 2 5  ? 10.561  3.492   0.723   1.00 0.00 ? 5  HIS B ND1  3  
ATOM 1953  C CD2  . HIS B 2 5  ? 12.042  4.504   -0.553  1.00 0.00 ? 5  HIS B CD2  3  
ATOM 1954  C CE1  . HIS B 2 5  ? 11.721  3.610   1.394   1.00 0.00 ? 5  HIS B CE1  3  
ATOM 1955  N NE2  . HIS B 2 5  ? 12.658  4.220   0.662   1.00 0.00 ? 5  HIS B NE2  3  
ATOM 1956  H H    . HIS B 2 5  ? 10.433  1.898   -2.598  1.00 0.00 ? 5  HIS B H    3  
ATOM 1957  H HA   . HIS B 2 5  ? 8.639   2.562   -0.459  1.00 0.00 ? 5  HIS B HA   3  
ATOM 1958  H HB2  . HIS B 2 5  ? 10.077  4.213   -2.540  1.00 0.00 ? 5  HIS B HB2  3  
ATOM 1959  H HB3  . HIS B 2 5  ? 9.000   4.950   -1.351  1.00 0.00 ? 5  HIS B HB3  3  
ATOM 1960  H HD1  . HIS B 2 5  ? 9.738   3.080   1.058   1.00 0.00 ? 5  HIS B HD1  3  
ATOM 1961  H HD2  . HIS B 2 5  ? 12.515  4.998   -1.389  1.00 0.00 ? 5  HIS B HD2  3  
ATOM 1962  H HE1  . HIS B 2 5  ? 11.877  3.254   2.403   1.00 0.00 ? 5  HIS B HE1  3  
ATOM 1963  N N    . LEU B 2 6  ? 6.476   3.380   -1.498  1.00 0.00 ? 6  LEU B N    3  
ATOM 1964  C CA   . LEU B 2 6  ? 5.145   3.599   -2.134  1.00 0.00 ? 6  LEU B CA   3  
ATOM 1965  C C    . LEU B 2 6  ? 4.665   5.017   -1.829  1.00 0.00 ? 6  LEU B C    3  
ATOM 1966  O O    . LEU B 2 6  ? 4.320   5.340   -0.709  1.00 0.00 ? 6  LEU B O    3  
ATOM 1967  C CB   . LEU B 2 6  ? 4.135   2.590   -1.586  1.00 0.00 ? 6  LEU B CB   3  
ATOM 1968  C CG   . LEU B 2 6  ? 4.815   1.236   -1.395  1.00 0.00 ? 6  LEU B CG   3  
ATOM 1969  C CD1  . LEU B 2 6  ? 3.929   0.335   -0.535  1.00 0.00 ? 6  LEU B CD1  3  
ATOM 1970  C CD2  . LEU B 2 6  ? 5.033   0.580   -2.760  1.00 0.00 ? 6  LEU B CD2  3  
ATOM 1971  H H    . LEU B 2 6  ? 6.584   3.512   -0.535  1.00 0.00 ? 6  LEU B H    3  
ATOM 1972  H HA   . LEU B 2 6  ? 5.231   3.476   -3.202  1.00 0.00 ? 6  LEU B HA   3  
ATOM 1973  H HB2  . LEU B 2 6  ? 3.754   2.942   -0.638  1.00 0.00 ? 6  LEU B HB2  3  
ATOM 1974  H HB3  . LEU B 2 6  ? 3.319   2.486   -2.285  1.00 0.00 ? 6  LEU B HB3  3  
ATOM 1975  H HG   . LEU B 2 6  ? 5.767   1.377   -0.906  1.00 0.00 ? 6  LEU B HG   3  
ATOM 1976  H HD11 . LEU B 2 6  ? 3.476   0.921   0.251   1.00 0.00 ? 6  LEU B HD11 3  
ATOM 1977  H HD12 . LEU B 2 6  ? 3.156   -0.102  -1.149  1.00 0.00 ? 6  LEU B HD12 3  
ATOM 1978  H HD13 . LEU B 2 6  ? 4.529   -0.450  -0.098  1.00 0.00 ? 6  LEU B HD13 3  
ATOM 1979  H HD21 . LEU B 2 6  ? 5.334   1.330   -3.477  1.00 0.00 ? 6  LEU B HD21 3  
ATOM 1980  H HD22 . LEU B 2 6  ? 5.803   -0.171  -2.680  1.00 0.00 ? 6  LEU B HD22 3  
ATOM 1981  H HD23 . LEU B 2 6  ? 4.113   0.119   -3.089  1.00 0.00 ? 6  LEU B HD23 3  
ATOM 1982  N N    . CYS B 2 7  ? 4.643   5.870   -2.816  1.00 0.00 ? 7  CYS B N    3  
ATOM 1983  C CA   . CYS B 2 7  ? 4.189   7.266   -2.579  1.00 0.00 ? 7  CYS B CA   3  
ATOM 1984  C C    . CYS B 2 7  ? 3.255   7.698   -3.711  1.00 0.00 ? 7  CYS B C    3  
ATOM 1985  O O    . CYS B 2 7  ? 3.679   7.922   -4.826  1.00 0.00 ? 7  CYS B O    3  
ATOM 1986  C CB   . CYS B 2 7  ? 5.405   8.191   -2.535  1.00 0.00 ? 7  CYS B CB   3  
ATOM 1987  S SG   . CYS B 2 7  ? 6.478   7.703   -1.163  1.00 0.00 ? 7  CYS B SG   3  
ATOM 1988  H H    . CYS B 2 7  ? 4.928   5.592   -3.710  1.00 0.00 ? 7  CYS B H    3  
ATOM 1989  H HA   . CYS B 2 7  ? 3.662   7.320   -1.637  1.00 0.00 ? 7  CYS B HA   3  
ATOM 1990  H HB2  . CYS B 2 7  ? 5.949   8.113   -3.465  1.00 0.00 ? 7  CYS B HB2  3  
ATOM 1991  H HB3  . CYS B 2 7  ? 5.078   9.211   -2.393  1.00 0.00 ? 7  CYS B HB3  3  
ATOM 1992  N N    . GLY B 2 8  ? 1.985   7.814   -3.430  1.00 0.00 ? 8  GLY B N    3  
ATOM 1993  C CA   . GLY B 2 8  ? 1.022   8.228   -4.490  1.00 0.00 ? 8  GLY B CA   3  
ATOM 1994  C C    . GLY B 2 8  ? 0.290   6.996   -5.021  1.00 0.00 ? 8  GLY B C    3  
ATOM 1995  O O    . GLY B 2 8  ? -0.303  6.245   -4.276  1.00 0.00 ? 8  GLY B O    3  
ATOM 1996  H H    . GLY B 2 8  ? 1.665   7.628   -2.523  1.00 0.00 ? 8  GLY B H    3  
ATOM 1997  H HA2  . GLY B 2 8  ? 0.306   8.924   -4.073  1.00 0.00 ? 8  GLY B HA2  3  
ATOM 1998  H HA3  . GLY B 2 8  ? 1.559   8.703   -5.299  1.00 0.00 ? 8  GLY B HA3  3  
ATOM 1999  N N    . SER B 2 9  ? 0.330   6.782   -6.309  1.00 0.00 ? 9  SER B N    3  
ATOM 2000  C CA   . SER B 2 9  ? -0.364  5.596   -6.888  1.00 0.00 ? 9  SER B CA   3  
ATOM 2001  C C    . SER B 2 9  ? 0.495   4.347   -6.673  1.00 0.00 ? 9  SER B C    3  
ATOM 2002  O O    . SER B 2 9  ? 0.039   3.234   -6.837  1.00 0.00 ? 9  SER B O    3  
ATOM 2003  C CB   . SER B 2 9  ? -0.581  5.815   -8.384  1.00 0.00 ? 9  SER B CB   3  
ATOM 2004  O OG   . SER B 2 9  ? 0.371   6.756   -8.863  1.00 0.00 ? 9  SER B OG   3  
ATOM 2005  H H    . SER B 2 9  ? 0.814   7.400   -6.894  1.00 0.00 ? 9  SER B H    3  
ATOM 2006  H HA   . SER B 2 9  ? -1.319  5.464   -6.400  1.00 0.00 ? 9  SER B HA   3  
ATOM 2007  H HB2  . SER B 2 9  ? -0.453  4.884   -8.909  1.00 0.00 ? 9  SER B HB2  3  
ATOM 2008  H HB3  . SER B 2 9  ? -1.582  6.186   -8.552  1.00 0.00 ? 9  SER B HB3  3  
ATOM 2009  H HG   . SER B 2 9  ? 1.123   6.269   -9.207  1.00 0.00 ? 9  SER B HG   3  
ATOM 2010  N N    . HIS B 2 10 ? 1.736   4.524   -6.306  1.00 0.00 ? 10 HIS B N    3  
ATOM 2011  C CA   . HIS B 2 10 ? 2.621   3.346   -6.084  1.00 0.00 ? 10 HIS B CA   3  
ATOM 2012  C C    . HIS B 2 10 ? 2.044   2.472   -4.969  1.00 0.00 ? 10 HIS B C    3  
ATOM 2013  O O    . HIS B 2 10 ? 2.054   1.261   -5.052  1.00 0.00 ? 10 HIS B O    3  
ATOM 2014  C CB   . HIS B 2 10 ? 4.016   3.822   -5.683  1.00 0.00 ? 10 HIS B CB   3  
ATOM 2015  C CG   . HIS B 2 10 ? 4.928   3.766   -6.879  1.00 0.00 ? 10 HIS B CG   3  
ATOM 2016  N ND1  . HIS B 2 10 ? 4.915   4.740   -7.865  1.00 0.00 ? 10 HIS B ND1  3  
ATOM 2017  C CD2  . HIS B 2 10 ? 5.883   2.857   -7.263  1.00 0.00 ? 10 HIS B CD2  3  
ATOM 2018  C CE1  . HIS B 2 10 ? 5.837   4.399   -8.785  1.00 0.00 ? 10 HIS B CE1  3  
ATOM 2019  N NE2  . HIS B 2 10 ? 6.455   3.258   -8.466  1.00 0.00 ? 10 HIS B NE2  3  
ATOM 2020  H H    . HIS B 2 10 ? 2.086   5.430   -6.179  1.00 0.00 ? 10 HIS B H    3  
ATOM 2021  H HA   . HIS B 2 10 ? 2.688   2.769   -6.992  1.00 0.00 ? 10 HIS B HA   3  
ATOM 2022  H HB2  . HIS B 2 10 ? 3.962   4.839   -5.320  1.00 0.00 ? 10 HIS B HB2  3  
ATOM 2023  H HB3  . HIS B 2 10 ? 4.404   3.184   -4.906  1.00 0.00 ? 10 HIS B HB3  3  
ATOM 2024  H HD1  . HIS B 2 10 ? 4.341   5.534   -7.889  1.00 0.00 ? 10 HIS B HD1  3  
ATOM 2025  H HD2  . HIS B 2 10 ? 6.149   1.965   -6.715  1.00 0.00 ? 10 HIS B HD2  3  
ATOM 2026  H HE1  . HIS B 2 10 ? 6.049   4.975   -9.674  1.00 0.00 ? 10 HIS B HE1  3  
ATOM 2027  N N    . LEU B 2 11 ? 1.541   3.073   -3.924  1.00 0.00 ? 11 LEU B N    3  
ATOM 2028  C CA   . LEU B 2 11 ? 0.967   2.263   -2.814  1.00 0.00 ? 11 LEU B CA   3  
ATOM 2029  C C    . LEU B 2 11 ? -0.237  1.475   -3.328  1.00 0.00 ? 11 LEU B C    3  
ATOM 2030  O O    . LEU B 2 11 ? -0.498  0.373   -2.892  1.00 0.00 ? 11 LEU B O    3  
ATOM 2031  C CB   . LEU B 2 11 ? 0.534   3.181   -1.670  1.00 0.00 ? 11 LEU B CB   3  
ATOM 2032  C CG   . LEU B 2 11 ? 1.077   2.625   -0.353  1.00 0.00 ? 11 LEU B CG   3  
ATOM 2033  C CD1  . LEU B 2 11 ? 1.512   3.779   0.552   1.00 0.00 ? 11 LEU B CD1  3  
ATOM 2034  C CD2  . LEU B 2 11 ? -0.013  1.801   0.337   1.00 0.00 ? 11 LEU B CD2  3  
ATOM 2035  H H    . LEU B 2 11 ? 1.541   4.051   -3.872  1.00 0.00 ? 11 LEU B H    3  
ATOM 2036  H HA   . LEU B 2 11 ? 1.715   1.571   -2.453  1.00 0.00 ? 11 LEU B HA   3  
ATOM 2037  H HB2  . LEU B 2 11 ? 0.931   4.173   -1.835  1.00 0.00 ? 11 LEU B HB2  3  
ATOM 2038  H HB3  . LEU B 2 11 ? -0.543  3.224   -1.627  1.00 0.00 ? 11 LEU B HB3  3  
ATOM 2039  H HG   . LEU B 2 11 ? 1.929   1.993   -0.558  1.00 0.00 ? 11 LEU B HG   3  
ATOM 2040  H HD11 . LEU B 2 11 ? 0.738   4.535   0.575   1.00 0.00 ? 11 LEU B HD11 3  
ATOM 2041  H HD12 . LEU B 2 11 ? 1.681   3.410   1.554   1.00 0.00 ? 11 LEU B HD12 3  
ATOM 2042  H HD13 . LEU B 2 11 ? 2.426   4.211   0.169   1.00 0.00 ? 11 LEU B HD13 3  
ATOM 2043  H HD21 . LEU B 2 11 ? -0.484  1.148   -0.384  1.00 0.00 ? 11 LEU B HD21 3  
ATOM 2044  H HD22 . LEU B 2 11 ? 0.428   1.209   1.125   1.00 0.00 ? 11 LEU B HD22 3  
ATOM 2045  H HD23 . LEU B 2 11 ? -0.756  2.464   0.760   1.00 0.00 ? 11 LEU B HD23 3  
ATOM 2046  N N    . VAL B 2 12 ? -0.967  2.021   -4.263  1.00 0.00 ? 12 VAL B N    3  
ATOM 2047  C CA   . VAL B 2 12 ? -2.135  1.280   -4.805  1.00 0.00 ? 12 VAL B CA   3  
ATOM 2048  C C    . VAL B 2 12 ? -1.627  0.026   -5.519  1.00 0.00 ? 12 VAL B C    3  
ATOM 2049  O O    . VAL B 2 12 ? -2.331  -0.956  -5.654  1.00 0.00 ? 12 VAL B O    3  
ATOM 2050  C CB   . VAL B 2 12 ? -2.896  2.170   -5.791  1.00 0.00 ? 12 VAL B CB   3  
ATOM 2051  C CG1  . VAL B 2 12 ? -3.832  1.315   -6.646  1.00 0.00 ? 12 VAL B CG1  3  
ATOM 2052  C CG2  . VAL B 2 12 ? -3.716  3.196   -5.010  1.00 0.00 ? 12 VAL B CG2  3  
ATOM 2053  H H    . VAL B 2 12 ? -0.740  2.908   -4.613  1.00 0.00 ? 12 VAL B H    3  
ATOM 2054  H HA   . VAL B 2 12 ? -2.789  0.996   -3.995  1.00 0.00 ? 12 VAL B HA   3  
ATOM 2055  H HB   . VAL B 2 12 ? -2.190  2.683   -6.431  1.00 0.00 ? 12 VAL B HB   3  
ATOM 2056  H HG11 . VAL B 2 12 ? -3.950  0.343   -6.190  1.00 0.00 ? 12 VAL B HG11 3  
ATOM 2057  H HG12 . VAL B 2 12 ? -4.796  1.798   -6.718  1.00 0.00 ? 12 VAL B HG12 3  
ATOM 2058  H HG13 . VAL B 2 12 ? -3.412  1.200   -7.636  1.00 0.00 ? 12 VAL B HG13 3  
ATOM 2059  H HG21 . VAL B 2 12 ? -4.085  2.744   -4.100  1.00 0.00 ? 12 VAL B HG21 3  
ATOM 2060  H HG22 . VAL B 2 12 ? -3.092  4.043   -4.766  1.00 0.00 ? 12 VAL B HG22 3  
ATOM 2061  H HG23 . VAL B 2 12 ? -4.551  3.523   -5.612  1.00 0.00 ? 12 VAL B HG23 3  
ATOM 2062  N N    . GLU B 2 13 ? -0.400  0.053   -5.968  1.00 0.00 ? 13 GLU B N    3  
ATOM 2063  C CA   . GLU B 2 13 ? 0.169   -1.134  -6.662  1.00 0.00 ? 13 GLU B CA   3  
ATOM 2064  C C    . GLU B 2 13 ? 0.515   -2.196  -5.617  1.00 0.00 ? 13 GLU B C    3  
ATOM 2065  O O    . GLU B 2 13 ? 0.601   -3.372  -5.914  1.00 0.00 ? 13 GLU B O    3  
ATOM 2066  C CB   . GLU B 2 13 ? 1.435   -0.727  -7.419  1.00 0.00 ? 13 GLU B CB   3  
ATOM 2067  C CG   . GLU B 2 13 ? 1.050   0.105   -8.643  1.00 0.00 ? 13 GLU B CG   3  
ATOM 2068  C CD   . GLU B 2 13 ? 2.195   0.080   -9.657  1.00 0.00 ? 13 GLU B CD   3  
ATOM 2069  O OE1  . GLU B 2 13 ? 3.110   -0.706  -9.469  1.00 0.00 ? 13 GLU B OE1  3  
ATOM 2070  O OE2  . GLU B 2 13 ? 2.140   0.846   -10.603 1.00 0.00 ? 13 GLU B OE2  3  
ATOM 2071  H H    . GLU B 2 13 ? 0.149   0.855   -5.839  1.00 0.00 ? 13 GLU B H    3  
ATOM 2072  H HA   . GLU B 2 13 ? -0.558  -1.532  -7.355  1.00 0.00 ? 13 GLU B HA   3  
ATOM 2073  H HB2  . GLU B 2 13 ? 2.070   -0.142  -6.768  1.00 0.00 ? 13 GLU B HB2  3  
ATOM 2074  H HB3  . GLU B 2 13 ? 1.964   -1.613  -7.739  1.00 0.00 ? 13 GLU B HB3  3  
ATOM 2075  H HG2  . GLU B 2 13 ? 0.159   -0.308  -9.095  1.00 0.00 ? 13 GLU B HG2  3  
ATOM 2076  H HG3  . GLU B 2 13 ? 0.863   1.124   -8.342  1.00 0.00 ? 13 GLU B HG3  3  
ATOM 2077  N N    . ALA B 2 14 ? 0.704   -1.789  -4.392  1.00 0.00 ? 14 ALA B N    3  
ATOM 2078  C CA   . ALA B 2 14 ? 1.034   -2.769  -3.322  1.00 0.00 ? 14 ALA B CA   3  
ATOM 2079  C C    . ALA B 2 14 ? -0.236  -3.077  -2.526  1.00 0.00 ? 14 ALA B C    3  
ATOM 2080  O O    . ALA B 2 14 ? -0.284  -4.009  -1.747  1.00 0.00 ? 14 ALA B O    3  
ATOM 2081  C CB   . ALA B 2 14 ? 2.091   -2.171  -2.390  1.00 0.00 ? 14 ALA B CB   3  
ATOM 2082  H H    . ALA B 2 14 ? 0.623   -0.837  -4.175  1.00 0.00 ? 14 ALA B H    3  
ATOM 2083  H HA   . ALA B 2 14 ? 1.411   -3.677  -3.766  1.00 0.00 ? 14 ALA B HA   3  
ATOM 2084  H HB1  . ALA B 2 14 ? 1.777   -1.188  -2.075  1.00 0.00 ? 14 ALA B HB1  3  
ATOM 2085  H HB2  . ALA B 2 14 ? 2.206   -2.807  -1.525  1.00 0.00 ? 14 ALA B HB2  3  
ATOM 2086  H HB3  . ALA B 2 14 ? 3.032   -2.100  -2.913  1.00 0.00 ? 14 ALA B HB3  3  
ATOM 2087  N N    . LEU B 2 15 ? -1.267  -2.296  -2.716  1.00 0.00 ? 15 LEU B N    3  
ATOM 2088  C CA   . LEU B 2 15 ? -2.536  -2.540  -1.975  1.00 0.00 ? 15 LEU B CA   3  
ATOM 2089  C C    . LEU B 2 15 ? -3.339  -3.624  -2.694  1.00 0.00 ? 15 LEU B C    3  
ATOM 2090  O O    . LEU B 2 15 ? -3.782  -4.583  -2.093  1.00 0.00 ? 15 LEU B O    3  
ATOM 2091  C CB   . LEU B 2 15 ? -3.355  -1.248  -1.930  1.00 0.00 ? 15 LEU B CB   3  
ATOM 2092  C CG   . LEU B 2 15 ? -2.751  -0.299  -0.894  1.00 0.00 ? 15 LEU B CG   3  
ATOM 2093  C CD1  . LEU B 2 15 ? -3.434  1.066   -0.992  1.00 0.00 ? 15 LEU B CD1  3  
ATOM 2094  C CD2  . LEU B 2 15 ? -2.960  -0.874  0.507   1.00 0.00 ? 15 LEU B CD2  3  
ATOM 2095  H H    . LEU B 2 15 ? -1.207  -1.551  -3.350  1.00 0.00 ? 15 LEU B H    3  
ATOM 2096  H HA   . LEU B 2 15 ? -2.311  -2.860  -0.969  1.00 0.00 ? 15 LEU B HA   3  
ATOM 2097  H HB2  . LEU B 2 15 ? -3.342  -0.778  -2.902  1.00 0.00 ? 15 LEU B HB2  3  
ATOM 2098  H HB3  . LEU B 2 15 ? -4.374  -1.477  -1.652  1.00 0.00 ? 15 LEU B HB3  3  
ATOM 2099  H HG   . LEU B 2 15 ? -1.693  -0.187  -1.084  1.00 0.00 ? 15 LEU B HG   3  
ATOM 2100  H HD11 . LEU B 2 15 ? -4.352  0.966   -1.551  1.00 0.00 ? 15 LEU B HD11 3  
ATOM 2101  H HD12 . LEU B 2 15 ? -3.653  1.431   0.000   1.00 0.00 ? 15 LEU B HD12 3  
ATOM 2102  H HD13 . LEU B 2 15 ? -2.779  1.761   -1.496  1.00 0.00 ? 15 LEU B HD13 3  
ATOM 2103  H HD21 . LEU B 2 15 ? -3.672  -1.687  0.462   1.00 0.00 ? 15 LEU B HD21 3  
ATOM 2104  H HD22 . LEU B 2 15 ? -2.021  -1.242  0.891   1.00 0.00 ? 15 LEU B HD22 3  
ATOM 2105  H HD23 . LEU B 2 15 ? -3.339  -0.103  1.161   1.00 0.00 ? 15 LEU B HD23 3  
ATOM 2106  N N    . HIS B 2 16 ? -3.527  -3.481  -3.979  1.00 0.00 ? 16 HIS B N    3  
ATOM 2107  C CA   . HIS B 2 16 ? -4.295  -4.510  -4.734  1.00 0.00 ? 16 HIS B CA   3  
ATOM 2108  C C    . HIS B 2 16 ? -3.589  -5.858  -4.594  1.00 0.00 ? 16 HIS B C    3  
ATOM 2109  O O    . HIS B 2 16 ? -4.212  -6.899  -4.553  1.00 0.00 ? 16 HIS B O    3  
ATOM 2110  C CB   . HIS B 2 16 ? -4.375  -4.103  -6.214  1.00 0.00 ? 16 HIS B CB   3  
ATOM 2111  C CG   . HIS B 2 16 ? -3.081  -4.430  -6.908  1.00 0.00 ? 16 HIS B CG   3  
ATOM 2112  N ND1  . HIS B 2 16 ? -3.020  -5.283  -8.001  1.00 0.00 ? 16 HIS B ND1  3  
ATOM 2113  C CD2  . HIS B 2 16 ? -1.795  -4.023  -6.677  1.00 0.00 ? 16 HIS B CD2  3  
ATOM 2114  C CE1  . HIS B 2 16 ? -1.731  -5.358  -8.380  1.00 0.00 ? 16 HIS B CE1  3  
ATOM 2115  N NE2  . HIS B 2 16 ? -0.941  -4.608  -7.606  1.00 0.00 ? 16 HIS B NE2  3  
ATOM 2116  H H    . HIS B 2 16 ? -3.160  -2.703  -4.444  1.00 0.00 ? 16 HIS B H    3  
ATOM 2117  H HA   . HIS B 2 16 ? -5.295  -4.582  -4.328  1.00 0.00 ? 16 HIS B HA   3  
ATOM 2118  H HB2  . HIS B 2 16 ? -5.183  -4.634  -6.691  1.00 0.00 ? 16 HIS B HB2  3  
ATOM 2119  H HB3  . HIS B 2 16 ? -4.555  -3.041  -6.281  1.00 0.00 ? 16 HIS B HB3  3  
ATOM 2120  H HD1  . HIS B 2 16 ? -3.776  -5.745  -8.419  1.00 0.00 ? 16 HIS B HD1  3  
ATOM 2121  H HD2  . HIS B 2 16 ? -1.494  -3.352  -5.889  1.00 0.00 ? 16 HIS B HD2  3  
ATOM 2122  H HE1  . HIS B 2 16 ? -1.377  -5.951  -9.210  1.00 0.00 ? 16 HIS B HE1  3  
ATOM 2123  N N    . LEU B 2 17 ? -2.287  -5.839  -4.512  1.00 0.00 ? 17 LEU B N    3  
ATOM 2124  C CA   . LEU B 2 17 ? -1.528  -7.111  -4.364  1.00 0.00 ? 17 LEU B CA   3  
ATOM 2125  C C    . LEU B 2 17 ? -1.937  -7.785  -3.055  1.00 0.00 ? 17 LEU B C    3  
ATOM 2126  O O    . LEU B 2 17 ? -1.960  -8.997  -2.946  1.00 0.00 ? 17 LEU B O    3  
ATOM 2127  C CB   . LEU B 2 17 ? -0.031  -6.801  -4.339  1.00 0.00 ? 17 LEU B CB   3  
ATOM 2128  C CG   . LEU B 2 17 ? 0.761   -8.099  -4.186  1.00 0.00 ? 17 LEU B CG   3  
ATOM 2129  C CD1  . LEU B 2 17 ? 0.488   -9.013  -5.384  1.00 0.00 ? 17 LEU B CD1  3  
ATOM 2130  C CD2  . LEU B 2 17 ? 2.253   -7.773  -4.125  1.00 0.00 ? 17 LEU B CD2  3  
ATOM 2131  H H    . LEU B 2 17 ? -1.809  -4.986  -4.542  1.00 0.00 ? 17 LEU B H    3  
ATOM 2132  H HA   . LEU B 2 17 ? -1.751  -7.765  -5.195  1.00 0.00 ? 17 LEU B HA   3  
ATOM 2133  H HB2  . LEU B 2 17 ? 0.251   -6.315  -5.263  1.00 0.00 ? 17 LEU B HB2  3  
ATOM 2134  H HB3  . LEU B 2 17 ? 0.189   -6.149  -3.508  1.00 0.00 ? 17 LEU B HB3  3  
ATOM 2135  H HG   . LEU B 2 17 ? 0.461   -8.599  -3.276  1.00 0.00 ? 17 LEU B HG   3  
ATOM 2136  H HD11 . LEU B 2 17 ? 0.061   -8.432  -6.188  1.00 0.00 ? 17 LEU B HD11 3  
ATOM 2137  H HD12 . LEU B 2 17 ? 1.415   -9.459  -5.714  1.00 0.00 ? 17 LEU B HD12 3  
ATOM 2138  H HD13 . LEU B 2 17 ? -0.202  -9.790  -5.093  1.00 0.00 ? 17 LEU B HD13 3  
ATOM 2139  H HD21 . LEU B 2 17 ? 2.399   -6.724  -4.327  1.00 0.00 ? 17 LEU B HD21 3  
ATOM 2140  H HD22 . LEU B 2 17 ? 2.632   -8.006  -3.138  1.00 0.00 ? 17 LEU B HD22 3  
ATOM 2141  H HD23 . LEU B 2 17 ? 2.781   -8.361  -4.861  1.00 0.00 ? 17 LEU B HD23 3  
ATOM 2142  N N    . VAL B 2 18 ? -2.268  -7.007  -2.060  1.00 0.00 ? 18 VAL B N    3  
ATOM 2143  C CA   . VAL B 2 18 ? -2.685  -7.596  -0.757  1.00 0.00 ? 18 VAL B CA   3  
ATOM 2144  C C    . VAL B 2 18 ? -4.065  -8.239  -0.921  1.00 0.00 ? 18 VAL B C    3  
ATOM 2145  O O    . VAL B 2 18 ? -4.382  -9.223  -0.282  1.00 0.00 ? 18 VAL B O    3  
ATOM 2146  C CB   . VAL B 2 18 ? -2.755  -6.492  0.302   1.00 0.00 ? 18 VAL B CB   3  
ATOM 2147  C CG1  . VAL B 2 18 ? -3.089  -7.109  1.662   1.00 0.00 ? 18 VAL B CG1  3  
ATOM 2148  C CG2  . VAL B 2 18 ? -1.402  -5.782  0.383   1.00 0.00 ? 18 VAL B CG2  3  
ATOM 2149  H H    . VAL B 2 18 ? -2.247  -6.034  -2.174  1.00 0.00 ? 18 VAL B H    3  
ATOM 2150  H HA   . VAL B 2 18 ? -1.970  -8.345  -0.453  1.00 0.00 ? 18 VAL B HA   3  
ATOM 2151  H HB   . VAL B 2 18 ? -3.521  -5.781  0.030   1.00 0.00 ? 18 VAL B HB   3  
ATOM 2152  H HG11 . VAL B 2 18 ? -3.117  -8.185  1.573   1.00 0.00 ? 18 VAL B HG11 3  
ATOM 2153  H HG12 . VAL B 2 18 ? -2.333  -6.828  2.380   1.00 0.00 ? 18 VAL B HG12 3  
ATOM 2154  H HG13 . VAL B 2 18 ? -4.052  -6.750  1.993   1.00 0.00 ? 18 VAL B HG13 3  
ATOM 2155  H HG21 . VAL B 2 18 ? -0.667  -6.340  -0.176  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 2156  H HG22 . VAL B 2 18 ? -1.493  -4.789  -0.031  1.00 0.00 ? 18 VAL B HG22 3  
ATOM 2157  H HG23 . VAL B 2 18 ? -1.093  -5.714  1.416   1.00 0.00 ? 18 VAL B HG23 3  
ATOM 2158  N N    . CYS B 2 19 ? -4.883  -7.692  -1.778  1.00 0.00 ? 19 CYS B N    3  
ATOM 2159  C CA   . CYS B 2 19 ? -6.237  -8.271  -1.994  1.00 0.00 ? 19 CYS B CA   3  
ATOM 2160  C C    . CYS B 2 19 ? -6.345  -8.770  -3.436  1.00 0.00 ? 19 CYS B C    3  
ATOM 2161  O O    . CYS B 2 19 ? -6.082  -9.922  -3.723  1.00 0.00 ? 19 CYS B O    3  
ATOM 2162  C CB   . CYS B 2 19 ? -7.297  -7.200  -1.746  1.00 0.00 ? 19 CYS B CB   3  
ATOM 2163  S SG   . CYS B 2 19 ? -8.181  -7.568  -0.208  1.00 0.00 ? 19 CYS B SG   3  
ATOM 2164  H H    . CYS B 2 19 ? -4.602  -6.901  -2.284  1.00 0.00 ? 19 CYS B H    3  
ATOM 2165  H HA   . CYS B 2 19 ? -6.394  -9.092  -1.316  1.00 0.00 ? 19 CYS B HA   3  
ATOM 2166  H HB2  . CYS B 2 19 ? -6.823  -6.232  -1.667  1.00 0.00 ? 19 CYS B HB2  3  
ATOM 2167  H HB3  . CYS B 2 19 ? -7.994  -7.194  -2.566  1.00 0.00 ? 19 CYS B HB3  3  
ATOM 2168  N N    . GLY B 2 20 ? -6.721  -7.914  -4.347  1.00 0.00 ? 20 GLY B N    3  
ATOM 2169  C CA   . GLY B 2 20 ? -6.836  -8.344  -5.770  1.00 0.00 ? 20 GLY B CA   3  
ATOM 2170  C C    . GLY B 2 20 ? -8.251  -8.833  -6.054  1.00 0.00 ? 20 GLY B C    3  
ATOM 2171  O O    . GLY B 2 20 ? -9.087  -8.105  -6.550  1.00 0.00 ? 20 GLY B O    3  
ATOM 2172  H H    . GLY B 2 20 ? -6.924  -6.988  -4.096  1.00 0.00 ? 20 GLY B H    3  
ATOM 2173  H HA2  . GLY B 2 20 ? -6.609  -7.517  -6.414  1.00 0.00 ? 20 GLY B HA2  3  
ATOM 2174  H HA3  . GLY B 2 20 ? -6.140  -9.146  -5.957  1.00 0.00 ? 20 GLY B HA3  3  
ATOM 2175  N N    . GLU B 2 21 ? -8.512  -10.068 -5.750  1.00 0.00 ? 21 GLU B N    3  
ATOM 2176  C CA   . GLU B 2 21 ? -9.862  -10.652 -5.998  1.00 0.00 ? 21 GLU B CA   3  
ATOM 2177  C C    . GLU B 2 21 ? -10.948 -9.616  -5.692  1.00 0.00 ? 21 GLU B C    3  
ATOM 2178  O O    . GLU B 2 21 ? -11.657 -9.168  -6.573  1.00 0.00 ? 21 GLU B O    3  
ATOM 2179  C CB   . GLU B 2 21 ? -10.061 -11.873 -5.096  1.00 0.00 ? 21 GLU B CB   3  
ATOM 2180  C CG   . GLU B 2 21 ? -9.396  -13.095 -5.733  1.00 0.00 ? 21 GLU B CG   3  
ATOM 2181  C CD   . GLU B 2 21 ? -8.250  -13.574 -4.839  1.00 0.00 ? 21 GLU B CD   3  
ATOM 2182  O OE1  . GLU B 2 21 ? -8.531  -14.209 -3.837  1.00 0.00 ? 21 GLU B OE1  3  
ATOM 2183  O OE2  . GLU B 2 21 ? -7.109  -13.298 -5.175  1.00 0.00 ? 21 GLU B OE2  3  
ATOM 2184  H H    . GLU B 2 21 ? -7.804  -10.621 -5.363  1.00 0.00 ? 21 GLU B H    3  
ATOM 2185  H HA   . GLU B 2 21 ? -9.938  -10.956 -7.032  1.00 0.00 ? 21 GLU B HA   3  
ATOM 2186  H HB2  . GLU B 2 21 ? -9.615  -11.681 -4.131  1.00 0.00 ? 21 GLU B HB2  3  
ATOM 2187  H HB3  . GLU B 2 21 ? -11.116 -12.063 -4.974  1.00 0.00 ? 21 GLU B HB3  3  
ATOM 2188  H HG2  . GLU B 2 21 ? -10.123 -13.885 -5.840  1.00 0.00 ? 21 GLU B HG2  3  
ATOM 2189  H HG3  . GLU B 2 21 ? -9.006  -12.828 -6.703  1.00 0.00 ? 21 GLU B HG3  3  
ATOM 2190  N N    . ARG B 2 22 ? -11.091 -9.237  -4.453  1.00 0.00 ? 22 ARG B N    3  
ATOM 2191  C CA   . ARG B 2 22 ? -12.138 -8.237  -4.095  1.00 0.00 ? 22 ARG B CA   3  
ATOM 2192  C C    . ARG B 2 22 ? -11.643 -6.825  -4.421  1.00 0.00 ? 22 ARG B C    3  
ATOM 2193  O O    . ARG B 2 22 ? -12.063 -6.216  -5.385  1.00 0.00 ? 22 ARG B O    3  
ATOM 2194  C CB   . ARG B 2 22 ? -12.448 -8.336  -2.601  1.00 0.00 ? 22 ARG B CB   3  
ATOM 2195  C CG   . ARG B 2 22 ? -13.201 -9.637  -2.322  1.00 0.00 ? 22 ARG B CG   3  
ATOM 2196  C CD   . ARG B 2 22 ? -14.546 -9.316  -1.670  1.00 0.00 ? 22 ARG B CD   3  
ATOM 2197  N NE   . ARG B 2 22 ? -15.398 -10.538 -1.666  1.00 0.00 ? 22 ARG B NE   3  
ATOM 2198  C CZ   . ARG B 2 22 ? -16.461 -10.594 -0.909  1.00 0.00 ? 22 ARG B CZ   3  
ATOM 2199  N NH1  . ARG B 2 22 ? -16.784 -9.580  -0.154  1.00 0.00 ? 22 ARG B NH1  3  
ATOM 2200  N NH2  . ARG B 2 22 ? -17.203 -11.668 -0.910  1.00 0.00 ? 22 ARG B NH2  3  
ATOM 2201  H H    . ARG B 2 22 ? -10.513 -9.613  -3.755  1.00 0.00 ? 22 ARG B H    3  
ATOM 2202  H HA   . ARG B 2 22 ? -13.035 -8.441  -4.661  1.00 0.00 ? 22 ARG B HA   3  
ATOM 2203  H HB2  . ARG B 2 22 ? -11.524 -8.325  -2.041  1.00 0.00 ? 22 ARG B HB2  3  
ATOM 2204  H HB3  . ARG B 2 22 ? -13.060 -7.498  -2.304  1.00 0.00 ? 22 ARG B HB3  3  
ATOM 2205  H HG2  . ARG B 2 22 ? -13.364 -10.164 -3.250  1.00 0.00 ? 22 ARG B HG2  3  
ATOM 2206  H HG3  . ARG B 2 22 ? -12.617 -10.254 -1.656  1.00 0.00 ? 22 ARG B HG3  3  
ATOM 2207  H HD2  . ARG B 2 22 ? -14.385 -8.986  -0.655  1.00 0.00 ? 22 ARG B HD2  3  
ATOM 2208  H HD3  . ARG B 2 22 ? -15.039 -8.535  -2.228  1.00 0.00 ? 22 ARG B HD3  3  
ATOM 2209  H HE   . ARG B 2 22 ? -15.160 -11.302 -2.232  1.00 0.00 ? 22 ARG B HE   3  
ATOM 2210  H HH11 . ARG B 2 22 ? -16.219 -8.757  -0.151  1.00 0.00 ? 22 ARG B HH11 3  
ATOM 2211  H HH12 . ARG B 2 22 ? -17.601 -9.626  0.424   1.00 0.00 ? 22 ARG B HH12 3  
ATOM 2212  H HH21 . ARG B 2 22 ? -16.957 -12.447 -1.489  1.00 0.00 ? 22 ARG B HH21 3  
ATOM 2213  H HH22 . ARG B 2 22 ? -18.017 -11.713 -0.331  1.00 0.00 ? 22 ARG B HH22 3  
ATOM 2214  N N    . GLY B 2 23 ? -10.755 -6.298  -3.622  1.00 0.00 ? 23 GLY B N    3  
ATOM 2215  C CA   . GLY B 2 23 ? -10.240 -4.925  -3.886  1.00 0.00 ? 23 GLY B CA   3  
ATOM 2216  C C    . GLY B 2 23 ? -9.859  -4.262  -2.561  1.00 0.00 ? 23 GLY B C    3  
ATOM 2217  O O    . GLY B 2 23 ? -9.921  -4.875  -1.512  1.00 0.00 ? 23 GLY B O    3  
ATOM 2218  H H    . GLY B 2 23 ? -10.430 -6.803  -2.849  1.00 0.00 ? 23 GLY B H    3  
ATOM 2219  H HA2  . GLY B 2 23 ? -9.371  -4.983  -4.527  1.00 0.00 ? 23 GLY B HA2  3  
ATOM 2220  H HA3  . GLY B 2 23 ? -11.007 -4.337  -4.369  1.00 0.00 ? 23 GLY B HA3  3  
ATOM 2221  N N    . PHE B 2 24 ? -9.464  -3.020  -2.594  1.00 0.00 ? 24 PHE B N    3  
ATOM 2222  C CA   . PHE B 2 24 ? -9.080  -2.330  -1.331  1.00 0.00 ? 24 PHE B CA   3  
ATOM 2223  C C    . PHE B 2 24 ? -9.683  -0.924  -1.309  1.00 0.00 ? 24 PHE B C    3  
ATOM 2224  O O    . PHE B 2 24 ? -10.184 -0.437  -2.303  1.00 0.00 ? 24 PHE B O    3  
ATOM 2225  C CB   . PHE B 2 24 ? -7.555  -2.235  -1.249  1.00 0.00 ? 24 PHE B CB   3  
ATOM 2226  C CG   . PHE B 2 24 ? -7.007  -1.786  -2.579  1.00 0.00 ? 24 PHE B CG   3  
ATOM 2227  C CD1  . PHE B 2 24 ? -6.928  -2.700  -3.631  1.00 0.00 ? 24 PHE B CD1  3  
ATOM 2228  C CD2  . PHE B 2 24 ? -6.584  -0.464  -2.762  1.00 0.00 ? 24 PHE B CD2  3  
ATOM 2229  C CE1  . PHE B 2 24 ? -6.424  -2.298  -4.873  1.00 0.00 ? 24 PHE B CE1  3  
ATOM 2230  C CE2  . PHE B 2 24 ? -6.081  -0.060  -4.005  1.00 0.00 ? 24 PHE B CE2  3  
ATOM 2231  C CZ   . PHE B 2 24 ? -6.002  -0.976  -5.060  1.00 0.00 ? 24 PHE B CZ   3  
ATOM 2232  H H    . PHE B 2 24 ? -9.421  -2.542  -3.449  1.00 0.00 ? 24 PHE B H    3  
ATOM 2233  H HA   . PHE B 2 24 ? -9.450  -2.892  -0.487  1.00 0.00 ? 24 PHE B HA   3  
ATOM 2234  H HB2  . PHE B 2 24 ? -7.277  -1.525  -0.483  1.00 0.00 ? 24 PHE B HB2  3  
ATOM 2235  H HB3  . PHE B 2 24 ? -7.149  -3.206  -1.008  1.00 0.00 ? 24 PHE B HB3  3  
ATOM 2236  H HD1  . PHE B 2 24 ? -7.254  -3.719  -3.480  1.00 0.00 ? 24 PHE B HD1  3  
ATOM 2237  H HD2  . PHE B 2 24 ? -6.645  0.241   -1.949  1.00 0.00 ? 24 PHE B HD2  3  
ATOM 2238  H HE1  . PHE B 2 24 ? -6.366  -3.005  -5.687  1.00 0.00 ? 24 PHE B HE1  3  
ATOM 2239  H HE2  . PHE B 2 24 ? -5.754  0.960   -4.149  1.00 0.00 ? 24 PHE B HE2  3  
ATOM 2240  H HZ   . PHE B 2 24 ? -5.613  -0.665  -6.019  1.00 0.00 ? 24 PHE B HZ   3  
ATOM 2241  N N    . PHE B 2 25 ? -9.630  -0.269  -0.181  1.00 0.00 ? 25 PHE B N    3  
ATOM 2242  C CA   . PHE B 2 25 ? -10.193 1.106   -0.089  1.00 0.00 ? 25 PHE B CA   3  
ATOM 2243  C C    . PHE B 2 25 ? -9.063  2.088   0.226   1.00 0.00 ? 25 PHE B C    3  
ATOM 2244  O O    . PHE B 2 25 ? -8.983  2.635   1.306   1.00 0.00 ? 25 PHE B O    3  
ATOM 2245  C CB   . PHE B 2 25 ? -11.253 1.159   1.017   1.00 0.00 ? 25 PHE B CB   3  
ATOM 2246  C CG   . PHE B 2 25 ? -10.634 0.778   2.342   1.00 0.00 ? 25 PHE B CG   3  
ATOM 2247  C CD1  . PHE B 2 25 ? -10.353 -0.564  2.624   1.00 0.00 ? 25 PHE B CD1  3  
ATOM 2248  C CD2  . PHE B 2 25 ? -10.344 1.766   3.289   1.00 0.00 ? 25 PHE B CD2  3  
ATOM 2249  C CE1  . PHE B 2 25 ? -9.781  -0.917  3.853   1.00 0.00 ? 25 PHE B CE1  3  
ATOM 2250  C CE2  . PHE B 2 25 ? -9.771  1.414   4.518   1.00 0.00 ? 25 PHE B CE2  3  
ATOM 2251  C CZ   . PHE B 2 25 ? -9.490  0.073   4.799   1.00 0.00 ? 25 PHE B CZ   3  
ATOM 2252  H H    . PHE B 2 25 ? -9.216  -0.682  0.603   1.00 0.00 ? 25 PHE B H    3  
ATOM 2253  H HA   . PHE B 2 25 ? -10.645 1.373   -1.034  1.00 0.00 ? 25 PHE B HA   3  
ATOM 2254  H HB2  . PHE B 2 25 ? -11.654 2.159   1.084   1.00 0.00 ? 25 PHE B HB2  3  
ATOM 2255  H HB3  . PHE B 2 25 ? -12.049 0.468   0.783   1.00 0.00 ? 25 PHE B HB3  3  
ATOM 2256  H HD1  . PHE B 2 25 ? -10.577 -1.329  1.896   1.00 0.00 ? 25 PHE B HD1  3  
ATOM 2257  H HD2  . PHE B 2 25 ? -10.559 2.803   3.072   1.00 0.00 ? 25 PHE B HD2  3  
ATOM 2258  H HE1  . PHE B 2 25 ? -9.563  -1.953  4.069   1.00 0.00 ? 25 PHE B HE1  3  
ATOM 2259  H HE2  . PHE B 2 25 ? -9.548  2.178   5.247   1.00 0.00 ? 25 PHE B HE2  3  
ATOM 2260  H HZ   . PHE B 2 25 ? -9.049  -0.199  5.747   1.00 0.00 ? 25 PHE B HZ   3  
ATOM 2261  N N    . TYR B 2 26 ? -8.185  2.312   -0.712  1.00 0.00 ? 26 TYR B N    3  
ATOM 2262  C CA   . TYR B 2 26 ? -7.056  3.253   -0.467  1.00 0.00 ? 26 TYR B CA   3  
ATOM 2263  C C    . TYR B 2 26 ? -7.593  4.681   -0.374  1.00 0.00 ? 26 TYR B C    3  
ATOM 2264  O O    . TYR B 2 26 ? -8.386  5.111   -1.187  1.00 0.00 ? 26 TYR B O    3  
ATOM 2265  C CB   . TYR B 2 26 ? -6.061  3.155   -1.625  1.00 0.00 ? 26 TYR B CB   3  
ATOM 2266  C CG   . TYR B 2 26 ? -4.825  3.969   -1.313  1.00 0.00 ? 26 TYR B CG   3  
ATOM 2267  C CD1  . TYR B 2 26 ? -4.328  4.029   -0.005  1.00 0.00 ? 26 TYR B CD1  3  
ATOM 2268  C CD2  . TYR B 2 26 ? -4.173  4.661   -2.340  1.00 0.00 ? 26 TYR B CD2  3  
ATOM 2269  C CE1  . TYR B 2 26 ? -3.181  4.783   0.275   1.00 0.00 ? 26 TYR B CE1  3  
ATOM 2270  C CE2  . TYR B 2 26 ? -3.026  5.412   -2.061  1.00 0.00 ? 26 TYR B CE2  3  
ATOM 2271  C CZ   . TYR B 2 26 ? -2.530  5.473   -0.753  1.00 0.00 ? 26 TYR B CZ   3  
ATOM 2272  O OH   . TYR B 2 26 ? -1.399  6.214   -0.477  1.00 0.00 ? 26 TYR B OH   3  
ATOM 2273  H H    . TYR B 2 26 ? -8.266  1.858   -1.578  1.00 0.00 ? 26 TYR B H    3  
ATOM 2274  H HA   . TYR B 2 26 ? -6.564  2.990   0.454   1.00 0.00 ? 26 TYR B HA   3  
ATOM 2275  H HB2  . TYR B 2 26 ? -5.784  2.122   -1.772  1.00 0.00 ? 26 TYR B HB2  3  
ATOM 2276  H HB3  . TYR B 2 26 ? -6.520  3.533   -2.527  1.00 0.00 ? 26 TYR B HB3  3  
ATOM 2277  H HD1  . TYR B 2 26 ? -4.827  3.498   0.791   1.00 0.00 ? 26 TYR B HD1  3  
ATOM 2278  H HD2  . TYR B 2 26 ? -4.556  4.615   -3.349  1.00 0.00 ? 26 TYR B HD2  3  
ATOM 2279  H HE1  . TYR B 2 26 ? -2.799  4.830   1.283   1.00 0.00 ? 26 TYR B HE1  3  
ATOM 2280  H HE2  . TYR B 2 26 ? -2.523  5.944   -2.854  1.00 0.00 ? 26 TYR B HE2  3  
ATOM 2281  H HH   . TYR B 2 26 ? -1.381  6.962   -1.079  1.00 0.00 ? 26 TYR B HH   3  
ATOM 2282  N N    . THR B 2 27 ? -7.167  5.422   0.613   1.00 0.00 ? 27 THR B N    3  
ATOM 2283  C CA   . THR B 2 27 ? -7.659  6.820   0.755   1.00 0.00 ? 27 THR B CA   3  
ATOM 2284  C C    . THR B 2 27 ? -6.471  7.787   0.771   1.00 0.00 ? 27 THR B C    3  
ATOM 2285  O O    . THR B 2 27 ? -6.162  8.369   1.791   1.00 0.00 ? 27 THR B O    3  
ATOM 2286  C CB   . THR B 2 27 ? -8.445  6.957   2.061   1.00 0.00 ? 27 THR B CB   3  
ATOM 2287  O OG1  . THR B 2 27 ? -9.455  5.961   2.110   1.00 0.00 ? 27 THR B OG1  3  
ATOM 2288  C CG2  . THR B 2 27 ? -9.087  8.343   2.129   1.00 0.00 ? 27 THR B CG2  3  
ATOM 2289  H H    . THR B 2 27 ? -6.528  5.058   1.260   1.00 0.00 ? 27 THR B H    3  
ATOM 2290  H HA   . THR B 2 27 ? -8.304  7.057   -0.077  1.00 0.00 ? 27 THR B HA   3  
ATOM 2291  H HB   . THR B 2 27 ? -7.775  6.834   2.899   1.00 0.00 ? 27 THR B HB   3  
ATOM 2292  H HG1  . THR B 2 27 ? -9.032  5.104   2.033   1.00 0.00 ? 27 THR B HG1  3  
ATOM 2293  H HG21 . THR B 2 27 ? -8.873  8.883   1.218   1.00 0.00 ? 27 THR B HG21 3  
ATOM 2294  H HG22 . THR B 2 27 ? -10.156 8.238   2.242   1.00 0.00 ? 27 THR B HG22 3  
ATOM 2295  H HG23 . THR B 2 27 ? -8.687  8.886   2.972   1.00 0.00 ? 27 THR B HG23 3  
ATOM 2296  N N    . PRO B 2 28 ? -5.843  7.929   -0.368  1.00 0.00 ? 28 PRO B N    3  
ATOM 2297  C CA   . PRO B 2 28 ? -4.675  8.823   -0.547  1.00 0.00 ? 28 PRO B CA   3  
ATOM 2298  C C    . PRO B 2 28 ? -5.077  10.273  -0.263  1.00 0.00 ? 28 PRO B C    3  
ATOM 2299  O O    . PRO B 2 28 ? -5.788  10.891  -1.031  1.00 0.00 ? 28 PRO B O    3  
ATOM 2300  C CB   . PRO B 2 28 ? -4.244  8.667   -2.009  1.00 0.00 ? 28 PRO B CB   3  
ATOM 2301  C CG   . PRO B 2 28 ? -5.219  7.678   -2.679  1.00 0.00 ? 28 PRO B CG   3  
ATOM 2302  C CD   . PRO B 2 28 ? -6.220  7.217   -1.610  1.00 0.00 ? 28 PRO B CD   3  
ATOM 2303  H HA   . PRO B 2 28 ? -3.871  8.522   0.107   1.00 0.00 ? 28 PRO B HA   3  
ATOM 2304  H HB2  . PRO B 2 28 ? -4.289  9.625   -2.507  1.00 0.00 ? 28 PRO B HB2  3  
ATOM 2305  H HB3  . PRO B 2 28 ? -3.240  8.273   -2.056  1.00 0.00 ? 28 PRO B HB3  3  
ATOM 2306  H HG2  . PRO B 2 28 ? -5.743  8.172   -3.486  1.00 0.00 ? 28 PRO B HG2  3  
ATOM 2307  H HG3  . PRO B 2 28 ? -4.677  6.827   -3.059  1.00 0.00 ? 28 PRO B HG3  3  
ATOM 2308  H HD2  . PRO B 2 28 ? -7.225  7.480   -1.904  1.00 0.00 ? 28 PRO B HD2  3  
ATOM 2309  H HD3  . PRO B 2 28 ? -6.138  6.151   -1.464  1.00 0.00 ? 28 PRO B HD3  3  
ATOM 2310  N N    . LYS B 2 29 ? -4.625  10.821  0.831   1.00 0.00 ? 29 LYS B N    3  
ATOM 2311  C CA   . LYS B 2 29 ? -4.980  12.230  1.161   1.00 0.00 ? 29 LYS B CA   3  
ATOM 2312  C C    . LYS B 2 29 ? -4.171  12.688  2.376   1.00 0.00 ? 29 LYS B C    3  
ATOM 2313  O O    . LYS B 2 29 ? -4.638  13.454  3.194   1.00 0.00 ? 29 LYS B O    3  
ATOM 2314  C CB   . LYS B 2 29 ? -6.474  12.321  1.477   1.00 0.00 ? 29 LYS B CB   3  
ATOM 2315  C CG   . LYS B 2 29 ? -7.112  13.420  0.626   1.00 0.00 ? 29 LYS B CG   3  
ATOM 2316  C CD   . LYS B 2 29 ? -6.419  14.754  0.908   1.00 0.00 ? 29 LYS B CD   3  
ATOM 2317  C CE   . LYS B 2 29 ? -7.312  15.615  1.804   1.00 0.00 ? 29 LYS B CE   3  
ATOM 2318  N NZ   . LYS B 2 29 ? -6.475  16.617  2.524   1.00 0.00 ? 29 LYS B NZ   3  
ATOM 2319  H H    . LYS B 2 29 ? -4.052  10.306  1.437   1.00 0.00 ? 29 LYS B H    3  
ATOM 2320  H HA   . LYS B 2 29 ? -4.751  12.865  0.317   1.00 0.00 ? 29 LYS B HA   3  
ATOM 2321  H HB2  . LYS B 2 29 ? -6.946  11.373  1.257   1.00 0.00 ? 29 LYS B HB2  3  
ATOM 2322  H HB3  . LYS B 2 29 ? -6.607  12.554  2.524   1.00 0.00 ? 29 LYS B HB3  3  
ATOM 2323  H HG2  . LYS B 2 29 ? -7.004  13.171  -0.422  1.00 0.00 ? 29 LYS B HG2  3  
ATOM 2324  H HG3  . LYS B 2 29 ? -8.159  13.502  0.869   1.00 0.00 ? 29 LYS B HG3  3  
ATOM 2325  H HD2  . LYS B 2 29 ? -5.477  14.572  1.405   1.00 0.00 ? 29 LYS B HD2  3  
ATOM 2326  H HD3  . LYS B 2 29 ? -6.241  15.273  -0.023  1.00 0.00 ? 29 LYS B HD3  3  
ATOM 2327  H HE2  . LYS B 2 29 ? -8.042  16.126  1.197   1.00 0.00 ? 29 LYS B HE2  3  
ATOM 2328  H HE3  . LYS B 2 29 ? -7.816  14.984  2.522   1.00 0.00 ? 29 LYS B HE3  3  
ATOM 2329  H HZ1  . LYS B 2 29 ? -5.533  16.214  2.708   1.00 0.00 ? 29 LYS B HZ1  3  
ATOM 2330  H HZ2  . LYS B 2 29 ? -6.380  17.472  1.941   1.00 0.00 ? 29 LYS B HZ2  3  
ATOM 2331  H HZ3  . LYS B 2 29 ? -6.929  16.863  3.427   1.00 0.00 ? 29 LYS B HZ3  3  
ATOM 2332  N N    . THR B 2 30 ? -2.956  12.225  2.497   1.00 0.00 ? 30 THR B N    3  
ATOM 2333  C CA   . THR B 2 30 ? -2.116  12.633  3.656   1.00 0.00 ? 30 THR B CA   3  
ATOM 2334  C C    . THR B 2 30 ? -0.657  12.755  3.208   1.00 0.00 ? 30 THR B C    3  
ATOM 2335  O O    . THR B 2 30 ? -0.431  12.841  2.013   1.00 0.00 ? 30 THR B O    3  
ATOM 2336  C CB   . THR B 2 30 ? -2.224  11.577  4.761   1.00 0.00 ? 30 THR B CB   3  
ATOM 2337  O OG1  . THR B 2 30 ? -1.639  12.081  5.953   1.00 0.00 ? 30 THR B OG1  3  
ATOM 2338  C CG2  . THR B 2 30 ? -1.493  10.307  4.328   1.00 0.00 ? 30 THR B CG2  3  
ATOM 2339  O OXT  . THR B 2 30 ? 0.207   12.757  4.070   1.00 0.00 ? 30 THR B OXT  3  
ATOM 2340  H H    . THR B 2 30 ? -2.599  11.608  1.825   1.00 0.00 ? 30 THR B H    3  
ATOM 2341  H HA   . THR B 2 30 ? -2.458  13.585  4.033   1.00 0.00 ? 30 THR B HA   3  
ATOM 2342  H HB   . THR B 2 30 ? -3.263  11.346  4.939   1.00 0.00 ? 30 THR B HB   3  
ATOM 2343  H HG1  . THR B 2 30 ? -0.687  11.984  5.882   1.00 0.00 ? 30 THR B HG1  3  
ATOM 2344  H HG21 . THR B 2 30 ? -1.437  10.273  3.250   1.00 0.00 ? 30 THR B HG21 3  
ATOM 2345  H HG22 . THR B 2 30 ? -0.496  10.305  4.740   1.00 0.00 ? 30 THR B HG22 3  
ATOM 2346  H HG23 . THR B 2 30 ? -2.034  9.442   4.687   1.00 0.00 ? 30 THR B HG23 3  
ATOM 2347  N N    . GLY A 1 1  ? -2.220  7.194   7.374   1.00 0.00 ? 1  GLY A N    4  
ATOM 2348  C CA   . GLY A 1 1  ? -2.520  5.749   7.588   1.00 0.00 ? 1  GLY A CA   4  
ATOM 2349  C C    . GLY A 1 1  ? -1.311  4.908   7.185   1.00 0.00 ? 1  GLY A C    4  
ATOM 2350  O O    . GLY A 1 1  ? -0.319  4.839   7.886   1.00 0.00 ? 1  GLY A O    4  
ATOM 2351  H H1   . GLY A 1 1  ? -1.361  7.451   7.899   1.00 0.00 ? 1  GLY A H1   4  
ATOM 2352  H H2   . GLY A 1 1  ? -2.075  7.372   6.359   1.00 0.00 ? 1  GLY A H2   4  
ATOM 2353  H H3   . GLY A 1 1  ? -3.018  7.768   7.715   1.00 0.00 ? 1  GLY A H3   4  
ATOM 2354  H HA2  . GLY A 1 1  ? -2.751  5.575   8.629   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 2355  H HA3  . GLY A 1 1  ? -3.366  5.460   6.977   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 2356  N N    . ILE A 1 2  ? -1.397  4.264   6.059   1.00 0.00 ? 2  ILE A N    4  
ATOM 2357  C CA   . ILE A 1 2  ? -0.274  3.410   5.588   1.00 0.00 ? 2  ILE A CA   4  
ATOM 2358  C C    . ILE A 1 2  ? 0.676   4.251   4.728   1.00 0.00 ? 2  ILE A C    4  
ATOM 2359  O O    . ILE A 1 2  ? 1.866   4.010   4.678   1.00 0.00 ? 2  ILE A O    4  
ATOM 2360  C CB   . ILE A 1 2  ? -0.877  2.262   4.774   1.00 0.00 ? 2  ILE A CB   4  
ATOM 2361  C CG1  . ILE A 1 2  ? 0.040   1.041   4.809   1.00 0.00 ? 2  ILE A CG1  4  
ATOM 2362  C CG2  . ILE A 1 2  ? -1.096  2.695   3.320   1.00 0.00 ? 2  ILE A CG2  4  
ATOM 2363  C CD1  . ILE A 1 2  ? -0.816  -0.217  4.620   1.00 0.00 ? 2  ILE A CD1  4  
ATOM 2364  H H    . ILE A 1 2  ? -2.212  4.335   5.520   1.00 0.00 ? 2  ILE A H    4  
ATOM 2365  H HA   . ILE A 1 2  ? 0.260   3.011   6.437   1.00 0.00 ? 2  ILE A HA   4  
ATOM 2366  H HB   . ILE A 1 2  ? -1.825  1.999   5.214   1.00 0.00 ? 2  ILE A HB   4  
ATOM 2367  H HG12 . ILE A 1 2  ? 0.768   1.111   4.013   1.00 0.00 ? 2  ILE A HG12 4  
ATOM 2368  H HG13 . ILE A 1 2  ? 0.545   0.993   5.761   1.00 0.00 ? 2  ILE A HG13 4  
ATOM 2369  H HG21 . ILE A 1 2  ? -1.740  3.561   3.296   1.00 0.00 ? 2  ILE A HG21 4  
ATOM 2370  H HG22 . ILE A 1 2  ? -0.146  2.939   2.868   1.00 0.00 ? 2  ILE A HG22 4  
ATOM 2371  H HG23 . ILE A 1 2  ? -1.558  1.888   2.770   1.00 0.00 ? 2  ILE A HG23 4  
ATOM 2372  H HD11 . ILE A 1 2  ? -1.469  -0.086  3.766   1.00 0.00 ? 2  ILE A HD11 4  
ATOM 2373  H HD12 . ILE A 1 2  ? -0.177  -1.068  4.454   1.00 0.00 ? 2  ILE A HD12 4  
ATOM 2374  H HD13 . ILE A 1 2  ? -1.412  -0.383  5.503   1.00 0.00 ? 2  ILE A HD13 4  
ATOM 2375  N N    . VAL A 1 3  ? 0.156   5.242   4.054   1.00 0.00 ? 3  VAL A N    4  
ATOM 2376  C CA   . VAL A 1 3  ? 1.021   6.105   3.202   1.00 0.00 ? 3  VAL A CA   4  
ATOM 2377  C C    . VAL A 1 3  ? 2.206   6.603   4.028   1.00 0.00 ? 3  VAL A C    4  
ATOM 2378  O O    . VAL A 1 3  ? 3.307   6.742   3.533   1.00 0.00 ? 3  VAL A O    4  
ATOM 2379  C CB   . VAL A 1 3  ? 0.213   7.302   2.704   1.00 0.00 ? 3  VAL A CB   4  
ATOM 2380  C CG1  . VAL A 1 3  ? 1.157   8.335   2.085   1.00 0.00 ? 3  VAL A CG1  4  
ATOM 2381  C CG2  . VAL A 1 3  ? -0.793  6.836   1.651   1.00 0.00 ? 3  VAL A CG2  4  
ATOM 2382  H H    . VAL A 1 3  ? -0.807  5.420   4.112   1.00 0.00 ? 3  VAL A H    4  
ATOM 2383  H HA   . VAL A 1 3  ? 1.382   5.535   2.358   1.00 0.00 ? 3  VAL A HA   4  
ATOM 2384  H HB   . VAL A 1 3  ? -0.313  7.748   3.536   1.00 0.00 ? 3  VAL A HB   4  
ATOM 2385  H HG11 . VAL A 1 3  ? 2.011   7.832   1.657   1.00 0.00 ? 3  VAL A HG11 4  
ATOM 2386  H HG12 . VAL A 1 3  ? 0.637   8.882   1.312   1.00 0.00 ? 3  VAL A HG12 4  
ATOM 2387  H HG13 . VAL A 1 3  ? 1.491   9.021   2.850   1.00 0.00 ? 3  VAL A HG13 4  
ATOM 2388  H HG21 . VAL A 1 3  ? -0.389  5.986   1.118   1.00 0.00 ? 3  VAL A HG21 4  
ATOM 2389  H HG22 . VAL A 1 3  ? -1.716  6.553   2.134   1.00 0.00 ? 3  VAL A HG22 4  
ATOM 2390  H HG23 . VAL A 1 3  ? -0.983  7.640   0.954   1.00 0.00 ? 3  VAL A HG23 4  
ATOM 2391  N N    . GLU A 1 4  ? 1.987   6.876   5.285   1.00 0.00 ? 4  GLU A N    4  
ATOM 2392  C CA   . GLU A 1 4  ? 3.100   7.368   6.148   1.00 0.00 ? 4  GLU A CA   4  
ATOM 2393  C C    . GLU A 1 4  ? 3.922   6.184   6.668   1.00 0.00 ? 4  GLU A C    4  
ATOM 2394  O O    . GLU A 1 4  ? 4.378   6.182   7.794   1.00 0.00 ? 4  GLU A O    4  
ATOM 2395  C CB   . GLU A 1 4  ? 2.519   8.141   7.336   1.00 0.00 ? 4  GLU A CB   4  
ATOM 2396  C CG   . GLU A 1 4  ? 2.572   9.642   7.045   1.00 0.00 ? 4  GLU A CG   4  
ATOM 2397  C CD   . GLU A 1 4  ? 1.429   10.020  6.104   1.00 0.00 ? 4  GLU A CD   4  
ATOM 2398  O OE1  . GLU A 1 4  ? 0.333   10.238  6.592   1.00 0.00 ? 4  GLU A OE1  4  
ATOM 2399  O OE2  . GLU A 1 4  ? 1.668   10.084  4.909   1.00 0.00 ? 4  GLU A OE2  4  
ATOM 2400  H H    . GLU A 1 4  ? 1.090   6.759   5.662   1.00 0.00 ? 4  GLU A H    4  
ATOM 2401  H HA   . GLU A 1 4  ? 3.738   8.022   5.573   1.00 0.00 ? 4  GLU A HA   4  
ATOM 2402  H HB2  . GLU A 1 4  ? 1.494   7.840   7.494   1.00 0.00 ? 4  GLU A HB2  4  
ATOM 2403  H HB3  . GLU A 1 4  ? 3.099   7.927   8.222   1.00 0.00 ? 4  GLU A HB3  4  
ATOM 2404  H HG2  . GLU A 1 4  ? 2.477   10.191  7.969   1.00 0.00 ? 4  GLU A HG2  4  
ATOM 2405  H HG3  . GLU A 1 4  ? 3.515   9.884   6.579   1.00 0.00 ? 4  GLU A HG3  4  
ATOM 2406  N N    . GLN A 1 5  ? 4.123   5.180   5.858   1.00 0.00 ? 5  GLN A N    4  
ATOM 2407  C CA   . GLN A 1 5  ? 4.922   4.008   6.306   1.00 0.00 ? 5  GLN A CA   4  
ATOM 2408  C C    . GLN A 1 5  ? 5.619   3.389   5.094   1.00 0.00 ? 5  GLN A C    4  
ATOM 2409  O O    . GLN A 1 5  ? 6.817   3.183   5.095   1.00 0.00 ? 5  GLN A O    4  
ATOM 2410  C CB   . GLN A 1 5  ? 3.996   2.974   6.953   1.00 0.00 ? 5  GLN A CB   4  
ATOM 2411  C CG   . GLN A 1 5  ? 4.414   2.759   8.409   1.00 0.00 ? 5  GLN A CG   4  
ATOM 2412  C CD   . GLN A 1 5  ? 3.173   2.766   9.304   1.00 0.00 ? 5  GLN A CD   4  
ATOM 2413  O OE1  . GLN A 1 5  ? 2.105   2.371   8.883   1.00 0.00 ? 5  GLN A OE1  4  
ATOM 2414  N NE2  . GLN A 1 5  ? 3.271   3.202   10.530  1.00 0.00 ? 5  GLN A NE2  4  
ATOM 2415  H H    . GLN A 1 5  ? 3.756   5.199   4.952   1.00 0.00 ? 5  GLN A H    4  
ATOM 2416  H HA   . GLN A 1 5  ? 5.662   4.331   7.022   1.00 0.00 ? 5  GLN A HA   4  
ATOM 2417  H HB2  . GLN A 1 5  ? 2.977   3.332   6.920   1.00 0.00 ? 5  GLN A HB2  4  
ATOM 2418  H HB3  . GLN A 1 5  ? 4.069   2.039   6.419   1.00 0.00 ? 5  GLN A HB3  4  
ATOM 2419  H HG2  . GLN A 1 5  ? 4.921   1.811   8.502   1.00 0.00 ? 5  GLN A HG2  4  
ATOM 2420  H HG3  . GLN A 1 5  ? 5.079   3.554   8.715   1.00 0.00 ? 5  GLN A HG3  4  
ATOM 2421  H HE21 . GLN A 1 5  ? 4.132   3.522   10.869  1.00 0.00 ? 5  GLN A HE21 4  
ATOM 2422  H HE22 . GLN A 1 5  ? 2.483   3.209   11.112  1.00 0.00 ? 5  GLN A HE22 4  
ATOM 2423  N N    . CYS A 1 6  ? 4.883   3.102   4.054   1.00 0.00 ? 6  CYS A N    4  
ATOM 2424  C CA   . CYS A 1 6  ? 5.513   2.509   2.841   1.00 0.00 ? 6  CYS A CA   4  
ATOM 2425  C C    . CYS A 1 6  ? 6.131   3.620   1.991   1.00 0.00 ? 6  CYS A C    4  
ATOM 2426  O O    . CYS A 1 6  ? 7.124   3.419   1.325   1.00 0.00 ? 6  CYS A O    4  
ATOM 2427  C CB   . CYS A 1 6  ? 4.463   1.756   2.023   1.00 0.00 ? 6  CYS A CB   4  
ATOM 2428  S SG   . CYS A 1 6  ? 4.974   0.027   1.836   1.00 0.00 ? 6  CYS A SG   4  
ATOM 2429  H H    . CYS A 1 6  ? 3.921   3.282   4.070   1.00 0.00 ? 6  CYS A H    4  
ATOM 2430  H HA   . CYS A 1 6  ? 6.286   1.823   3.144   1.00 0.00 ? 6  CYS A HA   4  
ATOM 2431  H HB2  . CYS A 1 6  ? 3.510   1.796   2.531   1.00 0.00 ? 6  CYS A HB2  4  
ATOM 2432  H HB3  . CYS A 1 6  ? 4.372   2.211   1.047   1.00 0.00 ? 6  CYS A HB3  4  
ATOM 2433  N N    . CYS A 1 7  ? 5.559   4.794   2.009   1.00 0.00 ? 7  CYS A N    4  
ATOM 2434  C CA   . CYS A 1 7  ? 6.133   5.906   1.200   1.00 0.00 ? 7  CYS A CA   4  
ATOM 2435  C C    . CYS A 1 7  ? 7.324   6.512   1.948   1.00 0.00 ? 7  CYS A C    4  
ATOM 2436  O O    . CYS A 1 7  ? 8.459   6.378   1.534   1.00 0.00 ? 7  CYS A O    4  
ATOM 2437  C CB   . CYS A 1 7  ? 5.067   6.977   0.971   1.00 0.00 ? 7  CYS A CB   4  
ATOM 2438  S SG   . CYS A 1 7  ? 5.834   8.454   0.261   1.00 0.00 ? 7  CYS A SG   4  
ATOM 2439  H H    . CYS A 1 7  ? 4.760   4.943   2.556   1.00 0.00 ? 7  CYS A H    4  
ATOM 2440  H HA   . CYS A 1 7  ? 6.467   5.522   0.247   1.00 0.00 ? 7  CYS A HA   4  
ATOM 2441  H HB2  . CYS A 1 7  ? 4.319   6.599   0.289   1.00 0.00 ? 7  CYS A HB2  4  
ATOM 2442  H HB3  . CYS A 1 7  ? 4.599   7.228   1.909   1.00 0.00 ? 7  CYS A HB3  4  
ATOM 2443  N N    . THR A 1 8  ? 7.081   7.174   3.047   1.00 0.00 ? 8  THR A N    4  
ATOM 2444  C CA   . THR A 1 8  ? 8.210   7.775   3.812   1.00 0.00 ? 8  THR A CA   4  
ATOM 2445  C C    . THR A 1 8  ? 9.312   6.730   3.977   1.00 0.00 ? 8  THR A C    4  
ATOM 2446  O O    . THR A 1 8  ? 10.463  6.964   3.663   1.00 0.00 ? 8  THR A O    4  
ATOM 2447  C CB   . THR A 1 8  ? 7.720   8.214   5.194   1.00 0.00 ? 8  THR A CB   4  
ATOM 2448  O OG1  . THR A 1 8  ? 6.743   7.293   5.663   1.00 0.00 ? 8  THR A OG1  4  
ATOM 2449  C CG2  . THR A 1 8  ? 7.105   9.609   5.104   1.00 0.00 ? 8  THR A CG2  4  
ATOM 2450  H H    . THR A 1 8  ? 6.160   7.271   3.370   1.00 0.00 ? 8  THR A H    4  
ATOM 2451  H HA   . THR A 1 8  ? 8.597   8.630   3.276   1.00 0.00 ? 8  THR A HA   4  
ATOM 2452  H HB   . THR A 1 8  ? 8.552   8.235   5.881   1.00 0.00 ? 8  THR A HB   4  
ATOM 2453  H HG1  . THR A 1 8  ? 6.478   7.567   6.545   1.00 0.00 ? 8  THR A HG1  4  
ATOM 2454  H HG21 . THR A 1 8  ? 6.604   9.720   4.153   1.00 0.00 ? 8  THR A HG21 4  
ATOM 2455  H HG22 . THR A 1 8  ? 6.391   9.739   5.905   1.00 0.00 ? 8  THR A HG22 4  
ATOM 2456  H HG23 . THR A 1 8  ? 7.885   10.351  5.191   1.00 0.00 ? 8  THR A HG23 4  
ATOM 2457  N N    . SER A 1 9  ? 8.963   5.573   4.466   1.00 0.00 ? 9  SER A N    4  
ATOM 2458  C CA   . SER A 1 9  ? 9.978   4.500   4.653   1.00 0.00 ? 9  SER A CA   4  
ATOM 2459  C C    . SER A 1 9  ? 9.551   3.269   3.848   1.00 0.00 ? 9  SER A C    4  
ATOM 2460  O O    . SER A 1 9  ? 8.911   3.386   2.821   1.00 0.00 ? 9  SER A O    4  
ATOM 2461  C CB   . SER A 1 9  ? 10.065  4.140   6.139   1.00 0.00 ? 9  SER A CB   4  
ATOM 2462  O OG   . SER A 1 9  ? 11.431  4.083   6.531   1.00 0.00 ? 9  SER A OG   4  
ATOM 2463  H H    . SER A 1 9  ? 8.029   5.408   4.709   1.00 0.00 ? 9  SER A H    4  
ATOM 2464  H HA   . SER A 1 9  ? 10.940  4.845   4.307   1.00 0.00 ? 9  SER A HA   4  
ATOM 2465  H HB2  . SER A 1 9  ? 9.560   4.892   6.721   1.00 0.00 ? 9  SER A HB2  4  
ATOM 2466  H HB3  . SER A 1 9  ? 9.591   3.181   6.305   1.00 0.00 ? 9  SER A HB3  4  
ATOM 2467  H HG   . SER A 1 9  ? 11.955  3.876   5.752   1.00 0.00 ? 9  SER A HG   4  
ATOM 2468  N N    . ILE A 1 10 ? 9.894   2.095   4.300   1.00 0.00 ? 10 ILE A N    4  
ATOM 2469  C CA   . ILE A 1 10 ? 9.495   0.872   3.551   1.00 0.00 ? 10 ILE A CA   4  
ATOM 2470  C C    . ILE A 1 10 ? 8.599   0.004   4.439   1.00 0.00 ? 10 ILE A C    4  
ATOM 2471  O O    . ILE A 1 10 ? 9.001   -0.447  5.493   1.00 0.00 ? 10 ILE A O    4  
ATOM 2472  C CB   . ILE A 1 10 ? 10.744  0.089   3.153   1.00 0.00 ? 10 ILE A CB   4  
ATOM 2473  C CG1  . ILE A 1 10 ? 11.597  0.950   2.209   1.00 0.00 ? 10 ILE A CG1  4  
ATOM 2474  C CG2  . ILE A 1 10 ? 10.328  -1.204  2.445   1.00 0.00 ? 10 ILE A CG2  4  
ATOM 2475  C CD1  . ILE A 1 10 ? 12.597  0.069   1.457   1.00 0.00 ? 10 ILE A CD1  4  
ATOM 2476  H H    . ILE A 1 10 ? 10.408  2.018   5.130   1.00 0.00 ? 10 ILE A H    4  
ATOM 2477  H HA   . ILE A 1 10 ? 8.952   1.157   2.663   1.00 0.00 ? 10 ILE A HA   4  
ATOM 2478  H HB   . ILE A 1 10 ? 11.315  -0.154  4.039   1.00 0.00 ? 10 ILE A HB   4  
ATOM 2479  H HG12 . ILE A 1 10 ? 10.952  1.448   1.501   1.00 0.00 ? 10 ILE A HG12 4  
ATOM 2480  H HG13 . ILE A 1 10 ? 12.135  1.687   2.787   1.00 0.00 ? 10 ILE A HG13 4  
ATOM 2481  H HG21 . ILE A 1 10 ? 9.399   -1.560  2.864   1.00 0.00 ? 10 ILE A HG21 4  
ATOM 2482  H HG22 . ILE A 1 10 ? 10.198  -1.010  1.391   1.00 0.00 ? 10 ILE A HG22 4  
ATOM 2483  H HG23 . ILE A 1 10 ? 11.095  -1.952  2.582   1.00 0.00 ? 10 ILE A HG23 4  
ATOM 2484  H HD11 . ILE A 1 10 ? 12.899  -0.753  2.089   1.00 0.00 ? 10 ILE A HD11 4  
ATOM 2485  H HD12 . ILE A 1 10 ? 12.135  -0.315  0.561   1.00 0.00 ? 10 ILE A HD12 4  
ATOM 2486  H HD13 . ILE A 1 10 ? 13.464  0.655   1.192   1.00 0.00 ? 10 ILE A HD13 4  
ATOM 2487  N N    . CYS A 1 11 ? 7.381   -0.226  4.025   1.00 0.00 ? 11 CYS A N    4  
ATOM 2488  C CA   . CYS A 1 11 ? 6.457   -1.056  4.849   1.00 0.00 ? 11 CYS A CA   4  
ATOM 2489  C C    . CYS A 1 11 ? 6.413   -2.486  4.298   1.00 0.00 ? 11 CYS A C    4  
ATOM 2490  O O    . CYS A 1 11 ? 6.929   -2.768  3.235   1.00 0.00 ? 11 CYS A O    4  
ATOM 2491  C CB   . CYS A 1 11 ? 5.050   -0.425  4.844   1.00 0.00 ? 11 CYS A CB   4  
ATOM 2492  S SG   . CYS A 1 11 ? 4.105   -0.940  3.382   1.00 0.00 ? 11 CYS A SG   4  
ATOM 2493  H H    . CYS A 1 11 ? 7.075   0.151   3.175   1.00 0.00 ? 11 CYS A H    4  
ATOM 2494  H HA   . CYS A 1 11 ? 6.825   -1.085  5.865   1.00 0.00 ? 11 CYS A HA   4  
ATOM 2495  H HB2  . CYS A 1 11 ? 4.521   -0.734  5.733   1.00 0.00 ? 11 CYS A HB2  4  
ATOM 2496  H HB3  . CYS A 1 11 ? 5.145   0.651   4.846   1.00 0.00 ? 11 CYS A HB3  4  
ATOM 2497  N N    . SER A 1 12 ? 5.805   -3.390  5.017   1.00 0.00 ? 12 SER A N    4  
ATOM 2498  C CA   . SER A 1 12 ? 5.732   -4.801  4.541   1.00 0.00 ? 12 SER A CA   4  
ATOM 2499  C C    . SER A 1 12 ? 4.377   -5.055  3.875   1.00 0.00 ? 12 SER A C    4  
ATOM 2500  O O    . SER A 1 12 ? 3.473   -4.248  3.953   1.00 0.00 ? 12 SER A O    4  
ATOM 2501  C CB   . SER A 1 12 ? 5.896   -5.745  5.732   1.00 0.00 ? 12 SER A CB   4  
ATOM 2502  O OG   . SER A 1 12 ? 5.282   -5.168  6.877   1.00 0.00 ? 12 SER A OG   4  
ATOM 2503  H H    . SER A 1 12 ? 5.398   -3.141  5.875   1.00 0.00 ? 12 SER A H    4  
ATOM 2504  H HA   . SER A 1 12 ? 6.523   -4.980  3.827   1.00 0.00 ? 12 SER A HA   4  
ATOM 2505  H HB2  . SER A 1 12 ? 5.424   -6.687  5.514   1.00 0.00 ? 12 SER A HB2  4  
ATOM 2506  H HB3  . SER A 1 12 ? 6.949   -5.907  5.918   1.00 0.00 ? 12 SER A HB3  4  
ATOM 2507  H HG   . SER A 1 12 ? 4.409   -4.861  6.622   1.00 0.00 ? 12 SER A HG   4  
ATOM 2508  N N    . LEU A 1 13 ? 4.230   -6.178  3.225   1.00 0.00 ? 13 LEU A N    4  
ATOM 2509  C CA   . LEU A 1 13 ? 2.936   -6.494  2.558   1.00 0.00 ? 13 LEU A CA   4  
ATOM 2510  C C    . LEU A 1 13 ? 1.862   -6.717  3.623   1.00 0.00 ? 13 LEU A C    4  
ATOM 2511  O O    . LEU A 1 13 ? 0.679   -6.676  3.346   1.00 0.00 ? 13 LEU A O    4  
ATOM 2512  C CB   . LEU A 1 13 ? 3.092   -7.762  1.715   1.00 0.00 ? 13 LEU A CB   4  
ATOM 2513  C CG   . LEU A 1 13 ? 2.910   -7.421  0.233   1.00 0.00 ? 13 LEU A CG   4  
ATOM 2514  C CD1  . LEU A 1 13 ? 1.428   -7.175  -0.055  1.00 0.00 ? 13 LEU A CD1  4  
ATOM 2515  C CD2  . LEU A 1 13 ? 3.712   -6.161  -0.107  1.00 0.00 ? 13 LEU A CD2  4  
ATOM 2516  H H    . LEU A 1 13 ? 4.973   -6.816  3.179   1.00 0.00 ? 13 LEU A H    4  
ATOM 2517  H HA   . LEU A 1 13 ? 2.647   -5.670  1.922   1.00 0.00 ? 13 LEU A HA   4  
ATOM 2518  H HB2  . LEU A 1 13 ? 4.076   -8.178  1.871   1.00 0.00 ? 13 LEU A HB2  4  
ATOM 2519  H HB3  . LEU A 1 13 ? 2.346   -8.483  2.009   1.00 0.00 ? 13 LEU A HB3  4  
ATOM 2520  H HG   . LEU A 1 13 ? 3.260   -8.247  -0.370  1.00 0.00 ? 13 LEU A HG   4  
ATOM 2521  H HD11 . LEU A 1 13 ? 0.863   -7.274  0.859   1.00 0.00 ? 13 LEU A HD11 4  
ATOM 2522  H HD12 . LEU A 1 13 ? 1.300   -6.181  -0.454  1.00 0.00 ? 13 LEU A HD12 4  
ATOM 2523  H HD13 . LEU A 1 13 ? 1.078   -7.899  -0.775  1.00 0.00 ? 13 LEU A HD13 4  
ATOM 2524  H HD21 . LEU A 1 13 ? 4.336   -5.895  0.734   1.00 0.00 ? 13 LEU A HD21 4  
ATOM 2525  H HD22 . LEU A 1 13 ? 4.332   -6.352  -0.970  1.00 0.00 ? 13 LEU A HD22 4  
ATOM 2526  H HD23 . LEU A 1 13 ? 3.034   -5.350  -0.323  1.00 0.00 ? 13 LEU A HD23 4  
ATOM 2527  N N    . TYR A 1 14 ? 2.265   -6.954  4.840   1.00 0.00 ? 14 TYR A N    4  
ATOM 2528  C CA   . TYR A 1 14 ? 1.274   -7.181  5.928   1.00 0.00 ? 14 TYR A CA   4  
ATOM 2529  C C    . TYR A 1 14 ? 0.546   -5.868  6.231   1.00 0.00 ? 14 TYR A C    4  
ATOM 2530  O O    . TYR A 1 14 ? -0.552  -5.862  6.749   1.00 0.00 ? 14 TYR A O    4  
ATOM 2531  C CB   . TYR A 1 14 ? 2.005   -7.662  7.183   1.00 0.00 ? 14 TYR A CB   4  
ATOM 2532  C CG   . TYR A 1 14 ? 1.069   -7.607  8.368   1.00 0.00 ? 14 TYR A CG   4  
ATOM 2533  C CD1  . TYR A 1 14 ? -0.151  -8.290  8.331   1.00 0.00 ? 14 TYR A CD1  4  
ATOM 2534  C CD2  . TYR A 1 14 ? 1.427   -6.873  9.505   1.00 0.00 ? 14 TYR A CD2  4  
ATOM 2535  C CE1  . TYR A 1 14 ? -1.017  -8.236  9.429   1.00 0.00 ? 14 TYR A CE1  4  
ATOM 2536  C CE2  . TYR A 1 14 ? 0.561   -6.820  10.604  1.00 0.00 ? 14 TYR A CE2  4  
ATOM 2537  C CZ   . TYR A 1 14 ? -0.660  -7.502  10.566  1.00 0.00 ? 14 TYR A CZ   4  
ATOM 2538  O OH   . TYR A 1 14 ? -1.513  -7.450  11.650  1.00 0.00 ? 14 TYR A OH   4  
ATOM 2539  H H    . TYR A 1 14 ? 3.225   -6.983  5.039   1.00 0.00 ? 14 TYR A H    4  
ATOM 2540  H HA   . TYR A 1 14 ? 0.559   -7.927  5.617   1.00 0.00 ? 14 TYR A HA   4  
ATOM 2541  H HB2  . TYR A 1 14 ? 2.341   -8.678  7.036   1.00 0.00 ? 14 TYR A HB2  4  
ATOM 2542  H HB3  . TYR A 1 14 ? 2.857   -7.025  7.368   1.00 0.00 ? 14 TYR A HB3  4  
ATOM 2543  H HD1  . TYR A 1 14 ? -0.426  -8.856  7.453   1.00 0.00 ? 14 TYR A HD1  4  
ATOM 2544  H HD2  . TYR A 1 14 ? 2.370   -6.347  9.534   1.00 0.00 ? 14 TYR A HD2  4  
ATOM 2545  H HE1  . TYR A 1 14 ? -1.958  -8.763  9.400   1.00 0.00 ? 14 TYR A HE1  4  
ATOM 2546  H HE2  . TYR A 1 14 ? 0.835   -6.253  11.480  1.00 0.00 ? 14 TYR A HE2  4  
ATOM 2547  H HH   . TYR A 1 14 ? -1.906  -8.319  11.760  1.00 0.00 ? 14 TYR A HH   4  
ATOM 2548  N N    . GLN A 1 15 ? 1.153   -4.758  5.912   1.00 0.00 ? 15 GLN A N    4  
ATOM 2549  C CA   . GLN A 1 15 ? 0.497   -3.448  6.185   1.00 0.00 ? 15 GLN A CA   4  
ATOM 2550  C C    . GLN A 1 15 ? -0.660  -3.232  5.203   1.00 0.00 ? 15 GLN A C    4  
ATOM 2551  O O    . GLN A 1 15 ? -1.765  -2.914  5.594   1.00 0.00 ? 15 GLN A O    4  
ATOM 2552  C CB   . GLN A 1 15 ? 1.521   -2.324  6.030   1.00 0.00 ? 15 GLN A CB   4  
ATOM 2553  C CG   . GLN A 1 15 ? 2.318   -2.177  7.326   1.00 0.00 ? 15 GLN A CG   4  
ATOM 2554  C CD   . GLN A 1 15 ? 1.581   -1.228  8.274   1.00 0.00 ? 15 GLN A CD   4  
ATOM 2555  O OE1  . GLN A 1 15 ? 0.367   -1.201  8.302   1.00 0.00 ? 15 GLN A OE1  4  
ATOM 2556  N NE2  . GLN A 1 15 ? 2.269   -0.445  9.059   1.00 0.00 ? 15 GLN A NE2  4  
ATOM 2557  H H    . GLN A 1 15 ? 2.040   -4.786  5.497   1.00 0.00 ? 15 GLN A H    4  
ATOM 2558  H HA   . GLN A 1 15 ? 0.114   -3.442  7.194   1.00 0.00 ? 15 GLN A HA   4  
ATOM 2559  H HB2  . GLN A 1 15 ? 2.191   -2.558  5.217   1.00 0.00 ? 15 GLN A HB2  4  
ATOM 2560  H HB3  . GLN A 1 15 ? 1.009   -1.400  5.821   1.00 0.00 ? 15 GLN A HB3  4  
ATOM 2561  H HG2  . GLN A 1 15 ? 2.424   -3.145  7.794   1.00 0.00 ? 15 GLN A HG2  4  
ATOM 2562  H HG3  . GLN A 1 15 ? 3.295   -1.774  7.105   1.00 0.00 ? 15 GLN A HG3  4  
ATOM 2563  H HE21 . GLN A 1 15 ? 3.249   -0.467  9.036   1.00 0.00 ? 15 GLN A HE21 4  
ATOM 2564  H HE22 . GLN A 1 15 ? 1.808   0.168   9.669   1.00 0.00 ? 15 GLN A HE22 4  
ATOM 2565  N N    . LEU A 1 16 ? -0.420  -3.408  3.930   1.00 0.00 ? 16 LEU A N    4  
ATOM 2566  C CA   . LEU A 1 16 ? -1.513  -3.216  2.935   1.00 0.00 ? 16 LEU A CA   4  
ATOM 2567  C C    . LEU A 1 16 ? -2.633  -4.221  3.205   1.00 0.00 ? 16 LEU A C    4  
ATOM 2568  O O    . LEU A 1 16 ? -3.715  -4.115  2.664   1.00 0.00 ? 16 LEU A O    4  
ATOM 2569  C CB   . LEU A 1 16 ? -0.969  -3.431  1.516   1.00 0.00 ? 16 LEU A CB   4  
ATOM 2570  C CG   . LEU A 1 16 ? 0.343   -2.653  1.290   1.00 0.00 ? 16 LEU A CG   4  
ATOM 2571  C CD1  . LEU A 1 16 ? 0.357   -2.111  -0.136  1.00 0.00 ? 16 LEU A CD1  4  
ATOM 2572  C CD2  . LEU A 1 16 ? 0.461   -1.471  2.257   1.00 0.00 ? 16 LEU A CD2  4  
ATOM 2573  H H    . LEU A 1 16 ? 0.471   -3.665  3.631   1.00 0.00 ? 16 LEU A H    4  
ATOM 2574  H HA   . LEU A 1 16 ? -1.903  -2.213  3.022   1.00 0.00 ? 16 LEU A HA   4  
ATOM 2575  H HB2  . LEU A 1 16 ? -0.782  -4.484  1.365   1.00 0.00 ? 16 LEU A HB2  4  
ATOM 2576  H HB3  . LEU A 1 16 ? -1.704  -3.096  0.801   1.00 0.00 ? 16 LEU A HB3  4  
ATOM 2577  H HG   . LEU A 1 16 ? 1.182   -3.320  1.428   1.00 0.00 ? 16 LEU A HG   4  
ATOM 2578  H HD11 . LEU A 1 16 ? -0.373  -2.642  -0.729  1.00 0.00 ? 16 LEU A HD11 4  
ATOM 2579  H HD12 . LEU A 1 16 ? 0.110   -1.059  -0.119  1.00 0.00 ? 16 LEU A HD12 4  
ATOM 2580  H HD13 . LEU A 1 16 ? 1.338   -2.244  -0.563  1.00 0.00 ? 16 LEU A HD13 4  
ATOM 2581  H HD21 . LEU A 1 16 ? -0.522  -1.093  2.484   1.00 0.00 ? 16 LEU A HD21 4  
ATOM 2582  H HD22 . LEU A 1 16 ? 0.942   -1.798  3.168   1.00 0.00 ? 16 LEU A HD22 4  
ATOM 2583  H HD23 . LEU A 1 16 ? 1.051   -0.690  1.799   1.00 0.00 ? 16 LEU A HD23 4  
ATOM 2584  N N    . GLU A 1 17 ? -2.389  -5.197  4.037   1.00 0.00 ? 17 GLU A N    4  
ATOM 2585  C CA   . GLU A 1 17 ? -3.452  -6.196  4.338   1.00 0.00 ? 17 GLU A CA   4  
ATOM 2586  C C    . GLU A 1 17 ? -4.632  -5.475  4.991   1.00 0.00 ? 17 GLU A C    4  
ATOM 2587  O O    . GLU A 1 17 ? -5.777  -5.836  4.803   1.00 0.00 ? 17 GLU A O    4  
ATOM 2588  C CB   . GLU A 1 17 ? -2.906  -7.261  5.293   1.00 0.00 ? 17 GLU A CB   4  
ATOM 2589  C CG   . GLU A 1 17 ? -2.039  -8.251  4.513   1.00 0.00 ? 17 GLU A CG   4  
ATOM 2590  C CD   . GLU A 1 17 ? -2.150  -9.640  5.147   1.00 0.00 ? 17 GLU A CD   4  
ATOM 2591  O OE1  . GLU A 1 17 ? -2.965  -9.797  6.040   1.00 0.00 ? 17 GLU A OE1  4  
ATOM 2592  O OE2  . GLU A 1 17 ? -1.416  -10.520 4.727   1.00 0.00 ? 17 GLU A OE2  4  
ATOM 2593  H H    . GLU A 1 17 ? -1.511  -5.269  4.467   1.00 0.00 ? 17 GLU A H    4  
ATOM 2594  H HA   . GLU A 1 17 ? -3.777  -6.663  3.419   1.00 0.00 ? 17 GLU A HA   4  
ATOM 2595  H HB2  . GLU A 1 17 ? -2.311  -6.786  6.060   1.00 0.00 ? 17 GLU A HB2  4  
ATOM 2596  H HB3  . GLU A 1 17 ? -3.729  -7.789  5.750   1.00 0.00 ? 17 GLU A HB3  4  
ATOM 2597  H HG2  . GLU A 1 17 ? -2.378  -8.295  3.487   1.00 0.00 ? 17 GLU A HG2  4  
ATOM 2598  H HG3  . GLU A 1 17 ? -1.009  -7.927  4.539   1.00 0.00 ? 17 GLU A HG3  4  
ATOM 2599  N N    . ASN A 1 18 ? -4.358  -4.451  5.753   1.00 0.00 ? 18 ASN A N    4  
ATOM 2600  C CA   . ASN A 1 18 ? -5.456  -3.691  6.417   1.00 0.00 ? 18 ASN A CA   4  
ATOM 2601  C C    . ASN A 1 18 ? -6.344  -3.048  5.351   1.00 0.00 ? 18 ASN A C    4  
ATOM 2602  O O    . ASN A 1 18 ? -7.499  -2.751  5.583   1.00 0.00 ? 18 ASN A O    4  
ATOM 2603  C CB   . ASN A 1 18 ? -4.852  -2.592  7.294   1.00 0.00 ? 18 ASN A CB   4  
ATOM 2604  C CG   . ASN A 1 18 ? -3.871  -3.210  8.290   1.00 0.00 ? 18 ASN A CG   4  
ATOM 2605  O OD1  . ASN A 1 18 ? -3.478  -4.351  8.146   1.00 0.00 ? 18 ASN A OD1  4  
ATOM 2606  N ND2  . ASN A 1 18 ? -3.455  -2.501  9.304   1.00 0.00 ? 18 ASN A ND2  4  
ATOM 2607  H H    . ASN A 1 18 ? -3.426  -4.174  5.884   1.00 0.00 ? 18 ASN A H    4  
ATOM 2608  H HA   . ASN A 1 18 ? -6.045  -4.360  7.027   1.00 0.00 ? 18 ASN A HA   4  
ATOM 2609  H HB2  . ASN A 1 18 ? -4.332  -1.878  6.670   1.00 0.00 ? 18 ASN A HB2  4  
ATOM 2610  H HB3  . ASN A 1 18 ? -5.642  -2.089  7.833   1.00 0.00 ? 18 ASN A HB3  4  
ATOM 2611  H HD21 . ASN A 1 18 ? -3.772  -1.581  9.419   1.00 0.00 ? 18 ASN A HD21 4  
ATOM 2612  H HD22 . ASN A 1 18 ? -2.824  -2.887  9.946   1.00 0.00 ? 18 ASN A HD22 4  
ATOM 2613  N N    . TYR A 1 19 ? -5.803  -2.819  4.187   1.00 0.00 ? 19 TYR A N    4  
ATOM 2614  C CA   . TYR A 1 19 ? -6.594  -2.179  3.099   1.00 0.00 ? 19 TYR A CA   4  
ATOM 2615  C C    . TYR A 1 19 ? -7.502  -3.205  2.415   1.00 0.00 ? 19 TYR A C    4  
ATOM 2616  O O    . TYR A 1 19 ? -8.098  -2.930  1.393   1.00 0.00 ? 19 TYR A O    4  
ATOM 2617  C CB   . TYR A 1 19 ? -5.628  -1.582  2.075   1.00 0.00 ? 19 TYR A CB   4  
ATOM 2618  C CG   . TYR A 1 19 ? -5.346  -0.159  2.459   1.00 0.00 ? 19 TYR A CG   4  
ATOM 2619  C CD1  . TYR A 1 19 ? -6.266  0.840   2.126   1.00 0.00 ? 19 TYR A CD1  4  
ATOM 2620  C CD2  . TYR A 1 19 ? -4.183  0.160   3.160   1.00 0.00 ? 19 TYR A CD2  4  
ATOM 2621  C CE1  . TYR A 1 19 ? -6.022  2.166   2.499   1.00 0.00 ? 19 TYR A CE1  4  
ATOM 2622  C CE2  . TYR A 1 19 ? -3.939  1.485   3.529   1.00 0.00 ? 19 TYR A CE2  4  
ATOM 2623  C CZ   . TYR A 1 19 ? -4.858  2.488   3.201   1.00 0.00 ? 19 TYR A CZ   4  
ATOM 2624  O OH   . TYR A 1 19 ? -4.613  3.795   3.571   1.00 0.00 ? 19 TYR A OH   4  
ATOM 2625  H H    . TYR A 1 19 ? -4.865  -3.054  4.031   1.00 0.00 ? 19 TYR A H    4  
ATOM 2626  H HA   . TYR A 1 19 ? -7.199  -1.388  3.515   1.00 0.00 ? 19 TYR A HA   4  
ATOM 2627  H HB2  . TYR A 1 19 ? -4.707  -2.146  2.074   1.00 0.00 ? 19 TYR A HB2  4  
ATOM 2628  H HB3  . TYR A 1 19 ? -6.070  -1.606  1.097   1.00 0.00 ? 19 TYR A HB3  4  
ATOM 2629  H HD1  . TYR A 1 19 ? -7.162  0.586   1.581   1.00 0.00 ? 19 TYR A HD1  4  
ATOM 2630  H HD2  . TYR A 1 19 ? -3.467  -0.615  3.409   1.00 0.00 ? 19 TYR A HD2  4  
ATOM 2631  H HE1  . TYR A 1 19 ? -6.730  2.940   2.242   1.00 0.00 ? 19 TYR A HE1  4  
ATOM 2632  H HE2  . TYR A 1 19 ? -3.051  1.731   4.073   1.00 0.00 ? 19 TYR A HE2  4  
ATOM 2633  H HH   . TYR A 1 19 ? -4.198  3.787   4.438   1.00 0.00 ? 19 TYR A HH   4  
ATOM 2634  N N    . CYS A 1 20 ? -7.624  -4.378  2.968   1.00 0.00 ? 20 CYS A N    4  
ATOM 2635  C CA   . CYS A 1 20 ? -8.504  -5.404  2.343   1.00 0.00 ? 20 CYS A CA   4  
ATOM 2636  C C    . CYS A 1 20 ? -9.820  -5.486  3.124   1.00 0.00 ? 20 CYS A C    4  
ATOM 2637  O O    . CYS A 1 20 ? -9.828  -5.577  4.335   1.00 0.00 ? 20 CYS A O    4  
ATOM 2638  C CB   . CYS A 1 20 ? -7.805  -6.764  2.376   1.00 0.00 ? 20 CYS A CB   4  
ATOM 2639  S SG   . CYS A 1 20 ? -6.308  -6.707  1.355   1.00 0.00 ? 20 CYS A SG   4  
ATOM 2640  H H    . CYS A 1 20 ? -7.142  -4.584  3.795   1.00 0.00 ? 20 CYS A H    4  
ATOM 2641  H HA   . CYS A 1 20 ? -8.712  -5.128  1.320   1.00 0.00 ? 20 CYS A HA   4  
ATOM 2642  H HB2  . CYS A 1 20 ? -7.535  -7.007  3.393   1.00 0.00 ? 20 CYS A HB2  4  
ATOM 2643  H HB3  . CYS A 1 20 ? -8.472  -7.522  1.991   1.00 0.00 ? 20 CYS A HB3  4  
ATOM 2644  N N    . ASN A 1 21 ? -10.932 -5.455  2.440   1.00 0.00 ? 21 ASN A N    4  
ATOM 2645  C CA   . ASN A 1 21 ? -12.244 -5.529  3.148   1.00 0.00 ? 21 ASN A CA   4  
ATOM 2646  C C    . ASN A 1 21 ? -12.854 -6.918  2.950   1.00 0.00 ? 21 ASN A C    4  
ATOM 2647  O O    . ASN A 1 21 ? -12.497 -7.571  1.984   1.00 0.00 ? 21 ASN A O    4  
ATOM 2648  C CB   . ASN A 1 21 ? -13.193 -4.471  2.578   1.00 0.00 ? 21 ASN A CB   4  
ATOM 2649  C CG   . ASN A 1 21 ? -14.539 -4.552  3.300   1.00 0.00 ? 21 ASN A CG   4  
ATOM 2650  O OD1  . ASN A 1 21 ? -15.204 -5.569  3.256   1.00 0.00 ? 21 ASN A OD1  4  
ATOM 2651  N ND2  . ASN A 1 21 ? -14.974 -3.520  3.969   1.00 0.00 ? 21 ASN A ND2  4  
ATOM 2652  O OXT  . ASN A 1 21 ? -13.671 -7.307  3.771   1.00 0.00 ? 21 ASN A OXT  4  
ATOM 2653  H H    . ASN A 1 21 ? -10.905 -5.379  1.464   1.00 0.00 ? 21 ASN A H    4  
ATOM 2654  H HA   . ASN A 1 21 ? -12.095 -5.347  4.201   1.00 0.00 ? 21 ASN A HA   4  
ATOM 2655  H HB2  . ASN A 1 21 ? -12.765 -3.488  2.722   1.00 0.00 ? 21 ASN A HB2  4  
ATOM 2656  H HB3  . ASN A 1 21 ? -13.341 -4.648  1.522   1.00 0.00 ? 21 ASN A HB3  4  
ATOM 2657  H HD21 . ASN A 1 21 ? -14.437 -2.700  4.004   1.00 0.00 ? 21 ASN A HD21 4  
ATOM 2658  H HD22 . ASN A 1 21 ? -15.834 -3.563  4.434   1.00 0.00 ? 21 ASN A HD22 4  
ATOM 2659  N N    . PHE B 2 1  ? 9.570   -10.606 -0.238  1.00 0.00 ? 1  PHE B N    4  
ATOM 2660  C CA   . PHE B 2 1  ? 9.113   -9.523  -1.152  1.00 0.00 ? 1  PHE B CA   4  
ATOM 2661  C C    . PHE B 2 1  ? 10.252  -8.528  -1.379  1.00 0.00 ? 1  PHE B C    4  
ATOM 2662  O O    . PHE B 2 1  ? 11.348  -8.701  -0.883  1.00 0.00 ? 1  PHE B O    4  
ATOM 2663  C CB   . PHE B 2 1  ? 7.919   -8.798  -0.526  1.00 0.00 ? 1  PHE B CB   4  
ATOM 2664  C CG   . PHE B 2 1  ? 6.724   -8.903  -1.441  1.00 0.00 ? 1  PHE B CG   4  
ATOM 2665  C CD1  . PHE B 2 1  ? 5.902   -10.034 -1.394  1.00 0.00 ? 1  PHE B CD1  4  
ATOM 2666  C CD2  . PHE B 2 1  ? 6.437   -7.868  -2.340  1.00 0.00 ? 1  PHE B CD2  4  
ATOM 2667  C CE1  . PHE B 2 1  ? 4.792   -10.130 -2.242  1.00 0.00 ? 1  PHE B CE1  4  
ATOM 2668  C CE2  . PHE B 2 1  ? 5.327   -7.964  -3.188  1.00 0.00 ? 1  PHE B CE2  4  
ATOM 2669  C CZ   . PHE B 2 1  ? 4.505   -9.095  -3.140  1.00 0.00 ? 1  PHE B CZ   4  
ATOM 2670  H H1   . PHE B 2 1  ? 10.296  -10.233 0.405   1.00 0.00 ? 1  PHE B H1   4  
ATOM 2671  H H2   . PHE B 2 1  ? 8.763   -10.957 0.315   1.00 0.00 ? 1  PHE B H2   4  
ATOM 2672  H H3   . PHE B 2 1  ? 9.973   -11.384 -0.797  1.00 0.00 ? 1  PHE B H3   4  
ATOM 2673  H HA   . PHE B 2 1  ? 8.816   -9.950  -2.098  1.00 0.00 ? 1  PHE B HA   4  
ATOM 2674  H HB2  . PHE B 2 1  ? 7.685   -9.249  0.426   1.00 0.00 ? 1  PHE B HB2  4  
ATOM 2675  H HB3  . PHE B 2 1  ? 8.168   -7.756  -0.379  1.00 0.00 ? 1  PHE B HB3  4  
ATOM 2676  H HD1  . PHE B 2 1  ? 6.122   -10.833 -0.701  1.00 0.00 ? 1  PHE B HD1  4  
ATOM 2677  H HD2  . PHE B 2 1  ? 7.071   -6.994  -2.378  1.00 0.00 ? 1  PHE B HD2  4  
ATOM 2678  H HE1  . PHE B 2 1  ? 4.157   -11.004 -2.206  1.00 0.00 ? 1  PHE B HE1  4  
ATOM 2679  H HE2  . PHE B 2 1  ? 5.106   -7.164  -3.880  1.00 0.00 ? 1  PHE B HE2  4  
ATOM 2680  H HZ   . PHE B 2 1  ? 3.649   -9.169  -3.793  1.00 0.00 ? 1  PHE B HZ   4  
ATOM 2681  N N    . VAL B 2 2  ? 10.002  -7.484  -2.121  1.00 0.00 ? 2  VAL B N    4  
ATOM 2682  C CA   . VAL B 2 2  ? 11.069  -6.477  -2.377  1.00 0.00 ? 2  VAL B CA   4  
ATOM 2683  C C    . VAL B 2 2  ? 10.819  -5.242  -1.508  1.00 0.00 ? 2  VAL B C    4  
ATOM 2684  O O    . VAL B 2 2  ? 9.711   -4.983  -1.085  1.00 0.00 ? 2  VAL B O    4  
ATOM 2685  C CB   . VAL B 2 2  ? 11.044  -6.074  -3.853  1.00 0.00 ? 2  VAL B CB   4  
ATOM 2686  C CG1  . VAL B 2 2  ? 12.417  -5.531  -4.258  1.00 0.00 ? 2  VAL B CG1  4  
ATOM 2687  C CG2  . VAL B 2 2  ? 10.705  -7.295  -4.708  1.00 0.00 ? 2  VAL B CG2  4  
ATOM 2688  H H    . VAL B 2 2  ? 9.110   -7.363  -2.509  1.00 0.00 ? 2  VAL B H    4  
ATOM 2689  H HA   . VAL B 2 2  ? 12.032  -6.900  -2.135  1.00 0.00 ? 2  VAL B HA   4  
ATOM 2690  H HB   . VAL B 2 2  ? 10.297  -5.307  -4.002  1.00 0.00 ? 2  VAL B HB   4  
ATOM 2691  H HG11 . VAL B 2 2  ? 13.189  -6.176  -3.864  1.00 0.00 ? 2  VAL B HG11 4  
ATOM 2692  H HG12 . VAL B 2 2  ? 12.487  -5.502  -5.334  1.00 0.00 ? 2  VAL B HG12 4  
ATOM 2693  H HG13 . VAL B 2 2  ? 12.542  -4.535  -3.861  1.00 0.00 ? 2  VAL B HG13 4  
ATOM 2694  H HG21 . VAL B 2 2  ? 9.747   -7.691  -4.406  1.00 0.00 ? 2  VAL B HG21 4  
ATOM 2695  H HG22 . VAL B 2 2  ? 10.663  -7.006  -5.747  1.00 0.00 ? 2  VAL B HG22 4  
ATOM 2696  H HG23 . VAL B 2 2  ? 11.465  -8.051  -4.576  1.00 0.00 ? 2  VAL B HG23 4  
ATOM 2697  N N    . ASN B 2 3  ? 11.842  -4.476  -1.240  1.00 0.00 ? 3  ASN B N    4  
ATOM 2698  C CA   . ASN B 2 3  ? 11.655  -3.260  -0.399  1.00 0.00 ? 3  ASN B CA   4  
ATOM 2699  C C    . ASN B 2 3  ? 11.576  -2.025  -1.297  1.00 0.00 ? 3  ASN B C    4  
ATOM 2700  O O    . ASN B 2 3  ? 12.533  -1.655  -1.951  1.00 0.00 ? 3  ASN B O    4  
ATOM 2701  C CB   . ASN B 2 3  ? 12.839  -3.114  0.561   1.00 0.00 ? 3  ASN B CB   4  
ATOM 2702  C CG   . ASN B 2 3  ? 13.171  -4.476  1.176   1.00 0.00 ? 3  ASN B CG   4  
ATOM 2703  O OD1  . ASN B 2 3  ? 12.370  -5.388  1.131   1.00 0.00 ? 3  ASN B OD1  4  
ATOM 2704  N ND2  . ASN B 2 3  ? 14.329  -4.651  1.752   1.00 0.00 ? 3  ASN B ND2  4  
ATOM 2705  H H    . ASN B 2 3  ? 12.729  -4.700  -1.591  1.00 0.00 ? 3  ASN B H    4  
ATOM 2706  H HA   . ASN B 2 3  ? 10.742  -3.351  0.168   1.00 0.00 ? 3  ASN B HA   4  
ATOM 2707  H HB2  . ASN B 2 3  ? 13.698  -2.743  0.022   1.00 0.00 ? 3  ASN B HB2  4  
ATOM 2708  H HB3  . ASN B 2 3  ? 12.579  -2.423  1.348   1.00 0.00 ? 3  ASN B HB3  4  
ATOM 2709  H HD21 . ASN B 2 3  ? 14.974  -3.914  1.787   1.00 0.00 ? 3  ASN B HD21 4  
ATOM 2710  H HD22 . ASN B 2 3  ? 14.552  -5.518  2.151   1.00 0.00 ? 3  ASN B HD22 4  
ATOM 2711  N N    . GLN B 2 4  ? 10.442  -1.379  -1.336  1.00 0.00 ? 4  GLN B N    4  
ATOM 2712  C CA   . GLN B 2 4  ? 10.304  -0.166  -2.192  1.00 0.00 ? 4  GLN B CA   4  
ATOM 2713  C C    . GLN B 2 4  ? 9.347   0.824   -1.526  1.00 0.00 ? 4  GLN B C    4  
ATOM 2714  O O    . GLN B 2 4  ? 8.560   0.463   -0.672  1.00 0.00 ? 4  GLN B O    4  
ATOM 2715  C CB   . GLN B 2 4  ? 9.749   -0.566  -3.560  1.00 0.00 ? 4  GLN B CB   4  
ATOM 2716  C CG   . GLN B 2 4  ? 10.586  -1.705  -4.140  1.00 0.00 ? 4  GLN B CG   4  
ATOM 2717  C CD   . GLN B 2 4  ? 10.058  -2.077  -5.527  1.00 0.00 ? 4  GLN B CD   4  
ATOM 2718  O OE1  . GLN B 2 4  ? 10.423  -1.466  -6.512  1.00 0.00 ? 4  GLN B OE1  4  
ATOM 2719  N NE2  . GLN B 2 4  ? 9.206   -3.058  -5.647  1.00 0.00 ? 4  GLN B NE2  4  
ATOM 2720  H H    . GLN B 2 4  ? 9.683   -1.690  -0.800  1.00 0.00 ? 4  GLN B H    4  
ATOM 2721  H HA   . GLN B 2 4  ? 11.270  0.297   -2.318  1.00 0.00 ? 4  GLN B HA   4  
ATOM 2722  H HB2  . GLN B 2 4  ? 8.725   -0.893  -3.450  1.00 0.00 ? 4  GLN B HB2  4  
ATOM 2723  H HB3  . GLN B 2 4  ? 9.787   0.281   -4.227  1.00 0.00 ? 4  GLN B HB3  4  
ATOM 2724  H HG2  . GLN B 2 4  ? 11.617  -1.390  -4.220  1.00 0.00 ? 4  GLN B HG2  4  
ATOM 2725  H HG3  . GLN B 2 4  ? 10.523  -2.566  -3.491  1.00 0.00 ? 4  GLN B HG3  4  
ATOM 2726  H HE21 . GLN B 2 4  ? 8.912   -3.550  -4.851  1.00 0.00 ? 4  GLN B HE21 4  
ATOM 2727  H HE22 . GLN B 2 4  ? 8.861   -3.303  -6.530  1.00 0.00 ? 4  GLN B HE22 4  
ATOM 2728  N N    . HIS B 2 5  ? 9.405   2.068   -1.910  1.00 0.00 ? 5  HIS B N    4  
ATOM 2729  C CA   . HIS B 2 5  ? 8.497   3.079   -1.301  1.00 0.00 ? 5  HIS B CA   4  
ATOM 2730  C C    . HIS B 2 5  ? 7.249   3.230   -2.175  1.00 0.00 ? 5  HIS B C    4  
ATOM 2731  O O    . HIS B 2 5  ? 7.263   2.912   -3.348  1.00 0.00 ? 5  HIS B O    4  
ATOM 2732  C CB   . HIS B 2 5  ? 9.233   4.417   -1.193  1.00 0.00 ? 5  HIS B CB   4  
ATOM 2733  C CG   . HIS B 2 5  ? 10.484  4.224   -0.381  1.00 0.00 ? 5  HIS B CG   4  
ATOM 2734  N ND1  . HIS B 2 5  ? 11.547  3.457   -0.833  1.00 0.00 ? 5  HIS B ND1  4  
ATOM 2735  C CD2  . HIS B 2 5  ? 10.855  4.683   0.859   1.00 0.00 ? 5  HIS B CD2  4  
ATOM 2736  C CE1  . HIS B 2 5  ? 12.497  3.477   0.119   1.00 0.00 ? 5  HIS B CE1  4  
ATOM 2737  N NE2  . HIS B 2 5  ? 12.127  4.210   1.172   1.00 0.00 ? 5  HIS B NE2  4  
ATOM 2738  H H    . HIS B 2 5  ? 10.045  2.338   -2.601  1.00 0.00 ? 5  HIS B H    4  
ATOM 2739  H HA   . HIS B 2 5  ? 8.208   2.748   -0.316  1.00 0.00 ? 5  HIS B HA   4  
ATOM 2740  H HB2  . HIS B 2 5  ? 9.491   4.767   -2.182  1.00 0.00 ? 5  HIS B HB2  4  
ATOM 2741  H HB3  . HIS B 2 5  ? 8.595   5.142   -0.709  1.00 0.00 ? 5  HIS B HB3  4  
ATOM 2742  H HD1  . HIS B 2 5  ? 11.597  2.986   -1.691  1.00 0.00 ? 5  HIS B HD1  4  
ATOM 2743  H HD2  . HIS B 2 5  ? 10.253  5.310   1.497   1.00 0.00 ? 5  HIS B HD2  4  
ATOM 2744  H HE1  . HIS B 2 5  ? 13.442  2.961   0.044   1.00 0.00 ? 5  HIS B HE1  4  
ATOM 2745  N N    . LEU B 2 6  ? 6.162   3.693   -1.615  1.00 0.00 ? 6  LEU B N    4  
ATOM 2746  C CA   . LEU B 2 6  ? 4.916   3.834   -2.424  1.00 0.00 ? 6  LEU B CA   4  
ATOM 2747  C C    . LEU B 2 6  ? 4.176   5.126   -2.057  1.00 0.00 ? 6  LEU B C    4  
ATOM 2748  O O    . LEU B 2 6  ? 3.529   5.210   -1.036  1.00 0.00 ? 6  LEU B O    4  
ATOM 2749  C CB   . LEU B 2 6  ? 4.001   2.638   -2.152  1.00 0.00 ? 6  LEU B CB   4  
ATOM 2750  C CG   . LEU B 2 6  ? 4.841   1.379   -1.923  1.00 0.00 ? 6  LEU B CG   4  
ATOM 2751  C CD1  . LEU B 2 6  ? 3.970   0.293   -1.291  1.00 0.00 ? 6  LEU B CD1  4  
ATOM 2752  C CD2  . LEU B 2 6  ? 5.384   0.877   -3.262  1.00 0.00 ? 6  LEU B CD2  4  
ATOM 2753  H H    . LEU B 2 6  ? 6.162   3.930   -0.665  1.00 0.00 ? 6  LEU B H    4  
ATOM 2754  H HA   . LEU B 2 6  ? 5.169   3.852   -3.469  1.00 0.00 ? 6  LEU B HA   4  
ATOM 2755  H HB2  . LEU B 2 6  ? 3.407   2.839   -1.271  1.00 0.00 ? 6  LEU B HB2  4  
ATOM 2756  H HB3  . LEU B 2 6  ? 3.350   2.487   -2.998  1.00 0.00 ? 6  LEU B HB3  4  
ATOM 2757  H HG   . LEU B 2 6  ? 5.664   1.605   -1.261  1.00 0.00 ? 6  LEU B HG   4  
ATOM 2758  H HD11 . LEU B 2 6  ? 3.074   0.159   -1.883  1.00 0.00 ? 6  LEU B HD11 4  
ATOM 2759  H HD12 . LEU B 2 6  ? 4.520   -0.638  -1.258  1.00 0.00 ? 6  LEU B HD12 4  
ATOM 2760  H HD13 . LEU B 2 6  ? 3.697   0.586   -0.288  1.00 0.00 ? 6  LEU B HD13 4  
ATOM 2761  H HD21 . LEU B 2 6  ? 5.415   1.695   -3.967  1.00 0.00 ? 6  LEU B HD21 4  
ATOM 2762  H HD22 . LEU B 2 6  ? 6.380   0.483   -3.124  1.00 0.00 ? 6  LEU B HD22 4  
ATOM 2763  H HD23 . LEU B 2 6  ? 4.739   0.098   -3.644  1.00 0.00 ? 6  LEU B HD23 4  
ATOM 2764  N N    . CYS B 2 7  ? 4.249   6.124   -2.896  1.00 0.00 ? 7  CYS B N    4  
ATOM 2765  C CA   . CYS B 2 7  ? 3.530   7.400   -2.608  1.00 0.00 ? 7  CYS B CA   4  
ATOM 2766  C C    . CYS B 2 7  ? 2.555   7.705   -3.750  1.00 0.00 ? 7  CYS B C    4  
ATOM 2767  O O    . CYS B 2 7  ? 2.858   7.500   -4.908  1.00 0.00 ? 7  CYS B O    4  
ATOM 2768  C CB   . CYS B 2 7  ? 4.527   8.547   -2.473  1.00 0.00 ? 7  CYS B CB   4  
ATOM 2769  S SG   . CYS B 2 7  ? 4.363   9.297   -0.834  1.00 0.00 ? 7  CYS B SG   4  
ATOM 2770  H H    . CYS B 2 7  ? 4.763   6.030   -3.727  1.00 0.00 ? 7  CYS B H    4  
ATOM 2771  H HA   . CYS B 2 7  ? 2.979   7.303   -1.690  1.00 0.00 ? 7  CYS B HA   4  
ATOM 2772  H HB2  . CYS B 2 7  ? 5.531   8.173   -2.603  1.00 0.00 ? 7  CYS B HB2  4  
ATOM 2773  H HB3  . CYS B 2 7  ? 4.317   9.284   -3.227  1.00 0.00 ? 7  CYS B HB3  4  
ATOM 2774  N N    . GLY B 2 8  ? 1.387   8.191   -3.430  1.00 0.00 ? 8  GLY B N    4  
ATOM 2775  C CA   . GLY B 2 8  ? 0.391   8.505   -4.495  1.00 0.00 ? 8  GLY B CA   4  
ATOM 2776  C C    . GLY B 2 8  ? -0.322  7.220   -4.917  1.00 0.00 ? 8  GLY B C    4  
ATOM 2777  O O    . GLY B 2 8  ? -0.617  6.366   -4.104  1.00 0.00 ? 8  GLY B O    4  
ATOM 2778  H H    . GLY B 2 8  ? 1.162   8.348   -2.488  1.00 0.00 ? 8  GLY B H    4  
ATOM 2779  H HA2  . GLY B 2 8  ? -0.331  9.215   -4.118  1.00 0.00 ? 8  GLY B HA2  4  
ATOM 2780  H HA3  . GLY B 2 8  ? 0.900   8.926   -5.349  1.00 0.00 ? 8  GLY B HA3  4  
ATOM 2781  N N    . SER B 2 9  ? -0.598  7.070   -6.184  1.00 0.00 ? 9  SER B N    4  
ATOM 2782  C CA   . SER B 2 9  ? -1.289  5.835   -6.653  1.00 0.00 ? 9  SER B CA   4  
ATOM 2783  C C    . SER B 2 9  ? -0.307  4.662   -6.626  1.00 0.00 ? 9  SER B C    4  
ATOM 2784  O O    . SER B 2 9  ? -0.672  3.528   -6.871  1.00 0.00 ? 9  SER B O    4  
ATOM 2785  C CB   . SER B 2 9  ? -1.793  6.044   -8.081  1.00 0.00 ? 9  SER B CB   4  
ATOM 2786  O OG   . SER B 2 9  ? -0.885  6.881   -8.783  1.00 0.00 ? 9  SER B OG   4  
ATOM 2787  H H    . SER B 2 9  ? -0.352  7.767   -6.828  1.00 0.00 ? 9  SER B H    4  
ATOM 2788  H HA   . SER B 2 9  ? -2.125  5.620   -6.004  1.00 0.00 ? 9  SER B HA   4  
ATOM 2789  H HB2  . SER B 2 9  ? -1.862  5.093   -8.585  1.00 0.00 ? 9  SER B HB2  4  
ATOM 2790  H HB3  . SER B 2 9  ? -2.773  6.503   -8.052  1.00 0.00 ? 9  SER B HB3  4  
ATOM 2791  H HG   . SER B 2 9  ? -0.748  6.504   -9.656  1.00 0.00 ? 9  SER B HG   4  
ATOM 2792  N N    . HIS B 2 10 ? 0.940   4.922   -6.329  1.00 0.00 ? 10 HIS B N    4  
ATOM 2793  C CA   . HIS B 2 10 ? 1.941   3.822   -6.286  1.00 0.00 ? 10 HIS B CA   4  
ATOM 2794  C C    . HIS B 2 10 ? 1.544   2.815   -5.207  1.00 0.00 ? 10 HIS B C    4  
ATOM 2795  O O    . HIS B 2 10 ? 1.440   1.631   -5.459  1.00 0.00 ? 10 HIS B O    4  
ATOM 2796  C CB   . HIS B 2 10 ? 3.322   4.399   -5.965  1.00 0.00 ? 10 HIS B CB   4  
ATOM 2797  C CG   . HIS B 2 10 ? 4.065   4.657   -7.245  1.00 0.00 ? 10 HIS B CG   4  
ATOM 2798  N ND1  . HIS B 2 10 ? 3.663   5.628   -8.150  1.00 0.00 ? 10 HIS B ND1  4  
ATOM 2799  C CD2  . HIS B 2 10 ? 5.184   4.077   -7.789  1.00 0.00 ? 10 HIS B CD2  4  
ATOM 2800  C CE1  . HIS B 2 10 ? 4.529   5.604   -9.180  1.00 0.00 ? 10 HIS B CE1  4  
ATOM 2801  N NE2  . HIS B 2 10 ? 5.475   4.677   -9.011  1.00 0.00 ? 10 HIS B NE2  4  
ATOM 2802  H H    . HIS B 2 10 ? 1.214   5.843   -6.135  1.00 0.00 ? 10 HIS B H    4  
ATOM 2803  H HA   . HIS B 2 10 ? 1.975   3.326   -7.245  1.00 0.00 ? 10 HIS B HA   4  
ATOM 2804  H HB2  . HIS B 2 10 ? 3.206   5.325   -5.420  1.00 0.00 ? 10 HIS B HB2  4  
ATOM 2805  H HB3  . HIS B 2 10 ? 3.877   3.694   -5.362  1.00 0.00 ? 10 HIS B HB3  4  
ATOM 2806  H HD1  . HIS B 2 10 ? 2.891   6.222   -8.056  1.00 0.00 ? 10 HIS B HD1  4  
ATOM 2807  H HD2  . HIS B 2 10 ? 5.754   3.278   -7.338  1.00 0.00 ? 10 HIS B HD2  4  
ATOM 2808  H HE1  . HIS B 2 10 ? 4.465   6.255   -10.039 1.00 0.00 ? 10 HIS B HE1  4  
ATOM 2809  N N    . LEU B 2 11 ? 1.320   3.272   -4.008  1.00 0.00 ? 11 LEU B N    4  
ATOM 2810  C CA   . LEU B 2 11 ? 0.927   2.334   -2.922  1.00 0.00 ? 11 LEU B CA   4  
ATOM 2811  C C    . LEU B 2 11 ? -0.331  1.576   -3.344  1.00 0.00 ? 11 LEU B C    4  
ATOM 2812  O O    . LEU B 2 11 ? -0.546  0.446   -2.953  1.00 0.00 ? 11 LEU B O    4  
ATOM 2813  C CB   . LEU B 2 11 ? 0.655   3.115   -1.638  1.00 0.00 ? 11 LEU B CB   4  
ATOM 2814  C CG   . LEU B 2 11 ? 1.148   2.306   -0.441  1.00 0.00 ? 11 LEU B CG   4  
ATOM 2815  C CD1  . LEU B 2 11 ? 1.786   3.244   0.587   1.00 0.00 ? 11 LEU B CD1  4  
ATOM 2816  C CD2  . LEU B 2 11 ? -0.035  1.573   0.197   1.00 0.00 ? 11 LEU B CD2  4  
ATOM 2817  H H    . LEU B 2 11 ? 1.407   4.230   -3.822  1.00 0.00 ? 11 LEU B H    4  
ATOM 2818  H HA   . LEU B 2 11 ? 1.727   1.629   -2.751  1.00 0.00 ? 11 LEU B HA   4  
ATOM 2819  H HB2  . LEU B 2 11 ? 1.173   4.063   -1.675  1.00 0.00 ? 11 LEU B HB2  4  
ATOM 2820  H HB3  . LEU B 2 11 ? -0.407  3.289   -1.539  1.00 0.00 ? 11 LEU B HB3  4  
ATOM 2821  H HG   . LEU B 2 11 ? 1.882   1.585   -0.773  1.00 0.00 ? 11 LEU B HG   4  
ATOM 2822  H HD11 . LEU B 2 11 ? 1.062   3.975   0.908   1.00 0.00 ? 11 LEU B HD11 4  
ATOM 2823  H HD12 . LEU B 2 11 ? 2.122   2.670   1.440   1.00 0.00 ? 11 LEU B HD12 4  
ATOM 2824  H HD13 . LEU B 2 11 ? 2.632   3.746   0.139   1.00 0.00 ? 11 LEU B HD13 4  
ATOM 2825  H HD21 . LEU B 2 11 ? -0.804  2.286   0.455   1.00 0.00 ? 11 LEU B HD21 4  
ATOM 2826  H HD22 . LEU B 2 11 ? -0.432  0.854   -0.506  1.00 0.00 ? 11 LEU B HD22 4  
ATOM 2827  H HD23 . LEU B 2 11 ? 0.295   1.060   1.089   1.00 0.00 ? 11 LEU B HD23 4  
ATOM 2828  N N    . VAL B 2 12 ? -1.159  2.182   -4.153  1.00 0.00 ? 12 VAL B N    4  
ATOM 2829  C CA   . VAL B 2 12 ? -2.392  1.484   -4.609  1.00 0.00 ? 12 VAL B CA   4  
ATOM 2830  C C    . VAL B 2 12 ? -1.985  0.268   -5.440  1.00 0.00 ? 12 VAL B C    4  
ATOM 2831  O O    . VAL B 2 12 ? -2.595  -0.780  -5.370  1.00 0.00 ? 12 VAL B O    4  
ATOM 2832  C CB   . VAL B 2 12 ? -3.239  2.429   -5.460  1.00 0.00 ? 12 VAL B CB   4  
ATOM 2833  C CG1  . VAL B 2 12 ? -4.337  1.630   -6.164  1.00 0.00 ? 12 VAL B CG1  4  
ATOM 2834  C CG2  . VAL B 2 12 ? -3.883  3.484   -4.558  1.00 0.00 ? 12 VAL B CG2  4  
ATOM 2835  H H    . VAL B 2 12 ? -0.963  3.089   -4.467  1.00 0.00 ? 12 VAL B H    4  
ATOM 2836  H HA   . VAL B 2 12 ? -2.961  1.161   -3.750  1.00 0.00 ? 12 VAL B HA   4  
ATOM 2837  H HB   . VAL B 2 12 ? -2.613  2.913   -6.197  1.00 0.00 ? 12 VAL B HB   4  
ATOM 2838  H HG11 . VAL B 2 12 ? -4.765  0.923   -5.471  1.00 0.00 ? 12 VAL B HG11 4  
ATOM 2839  H HG12 . VAL B 2 12 ? -5.105  2.304   -6.512  1.00 0.00 ? 12 VAL B HG12 4  
ATOM 2840  H HG13 . VAL B 2 12 ? -3.914  1.101   -7.005  1.00 0.00 ? 12 VAL B HG13 4  
ATOM 2841  H HG21 . VAL B 2 12 ? -4.151  3.034   -3.613  1.00 0.00 ? 12 VAL B HG21 4  
ATOM 2842  H HG22 . VAL B 2 12 ? -3.183  4.288   -4.385  1.00 0.00 ? 12 VAL B HG22 4  
ATOM 2843  H HG23 . VAL B 2 12 ? -4.769  3.875   -5.036  1.00 0.00 ? 12 VAL B HG23 4  
ATOM 2844  N N    . GLU B 2 13 ? -0.947  0.398   -6.224  1.00 0.00 ? 13 GLU B N    4  
ATOM 2845  C CA   . GLU B 2 13 ? -0.491  -0.751  -7.052  1.00 0.00 ? 13 GLU B CA   4  
ATOM 2846  C C    . GLU B 2 13 ? -0.066  -1.894  -6.133  1.00 0.00 ? 13 GLU B C    4  
ATOM 2847  O O    . GLU B 2 13 ? -0.017  -3.040  -6.531  1.00 0.00 ? 13 GLU B O    4  
ATOM 2848  C CB   . GLU B 2 13 ? 0.698   -0.319  -7.912  1.00 0.00 ? 13 GLU B CB   4  
ATOM 2849  C CG   . GLU B 2 13 ? 0.186   0.245   -9.239  1.00 0.00 ? 13 GLU B CG   4  
ATOM 2850  C CD   . GLU B 2 13 ? 1.359   0.799   -10.047 1.00 0.00 ? 13 GLU B CD   4  
ATOM 2851  O OE1  . GLU B 2 13 ? 2.056   1.658   -9.531  1.00 0.00 ? 13 GLU B OE1  4  
ATOM 2852  O OE2  . GLU B 2 13 ? 1.542   0.355   -11.170 1.00 0.00 ? 13 GLU B OE2  4  
ATOM 2853  H H    . GLU B 2 13 ? -0.466  1.251   -6.260  1.00 0.00 ? 13 GLU B H    4  
ATOM 2854  H HA   . GLU B 2 13 ? -1.298  -1.080  -7.689  1.00 0.00 ? 13 GLU B HA   4  
ATOM 2855  H HB2  . GLU B 2 13 ? 1.263   0.440   -7.391  1.00 0.00 ? 13 GLU B HB2  4  
ATOM 2856  H HB3  . GLU B 2 13 ? 1.331   -1.171  -8.107  1.00 0.00 ? 13 GLU B HB3  4  
ATOM 2857  H HG2  . GLU B 2 13 ? -0.300  -0.542  -9.799  1.00 0.00 ? 13 GLU B HG2  4  
ATOM 2858  H HG3  . GLU B 2 13 ? -0.520  1.038   -9.044  1.00 0.00 ? 13 GLU B HG3  4  
ATOM 2859  N N    . ALA B 2 14 ? 0.235   -1.590  -4.899  1.00 0.00 ? 14 ALA B N    4  
ATOM 2860  C CA   . ALA B 2 14 ? 0.648   -2.659  -3.950  1.00 0.00 ? 14 ALA B CA   4  
ATOM 2861  C C    . ALA B 2 14 ? -0.549  -3.036  -3.073  1.00 0.00 ? 14 ALA B C    4  
ATOM 2862  O O    . ALA B 2 14 ? -0.539  -4.038  -2.387  1.00 0.00 ? 14 ALA B O    4  
ATOM 2863  C CB   . ALA B 2 14 ? 1.789   -2.146  -3.069  1.00 0.00 ? 14 ALA B CB   4  
ATOM 2864  H H    . ALA B 2 14 ? 0.183   -0.659  -4.594  1.00 0.00 ? 14 ALA B H    4  
ATOM 2865  H HA   . ALA B 2 14 ? 0.979   -3.526  -4.502  1.00 0.00 ? 14 ALA B HA   4  
ATOM 2866  H HB1  . ALA B 2 14 ? 2.491   -1.591  -3.674  1.00 0.00 ? 14 ALA B HB1  4  
ATOM 2867  H HB2  . ALA B 2 14 ? 1.388   -1.503  -2.299  1.00 0.00 ? 14 ALA B HB2  4  
ATOM 2868  H HB3  . ALA B 2 14 ? 2.294   -2.984  -2.609  1.00 0.00 ? 14 ALA B HB3  4  
ATOM 2869  N N    . LEU B 2 15 ? -1.582  -2.237  -3.095  1.00 0.00 ? 15 LEU B N    4  
ATOM 2870  C CA   . LEU B 2 15 ? -2.782  -2.540  -2.269  1.00 0.00 ? 15 LEU B CA   4  
ATOM 2871  C C    . LEU B 2 15 ? -3.655  -3.568  -2.992  1.00 0.00 ? 15 LEU B C    4  
ATOM 2872  O O    . LEU B 2 15 ? -4.107  -4.532  -2.410  1.00 0.00 ? 15 LEU B O    4  
ATOM 2873  C CB   . LEU B 2 15 ? -3.585  -1.256  -2.046  1.00 0.00 ? 15 LEU B CB   4  
ATOM 2874  C CG   . LEU B 2 15 ? -2.866  -0.374  -1.024  1.00 0.00 ? 15 LEU B CG   4  
ATOM 2875  C CD1  . LEU B 2 15 ? -3.616  0.952   -0.876  1.00 0.00 ? 15 LEU B CD1  4  
ATOM 2876  C CD2  . LEU B 2 15 ? -2.830  -1.088  0.328   1.00 0.00 ? 15 LEU B CD2  4  
ATOM 2877  H H    . LEU B 2 15 ? -1.567  -1.434  -3.657  1.00 0.00 ? 15 LEU B H    4  
ATOM 2878  H HA   . LEU B 2 15 ? -2.471  -2.941  -1.314  1.00 0.00 ? 15 LEU B HA   4  
ATOM 2879  H HB2  . LEU B 2 15 ? -3.676  -0.724  -2.982  1.00 0.00 ? 15 LEU B HB2  4  
ATOM 2880  H HB3  . LEU B 2 15 ? -4.567  -1.505  -1.676  1.00 0.00 ? 15 LEU B HB3  4  
ATOM 2881  H HG   . LEU B 2 15 ? -1.857  -0.181  -1.360  1.00 0.00 ? 15 LEU B HG   4  
ATOM 2882  H HD11 . LEU B 2 15 ? -4.355  1.037   -1.658  1.00 0.00 ? 15 LEU B HD11 4  
ATOM 2883  H HD12 . LEU B 2 15 ? -4.105  0.982   0.087   1.00 0.00 ? 15 LEU B HD12 4  
ATOM 2884  H HD13 . LEU B 2 15 ? -2.916  1.770   -0.950  1.00 0.00 ? 15 LEU B HD13 4  
ATOM 2885  H HD21 . LEU B 2 15 ? -3.220  -2.087  0.218   1.00 0.00 ? 15 LEU B HD21 4  
ATOM 2886  H HD22 . LEU B 2 15 ? -1.811  -1.136  0.683   1.00 0.00 ? 15 LEU B HD22 4  
ATOM 2887  H HD23 . LEU B 2 15 ? -3.433  -0.541  1.040   1.00 0.00 ? 15 LEU B HD23 4  
ATOM 2888  N N    . HIS B 2 16 ? -3.895  -3.369  -4.260  1.00 0.00 ? 16 HIS B N    4  
ATOM 2889  C CA   . HIS B 2 16 ? -4.739  -4.337  -5.018  1.00 0.00 ? 16 HIS B CA   4  
ATOM 2890  C C    . HIS B 2 16 ? -4.014  -5.682  -5.098  1.00 0.00 ? 16 HIS B C    4  
ATOM 2891  O O    . HIS B 2 16 ? -4.628  -6.729  -5.163  1.00 0.00 ? 16 HIS B O    4  
ATOM 2892  C CB   . HIS B 2 16 ? -4.991  -3.793  -6.429  1.00 0.00 ? 16 HIS B CB   4  
ATOM 2893  C CG   . HIS B 2 16 ? -3.761  -3.969  -7.275  1.00 0.00 ? 16 HIS B CG   4  
ATOM 2894  N ND1  . HIS B 2 16 ? -3.783  -4.635  -8.492  1.00 0.00 ? 16 HIS B ND1  4  
ATOM 2895  C CD2  . HIS B 2 16 ? -2.469  -3.564  -7.092  1.00 0.00 ? 16 HIS B CD2  4  
ATOM 2896  C CE1  . HIS B 2 16 ? -2.531  -4.607  -8.989  1.00 0.00 ? 16 HIS B CE1  4  
ATOM 2897  N NE2  . HIS B 2 16 ? -1.691  -3.967  -8.174  1.00 0.00 ? 16 HIS B NE2  4  
ATOM 2898  H H    . HIS B 2 16 ? -3.522  -2.585  -4.712  1.00 0.00 ? 16 HIS B H    4  
ATOM 2899  H HA   . HIS B 2 16 ? -5.682  -4.467  -4.508  1.00 0.00 ? 16 HIS B HA   4  
ATOM 2900  H HB2  . HIS B 2 16 ? -5.816  -4.325  -6.880  1.00 0.00 ? 16 HIS B HB2  4  
ATOM 2901  H HB3  . HIS B 2 16 ? -5.229  -2.742  -6.369  1.00 0.00 ? 16 HIS B HB3  4  
ATOM 2902  H HD1  . HIS B 2 16 ? -4.565  -5.051  -8.912  1.00 0.00 ? 16 HIS B HD1  4  
ATOM 2903  H HD2  . HIS B 2 16 ? -2.110  -3.017  -6.236  1.00 0.00 ? 16 HIS B HD2  4  
ATOM 2904  H HE1  . HIS B 2 16 ? -2.245  -5.048  -9.932  1.00 0.00 ? 16 HIS B HE1  4  
ATOM 2905  N N    . LEU B 2 17 ? -2.710  -5.659  -5.093  1.00 0.00 ? 17 LEU B N    4  
ATOM 2906  C CA   . LEU B 2 17 ? -1.933  -6.927  -5.168  1.00 0.00 ? 17 LEU B CA   4  
ATOM 2907  C C    . LEU B 2 17 ? -2.093  -7.703  -3.857  1.00 0.00 ? 17 LEU B C    4  
ATOM 2908  O O    . LEU B 2 17 ? -1.773  -8.872  -3.775  1.00 0.00 ? 17 LEU B O    4  
ATOM 2909  C CB   . LEU B 2 17 ? -0.457  -6.595  -5.391  1.00 0.00 ? 17 LEU B CB   4  
ATOM 2910  C CG   . LEU B 2 17 ? 0.353   -7.888  -5.501  1.00 0.00 ? 17 LEU B CG   4  
ATOM 2911  C CD1  . LEU B 2 17 ? -0.066  -8.646  -6.761  1.00 0.00 ? 17 LEU B CD1  4  
ATOM 2912  C CD2  . LEU B 2 17 ? 1.841   -7.543  -5.583  1.00 0.00 ? 17 LEU B CD2  4  
ATOM 2913  H H    . LEU B 2 17 ? -2.237  -4.801  -5.039  1.00 0.00 ? 17 LEU B H    4  
ATOM 2914  H HA   . LEU B 2 17 ? -2.297  -7.526  -5.989  1.00 0.00 ? 17 LEU B HA   4  
ATOM 2915  H HB2  . LEU B 2 17 ? -0.351  -6.025  -6.302  1.00 0.00 ? 17 LEU B HB2  4  
ATOM 2916  H HB3  . LEU B 2 17 ? -0.090  -6.014  -4.558  1.00 0.00 ? 17 LEU B HB3  4  
ATOM 2917  H HG   . LEU B 2 17 ? 0.170   -8.502  -4.632  1.00 0.00 ? 17 LEU B HG   4  
ATOM 2918  H HD11 . LEU B 2 17 ? -0.302  -7.941  -7.545  1.00 0.00 ? 17 LEU B HD11 4  
ATOM 2919  H HD12 . LEU B 2 17 ? 0.746   -9.284  -7.084  1.00 0.00 ? 17 LEU B HD12 4  
ATOM 2920  H HD13 . LEU B 2 17 ? -0.934  -9.250  -6.547  1.00 0.00 ? 17 LEU B HD13 4  
ATOM 2921  H HD21 . LEU B 2 17 ? 1.969   -6.476  -5.479  1.00 0.00 ? 17 LEU B HD21 4  
ATOM 2922  H HD22 . LEU B 2 17 ? 2.371   -8.048  -4.790  1.00 0.00 ? 17 LEU B HD22 4  
ATOM 2923  H HD23 . LEU B 2 17 ? 2.232   -7.860  -6.539  1.00 0.00 ? 17 LEU B HD23 4  
ATOM 2924  N N    . VAL B 2 18 ? -2.585  -7.062  -2.834  1.00 0.00 ? 18 VAL B N    4  
ATOM 2925  C CA   . VAL B 2 18 ? -2.765  -7.762  -1.531  1.00 0.00 ? 18 VAL B CA   4  
ATOM 2926  C C    . VAL B 2 18 ? -4.169  -8.363  -1.461  1.00 0.00 ? 18 VAL B C    4  
ATOM 2927  O O    . VAL B 2 18 ? -4.340  -9.553  -1.290  1.00 0.00 ? 18 VAL B O    4  
ATOM 2928  C CB   . VAL B 2 18 ? -2.587  -6.761  -0.387  1.00 0.00 ? 18 VAL B CB   4  
ATOM 2929  C CG1  . VAL B 2 18 ? -2.801  -7.472  0.951   1.00 0.00 ? 18 VAL B CG1  4  
ATOM 2930  C CG2  . VAL B 2 18 ? -1.173  -6.179  -0.434  1.00 0.00 ? 18 VAL B CG2  4  
ATOM 2931  H H    . VAL B 2 18 ? -2.836  -6.119  -2.922  1.00 0.00 ? 18 VAL B H    4  
ATOM 2932  H HA   . VAL B 2 18 ? -2.031  -8.548  -1.438  1.00 0.00 ? 18 VAL B HA   4  
ATOM 2933  H HB   . VAL B 2 18 ? -3.311  -5.965  -0.490  1.00 0.00 ? 18 VAL B HB   4  
ATOM 2934  H HG11 . VAL B 2 18 ? -3.769  -7.948  0.957   1.00 0.00 ? 18 VAL B HG11 4  
ATOM 2935  H HG12 . VAL B 2 18 ? -2.031  -8.218  1.090   1.00 0.00 ? 18 VAL B HG12 4  
ATOM 2936  H HG13 . VAL B 2 18 ? -2.750  -6.749  1.753   1.00 0.00 ? 18 VAL B HG13 4  
ATOM 2937  H HG21 . VAL B 2 18 ? -0.590  -6.705  -1.175  1.00 0.00 ? 18 VAL B HG21 4  
ATOM 2938  H HG22 . VAL B 2 18 ? -1.224  -5.130  -0.694  1.00 0.00 ? 18 VAL B HG22 4  
ATOM 2939  H HG23 . VAL B 2 18 ? -0.707  -6.286  0.535   1.00 0.00 ? 18 VAL B HG23 4  
ATOM 2940  N N    . CYS B 2 19 ? -5.177  -7.546  -1.586  1.00 0.00 ? 19 CYS B N    4  
ATOM 2941  C CA   . CYS B 2 19 ? -6.571  -8.065  -1.523  1.00 0.00 ? 19 CYS B CA   4  
ATOM 2942  C C    . CYS B 2 19 ? -6.882  -8.859  -2.792  1.00 0.00 ? 19 CYS B C    4  
ATOM 2943  O O    . CYS B 2 19 ? -7.114  -10.050 -2.749  1.00 0.00 ? 19 CYS B O    4  
ATOM 2944  C CB   . CYS B 2 19 ? -7.537  -6.888  -1.409  1.00 0.00 ? 19 CYS B CB   4  
ATOM 2945  S SG   . CYS B 2 19 ? -6.856  -5.651  -0.278  1.00 0.00 ? 19 CYS B SG   4  
ATOM 2946  H H    . CYS B 2 19 ? -5.021  -6.588  -1.720  1.00 0.00 ? 19 CYS B H    4  
ATOM 2947  H HA   . CYS B 2 19 ? -6.680  -8.705  -0.658  1.00 0.00 ? 19 CYS B HA   4  
ATOM 2948  H HB2  . CYS B 2 19 ? -7.674  -6.444  -2.383  1.00 0.00 ? 19 CYS B HB2  4  
ATOM 2949  H HB3  . CYS B 2 19 ? -8.489  -7.237  -1.032  1.00 0.00 ? 19 CYS B HB3  4  
ATOM 2950  N N    . GLY B 2 20 ? -6.895  -8.206  -3.923  1.00 0.00 ? 20 GLY B N    4  
ATOM 2951  C CA   . GLY B 2 20 ? -7.195  -8.921  -5.195  1.00 0.00 ? 20 GLY B CA   4  
ATOM 2952  C C    . GLY B 2 20 ? -8.580  -8.505  -5.699  1.00 0.00 ? 20 GLY B C    4  
ATOM 2953  O O    . GLY B 2 20 ? -8.855  -7.338  -5.895  1.00 0.00 ? 20 GLY B O    4  
ATOM 2954  H H    . GLY B 2 20 ? -6.706  -7.244  -3.934  1.00 0.00 ? 20 GLY B H    4  
ATOM 2955  H HA2  . GLY B 2 20 ? -6.449  -8.666  -5.936  1.00 0.00 ? 20 GLY B HA2  4  
ATOM 2956  H HA3  . GLY B 2 20 ? -7.183  -9.987  -5.022  1.00 0.00 ? 20 GLY B HA3  4  
ATOM 2957  N N    . GLU B 2 21 ? -9.455  -9.451  -5.908  1.00 0.00 ? 21 GLU B N    4  
ATOM 2958  C CA   . GLU B 2 21 ? -10.820 -9.107  -6.399  1.00 0.00 ? 21 GLU B CA   4  
ATOM 2959  C C    . GLU B 2 21 ? -11.615 -8.445  -5.272  1.00 0.00 ? 21 GLU B C    4  
ATOM 2960  O O    . GLU B 2 21 ? -12.420 -7.565  -5.502  1.00 0.00 ? 21 GLU B O    4  
ATOM 2961  C CB   . GLU B 2 21 ? -11.540 -10.382 -6.850  1.00 0.00 ? 21 GLU B CB   4  
ATOM 2962  C CG   . GLU B 2 21 ? -12.925 -10.022 -7.392  1.00 0.00 ? 21 GLU B CG   4  
ATOM 2963  C CD   . GLU B 2 21 ? -13.923 -11.120 -7.018  1.00 0.00 ? 21 GLU B CD   4  
ATOM 2964  O OE1  . GLU B 2 21 ? -13.498 -12.255 -6.879  1.00 0.00 ? 21 GLU B OE1  4  
ATOM 2965  O OE2  . GLU B 2 21 ? -15.093 -10.806 -6.876  1.00 0.00 ? 21 GLU B OE2  4  
ATOM 2966  H H    . GLU B 2 21 ? -9.214  -10.388 -5.744  1.00 0.00 ? 21 GLU B H    4  
ATOM 2967  H HA   . GLU B 2 21 ? -10.742 -8.424  -7.232  1.00 0.00 ? 21 GLU B HA   4  
ATOM 2968  H HB2  . GLU B 2 21 ? -10.961 -10.864 -7.626  1.00 0.00 ? 21 GLU B HB2  4  
ATOM 2969  H HB3  . GLU B 2 21 ? -11.646 -11.052 -6.011  1.00 0.00 ? 21 GLU B HB3  4  
ATOM 2970  H HG2  . GLU B 2 21 ? -13.245 -9.082  -6.965  1.00 0.00 ? 21 GLU B HG2  4  
ATOM 2971  H HG3  . GLU B 2 21 ? -12.878 -9.931  -8.467  1.00 0.00 ? 21 GLU B HG3  4  
ATOM 2972  N N    . ARG B 2 22 ? -11.396 -8.861  -4.054  1.00 0.00 ? 22 ARG B N    4  
ATOM 2973  C CA   . ARG B 2 22 ? -12.141 -8.250  -2.916  1.00 0.00 ? 22 ARG B CA   4  
ATOM 2974  C C    . ARG B 2 22 ? -12.110 -6.727  -3.048  1.00 0.00 ? 22 ARG B C    4  
ATOM 2975  O O    . ARG B 2 22 ? -13.118 -6.063  -2.911  1.00 0.00 ? 22 ARG B O    4  
ATOM 2976  C CB   . ARG B 2 22 ? -11.490 -8.665  -1.597  1.00 0.00 ? 22 ARG B CB   4  
ATOM 2977  C CG   . ARG B 2 22 ? -12.010 -10.042 -1.183  1.00 0.00 ? 22 ARG B CG   4  
ATOM 2978  C CD   . ARG B 2 22 ? -11.194 -10.562 0.003   1.00 0.00 ? 22 ARG B CD   4  
ATOM 2979  N NE   . ARG B 2 22 ? -10.567 -11.862 -0.362  1.00 0.00 ? 22 ARG B NE   4  
ATOM 2980  C CZ   . ARG B 2 22 ? -9.600  -12.353 0.368   1.00 0.00 ? 22 ARG B CZ   4  
ATOM 2981  N NH1  . ARG B 2 22 ? -9.173  -11.699 1.415   1.00 0.00 ? 22 ARG B NH1  4  
ATOM 2982  N NH2  . ARG B 2 22 ? -9.058  -13.496 0.046   1.00 0.00 ? 22 ARG B NH2  4  
ATOM 2983  H H    . ARG B 2 22 ? -10.743 -9.571  -3.888  1.00 0.00 ? 22 ARG B H    4  
ATOM 2984  H HA   . ARG B 2 22 ? -13.163 -8.591  -2.932  1.00 0.00 ? 22 ARG B HA   4  
ATOM 2985  H HB2  . ARG B 2 22 ? -10.418 -8.704  -1.722  1.00 0.00 ? 22 ARG B HB2  4  
ATOM 2986  H HB3  . ARG B 2 22 ? -11.739 -7.944  -0.835  1.00 0.00 ? 22 ARG B HB3  4  
ATOM 2987  H HG2  . ARG B 2 22 ? -13.049 -9.963  -0.901  1.00 0.00 ? 22 ARG B HG2  4  
ATOM 2988  H HG3  . ARG B 2 22 ? -11.912 -10.726 -2.012  1.00 0.00 ? 22 ARG B HG3  4  
ATOM 2989  H HD2  . ARG B 2 22 ? -10.425 -9.847  0.253   1.00 0.00 ? 22 ARG B HD2  4  
ATOM 2990  H HD3  . ARG B 2 22 ? -11.847 -10.701 0.853   1.00 0.00 ? 22 ARG B HD3  4  
ATOM 2991  H HE   . ARG B 2 22 ? -10.882 -12.355 -1.148  1.00 0.00 ? 22 ARG B HE   4  
ATOM 2992  H HH11 . ARG B 2 22 ? -9.586  -10.824 1.663   1.00 0.00 ? 22 ARG B HH11 4  
ATOM 2993  H HH12 . ARG B 2 22 ? -8.431  -12.079 1.971   1.00 0.00 ? 22 ARG B HH12 4  
ATOM 2994  H HH21 . ARG B 2 22 ? -9.384  -13.994 -0.756  1.00 0.00 ? 22 ARG B HH21 4  
ATOM 2995  H HH22 . ARG B 2 22 ? -8.317  -13.871 0.602   1.00 0.00 ? 22 ARG B HH22 4  
ATOM 2996  N N    . GLY B 2 23 ? -10.962 -6.167  -3.316  1.00 0.00 ? 23 GLY B N    4  
ATOM 2997  C CA   . GLY B 2 23 ? -10.872 -4.687  -3.460  1.00 0.00 ? 23 GLY B CA   4  
ATOM 2998  C C    . GLY B 2 23 ? -10.226 -4.086  -2.211  1.00 0.00 ? 23 GLY B C    4  
ATOM 2999  O O    . GLY B 2 23 ? -9.926  -4.781  -1.260  1.00 0.00 ? 23 GLY B O    4  
ATOM 3000  H H    . GLY B 2 23 ? -10.161 -6.721  -3.426  1.00 0.00 ? 23 GLY B H    4  
ATOM 3001  H HA2  . GLY B 2 23 ? -10.272 -4.448  -4.327  1.00 0.00 ? 23 GLY B HA2  4  
ATOM 3002  H HA3  . GLY B 2 23 ? -11.861 -4.276  -3.583  1.00 0.00 ? 23 GLY B HA3  4  
ATOM 3003  N N    . PHE B 2 24 ? -10.008 -2.800  -2.208  1.00 0.00 ? 24 PHE B N    4  
ATOM 3004  C CA   . PHE B 2 24 ? -9.381  -2.153  -1.020  1.00 0.00 ? 24 PHE B CA   4  
ATOM 3005  C C    . PHE B 2 24 ? -9.724  -0.662  -1.009  1.00 0.00 ? 24 PHE B C    4  
ATOM 3006  O O    . PHE B 2 24 ? -9.613  0.016   -2.011  1.00 0.00 ? 24 PHE B O    4  
ATOM 3007  C CB   . PHE B 2 24 ? -7.863  -2.327  -1.092  1.00 0.00 ? 24 PHE B CB   4  
ATOM 3008  C CG   . PHE B 2 24 ? -7.358  -1.831  -2.424  1.00 0.00 ? 24 PHE B CG   4  
ATOM 3009  C CD1  . PHE B 2 24 ? -7.422  -2.664  -3.544  1.00 0.00 ? 24 PHE B CD1  4  
ATOM 3010  C CD2  . PHE B 2 24 ? -6.826  -0.541  -2.538  1.00 0.00 ? 24 PHE B CD2  4  
ATOM 3011  C CE1  . PHE B 2 24 ? -6.954  -2.209  -4.783  1.00 0.00 ? 24 PHE B CE1  4  
ATOM 3012  C CE2  . PHE B 2 24 ? -6.357  -0.084  -3.776  1.00 0.00 ? 24 PHE B CE2  4  
ATOM 3013  C CZ   . PHE B 2 24 ? -6.422  -0.919  -4.898  1.00 0.00 ? 24 PHE B CZ   4  
ATOM 3014  H H    . PHE B 2 24 ? -10.259 -2.259  -2.984  1.00 0.00 ? 24 PHE B H    4  
ATOM 3015  H HA   . PHE B 2 24 ? -9.754  -2.615  -0.119  1.00 0.00 ? 24 PHE B HA   4  
ATOM 3016  H HB2  . PHE B 2 24 ? -7.396  -1.767  -0.297  1.00 0.00 ? 24 PHE B HB2  4  
ATOM 3017  H HB3  . PHE B 2 24 ? -7.617  -3.373  -0.988  1.00 0.00 ? 24 PHE B HB3  4  
ATOM 3018  H HD1  . PHE B 2 24 ? -7.832  -3.658  -3.451  1.00 0.00 ? 24 PHE B HD1  4  
ATOM 3019  H HD2  . PHE B 2 24 ? -6.777  0.101   -1.670  1.00 0.00 ? 24 PHE B HD2  4  
ATOM 3020  H HE1  . PHE B 2 24 ? -7.003  -2.852  -5.648  1.00 0.00 ? 24 PHE B HE1  4  
ATOM 3021  H HE2  . PHE B 2 24 ? -5.946  0.910   -3.866  1.00 0.00 ? 24 PHE B HE2  4  
ATOM 3022  H HZ   . PHE B 2 24 ? -6.061  -0.567  -5.854  1.00 0.00 ? 24 PHE B HZ   4  
ATOM 3023  N N    . PHE B 2 25 ? -10.134 -0.145  0.117   1.00 0.00 ? 25 PHE B N    4  
ATOM 3024  C CA   . PHE B 2 25 ? -10.477 1.304   0.184   1.00 0.00 ? 25 PHE B CA   4  
ATOM 3025  C C    . PHE B 2 25 ? -9.204  2.112   0.446   1.00 0.00 ? 25 PHE B C    4  
ATOM 3026  O O    . PHE B 2 25 ? -8.697  2.154   1.549   1.00 0.00 ? 25 PHE B O    4  
ATOM 3027  C CB   . PHE B 2 25 ? -11.488 1.551   1.312   1.00 0.00 ? 25 PHE B CB   4  
ATOM 3028  C CG   . PHE B 2 25 ? -11.062 0.824   2.567   1.00 0.00 ? 25 PHE B CG   4  
ATOM 3029  C CD1  . PHE B 2 25 ? -10.210 1.449   3.483   1.00 0.00 ? 25 PHE B CD1  4  
ATOM 3030  C CD2  . PHE B 2 25 ? -11.528 -0.473  2.816   1.00 0.00 ? 25 PHE B CD2  4  
ATOM 3031  C CE1  . PHE B 2 25 ? -9.820  0.779   4.649   1.00 0.00 ? 25 PHE B CE1  4  
ATOM 3032  C CE2  . PHE B 2 25 ? -11.139 -1.143  3.983   1.00 0.00 ? 25 PHE B CE2  4  
ATOM 3033  C CZ   . PHE B 2 25 ? -10.284 -0.517  4.898   1.00 0.00 ? 25 PHE B CZ   4  
ATOM 3034  H H    . PHE B 2 25 ? -10.212 -0.707  0.916   1.00 0.00 ? 25 PHE B H    4  
ATOM 3035  H HA   . PHE B 2 25 ? -10.908 1.613   -0.757  1.00 0.00 ? 25 PHE B HA   4  
ATOM 3036  H HB2  . PHE B 2 25 ? -11.543 2.611   1.514   1.00 0.00 ? 25 PHE B HB2  4  
ATOM 3037  H HB3  . PHE B 2 25 ? -12.461 1.195   1.004   1.00 0.00 ? 25 PHE B HB3  4  
ATOM 3038  H HD1  . PHE B 2 25 ? -9.850  2.451   3.292   1.00 0.00 ? 25 PHE B HD1  4  
ATOM 3039  H HD2  . PHE B 2 25 ? -12.186 -0.957  2.110   1.00 0.00 ? 25 PHE B HD2  4  
ATOM 3040  H HE1  . PHE B 2 25 ? -9.161  1.262   5.355   1.00 0.00 ? 25 PHE B HE1  4  
ATOM 3041  H HE2  . PHE B 2 25 ? -11.498 -2.143  4.176   1.00 0.00 ? 25 PHE B HE2  4  
ATOM 3042  H HZ   . PHE B 2 25 ? -9.984  -1.035  5.798   1.00 0.00 ? 25 PHE B HZ   4  
ATOM 3043  N N    . TYR B 2 26 ? -8.681  2.753   -0.561  1.00 0.00 ? 26 TYR B N    4  
ATOM 3044  C CA   . TYR B 2 26 ? -7.438  3.552   -0.368  1.00 0.00 ? 26 TYR B CA   4  
ATOM 3045  C C    . TYR B 2 26 ? -7.806  4.966   0.083   1.00 0.00 ? 26 TYR B C    4  
ATOM 3046  O O    . TYR B 2 26 ? -8.828  5.504   -0.297  1.00 0.00 ? 26 TYR B O    4  
ATOM 3047  C CB   . TYR B 2 26 ? -6.667  3.618   -1.688  1.00 0.00 ? 26 TYR B CB   4  
ATOM 3048  C CG   . TYR B 2 26 ? -5.253  4.083   -1.427  1.00 0.00 ? 26 TYR B CG   4  
ATOM 3049  C CD1  . TYR B 2 26 ? -4.533  3.567   -0.342  1.00 0.00 ? 26 TYR B CD1  4  
ATOM 3050  C CD2  . TYR B 2 26 ? -4.663  5.032   -2.268  1.00 0.00 ? 26 TYR B CD2  4  
ATOM 3051  C CE1  . TYR B 2 26 ? -3.225  3.999   -0.100  1.00 0.00 ? 26 TYR B CE1  4  
ATOM 3052  C CE2  . TYR B 2 26 ? -3.353  5.466   -2.025  1.00 0.00 ? 26 TYR B CE2  4  
ATOM 3053  C CZ   . TYR B 2 26 ? -2.636  4.949   -0.942  1.00 0.00 ? 26 TYR B CZ   4  
ATOM 3054  O OH   . TYR B 2 26 ? -1.345  5.376   -0.702  1.00 0.00 ? 26 TYR B OH   4  
ATOM 3055  H H    . TYR B 2 26 ? -9.101  2.705   -1.446  1.00 0.00 ? 26 TYR B H    4  
ATOM 3056  H HA   . TYR B 2 26 ? -6.825  3.082   0.384   1.00 0.00 ? 26 TYR B HA   4  
ATOM 3057  H HB2  . TYR B 2 26 ? -6.644  2.638   -2.143  1.00 0.00 ? 26 TYR B HB2  4  
ATOM 3058  H HB3  . TYR B 2 26 ? -7.155  4.313   -2.356  1.00 0.00 ? 26 TYR B HB3  4  
ATOM 3059  H HD1  . TYR B 2 26 ? -4.987  2.831   0.307   1.00 0.00 ? 26 TYR B HD1  4  
ATOM 3060  H HD2  . TYR B 2 26 ? -5.217  5.432   -3.105  1.00 0.00 ? 26 TYR B HD2  4  
ATOM 3061  H HE1  . TYR B 2 26 ? -2.671  3.600   0.737   1.00 0.00 ? 26 TYR B HE1  4  
ATOM 3062  H HE2  . TYR B 2 26 ? -2.898  6.200   -2.674  1.00 0.00 ? 26 TYR B HE2  4  
ATOM 3063  H HH   . TYR B 2 26 ? -0.900  4.698   -0.191  1.00 0.00 ? 26 TYR B HH   4  
ATOM 3064  N N    . THR B 2 27 ? -6.983  5.573   0.895   1.00 0.00 ? 27 THR B N    4  
ATOM 3065  C CA   . THR B 2 27 ? -7.289  6.951   1.372   1.00 0.00 ? 27 THR B CA   4  
ATOM 3066  C C    . THR B 2 27 ? -6.089  7.865   1.100   1.00 0.00 ? 27 THR B C    4  
ATOM 3067  O O    . THR B 2 27 ? -5.446  8.331   2.020   1.00 0.00 ? 27 THR B O    4  
ATOM 3068  C CB   . THR B 2 27 ? -7.582  6.920   2.873   1.00 0.00 ? 27 THR B CB   4  
ATOM 3069  O OG1  . THR B 2 27 ? -7.622  5.570   3.316   1.00 0.00 ? 27 THR B OG1  4  
ATOM 3070  C CG2  . THR B 2 27 ? -8.927  7.590   3.145   1.00 0.00 ? 27 THR B CG2  4  
ATOM 3071  H H    . THR B 2 27 ? -6.166  5.123   1.192   1.00 0.00 ? 27 THR B H    4  
ATOM 3072  H HA   . THR B 2 27 ? -8.153  7.329   0.845   1.00 0.00 ? 27 THR B HA   4  
ATOM 3073  H HB   . THR B 2 27 ? -6.805  7.450   3.403   1.00 0.00 ? 27 THR B HB   4  
ATOM 3074  H HG1  . THR B 2 27 ? -7.959  5.563   4.215   1.00 0.00 ? 27 THR B HG1  4  
ATOM 3075  H HG21 . THR B 2 27 ? -9.530  7.565   2.249   1.00 0.00 ? 27 THR B HG21 4  
ATOM 3076  H HG22 . THR B 2 27 ? -9.439  7.065   3.937   1.00 0.00 ? 27 THR B HG22 4  
ATOM 3077  H HG23 . THR B 2 27 ? -8.765  8.616   3.441   1.00 0.00 ? 27 THR B HG23 4  
ATOM 3078  N N    . PRO B 2 28 ? -5.833  8.090   -0.162  1.00 0.00 ? 28 PRO B N    4  
ATOM 3079  C CA   . PRO B 2 28 ? -4.716  8.947   -0.630  1.00 0.00 ? 28 PRO B CA   4  
ATOM 3080  C C    . PRO B 2 28 ? -4.894  10.378  -0.114  1.00 0.00 ? 28 PRO B C    4  
ATOM 3081  O O    . PRO B 2 28 ? -5.514  11.205  -0.754  1.00 0.00 ? 28 PRO B O    4  
ATOM 3082  C CB   . PRO B 2 28 ? -4.786  8.928   -2.162  1.00 0.00 ? 28 PRO B CB   4  
ATOM 3083  C CG   . PRO B 2 28 ? -5.993  8.060   -2.563  1.00 0.00 ? 28 PRO B CG   4  
ATOM 3084  C CD   . PRO B 2 28 ? -6.623  7.517   -1.274  1.00 0.00 ? 28 PRO B CD   4  
ATOM 3085  H HA   . PRO B 2 28 ? -3.771  8.545   -0.302  1.00 0.00 ? 28 PRO B HA   4  
ATOM 3086  H HB2  . PRO B 2 28 ? -4.914  9.935   -2.534  1.00 0.00 ? 28 PRO B HB2  4  
ATOM 3087  H HB3  . PRO B 2 28 ? -3.882  8.499   -2.565  1.00 0.00 ? 28 PRO B HB3  4  
ATOM 3088  H HG2  . PRO B 2 28 ? -6.713  8.662   -3.099  1.00 0.00 ? 28 PRO B HG2  4  
ATOM 3089  H HG3  . PRO B 2 28 ? -5.667  7.239   -3.181  1.00 0.00 ? 28 PRO B HG3  4  
ATOM 3090  H HD2  . PRO B 2 28 ? -7.655  7.832   -1.203  1.00 0.00 ? 28 PRO B HD2  4  
ATOM 3091  H HD3  . PRO B 2 28 ? -6.559  6.439   -1.254  1.00 0.00 ? 28 PRO B HD3  4  
ATOM 3092  N N    . LYS B 2 29 ? -4.353  10.677  1.035   1.00 0.00 ? 29 LYS B N    4  
ATOM 3093  C CA   . LYS B 2 29 ? -4.491  12.056  1.584   1.00 0.00 ? 29 LYS B CA   4  
ATOM 3094  C C    . LYS B 2 29 ? -3.119  12.567  2.029   1.00 0.00 ? 29 LYS B C    4  
ATOM 3095  O O    . LYS B 2 29 ? -2.767  12.498  3.189   1.00 0.00 ? 29 LYS B O    4  
ATOM 3096  C CB   . LYS B 2 29 ? -5.440  12.037  2.782   1.00 0.00 ? 29 LYS B CB   4  
ATOM 3097  C CG   . LYS B 2 29 ? -6.825  12.516  2.342   1.00 0.00 ? 29 LYS B CG   4  
ATOM 3098  C CD   . LYS B 2 29 ? -7.058  13.938  2.856   1.00 0.00 ? 29 LYS B CD   4  
ATOM 3099  C CE   . LYS B 2 29 ? -8.557  14.245  2.846   1.00 0.00 ? 29 LYS B CE   4  
ATOM 3100  N NZ   . LYS B 2 29 ? -8.998  14.517  1.449   1.00 0.00 ? 29 LYS B NZ   4  
ATOM 3101  H H    . LYS B 2 29 ? -3.855  9.999   1.534   1.00 0.00 ? 29 LYS B H    4  
ATOM 3102  H HA   . LYS B 2 29 ? -4.888  12.710  0.820   1.00 0.00 ? 29 LYS B HA   4  
ATOM 3103  H HB2  . LYS B 2 29 ? -5.511  11.029  3.169   1.00 0.00 ? 29 LYS B HB2  4  
ATOM 3104  H HB3  . LYS B 2 29 ? -5.062  12.691  3.552   1.00 0.00 ? 29 LYS B HB3  4  
ATOM 3105  H HG2  . LYS B 2 29 ? -6.882  12.508  1.264   1.00 0.00 ? 29 LYS B HG2  4  
ATOM 3106  H HG3  . LYS B 2 29 ? -7.579  11.860  2.748   1.00 0.00 ? 29 LYS B HG3  4  
ATOM 3107  H HD2  . LYS B 2 29 ? -6.679  14.022  3.865   1.00 0.00 ? 29 LYS B HD2  4  
ATOM 3108  H HD3  . LYS B 2 29 ? -6.544  14.641  2.219   1.00 0.00 ? 29 LYS B HD3  4  
ATOM 3109  H HE2  . LYS B 2 29 ? -9.102  13.398  3.236   1.00 0.00 ? 29 LYS B HE2  4  
ATOM 3110  H HE3  . LYS B 2 29 ? -8.751  15.113  3.461   1.00 0.00 ? 29 LYS B HE3  4  
ATOM 3111  H HZ1  . LYS B 2 29 ? -8.363  14.033  0.784   1.00 0.00 ? 29 LYS B HZ1  4  
ATOM 3112  H HZ2  . LYS B 2 29 ? -9.970  14.168  1.319   1.00 0.00 ? 29 LYS B HZ2  4  
ATOM 3113  H HZ3  . LYS B 2 29 ? -8.970  15.542  1.268   1.00 0.00 ? 29 LYS B HZ3  4  
ATOM 3114  N N    . THR B 2 30 ? -2.343  13.083  1.115   1.00 0.00 ? 30 THR B N    4  
ATOM 3115  C CA   . THR B 2 30 ? -0.996  13.598  1.488   1.00 0.00 ? 30 THR B CA   4  
ATOM 3116  C C    . THR B 2 30 ? -0.825  15.018  0.943   1.00 0.00 ? 30 THR B C    4  
ATOM 3117  O O    . THR B 2 30 ? 0.222   15.293  0.380   1.00 0.00 ? 30 THR B O    4  
ATOM 3118  C CB   . THR B 2 30 ? 0.085   12.690  0.894   1.00 0.00 ? 30 THR B CB   4  
ATOM 3119  O OG1  . THR B 2 30 ? 1.366   13.175  1.268   1.00 0.00 ? 30 THR B OG1  4  
ATOM 3120  C CG2  . THR B 2 30 ? -0.033  12.685  -0.632  1.00 0.00 ? 30 THR B CG2  4  
ATOM 3121  O OXT  . THR B 2 30 ? -1.743  15.805  1.099   1.00 0.00 ? 30 THR B OXT  4  
ATOM 3122  H H    . THR B 2 30 ? -2.646  13.130  0.184   1.00 0.00 ? 30 THR B H    4  
ATOM 3123  H HA   . THR B 2 30 ? -0.901  13.612  2.563   1.00 0.00 ? 30 THR B HA   4  
ATOM 3124  H HB   . THR B 2 30 ? -0.044  11.685  1.264   1.00 0.00 ? 30 THR B HB   4  
ATOM 3125  H HG1  . THR B 2 30 ? 1.672   13.769  0.578   1.00 0.00 ? 30 THR B HG1  4  
ATOM 3126  H HG21 . THR B 2 30 ? -1.075  12.714  -0.912  1.00 0.00 ? 30 THR B HG21 4  
ATOM 3127  H HG22 . THR B 2 30 ? 0.474   13.547  -1.036  1.00 0.00 ? 30 THR B HG22 4  
ATOM 3128  H HG23 . THR B 2 30 ? 0.418   11.785  -1.024  1.00 0.00 ? 30 THR B HG23 4  
ATOM 3129  N N    . GLY A 1 1  ? -1.798  6.127   8.853   1.00 0.00 ? 1  GLY A N    5  
ATOM 3130  C CA   . GLY A 1 1  ? -1.985  5.012   7.881   1.00 0.00 ? 1  GLY A CA   5  
ATOM 3131  C C    . GLY A 1 1  ? -0.620  4.475   7.448   1.00 0.00 ? 1  GLY A C    5  
ATOM 3132  O O    . GLY A 1 1  ? 0.381   4.686   8.103   1.00 0.00 ? 1  GLY A O    5  
ATOM 3133  H H1   . GLY A 1 1  ? -0.782  6.267   9.029   1.00 0.00 ? 1  GLY A H1   5  
ATOM 3134  H H2   . GLY A 1 1  ? -2.208  6.998   8.463   1.00 0.00 ? 1  GLY A H2   5  
ATOM 3135  H H3   . GLY A 1 1  ? -2.276  5.893   9.747   1.00 0.00 ? 1  GLY A H3   5  
ATOM 3136  H HA2  . GLY A 1 1  ? -2.552  4.221   8.349   1.00 0.00 ? 1  GLY A HA2  5  
ATOM 3137  H HA3  . GLY A 1 1  ? -2.516  5.375   7.016   1.00 0.00 ? 1  GLY A HA3  5  
ATOM 3138  N N    . ILE A 1 2  ? -0.572  3.782   6.341   1.00 0.00 ? 2  ILE A N    5  
ATOM 3139  C CA   . ILE A 1 2  ? 0.728   3.232   5.861   1.00 0.00 ? 2  ILE A CA   5  
ATOM 3140  C C    . ILE A 1 2  ? 1.393   4.250   4.934   1.00 0.00 ? 2  ILE A C    5  
ATOM 3141  O O    . ILE A 1 2  ? 2.381   3.964   4.293   1.00 0.00 ? 2  ILE A O    5  
ATOM 3142  C CB   . ILE A 1 2  ? 0.521   1.883   5.127   1.00 0.00 ? 2  ILE A CB   5  
ATOM 3143  C CG1  . ILE A 1 2  ? 0.290   2.087   3.613   1.00 0.00 ? 2  ILE A CG1  5  
ATOM 3144  C CG2  . ILE A 1 2  ? -0.673  1.133   5.721   1.00 0.00 ? 2  ILE A CG2  5  
ATOM 3145  C CD1  . ILE A 1 2  ? -1.134  2.581   3.347   1.00 0.00 ? 2  ILE A CD1  5  
ATOM 3146  H H    . ILE A 1 2  ? -1.391  3.633   5.832   1.00 0.00 ? 2  ILE A H    5  
ATOM 3147  H HA   . ILE A 1 2  ? 1.372   3.071   6.715   1.00 0.00 ? 2  ILE A HA   5  
ATOM 3148  H HB   . ILE A 1 2  ? 1.408   1.280   5.267   1.00 0.00 ? 2  ILE A HB   5  
ATOM 3149  H HG12 . ILE A 1 2  ? 0.995   2.802   3.228   1.00 0.00 ? 2  ILE A HG12 5  
ATOM 3150  H HG13 . ILE A 1 2  ? 0.433   1.144   3.108   1.00 0.00 ? 2  ILE A HG13 5  
ATOM 3151  H HG21 . ILE A 1 2  ? -1.433  1.832   6.027   1.00 0.00 ? 2  ILE A HG21 5  
ATOM 3152  H HG22 . ILE A 1 2  ? -1.082  0.465   4.975   1.00 0.00 ? 2  ILE A HG22 5  
ATOM 3153  H HG23 . ILE A 1 2  ? -0.348  0.560   6.576   1.00 0.00 ? 2  ILE A HG23 5  
ATOM 3154  H HD11 . ILE A 1 2  ? -1.601  2.854   4.276   1.00 0.00 ? 2  ILE A HD11 5  
ATOM 3155  H HD12 . ILE A 1 2  ? -1.098  3.443   2.697   1.00 0.00 ? 2  ILE A HD12 5  
ATOM 3156  H HD13 . ILE A 1 2  ? -1.706  1.796   2.872   1.00 0.00 ? 2  ILE A HD13 5  
ATOM 3157  N N    . VAL A 1 3  ? 0.856   5.432   4.845   1.00 0.00 ? 3  VAL A N    5  
ATOM 3158  C CA   . VAL A 1 3  ? 1.458   6.455   3.948   1.00 0.00 ? 3  VAL A CA   5  
ATOM 3159  C C    . VAL A 1 3  ? 2.592   7.175   4.679   1.00 0.00 ? 3  VAL A C    5  
ATOM 3160  O O    . VAL A 1 3  ? 3.594   7.531   4.092   1.00 0.00 ? 3  VAL A O    5  
ATOM 3161  C CB   . VAL A 1 3  ? 0.380   7.455   3.536   1.00 0.00 ? 3  VAL A CB   5  
ATOM 3162  C CG1  . VAL A 1 3  ? 0.939   8.406   2.478   1.00 0.00 ? 3  VAL A CG1  5  
ATOM 3163  C CG2  . VAL A 1 3  ? -0.812  6.688   2.957   1.00 0.00 ? 3  VAL A CG2  5  
ATOM 3164  H H    . VAL A 1 3  ? 0.052   5.646   5.363   1.00 0.00 ? 3  VAL A H    5  
ATOM 3165  H HA   . VAL A 1 3  ? 1.851   5.969   3.066   1.00 0.00 ? 3  VAL A HA   5  
ATOM 3166  H HB   . VAL A 1 3  ? 0.064   8.018   4.401   1.00 0.00 ? 3  VAL A HB   5  
ATOM 3167  H HG11 . VAL A 1 3  ? 1.996   8.221   2.348   1.00 0.00 ? 3  VAL A HG11 5  
ATOM 3168  H HG12 . VAL A 1 3  ? 0.428   8.245   1.542   1.00 0.00 ? 3  VAL A HG12 5  
ATOM 3169  H HG13 . VAL A 1 3  ? 0.791   9.428   2.798   1.00 0.00 ? 3  VAL A HG13 5  
ATOM 3170  H HG21 . VAL A 1 3  ? -0.451  5.903   2.305   1.00 0.00 ? 3  VAL A HG21 5  
ATOM 3171  H HG22 . VAL A 1 3  ? -1.384  6.252   3.762   1.00 0.00 ? 3  VAL A HG22 5  
ATOM 3172  H HG23 . VAL A 1 3  ? -1.437  7.365   2.394   1.00 0.00 ? 3  VAL A HG23 5  
ATOM 3173  N N    . GLU A 1 4  ? 2.447   7.387   5.957   1.00 0.00 ? 4  GLU A N    5  
ATOM 3174  C CA   . GLU A 1 4  ? 3.523   8.076   6.721   1.00 0.00 ? 4  GLU A CA   5  
ATOM 3175  C C    . GLU A 1 4  ? 4.591   7.058   7.133   1.00 0.00 ? 4  GLU A C    5  
ATOM 3176  O O    . GLU A 1 4  ? 5.588   7.400   7.735   1.00 0.00 ? 4  GLU A O    5  
ATOM 3177  C CB   . GLU A 1 4  ? 2.928   8.726   7.974   1.00 0.00 ? 4  GLU A CB   5  
ATOM 3178  C CG   . GLU A 1 4  ? 3.758   9.955   8.352   1.00 0.00 ? 4  GLU A CG   5  
ATOM 3179  C CD   . GLU A 1 4  ? 3.398   10.396  9.771   1.00 0.00 ? 4  GLU A CD   5  
ATOM 3180  O OE1  . GLU A 1 4  ? 2.955   9.557   10.538  1.00 0.00 ? 4  GLU A OE1  5  
ATOM 3181  O OE2  . GLU A 1 4  ? 3.571   11.567  10.068  1.00 0.00 ? 4  GLU A OE2  5  
ATOM 3182  H H    . GLU A 1 4  ? 1.632   7.088   6.414   1.00 0.00 ? 4  GLU A H    5  
ATOM 3183  H HA   . GLU A 1 4  ? 3.972   8.837   6.102   1.00 0.00 ? 4  GLU A HA   5  
ATOM 3184  H HB2  . GLU A 1 4  ? 1.909   9.023   7.776   1.00 0.00 ? 4  GLU A HB2  5  
ATOM 3185  H HB3  . GLU A 1 4  ? 2.946   8.017   8.789   1.00 0.00 ? 4  GLU A HB3  5  
ATOM 3186  H HG2  . GLU A 1 4  ? 4.808   9.709   8.305   1.00 0.00 ? 4  GLU A HG2  5  
ATOM 3187  H HG3  . GLU A 1 4  ? 3.545   10.759  7.663   1.00 0.00 ? 4  GLU A HG3  5  
ATOM 3188  N N    . GLN A 1 5  ? 4.389   5.805   6.815   1.00 0.00 ? 5  GLN A N    5  
ATOM 3189  C CA   . GLN A 1 5  ? 5.393   4.770   7.189   1.00 0.00 ? 5  GLN A CA   5  
ATOM 3190  C C    . GLN A 1 5  ? 5.908   4.072   5.929   1.00 0.00 ? 5  GLN A C    5  
ATOM 3191  O O    . GLN A 1 5  ? 6.988   3.515   5.910   1.00 0.00 ? 5  GLN A O    5  
ATOM 3192  C CB   . GLN A 1 5  ? 4.740   3.735   8.108   1.00 0.00 ? 5  GLN A CB   5  
ATOM 3193  C CG   . GLN A 1 5  ? 4.396   4.383   9.448   1.00 0.00 ? 5  GLN A CG   5  
ATOM 3194  C CD   . GLN A 1 5  ? 3.808   3.328   10.387  1.00 0.00 ? 5  GLN A CD   5  
ATOM 3195  O OE1  . GLN A 1 5  ? 2.848   3.586   11.085  1.00 0.00 ? 5  GLN A OE1  5  
ATOM 3196  N NE2  . GLN A 1 5  ? 4.347   2.141   10.433  1.00 0.00 ? 5  GLN A NE2  5  
ATOM 3197  H H    . GLN A 1 5  ? 3.578   5.547   6.330   1.00 0.00 ? 5  GLN A H    5  
ATOM 3198  H HA   . GLN A 1 5  ? 6.218   5.237   7.706   1.00 0.00 ? 5  GLN A HA   5  
ATOM 3199  H HB2  . GLN A 1 5  ? 3.838   3.362   7.644   1.00 0.00 ? 5  GLN A HB2  5  
ATOM 3200  H HB3  . GLN A 1 5  ? 5.425   2.915   8.271   1.00 0.00 ? 5  GLN A HB3  5  
ATOM 3201  H HG2  . GLN A 1 5  ? 5.291   4.799   9.887   1.00 0.00 ? 5  GLN A HG2  5  
ATOM 3202  H HG3  . GLN A 1 5  ? 3.671   5.168   9.294   1.00 0.00 ? 5  GLN A HG3  5  
ATOM 3203  H HE21 . GLN A 1 5  ? 5.121   1.931   9.868   1.00 0.00 ? 5  GLN A HE21 5  
ATOM 3204  H HE22 . GLN A 1 5  ? 3.978   1.457   11.030  1.00 0.00 ? 5  GLN A HE22 5  
ATOM 3205  N N    . CYS A 1 6  ? 5.143   4.100   4.872   1.00 0.00 ? 6  CYS A N    5  
ATOM 3206  C CA   . CYS A 1 6  ? 5.586   3.439   3.610   1.00 0.00 ? 6  CYS A CA   5  
ATOM 3207  C C    . CYS A 1 6  ? 6.209   4.480   2.687   1.00 0.00 ? 6  CYS A C    5  
ATOM 3208  O O    . CYS A 1 6  ? 7.404   4.492   2.471   1.00 0.00 ? 6  CYS A O    5  
ATOM 3209  C CB   . CYS A 1 6  ? 4.382   2.797   2.921   1.00 0.00 ? 6  CYS A CB   5  
ATOM 3210  S SG   . CYS A 1 6  ? 3.648   1.565   4.024   1.00 0.00 ? 6  CYS A SG   5  
ATOM 3211  H H    . CYS A 1 6  ? 4.277   4.555   4.908   1.00 0.00 ? 6  CYS A H    5  
ATOM 3212  H HA   . CYS A 1 6  ? 6.315   2.680   3.839   1.00 0.00 ? 6  CYS A HA   5  
ATOM 3213  H HB2  . CYS A 1 6  ? 3.654   3.559   2.690   1.00 0.00 ? 6  CYS A HB2  5  
ATOM 3214  H HB3  . CYS A 1 6  ? 4.706   2.317   2.008   1.00 0.00 ? 6  CYS A HB3  5  
ATOM 3215  N N    . CYS A 1 7  ? 5.414   5.357   2.142   1.00 0.00 ? 7  CYS A N    5  
ATOM 3216  C CA   . CYS A 1 7  ? 5.973   6.399   1.238   1.00 0.00 ? 7  CYS A CA   5  
ATOM 3217  C C    . CYS A 1 7  ? 7.241   6.973   1.875   1.00 0.00 ? 7  CYS A C    5  
ATOM 3218  O O    . CYS A 1 7  ? 8.136   7.440   1.196   1.00 0.00 ? 7  CYS A O    5  
ATOM 3219  C CB   . CYS A 1 7  ? 4.942   7.513   1.044   1.00 0.00 ? 7  CYS A CB   5  
ATOM 3220  S SG   . CYS A 1 7  ? 5.707   8.901   0.171   1.00 0.00 ? 7  CYS A SG   5  
ATOM 3221  H H    . CYS A 1 7  ? 4.453   5.335   2.331   1.00 0.00 ? 7  CYS A H    5  
ATOM 3222  H HA   . CYS A 1 7  ? 6.216   5.958   0.283   1.00 0.00 ? 7  CYS A HA   5  
ATOM 3223  H HB2  . CYS A 1 7  ? 4.112   7.136   0.463   1.00 0.00 ? 7  CYS A HB2  5  
ATOM 3224  H HB3  . CYS A 1 7  ? 4.583   7.844   2.007   1.00 0.00 ? 7  CYS A HB3  5  
ATOM 3225  N N    . THR A 1 8  ? 7.330   6.932   3.176   1.00 0.00 ? 8  THR A N    5  
ATOM 3226  C CA   . THR A 1 8  ? 8.541   7.462   3.861   1.00 0.00 ? 8  THR A CA   5  
ATOM 3227  C C    . THR A 1 8  ? 9.673   6.435   3.753   1.00 0.00 ? 8  THR A C    5  
ATOM 3228  O O    . THR A 1 8  ? 10.801  6.771   3.456   1.00 0.00 ? 8  THR A O    5  
ATOM 3229  C CB   . THR A 1 8  ? 8.222   7.710   5.337   1.00 0.00 ? 8  THR A CB   5  
ATOM 3230  O OG1  . THR A 1 8  ? 7.346   6.694   5.806   1.00 0.00 ? 8  THR A OG1  5  
ATOM 3231  C CG2  . THR A 1 8  ? 7.551   9.074   5.498   1.00 0.00 ? 8  THR A CG2  5  
ATOM 3232  H H    . THR A 1 8  ? 6.600   6.544   3.704   1.00 0.00 ? 8  THR A H    5  
ATOM 3233  H HA   . THR A 1 8  ? 8.846   8.387   3.397   1.00 0.00 ? 8  THR A HA   5  
ATOM 3234  H HB   . THR A 1 8  ? 9.135   7.693   5.913   1.00 0.00 ? 8  THR A HB   5  
ATOM 3235  H HG1  . THR A 1 8  ? 7.798   6.210   6.501   1.00 0.00 ? 8  THR A HG1  5  
ATOM 3236  H HG21 . THR A 1 8  ? 6.723   9.151   4.806   1.00 0.00 ? 8  THR A HG21 5  
ATOM 3237  H HG22 . THR A 1 8  ? 7.186   9.180   6.507   1.00 0.00 ? 8  THR A HG22 5  
ATOM 3238  H HG23 . THR A 1 8  ? 8.268   9.855   5.291   1.00 0.00 ? 8  THR A HG23 5  
ATOM 3239  N N    . SER A 1 9  ? 9.376   5.187   3.993   1.00 0.00 ? 9  SER A N    5  
ATOM 3240  C CA   . SER A 1 9  ? 10.430  4.136   3.908   1.00 0.00 ? 9  SER A CA   5  
ATOM 3241  C C    . SER A 1 9  ? 9.860   2.901   3.195   1.00 0.00 ? 9  SER A C    5  
ATOM 3242  O O    . SER A 1 9  ? 9.175   3.016   2.198   1.00 0.00 ? 9  SER A O    5  
ATOM 3243  C CB   . SER A 1 9  ? 10.877  3.761   5.323   1.00 0.00 ? 9  SER A CB   5  
ATOM 3244  O OG   . SER A 1 9  ? 12.130  3.092   5.258   1.00 0.00 ? 9  SER A OG   5  
ATOM 3245  H H    . SER A 1 9  ? 8.457   4.941   4.235   1.00 0.00 ? 9  SER A H    5  
ATOM 3246  H HA   . SER A 1 9  ? 11.274  4.516   3.353   1.00 0.00 ? 9  SER A HA   5  
ATOM 3247  H HB2  . SER A 1 9  ? 10.982  4.652   5.918   1.00 0.00 ? 9  SER A HB2  5  
ATOM 3248  H HB3  . SER A 1 9  ? 10.135  3.116   5.775   1.00 0.00 ? 9  SER A HB3  5  
ATOM 3249  H HG   . SER A 1 9  ? 12.668  3.534   4.596   1.00 0.00 ? 9  SER A HG   5  
ATOM 3250  N N    . ILE A 1 10 ? 10.134  1.720   3.689   1.00 0.00 ? 10 ILE A N    5  
ATOM 3251  C CA   . ILE A 1 10 ? 9.596   0.498   3.026   1.00 0.00 ? 10 ILE A CA   5  
ATOM 3252  C C    . ILE A 1 10 ? 8.683   -0.248  4.004   1.00 0.00 ? 10 ILE A C    5  
ATOM 3253  O O    . ILE A 1 10 ? 8.945   -0.308  5.189   1.00 0.00 ? 10 ILE A O    5  
ATOM 3254  C CB   . ILE A 1 10 ? 10.758  -0.410  2.607   1.00 0.00 ? 10 ILE A CB   5  
ATOM 3255  C CG1  . ILE A 1 10 ? 11.449  0.188   1.380   1.00 0.00 ? 10 ILE A CG1  5  
ATOM 3256  C CG2  . ILE A 1 10 ? 10.226  -1.801  2.260   1.00 0.00 ? 10 ILE A CG2  5  
ATOM 3257  C CD1  . ILE A 1 10 ? 12.791  -0.513  1.154   1.00 0.00 ? 10 ILE A CD1  5  
ATOM 3258  H H    . ILE A 1 10 ? 10.688  1.636   4.492   1.00 0.00 ? 10 ILE A H    5  
ATOM 3259  H HA   . ILE A 1 10 ? 9.029   0.783   2.152   1.00 0.00 ? 10 ILE A HA   5  
ATOM 3260  H HB   . ILE A 1 10 ? 11.464  -0.487  3.421   1.00 0.00 ? 10 ILE A HB   5  
ATOM 3261  H HG12 . ILE A 1 10 ? 10.821  0.051   0.511   1.00 0.00 ? 10 ILE A HG12 5  
ATOM 3262  H HG13 . ILE A 1 10 ? 11.620  1.243   1.538   1.00 0.00 ? 10 ILE A HG13 5  
ATOM 3263  H HG21 . ILE A 1 10 ? 9.209   -1.721  1.904   1.00 0.00 ? 10 ILE A HG21 5  
ATOM 3264  H HG22 . ILE A 1 10 ? 10.842  -2.240  1.491   1.00 0.00 ? 10 ILE A HG22 5  
ATOM 3265  H HG23 . ILE A 1 10 ? 10.250  -2.428  3.141   1.00 0.00 ? 10 ILE A HG23 5  
ATOM 3266  H HD11 . ILE A 1 10 ? 12.977  -1.201  1.966   1.00 0.00 ? 10 ILE A HD11 5  
ATOM 3267  H HD12 . ILE A 1 10 ? 12.761  -1.056  0.222   1.00 0.00 ? 10 ILE A HD12 5  
ATOM 3268  H HD13 . ILE A 1 10 ? 13.580  0.223   1.118   1.00 0.00 ? 10 ILE A HD13 5  
ATOM 3269  N N    . CYS A 1 11 ? 7.609   -0.810  3.518   1.00 0.00 ? 11 CYS A N    5  
ATOM 3270  C CA   . CYS A 1 11 ? 6.679   -1.544  4.424   1.00 0.00 ? 11 CYS A CA   5  
ATOM 3271  C C    . CYS A 1 11 ? 6.635   -3.022  4.039   1.00 0.00 ? 11 CYS A C    5  
ATOM 3272  O O    . CYS A 1 11 ? 7.392   -3.485  3.209   1.00 0.00 ? 11 CYS A O    5  
ATOM 3273  C CB   . CYS A 1 11 ? 5.271   -0.963  4.289   1.00 0.00 ? 11 CYS A CB   5  
ATOM 3274  S SG   . CYS A 1 11 ? 5.231   0.720   4.950   1.00 0.00 ? 11 CYS A SG   5  
ATOM 3275  H H    . CYS A 1 11 ? 7.413   -0.747  2.561   1.00 0.00 ? 11 CYS A H    5  
ATOM 3276  H HA   . CYS A 1 11 ? 7.012   -1.445  5.447   1.00 0.00 ? 11 CYS A HA   5  
ATOM 3277  H HB2  . CYS A 1 11 ? 4.988   -0.943  3.247   1.00 0.00 ? 11 CYS A HB2  5  
ATOM 3278  H HB3  . CYS A 1 11 ? 4.574   -1.580  4.837   1.00 0.00 ? 11 CYS A HB3  5  
ATOM 3279  N N    . SER A 1 12 ? 5.739   -3.759  4.635   1.00 0.00 ? 12 SER A N    5  
ATOM 3280  C CA   . SER A 1 12 ? 5.618   -5.207  4.311   1.00 0.00 ? 12 SER A CA   5  
ATOM 3281  C C    . SER A 1 12 ? 4.180   -5.492  3.874   1.00 0.00 ? 12 SER A C    5  
ATOM 3282  O O    . SER A 1 12 ? 3.305   -4.661  4.011   1.00 0.00 ? 12 SER A O    5  
ATOM 3283  C CB   . SER A 1 12 ? 5.947   -6.032  5.556   1.00 0.00 ? 12 SER A CB   5  
ATOM 3284  O OG   . SER A 1 12 ? 5.343   -5.428  6.692   1.00 0.00 ? 12 SER A OG   5  
ATOM 3285  H H    . SER A 1 12 ? 5.138   -3.358  5.295   1.00 0.00 ? 12 SER A H    5  
ATOM 3286  H HA   . SER A 1 12 ? 6.299   -5.460  3.515   1.00 0.00 ? 12 SER A HA   5  
ATOM 3287  H HB2  . SER A 1 12 ? 5.563   -7.032  5.440   1.00 0.00 ? 12 SER A HB2  5  
ATOM 3288  H HB3  . SER A 1 12 ? 7.019   -6.071  5.684   1.00 0.00 ? 12 SER A HB3  5  
ATOM 3289  H HG   . SER A 1 12 ? 5.448   -6.025  7.437   1.00 0.00 ? 12 SER A HG   5  
ATOM 3290  N N    . LEU A 1 13 ? 3.924   -6.658  3.351   1.00 0.00 ? 13 LEU A N    5  
ATOM 3291  C CA   . LEU A 1 13 ? 2.539   -6.984  2.913   1.00 0.00 ? 13 LEU A CA   5  
ATOM 3292  C C    . LEU A 1 13 ? 1.621   -7.038  4.140   1.00 0.00 ? 13 LEU A C    5  
ATOM 3293  O O    . LEU A 1 13 ? 0.415   -7.121  4.020   1.00 0.00 ? 13 LEU A O    5  
ATOM 3294  C CB   . LEU A 1 13 ? 2.530   -8.340  2.207   1.00 0.00 ? 13 LEU A CB   5  
ATOM 3295  C CG   . LEU A 1 13 ? 2.363   -8.130  0.700   1.00 0.00 ? 13 LEU A CG   5  
ATOM 3296  C CD1  . LEU A 1 13 ? 1.022   -7.446  0.423   1.00 0.00 ? 13 LEU A CD1  5  
ATOM 3297  C CD2  . LEU A 1 13 ? 3.499   -7.247  0.180   1.00 0.00 ? 13 LEU A CD2  5  
ATOM 3298  H H    . LEU A 1 13 ? 4.640   -7.320  3.248   1.00 0.00 ? 13 LEU A H    5  
ATOM 3299  H HA   . LEU A 1 13 ? 2.187   -6.220  2.235   1.00 0.00 ? 13 LEU A HA   5  
ATOM 3300  H HB2  . LEU A 1 13 ? 3.462   -8.852  2.398   1.00 0.00 ? 13 LEU A HB2  5  
ATOM 3301  H HB3  . LEU A 1 13 ? 1.709   -8.935  2.578   1.00 0.00 ? 13 LEU A HB3  5  
ATOM 3302  H HG   . LEU A 1 13 ? 2.390   -9.087  0.198   1.00 0.00 ? 13 LEU A HG   5  
ATOM 3303  H HD11 . LEU A 1 13 ? 0.539   -7.209  1.358   1.00 0.00 ? 13 LEU A HD11 5  
ATOM 3304  H HD12 . LEU A 1 13 ? 1.191   -6.538  -0.137  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 3305  H HD13 . LEU A 1 13 ? 0.393   -8.111  -0.151  1.00 0.00 ? 13 LEU A HD13 5  
ATOM 3306  H HD21 . LEU A 1 13 ? 4.443   -7.621  0.545   1.00 0.00 ? 13 LEU A HD21 5  
ATOM 3307  H HD22 . LEU A 1 13 ? 3.500   -7.261  -0.902  1.00 0.00 ? 13 LEU A HD22 5  
ATOM 3308  H HD23 . LEU A 1 13 ? 3.354   -6.233  0.525   1.00 0.00 ? 13 LEU A HD23 5  
ATOM 3309  N N    . TYR A 1 14 ? 2.185   -6.993  5.316   1.00 0.00 ? 14 TYR A N    5  
ATOM 3310  C CA   . TYR A 1 14 ? 1.352   -7.043  6.553   1.00 0.00 ? 14 TYR A CA   5  
ATOM 3311  C C    . TYR A 1 14 ? 0.703   -5.674  6.792   1.00 0.00 ? 14 TYR A C    5  
ATOM 3312  O O    . TYR A 1 14 ? -0.413  -5.583  7.261   1.00 0.00 ? 14 TYR A O    5  
ATOM 3313  C CB   . TYR A 1 14 ? 2.248   -7.416  7.740   1.00 0.00 ? 14 TYR A CB   5  
ATOM 3314  C CG   . TYR A 1 14 ? 1.563   -7.061  9.040   1.00 0.00 ? 14 TYR A CG   5  
ATOM 3315  C CD1  . TYR A 1 14 ? 0.225   -7.414  9.247   1.00 0.00 ? 14 TYR A CD1  5  
ATOM 3316  C CD2  . TYR A 1 14 ? 2.269   -6.377  10.035  1.00 0.00 ? 14 TYR A CD2  5  
ATOM 3317  C CE1  . TYR A 1 14 ? -0.408  -7.084  10.452  1.00 0.00 ? 14 TYR A CE1  5  
ATOM 3318  C CE2  . TYR A 1 14 ? 1.637   -6.046  11.241  1.00 0.00 ? 14 TYR A CE2  5  
ATOM 3319  C CZ   . TYR A 1 14 ? 0.298   -6.400  11.448  1.00 0.00 ? 14 TYR A CZ   5  
ATOM 3320  O OH   . TYR A 1 14 ? -0.325  -6.073  12.636  1.00 0.00 ? 14 TYR A OH   5  
ATOM 3321  H H    . TYR A 1 14 ? 3.159   -6.927  5.390   1.00 0.00 ? 14 TYR A H    5  
ATOM 3322  H HA   . TYR A 1 14 ? 0.583   -7.791  6.435   1.00 0.00 ? 14 TYR A HA   5  
ATOM 3323  H HB2  . TYR A 1 14 ? 2.448   -8.476  7.719   1.00 0.00 ? 14 TYR A HB2  5  
ATOM 3324  H HB3  . TYR A 1 14 ? 3.181   -6.875  7.669   1.00 0.00 ? 14 TYR A HB3  5  
ATOM 3325  H HD1  . TYR A 1 14 ? -0.320  -7.942  8.478   1.00 0.00 ? 14 TYR A HD1  5  
ATOM 3326  H HD2  . TYR A 1 14 ? 3.302   -6.104  9.874   1.00 0.00 ? 14 TYR A HD2  5  
ATOM 3327  H HE1  . TYR A 1 14 ? -1.440  -7.357  10.613  1.00 0.00 ? 14 TYR A HE1  5  
ATOM 3328  H HE2  . TYR A 1 14 ? 2.182   -5.517  12.009  1.00 0.00 ? 14 TYR A HE2  5  
ATOM 3329  H HH   . TYR A 1 14 ? -0.964  -6.762  12.836  1.00 0.00 ? 14 TYR A HH   5  
ATOM 3330  N N    . GLN A 1 15 ? 1.392   -4.613  6.476   1.00 0.00 ? 15 GLN A N    5  
ATOM 3331  C CA   . GLN A 1 15 ? 0.809   -3.258  6.690   1.00 0.00 ? 15 GLN A CA   5  
ATOM 3332  C C    . GLN A 1 15 ? -0.389  -3.058  5.759   1.00 0.00 ? 15 GLN A C    5  
ATOM 3333  O O    . GLN A 1 15 ? -1.418  -2.550  6.158   1.00 0.00 ? 15 GLN A O    5  
ATOM 3334  C CB   . GLN A 1 15 ? 1.866   -2.193  6.393   1.00 0.00 ? 15 GLN A CB   5  
ATOM 3335  C CG   . GLN A 1 15 ? 2.803   -2.052  7.593   1.00 0.00 ? 15 GLN A CG   5  
ATOM 3336  C CD   . GLN A 1 15 ? 3.163   -0.577  7.788   1.00 0.00 ? 15 GLN A CD   5  
ATOM 3337  O OE1  . GLN A 1 15 ? 4.313   -0.201  7.678   1.00 0.00 ? 15 GLN A OE1  5  
ATOM 3338  N NE2  . GLN A 1 15 ? 2.221   0.280   8.075   1.00 0.00 ? 15 GLN A NE2  5  
ATOM 3339  H H    . GLN A 1 15 ? 2.292   -4.706  6.100   1.00 0.00 ? 15 GLN A H    5  
ATOM 3340  H HA   . GLN A 1 15 ? 0.485   -3.163  7.714   1.00 0.00 ? 15 GLN A HA   5  
ATOM 3341  H HB2  . GLN A 1 15 ? 2.433   -2.481  5.522   1.00 0.00 ? 15 GLN A HB2  5  
ATOM 3342  H HB3  . GLN A 1 15 ? 1.376   -1.249  6.210   1.00 0.00 ? 15 GLN A HB3  5  
ATOM 3343  H HG2  . GLN A 1 15 ? 2.312   -2.424  8.480   1.00 0.00 ? 15 GLN A HG2  5  
ATOM 3344  H HG3  . GLN A 1 15 ? 3.705   -2.618  7.414   1.00 0.00 ? 15 GLN A HG3  5  
ATOM 3345  H HE21 . GLN A 1 15 ? 1.294   -0.022  8.164   1.00 0.00 ? 15 GLN A HE21 5  
ATOM 3346  H HE22 . GLN A 1 15 ? 2.442   1.227   8.201   1.00 0.00 ? 15 GLN A HE22 5  
ATOM 3347  N N    . LEU A 1 16 ? -0.260  -3.444  4.520   1.00 0.00 ? 16 LEU A N    5  
ATOM 3348  C CA   . LEU A 1 16 ? -1.389  -3.267  3.565   1.00 0.00 ? 16 LEU A CA   5  
ATOM 3349  C C    . LEU A 1 16 ? -2.449  -4.343  3.804   1.00 0.00 ? 16 LEU A C    5  
ATOM 3350  O O    . LEU A 1 16 ? -3.509  -4.323  3.211   1.00 0.00 ? 16 LEU A O    5  
ATOM 3351  C CB   . LEU A 1 16 ? -0.867  -3.371  2.129   1.00 0.00 ? 16 LEU A CB   5  
ATOM 3352  C CG   . LEU A 1 16 ? 0.392   -2.510  1.962   1.00 0.00 ? 16 LEU A CG   5  
ATOM 3353  C CD1  . LEU A 1 16 ? 0.581   -2.177  0.483   1.00 0.00 ? 16 LEU A CD1  5  
ATOM 3354  C CD2  . LEU A 1 16 ? 0.250   -1.205  2.752   1.00 0.00 ? 16 LEU A CD2  5  
ATOM 3355  H H    . LEU A 1 16 ? 0.579   -3.845  4.215   1.00 0.00 ? 16 LEU A H    5  
ATOM 3356  H HA   . LEU A 1 16 ? -1.832  -2.293  3.712   1.00 0.00 ? 16 LEU A HA   5  
ATOM 3357  H HB2  . LEU A 1 16 ? -0.628  -4.402  1.911   1.00 0.00 ? 16 LEU A HB2  5  
ATOM 3358  H HB3  . LEU A 1 16 ? -1.628  -3.028  1.445   1.00 0.00 ? 16 LEU A HB3  5  
ATOM 3359  H HG   . LEU A 1 16 ? 1.252   -3.059  2.320   1.00 0.00 ? 16 LEU A HG   5  
ATOM 3360  H HD11 . LEU A 1 16 ? -0.015  -2.849  -0.117  1.00 0.00 ? 16 LEU A HD11 5  
ATOM 3361  H HD12 . LEU A 1 16 ? 0.265   -1.160  0.303   1.00 0.00 ? 16 LEU A HD12 5  
ATOM 3362  H HD13 . LEU A 1 16 ? 1.622   -2.286  0.219   1.00 0.00 ? 16 LEU A HD13 5  
ATOM 3363  H HD21 . LEU A 1 16 ? -0.733  -0.788  2.589   1.00 0.00 ? 16 LEU A HD21 5  
ATOM 3364  H HD22 . LEU A 1 16 ? 0.385   -1.403  3.805   1.00 0.00 ? 16 LEU A HD22 5  
ATOM 3365  H HD23 . LEU A 1 16 ? 0.997   -0.500  2.419   1.00 0.00 ? 16 LEU A HD23 5  
ATOM 3366  N N    . GLU A 1 17 ? -2.182  -5.280  4.672   1.00 0.00 ? 17 GLU A N    5  
ATOM 3367  C CA   . GLU A 1 17 ? -3.188  -6.341  4.945   1.00 0.00 ? 17 GLU A CA   5  
ATOM 3368  C C    . GLU A 1 17 ? -4.426  -5.697  5.568   1.00 0.00 ? 17 GLU A C    5  
ATOM 3369  O O    . GLU A 1 17 ? -5.491  -6.278  5.610   1.00 0.00 ? 17 GLU A O    5  
ATOM 3370  C CB   . GLU A 1 17 ? -2.602  -7.369  5.912   1.00 0.00 ? 17 GLU A CB   5  
ATOM 3371  C CG   . GLU A 1 17 ? -1.841  -8.435  5.123   1.00 0.00 ? 17 GLU A CG   5  
ATOM 3372  C CD   . GLU A 1 17 ? -2.258  -9.824  5.607   1.00 0.00 ? 17 GLU A CD   5  
ATOM 3373  O OE1  . GLU A 1 17 ? -2.874  -9.904  6.656   1.00 0.00 ? 17 GLU A OE1  5  
ATOM 3374  O OE2  . GLU A 1 17 ? -1.955  -10.785 4.919   1.00 0.00 ? 17 GLU A OE2  5  
ATOM 3375  H H    . GLU A 1 17 ? -1.324  -5.282  5.146   1.00 0.00 ? 17 GLU A H    5  
ATOM 3376  H HA   . GLU A 1 17 ? -3.460  -6.828  4.019   1.00 0.00 ? 17 GLU A HA   5  
ATOM 3377  H HB2  . GLU A 1 17 ? -1.927  -6.875  6.596   1.00 0.00 ? 17 GLU A HB2  5  
ATOM 3378  H HB3  . GLU A 1 17 ? -3.400  -7.837  6.469   1.00 0.00 ? 17 GLU A HB3  5  
ATOM 3379  H HG2  . GLU A 1 17 ? -2.071  -8.334  4.071   1.00 0.00 ? 17 GLU A HG2  5  
ATOM 3380  H HG3  . GLU A 1 17 ? -0.780  -8.307  5.275   1.00 0.00 ? 17 GLU A HG3  5  
ATOM 3381  N N    . ASN A 1 18 ? -4.290  -4.490  6.050   1.00 0.00 ? 18 ASN A N    5  
ATOM 3382  C CA   . ASN A 1 18 ? -5.450  -3.794  6.669   1.00 0.00 ? 18 ASN A CA   5  
ATOM 3383  C C    . ASN A 1 18 ? -6.268  -3.103  5.576   1.00 0.00 ? 18 ASN A C    5  
ATOM 3384  O O    . ASN A 1 18 ? -7.442  -2.832  5.742   1.00 0.00 ? 18 ASN A O    5  
ATOM 3385  C CB   . ASN A 1 18 ? -4.940  -2.750  7.665   1.00 0.00 ? 18 ASN A CB   5  
ATOM 3386  C CG   . ASN A 1 18 ? -3.936  -3.403  8.619   1.00 0.00 ? 18 ASN A CG   5  
ATOM 3387  O OD1  . ASN A 1 18 ? -2.817  -3.681  8.241   1.00 0.00 ? 18 ASN A OD1  5  
ATOM 3388  N ND2  . ASN A 1 18 ? -4.295  -3.660  9.847   1.00 0.00 ? 18 ASN A ND2  5  
ATOM 3389  H H    . ASN A 1 18 ? -3.420  -4.040  6.002   1.00 0.00 ? 18 ASN A H    5  
ATOM 3390  H HA   . ASN A 1 18 ? -6.070  -4.513  7.186   1.00 0.00 ? 18 ASN A HA   5  
ATOM 3391  H HB2  . ASN A 1 18 ? -4.455  -1.946  7.130   1.00 0.00 ? 18 ASN A HB2  5  
ATOM 3392  H HB3  . ASN A 1 18 ? -5.770  -2.356  8.233   1.00 0.00 ? 18 ASN A HB3  5  
ATOM 3393  H HD21 . ASN A 1 18 ? -5.198  -3.433  10.153  1.00 0.00 ? 18 ASN A HD21 5  
ATOM 3394  H HD22 . ASN A 1 18 ? -3.660  -4.078  10.465  1.00 0.00 ? 18 ASN A HD22 5  
ATOM 3395  N N    . TYR A 1 19 ? -5.658  -2.817  4.457   1.00 0.00 ? 19 TYR A N    5  
ATOM 3396  C CA   . TYR A 1 19 ? -6.398  -2.148  3.351   1.00 0.00 ? 19 TYR A CA   5  
ATOM 3397  C C    . TYR A 1 19 ? -7.229  -3.183  2.588   1.00 0.00 ? 19 TYR A C    5  
ATOM 3398  O O    . TYR A 1 19 ? -7.865  -2.874  1.601   1.00 0.00 ? 19 TYR A O    5  
ATOM 3399  C CB   . TYR A 1 19 ? -5.401  -1.487  2.393   1.00 0.00 ? 19 TYR A CB   5  
ATOM 3400  C CG   . TYR A 1 19 ? -5.066  -0.112  2.902   1.00 0.00 ? 19 TYR A CG   5  
ATOM 3401  C CD1  . TYR A 1 19 ? -5.913  0.962   2.609   1.00 0.00 ? 19 TYR A CD1  5  
ATOM 3402  C CD2  . TYR A 1 19 ? -3.915  0.088   3.667   1.00 0.00 ? 19 TYR A CD2  5  
ATOM 3403  C CE1  . TYR A 1 19 ? -5.608  2.241   3.085   1.00 0.00 ? 19 TYR A CE1  5  
ATOM 3404  C CE2  . TYR A 1 19 ? -3.610  1.365   4.139   1.00 0.00 ? 19 TYR A CE2  5  
ATOM 3405  C CZ   . TYR A 1 19 ? -4.456  2.443   3.851   1.00 0.00 ? 19 TYR A CZ   5  
ATOM 3406  O OH   . TYR A 1 19 ? -4.151  3.706   4.321   1.00 0.00 ? 19 TYR A OH   5  
ATOM 3407  H H    . TYR A 1 19 ? -4.712  -3.046  4.344   1.00 0.00 ? 19 TYR A H    5  
ATOM 3408  H HA   . TYR A 1 19 ? -7.054  -1.394  3.762   1.00 0.00 ? 19 TYR A HA   5  
ATOM 3409  H HB2  . TYR A 1 19 ? -4.502  -2.084  2.340   1.00 0.00 ? 19 TYR A HB2  5  
ATOM 3410  H HB3  . TYR A 1 19 ? -5.839  -1.406  1.413   1.00 0.00 ? 19 TYR A HB3  5  
ATOM 3411  H HD1  . TYR A 1 19 ? -6.801  0.801   2.017   1.00 0.00 ? 19 TYR A HD1  5  
ATOM 3412  H HD2  . TYR A 1 19 ? -3.258  -0.743  3.885   1.00 0.00 ? 19 TYR A HD2  5  
ATOM 3413  H HE1  . TYR A 1 19 ? -6.260  3.073   2.858   1.00 0.00 ? 19 TYR A HE1  5  
ATOM 3414  H HE2  . TYR A 1 19 ? -2.724  1.520   4.730   1.00 0.00 ? 19 TYR A HE2  5  
ATOM 3415  H HH   . TYR A 1 19 ? -4.831  4.309   4.015   1.00 0.00 ? 19 TYR A HH   5  
ATOM 3416  N N    . CYS A 1 20 ? -7.230  -4.408  3.039   1.00 0.00 ? 20 CYS A N    5  
ATOM 3417  C CA   . CYS A 1 20 ? -8.023  -5.457  2.337   1.00 0.00 ? 20 CYS A CA   5  
ATOM 3418  C C    . CYS A 1 20 ? -9.379  -5.619  3.025   1.00 0.00 ? 20 CYS A C    5  
ATOM 3419  O O    . CYS A 1 20 ? -9.478  -5.622  4.236   1.00 0.00 ? 20 CYS A O    5  
ATOM 3420  C CB   . CYS A 1 20 ? -7.268  -6.783  2.384   1.00 0.00 ? 20 CYS A CB   5  
ATOM 3421  S SG   . CYS A 1 20 ? -6.610  -7.157  0.741   1.00 0.00 ? 20 CYS A SG   5  
ATOM 3422  H H    . CYS A 1 20 ? -6.712  -4.636  3.838   1.00 0.00 ? 20 CYS A H    5  
ATOM 3423  H HA   . CYS A 1 20 ? -8.172  -5.169  1.310   1.00 0.00 ? 20 CYS A HA   5  
ATOM 3424  H HB2  . CYS A 1 20 ? -6.455  -6.715  3.093   1.00 0.00 ? 20 CYS A HB2  5  
ATOM 3425  H HB3  . CYS A 1 20 ? -7.945  -7.566  2.686   1.00 0.00 ? 20 CYS A HB3  5  
ATOM 3426  N N    . ASN A 1 21 ? -10.427 -5.753  2.259   1.00 0.00 ? 21 ASN A N    5  
ATOM 3427  C CA   . ASN A 1 21 ? -11.777 -5.915  2.866   1.00 0.00 ? 21 ASN A CA   5  
ATOM 3428  C C    . ASN A 1 21 ? -12.412 -7.212  2.362   1.00 0.00 ? 21 ASN A C    5  
ATOM 3429  O O    . ASN A 1 21 ? -13.516 -7.513  2.785   1.00 0.00 ? 21 ASN A O    5  
ATOM 3430  C CB   . ASN A 1 21 ? -12.659 -4.729  2.470   1.00 0.00 ? 21 ASN A CB   5  
ATOM 3431  C CG   . ASN A 1 21 ? -12.848 -4.717  0.952   1.00 0.00 ? 21 ASN A CG   5  
ATOM 3432  O OD1  . ASN A 1 21 ? -13.347 -5.666  0.382   1.00 0.00 ? 21 ASN A OD1  5  
ATOM 3433  N ND2  . ASN A 1 21 ? -12.467 -3.672  0.271   1.00 0.00 ? 21 ASN A ND2  5  
ATOM 3434  O OXT  . ASN A 1 21 ? -11.785 -7.883  1.559   1.00 0.00 ? 21 ASN A OXT  5  
ATOM 3435  H H    . ASN A 1 21 ? -10.324 -5.747  1.285   1.00 0.00 ? 21 ASN A H    5  
ATOM 3436  H HA   . ASN A 1 21 ? -11.686 -5.951  3.941   1.00 0.00 ? 21 ASN A HA   5  
ATOM 3437  H HB2  . ASN A 1 21 ? -13.621 -4.819  2.953   1.00 0.00 ? 21 ASN A HB2  5  
ATOM 3438  H HB3  . ASN A 1 21 ? -12.183 -3.811  2.779   1.00 0.00 ? 21 ASN A HB3  5  
ATOM 3439  H HD21 . ASN A 1 21 ? -12.065 -2.907  0.732   1.00 0.00 ? 21 ASN A HD21 5  
ATOM 3440  H HD22 . ASN A 1 21 ? -12.585 -3.651  -0.702  1.00 0.00 ? 21 ASN A HD22 5  
ATOM 3441  N N    . PHE B 2 1  ? 6.385   -9.726  -3.728  1.00 0.00 ? 1  PHE B N    5  
ATOM 3442  C CA   . PHE B 2 1  ? 7.010   -9.169  -2.495  1.00 0.00 ? 1  PHE B CA   5  
ATOM 3443  C C    . PHE B 2 1  ? 8.397   -8.612  -2.835  1.00 0.00 ? 1  PHE B C    5  
ATOM 3444  O O    . PHE B 2 1  ? 9.255   -9.318  -3.324  1.00 0.00 ? 1  PHE B O    5  
ATOM 3445  C CB   . PHE B 2 1  ? 7.134   -10.282 -1.439  1.00 0.00 ? 1  PHE B CB   5  
ATOM 3446  C CG   . PHE B 2 1  ? 8.214   -9.927  -0.440  1.00 0.00 ? 1  PHE B CG   5  
ATOM 3447  C CD1  . PHE B 2 1  ? 9.560   -10.117 -0.778  1.00 0.00 ? 1  PHE B CD1  5  
ATOM 3448  C CD2  . PHE B 2 1  ? 7.874   -9.397  0.809   1.00 0.00 ? 1  PHE B CD2  5  
ATOM 3449  C CE1  . PHE B 2 1  ? 10.564  -9.778  0.132   1.00 0.00 ? 1  PHE B CE1  5  
ATOM 3450  C CE2  . PHE B 2 1  ? 8.880   -9.060  1.722   1.00 0.00 ? 1  PHE B CE2  5  
ATOM 3451  C CZ   . PHE B 2 1  ? 10.226  -9.249  1.384   1.00 0.00 ? 1  PHE B CZ   5  
ATOM 3452  H H1   . PHE B 2 1  ? 6.465   -9.033  -4.500  1.00 0.00 ? 1  PHE B H1   5  
ATOM 3453  H H2   . PHE B 2 1  ? 6.870   -10.606 -3.996  1.00 0.00 ? 1  PHE B H2   5  
ATOM 3454  H H3   . PHE B 2 1  ? 5.381   -9.929  -3.548  1.00 0.00 ? 1  PHE B H3   5  
ATOM 3455  H HA   . PHE B 2 1  ? 6.390   -8.375  -2.107  1.00 0.00 ? 1  PHE B HA   5  
ATOM 3456  H HB2  . PHE B 2 1  ? 6.191   -10.393 -0.924  1.00 0.00 ? 1  PHE B HB2  5  
ATOM 3457  H HB3  . PHE B 2 1  ? 7.387   -11.211 -1.927  1.00 0.00 ? 1  PHE B HB3  5  
ATOM 3458  H HD1  . PHE B 2 1  ? 9.822   -10.530 -1.740  1.00 0.00 ? 1  PHE B HD1  5  
ATOM 3459  H HD2  . PHE B 2 1  ? 6.835   -9.249  1.069   1.00 0.00 ? 1  PHE B HD2  5  
ATOM 3460  H HE1  . PHE B 2 1  ? 11.600  -9.923  -0.132  1.00 0.00 ? 1  PHE B HE1  5  
ATOM 3461  H HE2  . PHE B 2 1  ? 8.617   -8.650  2.688   1.00 0.00 ? 1  PHE B HE2  5  
ATOM 3462  H HZ   . PHE B 2 1  ? 11.001  -8.986  2.087   1.00 0.00 ? 1  PHE B HZ   5  
ATOM 3463  N N    . VAL B 2 2  ? 8.625   -7.355  -2.566  1.00 0.00 ? 2  VAL B N    5  
ATOM 3464  C CA   . VAL B 2 2  ? 9.958   -6.754  -2.858  1.00 0.00 ? 2  VAL B CA   5  
ATOM 3465  C C    . VAL B 2 2  ? 10.136  -5.480  -2.030  1.00 0.00 ? 2  VAL B C    5  
ATOM 3466  O O    . VAL B 2 2  ? 9.264   -4.636  -1.974  1.00 0.00 ? 2  VAL B O    5  
ATOM 3467  C CB   . VAL B 2 2  ? 10.049  -6.416  -4.345  1.00 0.00 ? 2  VAL B CB   5  
ATOM 3468  C CG1  . VAL B 2 2  ? 11.364  -5.683  -4.625  1.00 0.00 ? 2  VAL B CG1  5  
ATOM 3469  C CG2  . VAL B 2 2  ? 10.007  -7.712  -5.149  1.00 0.00 ? 2  VAL B CG2  5  
ATOM 3470  H H    . VAL B 2 2  ? 7.921   -6.808  -2.164  1.00 0.00 ? 2  VAL B H    5  
ATOM 3471  H HA   . VAL B 2 2  ? 10.733  -7.460  -2.602  1.00 0.00 ? 2  VAL B HA   5  
ATOM 3472  H HB   . VAL B 2 2  ? 9.218   -5.786  -4.625  1.00 0.00 ? 2  VAL B HB   5  
ATOM 3473  H HG11 . VAL B 2 2  ? 12.134  -6.067  -3.973  1.00 0.00 ? 2  VAL B HG11 5  
ATOM 3474  H HG12 . VAL B 2 2  ? 11.651  -5.841  -5.654  1.00 0.00 ? 2  VAL B HG12 5  
ATOM 3475  H HG13 . VAL B 2 2  ? 11.230  -4.627  -4.444  1.00 0.00 ? 2  VAL B HG13 5  
ATOM 3476  H HG21 . VAL B 2 2  ? 10.629  -8.453  -4.668  1.00 0.00 ? 2  VAL B HG21 5  
ATOM 3477  H HG22 . VAL B 2 2  ? 8.989   -8.072  -5.191  1.00 0.00 ? 2  VAL B HG22 5  
ATOM 3478  H HG23 . VAL B 2 2  ? 10.367  -7.531  -6.150  1.00 0.00 ? 2  VAL B HG23 5  
ATOM 3479  N N    . ASN B 2 3  ? 11.261  -5.338  -1.382  1.00 0.00 ? 3  ASN B N    5  
ATOM 3480  C CA   . ASN B 2 3  ? 11.495  -4.121  -0.555  1.00 0.00 ? 3  ASN B CA   5  
ATOM 3481  C C    . ASN B 2 3  ? 11.457  -2.879  -1.446  1.00 0.00 ? 3  ASN B C    5  
ATOM 3482  O O    . ASN B 2 3  ? 12.359  -2.631  -2.222  1.00 0.00 ? 3  ASN B O    5  
ATOM 3483  C CB   . ASN B 2 3  ? 12.864  -4.219  0.122   1.00 0.00 ? 3  ASN B CB   5  
ATOM 3484  C CG   . ASN B 2 3  ? 13.062  -5.632  0.675   1.00 0.00 ? 3  ASN B CG   5  
ATOM 3485  O OD1  . ASN B 2 3  ? 13.749  -6.440  0.082   1.00 0.00 ? 3  ASN B OD1  5  
ATOM 3486  N ND2  . ASN B 2 3  ? 12.485  -5.964  1.798   1.00 0.00 ? 3  ASN B ND2  5  
ATOM 3487  H H    . ASN B 2 3  ? 11.950  -6.032  -1.439  1.00 0.00 ? 3  ASN B H    5  
ATOM 3488  H HA   . ASN B 2 3  ? 10.727  -4.046  0.200   1.00 0.00 ? 3  ASN B HA   5  
ATOM 3489  H HB2  . ASN B 2 3  ? 13.639  -4.004  -0.601  1.00 0.00 ? 3  ASN B HB2  5  
ATOM 3490  H HB3  . ASN B 2 3  ? 12.918  -3.507  0.929   1.00 0.00 ? 3  ASN B HB3  5  
ATOM 3491  H HD21 . ASN B 2 3  ? 11.932  -5.313  2.277   1.00 0.00 ? 3  ASN B HD21 5  
ATOM 3492  H HD22 . ASN B 2 3  ? 12.605  -6.867  2.161   1.00 0.00 ? 3  ASN B HD22 5  
ATOM 3493  N N    . GLN B 2 4  ? 10.420  -2.095  -1.341  1.00 0.00 ? 4  GLN B N    5  
ATOM 3494  C CA   . GLN B 2 4  ? 10.325  -0.864  -2.180  1.00 0.00 ? 4  GLN B CA   5  
ATOM 3495  C C    . GLN B 2 4  ? 9.469   0.176   -1.457  1.00 0.00 ? 4  GLN B C    5  
ATOM 3496  O O    . GLN B 2 4  ? 8.602   -0.156  -0.672  1.00 0.00 ? 4  GLN B O    5  
ATOM 3497  C CB   . GLN B 2 4  ? 9.683   -1.211  -3.524  1.00 0.00 ? 4  GLN B CB   5  
ATOM 3498  C CG   . GLN B 2 4  ? 10.629  -0.811  -4.659  1.00 0.00 ? 4  GLN B CG   5  
ATOM 3499  C CD   . GLN B 2 4  ? 10.973  -2.043  -5.497  1.00 0.00 ? 4  GLN B CD   5  
ATOM 3500  O OE1  . GLN B 2 4  ? 12.094  -2.510  -5.479  1.00 0.00 ? 4  GLN B OE1  5  
ATOM 3501  N NE2  . GLN B 2 4  ? 10.050  -2.593  -6.236  1.00 0.00 ? 4  GLN B NE2  5  
ATOM 3502  H H    . GLN B 2 4  ? 9.703   -2.312  -0.708  1.00 0.00 ? 4  GLN B H    5  
ATOM 3503  H HA   . GLN B 2 4  ? 11.314  -0.465  -2.345  1.00 0.00 ? 4  GLN B HA   5  
ATOM 3504  H HB2  . GLN B 2 4  ? 9.494   -2.274  -3.570  1.00 0.00 ? 4  GLN B HB2  5  
ATOM 3505  H HB3  . GLN B 2 4  ? 8.753   -0.674  -3.627  1.00 0.00 ? 4  GLN B HB3  5  
ATOM 3506  H HG2  . GLN B 2 4  ? 10.147  -0.071  -5.284  1.00 0.00 ? 4  GLN B HG2  5  
ATOM 3507  H HG3  . GLN B 2 4  ? 11.535  -0.394  -4.243  1.00 0.00 ? 4  GLN B HG3  5  
ATOM 3508  H HE21 . GLN B 2 4  ? 9.144   -2.217  -6.250  1.00 0.00 ? 4  GLN B HE21 5  
ATOM 3509  H HE22 . GLN B 2 4  ? 10.260  -3.385  -6.775  1.00 0.00 ? 4  GLN B HE22 5  
ATOM 3510  N N    . HIS B 2 5  ? 9.704   1.433   -1.714  1.00 0.00 ? 5  HIS B N    5  
ATOM 3511  C CA   . HIS B 2 5  ? 8.903   2.493   -1.037  1.00 0.00 ? 5  HIS B CA   5  
ATOM 3512  C C    . HIS B 2 5  ? 7.583   2.686   -1.782  1.00 0.00 ? 5  HIS B C    5  
ATOM 3513  O O    . HIS B 2 5  ? 7.440   2.298   -2.925  1.00 0.00 ? 5  HIS B O    5  
ATOM 3514  C CB   . HIS B 2 5  ? 9.689   3.806   -1.034  1.00 0.00 ? 5  HIS B CB   5  
ATOM 3515  C CG   . HIS B 2 5  ? 10.958  3.628   -0.245  1.00 0.00 ? 5  HIS B CG   5  
ATOM 3516  N ND1  . HIS B 2 5  ? 11.946  2.733   -0.626  1.00 0.00 ? 5  HIS B ND1  5  
ATOM 3517  C CD2  . HIS B 2 5  ? 11.413  4.221   0.906   1.00 0.00 ? 5  HIS B CD2  5  
ATOM 3518  C CE1  . HIS B 2 5  ? 12.935  2.812   0.282   1.00 0.00 ? 5  HIS B CE1  5  
ATOM 3519  N NE2  . HIS B 2 5  ? 12.662  3.704   1.237   1.00 0.00 ? 5  HIS B NE2  5  
ATOM 3520  H H    . HIS B 2 5  ? 10.406  1.680   -2.349  1.00 0.00 ? 5  HIS B H    5  
ATOM 3521  H HA   . HIS B 2 5  ? 8.701   2.193   -0.020  1.00 0.00 ? 5  HIS B HA   5  
ATOM 3522  H HB2  . HIS B 2 5  ? 9.931   4.082   -2.050  1.00 0.00 ? 5  HIS B HB2  5  
ATOM 3523  H HB3  . HIS B 2 5  ? 9.091   4.581   -0.582  1.00 0.00 ? 5  HIS B HB3  5  
ATOM 3524  H HD1  . HIS B 2 5  ? 11.929  2.150   -1.411  1.00 0.00 ? 5  HIS B HD1  5  
ATOM 3525  H HD2  . HIS B 2 5  ? 10.881  4.974   1.469   1.00 0.00 ? 5  HIS B HD2  5  
ATOM 3526  H HE1  . HIS B 2 5  ? 13.839  2.224   0.244   1.00 0.00 ? 5  HIS B HE1  5  
ATOM 3527  N N    . LEU B 2 6  ? 6.614   3.279   -1.142  1.00 0.00 ? 6  LEU B N    5  
ATOM 3528  C CA   . LEU B 2 6  ? 5.302   3.496   -1.813  1.00 0.00 ? 6  LEU B CA   5  
ATOM 3529  C C    . LEU B 2 6  ? 4.884   4.960   -1.661  1.00 0.00 ? 6  LEU B C    5  
ATOM 3530  O O    . LEU B 2 6  ? 4.359   5.366   -0.644  1.00 0.00 ? 6  LEU B O    5  
ATOM 3531  C CB   . LEU B 2 6  ? 4.251   2.590   -1.165  1.00 0.00 ? 6  LEU B CB   5  
ATOM 3532  C CG   . LEU B 2 6  ? 4.642   1.125   -1.377  1.00 0.00 ? 6  LEU B CG   5  
ATOM 3533  C CD1  . LEU B 2 6  ? 3.570   0.215   -0.777  1.00 0.00 ? 6  LEU B CD1  5  
ATOM 3534  C CD2  . LEU B 2 6  ? 4.763   0.845   -2.876  1.00 0.00 ? 6  LEU B CD2  5  
ATOM 3535  H H    . LEU B 2 6  ? 6.750   3.582   -0.220  1.00 0.00 ? 6  LEU B H    5  
ATOM 3536  H HA   . LEU B 2 6  ? 5.388   3.253   -2.859  1.00 0.00 ? 6  LEU B HA   5  
ATOM 3537  H HB2  . LEU B 2 6  ? 4.199   2.799   -0.108  1.00 0.00 ? 6  LEU B HB2  5  
ATOM 3538  H HB3  . LEU B 2 6  ? 3.289   2.773   -1.617  1.00 0.00 ? 6  LEU B HB3  5  
ATOM 3539  H HG   . LEU B 2 6  ? 5.589   0.932   -0.895  1.00 0.00 ? 6  LEU B HG   5  
ATOM 3540  H HD11 . LEU B 2 6  ? 3.382   0.505   0.246   1.00 0.00 ? 6  LEU B HD11 5  
ATOM 3541  H HD12 . LEU B 2 6  ? 2.658   0.307   -1.350  1.00 0.00 ? 6  LEU B HD12 5  
ATOM 3542  H HD13 . LEU B 2 6  ? 3.910   -0.810  -0.805  1.00 0.00 ? 6  LEU B HD13 5  
ATOM 3543  H HD21 . LEU B 2 6  ? 4.162   1.556   -3.424  1.00 0.00 ? 6  LEU B HD21 5  
ATOM 3544  H HD22 . LEU B 2 6  ? 5.795   0.938   -3.178  1.00 0.00 ? 6  LEU B HD22 5  
ATOM 3545  H HD23 . LEU B 2 6  ? 4.415   -0.157  -3.085  1.00 0.00 ? 6  LEU B HD23 5  
ATOM 3546  N N    . CYS B 2 7  ? 5.114   5.758   -2.670  1.00 0.00 ? 7  CYS B N    5  
ATOM 3547  C CA   . CYS B 2 7  ? 4.733   7.198   -2.588  1.00 0.00 ? 7  CYS B CA   5  
ATOM 3548  C C    . CYS B 2 7  ? 3.758   7.531   -3.719  1.00 0.00 ? 7  CYS B C    5  
ATOM 3549  O O    . CYS B 2 7  ? 3.678   6.832   -4.708  1.00 0.00 ? 7  CYS B O    5  
ATOM 3550  C CB   . CYS B 2 7  ? 5.984   8.069   -2.726  1.00 0.00 ? 7  CYS B CB   5  
ATOM 3551  S SG   . CYS B 2 7  ? 6.925   8.027   -1.182  1.00 0.00 ? 7  CYS B SG   5  
ATOM 3552  H H    . CYS B 2 7  ? 5.539   5.412   -3.482  1.00 0.00 ? 7  CYS B H    5  
ATOM 3553  H HA   . CYS B 2 7  ? 4.262   7.393   -1.636  1.00 0.00 ? 7  CYS B HA   5  
ATOM 3554  H HB2  . CYS B 2 7  ? 6.596   7.691   -3.532  1.00 0.00 ? 7  CYS B HB2  5  
ATOM 3555  H HB3  . CYS B 2 7  ? 5.693   9.084   -2.945  1.00 0.00 ? 7  CYS B HB3  5  
ATOM 3556  N N    . GLY B 2 8  ? 3.016   8.594   -3.584  1.00 0.00 ? 8  GLY B N    5  
ATOM 3557  C CA   . GLY B 2 8  ? 2.051   8.966   -4.655  1.00 0.00 ? 8  GLY B CA   5  
ATOM 3558  C C    . GLY B 2 8  ? 1.019   7.849   -4.828  1.00 0.00 ? 8  GLY B C    5  
ATOM 3559  O O    . GLY B 2 8  ? 0.534   7.286   -3.866  1.00 0.00 ? 8  GLY B O    5  
ATOM 3560  H H    . GLY B 2 8  ? 3.094   9.150   -2.780  1.00 0.00 ? 8  GLY B H    5  
ATOM 3561  H HA2  . GLY B 2 8  ? 1.549   9.885   -4.386  1.00 0.00 ? 8  GLY B HA2  5  
ATOM 3562  H HA3  . GLY B 2 8  ? 2.582   9.107   -5.586  1.00 0.00 ? 8  GLY B HA3  5  
ATOM 3563  N N    . SER B 2 9  ? 0.681   7.523   -6.045  1.00 0.00 ? 9  SER B N    5  
ATOM 3564  C CA   . SER B 2 9  ? -0.322  6.445   -6.277  1.00 0.00 ? 9  SER B CA   5  
ATOM 3565  C C    . SER B 2 9  ? 0.392   5.095   -6.399  1.00 0.00 ? 9  SER B C    5  
ATOM 3566  O O    . SER B 2 9  ? -0.125  4.162   -6.979  1.00 0.00 ? 9  SER B O    5  
ATOM 3567  C CB   . SER B 2 9  ? -1.087  6.734   -7.568  1.00 0.00 ? 9  SER B CB   5  
ATOM 3568  O OG   . SER B 2 9  ? -1.101  8.137   -7.801  1.00 0.00 ? 9  SER B OG   5  
ATOM 3569  H H    . SER B 2 9  ? 1.082   7.991   -6.806  1.00 0.00 ? 9  SER B H    5  
ATOM 3570  H HA   . SER B 2 9  ? -1.013  6.412   -5.448  1.00 0.00 ? 9  SER B HA   5  
ATOM 3571  H HB2  . SER B 2 9  ? -0.604  6.242   -8.395  1.00 0.00 ? 9  SER B HB2  5  
ATOM 3572  H HB3  . SER B 2 9  ? -2.100  6.364   -7.474  1.00 0.00 ? 9  SER B HB3  5  
ATOM 3573  H HG   . SER B 2 9  ? -0.405  8.340   -8.431  1.00 0.00 ? 9  SER B HG   5  
ATOM 3574  N N    . HIS B 2 10 ? 1.576   4.983   -5.859  1.00 0.00 ? 10 HIS B N    5  
ATOM 3575  C CA   . HIS B 2 10 ? 2.312   3.690   -5.951  1.00 0.00 ? 10 HIS B CA   5  
ATOM 3576  C C    . HIS B 2 10 ? 1.874   2.768   -4.813  1.00 0.00 ? 10 HIS B C    5  
ATOM 3577  O O    . HIS B 2 10 ? 1.826   1.563   -4.964  1.00 0.00 ? 10 HIS B O    5  
ATOM 3578  C CB   . HIS B 2 10 ? 3.818   3.944   -5.846  1.00 0.00 ? 10 HIS B CB   5  
ATOM 3579  C CG   . HIS B 2 10 ? 4.411   4.012   -7.225  1.00 0.00 ? 10 HIS B CG   5  
ATOM 3580  N ND1  . HIS B 2 10 ? 3.722   4.553   -8.300  1.00 0.00 ? 10 HIS B ND1  5  
ATOM 3581  C CD2  . HIS B 2 10 ? 5.627   3.614   -7.722  1.00 0.00 ? 10 HIS B CD2  5  
ATOM 3582  C CE1  . HIS B 2 10 ? 4.521   4.464   -9.378  1.00 0.00 ? 10 HIS B CE1  5  
ATOM 3583  N NE2  . HIS B 2 10 ? 5.693   3.900   -9.082  1.00 0.00 ? 10 HIS B NE2  5  
ATOM 3584  H H    . HIS B 2 10 ? 1.980   5.745   -5.395  1.00 0.00 ? 10 HIS B H    5  
ATOM 3585  H HA   . HIS B 2 10 ? 2.093   3.218   -6.898  1.00 0.00 ? 10 HIS B HA   5  
ATOM 3586  H HB2  . HIS B 2 10 ? 3.990   4.874   -5.331  1.00 0.00 ? 10 HIS B HB2  5  
ATOM 3587  H HB3  . HIS B 2 10 ? 4.279   3.137   -5.296  1.00 0.00 ? 10 HIS B HB3  5  
ATOM 3588  H HD1  . HIS B 2 10 ? 2.818   4.930   -8.277  1.00 0.00 ? 10 HIS B HD1  5  
ATOM 3589  H HD2  . HIS B 2 10 ? 6.412   3.148   -7.145  1.00 0.00 ? 10 HIS B HD2  5  
ATOM 3590  H HE1  . HIS B 2 10 ? 4.245   4.808   -10.364 1.00 0.00 ? 10 HIS B HE1  5  
ATOM 3591  N N    . LEU B 2 11 ? 1.552   3.319   -3.673  1.00 0.00 ? 11 LEU B N    5  
ATOM 3592  C CA   . LEU B 2 11 ? 1.117   2.459   -2.537  1.00 0.00 ? 11 LEU B CA   5  
ATOM 3593  C C    . LEU B 2 11 ? -0.156  1.712   -2.929  1.00 0.00 ? 11 LEU B C    5  
ATOM 3594  O O    . LEU B 2 11 ? -0.386  0.597   -2.509  1.00 0.00 ? 11 LEU B O    5  
ATOM 3595  C CB   . LEU B 2 11 ? 0.840   3.321   -1.305  1.00 0.00 ? 11 LEU B CB   5  
ATOM 3596  C CG   . LEU B 2 11 ? 1.168   2.515   -0.047  1.00 0.00 ? 11 LEU B CG   5  
ATOM 3597  C CD1  . LEU B 2 11 ? 1.826   3.427   0.993   1.00 0.00 ? 11 LEU B CD1  5  
ATOM 3598  C CD2  . LEU B 2 11 ? -0.122  1.918   0.526   1.00 0.00 ? 11 LEU B CD2  5  
ATOM 3599  H H    . LEU B 2 11 ? 1.595   4.292   -3.566  1.00 0.00 ? 11 LEU B H    5  
ATOM 3600  H HA   . LEU B 2 11 ? 1.894   1.745   -2.310  1.00 0.00 ? 11 LEU B HA   5  
ATOM 3601  H HB2  . LEU B 2 11 ? 1.457   4.208   -1.338  1.00 0.00 ? 11 LEU B HB2  5  
ATOM 3602  H HB3  . LEU B 2 11 ? -0.200  3.604   -1.287  1.00 0.00 ? 11 LEU B HB3  5  
ATOM 3603  H HG   . LEU B 2 11 ? 1.850   1.717   -0.302  1.00 0.00 ? 11 LEU B HG   5  
ATOM 3604  H HD11 . LEU B 2 11 ? 2.644   3.965   0.535   1.00 0.00 ? 11 LEU B HD11 5  
ATOM 3605  H HD12 . LEU B 2 11 ? 1.097   4.132   1.368   1.00 0.00 ? 11 LEU B HD12 5  
ATOM 3606  H HD13 . LEU B 2 11 ? 2.203   2.829   1.808   1.00 0.00 ? 11 LEU B HD13 5  
ATOM 3607  H HD21 . LEU B 2 11 ? -0.718  1.514   -0.278  1.00 0.00 ? 11 LEU B HD21 5  
ATOM 3608  H HD22 . LEU B 2 11 ? 0.122   1.128   1.222   1.00 0.00 ? 11 LEU B HD22 5  
ATOM 3609  H HD23 . LEU B 2 11 ? -0.682  2.689   1.039   1.00 0.00 ? 11 LEU B HD23 5  
ATOM 3610  N N    . VAL B 2 12 ? -0.982  2.313   -3.741  1.00 0.00 ? 12 VAL B N    5  
ATOM 3611  C CA   . VAL B 2 12 ? -2.229  1.622   -4.162  1.00 0.00 ? 12 VAL B CA   5  
ATOM 3612  C C    . VAL B 2 12 ? -1.852  0.396   -4.991  1.00 0.00 ? 12 VAL B C    5  
ATOM 3613  O O    . VAL B 2 12 ? -2.572  -0.580  -5.040  1.00 0.00 ? 12 VAL B O    5  
ATOM 3614  C CB   . VAL B 2 12 ? -3.087  2.569   -5.000  1.00 0.00 ? 12 VAL B CB   5  
ATOM 3615  C CG1  . VAL B 2 12 ? -4.249  1.789   -5.618  1.00 0.00 ? 12 VAL B CG1  5  
ATOM 3616  C CG2  . VAL B 2 12 ? -3.637  3.678   -4.103  1.00 0.00 ? 12 VAL B CG2  5  
ATOM 3617  H H    . VAL B 2 12 ? -0.779  3.211   -4.077  1.00 0.00 ? 12 VAL B H    5  
ATOM 3618  H HA   . VAL B 2 12 ? -2.782  1.312   -3.288  1.00 0.00 ? 12 VAL B HA   5  
ATOM 3619  H HB   . VAL B 2 12 ? -2.485  3.002   -5.786  1.00 0.00 ? 12 VAL B HB   5  
ATOM 3620  H HG11 . VAL B 2 12 ? -4.670  1.123   -4.878  1.00 0.00 ? 12 VAL B HG11 5  
ATOM 3621  H HG12 . VAL B 2 12 ? -5.007  2.478   -5.955  1.00 0.00 ? 12 VAL B HG12 5  
ATOM 3622  H HG13 . VAL B 2 12 ? -3.890  1.212   -6.457  1.00 0.00 ? 12 VAL B HG13 5  
ATOM 3623  H HG21 . VAL B 2 12 ? -3.416  3.446   -3.071  1.00 0.00 ? 12 VAL B HG21 5  
ATOM 3624  H HG22 . VAL B 2 12 ? -3.176  4.617   -4.367  1.00 0.00 ? 12 VAL B HG22 5  
ATOM 3625  H HG23 . VAL B 2 12 ? -4.706  3.751   -4.233  1.00 0.00 ? 12 VAL B HG23 5  
ATOM 3626  N N    . GLU B 2 13 ? -0.718  0.436   -5.637  1.00 0.00 ? 13 GLU B N    5  
ATOM 3627  C CA   . GLU B 2 13 ? -0.282  -0.731  -6.450  1.00 0.00 ? 13 GLU B CA   5  
ATOM 3628  C C    . GLU B 2 13 ? 0.054   -1.889  -5.509  1.00 0.00 ? 13 GLU B C    5  
ATOM 3629  O O    . GLU B 2 13 ? 0.012   -3.044  -5.885  1.00 0.00 ? 13 GLU B O    5  
ATOM 3630  C CB   . GLU B 2 13 ? 0.954   -0.355  -7.268  1.00 0.00 ? 13 GLU B CB   5  
ATOM 3631  C CG   . GLU B 2 13 ? 0.520   0.359   -8.551  1.00 0.00 ? 13 GLU B CG   5  
ATOM 3632  C CD   . GLU B 2 13 ? 1.633   1.296   -9.015  1.00 0.00 ? 13 GLU B CD   5  
ATOM 3633  O OE1  . GLU B 2 13 ? 2.741   0.824   -9.202  1.00 0.00 ? 13 GLU B OE1  5  
ATOM 3634  O OE2  . GLU B 2 13 ? 1.359   2.474   -9.177  1.00 0.00 ? 13 GLU B OE2  5  
ATOM 3635  H H    . GLU B 2 13 ? -0.148  1.231   -5.577  1.00 0.00 ? 13 GLU B H    5  
ATOM 3636  H HA   . GLU B 2 13 ? -1.082  -1.026  -7.117  1.00 0.00 ? 13 GLU B HA   5  
ATOM 3637  H HB2  . GLU B 2 13 ? 1.585   0.302   -6.685  1.00 0.00 ? 13 GLU B HB2  5  
ATOM 3638  H HB3  . GLU B 2 13 ? 1.504   -1.248  -7.524  1.00 0.00 ? 13 GLU B HB3  5  
ATOM 3639  H HG2  . GLU B 2 13 ? 0.320   -0.375  -9.320  1.00 0.00 ? 13 GLU B HG2  5  
ATOM 3640  H HG3  . GLU B 2 13 ? -0.374  0.931   -8.359  1.00 0.00 ? 13 GLU B HG3  5  
ATOM 3641  N N    . ALA B 2 14 ? 0.372   -1.585  -4.281  1.00 0.00 ? 14 ALA B N    5  
ATOM 3642  C CA   . ALA B 2 14 ? 0.693   -2.659  -3.303  1.00 0.00 ? 14 ALA B CA   5  
ATOM 3643  C C    . ALA B 2 14 ? -0.556  -2.956  -2.474  1.00 0.00 ? 14 ALA B C    5  
ATOM 3644  O O    . ALA B 2 14 ? -0.655  -3.978  -1.822  1.00 0.00 ? 14 ALA B O    5  
ATOM 3645  C CB   . ALA B 2 14 ? 1.822   -2.194  -2.381  1.00 0.00 ? 14 ALA B CB   5  
ATOM 3646  H H    . ALA B 2 14 ? 0.388   -0.645  -3.998  1.00 0.00 ? 14 ALA B H    5  
ATOM 3647  H HA   . ALA B 2 14 ? 0.999   -3.552  -3.828  1.00 0.00 ? 14 ALA B HA   5  
ATOM 3648  H HB1  . ALA B 2 14 ? 2.668   -1.882  -2.977  1.00 0.00 ? 14 ALA B HB1  5  
ATOM 3649  H HB2  . ALA B 2 14 ? 1.479   -1.364  -1.781  1.00 0.00 ? 14 ALA B HB2  5  
ATOM 3650  H HB3  . ALA B 2 14 ? 2.118   -3.006  -1.735  1.00 0.00 ? 14 ALA B HB3  5  
ATOM 3651  N N    . LEU B 2 15 ? -1.516  -2.070  -2.500  1.00 0.00 ? 15 LEU B N    5  
ATOM 3652  C CA   . LEU B 2 15 ? -2.764  -2.300  -1.720  1.00 0.00 ? 15 LEU B CA   5  
ATOM 3653  C C    . LEU B 2 15 ? -3.663  -3.274  -2.487  1.00 0.00 ? 15 LEU B C    5  
ATOM 3654  O O    . LEU B 2 15 ? -4.122  -4.264  -1.952  1.00 0.00 ? 15 LEU B O    5  
ATOM 3655  C CB   . LEU B 2 15 ? -3.501  -0.973  -1.523  1.00 0.00 ? 15 LEU B CB   5  
ATOM 3656  C CG   . LEU B 2 15 ? -2.763  -0.138  -0.476  1.00 0.00 ? 15 LEU B CG   5  
ATOM 3657  C CD1  . LEU B 2 15 ? -3.587  1.105   -0.135  1.00 0.00 ? 15 LEU B CD1  5  
ATOM 3658  C CD2  . LEU B 2 15 ? -2.560  -0.969  0.791   1.00 0.00 ? 15 LEU B CD2  5  
ATOM 3659  H H    . LEU B 2 15 ? -1.416  -1.256  -3.037  1.00 0.00 ? 15 LEU B H    5  
ATOM 3660  H HA   . LEU B 2 15 ? -2.512  -2.717  -0.758  1.00 0.00 ? 15 LEU B HA   5  
ATOM 3661  H HB2  . LEU B 2 15 ? -3.531  -0.436  -2.460  1.00 0.00 ? 15 LEU B HB2  5  
ATOM 3662  H HB3  . LEU B 2 15 ? -4.507  -1.167  -1.186  1.00 0.00 ? 15 LEU B HB3  5  
ATOM 3663  H HG   . LEU B 2 15 ? -1.804  0.161   -0.871  1.00 0.00 ? 15 LEU B HG   5  
ATOM 3664  H HD11 . LEU B 2 15 ? -4.636  0.888   -0.267  1.00 0.00 ? 15 LEU B HD11 5  
ATOM 3665  H HD12 . LEU B 2 15 ? -3.402  1.386   0.893   1.00 0.00 ? 15 LEU B HD12 5  
ATOM 3666  H HD13 . LEU B 2 15 ? -3.301  1.915   -0.788  1.00 0.00 ? 15 LEU B HD13 5  
ATOM 3667  H HD21 . LEU B 2 15 ? -3.182  -1.852  0.749   1.00 0.00 ? 15 LEU B HD21 5  
ATOM 3668  H HD22 . LEU B 2 15 ? -1.525  -1.261  0.867   1.00 0.00 ? 15 LEU B HD22 5  
ATOM 3669  H HD23 . LEU B 2 15 ? -2.831  -0.380  1.654   1.00 0.00 ? 15 LEU B HD23 5  
ATOM 3670  N N    . HIS B 2 16 ? -3.913  -3.002  -3.741  1.00 0.00 ? 16 HIS B N    5  
ATOM 3671  C CA   . HIS B 2 16 ? -4.778  -3.912  -4.546  1.00 0.00 ? 16 HIS B CA   5  
ATOM 3672  C C    . HIS B 2 16 ? -4.093  -5.275  -4.673  1.00 0.00 ? 16 HIS B C    5  
ATOM 3673  O O    . HIS B 2 16 ? -4.735  -6.304  -4.737  1.00 0.00 ? 16 HIS B O    5  
ATOM 3674  C CB   . HIS B 2 16 ? -5.009  -3.299  -5.937  1.00 0.00 ? 16 HIS B CB   5  
ATOM 3675  C CG   . HIS B 2 16 ? -3.845  -3.598  -6.841  1.00 0.00 ? 16 HIS B CG   5  
ATOM 3676  N ND1  . HIS B 2 16 ? -3.988  -4.291  -8.032  1.00 0.00 ? 16 HIS B ND1  5  
ATOM 3677  C CD2  . HIS B 2 16 ? -2.514  -3.294  -6.740  1.00 0.00 ? 16 HIS B CD2  5  
ATOM 3678  C CE1  . HIS B 2 16 ? -2.770  -4.380  -8.597  1.00 0.00 ? 16 HIS B CE1  5  
ATOM 3679  N NE2  . HIS B 2 16 ? -1.834  -3.788  -7.849  1.00 0.00 ? 16 HIS B NE2  5  
ATOM 3680  H H    . HIS B 2 16 ? -3.530  -2.202  -4.152  1.00 0.00 ? 16 HIS B H    5  
ATOM 3681  H HA   . HIS B 2 16 ? -5.728  -4.035  -4.047  1.00 0.00 ? 16 HIS B HA   5  
ATOM 3682  H HB2  . HIS B 2 16 ? -5.909  -3.709  -6.366  1.00 0.00 ? 16 HIS B HB2  5  
ATOM 3683  H HB3  . HIS B 2 16 ? -5.113  -2.229  -5.840  1.00 0.00 ? 16 HIS B HB3  5  
ATOM 3684  H HD1  . HIS B 2 16 ? -4.823  -4.650  -8.396  1.00 0.00 ? 16 HIS B HD1  5  
ATOM 3685  H HD2  . HIS B 2 16 ? -2.066  -2.753  -5.923  1.00 0.00 ? 16 HIS B HD2  5  
ATOM 3686  H HE1  . HIS B 2 16 ? -2.571  -4.868  -9.540  1.00 0.00 ? 16 HIS B HE1  5  
ATOM 3687  N N    . LEU B 2 17 ? -2.787  -5.286  -4.706  1.00 0.00 ? 17 LEU B N    5  
ATOM 3688  C CA   . LEU B 2 17 ? -2.056  -6.577  -4.824  1.00 0.00 ? 17 LEU B CA   5  
ATOM 3689  C C    . LEU B 2 17 ? -2.308  -7.413  -3.569  1.00 0.00 ? 17 LEU B C    5  
ATOM 3690  O O    . LEU B 2 17 ? -2.216  -8.622  -3.585  1.00 0.00 ? 17 LEU B O    5  
ATOM 3691  C CB   . LEU B 2 17 ? -0.557  -6.300  -4.962  1.00 0.00 ? 17 LEU B CB   5  
ATOM 3692  C CG   . LEU B 2 17 ? 0.203   -7.624  -5.058  1.00 0.00 ? 17 LEU B CG   5  
ATOM 3693  C CD1  . LEU B 2 17 ? -0.095  -8.290  -6.400  1.00 0.00 ? 17 LEU B CD1  5  
ATOM 3694  C CD2  . LEU B 2 17 ? 1.705   -7.354  -4.945  1.00 0.00 ? 17 LEU B CD2  5  
ATOM 3695  H H    . LEU B 2 17 ? -2.289  -4.444  -4.651  1.00 0.00 ? 17 LEU B H    5  
ATOM 3696  H HA   . LEU B 2 17 ? -2.406  -7.114  -5.693  1.00 0.00 ? 17 LEU B HA   5  
ATOM 3697  H HB2  . LEU B 2 17 ? -0.380  -5.719  -5.855  1.00 0.00 ? 17 LEU B HB2  5  
ATOM 3698  H HB3  . LEU B 2 17 ? -0.211  -5.751  -4.101  1.00 0.00 ? 17 LEU B HB3  5  
ATOM 3699  H HG   . LEU B 2 17 ? -0.109  -8.276  -4.256  1.00 0.00 ? 17 LEU B HG   5  
ATOM 3700  H HD11 . LEU B 2 17 ? -0.982  -7.850  -6.833  1.00 0.00 ? 17 LEU B HD11 5  
ATOM 3701  H HD12 . LEU B 2 17 ? 0.741   -8.144  -7.069  1.00 0.00 ? 17 LEU B HD12 5  
ATOM 3702  H HD13 . LEU B 2 17 ? -0.255  -9.349  -6.251  1.00 0.00 ? 17 LEU B HD13 5  
ATOM 3703  H HD21 . LEU B 2 17 ? 1.901   -6.314  -5.161  1.00 0.00 ? 17 LEU B HD21 5  
ATOM 3704  H HD22 . LEU B 2 17 ? 2.038   -7.583  -3.943  1.00 0.00 ? 17 LEU B HD22 5  
ATOM 3705  H HD23 . LEU B 2 17 ? 2.237   -7.975  -5.650  1.00 0.00 ? 17 LEU B HD23 5  
ATOM 3706  N N    . VAL B 2 18 ? -2.634  -6.770  -2.479  1.00 0.00 ? 18 VAL B N    5  
ATOM 3707  C CA   . VAL B 2 18 ? -2.897  -7.521  -1.220  1.00 0.00 ? 18 VAL B CA   5  
ATOM 3708  C C    . VAL B 2 18 ? -4.297  -8.136  -1.281  1.00 0.00 ? 18 VAL B C    5  
ATOM 3709  O O    . VAL B 2 18 ? -4.618  -9.051  -0.550  1.00 0.00 ? 18 VAL B O    5  
ATOM 3710  C CB   . VAL B 2 18 ? -2.807  -6.565  -0.028  1.00 0.00 ? 18 VAL B CB   5  
ATOM 3711  C CG1  . VAL B 2 18 ? -3.031  -7.342  1.269   1.00 0.00 ? 18 VAL B CG1  5  
ATOM 3712  C CG2  . VAL B 2 18 ? -1.420  -5.917  -0.002  1.00 0.00 ? 18 VAL B CG2  5  
ATOM 3713  H H    . VAL B 2 18 ? -2.705  -5.793  -2.489  1.00 0.00 ? 18 VAL B H    5  
ATOM 3714  H HA   . VAL B 2 18 ? -2.164  -8.306  -1.108  1.00 0.00 ? 18 VAL B HA   5  
ATOM 3715  H HB   . VAL B 2 18 ? -3.563  -5.797  -0.126  1.00 0.00 ? 18 VAL B HB   5  
ATOM 3716  H HG11 . VAL B 2 18 ? -3.052  -8.401  1.057   1.00 0.00 ? 18 VAL B HG11 5  
ATOM 3717  H HG12 . VAL B 2 18 ? -2.228  -7.129  1.959   1.00 0.00 ? 18 VAL B HG12 5  
ATOM 3718  H HG13 . VAL B 2 18 ? -3.972  -7.045  1.709   1.00 0.00 ? 18 VAL B HG13 5  
ATOM 3719  H HG21 . VAL B 2 18 ? -0.823  -6.312  -0.808  1.00 0.00 ? 18 VAL B HG21 5  
ATOM 3720  H HG22 . VAL B 2 18 ? -1.520  -4.849  -0.117  1.00 0.00 ? 18 VAL B HG22 5  
ATOM 3721  H HG23 . VAL B 2 18 ? -0.941  -6.133  0.942   1.00 0.00 ? 18 VAL B HG23 5  
ATOM 3722  N N    . CYS B 2 19 ? -5.133  -7.638  -2.152  1.00 0.00 ? 19 CYS B N    5  
ATOM 3723  C CA   . CYS B 2 19 ? -6.511  -8.191  -2.264  1.00 0.00 ? 19 CYS B CA   5  
ATOM 3724  C C    . CYS B 2 19 ? -6.678  -8.874  -3.624  1.00 0.00 ? 19 CYS B C    5  
ATOM 3725  O O    . CYS B 2 19 ? -6.473  -10.063 -3.762  1.00 0.00 ? 19 CYS B O    5  
ATOM 3726  C CB   . CYS B 2 19 ? -7.529  -7.058  -2.140  1.00 0.00 ? 19 CYS B CB   5  
ATOM 3727  S SG   . CYS B 2 19 ? -8.222  -7.049  -0.469  1.00 0.00 ? 19 CYS B SG   5  
ATOM 3728  H H    . CYS B 2 19 ? -4.854  -6.901  -2.731  1.00 0.00 ? 19 CYS B H    5  
ATOM 3729  H HA   . CYS B 2 19 ? -6.678  -8.911  -1.478  1.00 0.00 ? 19 CYS B HA   5  
ATOM 3730  H HB2  . CYS B 2 19 ? -7.042  -6.113  -2.333  1.00 0.00 ? 19 CYS B HB2  5  
ATOM 3731  H HB3  . CYS B 2 19 ? -8.320  -7.208  -2.857  1.00 0.00 ? 19 CYS B HB3  5  
ATOM 3732  N N    . GLY B 2 20 ? -7.050  -8.130  -4.629  1.00 0.00 ? 20 GLY B N    5  
ATOM 3733  C CA   . GLY B 2 20 ? -7.231  -8.736  -5.980  1.00 0.00 ? 20 GLY B CA   5  
ATOM 3734  C C    . GLY B 2 20 ? -8.657  -8.478  -6.470  1.00 0.00 ? 20 GLY B C    5  
ATOM 3735  O O    . GLY B 2 20 ? -9.071  -7.348  -6.640  1.00 0.00 ? 20 GLY B O    5  
ATOM 3736  H H    . GLY B 2 20 ? -7.213  -7.171  -4.496  1.00 0.00 ? 20 GLY B H    5  
ATOM 3737  H HA2  . GLY B 2 20 ? -6.525  -8.294  -6.668  1.00 0.00 ? 20 GLY B HA2  5  
ATOM 3738  H HA3  . GLY B 2 20 ? -7.060  -9.800  -5.922  1.00 0.00 ? 20 GLY B HA3  5  
ATOM 3739  N N    . GLU B 2 21 ? -9.410  -9.517  -6.700  1.00 0.00 ? 21 GLU B N    5  
ATOM 3740  C CA   . GLU B 2 21 ? -10.809 -9.331  -7.180  1.00 0.00 ? 21 GLU B CA   5  
ATOM 3741  C C    . GLU B 2 21 ? -11.630 -8.630  -6.096  1.00 0.00 ? 21 GLU B C    5  
ATOM 3742  O O    . GLU B 2 21 ? -12.406 -7.737  -6.373  1.00 0.00 ? 21 GLU B O    5  
ATOM 3743  C CB   . GLU B 2 21 ? -11.426 -10.696 -7.487  1.00 0.00 ? 21 GLU B CB   5  
ATOM 3744  C CG   . GLU B 2 21 ? -12.872 -10.510 -7.957  1.00 0.00 ? 21 GLU B CG   5  
ATOM 3745  C CD   . GLU B 2 21 ? -13.738 -11.644 -7.406  1.00 0.00 ? 21 GLU B CD   5  
ATOM 3746  O OE1  . GLU B 2 21 ? -13.282 -12.328 -6.505  1.00 0.00 ? 21 GLU B OE1  5  
ATOM 3747  O OE2  . GLU B 2 21 ? -14.842 -11.810 -7.895  1.00 0.00 ? 21 GLU B OE2  5  
ATOM 3748  H H    . GLU B 2 21 ? -9.057  -10.420 -6.557  1.00 0.00 ? 21 GLU B H    5  
ATOM 3749  H HA   . GLU B 2 21 ? -10.804 -8.727  -8.076  1.00 0.00 ? 21 GLU B HA   5  
ATOM 3750  H HB2  . GLU B 2 21 ? -10.855 -11.184 -8.262  1.00 0.00 ? 21 GLU B HB2  5  
ATOM 3751  H HB3  . GLU B 2 21 ? -11.416 -11.306 -6.595  1.00 0.00 ? 21 GLU B HB3  5  
ATOM 3752  H HG2  . GLU B 2 21 ? -13.247 -9.561  -7.599  1.00 0.00 ? 21 GLU B HG2  5  
ATOM 3753  H HG3  . GLU B 2 21 ? -12.904 -10.527 -9.035  1.00 0.00 ? 21 GLU B HG3  5  
ATOM 3754  N N    . ARG B 2 22 ? -11.468 -9.028  -4.864  1.00 0.00 ? 22 ARG B N    5  
ATOM 3755  C CA   . ARG B 2 22 ? -12.239 -8.384  -3.764  1.00 0.00 ? 22 ARG B CA   5  
ATOM 3756  C C    . ARG B 2 22 ? -12.102 -6.863  -3.869  1.00 0.00 ? 22 ARG B C    5  
ATOM 3757  O O    . ARG B 2 22 ? -13.050 -6.164  -4.160  1.00 0.00 ? 22 ARG B O    5  
ATOM 3758  C CB   . ARG B 2 22 ? -11.693 -8.855  -2.416  1.00 0.00 ? 22 ARG B CB   5  
ATOM 3759  C CG   . ARG B 2 22 ? -11.948 -10.356 -2.263  1.00 0.00 ? 22 ARG B CG   5  
ATOM 3760  C CD   . ARG B 2 22 ? -11.672 -10.776 -0.818  1.00 0.00 ? 22 ARG B CD   5  
ATOM 3761  N NE   . ARG B 2 22 ? -10.320 -11.399 -0.729  1.00 0.00 ? 22 ARG B NE   5  
ATOM 3762  C CZ   . ARG B 2 22 ? -9.748  -11.558 0.434   1.00 0.00 ? 22 ARG B CZ   5  
ATOM 3763  N NH1  . ARG B 2 22 ? -10.350 -11.162 1.523   1.00 0.00 ? 22 ARG B NH1  5  
ATOM 3764  N NH2  . ARG B 2 22 ? -8.569  -12.110 0.508   1.00 0.00 ? 22 ARG B NH2  5  
ATOM 3765  H H    . ARG B 2 22 ? -10.836 -9.750  -4.662  1.00 0.00 ? 22 ARG B H    5  
ATOM 3766  H HA   . ARG B 2 22 ? -13.280 -8.658  -3.847  1.00 0.00 ? 22 ARG B HA   5  
ATOM 3767  H HB2  . ARG B 2 22 ? -10.630 -8.663  -2.370  1.00 0.00 ? 22 ARG B HB2  5  
ATOM 3768  H HB3  . ARG B 2 22 ? -12.190 -8.326  -1.619  1.00 0.00 ? 22 ARG B HB3  5  
ATOM 3769  H HG2  . ARG B 2 22 ? -12.976 -10.574 -2.511  1.00 0.00 ? 22 ARG B HG2  5  
ATOM 3770  H HG3  . ARG B 2 22 ? -11.293 -10.903 -2.924  1.00 0.00 ? 22 ARG B HG3  5  
ATOM 3771  H HD2  . ARG B 2 22 ? -11.712 -9.907  -0.177  1.00 0.00 ? 22 ARG B HD2  5  
ATOM 3772  H HD3  . ARG B 2 22 ? -12.418 -11.491 -0.503  1.00 0.00 ? 22 ARG B HD3  5  
ATOM 3773  H HE   . ARG B 2 22 ? -9.861  -11.691 -1.544  1.00 0.00 ? 22 ARG B HE   5  
ATOM 3774  H HH11 . ARG B 2 22 ? -11.253 -10.736 1.471   1.00 0.00 ? 22 ARG B HH11 5  
ATOM 3775  H HH12 . ARG B 2 22 ? -9.908  -11.286 2.412   1.00 0.00 ? 22 ARG B HH12 5  
ATOM 3776  H HH21 . ARG B 2 22 ? -8.104  -12.411 -0.325  1.00 0.00 ? 22 ARG B HH21 5  
ATOM 3777  H HH22 . ARG B 2 22 ? -8.127  -12.234 1.398   1.00 0.00 ? 22 ARG B HH22 5  
ATOM 3778  N N    . GLY B 2 23 ? -10.926 -6.347  -3.638  1.00 0.00 ? 23 GLY B N    5  
ATOM 3779  C CA   . GLY B 2 23 ? -10.730 -4.871  -3.730  1.00 0.00 ? 23 GLY B CA   5  
ATOM 3780  C C    . GLY B 2 23 ? -10.265 -4.326  -2.378  1.00 0.00 ? 23 GLY B C    5  
ATOM 3781  O O    . GLY B 2 23 ? -10.273 -5.019  -1.381  1.00 0.00 ? 23 GLY B O    5  
ATOM 3782  H H    . GLY B 2 23 ? -10.170 -6.928  -3.407  1.00 0.00 ? 23 GLY B H    5  
ATOM 3783  H HA2  . GLY B 2 23 ? -9.984  -4.655  -4.481  1.00 0.00 ? 23 GLY B HA2  5  
ATOM 3784  H HA3  . GLY B 2 23 ? -11.664 -4.402  -4.001  1.00 0.00 ? 23 GLY B HA3  5  
ATOM 3785  N N    . PHE B 2 24 ? -9.860  -3.087  -2.341  1.00 0.00 ? 24 PHE B N    5  
ATOM 3786  C CA   . PHE B 2 24 ? -9.393  -2.489  -1.059  1.00 0.00 ? 24 PHE B CA   5  
ATOM 3787  C C    . PHE B 2 24 ? -9.998  -1.092  -0.905  1.00 0.00 ? 24 PHE B C    5  
ATOM 3788  O O    . PHE B 2 24 ? -10.695 -0.611  -1.776  1.00 0.00 ? 24 PHE B O    5  
ATOM 3789  C CB   . PHE B 2 24 ? -7.867  -2.392  -1.069  1.00 0.00 ? 24 PHE B CB   5  
ATOM 3790  C CG   . PHE B 2 24 ? -7.417  -1.726  -2.343  1.00 0.00 ? 24 PHE B CG   5  
ATOM 3791  C CD1  . PHE B 2 24 ? -7.526  -2.416  -3.547  1.00 0.00 ? 24 PHE B CD1  5  
ATOM 3792  C CD2  . PHE B 2 24 ? -6.898  -0.426  -2.320  1.00 0.00 ? 24 PHE B CD2  5  
ATOM 3793  C CE1  . PHE B 2 24 ? -7.114  -1.812  -4.741  1.00 0.00 ? 24 PHE B CE1  5  
ATOM 3794  C CE2  . PHE B 2 24 ? -6.485  0.181   -3.512  1.00 0.00 ? 24 PHE B CE2  5  
ATOM 3795  C CZ   . PHE B 2 24 ? -6.595  -0.513  -4.724  1.00 0.00 ? 24 PHE B CZ   5  
ATOM 3796  H H    . PHE B 2 24 ? -9.862  -2.546  -3.159  1.00 0.00 ? 24 PHE B H    5  
ATOM 3797  H HA   . PHE B 2 24 ? -9.710  -3.112  -0.235  1.00 0.00 ? 24 PHE B HA   5  
ATOM 3798  H HB2  . PHE B 2 24 ? -7.530  -1.817  -0.220  1.00 0.00 ? 24 PHE B HB2  5  
ATOM 3799  H HB3  . PHE B 2 24 ? -7.447  -3.385  -1.027  1.00 0.00 ? 24 PHE B HB3  5  
ATOM 3800  H HD1  . PHE B 2 24 ? -7.924  -3.420  -3.553  1.00 0.00 ? 24 PHE B HD1  5  
ATOM 3801  H HD2  . PHE B 2 24 ? -6.814  0.107   -1.385  1.00 0.00 ? 24 PHE B HD2  5  
ATOM 3802  H HE1  . PHE B 2 24 ? -7.197  -2.350  -5.675  1.00 0.00 ? 24 PHE B HE1  5  
ATOM 3803  H HE2  . PHE B 2 24 ? -6.083  1.183   -3.497  1.00 0.00 ? 24 PHE B HE2  5  
ATOM 3804  H HZ   . PHE B 2 24 ? -6.276  -0.045  -5.645  1.00 0.00 ? 24 PHE B HZ   5  
ATOM 3805  N N    . PHE B 2 25 ? -9.738  -0.437  0.193   1.00 0.00 ? 25 PHE B N    5  
ATOM 3806  C CA   . PHE B 2 25 ? -10.305 0.925   0.391   1.00 0.00 ? 25 PHE B CA   5  
ATOM 3807  C C    . PHE B 2 25 ? -9.186  1.893   0.783   1.00 0.00 ? 25 PHE B C    5  
ATOM 3808  O O    . PHE B 2 25 ? -8.992  2.201   1.941   1.00 0.00 ? 25 PHE B O    5  
ATOM 3809  C CB   . PHE B 2 25 ? -11.364 0.884   1.495   1.00 0.00 ? 25 PHE B CB   5  
ATOM 3810  C CG   . PHE B 2 25 ? -10.719 0.508   2.807   1.00 0.00 ? 25 PHE B CG   5  
ATOM 3811  C CD1  . PHE B 2 25 ? -10.225 -0.789  3.002   1.00 0.00 ? 25 PHE B CD1  5  
ATOM 3812  C CD2  . PHE B 2 25 ? -10.618 1.457   3.832   1.00 0.00 ? 25 PHE B CD2  5  
ATOM 3813  C CE1  . PHE B 2 25 ? -9.628  -1.135  4.220   1.00 0.00 ? 25 PHE B CE1  5  
ATOM 3814  C CE2  . PHE B 2 25 ? -10.021 1.110   5.049   1.00 0.00 ? 25 PHE B CE2  5  
ATOM 3815  C CZ   . PHE B 2 25 ? -9.525  -0.186  5.244   1.00 0.00 ? 25 PHE B CZ   5  
ATOM 3816  H H    . PHE B 2 25 ? -9.175  -0.841  0.884   1.00 0.00 ? 25 PHE B H    5  
ATOM 3817  H HA   . PHE B 2 25 ? -10.760 1.260   -0.530  1.00 0.00 ? 25 PHE B HA   5  
ATOM 3818  H HB2  . PHE B 2 25 ? -11.825 1.857   1.588   1.00 0.00 ? 25 PHE B HB2  5  
ATOM 3819  H HB3  . PHE B 2 25 ? -12.118 0.152   1.244   1.00 0.00 ? 25 PHE B HB3  5  
ATOM 3820  H HD1  . PHE B 2 25 ? -10.306 -1.523  2.211   1.00 0.00 ? 25 PHE B HD1  5  
ATOM 3821  H HD2  . PHE B 2 25 ? -10.999 2.455   3.684   1.00 0.00 ? 25 PHE B HD2  5  
ATOM 3822  H HE1  . PHE B 2 25 ? -9.246  -2.134  4.368   1.00 0.00 ? 25 PHE B HE1  5  
ATOM 3823  H HE2  . PHE B 2 25 ? -9.941  1.841   5.840   1.00 0.00 ? 25 PHE B HE2  5  
ATOM 3824  H HZ   . PHE B 2 25 ? -9.064  -0.453  6.182   1.00 0.00 ? 25 PHE B HZ   5  
ATOM 3825  N N    . TYR B 2 26 ? -8.449  2.380   -0.179  1.00 0.00 ? 26 TYR B N    5  
ATOM 3826  C CA   . TYR B 2 26 ? -7.345  3.330   0.133   1.00 0.00 ? 26 TYR B CA   5  
ATOM 3827  C C    . TYR B 2 26 ? -7.938  4.661   0.594   1.00 0.00 ? 26 TYR B C    5  
ATOM 3828  O O    . TYR B 2 26 ? -9.126  4.894   0.481   1.00 0.00 ? 26 TYR B O    5  
ATOM 3829  C CB   . TYR B 2 26 ? -6.497  3.554   -1.124  1.00 0.00 ? 26 TYR B CB   5  
ATOM 3830  C CG   . TYR B 2 26 ? -5.173  4.178   -0.745  1.00 0.00 ? 26 TYR B CG   5  
ATOM 3831  C CD1  . TYR B 2 26 ? -4.473  3.713   0.372   1.00 0.00 ? 26 TYR B CD1  5  
ATOM 3832  C CD2  . TYR B 2 26 ? -4.646  5.220   -1.517  1.00 0.00 ? 26 TYR B CD2  5  
ATOM 3833  C CE1  . TYR B 2 26 ? -3.245  4.288   0.720   1.00 0.00 ? 26 TYR B CE1  5  
ATOM 3834  C CE2  . TYR B 2 26 ? -3.419  5.797   -1.171  1.00 0.00 ? 26 TYR B CE2  5  
ATOM 3835  C CZ   . TYR B 2 26 ? -2.718  5.332   -0.052  1.00 0.00 ? 26 TYR B CZ   5  
ATOM 3836  O OH   . TYR B 2 26 ? -1.508  5.899   0.291   1.00 0.00 ? 26 TYR B OH   5  
ATOM 3837  H H    . TYR B 2 26 ? -8.623  2.121   -1.108  1.00 0.00 ? 26 TYR B H    5  
ATOM 3838  H HA   . TYR B 2 26 ? -6.726  2.919   0.917   1.00 0.00 ? 26 TYR B HA   5  
ATOM 3839  H HB2  . TYR B 2 26 ? -6.322  2.606   -1.611  1.00 0.00 ? 26 TYR B HB2  5  
ATOM 3840  H HB3  . TYR B 2 26 ? -7.024  4.213   -1.798  1.00 0.00 ? 26 TYR B HB3  5  
ATOM 3841  H HD1  . TYR B 2 26 ? -4.878  2.909   0.967   1.00 0.00 ? 26 TYR B HD1  5  
ATOM 3842  H HD2  . TYR B 2 26 ? -5.186  5.580   -2.382  1.00 0.00 ? 26 TYR B HD2  5  
ATOM 3843  H HE1  . TYR B 2 26 ? -2.706  3.929   1.583   1.00 0.00 ? 26 TYR B HE1  5  
ATOM 3844  H HE2  . TYR B 2 26 ? -3.011  6.600   -1.767  1.00 0.00 ? 26 TYR B HE2  5  
ATOM 3845  H HH   . TYR B 2 26 ? -0.841  5.567   -0.315  1.00 0.00 ? 26 TYR B HH   5  
ATOM 3846  N N    . THR B 2 27 ? -7.124  5.542   1.109   1.00 0.00 ? 27 THR B N    5  
ATOM 3847  C CA   . THR B 2 27 ? -7.649  6.857   1.573   1.00 0.00 ? 27 THR B CA   5  
ATOM 3848  C C    . THR B 2 27 ? -6.775  7.984   1.014   1.00 0.00 ? 27 THR B C    5  
ATOM 3849  O O    . THR B 2 27 ? -6.225  8.768   1.761   1.00 0.00 ? 27 THR B O    5  
ATOM 3850  C CB   . THR B 2 27 ? -7.631  6.904   3.103   1.00 0.00 ? 27 THR B CB   5  
ATOM 3851  O OG1  . THR B 2 27 ? -7.682  8.257   3.534   1.00 0.00 ? 27 THR B OG1  5  
ATOM 3852  C CG2  . THR B 2 27 ? -6.350  6.248   3.621   1.00 0.00 ? 27 THR B CG2  5  
ATOM 3853  H H    . THR B 2 27 ? -6.169  5.339   1.192   1.00 0.00 ? 27 THR B H    5  
ATOM 3854  H HA   . THR B 2 27 ? -8.663  6.981   1.222   1.00 0.00 ? 27 THR B HA   5  
ATOM 3855  H HB   . THR B 2 27 ? -8.485  6.371   3.491   1.00 0.00 ? 27 THR B HB   5  
ATOM 3856  H HG1  . THR B 2 27 ? -8.399  8.341   4.165   1.00 0.00 ? 27 THR B HG1  5  
ATOM 3857  H HG21 . THR B 2 27 ? -6.212  5.294   3.137   1.00 0.00 ? 27 THR B HG21 5  
ATOM 3858  H HG22 . THR B 2 27 ? -5.506  6.887   3.405   1.00 0.00 ? 27 THR B HG22 5  
ATOM 3859  H HG23 . THR B 2 27 ? -6.426  6.104   4.688   1.00 0.00 ? 27 THR B HG23 5  
ATOM 3860  N N    . PRO B 2 28 ? -6.679  8.027   -0.290  1.00 0.00 ? 28 PRO B N    5  
ATOM 3861  C CA   . PRO B 2 28 ? -5.881  9.045   -1.016  1.00 0.00 ? 28 PRO B CA   5  
ATOM 3862  C C    . PRO B 2 28 ? -6.444  10.443  -0.744  1.00 0.00 ? 28 PRO B C    5  
ATOM 3863  O O    . PRO B 2 28 ? -7.460  10.830  -1.286  1.00 0.00 ? 28 PRO B O    5  
ATOM 3864  C CB   . PRO B 2 28 ? -6.016  8.703   -2.506  1.00 0.00 ? 28 PRO B CB   5  
ATOM 3865  C CG   . PRO B 2 28 ? -6.976  7.503   -2.620  1.00 0.00 ? 28 PRO B CG   5  
ATOM 3866  C CD   . PRO B 2 28 ? -7.350  7.069   -1.199  1.00 0.00 ? 28 PRO B CD   5  
ATOM 3867  H HA   . PRO B 2 28 ? -4.847  8.993   -0.720  1.00 0.00 ? 28 PRO B HA   5  
ATOM 3868  H HB2  . PRO B 2 28 ? -6.420  9.552   -3.040  1.00 0.00 ? 28 PRO B HB2  5  
ATOM 3869  H HB3  . PRO B 2 28 ? -5.053  8.437   -2.909  1.00 0.00 ? 28 PRO B HB3  5  
ATOM 3870  H HG2  . PRO B 2 28 ? -7.864  7.795   -3.164  1.00 0.00 ? 28 PRO B HG2  5  
ATOM 3871  H HG3  . PRO B 2 28 ? -6.485  6.689   -3.131  1.00 0.00 ? 28 PRO B HG3  5  
ATOM 3872  H HD2  . PRO B 2 28 ? -8.422  7.113   -1.066  1.00 0.00 ? 28 PRO B HD2  5  
ATOM 3873  H HD3  . PRO B 2 28 ? -6.992  6.070   -1.009  1.00 0.00 ? 28 PRO B HD3  5  
ATOM 3874  N N    . LYS B 2 29 ? -5.793  11.205  0.091   1.00 0.00 ? 29 LYS B N    5  
ATOM 3875  C CA   . LYS B 2 29 ? -6.295  12.575  0.391   1.00 0.00 ? 29 LYS B CA   5  
ATOM 3876  C C    . LYS B 2 29 ? -5.332  13.611  -0.188  1.00 0.00 ? 29 LYS B C    5  
ATOM 3877  O O    . LYS B 2 29 ? -4.441  14.091  0.485   1.00 0.00 ? 29 LYS B O    5  
ATOM 3878  C CB   . LYS B 2 29 ? -6.396  12.765  1.907   1.00 0.00 ? 29 LYS B CB   5  
ATOM 3879  C CG   . LYS B 2 29 ? -7.812  13.218  2.270   1.00 0.00 ? 29 LYS B CG   5  
ATOM 3880  C CD   . LYS B 2 29 ? -8.044  14.638  1.749   1.00 0.00 ? 29 LYS B CD   5  
ATOM 3881  C CE   . LYS B 2 29 ? -9.118  14.614  0.661   1.00 0.00 ? 29 LYS B CE   5  
ATOM 3882  N NZ   . LYS B 2 29 ? -10.466 14.583  1.292   1.00 0.00 ? 29 LYS B NZ   5  
ATOM 3883  H H    . LYS B 2 29 ? -4.975  10.877  0.520   1.00 0.00 ? 29 LYS B H    5  
ATOM 3884  H HA   . LYS B 2 29 ? -7.271  12.705  -0.053  1.00 0.00 ? 29 LYS B HA   5  
ATOM 3885  H HB2  . LYS B 2 29 ? -6.177  11.830  2.401   1.00 0.00 ? 29 LYS B HB2  5  
ATOM 3886  H HB3  . LYS B 2 29 ? -5.688  13.515  2.223   1.00 0.00 ? 29 LYS B HB3  5  
ATOM 3887  H HG2  . LYS B 2 29 ? -8.531  12.547  1.822   1.00 0.00 ? 29 LYS B HG2  5  
ATOM 3888  H HG3  . LYS B 2 29 ? -7.929  13.208  3.343   1.00 0.00 ? 29 LYS B HG3  5  
ATOM 3889  H HD2  . LYS B 2 29 ? -8.367  15.271  2.563   1.00 0.00 ? 29 LYS B HD2  5  
ATOM 3890  H HD3  . LYS B 2 29 ? -7.124  15.025  1.337   1.00 0.00 ? 29 LYS B HD3  5  
ATOM 3891  H HE2  . LYS B 2 29 ? -9.029  15.501  0.048   1.00 0.00 ? 29 LYS B HE2  5  
ATOM 3892  H HE3  . LYS B 2 29 ? -8.987  13.737  0.044   1.00 0.00 ? 29 LYS B HE3  5  
ATOM 3893  H HZ1  . LYS B 2 29 ? -10.434 15.085  2.203   1.00 0.00 ? 29 LYS B HZ1  5  
ATOM 3894  H HZ2  . LYS B 2 29 ? -11.154 15.044  0.665   1.00 0.00 ? 29 LYS B HZ2  5  
ATOM 3895  H HZ3  . LYS B 2 29 ? -10.752 13.596  1.451   1.00 0.00 ? 29 LYS B HZ3  5  
ATOM 3896  N N    . THR B 2 30 ? -5.503  13.963  -1.434  1.00 0.00 ? 30 THR B N    5  
ATOM 3897  C CA   . THR B 2 30 ? -4.600  14.971  -2.055  1.00 0.00 ? 30 THR B CA   5  
ATOM 3898  C C    . THR B 2 30 ? -5.112  16.378  -1.736  1.00 0.00 ? 30 THR B C    5  
ATOM 3899  O O    . THR B 2 30 ? -6.316  16.569  -1.770  1.00 0.00 ? 30 THR B O    5  
ATOM 3900  C CB   . THR B 2 30 ? -4.576  14.769  -3.572  1.00 0.00 ? 30 THR B CB   5  
ATOM 3901  O OG1  . THR B 2 30 ? -5.801  15.225  -4.128  1.00 0.00 ? 30 THR B OG1  5  
ATOM 3902  C CG2  . THR B 2 30 ? -4.391  13.283  -3.890  1.00 0.00 ? 30 THR B CG2  5  
ATOM 3903  O OXT  . THR B 2 30 ? -4.292  17.239  -1.465  1.00 0.00 ? 30 THR B OXT  5  
ATOM 3904  H H    . THR B 2 30 ? -6.230  13.567  -1.959  1.00 0.00 ? 30 THR B H    5  
ATOM 3905  H HA   . THR B 2 30 ? -3.602  14.853  -1.659  1.00 0.00 ? 30 THR B HA   5  
ATOM 3906  H HB   . THR B 2 30 ? -3.756  15.328  -3.998  1.00 0.00 ? 30 THR B HB   5  
ATOM 3907  H HG1  . THR B 2 30 ? -5.995  14.688  -4.900  1.00 0.00 ? 30 THR B HG1  5  
ATOM 3908  H HG21 . THR B 2 30 ? -3.504  12.918  -3.394  1.00 0.00 ? 30 THR B HG21 5  
ATOM 3909  H HG22 . THR B 2 30 ? -5.251  12.731  -3.543  1.00 0.00 ? 30 THR B HG22 5  
ATOM 3910  H HG23 . THR B 2 30 ? -4.285  13.155  -4.956  1.00 0.00 ? 30 THR B HG23 5  
ATOM 3911  N N    . GLY A 1 1  ? 0.013   4.310   9.834   1.00 0.00 ? 1  GLY A N    6  
ATOM 3912  C CA   . GLY A 1 1  ? -0.516  4.503   8.456   1.00 0.00 ? 1  GLY A CA   6  
ATOM 3913  C C    . GLY A 1 1  ? 0.477   3.936   7.440   1.00 0.00 ? 1  GLY A C    6  
ATOM 3914  O O    . GLY A 1 1  ? 1.634   3.716   7.741   1.00 0.00 ? 1  GLY A O    6  
ATOM 3915  H H1   . GLY A 1 1  ? 0.313   3.320   9.954   1.00 0.00 ? 1  GLY A H1   6  
ATOM 3916  H H2   . GLY A 1 1  ? 0.824   4.941   9.988   1.00 0.00 ? 1  GLY A H2   6  
ATOM 3917  H H3   . GLY A 1 1  ? -0.731  4.532   10.526  1.00 0.00 ? 1  GLY A H3   6  
ATOM 3918  H HA2  . GLY A 1 1  ? -1.463  3.989   8.357   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 3919  H HA3  . GLY A 1 1  ? -0.656  5.555   8.267   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 3920  N N    . ILE A 1 2  ? 0.031   3.697   6.238   1.00 0.00 ? 2  ILE A N    6  
ATOM 3921  C CA   . ILE A 1 2  ? 0.937   3.140   5.195   1.00 0.00 ? 2  ILE A CA   6  
ATOM 3922  C C    . ILE A 1 2  ? 1.604   4.280   4.432   1.00 0.00 ? 2  ILE A C    6  
ATOM 3923  O O    . ILE A 1 2  ? 2.664   4.126   3.863   1.00 0.00 ? 2  ILE A O    6  
ATOM 3924  C CB   . ILE A 1 2  ? 0.117   2.311   4.215   1.00 0.00 ? 2  ILE A CB   6  
ATOM 3925  C CG1  . ILE A 1 2  ? -1.069  3.146   3.725   1.00 0.00 ? 2  ILE A CG1  6  
ATOM 3926  C CG2  . ILE A 1 2  ? -0.400  1.057   4.912   1.00 0.00 ? 2  ILE A CG2  6  
ATOM 3927  C CD1  . ILE A 1 2  ? -1.607  2.561   2.419   1.00 0.00 ? 2  ILE A CD1  6  
ATOM 3928  H H    . ILE A 1 2  ? -0.908  3.880   6.023   1.00 0.00 ? 2  ILE A H    6  
ATOM 3929  H HA   . ILE A 1 2  ? 1.691   2.520   5.659   1.00 0.00 ? 2  ILE A HA   6  
ATOM 3930  H HB   . ILE A 1 2  ? 0.735   2.029   3.377   1.00 0.00 ? 2  ILE A HB   6  
ATOM 3931  H HG12 . ILE A 1 2  ? -1.848  3.139   4.471   1.00 0.00 ? 2  ILE A HG12 6  
ATOM 3932  H HG13 . ILE A 1 2  ? -0.744  4.162   3.553   1.00 0.00 ? 2  ILE A HG13 6  
ATOM 3933  H HG21 . ILE A 1 2  ? -0.886  1.335   5.835   1.00 0.00 ? 2  ILE A HG21 6  
ATOM 3934  H HG22 . ILE A 1 2  ? -1.106  0.557   4.268   1.00 0.00 ? 2  ILE A HG22 6  
ATOM 3935  H HG23 . ILE A 1 2  ? 0.427   0.395   5.125   1.00 0.00 ? 2  ILE A HG23 6  
ATOM 3936  H HD11 . ILE A 1 2  ? -1.419  1.497   2.397   1.00 0.00 ? 2  ILE A HD11 6  
ATOM 3937  H HD12 . ILE A 1 2  ? -2.669  2.741   2.355   1.00 0.00 ? 2  ILE A HD12 6  
ATOM 3938  H HD13 . ILE A 1 2  ? -1.112  3.033   1.586   1.00 0.00 ? 2  ILE A HD13 6  
ATOM 3939  N N    . VAL A 1 3  ? 0.989   5.422   4.401   1.00 0.00 ? 3  VAL A N    6  
ATOM 3940  C CA   . VAL A 1 3  ? 1.592   6.560   3.664   1.00 0.00 ? 3  VAL A CA   6  
ATOM 3941  C C    . VAL A 1 3  ? 2.566   7.289   4.587   1.00 0.00 ? 3  VAL A C    6  
ATOM 3942  O O    . VAL A 1 3  ? 3.590   7.787   4.163   1.00 0.00 ? 3  VAL A O    6  
ATOM 3943  C CB   . VAL A 1 3  ? 0.479   7.502   3.223   1.00 0.00 ? 3  VAL A CB   6  
ATOM 3944  C CG1  . VAL A 1 3  ? 0.976   8.378   2.071   1.00 0.00 ? 3  VAL A CG1  6  
ATOM 3945  C CG2  . VAL A 1 3  ? -0.716  6.663   2.758   1.00 0.00 ? 3  VAL A CG2  6  
ATOM 3946  H H    . VAL A 1 3  ? 0.130   5.532   4.857   1.00 0.00 ? 3  VAL A H    6  
ATOM 3947  H HA   . VAL A 1 3  ? 2.118   6.188   2.796   1.00 0.00 ? 3  VAL A HA   6  
ATOM 3948  H HB   . VAL A 1 3  ? 0.184   8.125   4.055   1.00 0.00 ? 3  VAL A HB   6  
ATOM 3949  H HG11 . VAL A 1 3  ? 1.946   8.029   1.746   1.00 0.00 ? 3  VAL A HG11 6  
ATOM 3950  H HG12 . VAL A 1 3  ? 0.279   8.322   1.249   1.00 0.00 ? 3  VAL A HG12 6  
ATOM 3951  H HG13 . VAL A 1 3  ? 1.057   9.401   2.407   1.00 0.00 ? 3  VAL A HG13 6  
ATOM 3952  H HG21 . VAL A 1 3  ? -0.377  5.667   2.501   1.00 0.00 ? 3  VAL A HG21 6  
ATOM 3953  H HG22 . VAL A 1 3  ? -1.443  6.600   3.554   1.00 0.00 ? 3  VAL A HG22 6  
ATOM 3954  H HG23 . VAL A 1 3  ? -1.166  7.126   1.893   1.00 0.00 ? 3  VAL A HG23 6  
ATOM 3955  N N    . GLU A 1 4  ? 2.259   7.337   5.855   1.00 0.00 ? 4  GLU A N    6  
ATOM 3956  C CA   . GLU A 1 4  ? 3.171   8.013   6.820   1.00 0.00 ? 4  GLU A CA   6  
ATOM 3957  C C    . GLU A 1 4  ? 4.184   6.992   7.347   1.00 0.00 ? 4  GLU A C    6  
ATOM 3958  O O    . GLU A 1 4  ? 4.749   7.156   8.409   1.00 0.00 ? 4  GLU A O    6  
ATOM 3959  C CB   . GLU A 1 4  ? 2.351   8.572   7.987   1.00 0.00 ? 4  GLU A CB   6  
ATOM 3960  C CG   . GLU A 1 4  ? 3.218   9.519   8.820   1.00 0.00 ? 4  GLU A CG   6  
ATOM 3961  C CD   . GLU A 1 4  ? 2.846   10.969  8.499   1.00 0.00 ? 4  GLU A CD   6  
ATOM 3962  O OE1  . GLU A 1 4  ? 1.668   11.281  8.544   1.00 0.00 ? 4  GLU A OE1  6  
ATOM 3963  O OE2  . GLU A 1 4  ? 3.747   11.741  8.215   1.00 0.00 ? 4  GLU A OE2  6  
ATOM 3964  H H    . GLU A 1 4  ? 1.433   6.918   6.172   1.00 0.00 ? 4  GLU A H    6  
ATOM 3965  H HA   . GLU A 1 4  ? 3.692   8.819   6.325   1.00 0.00 ? 4  GLU A HA   6  
ATOM 3966  H HB2  . GLU A 1 4  ? 1.497   9.111   7.602   1.00 0.00 ? 4  GLU A HB2  6  
ATOM 3967  H HB3  . GLU A 1 4  ? 2.012   7.759   8.610   1.00 0.00 ? 4  GLU A HB3  6  
ATOM 3968  H HG2  . GLU A 1 4  ? 3.054   9.330   9.872   1.00 0.00 ? 4  GLU A HG2  6  
ATOM 3969  H HG3  . GLU A 1 4  ? 4.259   9.356   8.585   1.00 0.00 ? 4  GLU A HG3  6  
ATOM 3970  N N    . GLN A 1 5  ? 4.412   5.936   6.611   1.00 0.00 ? 5  GLN A N    6  
ATOM 3971  C CA   . GLN A 1 5  ? 5.383   4.899   7.067   1.00 0.00 ? 5  GLN A CA   6  
ATOM 3972  C C    . GLN A 1 5  ? 5.961   4.168   5.853   1.00 0.00 ? 5  GLN A C    6  
ATOM 3973  O O    . GLN A 1 5  ? 7.159   4.098   5.668   1.00 0.00 ? 5  GLN A O    6  
ATOM 3974  C CB   . GLN A 1 5  ? 4.661   3.895   7.970   1.00 0.00 ? 5  GLN A CB   6  
ATOM 3975  C CG   . GLN A 1 5  ? 5.680   3.190   8.869   1.00 0.00 ? 5  GLN A CG   6  
ATOM 3976  C CD   . GLN A 1 5  ? 5.546   1.676   8.709   1.00 0.00 ? 5  GLN A CD   6  
ATOM 3977  O OE1  . GLN A 1 5  ? 6.531   0.978   8.563   1.00 0.00 ? 5  GLN A OE1  6  
ATOM 3978  N NE2  . GLN A 1 5  ? 4.359   1.131   8.729   1.00 0.00 ? 5  GLN A NE2  6  
ATOM 3979  H H    . GLN A 1 5  ? 3.944   5.823   5.760   1.00 0.00 ? 5  GLN A H    6  
ATOM 3980  H HA   . GLN A 1 5  ? 6.182   5.372   7.619   1.00 0.00 ? 5  GLN A HA   6  
ATOM 3981  H HB2  . GLN A 1 5  ? 3.940   4.417   8.581   1.00 0.00 ? 5  GLN A HB2  6  
ATOM 3982  H HB3  . GLN A 1 5  ? 4.153   3.162   7.359   1.00 0.00 ? 5  GLN A HB3  6  
ATOM 3983  H HG2  . GLN A 1 5  ? 6.679   3.496   8.589   1.00 0.00 ? 5  GLN A HG2  6  
ATOM 3984  H HG3  . GLN A 1 5  ? 5.498   3.459   9.898   1.00 0.00 ? 5  GLN A HG3  6  
ATOM 3985  H HE21 . GLN A 1 5  ? 3.564   1.692   8.847   1.00 0.00 ? 5  GLN A HE21 6  
ATOM 3986  H HE22 . GLN A 1 5  ? 4.264   0.161   8.628   1.00 0.00 ? 5  GLN A HE22 6  
ATOM 3987  N N    . CYS A 1 6  ? 5.116   3.617   5.026   1.00 0.00 ? 6  CYS A N    6  
ATOM 3988  C CA   . CYS A 1 6  ? 5.610   2.886   3.826   1.00 0.00 ? 6  CYS A CA   6  
ATOM 3989  C C    . CYS A 1 6  ? 6.219   3.878   2.832   1.00 0.00 ? 6  CYS A C    6  
ATOM 3990  O O    . CYS A 1 6  ? 7.118   3.549   2.088   1.00 0.00 ? 6  CYS A O    6  
ATOM 3991  C CB   . CYS A 1 6  ? 4.449   2.144   3.165   1.00 0.00 ? 6  CYS A CB   6  
ATOM 3992  S SG   . CYS A 1 6  ? 3.534   1.234   4.432   1.00 0.00 ? 6  CYS A SG   6  
ATOM 3993  H H    . CYS A 1 6  ? 4.155   3.682   5.198   1.00 0.00 ? 6  CYS A H    6  
ATOM 3994  H HA   . CYS A 1 6  ? 6.360   2.173   4.125   1.00 0.00 ? 6  CYS A HA   6  
ATOM 3995  H HB2  . CYS A 1 6  ? 3.796   2.852   2.680   1.00 0.00 ? 6  CYS A HB2  6  
ATOM 3996  H HB3  . CYS A 1 6  ? 4.835   1.452   2.431   1.00 0.00 ? 6  CYS A HB3  6  
ATOM 3997  N N    . CYS A 1 7  ? 5.746   5.091   2.820   1.00 0.00 ? 7  CYS A N    6  
ATOM 3998  C CA   . CYS A 1 7  ? 6.315   6.097   1.881   1.00 0.00 ? 7  CYS A CA   6  
ATOM 3999  C C    . CYS A 1 7  ? 7.546   6.738   2.523   1.00 0.00 ? 7  CYS A C    6  
ATOM 4000  O O    . CYS A 1 7  ? 8.413   7.256   1.850   1.00 0.00 ? 7  CYS A O    6  
ATOM 4001  C CB   . CYS A 1 7  ? 5.269   7.175   1.586   1.00 0.00 ? 7  CYS A CB   6  
ATOM 4002  S SG   . CYS A 1 7  ? 6.044   8.525   0.665   1.00 0.00 ? 7  CYS A SG   6  
ATOM 4003  H H    . CYS A 1 7  ? 5.025   5.345   3.433   1.00 0.00 ? 7  CYS A H    6  
ATOM 4004  H HA   . CYS A 1 7  ? 6.604   5.609   0.960   1.00 0.00 ? 7  CYS A HA   6  
ATOM 4005  H HB2  . CYS A 1 7  ? 4.468   6.751   1.001   1.00 0.00 ? 7  CYS A HB2  6  
ATOM 4006  H HB3  . CYS A 1 7  ? 4.872   7.552   2.516   1.00 0.00 ? 7  CYS A HB3  6  
ATOM 4007  N N    . THR A 1 8  ? 7.630   6.698   3.824   1.00 0.00 ? 8  THR A N    6  
ATOM 4008  C CA   . THR A 1 8  ? 8.804   7.293   4.519   1.00 0.00 ? 8  THR A CA   6  
ATOM 4009  C C    . THR A 1 8  ? 9.930   6.258   4.565   1.00 0.00 ? 8  THR A C    6  
ATOM 4010  O O    . THR A 1 8  ? 11.081  6.584   4.777   1.00 0.00 ? 8  THR A O    6  
ATOM 4011  C CB   . THR A 1 8  ? 8.405   7.687   5.942   1.00 0.00 ? 8  THR A CB   6  
ATOM 4012  O OG1  . THR A 1 8  ? 8.229   6.516   6.726   1.00 0.00 ? 8  THR A OG1  6  
ATOM 4013  C CG2  . THR A 1 8  ? 7.098   8.479   5.903   1.00 0.00 ? 8  THR A CG2  6  
ATOM 4014  H H    . THR A 1 8  ? 6.919   6.269   4.347   1.00 0.00 ? 8  THR A H    6  
ATOM 4015  H HA   . THR A 1 8  ? 9.138   8.168   3.979   1.00 0.00 ? 8  THR A HA   6  
ATOM 4016  H HB   . THR A 1 8  ? 9.179   8.300   6.378   1.00 0.00 ? 8  THR A HB   6  
ATOM 4017  H HG1  . THR A 1 8  ? 7.720   6.754   7.505   1.00 0.00 ? 8  THR A HG1  6  
ATOM 4018  H HG21 . THR A 1 8  ? 6.959   8.896   4.917   1.00 0.00 ? 8  THR A HG21 6  
ATOM 4019  H HG22 . THR A 1 8  ? 6.273   7.824   6.139   1.00 0.00 ? 8  THR A HG22 6  
ATOM 4020  H HG23 . THR A 1 8  ? 7.141   9.280   6.629   1.00 0.00 ? 8  THR A HG23 6  
ATOM 4021  N N    . SER A 1 9  ? 9.601   5.014   4.362   1.00 0.00 ? 9  SER A N    6  
ATOM 4022  C CA   . SER A 1 9  ? 10.635  3.942   4.383   1.00 0.00 ? 9  SER A CA   6  
ATOM 4023  C C    . SER A 1 9  ? 10.097  2.722   3.635   1.00 0.00 ? 9  SER A C    6  
ATOM 4024  O O    . SER A 1 9  ? 9.178   2.827   2.851   1.00 0.00 ? 9  SER A O    6  
ATOM 4025  C CB   . SER A 1 9  ? 10.951  3.563   5.830   1.00 0.00 ? 9  SER A CB   6  
ATOM 4026  O OG   . SER A 1 9  ? 10.168  2.435   6.202   1.00 0.00 ? 9  SER A OG   6  
ATOM 4027  H H    . SER A 1 9  ? 8.663   4.781   4.188   1.00 0.00 ? 9  SER A H    6  
ATOM 4028  H HA   . SER A 1 9  ? 11.533  4.297   3.897   1.00 0.00 ? 9  SER A HA   6  
ATOM 4029  H HB2  . SER A 1 9  ? 11.994  3.314   5.920   1.00 0.00 ? 9  SER A HB2  6  
ATOM 4030  H HB3  . SER A 1 9  ? 10.725  4.400   6.478   1.00 0.00 ? 9  SER A HB3  6  
ATOM 4031  H HG   . SER A 1 9  ? 9.509   2.728   6.835   1.00 0.00 ? 9  SER A HG   6  
ATOM 4032  N N    . ILE A 1 10 ? 10.651  1.563   3.867   1.00 0.00 ? 10 ILE A N    6  
ATOM 4033  C CA   . ILE A 1 10 ? 10.145  0.354   3.159   1.00 0.00 ? 10 ILE A CA   6  
ATOM 4034  C C    . ILE A 1 10 ? 9.007   -0.258  3.981   1.00 0.00 ? 10 ILE A C    6  
ATOM 4035  O O    . ILE A 1 10 ? 8.952   -0.119  5.188   1.00 0.00 ? 10 ILE A O    6  
ATOM 4036  C CB   . ILE A 1 10 ? 11.302  -0.646  2.963   1.00 0.00 ? 10 ILE A CB   6  
ATOM 4037  C CG1  . ILE A 1 10 ? 11.892  -0.446  1.568   1.00 0.00 ? 10 ILE A CG1  6  
ATOM 4038  C CG2  . ILE A 1 10 ? 10.807  -2.091  3.089   1.00 0.00 ? 10 ILE A CG2  6  
ATOM 4039  C CD1  . ILE A 1 10 ? 13.389  -0.746  1.596   1.00 0.00 ? 10 ILE A CD1  6  
ATOM 4040  H H    . ILE A 1 10 ? 11.392  1.491   4.505   1.00 0.00 ? 10 ILE A H    6  
ATOM 4041  H HA   . ILE A 1 10 ? 9.761   0.648   2.191   1.00 0.00 ? 10 ILE A HA   6  
ATOM 4042  H HB   . ILE A 1 10 ? 12.064  -0.461  3.705   1.00 0.00 ? 10 ILE A HB   6  
ATOM 4043  H HG12 . ILE A 1 10 ? 11.406  -1.117  0.873   1.00 0.00 ? 10 ILE A HG12 6  
ATOM 4044  H HG13 . ILE A 1 10 ? 11.737  0.572   1.251   1.00 0.00 ? 10 ILE A HG13 6  
ATOM 4045  H HG21 . ILE A 1 10 ? 9.872   -2.199  2.560   1.00 0.00 ? 10 ILE A HG21 6  
ATOM 4046  H HG22 . ILE A 1 10 ? 11.542  -2.760  2.662   1.00 0.00 ? 10 ILE A HG22 6  
ATOM 4047  H HG23 . ILE A 1 10 ? 10.663  -2.334  4.132   1.00 0.00 ? 10 ILE A HG23 6  
ATOM 4048  H HD11 . ILE A 1 10 ? 13.563  -1.647  2.167   1.00 0.00 ? 10 ILE A HD11 6  
ATOM 4049  H HD12 . ILE A 1 10 ? 13.747  -0.884  0.587   1.00 0.00 ? 10 ILE A HD12 6  
ATOM 4050  H HD13 . ILE A 1 10 ? 13.913  0.081   2.055   1.00 0.00 ? 10 ILE A HD13 6  
ATOM 4051  N N    . CYS A 1 11 ? 8.087   -0.916  3.333   1.00 0.00 ? 11 CYS A N    6  
ATOM 4052  C CA   . CYS A 1 11 ? 6.940   -1.517  4.070   1.00 0.00 ? 11 CYS A CA   6  
ATOM 4053  C C    . CYS A 1 11 ? 6.796   -2.993  3.686   1.00 0.00 ? 11 CYS A C    6  
ATOM 4054  O O    . CYS A 1 11 ? 7.245   -3.419  2.641   1.00 0.00 ? 11 CYS A O    6  
ATOM 4055  C CB   . CYS A 1 11 ? 5.664   -0.764  3.689   1.00 0.00 ? 11 CYS A CB   6  
ATOM 4056  S SG   . CYS A 1 11 ? 4.901   -0.057  5.171   1.00 0.00 ? 11 CYS A SG   6  
ATOM 4057  H H    . CYS A 1 11 ? 8.143   -1.005  2.360   1.00 0.00 ? 11 CYS A H    6  
ATOM 4058  H HA   . CYS A 1 11 ? 7.108   -1.434  5.134   1.00 0.00 ? 11 CYS A HA   6  
ATOM 4059  H HB2  . CYS A 1 11 ? 5.913   0.031   3.003   1.00 0.00 ? 11 CYS A HB2  6  
ATOM 4060  H HB3  . CYS A 1 11 ? 4.973   -1.444  3.214   1.00 0.00 ? 11 CYS A HB3  6  
ATOM 4061  N N    . SER A 1 12 ? 6.161   -3.777  4.519   1.00 0.00 ? 12 SER A N    6  
ATOM 4062  C CA   . SER A 1 12 ? 5.981   -5.219  4.197   1.00 0.00 ? 12 SER A CA   6  
ATOM 4063  C C    . SER A 1 12 ? 4.627   -5.416  3.517   1.00 0.00 ? 12 SER A C    6  
ATOM 4064  O O    . SER A 1 12 ? 3.848   -4.495  3.379   1.00 0.00 ? 12 SER A O    6  
ATOM 4065  C CB   . SER A 1 12 ? 6.019   -6.037  5.488   1.00 0.00 ? 12 SER A CB   6  
ATOM 4066  O OG   . SER A 1 12 ? 5.777   -5.178  6.594   1.00 0.00 ? 12 SER A OG   6  
ATOM 4067  H H    . SER A 1 12 ? 5.799   -3.417  5.357   1.00 0.00 ? 12 SER A H    6  
ATOM 4068  H HA   . SER A 1 12 ? 6.771   -5.546  3.536   1.00 0.00 ? 12 SER A HA   6  
ATOM 4069  H HB2  . SER A 1 12 ? 5.255   -6.800  5.459   1.00 0.00 ? 12 SER A HB2  6  
ATOM 4070  H HB3  . SER A 1 12 ? 6.988   -6.506  5.588   1.00 0.00 ? 12 SER A HB3  6  
ATOM 4071  H HG   . SER A 1 12 ? 5.121   -5.595  7.156   1.00 0.00 ? 12 SER A HG   6  
ATOM 4072  N N    . LEU A 1 13 ? 4.331   -6.611  3.102   1.00 0.00 ? 13 LEU A N    6  
ATOM 4073  C CA   . LEU A 1 13 ? 3.019   -6.864  2.448   1.00 0.00 ? 13 LEU A CA   6  
ATOM 4074  C C    . LEU A 1 13 ? 1.998   -7.227  3.528   1.00 0.00 ? 13 LEU A C    6  
ATOM 4075  O O    . LEU A 1 13 ? 0.951   -7.775  3.253   1.00 0.00 ? 13 LEU A O    6  
ATOM 4076  C CB   . LEU A 1 13 ? 3.165   -8.024  1.459   1.00 0.00 ? 13 LEU A CB   6  
ATOM 4077  C CG   . LEU A 1 13 ? 1.830   -8.288  0.758   1.00 0.00 ? 13 LEU A CG   6  
ATOM 4078  C CD1  . LEU A 1 13 ? 1.218   -6.963  0.304   1.00 0.00 ? 13 LEU A CD1  6  
ATOM 4079  C CD2  . LEU A 1 13 ? 2.065   -9.183  -0.461  1.00 0.00 ? 13 LEU A CD2  6  
ATOM 4080  H H    . LEU A 1 13 ? 4.965   -7.348  3.228   1.00 0.00 ? 13 LEU A H    6  
ATOM 4081  H HA   . LEU A 1 13 ? 2.695   -5.976  1.925   1.00 0.00 ? 13 LEU A HA   6  
ATOM 4082  H HB2  . LEU A 1 13 ? 3.914   -7.774  0.721   1.00 0.00 ? 13 LEU A HB2  6  
ATOM 4083  H HB3  . LEU A 1 13 ? 3.469   -8.912  1.992   1.00 0.00 ? 13 LEU A HB3  6  
ATOM 4084  H HG   . LEU A 1 13 ? 1.155   -8.781  1.441   1.00 0.00 ? 13 LEU A HG   6  
ATOM 4085  H HD11 . LEU A 1 13 ? 1.979   -6.353  -0.159  1.00 0.00 ? 13 LEU A HD11 6  
ATOM 4086  H HD12 . LEU A 1 13 ? 0.429   -7.157  -0.411  1.00 0.00 ? 13 LEU A HD12 6  
ATOM 4087  H HD13 . LEU A 1 13 ? 0.810   -6.445  1.158   1.00 0.00 ? 13 LEU A HD13 6  
ATOM 4088  H HD21 . LEU A 1 13 ? 2.895   -8.798  -1.037  1.00 0.00 ? 13 LEU A HD21 6  
ATOM 4089  H HD22 . LEU A 1 13 ? 2.292   -10.187 -0.133  1.00 0.00 ? 13 LEU A HD22 6  
ATOM 4090  H HD23 . LEU A 1 13 ? 1.177   -9.196  -1.075  1.00 0.00 ? 13 LEU A HD23 6  
ATOM 4091  N N    . TYR A 1 14 ? 2.311   -6.940  4.764   1.00 0.00 ? 14 TYR A N    6  
ATOM 4092  C CA   . TYR A 1 14 ? 1.378   -7.286  5.869   1.00 0.00 ? 14 TYR A CA   6  
ATOM 4093  C C    . TYR A 1 14 ? 0.581   -6.065  6.339   1.00 0.00 ? 14 TYR A C    6  
ATOM 4094  O O    . TYR A 1 14 ? -0.500  -6.203  6.874   1.00 0.00 ? 14 TYR A O    6  
ATOM 4095  C CB   . TYR A 1 14 ? 2.177   -7.843  7.040   1.00 0.00 ? 14 TYR A CB   6  
ATOM 4096  C CG   . TYR A 1 14 ? 1.245   -8.602  7.941   1.00 0.00 ? 14 TYR A CG   6  
ATOM 4097  C CD1  . TYR A 1 14 ? 0.329   -7.906  8.734   1.00 0.00 ? 14 TYR A CD1  6  
ATOM 4098  C CD2  . TYR A 1 14 ? 1.292   -9.995  7.977   1.00 0.00 ? 14 TYR A CD2  6  
ATOM 4099  C CE1  . TYR A 1 14 ? -0.545  -8.608  9.569   1.00 0.00 ? 14 TYR A CE1  6  
ATOM 4100  C CE2  . TYR A 1 14 ? 0.421   -10.702 8.813   1.00 0.00 ? 14 TYR A CE2  6  
ATOM 4101  C CZ   . TYR A 1 14 ? -0.498  -10.008 9.610   1.00 0.00 ? 14 TYR A CZ   6  
ATOM 4102  O OH   . TYR A 1 14 ? -1.359  -10.701 10.433  1.00 0.00 ? 14 TYR A OH   6  
ATOM 4103  H H    . TYR A 1 14 ? 3.167   -6.510  4.964   1.00 0.00 ? 14 TYR A H    6  
ATOM 4104  H HA   . TYR A 1 14 ? 0.685   -8.040  5.530   1.00 0.00 ? 14 TYR A HA   6  
ATOM 4105  H HB2  . TYR A 1 14 ? 2.945   -8.507  6.671   1.00 0.00 ? 14 TYR A HB2  6  
ATOM 4106  H HB3  . TYR A 1 14 ? 2.631   -7.033  7.589   1.00 0.00 ? 14 TYR A HB3  6  
ATOM 4107  H HD1  . TYR A 1 14 ? 0.297   -6.829  8.698   1.00 0.00 ? 14 TYR A HD1  6  
ATOM 4108  H HD2  . TYR A 1 14 ? 2.001   -10.523 7.357   1.00 0.00 ? 14 TYR A HD2  6  
ATOM 4109  H HE1  . TYR A 1 14 ? -1.253  -8.069  10.180  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 4110  H HE2  . TYR A 1 14 ? 0.458   -11.780 8.845   1.00 0.00 ? 14 TYR A HE2  6  
ATOM 4111  H HH   . TYR A 1 14 ? -1.089  -11.623 10.435  1.00 0.00 ? 14 TYR A HH   6  
ATOM 4112  N N    . GLN A 1 15 ? 1.083   -4.876  6.159   1.00 0.00 ? 15 GLN A N    6  
ATOM 4113  C CA   . GLN A 1 15 ? 0.291   -3.698  6.631   1.00 0.00 ? 15 GLN A CA   6  
ATOM 4114  C C    . GLN A 1 15 ? -0.785  -3.385  5.596   1.00 0.00 ? 15 GLN A C    6  
ATOM 4115  O O    . GLN A 1 15 ? -1.867  -2.940  5.929   1.00 0.00 ? 15 GLN A O    6  
ATOM 4116  C CB   . GLN A 1 15 ? 1.166   -2.453  6.867   1.00 0.00 ? 15 GLN A CB   6  
ATOM 4117  C CG   . GLN A 1 15 ? 2.635   -2.745  6.570   1.00 0.00 ? 15 GLN A CG   6  
ATOM 4118  C CD   . GLN A 1 15 ? 2.935   -2.511  5.084   1.00 0.00 ? 15 GLN A CD   6  
ATOM 4119  O OE1  . GLN A 1 15 ? 4.067   -2.600  4.674   1.00 0.00 ? 15 GLN A OE1  6  
ATOM 4120  N NE2  . GLN A 1 15 ? 1.975   -2.210  4.252   1.00 0.00 ? 15 GLN A NE2  6  
ATOM 4121  H H    . GLN A 1 15 ? 1.950   -4.763  5.721   1.00 0.00 ? 15 GLN A H    6  
ATOM 4122  H HA   . GLN A 1 15 ? -0.189  -3.968  7.560   1.00 0.00 ? 15 GLN A HA   6  
ATOM 4123  H HB2  . GLN A 1 15 ? 0.824   -1.647  6.236   1.00 0.00 ? 15 GLN A HB2  6  
ATOM 4124  H HB3  . GLN A 1 15 ? 1.070   -2.150  7.899   1.00 0.00 ? 15 GLN A HB3  6  
ATOM 4125  H HG2  . GLN A 1 15 ? 3.253   -2.089  7.164   1.00 0.00 ? 15 GLN A HG2  6  
ATOM 4126  H HG3  . GLN A 1 15 ? 2.857   -3.767  6.829   1.00 0.00 ? 15 GLN A HG3  6  
ATOM 4127  H HE21 . GLN A 1 15 ? 1.055   -2.133  4.563   1.00 0.00 ? 15 GLN A HE21 6  
ATOM 4128  H HE22 . GLN A 1 15 ? 2.184   -2.054  3.307   1.00 0.00 ? 15 GLN A HE22 6  
ATOM 4129  N N    . LEU A 1 16 ? -0.508  -3.621  4.345   1.00 0.00 ? 16 LEU A N    6  
ATOM 4130  C CA   . LEU A 1 16 ? -1.535  -3.342  3.302   1.00 0.00 ? 16 LEU A CA   6  
ATOM 4131  C C    . LEU A 1 16 ? -2.687  -4.333  3.465   1.00 0.00 ? 16 LEU A C    6  
ATOM 4132  O O    . LEU A 1 16 ? -3.746  -4.166  2.895   1.00 0.00 ? 16 LEU A O    6  
ATOM 4133  C CB   . LEU A 1 16 ? -0.929  -3.491  1.904   1.00 0.00 ? 16 LEU A CB   6  
ATOM 4134  C CG   . LEU A 1 16 ? 0.181   -2.457  1.681   1.00 0.00 ? 16 LEU A CG   6  
ATOM 4135  C CD1  . LEU A 1 16 ? 0.296   -2.165  0.185   1.00 0.00 ? 16 LEU A CD1  6  
ATOM 4136  C CD2  . LEU A 1 16 ? -0.139  -1.152  2.421   1.00 0.00 ? 16 LEU A CD2  6  
ATOM 4137  H H    . LEU A 1 16 ? 0.371   -3.986  4.092   1.00 0.00 ? 16 LEU A H    6  
ATOM 4138  H HA   . LEU A 1 16 ? -1.908  -2.336  3.430   1.00 0.00 ? 16 LEU A HA   6  
ATOM 4139  H HB2  . LEU A 1 16 ? -0.521  -4.485  1.798   1.00 0.00 ? 16 LEU A HB2  6  
ATOM 4140  H HB3  . LEU A 1 16 ? -1.706  -3.345  1.167   1.00 0.00 ? 16 LEU A HB3  6  
ATOM 4141  H HG   . LEU A 1 16 ? 1.119   -2.858  2.038   1.00 0.00 ? 16 LEU A HG   6  
ATOM 4142  H HD11 . LEU A 1 16 ? -0.020  -3.031  -0.376  1.00 0.00 ? 16 LEU A HD11 6  
ATOM 4143  H HD12 . LEU A 1 16 ? -0.335  -1.324  -0.066  1.00 0.00 ? 16 LEU A HD12 6  
ATOM 4144  H HD13 . LEU A 1 16 ? 1.322   -1.932  -0.060  1.00 0.00 ? 16 LEU A HD13 6  
ATOM 4145  H HD21 . LEU A 1 16 ? -0.275  -1.359  3.473   1.00 0.00 ? 16 LEU A HD21 6  
ATOM 4146  H HD22 . LEU A 1 16 ? 0.676   -0.455  2.293   1.00 0.00 ? 16 LEU A HD22 6  
ATOM 4147  H HD23 . LEU A 1 16 ? -1.043  -0.723  2.019   1.00 0.00 ? 16 LEU A HD23 6  
ATOM 4148  N N    . GLU A 1 17 ? -2.492  -5.360  4.246   1.00 0.00 ? 17 GLU A N    6  
ATOM 4149  C CA   . GLU A 1 17 ? -3.585  -6.346  4.451   1.00 0.00 ? 17 GLU A CA   6  
ATOM 4150  C C    . GLU A 1 17 ? -4.745  -5.632  5.139   1.00 0.00 ? 17 GLU A C    6  
ATOM 4151  O O    . GLU A 1 17 ? -5.896  -5.988  4.987   1.00 0.00 ? 17 GLU A O    6  
ATOM 4152  C CB   . GLU A 1 17 ? -3.095  -7.492  5.343   1.00 0.00 ? 17 GLU A CB   6  
ATOM 4153  C CG   . GLU A 1 17 ? -1.722  -7.971  4.865   1.00 0.00 ? 17 GLU A CG   6  
ATOM 4154  C CD   . GLU A 1 17 ? -1.321  -9.220  5.652   1.00 0.00 ? 17 GLU A CD   6  
ATOM 4155  O OE1  . GLU A 1 17 ? -1.128  -9.104  6.852   1.00 0.00 ? 17 GLU A OE1  6  
ATOM 4156  O OE2  . GLU A 1 17 ? -1.213  -10.270 5.042   1.00 0.00 ? 17 GLU A OE2  6  
ATOM 4157  H H    . GLU A 1 17 ? -1.633  -5.476  4.706   1.00 0.00 ? 17 GLU A H    6  
ATOM 4158  H HA   . GLU A 1 17 ? -3.908  -6.737  3.499   1.00 0.00 ? 17 GLU A HA   6  
ATOM 4159  H HB2  . GLU A 1 17 ? -3.019  -7.143  6.362   1.00 0.00 ? 17 GLU A HB2  6  
ATOM 4160  H HB3  . GLU A 1 17 ? -3.797  -8.311  5.292   1.00 0.00 ? 17 GLU A HB3  6  
ATOM 4161  H HG2  . GLU A 1 17 ? -1.766  -8.205  3.816   1.00 0.00 ? 17 GLU A HG2  6  
ATOM 4162  H HG3  . GLU A 1 17 ? -0.991  -7.195  5.031   1.00 0.00 ? 17 GLU A HG3  6  
ATOM 4163  N N    . ASN A 1 18 ? -4.434  -4.616  5.895   1.00 0.00 ? 18 ASN A N    6  
ATOM 4164  C CA   . ASN A 1 18 ? -5.498  -3.852  6.608   1.00 0.00 ? 18 ASN A CA   6  
ATOM 4165  C C    . ASN A 1 18 ? -6.345  -3.082  5.590   1.00 0.00 ? 18 ASN A C    6  
ATOM 4166  O O    . ASN A 1 18 ? -7.483  -2.741  5.847   1.00 0.00 ? 18 ASN A O    6  
ATOM 4167  C CB   . ASN A 1 18 ? -4.843  -2.858  7.570   1.00 0.00 ? 18 ASN A CB   6  
ATOM 4168  C CG   . ASN A 1 18 ? -3.956  -3.613  8.563   1.00 0.00 ? 18 ASN A CG   6  
ATOM 4169  O OD1  . ASN A 1 18 ? -2.745  -3.545  8.486   1.00 0.00 ? 18 ASN A OD1  6  
ATOM 4170  N ND2  . ASN A 1 18 ? -4.510  -4.334  9.498   1.00 0.00 ? 18 ASN A ND2  6  
ATOM 4171  H H    . ASN A 1 18 ? -3.493  -4.357  5.995   1.00 0.00 ? 18 ASN A H    6  
ATOM 4172  H HA   . ASN A 1 18 ? -6.125  -4.533  7.161   1.00 0.00 ? 18 ASN A HA   6  
ATOM 4173  H HB2  . ASN A 1 18 ? -4.241  -2.157  7.010   1.00 0.00 ? 18 ASN A HB2  6  
ATOM 4174  H HB3  . ASN A 1 18 ? -5.610  -2.322  8.112   1.00 0.00 ? 18 ASN A HB3  6  
ATOM 4175  H HD21 . ASN A 1 18 ? -5.488  -4.387  9.563   1.00 0.00 ? 18 ASN A HD21 6  
ATOM 4176  H HD22 . ASN A 1 18 ? -3.951  -4.823  10.137  1.00 0.00 ? 18 ASN A HD22 6  
ATOM 4177  N N    . TYR A 1 19 ? -5.796  -2.794  4.441   1.00 0.00 ? 19 TYR A N    6  
ATOM 4178  C CA   . TYR A 1 19 ? -6.563  -2.033  3.413   1.00 0.00 ? 19 TYR A CA   6  
ATOM 4179  C C    . TYR A 1 19 ? -7.517  -2.964  2.662   1.00 0.00 ? 19 TYR A C    6  
ATOM 4180  O O    . TYR A 1 19 ? -8.211  -2.548  1.758   1.00 0.00 ? 19 TYR A O    6  
ATOM 4181  C CB   . TYR A 1 19 ? -5.587  -1.402  2.418   1.00 0.00 ? 19 TYR A CB   6  
ATOM 4182  C CG   . TYR A 1 19 ? -5.169  -0.044  2.924   1.00 0.00 ? 19 TYR A CG   6  
ATOM 4183  C CD1  . TYR A 1 19 ? -5.984  1.066   2.683   1.00 0.00 ? 19 TYR A CD1  6  
ATOM 4184  C CD2  . TYR A 1 19 ? -3.973  0.102   3.634   1.00 0.00 ? 19 TYR A CD2  6  
ATOM 4185  C CE1  . TYR A 1 19 ? -5.606  2.328   3.156   1.00 0.00 ? 19 TYR A CE1  6  
ATOM 4186  C CE2  . TYR A 1 19 ? -3.592  1.364   4.107   1.00 0.00 ? 19 TYR A CE2  6  
ATOM 4187  C CZ   . TYR A 1 19 ? -4.411  2.477   3.868   1.00 0.00 ? 19 TYR A CZ   6  
ATOM 4188  O OH   . TYR A 1 19 ? -4.035  3.720   4.334   1.00 0.00 ? 19 TYR A OH   6  
ATOM 4189  H H    . TYR A 1 19 ? -4.875  -3.068  4.260   1.00 0.00 ? 19 TYR A H    6  
ATOM 4190  H HA   . TYR A 1 19 ? -7.132  -1.253  3.897   1.00 0.00 ? 19 TYR A HA   6  
ATOM 4191  H HB2  . TYR A 1 19 ? -4.718  -2.032  2.313   1.00 0.00 ? 19 TYR A HB2  6  
ATOM 4192  H HB3  . TYR A 1 19 ? -6.072  -1.291  1.460   1.00 0.00 ? 19 TYR A HB3  6  
ATOM 4193  H HD1  . TYR A 1 19 ? -6.906  0.947   2.133   1.00 0.00 ? 19 TYR A HD1  6  
ATOM 4194  H HD2  . TYR A 1 19 ? -3.342  -0.756  3.815   1.00 0.00 ? 19 TYR A HD2  6  
ATOM 4195  H HE1  . TYR A 1 19 ? -6.235  3.186   2.969   1.00 0.00 ? 19 TYR A HE1  6  
ATOM 4196  H HE2  . TYR A 1 19 ? -2.670  1.481   4.656   1.00 0.00 ? 19 TYR A HE2  6  
ATOM 4197  H HH   . TYR A 1 19 ? -3.659  3.607   5.211   1.00 0.00 ? 19 TYR A HH   6  
ATOM 4198  N N    . CYS A 1 20 ? -7.561  -4.218  3.018   1.00 0.00 ? 20 CYS A N    6  
ATOM 4199  C CA   . CYS A 1 20 ? -8.478  -5.152  2.303   1.00 0.00 ? 20 CYS A CA   6  
ATOM 4200  C C    . CYS A 1 20 ? -9.822  -5.211  3.031   1.00 0.00 ? 20 CYS A C    6  
ATOM 4201  O O    . CYS A 1 20 ? -9.884  -5.274  4.241   1.00 0.00 ? 20 CYS A O    6  
ATOM 4202  C CB   . CYS A 1 20 ? -7.864  -6.553  2.256   1.00 0.00 ? 20 CYS A CB   6  
ATOM 4203  S SG   . CYS A 1 20 ? -6.447  -6.570  1.125   1.00 0.00 ? 20 CYS A SG   6  
ATOM 4204  H H    . CYS A 1 20 ? -6.995  -4.546  3.749   1.00 0.00 ? 20 CYS A H    6  
ATOM 4205  H HA   . CYS A 1 20 ? -8.637  -4.792  1.297   1.00 0.00 ? 20 CYS A HA   6  
ATOM 4206  H HB2  . CYS A 1 20 ? -7.535  -6.834  3.245   1.00 0.00 ? 20 CYS A HB2  6  
ATOM 4207  H HB3  . CYS A 1 20 ? -8.607  -7.258  1.910   1.00 0.00 ? 20 CYS A HB3  6  
ATOM 4208  N N    . ASN A 1 21 ? -10.901 -5.194  2.295   1.00 0.00 ? 21 ASN A N    6  
ATOM 4209  C CA   . ASN A 1 21 ? -12.243 -5.252  2.935   1.00 0.00 ? 21 ASN A CA   6  
ATOM 4210  C C    . ASN A 1 21 ? -12.682 -6.711  3.068   1.00 0.00 ? 21 ASN A C    6  
ATOM 4211  O O    . ASN A 1 21 ? -12.909 -7.142  4.187   1.00 0.00 ? 21 ASN A O    6  
ATOM 4212  C CB   . ASN A 1 21 ? -13.250 -4.492  2.070   1.00 0.00 ? 21 ASN A CB   6  
ATOM 4213  C CG   . ASN A 1 21 ? -14.266 -3.785  2.970   1.00 0.00 ? 21 ASN A CG   6  
ATOM 4214  O OD1  . ASN A 1 21 ? -14.154 -3.827  4.179   1.00 0.00 ? 21 ASN A OD1  6  
ATOM 4215  N ND2  . ASN A 1 21 ? -15.257 -3.133  2.428   1.00 0.00 ? 21 ASN A ND2  6  
ATOM 4216  O OXT  . ASN A 1 21 ? -12.784 -7.373  2.047   1.00 0.00 ? 21 ASN A OXT  6  
ATOM 4217  H H    . ASN A 1 21 ? -10.826 -5.144  1.320   1.00 0.00 ? 21 ASN A H    6  
ATOM 4218  H HA   . ASN A 1 21 ? -12.196 -4.799  3.914   1.00 0.00 ? 21 ASN A HA   6  
ATOM 4219  H HB2  . ASN A 1 21 ? -12.728 -3.759  1.470   1.00 0.00 ? 21 ASN A HB2  6  
ATOM 4220  H HB3  . ASN A 1 21 ? -13.766 -5.185  1.424   1.00 0.00 ? 21 ASN A HB3  6  
ATOM 4221  H HD21 . ASN A 1 21 ? -15.345 -3.100  1.453   1.00 0.00 ? 21 ASN A HD21 6  
ATOM 4222  H HD22 . ASN A 1 21 ? -15.914 -2.679  2.997   1.00 0.00 ? 21 ASN A HD22 6  
ATOM 4223  N N    . PHE B 2 1  ? 5.470   -7.825  -4.572  1.00 0.00 ? 1  PHE B N    6  
ATOM 4224  C CA   . PHE B 2 1  ? 6.047   -8.202  -3.248  1.00 0.00 ? 1  PHE B CA   6  
ATOM 4225  C C    . PHE B 2 1  ? 7.527   -7.819  -3.211  1.00 0.00 ? 1  PHE B C    6  
ATOM 4226  O O    . PHE B 2 1  ? 8.389   -8.650  -3.006  1.00 0.00 ? 1  PHE B O    6  
ATOM 4227  C CB   . PHE B 2 1  ? 5.907   -9.712  -3.024  1.00 0.00 ? 1  PHE B CB   6  
ATOM 4228  C CG   . PHE B 2 1  ? 5.771   -10.431 -4.348  1.00 0.00 ? 1  PHE B CG   6  
ATOM 4229  C CD1  . PHE B 2 1  ? 6.840   -10.445 -5.252  1.00 0.00 ? 1  PHE B CD1  6  
ATOM 4230  C CD2  . PHE B 2 1  ? 4.573   -11.083 -4.669  1.00 0.00 ? 1  PHE B CD2  6  
ATOM 4231  C CE1  . PHE B 2 1  ? 6.712   -11.112 -6.476  1.00 0.00 ? 1  PHE B CE1  6  
ATOM 4232  C CE2  . PHE B 2 1  ? 4.447   -11.750 -5.893  1.00 0.00 ? 1  PHE B CE2  6  
ATOM 4233  C CZ   . PHE B 2 1  ? 5.516   -11.765 -6.798  1.00 0.00 ? 1  PHE B CZ   6  
ATOM 4234  H H1   . PHE B 2 1  ? 6.146   -8.058  -5.325  1.00 0.00 ? 1  PHE B H1   6  
ATOM 4235  H H2   . PHE B 2 1  ? 4.587   -8.352  -4.728  1.00 0.00 ? 1  PHE B H2   6  
ATOM 4236  H H3   . PHE B 2 1  ? 5.273   -6.804  -4.585  1.00 0.00 ? 1  PHE B H3   6  
ATOM 4237  H HA   . PHE B 2 1  ? 5.521   -7.673  -2.468  1.00 0.00 ? 1  PHE B HA   6  
ATOM 4238  H HB2  . PHE B 2 1  ? 6.781   -10.079 -2.507  1.00 0.00 ? 1  PHE B HB2  6  
ATOM 4239  H HB3  . PHE B 2 1  ? 5.031   -9.904  -2.421  1.00 0.00 ? 1  PHE B HB3  6  
ATOM 4240  H HD1  . PHE B 2 1  ? 7.762   -9.942  -5.005  1.00 0.00 ? 1  PHE B HD1  6  
ATOM 4241  H HD2  . PHE B 2 1  ? 3.750   -11.071 -3.971  1.00 0.00 ? 1  PHE B HD2  6  
ATOM 4242  H HE1  . PHE B 2 1  ? 7.538   -11.123 -7.174  1.00 0.00 ? 1  PHE B HE1  6  
ATOM 4243  H HE2  . PHE B 2 1  ? 3.523   -12.253 -6.141  1.00 0.00 ? 1  PHE B HE2  6  
ATOM 4244  H HZ   . PHE B 2 1  ? 5.418   -12.279 -7.741  1.00 0.00 ? 1  PHE B HZ   6  
ATOM 4245  N N    . VAL B 2 2  ? 7.829   -6.564  -3.406  1.00 0.00 ? 2  VAL B N    6  
ATOM 4246  C CA   . VAL B 2 2  ? 9.253   -6.127  -3.383  1.00 0.00 ? 2  VAL B CA   6  
ATOM 4247  C C    . VAL B 2 2  ? 9.492   -5.235  -2.160  1.00 0.00 ? 2  VAL B C    6  
ATOM 4248  O O    . VAL B 2 2  ? 8.582   -4.622  -1.640  1.00 0.00 ? 2  VAL B O    6  
ATOM 4249  C CB   . VAL B 2 2  ? 9.565   -5.338  -4.654  1.00 0.00 ? 2  VAL B CB   6  
ATOM 4250  C CG1  . VAL B 2 2  ? 11.066  -5.408  -4.945  1.00 0.00 ? 2  VAL B CG1  6  
ATOM 4251  C CG2  . VAL B 2 2  ? 8.789   -5.939  -5.828  1.00 0.00 ? 2  VAL B CG2  6  
ATOM 4252  H H    . VAL B 2 2  ? 7.119   -5.908  -3.570  1.00 0.00 ? 2  VAL B H    6  
ATOM 4253  H HA   . VAL B 2 2  ? 9.897   -6.993  -3.329  1.00 0.00 ? 2  VAL B HA   6  
ATOM 4254  H HB   . VAL B 2 2  ? 9.274   -4.307  -4.517  1.00 0.00 ? 2  VAL B HB   6  
ATOM 4255  H HG11 . VAL B 2 2  ? 11.564  -5.924  -4.137  1.00 0.00 ? 2  VAL B HG11 6  
ATOM 4256  H HG12 . VAL B 2 2  ? 11.228  -5.942  -5.870  1.00 0.00 ? 2  VAL B HG12 6  
ATOM 4257  H HG13 . VAL B 2 2  ? 11.463  -4.408  -5.032  1.00 0.00 ? 2  VAL B HG13 6  
ATOM 4258  H HG21 . VAL B 2 2  ? 8.930   -7.010  -5.845  1.00 0.00 ? 2  VAL B HG21 6  
ATOM 4259  H HG22 . VAL B 2 2  ? 7.737   -5.717  -5.716  1.00 0.00 ? 2  VAL B HG22 6  
ATOM 4260  H HG23 . VAL B 2 2  ? 9.149   -5.514  -6.755  1.00 0.00 ? 2  VAL B HG23 6  
ATOM 4261  N N    . ASN B 2 3  ? 10.711  -5.156  -1.699  1.00 0.00 ? 3  ASN B N    6  
ATOM 4262  C CA   . ASN B 2 3  ? 11.004  -4.301  -0.512  1.00 0.00 ? 3  ASN B CA   6  
ATOM 4263  C C    . ASN B 2 3  ? 11.458  -2.916  -0.980  1.00 0.00 ? 3  ASN B C    6  
ATOM 4264  O O    . ASN B 2 3  ? 12.638  -2.640  -1.082  1.00 0.00 ? 3  ASN B O    6  
ATOM 4265  C CB   . ASN B 2 3  ? 12.112  -4.948  0.322   1.00 0.00 ? 3  ASN B CB   6  
ATOM 4266  C CG   . ASN B 2 3  ? 13.399  -5.028  -0.503  1.00 0.00 ? 3  ASN B CG   6  
ATOM 4267  O OD1  . ASN B 2 3  ? 13.365  -4.906  -1.712  1.00 0.00 ? 3  ASN B OD1  6  
ATOM 4268  N ND2  . ASN B 2 3  ? 14.539  -5.230  0.102   1.00 0.00 ? 3  ASN B ND2  6  
ATOM 4269  H H    . ASN B 2 3  ? 11.434  -5.656  -2.132  1.00 0.00 ? 3  ASN B H    6  
ATOM 4270  H HA   . ASN B 2 3  ? 10.112  -4.203  0.089   1.00 0.00 ? 3  ASN B HA   6  
ATOM 4271  H HB2  . ASN B 2 3  ? 12.290  -4.353  1.207   1.00 0.00 ? 3  ASN B HB2  6  
ATOM 4272  H HB3  . ASN B 2 3  ? 11.811  -5.942  0.612   1.00 0.00 ? 3  ASN B HB3  6  
ATOM 4273  H HD21 . ASN B 2 3  ? 14.565  -5.328  1.076   1.00 0.00 ? 3  ASN B HD21 6  
ATOM 4274  H HD22 . ASN B 2 3  ? 15.367  -5.281  -0.420  1.00 0.00 ? 3  ASN B HD22 6  
ATOM 4275  N N    . GLN B 2 4  ? 10.532  -2.043  -1.268  1.00 0.00 ? 4  GLN B N    6  
ATOM 4276  C CA   . GLN B 2 4  ? 10.913  -0.677  -1.730  1.00 0.00 ? 4  GLN B CA   6  
ATOM 4277  C C    . GLN B 2 4  ? 10.143  0.369   -0.920  1.00 0.00 ? 4  GLN B C    6  
ATOM 4278  O O    . GLN B 2 4  ? 9.639   0.092   0.149   1.00 0.00 ? 4  GLN B O    6  
ATOM 4279  C CB   . GLN B 2 4  ? 10.568  -0.524  -3.214  1.00 0.00 ? 4  GLN B CB   6  
ATOM 4280  C CG   . GLN B 2 4  ? 10.987  -1.782  -3.979  1.00 0.00 ? 4  GLN B CG   6  
ATOM 4281  C CD   . GLN B 2 4  ? 12.200  -1.467  -4.855  1.00 0.00 ? 4  GLN B CD   6  
ATOM 4282  O OE1  . GLN B 2 4  ? 13.318  -1.443  -4.378  1.00 0.00 ? 4  GLN B OE1  6  
ATOM 4283  N NE2  . GLN B 2 4  ? 12.028  -1.224  -6.125  1.00 0.00 ? 4  GLN B NE2  6  
ATOM 4284  H H    . GLN B 2 4  ? 9.587   -2.285  -1.180  1.00 0.00 ? 4  GLN B H    6  
ATOM 4285  H HA   . GLN B 2 4  ? 11.973  -0.532  -1.590  1.00 0.00 ? 4  GLN B HA   6  
ATOM 4286  H HB2  . GLN B 2 4  ? 9.502   -0.375  -3.321  1.00 0.00 ? 4  GLN B HB2  6  
ATOM 4287  H HB3  . GLN B 2 4  ? 11.090  0.330   -3.617  1.00 0.00 ? 4  GLN B HB3  6  
ATOM 4288  H HG2  . GLN B 2 4  ? 11.240  -2.563  -3.277  1.00 0.00 ? 4  GLN B HG2  6  
ATOM 4289  H HG3  . GLN B 2 4  ? 10.171  -2.110  -4.605  1.00 0.00 ? 4  GLN B HG3  6  
ATOM 4290  H HE21 . GLN B 2 4  ? 11.126  -1.244  -6.508  1.00 0.00 ? 4  GLN B HE21 6  
ATOM 4291  H HE22 . GLN B 2 4  ? 12.799  -1.024  -6.696  1.00 0.00 ? 4  GLN B HE22 6  
ATOM 4292  N N    . HIS B 2 5  ? 10.047  1.571   -1.423  1.00 0.00 ? 5  HIS B N    6  
ATOM 4293  C CA   . HIS B 2 5  ? 9.307   2.632   -0.681  1.00 0.00 ? 5  HIS B CA   6  
ATOM 4294  C C    . HIS B 2 5  ? 7.998   2.936   -1.407  1.00 0.00 ? 5  HIS B C    6  
ATOM 4295  O O    . HIS B 2 5  ? 7.982   3.236   -2.585  1.00 0.00 ? 5  HIS B O    6  
ATOM 4296  C CB   . HIS B 2 5  ? 10.158  3.902   -0.611  1.00 0.00 ? 5  HIS B CB   6  
ATOM 4297  C CG   . HIS B 2 5  ? 11.527  3.559   -0.090  1.00 0.00 ? 5  HIS B CG   6  
ATOM 4298  N ND1  . HIS B 2 5  ? 11.714  2.735   1.009   1.00 0.00 ? 5  HIS B ND1  6  
ATOM 4299  C CD2  . HIS B 2 5  ? 12.786  3.918   -0.504  1.00 0.00 ? 5  HIS B CD2  6  
ATOM 4300  C CE1  . HIS B 2 5  ? 13.038  2.629   1.218   1.00 0.00 ? 5  HIS B CE1  6  
ATOM 4301  N NE2  . HIS B 2 5  ? 13.740  3.330   0.322   1.00 0.00 ? 5  HIS B NE2  6  
ATOM 4302  H H    . HIS B 2 5  ? 10.460  1.776   -2.288  1.00 0.00 ? 5  HIS B H    6  
ATOM 4303  H HA   . HIS B 2 5  ? 9.092   2.286   0.319   1.00 0.00 ? 5  HIS B HA   6  
ATOM 4304  H HB2  . HIS B 2 5  ? 10.245  4.333   -1.598  1.00 0.00 ? 5  HIS B HB2  6  
ATOM 4305  H HB3  . HIS B 2 5  ? 9.685   4.613   0.055   1.00 0.00 ? 5  HIS B HB3  6  
ATOM 4306  H HD1  . HIS B 2 5  ? 11.009  2.304   1.533   1.00 0.00 ? 5  HIS B HD1  6  
ATOM 4307  H HD2  . HIS B 2 5  ? 13.004  4.558   -1.346  1.00 0.00 ? 5  HIS B HD2  6  
ATOM 4308  H HE1  . HIS B 2 5  ? 13.482  2.047   2.012   1.00 0.00 ? 5  HIS B HE1  6  
ATOM 4309  N N    . LEU B 2 6  ? 6.899   2.857   -0.713  1.00 0.00 ? 6  LEU B N    6  
ATOM 4310  C CA   . LEU B 2 6  ? 5.586   3.133   -1.356  1.00 0.00 ? 6  LEU B CA   6  
ATOM 4311  C C    . LEU B 2 6  ? 5.233   4.614   -1.195  1.00 0.00 ? 6  LEU B C    6  
ATOM 4312  O O    . LEU B 2 6  ? 4.770   5.040   -0.156  1.00 0.00 ? 6  LEU B O    6  
ATOM 4313  C CB   . LEU B 2 6  ? 4.519   2.271   -0.690  1.00 0.00 ? 6  LEU B CB   6  
ATOM 4314  C CG   . LEU B 2 6  ? 4.998   0.819   -0.650  1.00 0.00 ? 6  LEU B CG   6  
ATOM 4315  C CD1  . LEU B 2 6  ? 3.958   -0.048  0.059   1.00 0.00 ? 6  LEU B CD1  6  
ATOM 4316  C CD2  . LEU B 2 6  ? 5.197   0.313   -2.080  1.00 0.00 ? 6  LEU B CD2  6  
ATOM 4317  H H    . LEU B 2 6  ? 6.936   2.608   0.232   1.00 0.00 ? 6  LEU B H    6  
ATOM 4318  H HA   . LEU B 2 6  ? 5.639   2.890   -2.404  1.00 0.00 ? 6  LEU B HA   6  
ATOM 4319  H HB2  . LEU B 2 6  ? 4.348   2.623   0.317   1.00 0.00 ? 6  LEU B HB2  6  
ATOM 4320  H HB3  . LEU B 2 6  ? 3.603   2.331   -1.254  1.00 0.00 ? 6  LEU B HB3  6  
ATOM 4321  H HG   . LEU B 2 6  ? 5.935   0.766   -0.113  1.00 0.00 ? 6  LEU B HG   6  
ATOM 4322  H HD11 . LEU B 2 6  ? 3.716   0.390   1.016   1.00 0.00 ? 6  LEU B HD11 6  
ATOM 4323  H HD12 . LEU B 2 6  ? 3.065   -0.105  -0.547  1.00 0.00 ? 6  LEU B HD12 6  
ATOM 4324  H HD13 . LEU B 2 6  ? 4.356   -1.040  0.209   1.00 0.00 ? 6  LEU B HD13 6  
ATOM 4325  H HD21 . LEU B 2 6  ? 5.024   1.121   -2.773  1.00 0.00 ? 6  LEU B HD21 6  
ATOM 4326  H HD22 . LEU B 2 6  ? 6.207   -0.051  -2.196  1.00 0.00 ? 6  LEU B HD22 6  
ATOM 4327  H HD23 . LEU B 2 6  ? 4.499   -0.488  -2.279  1.00 0.00 ? 6  LEU B HD23 6  
ATOM 4328  N N    . CYS B 2 7  ? 5.444   5.397   -2.217  1.00 0.00 ? 7  CYS B N    6  
ATOM 4329  C CA   . CYS B 2 7  ? 5.120   6.851   -2.127  1.00 0.00 ? 7  CYS B CA   6  
ATOM 4330  C C    . CYS B 2 7  ? 4.196   7.243   -3.283  1.00 0.00 ? 7  CYS B C    6  
ATOM 4331  O O    . CYS B 2 7  ? 4.408   6.863   -4.418  1.00 0.00 ? 7  CYS B O    6  
ATOM 4332  C CB   . CYS B 2 7  ? 6.412   7.666   -2.213  1.00 0.00 ? 7  CYS B CB   6  
ATOM 4333  S SG   . CYS B 2 7  ? 7.282   7.589   -0.628  1.00 0.00 ? 7  CYS B SG   6  
ATOM 4334  H H    . CYS B 2 7  ? 5.817   5.030   -3.045  1.00 0.00 ? 7  CYS B H    6  
ATOM 4335  H HA   . CYS B 2 7  ? 4.628   7.053   -1.188  1.00 0.00 ? 7  CYS B HA   6  
ATOM 4336  H HB2  . CYS B 2 7  ? 7.043   7.262   -2.991  1.00 0.00 ? 7  CYS B HB2  6  
ATOM 4337  H HB3  . CYS B 2 7  ? 6.173   8.694   -2.441  1.00 0.00 ? 7  CYS B HB3  6  
ATOM 4338  N N    . GLY B 2 8  ? 3.174   8.003   -3.004  1.00 0.00 ? 8  GLY B N    6  
ATOM 4339  C CA   . GLY B 2 8  ? 2.239   8.424   -4.087  1.00 0.00 ? 8  GLY B CA   6  
ATOM 4340  C C    . GLY B 2 8  ? 1.352   7.244   -4.487  1.00 0.00 ? 8  GLY B C    6  
ATOM 4341  O O    . GLY B 2 8  ? 0.820   6.542   -3.651  1.00 0.00 ? 8  GLY B O    6  
ATOM 4342  H H    . GLY B 2 8  ? 3.021   8.301   -2.083  1.00 0.00 ? 8  GLY B H    6  
ATOM 4343  H HA2  . GLY B 2 8  ? 1.622   9.238   -3.731  1.00 0.00 ? 8  GLY B HA2  6  
ATOM 4344  H HA3  . GLY B 2 8  ? 2.806   8.749   -4.945  1.00 0.00 ? 8  GLY B HA3  6  
ATOM 4345  N N    . SER B 2 9  ? 1.187   7.023   -5.763  1.00 0.00 ? 9  SER B N    6  
ATOM 4346  C CA   . SER B 2 9  ? 0.331   5.890   -6.218  1.00 0.00 ? 9  SER B CA   6  
ATOM 4347  C C    . SER B 2 9  ? 1.131   4.588   -6.157  1.00 0.00 ? 9  SER B C    6  
ATOM 4348  O O    . SER B 2 9  ? 0.675   3.549   -6.590  1.00 0.00 ? 9  SER B O    6  
ATOM 4349  C CB   . SER B 2 9  ? -0.121  6.139   -7.658  1.00 0.00 ? 9  SER B CB   6  
ATOM 4350  O OG   . SER B 2 9  ? 0.816   6.990   -8.303  1.00 0.00 ? 9  SER B OG   6  
ATOM 4351  H H    . SER B 2 9  ? 1.623   7.603   -6.422  1.00 0.00 ? 9  SER B H    6  
ATOM 4352  H HA   . SER B 2 9  ? -0.534  5.812   -5.578  1.00 0.00 ? 9  SER B HA   6  
ATOM 4353  H HB2  . SER B 2 9  ? -0.172  5.203   -8.188  1.00 0.00 ? 9  SER B HB2  6  
ATOM 4354  H HB3  . SER B 2 9  ? -1.100  6.601   -7.651  1.00 0.00 ? 9  SER B HB3  6  
ATOM 4355  H HG   . SER B 2 9  ? 0.370   7.423   -9.034  1.00 0.00 ? 9  SER B HG   6  
ATOM 4356  N N    . HIS B 2 10 ? 2.321   4.633   -5.626  1.00 0.00 ? 10 HIS B N    6  
ATOM 4357  C CA   . HIS B 2 10 ? 3.141   3.395   -5.543  1.00 0.00 ? 10 HIS B CA   6  
ATOM 4358  C C    . HIS B 2 10 ? 2.585   2.489   -4.444  1.00 0.00 ? 10 HIS B C    6  
ATOM 4359  O O    . HIS B 2 10 ? 2.655   1.280   -4.531  1.00 0.00 ? 10 HIS B O    6  
ATOM 4360  C CB   . HIS B 2 10 ? 4.590   3.762   -5.213  1.00 0.00 ? 10 HIS B CB   6  
ATOM 4361  C CG   . HIS B 2 10 ? 5.308   4.143   -6.478  1.00 0.00 ? 10 HIS B CG   6  
ATOM 4362  N ND1  . HIS B 2 10 ? 4.643   4.309   -7.683  1.00 0.00 ? 10 HIS B ND1  6  
ATOM 4363  C CD2  . HIS B 2 10 ? 6.632   4.392   -6.742  1.00 0.00 ? 10 HIS B CD2  6  
ATOM 4364  C CE1  . HIS B 2 10 ? 5.561   4.645   -8.609  1.00 0.00 ? 10 HIS B CE1  6  
ATOM 4365  N NE2  . HIS B 2 10 ? 6.790   4.709   -8.088  1.00 0.00 ? 10 HIS B NE2  6  
ATOM 4366  H H    . HIS B 2 10 ? 2.674   5.481   -5.283  1.00 0.00 ? 10 HIS B H    6  
ATOM 4367  H HA   . HIS B 2 10 ? 3.109   2.877   -6.488  1.00 0.00 ? 10 HIS B HA   6  
ATOM 4368  H HB2  . HIS B 2 10 ? 4.605   4.596   -4.528  1.00 0.00 ? 10 HIS B HB2  6  
ATOM 4369  H HB3  . HIS B 2 10 ? 5.083   2.914   -4.761  1.00 0.00 ? 10 HIS B HB3  6  
ATOM 4370  H HD1  . HIS B 2 10 ? 3.681   4.202   -7.835  1.00 0.00 ? 10 HIS B HD1  6  
ATOM 4371  H HD2  . HIS B 2 10 ? 7.428   4.348   -6.015  1.00 0.00 ? 10 HIS B HD2  6  
ATOM 4372  H HE1  . HIS B 2 10 ? 5.332   4.839   -9.646  1.00 0.00 ? 10 HIS B HE1  6  
ATOM 4373  N N    . LEU B 2 11 ? 2.030   3.060   -3.411  1.00 0.00 ? 11 LEU B N    6  
ATOM 4374  C CA   . LEU B 2 11 ? 1.470   2.225   -2.315  1.00 0.00 ? 11 LEU B CA   6  
ATOM 4375  C C    . LEU B 2 11 ? 0.174   1.568   -2.788  1.00 0.00 ? 11 LEU B C    6  
ATOM 4376  O O    . LEU B 2 11 ? -0.123  0.443   -2.439  1.00 0.00 ? 11 LEU B O    6  
ATOM 4377  C CB   . LEU B 2 11 ? 1.188   3.095   -1.090  1.00 0.00 ? 11 LEU B CB   6  
ATOM 4378  C CG   . LEU B 2 11 ? 1.544   2.314   0.174   1.00 0.00 ? 11 LEU B CG   6  
ATOM 4379  C CD1  . LEU B 2 11 ? 1.938   3.287   1.292   1.00 0.00 ? 11 LEU B CD1  6  
ATOM 4380  C CD2  . LEU B 2 11 ? 0.337   1.480   0.610   1.00 0.00 ? 11 LEU B CD2  6  
ATOM 4381  H H    . LEU B 2 11 ? 1.980   4.039   -3.357  1.00 0.00 ? 11 LEU B H    6  
ATOM 4382  H HA   . LEU B 2 11 ? 2.182   1.456   -2.052  1.00 0.00 ? 11 LEU B HA   6  
ATOM 4383  H HB2  . LEU B 2 11 ? 1.787   3.995   -1.142  1.00 0.00 ? 11 LEU B HB2  6  
ATOM 4384  H HB3  . LEU B 2 11 ? 0.143   3.359   -1.067  1.00 0.00 ? 11 LEU B HB3  6  
ATOM 4385  H HG   . LEU B 2 11 ? 2.374   1.656   -0.035  1.00 0.00 ? 11 LEU B HG   6  
ATOM 4386  H HD11 . LEU B 2 11 ? 1.194   4.066   1.379   1.00 0.00 ? 11 LEU B HD11 6  
ATOM 4387  H HD12 . LEU B 2 11 ? 2.011   2.751   2.226   1.00 0.00 ? 11 LEU B HD12 6  
ATOM 4388  H HD13 . LEU B 2 11 ? 2.900   3.732   1.058   1.00 0.00 ? 11 LEU B HD13 6  
ATOM 4389  H HD21 . LEU B 2 11 ? -0.568  1.925   0.225   1.00 0.00 ? 11 LEU B HD21 6  
ATOM 4390  H HD22 . LEU B 2 11 ? 0.435   0.476   0.223   1.00 0.00 ? 11 LEU B HD22 6  
ATOM 4391  H HD23 . LEU B 2 11 ? 0.292   1.444   1.687   1.00 0.00 ? 11 LEU B HD23 6  
ATOM 4392  N N    . VAL B 2 12 ? -0.596  2.252   -3.588  1.00 0.00 ? 12 VAL B N    6  
ATOM 4393  C CA   . VAL B 2 12 ? -1.861  1.646   -4.084  1.00 0.00 ? 12 VAL B CA   6  
ATOM 4394  C C    . VAL B 2 12 ? -1.519  0.423   -4.937  1.00 0.00 ? 12 VAL B C    6  
ATOM 4395  O O    . VAL B 2 12 ? -2.227  -0.565  -4.939  1.00 0.00 ? 12 VAL B O    6  
ATOM 4396  C CB   . VAL B 2 12 ? -2.628  2.662   -4.931  1.00 0.00 ? 12 VAL B CB   6  
ATOM 4397  C CG1  . VAL B 2 12 ? -3.785  1.955   -5.638  1.00 0.00 ? 12 VAL B CG1  6  
ATOM 4398  C CG2  . VAL B 2 12 ? -3.183  3.760   -4.025  1.00 0.00 ? 12 VAL B CG2  6  
ATOM 4399  H H    . VAL B 2 12 ? -0.340  3.155   -3.867  1.00 0.00 ? 12 VAL B H    6  
ATOM 4400  H HA   . VAL B 2 12 ? -2.470  1.346   -3.243  1.00 0.00 ? 12 VAL B HA   6  
ATOM 4401  H HB   . VAL B 2 12 ? -1.964  3.095   -5.665  1.00 0.00 ? 12 VAL B HB   6  
ATOM 4402  H HG11 . VAL B 2 12 ? -4.308  1.327   -4.931  1.00 0.00 ? 12 VAL B HG11 6  
ATOM 4403  H HG12 . VAL B 2 12 ? -4.466  2.693   -6.037  1.00 0.00 ? 12 VAL B HG12 6  
ATOM 4404  H HG13 . VAL B 2 12 ? -3.400  1.348   -6.443  1.00 0.00 ? 12 VAL B HG13 6  
ATOM 4405  H HG21 . VAL B 2 12 ? -2.886  3.569   -3.005  1.00 0.00 ? 12 VAL B HG21 6  
ATOM 4406  H HG22 . VAL B 2 12 ? -2.798  4.718   -4.342  1.00 0.00 ? 12 VAL B HG22 6  
ATOM 4407  H HG23 . VAL B 2 12 ? -4.262  3.766   -4.088  1.00 0.00 ? 12 VAL B HG23 6  
ATOM 4408  N N    . GLU B 2 13 ? -0.431  0.482   -5.659  1.00 0.00 ? 13 GLU B N    6  
ATOM 4409  C CA   . GLU B 2 13 ? -0.029  -0.675  -6.512  1.00 0.00 ? 13 GLU B CA   6  
ATOM 4410  C C    . GLU B 2 13 ? 0.170   -1.905  -5.626  1.00 0.00 ? 13 GLU B C    6  
ATOM 4411  O O    . GLU B 2 13 ? 0.091   -3.030  -6.078  1.00 0.00 ? 13 GLU B O    6  
ATOM 4412  C CB   . GLU B 2 13 ? 1.282   -0.348  -7.232  1.00 0.00 ? 13 GLU B CB   6  
ATOM 4413  C CG   . GLU B 2 13 ? 0.984   0.490   -8.477  1.00 0.00 ? 13 GLU B CG   6  
ATOM 4414  C CD   . GLU B 2 13 ? 1.398   -0.292  -9.725  1.00 0.00 ? 13 GLU B CD   6  
ATOM 4415  O OE1  . GLU B 2 13 ? 2.341   -1.060  -9.632  1.00 0.00 ? 13 GLU B OE1  6  
ATOM 4416  O OE2  . GLU B 2 13 ? 0.764   -0.110  -10.751 1.00 0.00 ? 13 GLU B OE2  6  
ATOM 4417  H H    . GLU B 2 13 ? 0.125   1.287   -5.636  1.00 0.00 ? 13 GLU B H    6  
ATOM 4418  H HA   . GLU B 2 13 ? -0.802  -0.872  -7.238  1.00 0.00 ? 13 GLU B HA   6  
ATOM 4419  H HB2  . GLU B 2 13 ? 1.927   0.210   -6.567  1.00 0.00 ? 13 GLU B HB2  6  
ATOM 4420  H HB3  . GLU B 2 13 ? 1.770   -1.264  -7.524  1.00 0.00 ? 13 GLU B HB3  6  
ATOM 4421  H HG2  . GLU B 2 13 ? -0.073  0.706   -8.519  1.00 0.00 ? 13 GLU B HG2  6  
ATOM 4422  H HG3  . GLU B 2 13 ? 1.541   1.414   -8.431  1.00 0.00 ? 13 GLU B HG3  6  
ATOM 4423  N N    . ALA B 2 14 ? 0.423   -1.697  -4.365  1.00 0.00 ? 14 ALA B N    6  
ATOM 4424  C CA   . ALA B 2 14 ? 0.616   -2.848  -3.440  1.00 0.00 ? 14 ALA B CA   6  
ATOM 4425  C C    . ALA B 2 14 ? -0.683  -3.085  -2.676  1.00 0.00 ? 14 ALA B C    6  
ATOM 4426  O O    . ALA B 2 14 ? -0.922  -4.151  -2.150  1.00 0.00 ? 14 ALA B O    6  
ATOM 4427  C CB   . ALA B 2 14 ? 1.742   -2.526  -2.453  1.00 0.00 ? 14 ALA B CB   6  
ATOM 4428  H H    . ALA B 2 14 ? 0.476   -0.781  -4.024  1.00 0.00 ? 14 ALA B H    6  
ATOM 4429  H HA   . ALA B 2 14 ? 0.871   -3.732  -4.007  1.00 0.00 ? 14 ALA B HA   6  
ATOM 4430  H HB1  . ALA B 2 14 ? 1.533   -1.587  -1.962  1.00 0.00 ? 14 ALA B HB1  6  
ATOM 4431  H HB2  . ALA B 2 14 ? 1.807   -3.312  -1.715  1.00 0.00 ? 14 ALA B HB2  6  
ATOM 4432  H HB3  . ALA B 2 14 ? 2.679   -2.454  -2.986  1.00 0.00 ? 14 ALA B HB3  6  
ATOM 4433  N N    . LEU B 2 15 ? -1.528  -2.090  -2.613  1.00 0.00 ? 15 LEU B N    6  
ATOM 4434  C CA   . LEU B 2 15 ? -2.817  -2.249  -1.887  1.00 0.00 ? 15 LEU B CA   6  
ATOM 4435  C C    . LEU B 2 15 ? -3.731  -3.193  -2.672  1.00 0.00 ? 15 LEU B C    6  
ATOM 4436  O O    . LEU B 2 15 ? -4.278  -4.133  -2.130  1.00 0.00 ? 15 LEU B O    6  
ATOM 4437  C CB   . LEU B 2 15 ? -3.489  -0.884  -1.744  1.00 0.00 ? 15 LEU B CB   6  
ATOM 4438  C CG   . LEU B 2 15 ? -2.727  -0.052  -0.713  1.00 0.00 ? 15 LEU B CG   6  
ATOM 4439  C CD1  . LEU B 2 15 ? -3.242  1.389   -0.731  1.00 0.00 ? 15 LEU B CD1  6  
ATOM 4440  C CD2  . LEU B 2 15 ? -2.941  -0.652  0.677   1.00 0.00 ? 15 LEU B CD2  6  
ATOM 4441  H H    . LEU B 2 15 ? -1.313  -1.239  -3.047  1.00 0.00 ? 15 LEU B H    6  
ATOM 4442  H HA   . LEU B 2 15 ? -2.627  -2.661  -0.907  1.00 0.00 ? 15 LEU B HA   6  
ATOM 4443  H HB2  . LEU B 2 15 ? -3.480  -0.375  -2.697  1.00 0.00 ? 15 LEU B HB2  6  
ATOM 4444  H HB3  . LEU B 2 15 ? -4.509  -1.016  -1.415  1.00 0.00 ? 15 LEU B HB3  6  
ATOM 4445  H HG   . LEU B 2 15 ? -1.673  -0.060  -0.951  1.00 0.00 ? 15 LEU B HG   6  
ATOM 4446  H HD11 . LEU B 2 15 ? -4.286  1.394   -1.009  1.00 0.00 ? 15 LEU B HD11 6  
ATOM 4447  H HD12 . LEU B 2 15 ? -3.129  1.824   0.252   1.00 0.00 ? 15 LEU B HD12 6  
ATOM 4448  H HD13 . LEU B 2 15 ? -2.675  1.964   -1.446  1.00 0.00 ? 15 LEU B HD13 6  
ATOM 4449  H HD21 . LEU B 2 15 ? -3.965  -0.979  0.777   1.00 0.00 ? 15 LEU B HD21 6  
ATOM 4450  H HD22 . LEU B 2 15 ? -2.279  -1.496  0.809   1.00 0.00 ? 15 LEU B HD22 6  
ATOM 4451  H HD23 . LEU B 2 15 ? -2.726  0.093   1.430   1.00 0.00 ? 15 LEU B HD23 6  
ATOM 4452  N N    . HIS B 2 16 ? -3.896  -2.955  -3.945  1.00 0.00 ? 16 HIS B N    6  
ATOM 4453  C CA   . HIS B 2 16 ? -4.771  -3.844  -4.763  1.00 0.00 ? 16 HIS B CA   6  
ATOM 4454  C C    . HIS B 2 16 ? -4.135  -5.235  -4.846  1.00 0.00 ? 16 HIS B C    6  
ATOM 4455  O O    . HIS B 2 16 ? -4.815  -6.240  -4.900  1.00 0.00 ? 16 HIS B O    6  
ATOM 4456  C CB   . HIS B 2 16 ? -4.928  -3.251  -6.172  1.00 0.00 ? 16 HIS B CB   6  
ATOM 4457  C CG   . HIS B 2 16 ? -3.719  -3.572  -7.006  1.00 0.00 ? 16 HIS B CG   6  
ATOM 4458  N ND1  . HIS B 2 16 ? -3.804  -4.268  -8.200  1.00 0.00 ? 16 HIS B ND1  6  
ATOM 4459  C CD2  . HIS B 2 16 ? -2.390  -3.299  -6.822  1.00 0.00 ? 16 HIS B CD2  6  
ATOM 4460  C CE1  . HIS B 2 16 ? -2.555  -4.390  -8.687  1.00 0.00 ? 16 HIS B CE1  6  
ATOM 4461  N NE2  . HIS B 2 16 ? -1.654  -3.816  -7.884  1.00 0.00 ? 16 HIS B NE2  6  
ATOM 4462  H H    . HIS B 2 16 ? -3.442  -2.193  -4.365  1.00 0.00 ? 16 HIS B H    6  
ATOM 4463  H HA   . HIS B 2 16 ? -5.740  -3.921  -4.295  1.00 0.00 ? 16 HIS B HA   6  
ATOM 4464  H HB2  . HIS B 2 16 ? -5.808  -3.665  -6.641  1.00 0.00 ? 16 HIS B HB2  6  
ATOM 4465  H HB3  . HIS B 2 16 ? -5.032  -2.179  -6.098  1.00 0.00 ? 16 HIS B HB3  6  
ATOM 4466  H HD1  . HIS B 2 16 ? -4.623  -4.610  -8.615  1.00 0.00 ? 16 HIS B HD1  6  
ATOM 4467  H HD2  . HIS B 2 16 ? -1.981  -2.768  -5.981  1.00 0.00 ? 16 HIS B HD2  6  
ATOM 4468  H HE1  . HIS B 2 16 ? -2.310  -4.890  -9.613  1.00 0.00 ? 16 HIS B HE1  6  
ATOM 4469  N N    . LEU B 2 17 ? -2.831  -5.294  -4.852  1.00 0.00 ? 17 LEU B N    6  
ATOM 4470  C CA   . LEU B 2 17 ? -2.143  -6.613  -4.927  1.00 0.00 ? 17 LEU B CA   6  
ATOM 4471  C C    . LEU B 2 17 ? -2.345  -7.359  -3.609  1.00 0.00 ? 17 LEU B C    6  
ATOM 4472  O O    . LEU B 2 17 ? -2.138  -8.553  -3.518  1.00 0.00 ? 17 LEU B O    6  
ATOM 4473  C CB   . LEU B 2 17 ? -0.647  -6.389  -5.168  1.00 0.00 ? 17 LEU B CB   6  
ATOM 4474  C CG   . LEU B 2 17 ? 0.083   -7.733  -5.152  1.00 0.00 ? 17 LEU B CG   6  
ATOM 4475  C CD1  . LEU B 2 17 ? -0.314  -8.542  -6.387  1.00 0.00 ? 17 LEU B CD1  6  
ATOM 4476  C CD2  . LEU B 2 17 ? 1.593   -7.489  -5.167  1.00 0.00 ? 17 LEU B CD2  6  
ATOM 4477  H H    . LEU B 2 17 ? -2.302  -4.471  -4.804  1.00 0.00 ? 17 LEU B H    6  
ATOM 4478  H HA   . LEU B 2 17 ? -2.557  -7.191  -5.739  1.00 0.00 ? 17 LEU B HA   6  
ATOM 4479  H HB2  . LEU B 2 17 ? -0.506  -5.914  -6.129  1.00 0.00 ? 17 LEU B HB2  6  
ATOM 4480  H HB3  . LEU B 2 17 ? -0.248  -5.756  -4.391  1.00 0.00 ? 17 LEU B HB3  6  
ATOM 4481  H HG   . LEU B 2 17 ? -0.188  -8.279  -4.260  1.00 0.00 ? 17 LEU B HG   6  
ATOM 4482  H HD11 . LEU B 2 17 ? -0.674  -7.875  -7.156  1.00 0.00 ? 17 LEU B HD11 6  
ATOM 4483  H HD12 . LEU B 2 17 ? 0.548   -9.083  -6.754  1.00 0.00 ? 17 LEU B HD12 6  
ATOM 4484  H HD13 . LEU B 2 17 ? -1.092  -9.244  -6.123  1.00 0.00 ? 17 LEU B HD13 6  
ATOM 4485  H HD21 . LEU B 2 17 ? 1.809   -6.606  -5.750  1.00 0.00 ? 17 LEU B HD21 6  
ATOM 4486  H HD22 . LEU B 2 17 ? 1.944   -7.346  -4.156  1.00 0.00 ? 17 LEU B HD22 6  
ATOM 4487  H HD23 . LEU B 2 17 ? 2.091   -8.341  -5.604  1.00 0.00 ? 17 LEU B HD23 6  
ATOM 4488  N N    . VAL B 2 18 ? -2.748  -6.662  -2.581  1.00 0.00 ? 18 VAL B N    6  
ATOM 4489  C CA   . VAL B 2 18 ? -2.968  -7.324  -1.266  1.00 0.00 ? 18 VAL B CA   6  
ATOM 4490  C C    . VAL B 2 18 ? -4.363  -7.950  -1.238  1.00 0.00 ? 18 VAL B C    6  
ATOM 4491  O O    . VAL B 2 18 ? -4.562  -9.023  -0.703  1.00 0.00 ? 18 VAL B O    6  
ATOM 4492  C CB   . VAL B 2 18 ? -2.858  -6.285  -0.149  1.00 0.00 ? 18 VAL B CB   6  
ATOM 4493  C CG1  . VAL B 2 18 ? -3.106  -6.954  1.202   1.00 0.00 ? 18 VAL B CG1  6  
ATOM 4494  C CG2  . VAL B 2 18 ? -1.458  -5.672  -0.161  1.00 0.00 ? 18 VAL B CG2  6  
ATOM 4495  H H    . VAL B 2 18 ? -2.908  -5.699  -2.678  1.00 0.00 ? 18 VAL B H    6  
ATOM 4496  H HA   . VAL B 2 18 ? -2.223  -8.091  -1.119  1.00 0.00 ? 18 VAL B HA   6  
ATOM 4497  H HB   . VAL B 2 18 ? -3.594  -5.508  -0.307  1.00 0.00 ? 18 VAL B HB   6  
ATOM 4498  H HG11 . VAL B 2 18 ? -3.228  -8.017  1.062   1.00 0.00 ? 18 VAL B HG11 6  
ATOM 4499  H HG12 . VAL B 2 18 ? -2.263  -6.771  1.853   1.00 0.00 ? 18 VAL B HG12 6  
ATOM 4500  H HG13 . VAL B 2 18 ? -3.999  -6.544  1.648   1.00 0.00 ? 18 VAL B HG13 6  
ATOM 4501  H HG21 . VAL B 2 18 ? -0.919  -6.024  -1.029  1.00 0.00 ? 18 VAL B HG21 6  
ATOM 4502  H HG22 . VAL B 2 18 ? -1.536  -4.597  -0.196  1.00 0.00 ? 18 VAL B HG22 6  
ATOM 4503  H HG23 . VAL B 2 18 ? -0.931  -5.967  0.734   1.00 0.00 ? 18 VAL B HG23 6  
ATOM 4504  N N    . CYS B 2 19 ? -5.330  -7.289  -1.809  1.00 0.00 ? 19 CYS B N    6  
ATOM 4505  C CA   . CYS B 2 19 ? -6.710  -7.840  -1.813  1.00 0.00 ? 19 CYS B CA   6  
ATOM 4506  C C    . CYS B 2 19 ? -6.974  -8.541  -3.146  1.00 0.00 ? 19 CYS B C    6  
ATOM 4507  O O    . CYS B 2 19 ? -7.243  -9.725  -3.195  1.00 0.00 ? 19 CYS B O    6  
ATOM 4508  C CB   . CYS B 2 19 ? -7.710  -6.699  -1.631  1.00 0.00 ? 19 CYS B CB   6  
ATOM 4509  S SG   . CYS B 2 19 ? -7.044  -5.479  -0.469  1.00 0.00 ? 19 CYS B SG   6  
ATOM 4510  H H    . CYS B 2 19 ? -5.151  -6.423  -2.234  1.00 0.00 ? 19 CYS B H    6  
ATOM 4511  H HA   . CYS B 2 19 ? -6.820  -8.548  -1.004  1.00 0.00 ? 19 CYS B HA   6  
ATOM 4512  H HB2  . CYS B 2 19 ? -7.883  -6.225  -2.586  1.00 0.00 ? 19 CYS B HB2  6  
ATOM 4513  H HB3  . CYS B 2 19 ? -8.641  -7.091  -1.250  1.00 0.00 ? 19 CYS B HB3  6  
ATOM 4514  N N    . GLY B 2 20 ? -6.901  -7.819  -4.232  1.00 0.00 ? 20 GLY B N    6  
ATOM 4515  C CA   . GLY B 2 20 ? -7.147  -8.442  -5.562  1.00 0.00 ? 20 GLY B CA   6  
ATOM 4516  C C    . GLY B 2 20 ? -8.585  -8.162  -6.002  1.00 0.00 ? 20 GLY B C    6  
ATOM 4517  O O    . GLY B 2 20 ? -8.997  -7.025  -6.118  1.00 0.00 ? 20 GLY B O    6  
ATOM 4518  H H    . GLY B 2 20 ? -6.683  -6.866  -4.170  1.00 0.00 ? 20 GLY B H    6  
ATOM 4519  H HA2  . GLY B 2 20 ? -6.459  -8.027  -6.286  1.00 0.00 ? 20 GLY B HA2  6  
ATOM 4520  H HA3  . GLY B 2 20 ? -6.997  -9.509  -5.494  1.00 0.00 ? 20 GLY B HA3  6  
ATOM 4521  N N    . GLU B 2 21 ? -9.352  -9.188  -6.250  1.00 0.00 ? 21 GLU B N    6  
ATOM 4522  C CA   . GLU B 2 21 ? -10.763 -8.977  -6.682  1.00 0.00 ? 21 GLU B CA   6  
ATOM 4523  C C    . GLU B 2 21 ? -11.555 -8.341  -5.538  1.00 0.00 ? 21 GLU B C    6  
ATOM 4524  O O    . GLU B 2 21 ? -12.544 -7.670  -5.754  1.00 0.00 ? 21 GLU B O    6  
ATOM 4525  C CB   . GLU B 2 21 ? -11.392 -10.322 -7.051  1.00 0.00 ? 21 GLU B CB   6  
ATOM 4526  C CG   . GLU B 2 21 ? -12.195 -10.171 -8.344  1.00 0.00 ? 21 GLU B CG   6  
ATOM 4527  C CD   . GLU B 2 21 ? -13.675 -9.985  -8.009  1.00 0.00 ? 21 GLU B CD   6  
ATOM 4528  O OE1  . GLU B 2 21 ? -14.321 -10.972 -7.698  1.00 0.00 ? 21 GLU B OE1  6  
ATOM 4529  O OE2  . GLU B 2 21 ? -14.139 -8.858  -8.069  1.00 0.00 ? 21 GLU B OE2  6  
ATOM 4530  H H    . GLU B 2 21 ? -9.001  -10.097 -6.151  1.00 0.00 ? 21 GLU B H    6  
ATOM 4531  H HA   . GLU B 2 21 ? -10.783 -8.323  -7.540  1.00 0.00 ? 21 GLU B HA   6  
ATOM 4532  H HB2  . GLU B 2 21 ? -10.614 -11.056 -7.192  1.00 0.00 ? 21 GLU B HB2  6  
ATOM 4533  H HB3  . GLU B 2 21 ? -12.051 -10.641 -6.258  1.00 0.00 ? 21 GLU B HB3  6  
ATOM 4534  H HG2  . GLU B 2 21 ? -11.838 -9.310  -8.891  1.00 0.00 ? 21 GLU B HG2  6  
ATOM 4535  H HG3  . GLU B 2 21 ? -12.074 -11.058 -8.950  1.00 0.00 ? 21 GLU B HG3  6  
ATOM 4536  N N    . ARG B 2 22 ? -11.128 -8.547  -4.324  1.00 0.00 ? 22 ARG B N    6  
ATOM 4537  C CA   . ARG B 2 22 ? -11.855 -7.955  -3.167  1.00 0.00 ? 22 ARG B CA   6  
ATOM 4538  C C    . ARG B 2 22 ? -11.764 -6.430  -3.229  1.00 0.00 ? 22 ARG B C    6  
ATOM 4539  O O    . ARG B 2 22 ? -12.748 -5.734  -3.079  1.00 0.00 ? 22 ARG B O    6  
ATOM 4540  C CB   . ARG B 2 22 ? -11.228 -8.454  -1.864  1.00 0.00 ? 22 ARG B CB   6  
ATOM 4541  C CG   . ARG B 2 22 ? -11.585 -9.927  -1.655  1.00 0.00 ? 22 ARG B CG   6  
ATOM 4542  C CD   . ARG B 2 22 ? -10.313 -10.776 -1.704  1.00 0.00 ? 22 ARG B CD   6  
ATOM 4543  N NE   . ARG B 2 22 ? -10.588 -12.117 -1.117  1.00 0.00 ? 22 ARG B NE   6  
ATOM 4544  C CZ   . ARG B 2 22 ? -9.756  -13.106 -1.317  1.00 0.00 ? 22 ARG B CZ   6  
ATOM 4545  N NH1  . ARG B 2 22 ? -8.677  -12.923 -2.030  1.00 0.00 ? 22 ARG B NH1  6  
ATOM 4546  N NH2  . ARG B 2 22 ? -10.003 -14.279 -0.803  1.00 0.00 ? 22 ARG B NH2  6  
ATOM 4547  H H    . ARG B 2 22 ? -10.328 -9.094  -4.172  1.00 0.00 ? 22 ARG B H    6  
ATOM 4548  H HA   . ARG B 2 22 ? -12.892 -8.256  -3.203  1.00 0.00 ? 22 ARG B HA   6  
ATOM 4549  H HB2  . ARG B 2 22 ? -10.154 -8.347  -1.919  1.00 0.00 ? 22 ARG B HB2  6  
ATOM 4550  H HB3  . ARG B 2 22 ? -11.606 -7.873  -1.037  1.00 0.00 ? 22 ARG B HB3  6  
ATOM 4551  H HG2  . ARG B 2 22 ? -12.063 -10.048 -0.694  1.00 0.00 ? 22 ARG B HG2  6  
ATOM 4552  H HG3  . ARG B 2 22 ? -12.259 -10.247 -2.434  1.00 0.00 ? 22 ARG B HG3  6  
ATOM 4553  H HD2  . ARG B 2 22 ? -9.995  -10.889 -2.730  1.00 0.00 ? 22 ARG B HD2  6  
ATOM 4554  H HD3  . ARG B 2 22 ? -9.532  -10.289 -1.139  1.00 0.00 ? 22 ARG B HD3  6  
ATOM 4555  H HE   . ARG B 2 22 ? -11.395 -12.260 -0.579  1.00 0.00 ? 22 ARG B HE   6  
ATOM 4556  H HH11 . ARG B 2 22 ? -8.485  -12.025 -2.426  1.00 0.00 ? 22 ARG B HH11 6  
ATOM 4557  H HH12 . ARG B 2 22 ? -8.045  -13.681 -2.181  1.00 0.00 ? 22 ARG B HH12 6  
ATOM 4558  H HH21 . ARG B 2 22 ? -10.829 -14.422 -0.257  1.00 0.00 ? 22 ARG B HH21 6  
ATOM 4559  H HH22 . ARG B 2 22 ? -9.368  -15.036 -0.954  1.00 0.00 ? 22 ARG B HH22 6  
ATOM 4560  N N    . GLY B 2 23 ? -10.590 -5.905  -3.449  1.00 0.00 ? 23 GLY B N    6  
ATOM 4561  C CA   . GLY B 2 23 ? -10.438 -4.423  -3.521  1.00 0.00 ? 23 GLY B CA   6  
ATOM 4562  C C    . GLY B 2 23 ? -9.904  -3.897  -2.187  1.00 0.00 ? 23 GLY B C    6  
ATOM 4563  O O    . GLY B 2 23 ? -9.828  -4.616  -1.211  1.00 0.00 ? 23 GLY B O    6  
ATOM 4564  H H    . GLY B 2 23 ? -9.808  -6.483  -3.567  1.00 0.00 ? 23 GLY B H    6  
ATOM 4565  H HA2  . GLY B 2 23 ? -9.745  -4.171  -4.312  1.00 0.00 ? 23 GLY B HA2  6  
ATOM 4566  H HA3  . GLY B 2 23 ? -11.397 -3.973  -3.726  1.00 0.00 ? 23 GLY B HA3  6  
ATOM 4567  N N    . PHE B 2 24 ? -9.536  -2.644  -2.137  1.00 0.00 ? 24 PHE B N    6  
ATOM 4568  C CA   . PHE B 2 24 ? -9.009  -2.068  -0.867  1.00 0.00 ? 24 PHE B CA   6  
ATOM 4569  C C    . PHE B 2 24 ? -9.591  -0.667  -0.666  1.00 0.00 ? 24 PHE B C    6  
ATOM 4570  O O    . PHE B 2 24 ? -9.945  0.007   -1.612  1.00 0.00 ? 24 PHE B O    6  
ATOM 4571  C CB   . PHE B 2 24 ? -7.483  -1.983  -0.942  1.00 0.00 ? 24 PHE B CB   6  
ATOM 4572  C CG   . PHE B 2 24 ? -7.081  -1.317  -2.234  1.00 0.00 ? 24 PHE B CG   6  
ATOM 4573  C CD1  . PHE B 2 24 ? -7.134  -2.044  -3.422  1.00 0.00 ? 24 PHE B CD1  6  
ATOM 4574  C CD2  . PHE B 2 24 ? -6.657  0.018   -2.242  1.00 0.00 ? 24 PHE B CD2  6  
ATOM 4575  C CE1  . PHE B 2 24 ? -6.766  -1.439  -4.630  1.00 0.00 ? 24 PHE B CE1  6  
ATOM 4576  C CE2  . PHE B 2 24 ? -6.290  0.625   -3.449  1.00 0.00 ? 24 PHE B CE2  6  
ATOM 4577  C CZ   . PHE B 2 24 ? -6.343  -0.104  -4.642  1.00 0.00 ? 24 PHE B CZ   6  
ATOM 4578  H H    . PHE B 2 24 ? -9.607  -2.082  -2.937  1.00 0.00 ? 24 PHE B H    6  
ATOM 4579  H HA   . PHE B 2 24 ? -9.294  -2.699  -0.038  1.00 0.00 ? 24 PHE B HA   6  
ATOM 4580  H HB2  . PHE B 2 24 ? -7.110  -1.408  -0.106  1.00 0.00 ? 24 PHE B HB2  6  
ATOM 4581  H HB3  . PHE B 2 24 ? -7.066  -2.978  -0.913  1.00 0.00 ? 24 PHE B HB3  6  
ATOM 4582  H HD1  . PHE B 2 24 ? -7.457  -3.073  -3.405  1.00 0.00 ? 24 PHE B HD1  6  
ATOM 4583  H HD2  . PHE B 2 24 ? -6.616  0.579   -1.323  1.00 0.00 ? 24 PHE B HD2  6  
ATOM 4584  H HE1  . PHE B 2 24 ? -6.809  -2.001  -5.550  1.00 0.00 ? 24 PHE B HE1  6  
ATOM 4585  H HE2  . PHE B 2 24 ? -5.964  1.654   -3.457  1.00 0.00 ? 24 PHE B HE2  6  
ATOM 4586  H HZ   . PHE B 2 24 ? -6.059  0.364   -5.574  1.00 0.00 ? 24 PHE B HZ   6  
ATOM 4587  N N    . PHE B 2 25 ? -9.689  -0.222  0.557   1.00 0.00 ? 25 PHE B N    6  
ATOM 4588  C CA   . PHE B 2 25 ? -10.245 1.139   0.808   1.00 0.00 ? 25 PHE B CA   6  
ATOM 4589  C C    . PHE B 2 25 ? -9.104  2.109   1.111   1.00 0.00 ? 25 PHE B C    6  
ATOM 4590  O O    . PHE B 2 25 ? -8.888  2.498   2.240   1.00 0.00 ? 25 PHE B O    6  
ATOM 4591  C CB   . PHE B 2 25 ? -11.211 1.096   1.996   1.00 0.00 ? 25 PHE B CB   6  
ATOM 4592  C CG   . PHE B 2 25 ? -10.742 0.071   3.002   1.00 0.00 ? 25 PHE B CG   6  
ATOM 4593  C CD1  . PHE B 2 25 ? -9.774  0.414   3.954   1.00 0.00 ? 25 PHE B CD1  6  
ATOM 4594  C CD2  . PHE B 2 25 ? -11.280 -1.222  2.984   1.00 0.00 ? 25 PHE B CD2  6  
ATOM 4595  C CE1  . PHE B 2 25 ? -9.346  -0.534  4.889   1.00 0.00 ? 25 PHE B CE1  6  
ATOM 4596  C CE2  . PHE B 2 25 ? -10.851 -2.170  3.920   1.00 0.00 ? 25 PHE B CE2  6  
ATOM 4597  C CZ   . PHE B 2 25 ? -9.884  -1.828  4.871   1.00 0.00 ? 25 PHE B CZ   6  
ATOM 4598  H H    . PHE B 2 25 ? -9.395  -0.780  1.308   1.00 0.00 ? 25 PHE B H    6  
ATOM 4599  H HA   . PHE B 2 25 ? -10.776 1.473   -0.072  1.00 0.00 ? 25 PHE B HA   6  
ATOM 4600  H HB2  . PHE B 2 25 ? -11.246 2.070   2.463   1.00 0.00 ? 25 PHE B HB2  6  
ATOM 4601  H HB3  . PHE B 2 25 ? -12.199 0.831   1.646   1.00 0.00 ? 25 PHE B HB3  6  
ATOM 4602  H HD1  . PHE B 2 25 ? -9.361  1.412   3.969   1.00 0.00 ? 25 PHE B HD1  6  
ATOM 4603  H HD2  . PHE B 2 25 ? -12.027 -1.486  2.251   1.00 0.00 ? 25 PHE B HD2  6  
ATOM 4604  H HE1  . PHE B 2 25 ? -8.598  -0.271  5.623   1.00 0.00 ? 25 PHE B HE1  6  
ATOM 4605  H HE2  . PHE B 2 25 ? -11.266 -3.168  3.907   1.00 0.00 ? 25 PHE B HE2  6  
ATOM 4606  H HZ   . PHE B 2 25 ? -9.552  -2.560  5.594   1.00 0.00 ? 25 PHE B HZ   6  
ATOM 4607  N N    . TYR B 2 26 ? -8.375  2.507   0.105   1.00 0.00 ? 26 TYR B N    6  
ATOM 4608  C CA   . TYR B 2 26 ? -7.248  3.454   0.325   1.00 0.00 ? 26 TYR B CA   6  
ATOM 4609  C C    . TYR B 2 26 ? -7.808  4.830   0.696   1.00 0.00 ? 26 TYR B C    6  
ATOM 4610  O O    . TYR B 2 26 ? -8.993  5.077   0.581   1.00 0.00 ? 26 TYR B O    6  
ATOM 4611  C CB   . TYR B 2 26 ? -6.426  3.559   -0.963  1.00 0.00 ? 26 TYR B CB   6  
ATOM 4612  C CG   . TYR B 2 26 ? -5.118  4.262   -0.695  1.00 0.00 ? 26 TYR B CG   6  
ATOM 4613  C CD1  . TYR B 2 26 ? -4.404  4.008   0.483   1.00 0.00 ? 26 TYR B CD1  6  
ATOM 4614  C CD2  . TYR B 2 26 ? -4.612  5.172   -1.634  1.00 0.00 ? 26 TYR B CD2  6  
ATOM 4615  C CE1  . TYR B 2 26 ? -3.190  4.662   0.723   1.00 0.00 ? 26 TYR B CE1  6  
ATOM 4616  C CE2  . TYR B 2 26 ? -3.398  5.824   -1.394  1.00 0.00 ? 26 TYR B CE2  6  
ATOM 4617  C CZ   . TYR B 2 26 ? -2.688  5.569   -0.215  1.00 0.00 ? 26 TYR B CZ   6  
ATOM 4618  O OH   . TYR B 2 26 ? -1.490  6.213   0.021   1.00 0.00 ? 26 TYR B OH   6  
ATOM 4619  H H    . TYR B 2 26 ? -8.570  2.180   -0.798  1.00 0.00 ? 26 TYR B H    6  
ATOM 4620  H HA   . TYR B 2 26 ? -6.621  3.091   1.126   1.00 0.00 ? 26 TYR B HA   6  
ATOM 4621  H HB2  . TYR B 2 26 ? -6.228  2.567   -1.343  1.00 0.00 ? 26 TYR B HB2  6  
ATOM 4622  H HB3  . TYR B 2 26 ? -6.988  4.116   -1.700  1.00 0.00 ? 26 TYR B HB3  6  
ATOM 4623  H HD1  . TYR B 2 26 ? -4.790  3.307   1.205   1.00 0.00 ? 26 TYR B HD1  6  
ATOM 4624  H HD2  . TYR B 2 26 ? -5.161  5.369   -2.543  1.00 0.00 ? 26 TYR B HD2  6  
ATOM 4625  H HE1  . TYR B 2 26 ? -2.643  4.467   1.631   1.00 0.00 ? 26 TYR B HE1  6  
ATOM 4626  H HE2  . TYR B 2 26 ? -3.011  6.524   -2.118  1.00 0.00 ? 26 TYR B HE2  6  
ATOM 4627  H HH   . TYR B 2 26 ? -1.482  7.021   -0.496  1.00 0.00 ? 26 TYR B HH   6  
ATOM 4628  N N    . THR B 2 27 ? -6.970  5.729   1.141   1.00 0.00 ? 27 THR B N    6  
ATOM 4629  C CA   . THR B 2 27 ? -7.464  7.084   1.517   1.00 0.00 ? 27 THR B CA   6  
ATOM 4630  C C    . THR B 2 27 ? -6.624  8.157   0.815   1.00 0.00 ? 27 THR B C    6  
ATOM 4631  O O    . THR B 2 27 ? -6.062  9.018   1.461   1.00 0.00 ? 27 THR B O    6  
ATOM 4632  C CB   . THR B 2 27 ? -7.352  7.267   3.032   1.00 0.00 ? 27 THR B CB   6  
ATOM 4633  O OG1  . THR B 2 27 ? -6.910  6.054   3.622   1.00 0.00 ? 27 THR B OG1  6  
ATOM 4634  C CG2  . THR B 2 27 ? -8.718  7.649   3.605   1.00 0.00 ? 27 THR B CG2  6  
ATOM 4635  H H    . THR B 2 27 ? -6.020  5.512   1.229   1.00 0.00 ? 27 THR B H    6  
ATOM 4636  H HA   . THR B 2 27 ? -8.497  7.185   1.219   1.00 0.00 ? 27 THR B HA   6  
ATOM 4637  H HB   . THR B 2 27 ? -6.644  8.052   3.248   1.00 0.00 ? 27 THR B HB   6  
ATOM 4638  H HG1  . THR B 2 27 ? -5.951  6.071   3.649   1.00 0.00 ? 27 THR B HG1  6  
ATOM 4639  H HG21 . THR B 2 27 ? -9.144  8.448   3.017   1.00 0.00 ? 27 THR B HG21 6  
ATOM 4640  H HG22 . THR B 2 27 ? -9.373  6.791   3.575   1.00 0.00 ? 27 THR B HG22 6  
ATOM 4641  H HG23 . THR B 2 27 ? -8.599  7.977   4.627   1.00 0.00 ? 27 THR B HG23 6  
ATOM 4642  N N    . PRO B 2 28 ? -6.573  8.073   -0.487  1.00 0.00 ? 28 PRO B N    6  
ATOM 4643  C CA   . PRO B 2 28 ? -5.815  9.024   -1.333  1.00 0.00 ? 28 PRO B CA   6  
ATOM 4644  C C    . PRO B 2 28 ? -6.356  10.442  -1.135  1.00 0.00 ? 28 PRO B C    6  
ATOM 4645  O O    . PRO B 2 28 ? -7.153  10.696  -0.252  1.00 0.00 ? 28 PRO B O    6  
ATOM 4646  C CB   . PRO B 2 28 ? -6.036  8.571   -2.780  1.00 0.00 ? 28 PRO B CB   6  
ATOM 4647  C CG   . PRO B 2 28 ? -6.971  7.346   -2.746  1.00 0.00 ? 28 PRO B CG   6  
ATOM 4648  C CD   . PRO B 2 28 ? -7.255  7.021   -1.276  1.00 0.00 ? 28 PRO B CD   6  
ATOM 4649  H HA   . PRO B 2 28 ? -4.766  8.989   -1.092  1.00 0.00 ? 28 PRO B HA   6  
ATOM 4650  H HB2  . PRO B 2 28 ? -6.492  9.368   -3.349  1.00 0.00 ? 28 PRO B HB2  6  
ATOM 4651  H HB3  . PRO B 2 28 ? -5.092  8.294   -3.224  1.00 0.00 ? 28 PRO B HB3  6  
ATOM 4652  H HG2  . PRO B 2 28 ? -7.894  7.578   -3.259  1.00 0.00 ? 28 PRO B HG2  6  
ATOM 4653  H HG3  . PRO B 2 28 ? -6.490  6.502   -3.216  1.00 0.00 ? 28 PRO B HG3  6  
ATOM 4654  H HD2  . PRO B 2 28 ? -8.319  7.043   -1.086  1.00 0.00 ? 28 PRO B HD2  6  
ATOM 4655  H HD3  . PRO B 2 28 ? -6.850  6.053   -1.026  1.00 0.00 ? 28 PRO B HD3  6  
ATOM 4656  N N    . LYS B 2 29 ? -5.931  11.366  -1.949  1.00 0.00 ? 29 LYS B N    6  
ATOM 4657  C CA   . LYS B 2 29 ? -6.421  12.766  -1.809  1.00 0.00 ? 29 LYS B CA   6  
ATOM 4658  C C    . LYS B 2 29 ? -7.843  12.865  -2.363  1.00 0.00 ? 29 LYS B C    6  
ATOM 4659  O O    . LYS B 2 29 ? -8.349  11.940  -2.969  1.00 0.00 ? 29 LYS B O    6  
ATOM 4660  C CB   . LYS B 2 29 ? -5.502  13.706  -2.591  1.00 0.00 ? 29 LYS B CB   6  
ATOM 4661  C CG   . LYS B 2 29 ? -5.299  13.159  -4.006  1.00 0.00 ? 29 LYS B CG   6  
ATOM 4662  C CD   . LYS B 2 29 ? -4.999  14.313  -4.963  1.00 0.00 ? 29 LYS B CD   6  
ATOM 4663  C CE   . LYS B 2 29 ? -3.870  15.169  -4.390  1.00 0.00 ? 29 LYS B CE   6  
ATOM 4664  N NZ   . LYS B 2 29 ? -2.826  15.376  -5.435  1.00 0.00 ? 29 LYS B NZ   6  
ATOM 4665  H H    . LYS B 2 29 ? -5.289  11.140  -2.654  1.00 0.00 ? 29 LYS B H    6  
ATOM 4666  H HA   . LYS B 2 29 ? -6.419  13.046  -0.766  1.00 0.00 ? 29 LYS B HA   6  
ATOM 4667  H HB2  . LYS B 2 29 ? -5.953  14.687  -2.645  1.00 0.00 ? 29 LYS B HB2  6  
ATOM 4668  H HB3  . LYS B 2 29 ? -4.547  13.775  -2.094  1.00 0.00 ? 29 LYS B HB3  6  
ATOM 4669  H HG2  . LYS B 2 29 ? -4.471  12.465  -4.009  1.00 0.00 ? 29 LYS B HG2  6  
ATOM 4670  H HG3  . LYS B 2 29 ? -6.195  12.651  -4.328  1.00 0.00 ? 29 LYS B HG3  6  
ATOM 4671  H HD2  . LYS B 2 29 ? -4.704  13.917  -5.923  1.00 0.00 ? 29 LYS B HD2  6  
ATOM 4672  H HD3  . LYS B 2 29 ? -5.884  14.921  -5.082  1.00 0.00 ? 29 LYS B HD3  6  
ATOM 4673  H HE2  . LYS B 2 29 ? -4.263  16.127  -4.081  1.00 0.00 ? 29 LYS B HE2  6  
ATOM 4674  H HE3  . LYS B 2 29 ? -3.434  14.669  -3.540  1.00 0.00 ? 29 LYS B HE3  6  
ATOM 4675  H HZ1  . LYS B 2 29 ? -3.255  15.267  -6.378  1.00 0.00 ? 29 LYS B HZ1  6  
ATOM 4676  H HZ2  . LYS B 2 29 ? -2.427  16.330  -5.342  1.00 0.00 ? 29 LYS B HZ2  6  
ATOM 4677  H HZ3  . LYS B 2 29 ? -2.071  14.672  -5.313  1.00 0.00 ? 29 LYS B HZ3  6  
ATOM 4678  N N    . THR B 2 30 ? -8.492  13.980  -2.163  1.00 0.00 ? 30 THR B N    6  
ATOM 4679  C CA   . THR B 2 30 ? -9.880  14.137  -2.680  1.00 0.00 ? 30 THR B CA   6  
ATOM 4680  C C    . THR B 2 30 ? -9.852  14.953  -3.974  1.00 0.00 ? 30 THR B C    6  
ATOM 4681  O O    . THR B 2 30 ? -9.992  14.358  -5.030  1.00 0.00 ? 30 THR B O    6  
ATOM 4682  C CB   . THR B 2 30 ? -10.736 14.862  -1.638  1.00 0.00 ? 30 THR B CB   6  
ATOM 4683  O OG1  . THR B 2 30 ? -10.340 16.224  -1.569  1.00 0.00 ? 30 THR B OG1  6  
ATOM 4684  C CG2  . THR B 2 30 ? -10.552 14.203  -0.271  1.00 0.00 ? 30 THR B CG2  6  
ATOM 4685  O OXT  . THR B 2 30 ? -9.691  16.159  -3.887  1.00 0.00 ? 30 THR B OXT  6  
ATOM 4686  H H    . THR B 2 30 ? -8.065  14.714  -1.672  1.00 0.00 ? 30 THR B H    6  
ATOM 4687  H HA   . THR B 2 30 ? -10.303 13.163  -2.878  1.00 0.00 ? 30 THR B HA   6  
ATOM 4688  H HB   . THR B 2 30 ? -11.776 14.806  -1.924  1.00 0.00 ? 30 THR B HB   6  
ATOM 4689  H HG1  . THR B 2 30 ? -9.512  16.269  -1.083  1.00 0.00 ? 30 THR B HG1  6  
ATOM 4690  H HG21 . THR B 2 30 ? -10.483 13.131  -0.395  1.00 0.00 ? 30 THR B HG21 6  
ATOM 4691  H HG22 . THR B 2 30 ? -9.647  14.570  0.189   1.00 0.00 ? 30 THR B HG22 6  
ATOM 4692  H HG23 . THR B 2 30 ? -11.398 14.438  0.359   1.00 0.00 ? 30 THR B HG23 6  
ATOM 4693  N N    . GLY A 1 1  ? -1.802  7.718   7.407   1.00 0.00 ? 1  GLY A N    7  
ATOM 4694  C CA   . GLY A 1 1  ? -2.213  6.293   7.547   1.00 0.00 ? 1  GLY A CA   7  
ATOM 4695  C C    . GLY A 1 1  ? -1.048  5.382   7.159   1.00 0.00 ? 1  GLY A C    7  
ATOM 4696  O O    . GLY A 1 1  ? -0.039  5.320   7.831   1.00 0.00 ? 1  GLY A O    7  
ATOM 4697  H H1   . GLY A 1 1  ? -0.806  7.822   7.688   1.00 0.00 ? 1  GLY A H1   7  
ATOM 4698  H H2   . GLY A 1 1  ? -1.916  8.015   6.416   1.00 0.00 ? 1  GLY A H2   7  
ATOM 4699  H H3   . GLY A 1 1  ? -2.396  8.313   8.019   1.00 0.00 ? 1  GLY A H3   7  
ATOM 4700  H HA2  . GLY A 1 1  ? -2.497  6.098   8.569   1.00 0.00 ? 1  GLY A HA2  7  
ATOM 4701  H HA3  . GLY A 1 1  ? -3.051  6.091   6.893   1.00 0.00 ? 1  GLY A HA3  7  
ATOM 4702  N N    . ILE A 1 2  ? -1.194  4.670   6.080   1.00 0.00 ? 2  ILE A N    7  
ATOM 4703  C CA   . ILE A 1 2  ? -0.118  3.747   5.629   1.00 0.00 ? 2  ILE A CA   7  
ATOM 4704  C C    . ILE A 1 2  ? 0.831   4.487   4.678   1.00 0.00 ? 2  ILE A C    7  
ATOM 4705  O O    . ILE A 1 2  ? 1.895   4.006   4.345   1.00 0.00 ? 2  ILE A O    7  
ATOM 4706  C CB   . ILE A 1 2  ? -0.780  2.568   4.913   1.00 0.00 ? 2  ILE A CB   7  
ATOM 4707  C CG1  . ILE A 1 2  ? 0.155   1.363   4.887   1.00 0.00 ? 2  ILE A CG1  7  
ATOM 4708  C CG2  . ILE A 1 2  ? -1.144  2.962   3.479   1.00 0.00 ? 2  ILE A CG2  7  
ATOM 4709  C CD1  . ILE A 1 2  ? -0.688  0.088   4.795   1.00 0.00 ? 2  ILE A CD1  7  
ATOM 4710  H H    . ILE A 1 2  ? -2.025  4.737   5.564   1.00 0.00 ? 2  ILE A H    7  
ATOM 4711  H HA   . ILE A 1 2  ? 0.435   3.386   6.483   1.00 0.00 ? 2  ILE A HA   7  
ATOM 4712  H HB   . ILE A 1 2  ? -1.678  2.306   5.450   1.00 0.00 ? 2  ILE A HB   7  
ATOM 4713  H HG12 . ILE A 1 2  ? 0.810   1.431   4.029   1.00 0.00 ? 2  ILE A HG12 7  
ATOM 4714  H HG13 . ILE A 1 2  ? 0.742   1.340   5.792   1.00 0.00 ? 2  ILE A HG13 7  
ATOM 4715  H HG21 . ILE A 1 2  ? -1.818  3.806   3.496   1.00 0.00 ? 2  ILE A HG21 7  
ATOM 4716  H HG22 . ILE A 1 2  ? -0.247  3.230   2.939   1.00 0.00 ? 2  ILE A HG22 7  
ATOM 4717  H HG23 . ILE A 1 2  ? -1.624  2.128   2.988   1.00 0.00 ? 2  ILE A HG23 7  
ATOM 4718  H HD11 . ILE A 1 2  ? -1.337  0.146   3.930   1.00 0.00 ? 2  ILE A HD11 7  
ATOM 4719  H HD12 . ILE A 1 2  ? -0.041  -0.768  4.703   1.00 0.00 ? 2  ILE A HD12 7  
ATOM 4720  H HD13 . ILE A 1 2  ? -1.291  -0.011  5.686   1.00 0.00 ? 2  ILE A HD13 7  
ATOM 4721  N N    . VAL A 1 3  ? 0.446   5.654   4.239   1.00 0.00 ? 3  VAL A N    7  
ATOM 4722  C CA   . VAL A 1 3  ? 1.314   6.429   3.308   1.00 0.00 ? 3  VAL A CA   7  
ATOM 4723  C C    . VAL A 1 3  ? 2.450   7.092   4.093   1.00 0.00 ? 3  VAL A C    7  
ATOM 4724  O O    . VAL A 1 3  ? 3.570   7.177   3.629   1.00 0.00 ? 3  VAL A O    7  
ATOM 4725  C CB   . VAL A 1 3  ? 0.476   7.504   2.612   1.00 0.00 ? 3  VAL A CB   7  
ATOM 4726  C CG1  . VAL A 1 3  ? 1.394   8.450   1.838   1.00 0.00 ? 3  VAL A CG1  7  
ATOM 4727  C CG2  . VAL A 1 3  ? -0.500  6.835   1.640   1.00 0.00 ? 3  VAL A CG2  7  
ATOM 4728  H H    . VAL A 1 3  ? -0.418  6.019   4.519   1.00 0.00 ? 3  VAL A H    7  
ATOM 4729  H HA   . VAL A 1 3  ? 1.731   5.763   2.566   1.00 0.00 ? 3  VAL A HA   7  
ATOM 4730  H HB   . VAL A 1 3  ? -0.078  8.063   3.353   1.00 0.00 ? 3  VAL A HB   7  
ATOM 4731  H HG11 . VAL A 1 3  ? 1.947   7.890   1.099   1.00 0.00 ? 3  VAL A HG11 7  
ATOM 4732  H HG12 . VAL A 1 3  ? 0.798   9.205   1.345   1.00 0.00 ? 3  VAL A HG12 7  
ATOM 4733  H HG13 . VAL A 1 3  ? 2.083   8.924   2.522   1.00 0.00 ? 3  VAL A HG13 7  
ATOM 4734  H HG21 . VAL A 1 3  ? -0.042  5.951   1.221   1.00 0.00 ? 3  VAL A HG21 7  
ATOM 4735  H HG22 . VAL A 1 3  ? -1.401  6.558   2.168   1.00 0.00 ? 3  VAL A HG22 7  
ATOM 4736  H HG23 . VAL A 1 3  ? -0.746  7.523   0.846   1.00 0.00 ? 3  VAL A HG23 7  
ATOM 4737  N N    . GLU A 1 4  ? 2.170   7.565   5.277   1.00 0.00 ? 4  GLU A N    7  
ATOM 4738  C CA   . GLU A 1 4  ? 3.236   8.221   6.088   1.00 0.00 ? 4  GLU A CA   7  
ATOM 4739  C C    . GLU A 1 4  ? 4.261   7.175   6.534   1.00 0.00 ? 4  GLU A C    7  
ATOM 4740  O O    . GLU A 1 4  ? 5.287   7.500   7.101   1.00 0.00 ? 4  GLU A O    7  
ATOM 4741  C CB   . GLU A 1 4  ? 2.609   8.875   7.322   1.00 0.00 ? 4  GLU A CB   7  
ATOM 4742  C CG   . GLU A 1 4  ? 2.129   10.282  6.968   1.00 0.00 ? 4  GLU A CG   7  
ATOM 4743  C CD   . GLU A 1 4  ? 0.698   10.213  6.431   1.00 0.00 ? 4  GLU A CD   7  
ATOM 4744  O OE1  . GLU A 1 4  ? 0.534   9.824   5.286   1.00 0.00 ? 4  GLU A OE1  7  
ATOM 4745  O OE2  . GLU A 1 4  ? -0.209  10.547  7.174   1.00 0.00 ? 4  GLU A OE2  7  
ATOM 4746  H H    . GLU A 1 4  ? 1.261   7.487   5.634   1.00 0.00 ? 4  GLU A H    7  
ATOM 4747  H HA   . GLU A 1 4  ? 3.728   8.977   5.493   1.00 0.00 ? 4  GLU A HA   7  
ATOM 4748  H HB2  . GLU A 1 4  ? 1.771   8.280   7.657   1.00 0.00 ? 4  GLU A HB2  7  
ATOM 4749  H HB3  . GLU A 1 4  ? 3.345   8.935   8.110   1.00 0.00 ? 4  GLU A HB3  7  
ATOM 4750  H HG2  . GLU A 1 4  ? 2.153   10.902  7.851   1.00 0.00 ? 4  GLU A HG2  7  
ATOM 4751  H HG3  . GLU A 1 4  ? 2.773   10.704  6.213   1.00 0.00 ? 4  GLU A HG3  7  
ATOM 4752  N N    . GLN A 1 5  ? 3.994   5.923   6.283   1.00 0.00 ? 5  GLN A N    7  
ATOM 4753  C CA   . GLN A 1 5  ? 4.953   4.859   6.693   1.00 0.00 ? 5  GLN A CA   7  
ATOM 4754  C C    . GLN A 1 5  ? 5.469   4.137   5.448   1.00 0.00 ? 5  GLN A C    7  
ATOM 4755  O O    . GLN A 1 5  ? 6.519   3.528   5.459   1.00 0.00 ? 5  GLN A O    7  
ATOM 4756  C CB   . GLN A 1 5  ? 4.244   3.858   7.607   1.00 0.00 ? 5  GLN A CB   7  
ATOM 4757  C CG   . GLN A 1 5  ? 4.134   4.440   9.018   1.00 0.00 ? 5  GLN A CG   7  
ATOM 4758  C CD   . GLN A 1 5  ? 2.668   4.451   9.457   1.00 0.00 ? 5  GLN A CD   7  
ATOM 4759  O OE1  . GLN A 1 5  ? 1.935   5.369   9.148   1.00 0.00 ? 5  GLN A OE1  7  
ATOM 4760  N NE2  . GLN A 1 5  ? 2.206   3.461   10.171  1.00 0.00 ? 5  GLN A NE2  7  
ATOM 4761  H H    . GLN A 1 5  ? 3.162   5.682   5.826   1.00 0.00 ? 5  GLN A H    7  
ATOM 4762  H HA   . GLN A 1 5  ? 5.784   5.305   7.221   1.00 0.00 ? 5  GLN A HA   7  
ATOM 4763  H HB2  . GLN A 1 5  ? 3.254   3.660   7.221   1.00 0.00 ? 5  GLN A HB2  7  
ATOM 4764  H HB3  . GLN A 1 5  ? 4.809   2.939   7.642   1.00 0.00 ? 5  GLN A HB3  7  
ATOM 4765  H HG2  . GLN A 1 5  ? 4.710   3.833   9.701   1.00 0.00 ? 5  GLN A HG2  7  
ATOM 4766  H HG3  . GLN A 1 5  ? 4.516   5.449   9.023   1.00 0.00 ? 5  GLN A HG3  7  
ATOM 4767  H HE21 . GLN A 1 5  ? 2.796   2.719   10.421  1.00 0.00 ? 5  GLN A HE21 7  
ATOM 4768  H HE22 . GLN A 1 5  ? 1.267   3.458   10.456  1.00 0.00 ? 5  GLN A HE22 7  
ATOM 4769  N N    . CYS A 1 6  ? 4.734   4.203   4.372   1.00 0.00 ? 6  CYS A N    7  
ATOM 4770  C CA   . CYS A 1 6  ? 5.176   3.522   3.122   1.00 0.00 ? 6  CYS A CA   7  
ATOM 4771  C C    . CYS A 1 6  ? 5.701   4.564   2.131   1.00 0.00 ? 6  CYS A C    7  
ATOM 4772  O O    . CYS A 1 6  ? 6.799   4.456   1.626   1.00 0.00 ? 6  CYS A O    7  
ATOM 4773  C CB   . CYS A 1 6  ? 3.994   2.778   2.501   1.00 0.00 ? 6  CYS A CB   7  
ATOM 4774  S SG   . CYS A 1 6  ? 3.293   1.623   3.710   1.00 0.00 ? 6  CYS A SG   7  
ATOM 4775  H H    . CYS A 1 6  ? 3.892   4.701   4.387   1.00 0.00 ? 6  CYS A H    7  
ATOM 4776  H HA   . CYS A 1 6  ? 5.962   2.819   3.353   1.00 0.00 ? 6  CYS A HA   7  
ATOM 4777  H HB2  . CYS A 1 6  ? 3.238   3.490   2.206   1.00 0.00 ? 6  CYS A HB2  7  
ATOM 4778  H HB3  . CYS A 1 6  ? 4.330   2.230   1.633   1.00 0.00 ? 6  CYS A HB3  7  
ATOM 4779  N N    . CYS A 1 7  ? 4.925   5.571   1.848   1.00 0.00 ? 7  CYS A N    7  
ATOM 4780  C CA   . CYS A 1 7  ? 5.379   6.615   0.888   1.00 0.00 ? 7  CYS A CA   7  
ATOM 4781  C C    . CYS A 1 7  ? 6.594   7.351   1.456   1.00 0.00 ? 7  CYS A C    7  
ATOM 4782  O O    . CYS A 1 7  ? 7.471   7.768   0.727   1.00 0.00 ? 7  CYS A O    7  
ATOM 4783  C CB   . CYS A 1 7  ? 4.243   7.612   0.649   1.00 0.00 ? 7  CYS A CB   7  
ATOM 4784  S SG   . CYS A 1 7  ? 4.849   8.980   -0.366  1.00 0.00 ? 7  CYS A SG   7  
ATOM 4785  H H    . CYS A 1 7  ? 4.040   5.639   2.265   1.00 0.00 ? 7  CYS A H    7  
ATOM 4786  H HA   . CYS A 1 7  ? 5.651   6.149   -0.049  1.00 0.00 ? 7  CYS A HA   7  
ATOM 4787  H HB2  . CYS A 1 7  ? 3.429   7.117   0.138   1.00 0.00 ? 7  CYS A HB2  7  
ATOM 4788  H HB3  . CYS A 1 7  ? 3.892   7.992   1.596   1.00 0.00 ? 7  CYS A HB3  7  
ATOM 4789  N N    . THR A 1 8  ? 6.653   7.517   2.749   1.00 0.00 ? 8  THR A N    7  
ATOM 4790  C CA   . THR A 1 8  ? 7.815   8.231   3.351   1.00 0.00 ? 8  THR A CA   7  
ATOM 4791  C C    . THR A 1 8  ? 8.879   7.214   3.771   1.00 0.00 ? 8  THR A C    7  
ATOM 4792  O O    . THR A 1 8  ? 10.003  7.565   4.076   1.00 0.00 ? 8  THR A O    7  
ATOM 4793  C CB   . THR A 1 8  ? 7.349   9.021   4.578   1.00 0.00 ? 8  THR A CB   7  
ATOM 4794  O OG1  . THR A 1 8  ? 6.978   8.117   5.608   1.00 0.00 ? 8  THR A OG1  7  
ATOM 4795  C CG2  . THR A 1 8  ? 6.150   9.891   4.197   1.00 0.00 ? 8  THR A CG2  7  
ATOM 4796  H H    . THR A 1 8  ? 5.937   7.175   3.321   1.00 0.00 ? 8  THR A H    7  
ATOM 4797  H HA   . THR A 1 8  ? 8.235   8.911   2.625   1.00 0.00 ? 8  THR A HA   7  
ATOM 4798  H HB   . THR A 1 8  ? 8.150   9.654   4.925   1.00 0.00 ? 8  THR A HB   7  
ATOM 4799  H HG1  . THR A 1 8  ? 6.479   7.400   5.209   1.00 0.00 ? 8  THR A HG1  7  
ATOM 4800  H HG21 . THR A 1 8  ? 6.413   10.524  3.364   1.00 0.00 ? 8  THR A HG21 7  
ATOM 4801  H HG22 . THR A 1 8  ? 5.320   9.256   3.920   1.00 0.00 ? 8  THR A HG22 7  
ATOM 4802  H HG23 . THR A 1 8  ? 5.867   10.502  5.041   1.00 0.00 ? 8  THR A HG23 7  
ATOM 4803  N N    . SER A 1 9  ? 8.538   5.955   3.786   1.00 0.00 ? 9  SER A N    7  
ATOM 4804  C CA   . SER A 1 9  ? 9.529   4.914   4.182   1.00 0.00 ? 9  SER A CA   7  
ATOM 4805  C C    . SER A 1 9  ? 9.171   3.591   3.493   1.00 0.00 ? 9  SER A C    7  
ATOM 4806  O O    . SER A 1 9  ? 8.811   3.569   2.334   1.00 0.00 ? 9  SER A O    7  
ATOM 4807  C CB   . SER A 1 9  ? 9.493   4.737   5.703   1.00 0.00 ? 9  SER A CB   7  
ATOM 4808  O OG   . SER A 1 9  ? 9.716   5.994   6.328   1.00 0.00 ? 9  SER A OG   7  
ATOM 4809  H H    . SER A 1 9  ? 7.629   5.693   3.534   1.00 0.00 ? 9  SER A H    7  
ATOM 4810  H HA   . SER A 1 9  ? 10.518  5.222   3.878   1.00 0.00 ? 9  SER A HA   7  
ATOM 4811  H HB2  . SER A 1 9  ? 8.530   4.358   6.000   1.00 0.00 ? 9  SER A HB2  7  
ATOM 4812  H HB3  . SER A 1 9  ? 10.262  4.034   6.001   1.00 0.00 ? 9  SER A HB3  7  
ATOM 4813  H HG   . SER A 1 9  ? 9.145   6.046   7.100   1.00 0.00 ? 9  SER A HG   7  
ATOM 4814  N N    . ILE A 1 10 ? 9.260   2.488   4.189   1.00 0.00 ? 10 ILE A N    7  
ATOM 4815  C CA   . ILE A 1 10 ? 8.914   1.186   3.555   1.00 0.00 ? 10 ILE A CA   7  
ATOM 4816  C C    . ILE A 1 10 ? 8.154   0.324   4.560   1.00 0.00 ? 10 ILE A C    7  
ATOM 4817  O O    . ILE A 1 10 ? 8.554   0.179   5.699   1.00 0.00 ? 10 ILE A O    7  
ATOM 4818  C CB   . ILE A 1 10 ? 10.190  0.471   3.117   1.00 0.00 ? 10 ILE A CB   7  
ATOM 4819  C CG1  . ILE A 1 10 ? 11.204  1.522   2.635   1.00 0.00 ? 10 ILE A CG1  7  
ATOM 4820  C CG2  . ILE A 1 10 ? 9.854   -0.506  1.985   1.00 0.00 ? 10 ILE A CG2  7  
ATOM 4821  C CD1  . ILE A 1 10 ? 12.198  0.897   1.647   1.00 0.00 ? 10 ILE A CD1  7  
ATOM 4822  H H    . ILE A 1 10 ? 9.550   2.516   5.122   1.00 0.00 ? 10 ILE A H    7  
ATOM 4823  H HA   . ILE A 1 10 ? 8.289   1.363   2.692   1.00 0.00 ? 10 ILE A HA   7  
ATOM 4824  H HB   . ILE A 1 10 ? 10.603  -0.074  3.953   1.00 0.00 ? 10 ILE A HB   7  
ATOM 4825  H HG12 . ILE A 1 10 ? 10.678  2.328   2.150   1.00 0.00 ? 10 ILE A HG12 7  
ATOM 4826  H HG13 . ILE A 1 10 ? 11.745  1.909   3.484   1.00 0.00 ? 10 ILE A HG13 7  
ATOM 4827  H HG21 . ILE A 1 10 ? 8.885   -0.949  2.170   1.00 0.00 ? 10 ILE A HG21 7  
ATOM 4828  H HG22 . ILE A 1 10 ? 9.831   0.026   1.045   1.00 0.00 ? 10 ILE A HG22 7  
ATOM 4829  H HG23 . ILE A 1 10 ? 10.603  -1.281  1.943   1.00 0.00 ? 10 ILE A HG23 7  
ATOM 4830  H HD11 . ILE A 1 10 ? 12.154  -0.179  1.723   1.00 0.00 ? 10 ILE A HD11 7  
ATOM 4831  H HD12 . ILE A 1 10 ? 11.942  1.200   0.642   1.00 0.00 ? 10 ILE A HD12 7  
ATOM 4832  H HD13 . ILE A 1 10 ? 13.197  1.234   1.881   1.00 0.00 ? 10 ILE A HD13 7  
ATOM 4833  N N    . CYS A 1 11 ? 7.051   -0.240  4.155   1.00 0.00 ? 11 CYS A N    7  
ATOM 4834  C CA   . CYS A 1 11 ? 6.258   -1.081  5.093   1.00 0.00 ? 11 CYS A CA   7  
ATOM 4835  C C    . CYS A 1 11 ? 6.253   -2.530  4.608   1.00 0.00 ? 11 CYS A C    7  
ATOM 4836  O O    . CYS A 1 11 ? 6.837   -2.861  3.594   1.00 0.00 ? 11 CYS A O    7  
ATOM 4837  C CB   . CYS A 1 11 ? 4.818   -0.561  5.153   1.00 0.00 ? 11 CYS A CB   7  
ATOM 4838  S SG   . CYS A 1 11 ? 4.810   1.244   4.992   1.00 0.00 ? 11 CYS A SG   7  
ATOM 4839  H H    . CYS A 1 11 ? 6.740   -0.104  3.236   1.00 0.00 ? 11 CYS A H    7  
ATOM 4840  H HA   . CYS A 1 11 ? 6.696   -1.033  6.078   1.00 0.00 ? 11 CYS A HA   7  
ATOM 4841  H HB2  . CYS A 1 11 ? 4.245   -0.997  4.347   1.00 0.00 ? 11 CYS A HB2  7  
ATOM 4842  H HB3  . CYS A 1 11 ? 4.377   -0.839  6.097   1.00 0.00 ? 11 CYS A HB3  7  
ATOM 4843  N N    . SER A 1 12 ? 5.599   -3.400  5.329   1.00 0.00 ? 12 SER A N    7  
ATOM 4844  C CA   . SER A 1 12 ? 5.552   -4.830  4.916   1.00 0.00 ? 12 SER A CA   7  
ATOM 4845  C C    . SER A 1 12 ? 4.188   -5.140  4.299   1.00 0.00 ? 12 SER A C    7  
ATOM 4846  O O    . SER A 1 12 ? 3.305   -4.306  4.270   1.00 0.00 ? 12 SER A O    7  
ATOM 4847  C CB   . SER A 1 12 ? 5.770   -5.715  6.144   1.00 0.00 ? 12 SER A CB   7  
ATOM 4848  O OG   . SER A 1 12 ? 5.352   -5.012  7.307   1.00 0.00 ? 12 SER A OG   7  
ATOM 4849  H H    . SER A 1 12 ? 5.137   -3.112  6.142   1.00 0.00 ? 12 SER A H    7  
ATOM 4850  H HA   . SER A 1 12 ? 6.330   -5.023  4.191   1.00 0.00 ? 12 SER A HA   7  
ATOM 4851  H HB2  . SER A 1 12 ? 5.188   -6.618  6.048   1.00 0.00 ? 12 SER A HB2  7  
ATOM 4852  H HB3  . SER A 1 12 ? 6.818   -5.970  6.221   1.00 0.00 ? 12 SER A HB3  7  
ATOM 4853  H HG   . SER A 1 12 ? 6.011   -5.157  7.992   1.00 0.00 ? 12 SER A HG   7  
ATOM 4854  N N    . LEU A 1 13 ? 4.007   -6.334  3.804   1.00 0.00 ? 13 LEU A N    7  
ATOM 4855  C CA   . LEU A 1 13 ? 2.700   -6.698  3.191   1.00 0.00 ? 13 LEU A CA   7  
ATOM 4856  C C    . LEU A 1 13 ? 1.630   -6.774  4.282   1.00 0.00 ? 13 LEU A C    7  
ATOM 4857  O O    . LEU A 1 13 ? 0.446   -6.743  4.009   1.00 0.00 ? 13 LEU A O    7  
ATOM 4858  C CB   . LEU A 1 13 ? 2.823   -8.058  2.502   1.00 0.00 ? 13 LEU A CB   7  
ATOM 4859  C CG   . LEU A 1 13 ? 2.809   -7.867  0.986   1.00 0.00 ? 13 LEU A CG   7  
ATOM 4860  C CD1  . LEU A 1 13 ? 1.490   -7.217  0.564   1.00 0.00 ? 13 LEU A CD1  7  
ATOM 4861  C CD2  . LEU A 1 13 ? 3.975   -6.966  0.577   1.00 0.00 ? 13 LEU A CD2  7  
ATOM 4862  H H    . LEU A 1 13 ? 4.732   -6.992  3.837   1.00 0.00 ? 13 LEU A H    7  
ATOM 4863  H HA   . LEU A 1 13 ? 2.422   -5.950  2.464   1.00 0.00 ? 13 LEU A HA   7  
ATOM 4864  H HB2  . LEU A 1 13 ? 3.748   -8.530  2.798   1.00 0.00 ? 13 LEU A HB2  7  
ATOM 4865  H HB3  . LEU A 1 13 ? 1.992   -8.684  2.791   1.00 0.00 ? 13 LEU A HB3  7  
ATOM 4866  H HG   . LEU A 1 13 ? 2.907   -8.828  0.500   1.00 0.00 ? 13 LEU A HG   7  
ATOM 4867  H HD11 . LEU A 1 13 ? 0.926   -6.943  1.443   1.00 0.00 ? 13 LEU A HD11 7  
ATOM 4868  H HD12 . LEU A 1 13 ? 1.697   -6.332  -0.021  1.00 0.00 ? 13 LEU A HD12 7  
ATOM 4869  H HD13 . LEU A 1 13 ? 0.918   -7.915  -0.030  1.00 0.00 ? 13 LEU A HD13 7  
ATOM 4870  H HD21 . LEU A 1 13 ? 4.223   -6.305  1.393   1.00 0.00 ? 13 LEU A HD21 7  
ATOM 4871  H HD22 . LEU A 1 13 ? 4.834   -7.574  0.332   1.00 0.00 ? 13 LEU A HD22 7  
ATOM 4872  H HD23 . LEU A 1 13 ? 3.693   -6.380  -0.286  1.00 0.00 ? 13 LEU A HD23 7  
ATOM 4873  N N    . TYR A 1 14 ? 2.041   -6.872  5.516   1.00 0.00 ? 14 TYR A N    7  
ATOM 4874  C CA   . TYR A 1 14 ? 1.056   -6.950  6.631   1.00 0.00 ? 14 TYR A CA   7  
ATOM 4875  C C    . TYR A 1 14 ? 0.375   -5.591  6.809   1.00 0.00 ? 14 TYR A C    7  
ATOM 4876  O O    . TYR A 1 14 ? -0.715  -5.495  7.336   1.00 0.00 ? 14 TYR A O    7  
ATOM 4877  C CB   . TYR A 1 14 ? 1.789   -7.326  7.920   1.00 0.00 ? 14 TYR A CB   7  
ATOM 4878  C CG   . TYR A 1 14 ? 0.882   -7.103  9.108   1.00 0.00 ? 14 TYR A CG   7  
ATOM 4879  C CD1  . TYR A 1 14 ? -0.372  -7.724  9.158   1.00 0.00 ? 14 TYR A CD1  7  
ATOM 4880  C CD2  . TYR A 1 14 ? 1.296   -6.275  10.155  1.00 0.00 ? 14 TYR A CD2  7  
ATOM 4881  C CE1  . TYR A 1 14 ? -1.211  -7.514  10.259  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 4882  C CE2  . TYR A 1 14 ? 0.458   -6.065  11.256  1.00 0.00 ? 14 TYR A CE2  7  
ATOM 4883  C CZ   . TYR A 1 14 ? -0.797  -6.685  11.307  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 4884  O OH   . TYR A 1 14 ? -1.624  -6.478  12.393  1.00 0.00 ? 14 TYR A OH   7  
ATOM 4885  H H    . TYR A 1 14 ? 3.001   -6.895  5.710   1.00 0.00 ? 14 TYR A H    7  
ATOM 4886  H HA   . TYR A 1 14 ? 0.312   -7.700  6.405   1.00 0.00 ? 14 TYR A HA   7  
ATOM 4887  H HB2  . TYR A 1 14 ? 2.079   -8.366  7.878   1.00 0.00 ? 14 TYR A HB2  7  
ATOM 4888  H HB3  . TYR A 1 14 ? 2.670   -6.711  8.021   1.00 0.00 ? 14 TYR A HB3  7  
ATOM 4889  H HD1  . TYR A 1 14 ? -0.692  -8.364  8.349   1.00 0.00 ? 14 TYR A HD1  7  
ATOM 4890  H HD2  . TYR A 1 14 ? 2.265   -5.796  10.113  1.00 0.00 ? 14 TYR A HD2  7  
ATOM 4891  H HE1  . TYR A 1 14 ? -2.180  -7.993  10.299  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 4892  H HE2  . TYR A 1 14 ? 0.778   -5.425  12.065  1.00 0.00 ? 14 TYR A HE2  7  
ATOM 4893  H HH   . TYR A 1 14 ? -1.106  -6.056  13.084  1.00 0.00 ? 14 TYR A HH   7  
ATOM 4894  N N    . GLN A 1 15 ? 1.013   -4.539  6.380   1.00 0.00 ? 15 GLN A N    7  
ATOM 4895  C CA   . GLN A 1 15 ? 0.403   -3.186  6.531   1.00 0.00 ? 15 GLN A CA   7  
ATOM 4896  C C    . GLN A 1 15 ? -0.756  -3.029  5.545   1.00 0.00 ? 15 GLN A C    7  
ATOM 4897  O O    . GLN A 1 15 ? -1.854  -2.672  5.920   1.00 0.00 ? 15 GLN A O    7  
ATOM 4898  C CB   . GLN A 1 15 ? 1.464   -2.119  6.259   1.00 0.00 ? 15 GLN A CB   7  
ATOM 4899  C CG   . GLN A 1 15 ? 2.475   -2.104  7.405   1.00 0.00 ? 15 GLN A CG   7  
ATOM 4900  C CD   . GLN A 1 15 ? 2.336   -0.797  8.188   1.00 0.00 ? 15 GLN A CD   7  
ATOM 4901  O OE1  . GLN A 1 15 ? 2.489   0.274   7.637   1.00 0.00 ? 15 GLN A OE1  7  
ATOM 4902  N NE2  . GLN A 1 15 ? 2.049   -0.840  9.460   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 4903  H H    . GLN A 1 15 ? 1.894   -4.637  5.962   1.00 0.00 ? 15 GLN A H    7  
ATOM 4904  H HA   . GLN A 1 15 ? 0.034   -3.072  7.539   1.00 0.00 ? 15 GLN A HA   7  
ATOM 4905  H HB2  . GLN A 1 15 ? 1.971   -2.344  5.331   1.00 0.00 ? 15 GLN A HB2  7  
ATOM 4906  H HB3  . GLN A 1 15 ? 0.991   -1.153  6.186   1.00 0.00 ? 15 GLN A HB3  7  
ATOM 4907  H HG2  . GLN A 1 15 ? 2.284   -2.940  8.063   1.00 0.00 ? 15 GLN A HG2  7  
ATOM 4908  H HG3  . GLN A 1 15 ? 3.475   -2.180  7.008   1.00 0.00 ? 15 GLN A HG3  7  
ATOM 4909  H HE21 . GLN A 1 15 ? 1.925   -1.704  9.907   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 4910  H HE22 . GLN A 1 15 ? 1.957   -0.008  9.970   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 4911  N N    . LEU A 1 16 ? -0.525  -3.291  4.287   1.00 0.00 ? 16 LEU A N    7  
ATOM 4912  C CA   . LEU A 1 16 ? -1.618  -3.158  3.286   1.00 0.00 ? 16 LEU A CA   7  
ATOM 4913  C C    . LEU A 1 16 ? -2.722  -4.169  3.600   1.00 0.00 ? 16 LEU A C    7  
ATOM 4914  O O    . LEU A 1 16 ? -3.806  -4.107  3.054   1.00 0.00 ? 16 LEU A O    7  
ATOM 4915  C CB   . LEU A 1 16 ? -1.070  -3.432  1.880   1.00 0.00 ? 16 LEU A CB   7  
ATOM 4916  C CG   . LEU A 1 16 ? 0.267   -2.704  1.644   1.00 0.00 ? 16 LEU A CG   7  
ATOM 4917  C CD1  . LEU A 1 16 ? 0.339   -2.272  0.183   1.00 0.00 ? 16 LEU A CD1  7  
ATOM 4918  C CD2  . LEU A 1 16 ? 0.385   -1.462  2.531   1.00 0.00 ? 16 LEU A CD2  7  
ATOM 4919  H H    . LEU A 1 16 ? 0.363   -3.574  4.000   1.00 0.00 ? 16 LEU A H    7  
ATOM 4920  H HA   . LEU A 1 16 ? -2.024  -2.158  3.326   1.00 0.00 ? 16 LEU A HA   7  
ATOM 4921  H HB2  . LEU A 1 16 ? -0.915  -4.493  1.765   1.00 0.00 ? 16 LEU A HB2  7  
ATOM 4922  H HB3  . LEU A 1 16 ? -1.790  -3.096  1.147   1.00 0.00 ? 16 LEU A HB3  7  
ATOM 4923  H HG   . LEU A 1 16 ? 1.082   -3.381  1.857   1.00 0.00 ? 16 LEU A HG   7  
ATOM 4924  H HD11 . LEU A 1 16 ? 0.138   -3.120  -0.456  1.00 0.00 ? 16 LEU A HD11 7  
ATOM 4925  H HD12 . LEU A 1 16 ? -0.399  -1.503  0.001   1.00 0.00 ? 16 LEU A HD12 7  
ATOM 4926  H HD13 . LEU A 1 16 ? 1.325   -1.885  -0.031  1.00 0.00 ? 16 LEU A HD13 7  
ATOM 4927  H HD21 . LEU A 1 16 ? -0.601  -1.100  2.779   1.00 0.00 ? 16 LEU A HD21 7  
ATOM 4928  H HD22 . LEU A 1 16 ? 0.913   -1.716  3.437   1.00 0.00 ? 16 LEU A HD22 7  
ATOM 4929  H HD23 . LEU A 1 16 ? 0.927   -0.692  2.001   1.00 0.00 ? 16 LEU A HD23 7  
ATOM 4930  N N    . GLU A 1 17 ? -2.462  -5.102  4.475   1.00 0.00 ? 17 GLU A N    7  
ATOM 4931  C CA   . GLU A 1 17 ? -3.507  -6.107  4.818   1.00 0.00 ? 17 GLU A CA   7  
ATOM 4932  C C    . GLU A 1 17 ? -4.709  -5.380  5.425   1.00 0.00 ? 17 GLU A C    7  
ATOM 4933  O O    . GLU A 1 17 ? -5.817  -5.875  5.422   1.00 0.00 ? 17 GLU A O    7  
ATOM 4934  C CB   . GLU A 1 17 ? -2.945  -7.111  5.825   1.00 0.00 ? 17 GLU A CB   7  
ATOM 4935  C CG   . GLU A 1 17 ? -2.145  -8.183  5.083   1.00 0.00 ? 17 GLU A CG   7  
ATOM 4936  C CD   . GLU A 1 17 ? -2.442  -9.555  5.690   1.00 0.00 ? 17 GLU A CD   7  
ATOM 4937  O OE1  . GLU A 1 17 ? -3.494  -10.099 5.393   1.00 0.00 ? 17 GLU A OE1  7  
ATOM 4938  O OE2  . GLU A 1 17 ? -1.614  -10.041 6.442   1.00 0.00 ? 17 GLU A OE2  7  
ATOM 4939  H H    . GLU A 1 17 ? -1.583  -5.141  4.908   1.00 0.00 ? 17 GLU A H    7  
ATOM 4940  H HA   . GLU A 1 17 ? -3.816  -6.626  3.920   1.00 0.00 ? 17 GLU A HA   7  
ATOM 4941  H HB2  . GLU A 1 17 ? -2.301  -6.598  6.522   1.00 0.00 ? 17 GLU A HB2  7  
ATOM 4942  H HB3  . GLU A 1 17 ? -3.759  -7.579  6.359   1.00 0.00 ? 17 GLU A HB3  7  
ATOM 4943  H HG2  . GLU A 1 17 ? -2.421  -8.182  4.040   1.00 0.00 ? 17 GLU A HG2  7  
ATOM 4944  H HG3  . GLU A 1 17 ? -1.089  -7.973  5.176   1.00 0.00 ? 17 GLU A HG3  7  
ATOM 4945  N N    . ASN A 1 18 ? -4.489  -4.201  5.939   1.00 0.00 ? 18 ASN A N    7  
ATOM 4946  C CA   . ASN A 1 18 ? -5.606  -3.422  6.540   1.00 0.00 ? 18 ASN A CA   7  
ATOM 4947  C C    . ASN A 1 18 ? -6.423  -2.780  5.419   1.00 0.00 ? 18 ASN A C    7  
ATOM 4948  O O    . ASN A 1 18 ? -7.601  -2.521  5.561   1.00 0.00 ? 18 ASN A O    7  
ATOM 4949  C CB   . ASN A 1 18 ? -5.035  -2.324  7.442   1.00 0.00 ? 18 ASN A CB   7  
ATOM 4950  C CG   . ASN A 1 18 ? -4.255  -2.966  8.591   1.00 0.00 ? 18 ASN A CG   7  
ATOM 4951  O OD1  . ASN A 1 18 ? -4.765  -3.824  9.283   1.00 0.00 ? 18 ASN A OD1  7  
ATOM 4952  N ND2  . ASN A 1 18 ? -3.029  -2.584  8.824   1.00 0.00 ? 18 ASN A ND2  7  
ATOM 4953  H H    . ASN A 1 18 ? -3.586  -3.823  5.920   1.00 0.00 ? 18 ASN A H    7  
ATOM 4954  H HA   . ASN A 1 18 ? -6.238  -4.078  7.120   1.00 0.00 ? 18 ASN A HA   7  
ATOM 4955  H HB2  . ASN A 1 18 ? -4.377  -1.690  6.867   1.00 0.00 ? 18 ASN A HB2  7  
ATOM 4956  H HB3  . ASN A 1 18 ? -5.844  -1.733  7.845   1.00 0.00 ? 18 ASN A HB3  7  
ATOM 4957  H HD21 . ASN A 1 18 ? -2.617  -1.893  8.265   1.00 0.00 ? 18 ASN A HD21 7  
ATOM 4958  H HD22 . ASN A 1 18 ? -2.521  -2.990  9.557   1.00 0.00 ? 18 ASN A HD22 7  
ATOM 4959  N N    . TYR A 1 19 ? -5.797  -2.519  4.304   1.00 0.00 ? 19 TYR A N    7  
ATOM 4960  C CA   . TYR A 1 19 ? -6.520  -1.893  3.164   1.00 0.00 ? 19 TYR A CA   7  
ATOM 4961  C C    . TYR A 1 19 ? -7.329  -2.952  2.410   1.00 0.00 ? 19 TYR A C    7  
ATOM 4962  O O    . TYR A 1 19 ? -7.875  -2.691  1.356   1.00 0.00 ? 19 TYR A O    7  
ATOM 4963  C CB   . TYR A 1 19 ? -5.505  -1.250  2.220   1.00 0.00 ? 19 TYR A CB   7  
ATOM 4964  C CG   . TYR A 1 19 ? -5.263  0.165   2.664   1.00 0.00 ? 19 TYR A CG   7  
ATOM 4965  C CD1  . TYR A 1 19 ? -6.185  1.159   2.330   1.00 0.00 ? 19 TYR A CD1  7  
ATOM 4966  C CD2  . TYR A 1 19 ? -4.126  0.480   3.415   1.00 0.00 ? 19 TYR A CD2  7  
ATOM 4967  C CE1  . TYR A 1 19 ? -5.976  2.476   2.751   1.00 0.00 ? 19 TYR A CE1  7  
ATOM 4968  C CE2  . TYR A 1 19 ? -3.918  1.798   3.835   1.00 0.00 ? 19 TYR A CE2  7  
ATOM 4969  C CZ   . TYR A 1 19 ? -4.844  2.796   3.506   1.00 0.00 ? 19 TYR A CZ   7  
ATOM 4970  O OH   . TYR A 1 19 ? -4.634  4.094   3.923   1.00 0.00 ? 19 TYR A OH   7  
ATOM 4971  H H    . TYR A 1 19 ? -4.846  -2.733  4.219   1.00 0.00 ? 19 TYR A H    7  
ATOM 4972  H HA   . TYR A 1 19 ? -7.190  -1.133  3.541   1.00 0.00 ? 19 TYR A HA   7  
ATOM 4973  H HB2  . TYR A 1 19 ? -4.578  -1.803  2.250   1.00 0.00 ? 19 TYR A HB2  7  
ATOM 4974  H HB3  . TYR A 1 19 ? -5.893  -1.246  1.217   1.00 0.00 ? 19 TYR A HB3  7  
ATOM 4975  H HD1  . TYR A 1 19 ? -7.058  0.907   1.749   1.00 0.00 ? 19 TYR A HD1  7  
ATOM 4976  H HD2  . TYR A 1 19 ? -3.406  -0.295  3.664   1.00 0.00 ? 19 TYR A HD2  7  
ATOM 4977  H HE1  . TYR A 1 19 ? -6.689  3.244   2.495   1.00 0.00 ? 19 TYR A HE1  7  
ATOM 4978  H HE2  . TYR A 1 19 ? -3.053  2.043   4.417   1.00 0.00 ? 19 TYR A HE2  7  
ATOM 4979  H HH   . TYR A 1 19 ? -3.731  4.163   4.240   1.00 0.00 ? 19 TYR A HH   7  
ATOM 4980  N N    . CYS A 1 20 ? -7.415  -4.141  2.938   1.00 0.00 ? 20 CYS A N    7  
ATOM 4981  C CA   . CYS A 1 20 ? -8.195  -5.205  2.245   1.00 0.00 ? 20 CYS A CA   7  
ATOM 4982  C C    . CYS A 1 20 ? -9.658  -5.133  2.686   1.00 0.00 ? 20 CYS A C    7  
ATOM 4983  O O    . CYS A 1 20 ? -9.962  -4.803  3.815   1.00 0.00 ? 20 CYS A O    7  
ATOM 4984  C CB   . CYS A 1 20 ? -7.619  -6.573  2.603   1.00 0.00 ? 20 CYS A CB   7  
ATOM 4985  S SG   . CYS A 1 20 ? -6.722  -7.238  1.178   1.00 0.00 ? 20 CYS A SG   7  
ATOM 4986  H H    . CYS A 1 20 ? -6.972  -4.335  3.789   1.00 0.00 ? 20 CYS A H    7  
ATOM 4987  H HA   . CYS A 1 20 ? -8.133  -5.060  1.180   1.00 0.00 ? 20 CYS A HA   7  
ATOM 4988  H HB2  . CYS A 1 20 ? -6.946  -6.476  3.441   1.00 0.00 ? 20 CYS A HB2  7  
ATOM 4989  H HB3  . CYS A 1 20 ? -8.425  -7.240  2.862   1.00 0.00 ? 20 CYS A HB3  7  
ATOM 4990  N N    . ASN A 1 21 ? -10.568 -5.437  1.800   1.00 0.00 ? 21 ASN A N    7  
ATOM 4991  C CA   . ASN A 1 21 ? -12.014 -5.384  2.164   1.00 0.00 ? 21 ASN A CA   7  
ATOM 4992  C C    . ASN A 1 21 ? -12.408 -6.674  2.883   1.00 0.00 ? 21 ASN A C    7  
ATOM 4993  O O    . ASN A 1 21 ? -13.240 -7.393  2.355   1.00 0.00 ? 21 ASN A O    7  
ATOM 4994  C CB   . ASN A 1 21 ? -12.851 -5.232  0.893   1.00 0.00 ? 21 ASN A CB   7  
ATOM 4995  C CG   . ASN A 1 21 ? -14.112 -4.423  1.202   1.00 0.00 ? 21 ASN A CG   7  
ATOM 4996  O OD1  . ASN A 1 21 ? -15.106 -4.967  1.639   1.00 0.00 ? 21 ASN A OD1  7  
ATOM 4997  N ND2  . ASN A 1 21 ? -14.114 -3.135  0.991   1.00 0.00 ? 21 ASN A ND2  7  
ATOM 4998  O OXT  . ASN A 1 21 ? -11.873 -6.922  3.951   1.00 0.00 ? 21 ASN A OXT  7  
ATOM 4999  H H    . ASN A 1 21 ? -10.301 -5.698  0.893   1.00 0.00 ? 21 ASN A H    7  
ATOM 5000  H HA   . ASN A 1 21 ? -12.190 -4.539  2.814   1.00 0.00 ? 21 ASN A HA   7  
ATOM 5001  H HB2  . ASN A 1 21 ? -12.271 -4.720  0.139   1.00 0.00 ? 21 ASN A HB2  7  
ATOM 5002  H HB3  . ASN A 1 21 ? -13.133 -6.208  0.530   1.00 0.00 ? 21 ASN A HB3  7  
ATOM 5003  H HD21 . ASN A 1 21 ? -13.312 -2.696  0.640   1.00 0.00 ? 21 ASN A HD21 7  
ATOM 5004  H HD22 . ASN A 1 21 ? -14.917 -2.608  1.184   1.00 0.00 ? 21 ASN A HD22 7  
ATOM 5005  N N    . PHE B 2 1  ? 6.275   -7.896  -4.941  1.00 0.00 ? 1  PHE B N    7  
ATOM 5006  C CA   . PHE B 2 1  ? 6.304   -7.576  -3.486  1.00 0.00 ? 1  PHE B CA   7  
ATOM 5007  C C    . PHE B 2 1  ? 7.692   -7.055  -3.102  1.00 0.00 ? 1  PHE B C    7  
ATOM 5008  O O    . PHE B 2 1  ? 8.288   -7.492  -2.137  1.00 0.00 ? 1  PHE B O    7  
ATOM 5009  C CB   . PHE B 2 1  ? 5.970   -8.838  -2.678  1.00 0.00 ? 1  PHE B CB   7  
ATOM 5010  C CG   . PHE B 2 1  ? 7.175   -9.749  -2.602  1.00 0.00 ? 1  PHE B CG   7  
ATOM 5011  C CD1  . PHE B 2 1  ? 7.962   -9.980  -3.738  1.00 0.00 ? 1  PHE B CD1  7  
ATOM 5012  C CD2  . PHE B 2 1  ? 7.506   -10.365 -1.388  1.00 0.00 ? 1  PHE B CD2  7  
ATOM 5013  C CE1  . PHE B 2 1  ? 9.073   -10.825 -3.662  1.00 0.00 ? 1  PHE B CE1  7  
ATOM 5014  C CE2  . PHE B 2 1  ? 8.620   -11.210 -1.311  1.00 0.00 ? 1  PHE B CE2  7  
ATOM 5015  C CZ   . PHE B 2 1  ? 9.403   -11.439 -2.449  1.00 0.00 ? 1  PHE B CZ   7  
ATOM 5016  H H1   . PHE B 2 1  ? 7.228   -7.783  -5.340  1.00 0.00 ? 1  PHE B H1   7  
ATOM 5017  H H2   . PHE B 2 1  ? 5.958   -8.878  -5.072  1.00 0.00 ? 1  PHE B H2   7  
ATOM 5018  H H3   . PHE B 2 1  ? 5.618   -7.251  -5.424  1.00 0.00 ? 1  PHE B H3   7  
ATOM 5019  H HA   . PHE B 2 1  ? 5.571   -6.813  -3.276  1.00 0.00 ? 1  PHE B HA   7  
ATOM 5020  H HB2  . PHE B 2 1  ? 5.675   -8.554  -1.677  1.00 0.00 ? 1  PHE B HB2  7  
ATOM 5021  H HB3  . PHE B 2 1  ? 5.156   -9.363  -3.156  1.00 0.00 ? 1  PHE B HB3  7  
ATOM 5022  H HD1  . PHE B 2 1  ? 7.708   -9.508  -4.676  1.00 0.00 ? 1  PHE B HD1  7  
ATOM 5023  H HD2  . PHE B 2 1  ? 6.903   -10.189 -0.510  1.00 0.00 ? 1  PHE B HD2  7  
ATOM 5024  H HE1  . PHE B 2 1  ? 9.679   -11.003 -4.538  1.00 0.00 ? 1  PHE B HE1  7  
ATOM 5025  H HE2  . PHE B 2 1  ? 8.873   -11.684 -0.375  1.00 0.00 ? 1  PHE B HE2  7  
ATOM 5026  H HZ   . PHE B 2 1  ? 10.262  -12.092 -2.389  1.00 0.00 ? 1  PHE B HZ   7  
ATOM 5027  N N    . VAL B 2 2  ? 8.209   -6.120  -3.849  1.00 0.00 ? 2  VAL B N    7  
ATOM 5028  C CA   . VAL B 2 2  ? 9.557   -5.572  -3.530  1.00 0.00 ? 2  VAL B CA   7  
ATOM 5029  C C    . VAL B 2 2  ? 9.439   -4.548  -2.397  1.00 0.00 ? 2  VAL B C    7  
ATOM 5030  O O    . VAL B 2 2  ? 8.538   -3.734  -2.375  1.00 0.00 ? 2  VAL B O    7  
ATOM 5031  C CB   . VAL B 2 2  ? 10.134  -4.885  -4.769  1.00 0.00 ? 2  VAL B CB   7  
ATOM 5032  C CG1  . VAL B 2 2  ? 11.661  -4.887  -4.690  1.00 0.00 ? 2  VAL B CG1  7  
ATOM 5033  C CG2  . VAL B 2 2  ? 9.687   -5.640  -6.023  1.00 0.00 ? 2  VAL B CG2  7  
ATOM 5034  H H    . VAL B 2 2  ? 7.712   -5.782  -4.622  1.00 0.00 ? 2  VAL B H    7  
ATOM 5035  H HA   . VAL B 2 2  ? 10.212  -6.374  -3.224  1.00 0.00 ? 2  VAL B HA   7  
ATOM 5036  H HB   . VAL B 2 2  ? 9.779   -3.865  -4.814  1.00 0.00 ? 2  VAL B HB   7  
ATOM 5037  H HG11 . VAL B 2 2  ? 11.972  -4.633  -3.688  1.00 0.00 ? 2  VAL B HG11 7  
ATOM 5038  H HG12 . VAL B 2 2  ? 12.033  -5.870  -4.942  1.00 0.00 ? 2  VAL B HG12 7  
ATOM 5039  H HG13 . VAL B 2 2  ? 12.059  -4.163  -5.386  1.00 0.00 ? 2  VAL B HG13 7  
ATOM 5040  H HG21 . VAL B 2 2  ? 9.658   -6.699  -5.816  1.00 0.00 ? 2  VAL B HG21 7  
ATOM 5041  H HG22 . VAL B 2 2  ? 8.703   -5.303  -6.315  1.00 0.00 ? 2  VAL B HG22 7  
ATOM 5042  H HG23 . VAL B 2 2  ? 10.384  -5.450  -6.827  1.00 0.00 ? 2  VAL B HG23 7  
ATOM 5043  N N    . ASN B 2 3  ? 10.344  -4.583  -1.454  1.00 0.00 ? 3  ASN B N    7  
ATOM 5044  C CA   . ASN B 2 3  ? 10.284  -3.610  -0.326  1.00 0.00 ? 3  ASN B CA   7  
ATOM 5045  C C    . ASN B 2 3  ? 10.806  -2.252  -0.800  1.00 0.00 ? 3  ASN B C    7  
ATOM 5046  O O    . ASN B 2 3  ? 11.989  -1.979  -0.751  1.00 0.00 ? 3  ASN B O    7  
ATOM 5047  C CB   . ASN B 2 3  ? 11.151  -4.113  0.831   1.00 0.00 ? 3  ASN B CB   7  
ATOM 5048  C CG   . ASN B 2 3  ? 12.513  -4.562  0.296   1.00 0.00 ? 3  ASN B CG   7  
ATOM 5049  O OD1  . ASN B 2 3  ? 13.419  -3.763  0.159   1.00 0.00 ? 3  ASN B OD1  7  
ATOM 5050  N ND2  . ASN B 2 3  ? 12.696  -5.816  -0.014  1.00 0.00 ? 3  ASN B ND2  7  
ATOM 5051  H H    . ASN B 2 3  ? 11.064  -5.248  -1.492  1.00 0.00 ? 3  ASN B H    7  
ATOM 5052  H HA   . ASN B 2 3  ? 9.262   -3.507  0.007   1.00 0.00 ? 3  ASN B HA   7  
ATOM 5053  H HB2  . ASN B 2 3  ? 11.290  -3.315  1.547   1.00 0.00 ? 3  ASN B HB2  7  
ATOM 5054  H HB3  . ASN B 2 3  ? 10.662  -4.946  1.312   1.00 0.00 ? 3  ASN B HB3  7  
ATOM 5055  H HD21 . ASN B 2 3  ? 11.967  -6.460  0.096   1.00 0.00 ? 3  ASN B HD21 7  
ATOM 5056  H HD22 . ASN B 2 3  ? 13.566  -6.113  -0.356  1.00 0.00 ? 3  ASN B HD22 7  
ATOM 5057  N N    . GLN B 2 4  ? 9.931   -1.396  -1.261  1.00 0.00 ? 4  GLN B N    7  
ATOM 5058  C CA   . GLN B 2 4  ? 10.378  -0.056  -1.736  1.00 0.00 ? 4  GLN B CA   7  
ATOM 5059  C C    . GLN B 2 4  ? 9.436   1.017   -1.185  1.00 0.00 ? 4  GLN B C    7  
ATOM 5060  O O    . GLN B 2 4  ? 8.524   0.727   -0.437  1.00 0.00 ? 4  GLN B O    7  
ATOM 5061  C CB   . GLN B 2 4  ? 10.350  -0.020  -3.266  1.00 0.00 ? 4  GLN B CB   7  
ATOM 5062  C CG   . GLN B 2 4  ? 10.944  -1.314  -3.824  1.00 0.00 ? 4  GLN B CG   7  
ATOM 5063  C CD   . GLN B 2 4  ? 12.466  -1.186  -3.905  1.00 0.00 ? 4  GLN B CD   7  
ATOM 5064  O OE1  . GLN B 2 4  ? 13.185  -1.981  -3.332  1.00 0.00 ? 4  GLN B OE1  7  
ATOM 5065  N NE2  . GLN B 2 4  ? 12.990  -0.213  -4.600  1.00 0.00 ? 4  GLN B NE2  7  
ATOM 5066  H H    . GLN B 2 4  ? 8.982   -1.636  -1.292  1.00 0.00 ? 4  GLN B H    7  
ATOM 5067  H HA   . GLN B 2 4  ? 11.384  0.133   -1.390  1.00 0.00 ? 4  GLN B HA   7  
ATOM 5068  H HB2  . GLN B 2 4  ? 9.329   0.085   -3.604  1.00 0.00 ? 4  GLN B HB2  7  
ATOM 5069  H HB3  . GLN B 2 4  ? 10.933  0.819   -3.618  1.00 0.00 ? 4  GLN B HB3  7  
ATOM 5070  H HG2  . GLN B 2 4  ? 10.685  -2.139  -3.177  1.00 0.00 ? 4  GLN B HG2  7  
ATOM 5071  H HG3  . GLN B 2 4  ? 10.547  -1.493  -4.814  1.00 0.00 ? 4  GLN B HG3  7  
ATOM 5072  H HE21 . GLN B 2 4  ? 12.409  0.427   -5.061  1.00 0.00 ? 4  GLN B HE21 7  
ATOM 5073  H HE22 . GLN B 2 4  ? 13.964  -0.123  -4.657  1.00 0.00 ? 4  GLN B HE22 7  
ATOM 5074  N N    . HIS B 2 5  ? 9.650   2.254   -1.545  1.00 0.00 ? 5  HIS B N    7  
ATOM 5075  C CA   . HIS B 2 5  ? 8.763   3.340   -1.036  1.00 0.00 ? 5  HIS B CA   7  
ATOM 5076  C C    . HIS B 2 5  ? 7.466   3.364   -1.848  1.00 0.00 ? 5  HIS B C    7  
ATOM 5077  O O    . HIS B 2 5  ? 7.477   3.265   -3.059  1.00 0.00 ? 5  HIS B O    7  
ATOM 5078  C CB   . HIS B 2 5  ? 9.477   4.686   -1.164  1.00 0.00 ? 5  HIS B CB   7  
ATOM 5079  C CG   . HIS B 2 5  ? 10.754  4.652   -0.371  1.00 0.00 ? 5  HIS B CG   7  
ATOM 5080  N ND1  . HIS B 2 5  ? 11.180  3.514   0.296   1.00 0.00 ? 5  HIS B ND1  7  
ATOM 5081  C CD2  . HIS B 2 5  ? 11.712  5.607   -0.127  1.00 0.00 ? 5  HIS B CD2  7  
ATOM 5082  C CE1  . HIS B 2 5  ? 12.345  3.810   0.904   1.00 0.00 ? 5  HIS B CE1  7  
ATOM 5083  N NE2  . HIS B 2 5  ? 12.713  5.074   0.677   1.00 0.00 ? 5  HIS B NE2  7  
ATOM 5084  H H    . HIS B 2 5  ? 10.392  2.468   -2.149  1.00 0.00 ? 5  HIS B H    7  
ATOM 5085  H HA   . HIS B 2 5  ? 8.533   3.156   0.002   1.00 0.00 ? 5  HIS B HA   7  
ATOM 5086  H HB2  . HIS B 2 5  ? 9.705   4.877   -2.205  1.00 0.00 ? 5  HIS B HB2  7  
ATOM 5087  H HB3  . HIS B 2 5  ? 8.838   5.471   -0.786  1.00 0.00 ? 5  HIS B HB3  7  
ATOM 5088  H HD1  . HIS B 2 5  ? 10.718  2.652   0.322   1.00 0.00 ? 5  HIS B HD1  7  
ATOM 5089  H HD2  . HIS B 2 5  ? 11.689  6.617   -0.503  1.00 0.00 ? 5  HIS B HD2  7  
ATOM 5090  H HE1  . HIS B 2 5  ? 12.913  3.113   1.501   1.00 0.00 ? 5  HIS B HE1  7  
ATOM 5091  N N    . LEU B 2 6  ? 6.347   3.486   -1.186  1.00 0.00 ? 6  LEU B N    7  
ATOM 5092  C CA   . LEU B 2 6  ? 5.043   3.509   -1.908  1.00 0.00 ? 6  LEU B CA   7  
ATOM 5093  C C    . LEU B 2 6  ? 4.469   4.929   -1.907  1.00 0.00 ? 6  LEU B C    7  
ATOM 5094  O O    . LEU B 2 6  ? 3.910   5.381   -0.926  1.00 0.00 ? 6  LEU B O    7  
ATOM 5095  C CB   . LEU B 2 6  ? 4.069   2.560   -1.208  1.00 0.00 ? 6  LEU B CB   7  
ATOM 5096  C CG   . LEU B 2 6  ? 4.726   1.186   -1.043  1.00 0.00 ? 6  LEU B CG   7  
ATOM 5097  C CD1  . LEU B 2 6  ? 3.814   0.278   -0.215  1.00 0.00 ? 6  LEU B CD1  7  
ATOM 5098  C CD2  . LEU B 2 6  ? 4.948   0.559   -2.419  1.00 0.00 ? 6  LEU B CD2  7  
ATOM 5099  H H    . LEU B 2 6  ? 6.364   3.557   -0.208  1.00 0.00 ? 6  LEU B H    7  
ATOM 5100  H HA   . LEU B 2 6  ? 5.188   3.183   -2.926  1.00 0.00 ? 6  LEU B HA   7  
ATOM 5101  H HB2  . LEU B 2 6  ? 3.819   2.957   -0.236  1.00 0.00 ? 6  LEU B HB2  7  
ATOM 5102  H HB3  . LEU B 2 6  ? 3.172   2.459   -1.800  1.00 0.00 ? 6  LEU B HB3  7  
ATOM 5103  H HG   . LEU B 2 6  ? 5.674   1.300   -0.538  1.00 0.00 ? 6  LEU B HG   7  
ATOM 5104  H HD11 . LEU B 2 6  ? 3.244   0.877   0.480   1.00 0.00 ? 6  LEU B HD11 7  
ATOM 5105  H HD12 . LEU B 2 6  ? 3.139   -0.252  -0.871  1.00 0.00 ? 6  LEU B HD12 7  
ATOM 5106  H HD13 . LEU B 2 6  ? 4.415   -0.433  0.333   1.00 0.00 ? 6  LEU B HD13 7  
ATOM 5107  H HD21 . LEU B 2 6  ? 4.805   1.310   -3.184  1.00 0.00 ? 6  LEU B HD21 7  
ATOM 5108  H HD22 . LEU B 2 6  ? 5.954   0.172   -2.481  1.00 0.00 ? 6  LEU B HD22 7  
ATOM 5109  H HD23 . LEU B 2 6  ? 4.242   -0.244  -2.568  1.00 0.00 ? 6  LEU B HD23 7  
ATOM 5110  N N    . CYS B 2 7  ? 4.597   5.634   -3.000  1.00 0.00 ? 7  CYS B N    7  
ATOM 5111  C CA   . CYS B 2 7  ? 4.058   7.024   -3.065  1.00 0.00 ? 7  CYS B CA   7  
ATOM 5112  C C    . CYS B 2 7  ? 3.129   7.155   -4.276  1.00 0.00 ? 7  CYS B C    7  
ATOM 5113  O O    . CYS B 2 7  ? 3.403   6.635   -5.339  1.00 0.00 ? 7  CYS B O    7  
ATOM 5114  C CB   . CYS B 2 7  ? 5.214   8.018   -3.208  1.00 0.00 ? 7  CYS B CB   7  
ATOM 5115  S SG   . CYS B 2 7  ? 6.134   8.103   -1.653  1.00 0.00 ? 7  CYS B SG   7  
ATOM 5116  H H    . CYS B 2 7  ? 5.048   5.248   -3.779  1.00 0.00 ? 7  CYS B H    7  
ATOM 5117  H HA   . CYS B 2 7  ? 3.505   7.240   -2.162  1.00 0.00 ? 7  CYS B HA   7  
ATOM 5118  H HB2  . CYS B 2 7  ? 5.873   7.692   -3.998  1.00 0.00 ? 7  CYS B HB2  7  
ATOM 5119  H HB3  . CYS B 2 7  ? 4.821   8.994   -3.446  1.00 0.00 ? 7  CYS B HB3  7  
ATOM 5120  N N    . GLY B 2 8  ? 2.033   7.847   -4.127  1.00 0.00 ? 8  GLY B N    7  
ATOM 5121  C CA   . GLY B 2 8  ? 1.092   8.008   -5.274  1.00 0.00 ? 8  GLY B CA   7  
ATOM 5122  C C    . GLY B 2 8  ? 0.423   6.667   -5.581  1.00 0.00 ? 8  GLY B C    7  
ATOM 5123  O O    . GLY B 2 8  ? -0.073  5.994   -4.700  1.00 0.00 ? 8  GLY B O    7  
ATOM 5124  H H    . GLY B 2 8  ? 1.828   8.264   -3.263  1.00 0.00 ? 8  GLY B H    7  
ATOM 5125  H HA2  . GLY B 2 8  ? 0.336   8.739   -5.018  1.00 0.00 ? 8  GLY B HA2  7  
ATOM 5126  H HA3  . GLY B 2 8  ? 1.637   8.344   -6.143  1.00 0.00 ? 8  GLY B HA3  7  
ATOM 5127  N N    . SER B 2 9  ? 0.403   6.273   -6.825  1.00 0.00 ? 9  SER B N    7  
ATOM 5128  C CA   . SER B 2 9  ? -0.236  4.976   -7.184  1.00 0.00 ? 9  SER B CA   7  
ATOM 5129  C C    . SER B 2 9  ? 0.708   3.820   -6.836  1.00 0.00 ? 9  SER B C    7  
ATOM 5130  O O    . SER B 2 9  ? 0.366   2.664   -6.982  1.00 0.00 ? 9  SER B O    7  
ATOM 5131  C CB   . SER B 2 9  ? -0.539  4.952   -8.682  1.00 0.00 ? 9  SER B CB   7  
ATOM 5132  O OG   . SER B 2 9  ? 0.512   5.604   -9.384  1.00 0.00 ? 9  SER B OG   7  
ATOM 5133  H H    . SER B 2 9  ? 0.807   6.830   -7.524  1.00 0.00 ? 9  SER B H    7  
ATOM 5134  H HA   . SER B 2 9  ? -1.156  4.865   -6.631  1.00 0.00 ? 9  SER B HA   7  
ATOM 5135  H HB2  . SER B 2 9  ? -0.612  3.931   -9.021  1.00 0.00 ? 9  SER B HB2  7  
ATOM 5136  H HB3  . SER B 2 9  ? -1.478  5.456   -8.867  1.00 0.00 ? 9  SER B HB3  7  
ATOM 5137  H HG   . SER B 2 9  ? 1.321   5.488   -8.882  1.00 0.00 ? 9  SER B HG   7  
ATOM 5138  N N    . HIS B 2 10 ? 1.893   4.122   -6.377  1.00 0.00 ? 10 HIS B N    7  
ATOM 5139  C CA   . HIS B 2 10 ? 2.850   3.037   -6.024  1.00 0.00 ? 10 HIS B CA   7  
ATOM 5140  C C    . HIS B 2 10 ? 2.289   2.212   -4.865  1.00 0.00 ? 10 HIS B C    7  
ATOM 5141  O O    . HIS B 2 10 ? 2.465   1.009   -4.807  1.00 0.00 ? 10 HIS B O    7  
ATOM 5142  C CB   . HIS B 2 10 ? 4.189   3.649   -5.608  1.00 0.00 ? 10 HIS B CB   7  
ATOM 5143  C CG   . HIS B 2 10 ? 5.105   3.714   -6.799  1.00 0.00 ? 10 HIS B CG   7  
ATOM 5144  N ND1  . HIS B 2 10 ? 5.365   4.902   -7.466  1.00 0.00 ? 10 HIS B ND1  7  
ATOM 5145  C CD2  . HIS B 2 10 ? 5.830   2.750   -7.454  1.00 0.00 ? 10 HIS B CD2  7  
ATOM 5146  C CE1  . HIS B 2 10 ? 6.213   4.625   -8.472  1.00 0.00 ? 10 HIS B CE1  7  
ATOM 5147  N NE2  . HIS B 2 10 ? 6.529   3.326   -8.510  1.00 0.00 ? 10 HIS B NE2  7  
ATOM 5148  H H    . HIS B 2 10 ? 2.151   5.061   -6.266  1.00 0.00 ? 10 HIS B H    7  
ATOM 5149  H HA   . HIS B 2 10 ? 3.000   2.396   -6.882  1.00 0.00 ? 10 HIS B HA   7  
ATOM 5150  H HB2  . HIS B 2 10 ? 4.024   4.644   -5.224  1.00 0.00 ? 10 HIS B HB2  7  
ATOM 5151  H HB3  . HIS B 2 10 ? 4.641   3.038   -4.841  1.00 0.00 ? 10 HIS B HB3  7  
ATOM 5152  H HD1  . HIS B 2 10 ? 4.998   5.783   -7.243  1.00 0.00 ? 10 HIS B HD1  7  
ATOM 5153  H HD2  . HIS B 2 10 ? 5.854   1.702   -7.190  1.00 0.00 ? 10 HIS B HD2  7  
ATOM 5154  H HE1  . HIS B 2 10 ? 6.594   5.360   -9.164  1.00 0.00 ? 10 HIS B HE1  7  
ATOM 5155  N N    . LEU B 2 11 ? 1.617   2.841   -3.941  1.00 0.00 ? 11 LEU B N    7  
ATOM 5156  C CA   . LEU B 2 11 ? 1.052   2.082   -2.789  1.00 0.00 ? 11 LEU B CA   7  
ATOM 5157  C C    . LEU B 2 11 ? -0.202  1.331   -3.236  1.00 0.00 ? 11 LEU B C    7  
ATOM 5158  O O    . LEU B 2 11 ? -0.456  0.223   -2.805  1.00 0.00 ? 11 LEU B O    7  
ATOM 5159  C CB   . LEU B 2 11 ? 0.695   3.045   -1.659  1.00 0.00 ? 11 LEU B CB   7  
ATOM 5160  C CG   . LEU B 2 11 ? 0.963   2.365   -0.317  1.00 0.00 ? 11 LEU B CG   7  
ATOM 5161  C CD1  . LEU B 2 11 ? 1.398   3.410   0.712   1.00 0.00 ? 11 LEU B CD1  7  
ATOM 5162  C CD2  . LEU B 2 11 ? -0.315  1.668   0.160   1.00 0.00 ? 11 LEU B CD2  7  
ATOM 5163  H H    . LEU B 2 11 ? 1.485   3.810   -4.002  1.00 0.00 ? 11 LEU B H    7  
ATOM 5164  H HA   . LEU B 2 11 ? 1.786   1.373   -2.436  1.00 0.00 ? 11 LEU B HA   7  
ATOM 5165  H HB2  . LEU B 2 11 ? 1.298   3.939   -1.739  1.00 0.00 ? 11 LEU B HB2  7  
ATOM 5166  H HB3  . LEU B 2 11 ? -0.350  3.308   -1.725  1.00 0.00 ? 11 LEU B HB3  7  
ATOM 5167  H HG   . LEU B 2 11 ? 1.748   1.632   -0.439  1.00 0.00 ? 11 LEU B HG   7  
ATOM 5168  H HD11 . LEU B 2 11 ? 0.637   4.171   0.795   1.00 0.00 ? 11 LEU B HD11 7  
ATOM 5169  H HD12 . LEU B 2 11 ? 1.538   2.933   1.671   1.00 0.00 ? 11 LEU B HD12 7  
ATOM 5170  H HD13 . LEU B 2 11 ? 2.328   3.862   0.395   1.00 0.00 ? 11 LEU B HD13 7  
ATOM 5171  H HD21 . LEU B 2 11 ? -1.140  1.956   -0.475  1.00 0.00 ? 11 LEU B HD21 7  
ATOM 5172  H HD22 . LEU B 2 11 ? -0.182  0.596   0.113   1.00 0.00 ? 11 LEU B HD22 7  
ATOM 5173  H HD23 . LEU B 2 11 ? -0.526  1.960   1.179   1.00 0.00 ? 11 LEU B HD23 7  
ATOM 5174  N N    . VAL B 2 12 ? -0.987  1.916   -4.100  1.00 0.00 ? 12 VAL B N    7  
ATOM 5175  C CA   . VAL B 2 12 ? -2.213  1.216   -4.570  1.00 0.00 ? 12 VAL B CA   7  
ATOM 5176  C C    . VAL B 2 12 ? -1.796  -0.035  -5.344  1.00 0.00 ? 12 VAL B C    7  
ATOM 5177  O O    . VAL B 2 12 ? -2.551  -0.974  -5.485  1.00 0.00 ? 12 VAL B O    7  
ATOM 5178  C CB   . VAL B 2 12 ? -3.022  2.141   -5.481  1.00 0.00 ? 12 VAL B CB   7  
ATOM 5179  C CG1  . VAL B 2 12 ? -4.091  1.330   -6.217  1.00 0.00 ? 12 VAL B CG1  7  
ATOM 5180  C CG2  . VAL B 2 12 ? -3.698  3.219   -4.630  1.00 0.00 ? 12 VAL B CG2  7  
ATOM 5181  H H    . VAL B 2 12 ? -0.767  2.807   -4.443  1.00 0.00 ? 12 VAL B H    7  
ATOM 5182  H HA   . VAL B 2 12 ? -2.814  0.930   -3.718  1.00 0.00 ? 12 VAL B HA   7  
ATOM 5183  H HB   . VAL B 2 12 ? -2.363  2.605   -6.200  1.00 0.00 ? 12 VAL B HB   7  
ATOM 5184  H HG11 . VAL B 2 12 ? -4.618  0.703   -5.511  1.00 0.00 ? 12 VAL B HG11 7  
ATOM 5185  H HG12 . VAL B 2 12 ? -4.788  2.002   -6.693  1.00 0.00 ? 12 VAL B HG12 7  
ATOM 5186  H HG13 . VAL B 2 12 ? -3.620  0.711   -6.967  1.00 0.00 ? 12 VAL B HG13 7  
ATOM 5187  H HG21 . VAL B 2 12 ? -4.013  2.788   -3.691  1.00 0.00 ? 12 VAL B HG21 7  
ATOM 5188  H HG22 . VAL B 2 12 ? -2.996  4.018   -4.442  1.00 0.00 ? 12 VAL B HG22 7  
ATOM 5189  H HG23 . VAL B 2 12 ? -4.556  3.607   -5.157  1.00 0.00 ? 12 VAL B HG23 7  
ATOM 5190  N N    . GLU B 2 13 ? -0.587  -0.048  -5.838  1.00 0.00 ? 13 GLU B N    7  
ATOM 5191  C CA   . GLU B 2 13 ? -0.103  -1.234  -6.597  1.00 0.00 ? 13 GLU B CA   7  
ATOM 5192  C C    . GLU B 2 13 ? 0.120   -2.392  -5.623  1.00 0.00 ? 13 GLU B C    7  
ATOM 5193  O O    . GLU B 2 13 ? 0.041   -3.547  -5.989  1.00 0.00 ? 13 GLU B O    7  
ATOM 5194  C CB   . GLU B 2 13 ? 1.214   -0.890  -7.295  1.00 0.00 ? 13 GLU B CB   7  
ATOM 5195  C CG   . GLU B 2 13 ? 0.928   -0.036  -8.532  1.00 0.00 ? 13 GLU B CG   7  
ATOM 5196  C CD   . GLU B 2 13 ? 0.549   -0.946  -9.703  1.00 0.00 ? 13 GLU B CD   7  
ATOM 5197  O OE1  . GLU B 2 13 ? 0.232   -2.099  -9.453  1.00 0.00 ? 13 GLU B OE1  7  
ATOM 5198  O OE2  . GLU B 2 13 ? 0.581   -0.476  -10.827 1.00 0.00 ? 13 GLU B OE2  7  
ATOM 5199  H H    . GLU B 2 13 ? 0.005   0.720   -5.704  1.00 0.00 ? 13 GLU B H    7  
ATOM 5200  H HA   . GLU B 2 13 ? -0.839  -1.518  -7.334  1.00 0.00 ? 13 GLU B HA   7  
ATOM 5201  H HB2  . GLU B 2 13 ? 1.848   -0.339  -6.615  1.00 0.00 ? 13 GLU B HB2  7  
ATOM 5202  H HB3  . GLU B 2 13 ? 1.712   -1.800  -7.594  1.00 0.00 ? 13 GLU B HB3  7  
ATOM 5203  H HG2  . GLU B 2 13 ? 0.113   0.640   -8.322  1.00 0.00 ? 13 GLU B HG2  7  
ATOM 5204  H HG3  . GLU B 2 13 ? 1.810   0.529   -8.790  1.00 0.00 ? 13 GLU B HG3  7  
ATOM 5205  N N    . ALA B 2 14 ? 0.392   -2.090  -4.383  1.00 0.00 ? 14 ALA B N    7  
ATOM 5206  C CA   . ALA B 2 14 ? 0.610   -3.170  -3.383  1.00 0.00 ? 14 ALA B CA   7  
ATOM 5207  C C    . ALA B 2 14 ? -0.697  -3.415  -2.628  1.00 0.00 ? 14 ALA B C    7  
ATOM 5208  O O    . ALA B 2 14 ? -0.902  -4.457  -2.036  1.00 0.00 ? 14 ALA B O    7  
ATOM 5209  C CB   . ALA B 2 14 ? 1.699   -2.746  -2.395  1.00 0.00 ? 14 ALA B CB   7  
ATOM 5210  H H    . ALA B 2 14 ? 0.445   -1.150  -4.106  1.00 0.00 ? 14 ALA B H    7  
ATOM 5211  H HA   . ALA B 2 14 ? 0.910   -4.076  -3.889  1.00 0.00 ? 14 ALA B HA   7  
ATOM 5212  H HB1  . ALA B 2 14 ? 1.429   -1.803  -1.945  1.00 0.00 ? 14 ALA B HB1  7  
ATOM 5213  H HB2  . ALA B 2 14 ? 1.800   -3.497  -1.626  1.00 0.00 ? 14 ALA B HB2  7  
ATOM 5214  H HB3  . ALA B 2 14 ? 2.638   -2.640  -2.919  1.00 0.00 ? 14 ALA B HB3  7  
ATOM 5215  N N    . LEU B 2 15 ? -1.587  -2.460  -2.651  1.00 0.00 ? 15 LEU B N    7  
ATOM 5216  C CA   . LEU B 2 15 ? -2.884  -2.629  -1.940  1.00 0.00 ? 15 LEU B CA   7  
ATOM 5217  C C    . LEU B 2 15 ? -3.737  -3.659  -2.685  1.00 0.00 ? 15 LEU B C    7  
ATOM 5218  O O    . LEU B 2 15 ? -4.249  -4.594  -2.102  1.00 0.00 ? 15 LEU B O    7  
ATOM 5219  C CB   . LEU B 2 15 ? -3.623  -1.290  -1.901  1.00 0.00 ? 15 LEU B CB   7  
ATOM 5220  C CG   . LEU B 2 15 ? -2.925  -0.350  -0.918  1.00 0.00 ? 15 LEU B CG   7  
ATOM 5221  C CD1  . LEU B 2 15 ? -3.629  1.009   -0.923  1.00 0.00 ? 15 LEU B CD1  7  
ATOM 5222  C CD2  . LEU B 2 15 ? -2.985  -0.947  0.490   1.00 0.00 ? 15 LEU B CD2  7  
ATOM 5223  H H    . LEU B 2 15 ? -1.401  -1.629  -3.136  1.00 0.00 ? 15 LEU B H    7  
ATOM 5224  H HA   . LEU B 2 15 ? -2.701  -2.971  -0.931  1.00 0.00 ? 15 LEU B HA   7  
ATOM 5225  H HB2  . LEU B 2 15 ? -3.621  -0.849  -2.887  1.00 0.00 ? 15 LEU B HB2  7  
ATOM 5226  H HB3  . LEU B 2 15 ? -4.641  -1.452  -1.580  1.00 0.00 ? 15 LEU B HB3  7  
ATOM 5227  H HG   . LEU B 2 15 ? -1.894  -0.222  -1.213  1.00 0.00 ? 15 LEU B HG   7  
ATOM 5228  H HD11 . LEU B 2 15 ? -4.687  0.864   -1.077  1.00 0.00 ? 15 LEU B HD11 7  
ATOM 5229  H HD12 . LEU B 2 15 ? -3.466  1.502   0.024   1.00 0.00 ? 15 LEU B HD12 7  
ATOM 5230  H HD13 . LEU B 2 15 ? -3.228  1.618   -1.721  1.00 0.00 ? 15 LEU B HD13 7  
ATOM 5231  H HD21 . LEU B 2 15 ? -3.424  -1.933  0.443   1.00 0.00 ? 15 LEU B HD21 7  
ATOM 5232  H HD22 . LEU B 2 15 ? -1.988  -1.014  0.896   1.00 0.00 ? 15 LEU B HD22 7  
ATOM 5233  H HD23 . LEU B 2 15 ? -3.589  -0.314  1.121   1.00 0.00 ? 15 LEU B HD23 7  
ATOM 5234  N N    . HIS B 2 16 ? -3.895  -3.493  -3.970  1.00 0.00 ? 16 HIS B N    7  
ATOM 5235  C CA   . HIS B 2 16 ? -4.715  -4.460  -4.754  1.00 0.00 ? 16 HIS B CA   7  
ATOM 5236  C C    . HIS B 2 16 ? -3.976  -5.797  -4.836  1.00 0.00 ? 16 HIS B C    7  
ATOM 5237  O O    . HIS B 2 16 ? -4.580  -6.853  -4.849  1.00 0.00 ? 16 HIS B O    7  
ATOM 5238  C CB   . HIS B 2 16 ? -4.954  -3.896  -6.164  1.00 0.00 ? 16 HIS B CB   7  
ATOM 5239  C CG   . HIS B 2 16 ? -3.766  -4.168  -7.046  1.00 0.00 ? 16 HIS B CG   7  
ATOM 5240  N ND1  . HIS B 2 16 ? -3.865  -4.890  -8.225  1.00 0.00 ? 16 HIS B ND1  7  
ATOM 5241  C CD2  . HIS B 2 16 ? -2.449  -3.815  -6.932  1.00 0.00 ? 16 HIS B CD2  7  
ATOM 5242  C CE1  . HIS B 2 16 ? -2.637  -4.945  -8.771  1.00 0.00 ? 16 HIS B CE1  7  
ATOM 5243  N NE2  . HIS B 2 16 ? -1.735  -4.304  -8.022  1.00 0.00 ? 16 HIS B NE2  7  
ATOM 5244  H H    . HIS B 2 16 ? -3.475  -2.731  -4.420  1.00 0.00 ? 16 HIS B H    7  
ATOM 5245  H HA   . HIS B 2 16 ? -5.665  -4.603  -4.261  1.00 0.00 ? 16 HIS B HA   7  
ATOM 5246  H HB2  . HIS B 2 16 ? -5.830  -4.357  -6.592  1.00 0.00 ? 16 HIS B HB2  7  
ATOM 5247  H HB3  . HIS B 2 16 ? -5.105  -2.830  -6.098  1.00 0.00 ? 16 HIS B HB3  7  
ATOM 5248  H HD1  . HIS B 2 16 ? -4.683  -5.287  -8.595  1.00 0.00 ? 16 HIS B HD1  7  
ATOM 5249  H HD2  . HIS B 2 16 ? -2.031  -3.244  -6.119  1.00 0.00 ? 16 HIS B HD2  7  
ATOM 5250  H HE1  . HIS B 2 16 ? -2.408  -5.445  -9.700  1.00 0.00 ? 16 HIS B HE1  7  
ATOM 5251  N N    . LEU B 2 17 ? -2.674  -5.755  -4.887  1.00 0.00 ? 17 LEU B N    7  
ATOM 5252  C CA   . LEU B 2 17 ? -1.886  -7.015  -4.967  1.00 0.00 ? 17 LEU B CA   7  
ATOM 5253  C C    . LEU B 2 17 ? -2.103  -7.833  -3.693  1.00 0.00 ? 17 LEU B C    7  
ATOM 5254  O O    . LEU B 2 17 ? -1.990  -9.043  -3.695  1.00 0.00 ? 17 LEU B O    7  
ATOM 5255  C CB   . LEU B 2 17 ? -0.403  -6.666  -5.109  1.00 0.00 ? 17 LEU B CB   7  
ATOM 5256  C CG   . LEU B 2 17 ? 0.442   -7.930  -4.955  1.00 0.00 ? 17 LEU B CG   7  
ATOM 5257  C CD1  . LEU B 2 17 ? 0.320   -8.780  -6.219  1.00 0.00 ? 17 LEU B CD1  7  
ATOM 5258  C CD2  . LEU B 2 17 ? 1.905   -7.535  -4.742  1.00 0.00 ? 17 LEU B CD2  7  
ATOM 5259  H H    . LEU B 2 17 ? -2.214  -4.892  -4.873  1.00 0.00 ? 17 LEU B H    7  
ATOM 5260  H HA   . LEU B 2 17 ? -2.205  -7.589  -5.825  1.00 0.00 ? 17 LEU B HA   7  
ATOM 5261  H HB2  . LEU B 2 17 ? -0.228  -6.234  -6.084  1.00 0.00 ? 17 LEU B HB2  7  
ATOM 5262  H HB3  . LEU B 2 17 ? -0.127  -5.954  -4.346  1.00 0.00 ? 17 LEU B HB3  7  
ATOM 5263  H HG   . LEU B 2 17 ? 0.094   -8.497  -4.103  1.00 0.00 ? 17 LEU B HG   7  
ATOM 5264  H HD11 . LEU B 2 17 ? -0.415  -8.342  -6.876  1.00 0.00 ? 17 LEU B HD11 7  
ATOM 5265  H HD12 . LEU B 2 17 ? 1.276   -8.815  -6.723  1.00 0.00 ? 17 LEU B HD12 7  
ATOM 5266  H HD13 . LEU B 2 17 ? 0.015   -9.781  -5.953  1.00 0.00 ? 17 LEU B HD13 7  
ATOM 5267  H HD21 . LEU B 2 17 ? 1.949   -6.566  -4.265  1.00 0.00 ? 17 LEU B HD21 7  
ATOM 5268  H HD22 . LEU B 2 17 ? 2.389   -8.268  -4.116  1.00 0.00 ? 17 LEU B HD22 7  
ATOM 5269  H HD23 . LEU B 2 17 ? 2.407   -7.487  -5.698  1.00 0.00 ? 17 LEU B HD23 7  
ATOM 5270  N N    . VAL B 2 18 ? -2.418  -7.184  -2.606  1.00 0.00 ? 18 VAL B N    7  
ATOM 5271  C CA   . VAL B 2 18 ? -2.646  -7.924  -1.336  1.00 0.00 ? 18 VAL B CA   7  
ATOM 5272  C C    . VAL B 2 18 ? -3.981  -8.666  -1.414  1.00 0.00 ? 18 VAL B C    7  
ATOM 5273  O O    . VAL B 2 18 ? -4.072  -9.838  -1.105  1.00 0.00 ? 18 VAL B O    7  
ATOM 5274  C CB   . VAL B 2 18 ? -2.680  -6.936  -0.168  1.00 0.00 ? 18 VAL B CB   7  
ATOM 5275  C CG1  . VAL B 2 18 ? -3.151  -7.653  1.098   1.00 0.00 ? 18 VAL B CG1  7  
ATOM 5276  C CG2  . VAL B 2 18 ? -1.276  -6.371  0.060   1.00 0.00 ? 18 VAL B CG2  7  
ATOM 5277  H H    . VAL B 2 18 ? -2.507  -6.208  -2.629  1.00 0.00 ? 18 VAL B H    7  
ATOM 5278  H HA   . VAL B 2 18 ? -1.847  -8.635  -1.184  1.00 0.00 ? 18 VAL B HA   7  
ATOM 5279  H HB   . VAL B 2 18 ? -3.362  -6.129  -0.399  1.00 0.00 ? 18 VAL B HB   7  
ATOM 5280  H HG11 . VAL B 2 18 ? -4.070  -8.186  0.890   1.00 0.00 ? 18 VAL B HG11 7  
ATOM 5281  H HG12 . VAL B 2 18 ? -2.394  -8.355  1.417   1.00 0.00 ? 18 VAL B HG12 7  
ATOM 5282  H HG13 . VAL B 2 18 ? -3.324  -6.930  1.880   1.00 0.00 ? 18 VAL B HG13 7  
ATOM 5283  H HG21 . VAL B 2 18 ? -0.626  -6.684  -0.745  1.00 0.00 ? 18 VAL B HG21 7  
ATOM 5284  H HG22 . VAL B 2 18 ? -1.320  -5.292  0.087   1.00 0.00 ? 18 VAL B HG22 7  
ATOM 5285  H HG23 . VAL B 2 18 ? -0.887  -6.739  0.998   1.00 0.00 ? 18 VAL B HG23 7  
ATOM 5286  N N    . CYS B 2 19 ? -5.021  -7.993  -1.827  1.00 0.00 ? 19 CYS B N    7  
ATOM 5287  C CA   . CYS B 2 19 ? -6.349  -8.659  -1.928  1.00 0.00 ? 19 CYS B CA   7  
ATOM 5288  C C    . CYS B 2 19 ? -6.494  -9.302  -3.309  1.00 0.00 ? 19 CYS B C    7  
ATOM 5289  O O    . CYS B 2 19 ? -6.199  -10.464 -3.498  1.00 0.00 ? 19 CYS B O    7  
ATOM 5290  C CB   . CYS B 2 19 ? -7.457  -7.626  -1.729  1.00 0.00 ? 19 CYS B CB   7  
ATOM 5291  S SG   . CYS B 2 19 ? -8.182  -7.829  -0.084  1.00 0.00 ? 19 CYS B SG   7  
ATOM 5292  H H    . CYS B 2 19 ? -4.927  -7.049  -2.072  1.00 0.00 ? 19 CYS B H    7  
ATOM 5293  H HA   . CYS B 2 19 ? -6.432  -9.420  -1.169  1.00 0.00 ? 19 CYS B HA   7  
ATOM 5294  H HB2  . CYS B 2 19 ? -7.046  -6.632  -1.823  1.00 0.00 ? 19 CYS B HB2  7  
ATOM 5295  H HB3  . CYS B 2 19 ? -8.220  -7.772  -2.477  1.00 0.00 ? 19 CYS B HB3  7  
ATOM 5296  N N    . GLY B 2 20 ? -6.946  -8.552  -4.277  1.00 0.00 ? 20 GLY B N    7  
ATOM 5297  C CA   . GLY B 2 20 ? -7.107  -9.122  -5.646  1.00 0.00 ? 20 GLY B CA   7  
ATOM 5298  C C    . GLY B 2 20 ? -8.547  -8.915  -6.122  1.00 0.00 ? 20 GLY B C    7  
ATOM 5299  O O    . GLY B 2 20 ? -9.014  -7.802  -6.253  1.00 0.00 ? 20 GLY B O    7  
ATOM 5300  H H    . GLY B 2 20 ? -7.177  -7.616  -4.106  1.00 0.00 ? 20 GLY B H    7  
ATOM 5301  H HA2  . GLY B 2 20 ? -6.428  -8.624  -6.325  1.00 0.00 ? 20 GLY B HA2  7  
ATOM 5302  H HA3  . GLY B 2 20 ? -6.887  -10.178 -5.625  1.00 0.00 ? 20 GLY B HA3  7  
ATOM 5303  N N    . GLU B 2 21 ? -9.254  -9.983  -6.380  1.00 0.00 ? 21 GLU B N    7  
ATOM 5304  C CA   . GLU B 2 21 ? -10.665 -9.849  -6.846  1.00 0.00 ? 21 GLU B CA   7  
ATOM 5305  C C    . GLU B 2 21 ? -11.504 -9.193  -5.746  1.00 0.00 ? 21 GLU B C    7  
ATOM 5306  O O    . GLU B 2 21 ? -12.482 -8.525  -6.013  1.00 0.00 ? 21 GLU B O    7  
ATOM 5307  C CB   . GLU B 2 21 ? -11.232 -11.233 -7.162  1.00 0.00 ? 21 GLU B CB   7  
ATOM 5308  C CG   . GLU B 2 21 ? -10.668 -11.726 -8.496  1.00 0.00 ? 21 GLU B CG   7  
ATOM 5309  C CD   . GLU B 2 21 ? -10.979 -13.215 -8.661  1.00 0.00 ? 21 GLU B CD   7  
ATOM 5310  O OE1  . GLU B 2 21 ? -11.087 -13.895 -7.653  1.00 0.00 ? 21 GLU B OE1  7  
ATOM 5311  O OE2  . GLU B 2 21 ? -11.106 -13.651 -9.793  1.00 0.00 ? 21 GLU B OE2  7  
ATOM 5312  H H    . GLU B 2 21 ? -8.858  -10.871 -6.268  1.00 0.00 ? 21 GLU B H    7  
ATOM 5313  H HA   . GLU B 2 21 ? -10.693 -9.236  -7.734  1.00 0.00 ? 21 GLU B HA   7  
ATOM 5314  H HB2  . GLU B 2 21 ? -10.958 -11.923 -6.377  1.00 0.00 ? 21 GLU B HB2  7  
ATOM 5315  H HB3  . GLU B 2 21 ? -12.308 -11.174 -7.230  1.00 0.00 ? 21 GLU B HB3  7  
ATOM 5316  H HG2  . GLU B 2 21 ? -11.118 -11.171 -9.305  1.00 0.00 ? 21 GLU B HG2  7  
ATOM 5317  H HG3  . GLU B 2 21 ? -9.598  -11.582 -8.511  1.00 0.00 ? 21 GLU B HG3  7  
ATOM 5318  N N    . ARG B 2 22 ? -11.129 -9.386  -4.511  1.00 0.00 ? 22 ARG B N    7  
ATOM 5319  C CA   . ARG B 2 22 ? -11.904 -8.778  -3.394  1.00 0.00 ? 22 ARG B CA   7  
ATOM 5320  C C    . ARG B 2 22 ? -12.005 -7.268  -3.602  1.00 0.00 ? 22 ARG B C    7  
ATOM 5321  O O    . ARG B 2 22 ? -13.046 -6.747  -3.952  1.00 0.00 ? 22 ARG B O    7  
ATOM 5322  C CB   . ARG B 2 22 ? -11.193 -9.063  -2.069  1.00 0.00 ? 22 ARG B CB   7  
ATOM 5323  C CG   . ARG B 2 22 ? -11.049 -10.573 -1.880  1.00 0.00 ? 22 ARG B CG   7  
ATOM 5324  C CD   . ARG B 2 22 ? -12.435 -11.212 -1.778  1.00 0.00 ? 22 ARG B CD   7  
ATOM 5325  N NE   . ARG B 2 22 ? -12.290 -12.692 -1.688  1.00 0.00 ? 22 ARG B NE   7  
ATOM 5326  C CZ   . ARG B 2 22 ? -13.301 -13.431 -1.309  1.00 0.00 ? 22 ARG B CZ   7  
ATOM 5327  N NH1  . ARG B 2 22 ? -14.444 -12.875 -1.008  1.00 0.00 ? 22 ARG B NH1  7  
ATOM 5328  N NH2  . ARG B 2 22 ? -13.166 -14.726 -1.231  1.00 0.00 ? 22 ARG B NH2  7  
ATOM 5329  H H    . ARG B 2 22 ? -10.337 -9.930  -4.318  1.00 0.00 ? 22 ARG B H    7  
ATOM 5330  H HA   . ARG B 2 22 ? -12.896 -9.206  -3.369  1.00 0.00 ? 22 ARG B HA   7  
ATOM 5331  H HB2  . ARG B 2 22 ? -10.214 -8.604  -2.081  1.00 0.00 ? 22 ARG B HB2  7  
ATOM 5332  H HB3  . ARG B 2 22 ? -11.773 -8.654  -1.255  1.00 0.00 ? 22 ARG B HB3  7  
ATOM 5333  H HG2  . ARG B 2 22 ? -10.520 -10.992 -2.726  1.00 0.00 ? 22 ARG B HG2  7  
ATOM 5334  H HG3  . ARG B 2 22 ? -10.496 -10.773 -0.977  1.00 0.00 ? 22 ARG B HG3  7  
ATOM 5335  H HD2  . ARG B 2 22 ? -12.936 -10.845 -0.895  1.00 0.00 ? 22 ARG B HD2  7  
ATOM 5336  H HD3  . ARG B 2 22 ? -13.015 -10.957 -2.654  1.00 0.00 ? 22 ARG B HD3  7  
ATOM 5337  H HE   . ARG B 2 22 ? -11.437 -13.114 -1.914  1.00 0.00 ? 22 ARG B HE   7  
ATOM 5338  H HH11 . ARG B 2 22 ? -14.549 -11.881 -1.065  1.00 0.00 ? 22 ARG B HH11 7  
ATOM 5339  H HH12 . ARG B 2 22 ? -15.212 -13.442 -0.719  1.00 0.00 ? 22 ARG B HH12 7  
ATOM 5340  H HH21 . ARG B 2 22 ? -12.291 -15.151 -1.461  1.00 0.00 ? 22 ARG B HH21 7  
ATOM 5341  H HH22 . ARG B 2 22 ? -13.937 -15.292 -0.941  1.00 0.00 ? 22 ARG B HH22 7  
ATOM 5342  N N    . GLY B 2 23 ? -10.933 -6.558  -3.390  1.00 0.00 ? 23 GLY B N    7  
ATOM 5343  C CA   . GLY B 2 23 ? -10.967 -5.080  -3.575  1.00 0.00 ? 23 GLY B CA   7  
ATOM 5344  C C    . GLY B 2 23 ? -10.282 -4.403  -2.390  1.00 0.00 ? 23 GLY B C    7  
ATOM 5345  O O    . GLY B 2 23 ? -9.894  -5.045  -1.435  1.00 0.00 ? 23 GLY B O    7  
ATOM 5346  H H    . GLY B 2 23 ? -10.104 -6.997  -3.108  1.00 0.00 ? 23 GLY B H    7  
ATOM 5347  H HA2  . GLY B 2 23 ? -10.452 -4.819  -4.490  1.00 0.00 ? 23 GLY B HA2  7  
ATOM 5348  H HA3  . GLY B 2 23 ? -11.993 -4.747  -3.633  1.00 0.00 ? 23 GLY B HA3  7  
ATOM 5349  N N    . PHE B 2 24 ? -10.128 -3.108  -2.440  1.00 0.00 ? 24 PHE B N    7  
ATOM 5350  C CA   . PHE B 2 24 ? -9.467  -2.397  -1.313  1.00 0.00 ? 24 PHE B CA   7  
ATOM 5351  C C    . PHE B 2 24 ? -9.821  -0.910  -1.365  1.00 0.00 ? 24 PHE B C    7  
ATOM 5352  O O    . PHE B 2 24 ? -9.966  -0.334  -2.425  1.00 0.00 ? 24 PHE B O    7  
ATOM 5353  C CB   . PHE B 2 24 ? -7.950  -2.566  -1.425  1.00 0.00 ? 24 PHE B CB   7  
ATOM 5354  C CG   . PHE B 2 24 ? -7.471  -1.978  -2.728  1.00 0.00 ? 24 PHE B CG   7  
ATOM 5355  C CD1  . PHE B 2 24 ? -7.553  -2.732  -3.902  1.00 0.00 ? 24 PHE B CD1  7  
ATOM 5356  C CD2  . PHE B 2 24 ? -6.945  -0.681  -2.764  1.00 0.00 ? 24 PHE B CD2  7  
ATOM 5357  C CE1  . PHE B 2 24 ? -7.110  -2.193  -5.113  1.00 0.00 ? 24 PHE B CE1  7  
ATOM 5358  C CE2  . PHE B 2 24 ? -6.502  -0.141  -3.976  1.00 0.00 ? 24 PHE B CE2  7  
ATOM 5359  C CZ   . PHE B 2 24 ? -6.583  -0.896  -5.150  1.00 0.00 ? 24 PHE B CZ   7  
ATOM 5360  H H    . PHE B 2 24 ? -10.448 -2.605  -3.219  1.00 0.00 ? 24 PHE B H    7  
ATOM 5361  H HA   . PHE B 2 24 ? -9.805  -2.814  -0.376  1.00 0.00 ? 24 PHE B HA   7  
ATOM 5362  H HB2  . PHE B 2 24 ? -7.467  -2.061  -0.602  1.00 0.00 ? 24 PHE B HB2  7  
ATOM 5363  H HB3  . PHE B 2 24 ? -7.705  -3.617  -1.399  1.00 0.00 ? 24 PHE B HB3  7  
ATOM 5364  H HD1  . PHE B 2 24 ? -7.960  -3.732  -3.869  1.00 0.00 ? 24 PHE B HD1  7  
ATOM 5365  H HD2  . PHE B 2 24 ? -6.883  -0.098  -1.857  1.00 0.00 ? 24 PHE B HD2  7  
ATOM 5366  H HE1  . PHE B 2 24 ? -7.172  -2.776  -6.020  1.00 0.00 ? 24 PHE B HE1  7  
ATOM 5367  H HE2  . PHE B 2 24 ? -6.094  0.860   -4.004  1.00 0.00 ? 24 PHE B HE2  7  
ATOM 5368  H HZ   . PHE B 2 24 ? -6.239  -0.478  -6.086  1.00 0.00 ? 24 PHE B HZ   7  
ATOM 5369  N N    . PHE B 2 25 ? -9.957  -0.283  -0.230  1.00 0.00 ? 25 PHE B N    7  
ATOM 5370  C CA   . PHE B 2 25 ? -10.297 1.166   -0.218  1.00 0.00 ? 25 PHE B CA   7  
ATOM 5371  C C    . PHE B 2 25 ? -9.047  1.972   0.145   1.00 0.00 ? 25 PHE B C    7  
ATOM 5372  O O    . PHE B 2 25 ? -8.737  2.171   1.303   1.00 0.00 ? 25 PHE B O    7  
ATOM 5373  C CB   . PHE B 2 25 ? -11.411 1.439   0.802   1.00 0.00 ? 25 PHE B CB   7  
ATOM 5374  C CG   . PHE B 2 25 ? -11.009 0.927   2.166   1.00 0.00 ? 25 PHE B CG   7  
ATOM 5375  C CD1  . PHE B 2 25 ? -11.154 -0.429  2.477   1.00 0.00 ? 25 PHE B CD1  7  
ATOM 5376  C CD2  . PHE B 2 25 ? -10.502 1.814   3.124   1.00 0.00 ? 25 PHE B CD2  7  
ATOM 5377  C CE1  . PHE B 2 25 ? -10.788 -0.901  3.744   1.00 0.00 ? 25 PHE B CE1  7  
ATOM 5378  C CE2  . PHE B 2 25 ? -10.136 1.343   4.391   1.00 0.00 ? 25 PHE B CE2  7  
ATOM 5379  C CZ   . PHE B 2 25 ? -10.279 -0.015  4.701   1.00 0.00 ? 25 PHE B CZ   7  
ATOM 5380  H H    . PHE B 2 25 ? -9.831  -0.764  0.612   1.00 0.00 ? 25 PHE B H    7  
ATOM 5381  H HA   . PHE B 2 25 ? -10.634 1.461   -1.201  1.00 0.00 ? 25 PHE B HA   7  
ATOM 5382  H HB2  . PHE B 2 25 ? -11.592 2.502   0.859   1.00 0.00 ? 25 PHE B HB2  7  
ATOM 5383  H HB3  . PHE B 2 25 ? -12.315 0.939   0.484   1.00 0.00 ? 25 PHE B HB3  7  
ATOM 5384  H HD1  . PHE B 2 25 ? -11.546 -1.115  1.741   1.00 0.00 ? 25 PHE B HD1  7  
ATOM 5385  H HD2  . PHE B 2 25 ? -10.390 2.861   2.885   1.00 0.00 ? 25 PHE B HD2  7  
ATOM 5386  H HE1  . PHE B 2 25 ? -10.897 -1.948  3.984   1.00 0.00 ? 25 PHE B HE1  7  
ATOM 5387  H HE2  . PHE B 2 25 ? -9.746  2.028   5.129   1.00 0.00 ? 25 PHE B HE2  7  
ATOM 5388  H HZ   . PHE B 2 25 ? -9.997  -0.377  5.678   1.00 0.00 ? 25 PHE B HZ   7  
ATOM 5389  N N    . TYR B 2 26 ? -8.322  2.425   -0.839  1.00 0.00 ? 26 TYR B N    7  
ATOM 5390  C CA   . TYR B 2 26 ? -7.086  3.206   -0.559  1.00 0.00 ? 26 TYR B CA   7  
ATOM 5391  C C    . TYR B 2 26 ? -7.458  4.631   -0.145  1.00 0.00 ? 26 TYR B C    7  
ATOM 5392  O O    . TYR B 2 26 ? -8.311  5.261   -0.739  1.00 0.00 ? 26 TYR B O    7  
ATOM 5393  C CB   . TYR B 2 26 ? -6.220  3.254   -1.818  1.00 0.00 ? 26 TYR B CB   7  
ATOM 5394  C CG   . TYR B 2 26 ? -4.930  3.974   -1.517  1.00 0.00 ? 26 TYR B CG   7  
ATOM 5395  C CD1  . TYR B 2 26 ? -4.275  3.757   -0.298  1.00 0.00 ? 26 TYR B CD1  7  
ATOM 5396  C CD2  . TYR B 2 26 ? -4.385  4.859   -2.455  1.00 0.00 ? 26 TYR B CD2  7  
ATOM 5397  C CE1  . TYR B 2 26 ? -3.078  4.424   -0.017  1.00 0.00 ? 26 TYR B CE1  7  
ATOM 5398  C CE2  . TYR B 2 26 ? -3.187  5.526   -2.175  1.00 0.00 ? 26 TYR B CE2  7  
ATOM 5399  C CZ   . TYR B 2 26 ? -2.532  5.307   -0.956  1.00 0.00 ? 26 TYR B CZ   7  
ATOM 5400  O OH   . TYR B 2 26 ? -1.351  5.963   -0.679  1.00 0.00 ? 26 TYR B OH   7  
ATOM 5401  H H    . TYR B 2 26 ? -8.588  2.245   -1.766  1.00 0.00 ? 26 TYR B H    7  
ATOM 5402  H HA   . TYR B 2 26 ? -6.535  2.731   0.238   1.00 0.00 ? 26 TYR B HA   7  
ATOM 5403  H HB2  . TYR B 2 26 ? -6.005  2.246   -2.146  1.00 0.00 ? 26 TYR B HB2  7  
ATOM 5404  H HB3  . TYR B 2 26 ? -6.749  3.780   -2.600  1.00 0.00 ? 26 TYR B HB3  7  
ATOM 5405  H HD1  . TYR B 2 26 ? -4.697  3.074   0.427   1.00 0.00 ? 26 TYR B HD1  7  
ATOM 5406  H HD2  . TYR B 2 26 ? -4.890  5.026   -3.395  1.00 0.00 ? 26 TYR B HD2  7  
ATOM 5407  H HE1  . TYR B 2 26 ? -2.573  4.257   0.923   1.00 0.00 ? 26 TYR B HE1  7  
ATOM 5408  H HE2  . TYR B 2 26 ? -2.765  6.207   -2.899  1.00 0.00 ? 26 TYR B HE2  7  
ATOM 5409  H HH   . TYR B 2 26 ? -0.704  5.307   -0.410  1.00 0.00 ? 26 TYR B HH   7  
ATOM 5410  N N    . THR B 2 27 ? -6.822  5.143   0.872   1.00 0.00 ? 27 THR B N    7  
ATOM 5411  C CA   . THR B 2 27 ? -7.134  6.528   1.326   1.00 0.00 ? 27 THR B CA   7  
ATOM 5412  C C    . THR B 2 27 ? -5.852  7.366   1.309   1.00 0.00 ? 27 THR B C    7  
ATOM 5413  O O    . THR B 2 27 ? -5.296  7.667   2.344   1.00 0.00 ? 27 THR B O    7  
ATOM 5414  C CB   . THR B 2 27 ? -7.696  6.486   2.749   1.00 0.00 ? 27 THR B CB   7  
ATOM 5415  O OG1  . THR B 2 27 ? -7.335  5.256   3.363   1.00 0.00 ? 27 THR B OG1  7  
ATOM 5416  C CG2  . THR B 2 27 ? -9.220  6.609   2.702   1.00 0.00 ? 27 THR B CG2  7  
ATOM 5417  H H    . THR B 2 27 ? -6.136  4.620   1.336   1.00 0.00 ? 27 THR B H    7  
ATOM 5418  H HA   . THR B 2 27 ? -7.863  6.970   0.662   1.00 0.00 ? 27 THR B HA   7  
ATOM 5419  H HB   . THR B 2 27 ? -7.291  7.307   3.321   1.00 0.00 ? 27 THR B HB   7  
ATOM 5420  H HG1  . THR B 2 27 ? -6.377  5.202   3.378   1.00 0.00 ? 27 THR B HG1  7  
ATOM 5421  H HG21 . THR B 2 27 ? -9.593  6.122   1.812   1.00 0.00 ? 27 THR B HG21 7  
ATOM 5422  H HG22 . THR B 2 27 ? -9.646  6.137   3.574   1.00 0.00 ? 27 THR B HG22 7  
ATOM 5423  H HG23 . THR B 2 27 ? -9.496  7.652   2.685   1.00 0.00 ? 27 THR B HG23 7  
ATOM 5424  N N    . PRO B 2 28 ? -5.424  7.714   0.123   1.00 0.00 ? 28 PRO B N    7  
ATOM 5425  C CA   . PRO B 2 28 ? -4.203  8.520   -0.097  1.00 0.00 ? 28 PRO B CA   7  
ATOM 5426  C C    . PRO B 2 28 ? -4.342  9.881   0.593   1.00 0.00 ? 28 PRO B C    7  
ATOM 5427  O O    . PRO B 2 28 ? -5.205  10.669  0.266   1.00 0.00 ? 28 PRO B O    7  
ATOM 5428  C CB   . PRO B 2 28 ? -4.082  8.699   -1.616  1.00 0.00 ? 28 PRO B CB   7  
ATOM 5429  C CG   . PRO B 2 28 ? -5.268  7.964   -2.265  1.00 0.00 ? 28 PRO B CG   7  
ATOM 5430  C CD   . PRO B 2 28 ? -6.105  7.346   -1.138  1.00 0.00 ? 28 PRO B CD   7  
ATOM 5431  H HA   . PRO B 2 28 ? -3.337  7.998   0.279   1.00 0.00 ? 28 PRO B HA   7  
ATOM 5432  H HB2  . PRO B 2 28 ? -4.114  9.751   -1.864  1.00 0.00 ? 28 PRO B HB2  7  
ATOM 5433  H HB3  . PRO B 2 28 ? -3.155  8.268   -1.962  1.00 0.00 ? 28 PRO B HB3  7  
ATOM 5434  H HG2  . PRO B 2 28 ? -5.869  8.664   -2.830  1.00 0.00 ? 28 PRO B HG2  7  
ATOM 5435  H HG3  . PRO B 2 28 ? -4.906  7.184   -2.917  1.00 0.00 ? 28 PRO B HG3  7  
ATOM 5436  H HD2  . PRO B 2 28 ? -7.107  7.752   -1.155  1.00 0.00 ? 28 PRO B HD2  7  
ATOM 5437  H HD3  . PRO B 2 28 ? -6.137  6.273   -1.242  1.00 0.00 ? 28 PRO B HD3  7  
ATOM 5438  N N    . LYS B 2 29 ? -3.498  10.158  1.548   1.00 0.00 ? 29 LYS B N    7  
ATOM 5439  C CA   . LYS B 2 29 ? -3.580  11.465  2.260   1.00 0.00 ? 29 LYS B CA   7  
ATOM 5440  C C    . LYS B 2 29 ? -2.289  11.697  3.048   1.00 0.00 ? 29 LYS B C    7  
ATOM 5441  O O    . LYS B 2 29 ? -2.093  11.142  4.111   1.00 0.00 ? 29 LYS B O    7  
ATOM 5442  C CB   . LYS B 2 29 ? -4.770  11.445  3.221   1.00 0.00 ? 29 LYS B CB   7  
ATOM 5443  C CG   . LYS B 2 29 ? -5.483  12.800  3.180   1.00 0.00 ? 29 LYS B CG   7  
ATOM 5444  C CD   . LYS B 2 29 ? -5.004  13.666  4.346   1.00 0.00 ? 29 LYS B CD   7  
ATOM 5445  C CE   . LYS B 2 29 ? -5.120  15.144  3.968   1.00 0.00 ? 29 LYS B CE   7  
ATOM 5446  N NZ   . LYS B 2 29 ? -3.886  15.864  4.390   1.00 0.00 ? 29 LYS B NZ   7  
ATOM 5447  H H    . LYS B 2 29 ? -2.807  9.508   1.796   1.00 0.00 ? 29 LYS B H    7  
ATOM 5448  H HA   . LYS B 2 29 ? -3.711  12.261  1.540   1.00 0.00 ? 29 LYS B HA   7  
ATOM 5449  H HB2  . LYS B 2 29 ? -5.458  10.666  2.928   1.00 0.00 ? 29 LYS B HB2  7  
ATOM 5450  H HB3  . LYS B 2 29 ? -4.419  11.258  4.225   1.00 0.00 ? 29 LYS B HB3  7  
ATOM 5451  H HG2  . LYS B 2 29 ? -5.260  13.294  2.247   1.00 0.00 ? 29 LYS B HG2  7  
ATOM 5452  H HG3  . LYS B 2 29 ? -6.549  12.648  3.262   1.00 0.00 ? 29 LYS B HG3  7  
ATOM 5453  H HD2  . LYS B 2 29 ? -5.615  13.469  5.217   1.00 0.00 ? 29 LYS B HD2  7  
ATOM 5454  H HD3  . LYS B 2 29 ? -3.973  13.432  4.569   1.00 0.00 ? 29 LYS B HD3  7  
ATOM 5455  H HE2  . LYS B 2 29 ? -5.238  15.231  2.896   1.00 0.00 ? 29 LYS B HE2  7  
ATOM 5456  H HE3  . LYS B 2 29 ? -5.977  15.576  4.462   1.00 0.00 ? 29 LYS B HE3  7  
ATOM 5457  H HZ1  . LYS B 2 29 ? -3.586  15.519  5.322   1.00 0.00 ? 29 LYS B HZ1  7  
ATOM 5458  H HZ2  . LYS B 2 29 ? -3.129  15.694  3.696   1.00 0.00 ? 29 LYS B HZ2  7  
ATOM 5459  H HZ3  . LYS B 2 29 ? -4.082  16.883  4.447   1.00 0.00 ? 29 LYS B HZ3  7  
ATOM 5460  N N    . THR B 2 30 ? -1.407  12.511  2.536   1.00 0.00 ? 30 THR B N    7  
ATOM 5461  C CA   . THR B 2 30 ? -0.131  12.776  3.259   1.00 0.00 ? 30 THR B CA   7  
ATOM 5462  C C    . THR B 2 30 ? 0.316   14.214  2.995   1.00 0.00 ? 30 THR B C    7  
ATOM 5463  O O    . THR B 2 30 ? 1.238   14.659  3.660   1.00 0.00 ? 30 THR B O    7  
ATOM 5464  C CB   . THR B 2 30 ? 0.947   11.808  2.759   1.00 0.00 ? 30 THR B CB   7  
ATOM 5465  O OG1  . THR B 2 30 ? 2.220   12.246  3.214   1.00 0.00 ? 30 THR B OG1  7  
ATOM 5466  C CG2  . THR B 2 30 ? 0.933   11.768  1.232   1.00 0.00 ? 30 THR B CG2  7  
ATOM 5467  O OXT  . THR B 2 30 ? -0.270  14.850  2.134   1.00 0.00 ? 30 THR B OXT  7  
ATOM 5468  H H    . THR B 2 30 ? -1.585  12.949  1.677   1.00 0.00 ? 30 THR B H    7  
ATOM 5469  H HA   . THR B 2 30 ? -0.280  12.633  4.317   1.00 0.00 ? 30 THR B HA   7  
ATOM 5470  H HB   . THR B 2 30 ? 0.748   10.819  3.144   1.00 0.00 ? 30 THR B HB   7  
ATOM 5471  H HG1  . THR B 2 30 ? 2.096   12.701  4.051   1.00 0.00 ? 30 THR B HG1  7  
ATOM 5472  H HG21 . THR B 2 30 ? 0.935   12.777  0.843   1.00 0.00 ? 30 THR B HG21 7  
ATOM 5473  H HG22 . THR B 2 30 ? 1.809   11.245  0.876   1.00 0.00 ? 30 THR B HG22 7  
ATOM 5474  H HG23 . THR B 2 30 ? 0.046   11.255  0.893   1.00 0.00 ? 30 THR B HG23 7  
ATOM 5475  N N    . GLY A 1 1  ? -2.963  6.583   8.156   1.00 0.00 ? 1  GLY A N    8  
ATOM 5476  C CA   . GLY A 1 1  ? -2.680  6.237   6.733   1.00 0.00 ? 1  GLY A CA   8  
ATOM 5477  C C    . GLY A 1 1  ? -1.441  5.347   6.666   1.00 0.00 ? 1  GLY A C    8  
ATOM 5478  O O    . GLY A 1 1  ? -0.601  5.361   7.544   1.00 0.00 ? 1  GLY A O    8  
ATOM 5479  H H1   . GLY A 1 1  ? -2.091  6.910   8.615   1.00 0.00 ? 1  GLY A H1   8  
ATOM 5480  H H2   . GLY A 1 1  ? -3.681  7.335   8.193   1.00 0.00 ? 1  GLY A H2   8  
ATOM 5481  H H3   . GLY A 1 1  ? -3.317  5.740   8.653   1.00 0.00 ? 1  GLY A H3   8  
ATOM 5482  H HA2  . GLY A 1 1  ? -3.527  5.706   6.315   1.00 0.00 ? 1  GLY A HA2  8  
ATOM 5483  H HA3  . GLY A 1 1  ? -2.505  7.140   6.170   1.00 0.00 ? 1  GLY A HA3  8  
ATOM 5484  N N    . ILE A 1 2  ? -1.328  4.563   5.632   1.00 0.00 ? 2  ILE A N    8  
ATOM 5485  C CA   . ILE A 1 2  ? -0.155  3.658   5.504   1.00 0.00 ? 2  ILE A CA   8  
ATOM 5486  C C    . ILE A 1 2  ? 0.973   4.365   4.746   1.00 0.00 ? 2  ILE A C    8  
ATOM 5487  O O    . ILE A 1 2  ? 2.060   3.845   4.606   1.00 0.00 ? 2  ILE A O    8  
ATOM 5488  C CB   . ILE A 1 2  ? -0.606  2.392   4.760   1.00 0.00 ? 2  ILE A CB   8  
ATOM 5489  C CG1  . ILE A 1 2  ? 0.126   1.176   5.329   1.00 0.00 ? 2  ILE A CG1  8  
ATOM 5490  C CG2  . ILE A 1 2  ? -0.322  2.503   3.256   1.00 0.00 ? 2  ILE A CG2  8  
ATOM 5491  C CD1  . ILE A 1 2  ? -0.188  -0.066  4.487   1.00 0.00 ? 2  ILE A CD1  8  
ATOM 5492  H H    . ILE A 1 2  ? -2.024  4.563   4.942   1.00 0.00 ? 2  ILE A H    8  
ATOM 5493  H HA   . ILE A 1 2  ? 0.193   3.385   6.489   1.00 0.00 ? 2  ILE A HA   8  
ATOM 5494  H HB   . ILE A 1 2  ? -1.662  2.272   4.908   1.00 0.00 ? 2  ILE A HB   8  
ATOM 5495  H HG12 . ILE A 1 2  ? 1.191   1.361   5.316   1.00 0.00 ? 2  ILE A HG12 8  
ATOM 5496  H HG13 . ILE A 1 2  ? -0.197  1.008   6.346   1.00 0.00 ? 2  ILE A HG13 8  
ATOM 5497  H HG21 . ILE A 1 2  ? -0.280  3.543   2.971   1.00 0.00 ? 2  ILE A HG21 8  
ATOM 5498  H HG22 . ILE A 1 2  ? 0.619   2.028   3.037   1.00 0.00 ? 2  ILE A HG22 8  
ATOM 5499  H HG23 . ILE A 1 2  ? -1.110  2.009   2.705   1.00 0.00 ? 2  ILE A HG23 8  
ATOM 5500  H HD11 . ILE A 1 2  ? -0.646  0.229   3.553   1.00 0.00 ? 2  ILE A HD11 8  
ATOM 5501  H HD12 . ILE A 1 2  ? 0.726   -0.600  4.287   1.00 0.00 ? 2  ILE A HD12 8  
ATOM 5502  H HD13 . ILE A 1 2  ? -0.868  -0.708  5.028   1.00 0.00 ? 2  ILE A HD13 8  
ATOM 5503  N N    . VAL A 1 3  ? 0.715   5.541   4.246   1.00 0.00 ? 3  VAL A N    8  
ATOM 5504  C CA   . VAL A 1 3  ? 1.766   6.272   3.486   1.00 0.00 ? 3  VAL A CA   8  
ATOM 5505  C C    . VAL A 1 3  ? 2.910   6.668   4.423   1.00 0.00 ? 3  VAL A C    8  
ATOM 5506  O O    . VAL A 1 3  ? 4.062   6.668   4.040   1.00 0.00 ? 3  VAL A O    8  
ATOM 5507  C CB   . VAL A 1 3  ? 1.156   7.525   2.863   1.00 0.00 ? 3  VAL A CB   8  
ATOM 5508  C CG1  . VAL A 1 3  ? 2.251   8.325   2.157   1.00 0.00 ? 3  VAL A CG1  8  
ATOM 5509  C CG2  . VAL A 1 3  ? 0.089   7.110   1.847   1.00 0.00 ? 3  VAL A CG2  8  
ATOM 5510  H H    . VAL A 1 3  ? -0.173  5.938   4.361   1.00 0.00 ? 3  VAL A H    8  
ATOM 5511  H HA   . VAL A 1 3  ? 2.150   5.634   2.704   1.00 0.00 ? 3  VAL A HA   8  
ATOM 5512  H HB   . VAL A 1 3  ? 0.708   8.129   3.638   1.00 0.00 ? 3  VAL A HB   8  
ATOM 5513  H HG11 . VAL A 1 3  ? 2.728   7.703   1.414   1.00 0.00 ? 3  VAL A HG11 8  
ATOM 5514  H HG12 . VAL A 1 3  ? 1.815   9.188   1.678   1.00 0.00 ? 3  VAL A HG12 8  
ATOM 5515  H HG13 . VAL A 1 3  ? 2.986   8.645   2.882   1.00 0.00 ? 3  VAL A HG13 8  
ATOM 5516  H HG21 . VAL A 1 3  ? 0.422   6.230   1.320   1.00 0.00 ? 3  VAL A HG21 8  
ATOM 5517  H HG22 . VAL A 1 3  ? -0.835  6.894   2.363   1.00 0.00 ? 3  VAL A HG22 8  
ATOM 5518  H HG23 . VAL A 1 3  ? -0.070  7.913   1.143   1.00 0.00 ? 3  VAL A HG23 8  
ATOM 5519  N N    . GLU A 1 4  ? 2.603   7.010   5.645   1.00 0.00 ? 4  GLU A N    8  
ATOM 5520  C CA   . GLU A 1 4  ? 3.678   7.409   6.597   1.00 0.00 ? 4  GLU A CA   8  
ATOM 5521  C C    . GLU A 1 4  ? 4.399   6.163   7.125   1.00 0.00 ? 4  GLU A C    8  
ATOM 5522  O O    . GLU A 1 4  ? 5.255   6.251   7.983   1.00 0.00 ? 4  GLU A O    8  
ATOM 5523  C CB   . GLU A 1 4  ? 3.065   8.175   7.772   1.00 0.00 ? 4  GLU A CB   8  
ATOM 5524  C CG   . GLU A 1 4  ? 2.392   9.450   7.259   1.00 0.00 ? 4  GLU A CG   8  
ATOM 5525  C CD   . GLU A 1 4  ? 0.872   9.307   7.378   1.00 0.00 ? 4  GLU A CD   8  
ATOM 5526  O OE1  . GLU A 1 4  ? 0.414   8.195   7.580   1.00 0.00 ? 4  GLU A OE1  8  
ATOM 5527  O OE2  . GLU A 1 4  ? 0.193   10.314  7.265   1.00 0.00 ? 4  GLU A OE2  8  
ATOM 5528  H H    . GLU A 1 4  ? 1.667   7.009   5.933   1.00 0.00 ? 4  GLU A H    8  
ATOM 5529  H HA   . GLU A 1 4  ? 4.390   8.045   6.088   1.00 0.00 ? 4  GLU A HA   8  
ATOM 5530  H HB2  . GLU A 1 4  ? 2.333   7.551   8.265   1.00 0.00 ? 4  GLU A HB2  8  
ATOM 5531  H HB3  . GLU A 1 4  ? 3.843   8.439   8.473   1.00 0.00 ? 4  GLU A HB3  8  
ATOM 5532  H HG2  . GLU A 1 4  ? 2.722   10.294  7.847   1.00 0.00 ? 4  GLU A HG2  8  
ATOM 5533  H HG3  . GLU A 1 4  ? 2.656   9.606   6.224   1.00 0.00 ? 4  GLU A HG3  8  
ATOM 5534  N N    . GLN A 1 5  ? 4.061   5.005   6.627   1.00 0.00 ? 5  GLN A N    8  
ATOM 5535  C CA   . GLN A 1 5  ? 4.732   3.762   7.111   1.00 0.00 ? 5  GLN A CA   8  
ATOM 5536  C C    . GLN A 1 5  ? 5.337   2.999   5.929   1.00 0.00 ? 5  GLN A C    8  
ATOM 5537  O O    . GLN A 1 5  ? 6.233   2.195   6.092   1.00 0.00 ? 5  GLN A O    8  
ATOM 5538  C CB   . GLN A 1 5  ? 3.706   2.873   7.816   1.00 0.00 ? 5  GLN A CB   8  
ATOM 5539  C CG   . GLN A 1 5  ? 3.155   3.600   9.043   1.00 0.00 ? 5  GLN A CG   8  
ATOM 5540  C CD   . GLN A 1 5  ? 2.289   2.638   9.860   1.00 0.00 ? 5  GLN A CD   8  
ATOM 5541  O OE1  . GLN A 1 5  ? 2.663   2.236   10.944  1.00 0.00 ? 5  GLN A OE1  8  
ATOM 5542  N NE2  . GLN A 1 5  ? 1.139   2.251   9.381   1.00 0.00 ? 5  GLN A NE2  8  
ATOM 5543  H H    . GLN A 1 5  ? 3.366   4.951   5.938   1.00 0.00 ? 5  GLN A H    8  
ATOM 5544  H HA   . GLN A 1 5  ? 5.516   4.025   7.807   1.00 0.00 ? 5  GLN A HA   8  
ATOM 5545  H HB2  . GLN A 1 5  ? 2.897   2.651   7.134   1.00 0.00 ? 5  GLN A HB2  8  
ATOM 5546  H HB3  . GLN A 1 5  ? 4.179   1.953   8.125   1.00 0.00 ? 5  GLN A HB3  8  
ATOM 5547  H HG2  . GLN A 1 5  ? 3.976   3.951   9.653   1.00 0.00 ? 5  GLN A HG2  8  
ATOM 5548  H HG3  . GLN A 1 5  ? 2.555   4.439   8.727   1.00 0.00 ? 5  GLN A HG3  8  
ATOM 5549  H HE21 . GLN A 1 5  ? 0.836   2.578   8.508   1.00 0.00 ? 5  GLN A HE21 8  
ATOM 5550  H HE22 . GLN A 1 5  ? 0.574   1.636   9.896   1.00 0.00 ? 5  GLN A HE22 8  
ATOM 5551  N N    . CYS A 1 6  ? 4.855   3.239   4.742   1.00 0.00 ? 6  CYS A N    8  
ATOM 5552  C CA   . CYS A 1 6  ? 5.401   2.524   3.555   1.00 0.00 ? 6  CYS A CA   8  
ATOM 5553  C C    . CYS A 1 6  ? 6.173   3.506   2.675   1.00 0.00 ? 6  CYS A C    8  
ATOM 5554  O O    . CYS A 1 6  ? 7.218   3.190   2.141   1.00 0.00 ? 6  CYS A O    8  
ATOM 5555  C CB   . CYS A 1 6  ? 4.251   1.921   2.751   1.00 0.00 ? 6  CYS A CB   8  
ATOM 5556  S SG   . CYS A 1 6  ? 3.378   0.706   3.768   1.00 0.00 ? 6  CYS A SG   8  
ATOM 5557  H H    . CYS A 1 6  ? 4.133   3.888   4.630   1.00 0.00 ? 6  CYS A H    8  
ATOM 5558  H HA   . CYS A 1 6  ? 6.062   1.736   3.880   1.00 0.00 ? 6  CYS A HA   8  
ATOM 5559  H HB2  . CYS A 1 6  ? 3.570   2.706   2.463   1.00 0.00 ? 6  CYS A HB2  8  
ATOM 5560  H HB3  . CYS A 1 6  ? 4.641   1.439   1.867   1.00 0.00 ? 6  CYS A HB3  8  
ATOM 5561  N N    . CYS A 1 7  ? 5.666   4.698   2.513   1.00 0.00 ? 7  CYS A N    8  
ATOM 5562  C CA   . CYS A 1 7  ? 6.374   5.697   1.667   1.00 0.00 ? 7  CYS A CA   8  
ATOM 5563  C C    . CYS A 1 7  ? 7.546   6.287   2.453   1.00 0.00 ? 7  CYS A C    8  
ATOM 5564  O O    . CYS A 1 7  ? 8.690   5.963   2.213   1.00 0.00 ? 7  CYS A O    8  
ATOM 5565  C CB   . CYS A 1 7  ? 5.401   6.813   1.274   1.00 0.00 ? 7  CYS A CB   8  
ATOM 5566  S SG   . CYS A 1 7  ? 6.321   8.186   0.535   1.00 0.00 ? 7  CYS A SG   8  
ATOM 5567  H H    . CYS A 1 7  ? 4.821   4.934   2.951   1.00 0.00 ? 7  CYS A H    8  
ATOM 5568  H HA   . CYS A 1 7  ? 6.746   5.214   0.777   1.00 0.00 ? 7  CYS A HA   8  
ATOM 5569  H HB2  . CYS A 1 7  ? 4.687   6.432   0.559   1.00 0.00 ? 7  CYS A HB2  8  
ATOM 5570  H HB3  . CYS A 1 7  ? 4.876   7.158   2.153   1.00 0.00 ? 7  CYS A HB3  8  
ATOM 5571  N N    . THR A 1 8  ? 7.270   7.155   3.389   1.00 0.00 ? 8  THR A N    8  
ATOM 5572  C CA   . THR A 1 8  ? 8.374   7.763   4.186   1.00 0.00 ? 8  THR A CA   8  
ATOM 5573  C C    . THR A 1 8  ? 9.372   6.675   4.584   1.00 0.00 ? 8  THR A C    8  
ATOM 5574  O O    . THR A 1 8  ? 10.566  6.819   4.412   1.00 0.00 ? 8  THR A O    8  
ATOM 5575  C CB   . THR A 1 8  ? 7.796   8.419   5.444   1.00 0.00 ? 8  THR A CB   8  
ATOM 5576  O OG1  . THR A 1 8  ? 7.419   7.412   6.371   1.00 0.00 ? 8  THR A OG1  8  
ATOM 5577  C CG2  . THR A 1 8  ? 6.573   9.257   5.068   1.00 0.00 ? 8  THR A CG2  8  
ATOM 5578  H H    . THR A 1 8  ? 6.341   7.407   3.568   1.00 0.00 ? 8  THR A H    8  
ATOM 5579  H HA   . THR A 1 8  ? 8.876   8.510   3.588   1.00 0.00 ? 8  THR A HA   8  
ATOM 5580  H HB   . THR A 1 8  ? 8.542   9.059   5.891   1.00 0.00 ? 8  THR A HB   8  
ATOM 5581  H HG1  . THR A 1 8  ? 7.971   7.504   7.151   1.00 0.00 ? 8  THR A HG1  8  
ATOM 5582  H HG21 . THR A 1 8  ? 6.783   9.817   4.170   1.00 0.00 ? 8  THR A HG21 8  
ATOM 5583  H HG22 . THR A 1 8  ? 5.728   8.604   4.899   1.00 0.00 ? 8  THR A HG22 8  
ATOM 5584  H HG23 . THR A 1 8  ? 6.345   9.940   5.873   1.00 0.00 ? 8  THR A HG23 8  
ATOM 5585  N N    . SER A 1 9  ? 8.891   5.582   5.112   1.00 0.00 ? 9  SER A N    8  
ATOM 5586  C CA   . SER A 1 9  ? 9.810   4.481   5.516   1.00 0.00 ? 9  SER A CA   8  
ATOM 5587  C C    . SER A 1 9  ? 9.577   3.274   4.605   1.00 0.00 ? 9  SER A C    8  
ATOM 5588  O O    . SER A 1 9  ? 9.097   3.403   3.498   1.00 0.00 ? 9  SER A O    8  
ATOM 5589  C CB   . SER A 1 9  ? 9.533   4.088   6.967   1.00 0.00 ? 9  SER A CB   8  
ATOM 5590  O OG   . SER A 1 9  ? 10.764  4.004   7.673   1.00 0.00 ? 9  SER A OG   8  
ATOM 5591  H H    . SER A 1 9  ? 7.923   5.483   5.239   1.00 0.00 ? 9  SER A H    8  
ATOM 5592  H HA   . SER A 1 9  ? 10.833  4.812   5.419   1.00 0.00 ? 9  SER A HA   8  
ATOM 5593  H HB2  . SER A 1 9  ? 8.906   4.829   7.431   1.00 0.00 ? 9  SER A HB2  8  
ATOM 5594  H HB3  . SER A 1 9  ? 9.029   3.129   6.987   1.00 0.00 ? 9  SER A HB3  8  
ATOM 5595  H HG   . SER A 1 9  ? 10.897  4.836   8.135   1.00 0.00 ? 9  SER A HG   8  
ATOM 5596  N N    . ILE A 1 10 ? 9.914   2.099   5.062   1.00 0.00 ? 10 ILE A N    8  
ATOM 5597  C CA   . ILE A 1 10 ? 9.710   0.888   4.221   1.00 0.00 ? 10 ILE A CA   8  
ATOM 5598  C C    . ILE A 1 10 ? 8.913   -0.151  5.012   1.00 0.00 ? 10 ILE A C    8  
ATOM 5599  O O    . ILE A 1 10 ? 9.440   -0.834  5.866   1.00 0.00 ? 10 ILE A O    8  
ATOM 5600  C CB   . ILE A 1 10 ? 11.068  0.310   3.827   1.00 0.00 ? 10 ILE A CB   8  
ATOM 5601  C CG1  . ILE A 1 10 ? 11.774  1.283   2.880   1.00 0.00 ? 10 ILE A CG1  8  
ATOM 5602  C CG2  . ILE A 1 10 ? 10.869  -1.033  3.123   1.00 0.00 ? 10 ILE A CG2  8  
ATOM 5603  C CD1  . ILE A 1 10 ? 13.021  0.621   2.292   1.00 0.00 ? 10 ILE A CD1  8  
ATOM 5604  H H    . ILE A 1 10 ? 10.301  2.013   5.959   1.00 0.00 ? 10 ILE A H    8  
ATOM 5605  H HA   . ILE A 1 10 ? 9.162   1.160   3.330   1.00 0.00 ? 10 ILE A HA   8  
ATOM 5606  H HB   . ILE A 1 10 ? 11.670  0.167   4.714   1.00 0.00 ? 10 ILE A HB   8  
ATOM 5607  H HG12 . ILE A 1 10 ? 11.100  1.554   2.079   1.00 0.00 ? 10 ILE A HG12 8  
ATOM 5608  H HG13 . ILE A 1 10 ? 12.061  2.169   3.424   1.00 0.00 ? 10 ILE A HG13 8  
ATOM 5609  H HG21 . ILE A 1 10 ? 10.274  -1.682  3.749   1.00 0.00 ? 10 ILE A HG21 8  
ATOM 5610  H HG22 . ILE A 1 10 ? 10.360  -0.876  2.183   1.00 0.00 ? 10 ILE A HG22 8  
ATOM 5611  H HG23 . ILE A 1 10 ? 11.829  -1.491  2.940   1.00 0.00 ? 10 ILE A HG23 8  
ATOM 5612  H HD11 . ILE A 1 10 ? 13.463  -0.035  3.029   1.00 0.00 ? 10 ILE A HD11 8  
ATOM 5613  H HD12 . ILE A 1 10 ? 12.748  0.049   1.419   1.00 0.00 ? 10 ILE A HD12 8  
ATOM 5614  H HD13 . ILE A 1 10 ? 13.735  1.382   2.016   1.00 0.00 ? 10 ILE A HD13 8  
ATOM 5615  N N    . CYS A 1 11 ? 7.642   -0.271  4.736   1.00 0.00 ? 11 CYS A N    8  
ATOM 5616  C CA   . CYS A 1 11 ? 6.809   -1.262  5.473   1.00 0.00 ? 11 CYS A CA   8  
ATOM 5617  C C    . CYS A 1 11 ? 6.874   -2.616  4.762   1.00 0.00 ? 11 CYS A C    8  
ATOM 5618  O O    . CYS A 1 11 ? 7.556   -2.777  3.770   1.00 0.00 ? 11 CYS A O    8  
ATOM 5619  C CB   . CYS A 1 11 ? 5.356   -0.779  5.513   1.00 0.00 ? 11 CYS A CB   8  
ATOM 5620  S SG   . CYS A 1 11 ? 4.642   -0.867  3.851   1.00 0.00 ? 11 CYS A SG   8  
ATOM 5621  H H    . CYS A 1 11 ? 7.236   0.291   4.044   1.00 0.00 ? 11 CYS A H    8  
ATOM 5622  H HA   . CYS A 1 11 ? 7.181   -1.366  6.481   1.00 0.00 ? 11 CYS A HA   8  
ATOM 5623  H HB2  . CYS A 1 11 ? 4.787   -1.404  6.184   1.00 0.00 ? 11 CYS A HB2  8  
ATOM 5624  H HB3  . CYS A 1 11 ? 5.327   0.244   5.863   1.00 0.00 ? 11 CYS A HB3  8  
ATOM 5625  N N    . SER A 1 12 ? 6.166   -3.592  5.263   1.00 0.00 ? 12 SER A N    8  
ATOM 5626  C CA   . SER A 1 12 ? 6.184   -4.935  4.619   1.00 0.00 ? 12 SER A CA   8  
ATOM 5627  C C    . SER A 1 12 ? 4.832   -5.191  3.947   1.00 0.00 ? 12 SER A C    8  
ATOM 5628  O O    . SER A 1 12 ? 3.887   -4.450  4.132   1.00 0.00 ? 12 SER A O    8  
ATOM 5629  C CB   . SER A 1 12 ? 6.435   -6.003  5.685   1.00 0.00 ? 12 SER A CB   8  
ATOM 5630  O OG   . SER A 1 12 ? 5.883   -5.574  6.921   1.00 0.00 ? 12 SER A OG   8  
ATOM 5631  H H    . SER A 1 12 ? 5.623   -3.441  6.064   1.00 0.00 ? 12 SER A H    8  
ATOM 5632  H HA   . SER A 1 12 ? 6.968   -4.971  3.878   1.00 0.00 ? 12 SER A HA   8  
ATOM 5633  H HB2  . SER A 1 12 ? 5.966   -6.926  5.389   1.00 0.00 ? 12 SER A HB2  8  
ATOM 5634  H HB3  . SER A 1 12 ? 7.500   -6.159  5.789   1.00 0.00 ? 12 SER A HB3  8  
ATOM 5635  H HG   . SER A 1 12 ? 6.502   -5.801  7.618   1.00 0.00 ? 12 SER A HG   8  
ATOM 5636  N N    . LEU A 1 13 ? 4.729   -6.236  3.169   1.00 0.00 ? 13 LEU A N    8  
ATOM 5637  C CA   . LEU A 1 13 ? 3.435   -6.531  2.494   1.00 0.00 ? 13 LEU A CA   8  
ATOM 5638  C C    . LEU A 1 13 ? 2.399   -6.942  3.541   1.00 0.00 ? 13 LEU A C    8  
ATOM 5639  O O    . LEU A 1 13 ? 1.224   -7.063  3.253   1.00 0.00 ? 13 LEU A O    8  
ATOM 5640  C CB   . LEU A 1 13 ? 3.628   -7.669  1.489   1.00 0.00 ? 13 LEU A CB   8  
ATOM 5641  C CG   . LEU A 1 13 ? 2.470   -7.666  0.487   1.00 0.00 ? 13 LEU A CG   8  
ATOM 5642  C CD1  . LEU A 1 13 ? 2.678   -6.547  -0.534  1.00 0.00 ? 13 LEU A CD1  8  
ATOM 5643  C CD2  . LEU A 1 13 ? 2.420   -9.014  -0.237  1.00 0.00 ? 13 LEU A CD2  8  
ATOM 5644  H H    . LEU A 1 13 ? 5.501   -6.824  3.033   1.00 0.00 ? 13 LEU A H    8  
ATOM 5645  H HA   . LEU A 1 13 ? 3.091   -5.648  1.975   1.00 0.00 ? 13 LEU A HA   8  
ATOM 5646  H HB2  . LEU A 1 13 ? 4.561   -7.530  0.962   1.00 0.00 ? 13 LEU A HB2  8  
ATOM 5647  H HB3  . LEU A 1 13 ? 3.646   -8.614  2.011   1.00 0.00 ? 13 LEU A HB3  8  
ATOM 5648  H HG   . LEU A 1 13 ? 1.540   -7.503  1.013   1.00 0.00 ? 13 LEU A HG   8  
ATOM 5649  H HD11 . LEU A 1 13 ? 3.104   -5.685  -0.043  1.00 0.00 ? 13 LEU A HD11 8  
ATOM 5650  H HD12 . LEU A 1 13 ? 3.350   -6.887  -1.311  1.00 0.00 ? 13 LEU A HD12 8  
ATOM 5651  H HD13 . LEU A 1 13 ? 1.729   -6.279  -0.974  1.00 0.00 ? 13 LEU A HD13 8  
ATOM 5652  H HD21 . LEU A 1 13 ? 3.406   -9.262  -0.603  1.00 0.00 ? 13 LEU A HD21 8  
ATOM 5653  H HD22 . LEU A 1 13 ? 2.086   -9.777  0.448   1.00 0.00 ? 13 LEU A HD22 8  
ATOM 5654  H HD23 . LEU A 1 13 ? 1.734   -8.949  -1.068  1.00 0.00 ? 13 LEU A HD23 8  
ATOM 5655  N N    . TYR A 1 14 ? 2.823   -7.158  4.757   1.00 0.00 ? 14 TYR A N    8  
ATOM 5656  C CA   . TYR A 1 14 ? 1.861   -7.561  5.822   1.00 0.00 ? 14 TYR A CA   8  
ATOM 5657  C C    . TYR A 1 14 ? 0.968   -6.367  6.174   1.00 0.00 ? 14 TYR A C    8  
ATOM 5658  O O    . TYR A 1 14 ? -0.167  -6.529  6.577   1.00 0.00 ? 14 TYR A O    8  
ATOM 5659  C CB   . TYR A 1 14 ? 2.639   -8.013  7.064   1.00 0.00 ? 14 TYR A CB   8  
ATOM 5660  C CG   . TYR A 1 14 ? 1.715   -8.068  8.259   1.00 0.00 ? 14 TYR A CG   8  
ATOM 5661  C CD1  . TYR A 1 14 ? 0.410   -8.552  8.113   1.00 0.00 ? 14 TYR A CD1  8  
ATOM 5662  C CD2  . TYR A 1 14 ? 2.164   -7.633  9.511   1.00 0.00 ? 14 TYR A CD2  8  
ATOM 5663  C CE1  . TYR A 1 14 ? -0.447  -8.603  9.221   1.00 0.00 ? 14 TYR A CE1  8  
ATOM 5664  C CE2  . TYR A 1 14 ? 1.308   -7.683  10.619  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 5665  C CZ   . TYR A 1 14 ? 0.003   -8.168  10.472  1.00 0.00 ? 14 TYR A CZ   8  
ATOM 5666  O OH   . TYR A 1 14 ? -0.841  -8.216  11.563  1.00 0.00 ? 14 TYR A OH   8  
ATOM 5667  H H    . TYR A 1 14 ? 3.774   -7.056  4.969   1.00 0.00 ? 14 TYR A H    8  
ATOM 5668  H HA   . TYR A 1 14 ? 1.248   -8.376  5.465   1.00 0.00 ? 14 TYR A HA   8  
ATOM 5669  H HB2  . TYR A 1 14 ? 3.058   -8.992  6.887   1.00 0.00 ? 14 TYR A HB2  8  
ATOM 5670  H HB3  . TYR A 1 14 ? 3.438   -7.312  7.260   1.00 0.00 ? 14 TYR A HB3  8  
ATOM 5671  H HD1  . TYR A 1 14 ? 0.062   -8.889  7.147   1.00 0.00 ? 14 TYR A HD1  8  
ATOM 5672  H HD2  . TYR A 1 14 ? 3.172   -7.261  9.623   1.00 0.00 ? 14 TYR A HD2  8  
ATOM 5673  H HE1  . TYR A 1 14 ? -1.453  -8.976  9.107   1.00 0.00 ? 14 TYR A HE1  8  
ATOM 5674  H HE2  . TYR A 1 14 ? 1.655   -7.347  11.586  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 5675  H HH   . TYR A 1 14 ? -1.716  -7.944  11.274  1.00 0.00 ? 14 TYR A HH   8  
ATOM 5676  N N    . GLN A 1 15 ? 1.473   -5.174  6.026   1.00 0.00 ? 15 GLN A N    8  
ATOM 5677  C CA   . GLN A 1 15 ? 0.652   -3.974  6.355   1.00 0.00 ? 15 GLN A CA   8  
ATOM 5678  C C    . GLN A 1 15 ? -0.361  -3.718  5.237   1.00 0.00 ? 15 GLN A C    8  
ATOM 5679  O O    . GLN A 1 15 ? -1.404  -3.135  5.458   1.00 0.00 ? 15 GLN A O    8  
ATOM 5680  C CB   . GLN A 1 15 ? 1.565   -2.757  6.509   1.00 0.00 ? 15 GLN A CB   8  
ATOM 5681  C CG   . GLN A 1 15 ? 2.509   -2.973  7.691   1.00 0.00 ? 15 GLN A CG   8  
ATOM 5682  C CD   . GLN A 1 15 ? 2.764   -1.640  8.396   1.00 0.00 ? 15 GLN A CD   8  
ATOM 5683  O OE1  . GLN A 1 15 ? 2.193   -0.629  8.034   1.00 0.00 ? 15 GLN A OE1  8  
ATOM 5684  N NE2  . GLN A 1 15 ? 3.601   -1.593  9.396   1.00 0.00 ? 15 GLN A NE2  8  
ATOM 5685  H H    . GLN A 1 15 ? 2.390   -5.066  5.701   1.00 0.00 ? 15 GLN A H    8  
ATOM 5686  H HA   . GLN A 1 15 ? 0.125   -4.145  7.284   1.00 0.00 ? 15 GLN A HA   8  
ATOM 5687  H HB2  . GLN A 1 15 ? 2.141   -2.624  5.604   1.00 0.00 ? 15 GLN A HB2  8  
ATOM 5688  H HB3  . GLN A 1 15 ? 0.965   -1.878  6.687   1.00 0.00 ? 15 GLN A HB3  8  
ATOM 5689  H HG2  . GLN A 1 15 ? 2.063   -3.670  8.387   1.00 0.00 ? 15 GLN A HG2  8  
ATOM 5690  H HG3  . GLN A 1 15 ? 3.448   -3.374  7.334   1.00 0.00 ? 15 GLN A HG3  8  
ATOM 5691  H HE21 . GLN A 1 15 ? 4.062   -2.407  9.688   1.00 0.00 ? 15 GLN A HE21 8  
ATOM 5692  H HE22 . GLN A 1 15 ? 3.771   -0.744  9.854   1.00 0.00 ? 15 GLN A HE22 8  
ATOM 5693  N N    . LEU A 1 16 ? -0.070  -4.146  4.038   1.00 0.00 ? 16 LEU A N    8  
ATOM 5694  C CA   . LEU A 1 16 ? -1.032  -3.916  2.921   1.00 0.00 ? 16 LEU A CA   8  
ATOM 5695  C C    . LEU A 1 16 ? -2.181  -4.916  3.023   1.00 0.00 ? 16 LEU A C    8  
ATOM 5696  O O    . LEU A 1 16 ? -3.236  -4.724  2.450   1.00 0.00 ? 16 LEU A O    8  
ATOM 5697  C CB   . LEU A 1 16 ? -0.321  -4.086  1.571   1.00 0.00 ? 16 LEU A CB   8  
ATOM 5698  C CG   . LEU A 1 16 ? 0.805   -3.051  1.402   1.00 0.00 ? 16 LEU A CG   8  
ATOM 5699  C CD1  . LEU A 1 16 ? 0.760   -2.511  -0.024  1.00 0.00 ? 16 LEU A CD1  8  
ATOM 5700  C CD2  . LEU A 1 16 ? 0.635   -1.880  2.374   1.00 0.00 ? 16 LEU A CD2  8  
ATOM 5701  H H    . LEU A 1 16 ? 0.774   -4.615  3.873   1.00 0.00 ? 16 LEU A H    8  
ATOM 5702  H HA   . LEU A 1 16 ? -1.426  -2.913  2.992   1.00 0.00 ? 16 LEU A HA   8  
ATOM 5703  H HB2  . LEU A 1 16 ? 0.099   -5.077  1.512   1.00 0.00 ? 16 LEU A HB2  8  
ATOM 5704  H HB3  . LEU A 1 16 ? -1.041  -3.957  0.776   1.00 0.00 ? 16 LEU A HB3  8  
ATOM 5705  H HG   . LEU A 1 16 ? 1.759   -3.531  1.571   1.00 0.00 ? 16 LEU A HG   8  
ATOM 5706  H HD11 . LEU A 1 16 ? 0.493   -3.309  -0.699  1.00 0.00 ? 16 LEU A HD11 8  
ATOM 5707  H HD12 . LEU A 1 16 ? 0.020   -1.724  -0.083  1.00 0.00 ? 16 LEU A HD12 8  
ATOM 5708  H HD13 . LEU A 1 16 ? 1.729   -2.117  -0.291  1.00 0.00 ? 16 LEU A HD13 8  
ATOM 5709  H HD21 . LEU A 1 16 ? -0.365  -1.481  2.286   1.00 0.00 ? 16 LEU A HD21 8  
ATOM 5710  H HD22 . LEU A 1 16 ? 0.796   -2.227  3.385   1.00 0.00 ? 16 LEU A HD22 8  
ATOM 5711  H HD23 . LEU A 1 16 ? 1.353   -1.109  2.139   1.00 0.00 ? 16 LEU A HD23 8  
ATOM 5712  N N    . GLU A 1 17 ? -1.993  -5.980  3.753   1.00 0.00 ? 17 GLU A N    8  
ATOM 5713  C CA   . GLU A 1 17 ? -3.083  -6.982  3.893   1.00 0.00 ? 17 GLU A CA   8  
ATOM 5714  C C    . GLU A 1 17 ? -4.247  -6.343  4.650   1.00 0.00 ? 17 GLU A C    8  
ATOM 5715  O O    . GLU A 1 17 ? -5.392  -6.706  4.477   1.00 0.00 ? 17 GLU A O    8  
ATOM 5716  C CB   . GLU A 1 17 ? -2.566  -8.195  4.670   1.00 0.00 ? 17 GLU A CB   8  
ATOM 5717  C CG   . GLU A 1 17 ? -1.388  -8.815  3.914   1.00 0.00 ? 17 GLU A CG   8  
ATOM 5718  C CD   . GLU A 1 17 ? -0.884  -10.046 4.669   1.00 0.00 ? 17 GLU A CD   8  
ATOM 5719  O OE1  . GLU A 1 17 ? -1.710  -10.777 5.189   1.00 0.00 ? 17 GLU A OE1  8  
ATOM 5720  O OE2  . GLU A 1 17 ? 0.321   -10.236 4.714   1.00 0.00 ? 17 GLU A OE2  8  
ATOM 5721  H H    . GLU A 1 17 ? -1.139  -6.116  4.211   1.00 0.00 ? 17 GLU A H    8  
ATOM 5722  H HA   . GLU A 1 17 ? -3.417  -7.294  2.914   1.00 0.00 ? 17 GLU A HA   8  
ATOM 5723  H HB2  . GLU A 1 17 ? -2.241  -7.882  5.651   1.00 0.00 ? 17 GLU A HB2  8  
ATOM 5724  H HB3  . GLU A 1 17 ? -3.354  -8.926  4.765   1.00 0.00 ? 17 GLU A HB3  8  
ATOM 5725  H HG2  . GLU A 1 17 ? -1.709  -9.105  2.924   1.00 0.00 ? 17 GLU A HG2  8  
ATOM 5726  H HG3  . GLU A 1 17 ? -0.590  -8.092  3.836   1.00 0.00 ? 17 GLU A HG3  8  
ATOM 5727  N N    . ASN A 1 18 ? -3.957  -5.380  5.487   1.00 0.00 ? 18 ASN A N    8  
ATOM 5728  C CA   . ASN A 1 18 ? -5.042  -4.706  6.252   1.00 0.00 ? 18 ASN A CA   8  
ATOM 5729  C C    . ASN A 1 18 ? -5.870  -3.846  5.295   1.00 0.00 ? 18 ASN A C    8  
ATOM 5730  O O    . ASN A 1 18 ? -6.988  -3.475  5.587   1.00 0.00 ? 18 ASN A O    8  
ATOM 5731  C CB   . ASN A 1 18 ? -4.423  -3.817  7.332   1.00 0.00 ? 18 ASN A CB   8  
ATOM 5732  C CG   . ASN A 1 18 ? -5.010  -4.184  8.696   1.00 0.00 ? 18 ASN A CG   8  
ATOM 5733  O OD1  . ASN A 1 18 ? -6.007  -4.875  8.774   1.00 0.00 ? 18 ASN A OD1  8  
ATOM 5734  N ND2  . ASN A 1 18 ? -4.431  -3.749  9.781   1.00 0.00 ? 18 ASN A ND2  8  
ATOM 5735  H H    . ASN A 1 18 ? -3.027  -5.100  5.605   1.00 0.00 ? 18 ASN A H    8  
ATOM 5736  H HA   . ASN A 1 18 ? -5.676  -5.447  6.712   1.00 0.00 ? 18 ASN A HA   8  
ATOM 5737  H HB2  . ASN A 1 18 ? -3.352  -3.962  7.349   1.00 0.00 ? 18 ASN A HB2  8  
ATOM 5738  H HB3  . ASN A 1 18 ? -4.642  -2.781  7.114   1.00 0.00 ? 18 ASN A HB3  8  
ATOM 5739  H HD21 . ASN A 1 18 ? -3.626  -3.193  9.718   1.00 0.00 ? 18 ASN A HD21 8  
ATOM 5740  H HD22 . ASN A 1 18 ? -4.801  -3.978  10.660  1.00 0.00 ? 18 ASN A HD22 8  
ATOM 5741  N N    . TYR A 1 19 ? -5.325  -3.528  4.150   1.00 0.00 ? 19 TYR A N    8  
ATOM 5742  C CA   . TYR A 1 19 ? -6.073  -2.693  3.170   1.00 0.00 ? 19 TYR A CA   8  
ATOM 5743  C C    . TYR A 1 19 ? -6.989  -3.586  2.328   1.00 0.00 ? 19 TYR A C    8  
ATOM 5744  O O    . TYR A 1 19 ? -7.087  -3.428  1.130   1.00 0.00 ? 19 TYR A O    8  
ATOM 5745  C CB   . TYR A 1 19 ? -5.077  -1.975  2.255   1.00 0.00 ? 19 TYR A CB   8  
ATOM 5746  C CG   . TYR A 1 19 ? -4.684  -0.660  2.876   1.00 0.00 ? 19 TYR A CG   8  
ATOM 5747  C CD1  . TYR A 1 19 ? -5.451  0.487   2.644   1.00 0.00 ? 19 TYR A CD1  8  
ATOM 5748  C CD2  . TYR A 1 19 ? -3.551  -0.595  3.690   1.00 0.00 ? 19 TYR A CD2  8  
ATOM 5749  C CE1  . TYR A 1 19 ? -5.084  1.705   3.233   1.00 0.00 ? 19 TYR A CE1  8  
ATOM 5750  C CE2  . TYR A 1 19 ? -3.185  0.619   4.275   1.00 0.00 ? 19 TYR A CE2  8  
ATOM 5751  C CZ   . TYR A 1 19 ? -3.952  1.769   4.048   1.00 0.00 ? 19 TYR A CZ   8  
ATOM 5752  O OH   . TYR A 1 19 ? -3.592  2.968   4.630   1.00 0.00 ? 19 TYR A OH   8  
ATOM 5753  H H    . TYR A 1 19 ? -4.420  -3.839  3.938   1.00 0.00 ? 19 TYR A H    8  
ATOM 5754  H HA   . TYR A 1 19 ? -6.669  -1.963  3.698   1.00 0.00 ? 19 TYR A HA   8  
ATOM 5755  H HB2  . TYR A 1 19 ? -4.199  -2.588  2.125   1.00 0.00 ? 19 TYR A HB2  8  
ATOM 5756  H HB3  . TYR A 1 19 ? -5.529  -1.788  1.296   1.00 0.00 ? 19 TYR A HB3  8  
ATOM 5757  H HD1  . TYR A 1 19 ? -6.326  0.432   2.014   1.00 0.00 ? 19 TYR A HD1  8  
ATOM 5758  H HD2  . TYR A 1 19 ? -2.956  -1.481  3.859   1.00 0.00 ? 19 TYR A HD2  8  
ATOM 5759  H HE1  . TYR A 1 19 ? -5.673  2.597   3.055   1.00 0.00 ? 19 TYR A HE1  8  
ATOM 5760  H HE2  . TYR A 1 19 ? -2.316  0.665   4.904   1.00 0.00 ? 19 TYR A HE2  8  
ATOM 5761  H HH   . TYR A 1 19 ? -3.779  3.670   4.003   1.00 0.00 ? 19 TYR A HH   8  
ATOM 5762  N N    . CYS A 1 20 ? -7.662  -4.520  2.941   1.00 0.00 ? 20 CYS A N    8  
ATOM 5763  C CA   . CYS A 1 20 ? -8.568  -5.414  2.164   1.00 0.00 ? 20 CYS A CA   8  
ATOM 5764  C C    . CYS A 1 20 ? -9.989  -5.318  2.723   1.00 0.00 ? 20 CYS A C    8  
ATOM 5765  O O    . CYS A 1 20 ? -10.206 -5.413  3.916   1.00 0.00 ? 20 CYS A O    8  
ATOM 5766  C CB   . CYS A 1 20 ? -8.078  -6.860  2.271   1.00 0.00 ? 20 CYS A CB   8  
ATOM 5767  S SG   . CYS A 1 20 ? -6.337  -6.948  1.786   1.00 0.00 ? 20 CYS A SG   8  
ATOM 5768  H H    . CYS A 1 20 ? -7.575  -4.635  3.910   1.00 0.00 ? 20 CYS A H    8  
ATOM 5769  H HA   . CYS A 1 20 ? -8.568  -5.111  1.127   1.00 0.00 ? 20 CYS A HA   8  
ATOM 5770  H HB2  . CYS A 1 20 ? -8.186  -7.200  3.291   1.00 0.00 ? 20 CYS A HB2  8  
ATOM 5771  H HB3  . CYS A 1 20 ? -8.667  -7.488  1.620   1.00 0.00 ? 20 CYS A HB3  8  
ATOM 5772  N N    . ASN A 1 21 ? -10.960 -5.134  1.870   1.00 0.00 ? 21 ASN A N    8  
ATOM 5773  C CA   . ASN A 1 21 ? -12.367 -5.036  2.352   1.00 0.00 ? 21 ASN A CA   8  
ATOM 5774  C C    . ASN A 1 21 ? -12.783 -6.363  2.991   1.00 0.00 ? 21 ASN A C    8  
ATOM 5775  O O    . ASN A 1 21 ? -13.071 -6.361  4.176   1.00 0.00 ? 21 ASN A O    8  
ATOM 5776  C CB   . ASN A 1 21 ? -13.288 -4.727  1.169   1.00 0.00 ? 21 ASN A CB   8  
ATOM 5777  C CG   . ASN A 1 21 ? -13.687 -3.252  1.199   1.00 0.00 ? 21 ASN A CG   8  
ATOM 5778  O OD1  . ASN A 1 21 ? -14.445 -2.832  2.051   1.00 0.00 ? 21 ASN A OD1  8  
ATOM 5779  N ND2  . ASN A 1 21 ? -13.205 -2.439  0.299   1.00 0.00 ? 21 ASN A ND2  8  
ATOM 5780  O OXT  . ASN A 1 21 ? -12.807 -7.355  2.283   1.00 0.00 ? 21 ASN A OXT  8  
ATOM 5781  H H    . ASN A 1 21 ? -10.764 -5.064  0.915   1.00 0.00 ? 21 ASN A H    8  
ATOM 5782  H HA   . ASN A 1 21 ? -12.444 -4.244  3.083   1.00 0.00 ? 21 ASN A HA   8  
ATOM 5783  H HB2  . ASN A 1 21 ? -12.770 -4.942  0.245   1.00 0.00 ? 21 ASN A HB2  8  
ATOM 5784  H HB3  . ASN A 1 21 ? -14.175 -5.340  1.235   1.00 0.00 ? 21 ASN A HB3  8  
ATOM 5785  H HD21 . ASN A 1 21 ? -12.593 -2.777  -0.388  1.00 0.00 ? 21 ASN A HD21 8  
ATOM 5786  H HD22 . ASN A 1 21 ? -13.453 -1.492  0.310   1.00 0.00 ? 21 ASN A HD22 8  
ATOM 5787  N N    . PHE B 2 1  ? 5.778   -6.483  -5.742  1.00 0.00 ? 1  PHE B N    8  
ATOM 5788  C CA   . PHE B 2 1  ? 5.930   -7.282  -4.494  1.00 0.00 ? 1  PHE B CA   8  
ATOM 5789  C C    . PHE B 2 1  ? 7.375   -7.181  -3.994  1.00 0.00 ? 1  PHE B C    8  
ATOM 5790  O O    . PHE B 2 1  ? 8.153   -8.103  -4.133  1.00 0.00 ? 1  PHE B O    8  
ATOM 5791  C CB   . PHE B 2 1  ? 5.585   -8.749  -4.780  1.00 0.00 ? 1  PHE B CB   8  
ATOM 5792  C CG   . PHE B 2 1  ? 6.083   -9.620  -3.652  1.00 0.00 ? 1  PHE B CG   8  
ATOM 5793  C CD1  . PHE B 2 1  ? 5.450   -9.578  -2.403  1.00 0.00 ? 1  PHE B CD1  8  
ATOM 5794  C CD2  . PHE B 2 1  ? 7.181   -10.464 -3.851  1.00 0.00 ? 1  PHE B CD2  8  
ATOM 5795  C CE1  . PHE B 2 1  ? 5.915   -10.382 -1.356  1.00 0.00 ? 1  PHE B CE1  8  
ATOM 5796  C CE2  . PHE B 2 1  ? 7.649   -11.266 -2.803  1.00 0.00 ? 1  PHE B CE2  8  
ATOM 5797  C CZ   . PHE B 2 1  ? 7.014   -11.225 -1.555  1.00 0.00 ? 1  PHE B CZ   8  
ATOM 5798  H H1   . PHE B 2 1  ? 6.332   -5.607  -5.663  1.00 0.00 ? 1  PHE B H1   8  
ATOM 5799  H H2   . PHE B 2 1  ? 6.121   -7.035  -6.553  1.00 0.00 ? 1  PHE B H2   8  
ATOM 5800  H H3   . PHE B 2 1  ? 4.772   -6.246  -5.882  1.00 0.00 ? 1  PHE B H3   8  
ATOM 5801  H HA   . PHE B 2 1  ? 5.261   -6.898  -3.736  1.00 0.00 ? 1  PHE B HA   8  
ATOM 5802  H HB2  . PHE B 2 1  ? 4.514   -8.855  -4.871  1.00 0.00 ? 1  PHE B HB2  8  
ATOM 5803  H HB3  . PHE B 2 1  ? 6.055   -9.055  -5.705  1.00 0.00 ? 1  PHE B HB3  8  
ATOM 5804  H HD1  . PHE B 2 1  ? 4.602   -8.927  -2.249  1.00 0.00 ? 1  PHE B HD1  8  
ATOM 5805  H HD2  . PHE B 2 1  ? 7.669   -10.496 -4.814  1.00 0.00 ? 1  PHE B HD2  8  
ATOM 5806  H HE1  . PHE B 2 1  ? 5.427   -10.349 -0.393  1.00 0.00 ? 1  PHE B HE1  8  
ATOM 5807  H HE2  . PHE B 2 1  ? 8.496   -11.916 -2.958  1.00 0.00 ? 1  PHE B HE2  8  
ATOM 5808  H HZ   . PHE B 2 1  ? 7.373   -11.843 -0.747  1.00 0.00 ? 1  PHE B HZ   8  
ATOM 5809  N N    . VAL B 2 2  ? 7.736   -6.071  -3.414  1.00 0.00 ? 2  VAL B N    8  
ATOM 5810  C CA   . VAL B 2 2  ? 9.128   -5.917  -2.905  1.00 0.00 ? 2  VAL B CA   8  
ATOM 5811  C C    . VAL B 2 2  ? 9.166   -4.809  -1.851  1.00 0.00 ? 2  VAL B C    8  
ATOM 5812  O O    . VAL B 2 2  ? 8.587   -3.755  -2.024  1.00 0.00 ? 2  VAL B O    8  
ATOM 5813  C CB   . VAL B 2 2  ? 10.058  -5.554  -4.065  1.00 0.00 ? 2  VAL B CB   8  
ATOM 5814  C CG1  . VAL B 2 2  ? 11.464  -5.284  -3.528  1.00 0.00 ? 2  VAL B CG1  8  
ATOM 5815  C CG2  . VAL B 2 2  ? 10.104  -6.715  -5.061  1.00 0.00 ? 2  VAL B CG2  8  
ATOM 5816  H H    . VAL B 2 2  ? 7.093   -5.341  -3.310  1.00 0.00 ? 2  VAL B H    8  
ATOM 5817  H HA   . VAL B 2 2  ? 9.453   -6.846  -2.463  1.00 0.00 ? 2  VAL B HA   8  
ATOM 5818  H HB   . VAL B 2 2  ? 9.686   -4.667  -4.558  1.00 0.00 ? 2  VAL B HB   8  
ATOM 5819  H HG11 . VAL B 2 2  ? 11.699  -6.003  -2.756  1.00 0.00 ? 2  VAL B HG11 8  
ATOM 5820  H HG12 . VAL B 2 2  ? 12.181  -5.375  -4.332  1.00 0.00 ? 2  VAL B HG12 8  
ATOM 5821  H HG13 . VAL B 2 2  ? 11.510  -4.287  -3.116  1.00 0.00 ? 2  VAL B HG13 8  
ATOM 5822  H HG21 . VAL B 2 2  ? 10.384  -7.621  -4.544  1.00 0.00 ? 2  VAL B HG21 8  
ATOM 5823  H HG22 . VAL B 2 2  ? 9.131   -6.841  -5.510  1.00 0.00 ? 2  VAL B HG22 8  
ATOM 5824  H HG23 . VAL B 2 2  ? 10.832  -6.499  -5.830  1.00 0.00 ? 2  VAL B HG23 8  
ATOM 5825  N N    . ASN B 2 3  ? 9.844   -5.040  -0.760  1.00 0.00 ? 3  ASN B N    8  
ATOM 5826  C CA   . ASN B 2 3  ? 9.918   -4.003  0.308   1.00 0.00 ? 3  ASN B CA   8  
ATOM 5827  C C    . ASN B 2 3  ? 10.555  -2.733  -0.260  1.00 0.00 ? 3  ASN B C    8  
ATOM 5828  O O    . ASN B 2 3  ? 11.757  -2.646  -0.420  1.00 0.00 ? 3  ASN B O    8  
ATOM 5829  C CB   . ASN B 2 3  ? 10.765  -4.526  1.470   1.00 0.00 ? 3  ASN B CB   8  
ATOM 5830  C CG   . ASN B 2 3  ? 9.930   -5.493  2.312   1.00 0.00 ? 3  ASN B CG   8  
ATOM 5831  O OD1  . ASN B 2 3  ? 8.846   -5.876  1.922   1.00 0.00 ? 3  ASN B OD1  8  
ATOM 5832  N ND2  . ASN B 2 3  ? 10.392  -5.904  3.460   1.00 0.00 ? 3  ASN B ND2  8  
ATOM 5833  H H    . ASN B 2 3  ? 10.303  -5.898  -0.641  1.00 0.00 ? 3  ASN B H    8  
ATOM 5834  H HA   . ASN B 2 3  ? 8.923   -3.778  0.660   1.00 0.00 ? 3  ASN B HA   8  
ATOM 5835  H HB2  . ASN B 2 3  ? 11.631  -5.043  1.079   1.00 0.00 ? 3  ASN B HB2  8  
ATOM 5836  H HB3  . ASN B 2 3  ? 11.085  -3.700  2.083   1.00 0.00 ? 3  ASN B HB3  8  
ATOM 5837  H HD21 . ASN B 2 3  ? 11.266  -5.595  3.776   1.00 0.00 ? 3  ASN B HD21 8  
ATOM 5838  H HD22 . ASN B 2 3  ? 9.863   -6.521  4.007   1.00 0.00 ? 3  ASN B HD22 8  
ATOM 5839  N N    . GLN B 2 4  ? 9.758   -1.747  -0.568  1.00 0.00 ? 4  GLN B N    8  
ATOM 5840  C CA   . GLN B 2 4  ? 10.314  -0.482  -1.129  1.00 0.00 ? 4  GLN B CA   8  
ATOM 5841  C C    . GLN B 2 4  ? 9.433   0.695   -0.700  1.00 0.00 ? 4  GLN B C    8  
ATOM 5842  O O    . GLN B 2 4  ? 8.430   0.520   -0.040  1.00 0.00 ? 4  GLN B O    8  
ATOM 5843  C CB   . GLN B 2 4  ? 10.338  -0.576  -2.658  1.00 0.00 ? 4  GLN B CB   8  
ATOM 5844  C CG   . GLN B 2 4  ? 11.282  0.486   -3.224  1.00 0.00 ? 4  GLN B CG   8  
ATOM 5845  C CD   . GLN B 2 4  ? 11.906  -0.023  -4.526  1.00 0.00 ? 4  GLN B CD   8  
ATOM 5846  O OE1  . GLN B 2 4  ? 12.407  -1.127  -4.582  1.00 0.00 ? 4  GLN B OE1  8  
ATOM 5847  N NE2  . GLN B 2 4  ? 11.895  0.744   -5.583  1.00 0.00 ? 4  GLN B NE2  8  
ATOM 5848  H H    . GLN B 2 4  ? 8.792   -1.837  -0.434  1.00 0.00 ? 4  GLN B H    8  
ATOM 5849  H HA   . GLN B 2 4  ? 11.320  -0.335  -0.762  1.00 0.00 ? 4  GLN B HA   8  
ATOM 5850  H HB2  . GLN B 2 4  ? 10.682  -1.556  -2.953  1.00 0.00 ? 4  GLN B HB2  8  
ATOM 5851  H HB3  . GLN B 2 4  ? 9.342   -0.411  -3.043  1.00 0.00 ? 4  GLN B HB3  8  
ATOM 5852  H HG2  . GLN B 2 4  ? 10.727  1.392   -3.420  1.00 0.00 ? 4  GLN B HG2  8  
ATOM 5853  H HG3  . GLN B 2 4  ? 12.065  0.692   -2.509  1.00 0.00 ? 4  GLN B HG3  8  
ATOM 5854  H HE21 . GLN B 2 4  ? 11.491  1.636   -5.537  1.00 0.00 ? 4  GLN B HE21 8  
ATOM 5855  H HE22 . GLN B 2 4  ? 12.292  0.428   -6.422  1.00 0.00 ? 4  GLN B HE22 8  
ATOM 5856  N N    . HIS B 2 5  ? 9.800   1.892   -1.071  1.00 0.00 ? 5  HIS B N    8  
ATOM 5857  C CA   . HIS B 2 5  ? 8.980   3.074   -0.686  1.00 0.00 ? 5  HIS B CA   8  
ATOM 5858  C C    . HIS B 2 5  ? 7.727   3.119   -1.564  1.00 0.00 ? 5  HIS B C    8  
ATOM 5859  O O    . HIS B 2 5  ? 7.789   2.902   -2.758  1.00 0.00 ? 5  HIS B O    8  
ATOM 5860  C CB   . HIS B 2 5  ? 9.800   4.350   -0.887  1.00 0.00 ? 5  HIS B CB   8  
ATOM 5861  C CG   . HIS B 2 5  ? 10.972  4.342   0.056   1.00 0.00 ? 5  HIS B CG   8  
ATOM 5862  N ND1  . HIS B 2 5  ? 12.014  3.436   -0.064  1.00 0.00 ? 5  HIS B ND1  8  
ATOM 5863  C CD2  . HIS B 2 5  ? 11.279  5.121   1.147   1.00 0.00 ? 5  HIS B CD2  8  
ATOM 5864  C CE1  . HIS B 2 5  ? 12.888  3.688   0.929   1.00 0.00 ? 5  HIS B CE1  8  
ATOM 5865  N NE2  . HIS B 2 5  ? 12.488  4.705   1.696   1.00 0.00 ? 5  HIS B NE2  8  
ATOM 5866  H H    . HIS B 2 5  ? 10.613  2.013   -1.603  1.00 0.00 ? 5  HIS B H    8  
ATOM 5867  H HA   . HIS B 2 5  ? 8.690   2.990   0.351   1.00 0.00 ? 5  HIS B HA   8  
ATOM 5868  H HB2  . HIS B 2 5  ? 10.157  4.392   -1.906  1.00 0.00 ? 5  HIS B HB2  8  
ATOM 5869  H HB3  . HIS B 2 5  ? 9.182   5.213   -0.685  1.00 0.00 ? 5  HIS B HB3  8  
ATOM 5870  H HD1  . HIS B 2 5  ? 12.101  2.741   -0.749  1.00 0.00 ? 5  HIS B HD1  8  
ATOM 5871  H HD2  . HIS B 2 5  ? 10.674  5.931   1.522   1.00 0.00 ? 5  HIS B HD2  8  
ATOM 5872  H HE1  . HIS B 2 5  ? 13.798  3.130   1.089   1.00 0.00 ? 5  HIS B HE1  8  
ATOM 5873  N N    . LEU B 2 6  ? 6.586   3.379   -0.982  1.00 0.00 ? 6  LEU B N    8  
ATOM 5874  C CA   . LEU B 2 6  ? 5.335   3.418   -1.792  1.00 0.00 ? 6  LEU B CA   8  
ATOM 5875  C C    . LEU B 2 6  ? 4.634   4.767   -1.626  1.00 0.00 ? 6  LEU B C    8  
ATOM 5876  O O    . LEU B 2 6  ? 3.870   4.972   -0.705  1.00 0.00 ? 6  LEU B O    8  
ATOM 5877  C CB   . LEU B 2 6  ? 4.402   2.299   -1.326  1.00 0.00 ? 6  LEU B CB   8  
ATOM 5878  C CG   . LEU B 2 6  ? 5.032   0.945   -1.646  1.00 0.00 ? 6  LEU B CG   8  
ATOM 5879  C CD1  . LEU B 2 6  ? 4.281   -0.156  -0.897  1.00 0.00 ? 6  LEU B CD1  8  
ATOM 5880  C CD2  . LEU B 2 6  ? 4.943   0.687   -3.152  1.00 0.00 ? 6  LEU B CD2  8  
ATOM 5881  H H    . LEU B 2 6  ? 6.553   3.539   -0.016  1.00 0.00 ? 6  LEU B H    8  
ATOM 5882  H HA   . LEU B 2 6  ? 5.577   3.267   -2.832  1.00 0.00 ? 6  LEU B HA   8  
ATOM 5883  H HB2  . LEU B 2 6  ? 4.248   2.383   -0.259  1.00 0.00 ? 6  LEU B HB2  8  
ATOM 5884  H HB3  . LEU B 2 6  ? 3.455   2.385   -1.834  1.00 0.00 ? 6  LEU B HB3  8  
ATOM 5885  H HG   . LEU B 2 6  ? 6.068   0.947   -1.339  1.00 0.00 ? 6  LEU B HG   8  
ATOM 5886  H HD11 . LEU B 2 6  ? 3.234   -0.121  -1.160  1.00 0.00 ? 6  LEU B HD11 8  
ATOM 5887  H HD12 . LEU B 2 6  ? 4.689   -1.120  -1.171  1.00 0.00 ? 6  LEU B HD12 8  
ATOM 5888  H HD13 . LEU B 2 6  ? 4.393   -0.007  0.166   1.00 0.00 ? 6  LEU B HD13 8  
ATOM 5889  H HD21 . LEU B 2 6  ? 4.105   1.232   -3.561  1.00 0.00 ? 6  LEU B HD21 8  
ATOM 5890  H HD22 . LEU B 2 6  ? 5.853   1.020   -3.629  1.00 0.00 ? 6  LEU B HD22 8  
ATOM 5891  H HD23 . LEU B 2 6  ? 4.808   -0.369  -3.330  1.00 0.00 ? 6  LEU B HD23 8  
ATOM 5892  N N    . CYS B 2 7  ? 4.880   5.684   -2.521  1.00 0.00 ? 7  CYS B N    8  
ATOM 5893  C CA   . CYS B 2 7  ? 4.218   7.018   -2.429  1.00 0.00 ? 7  CYS B CA   8  
ATOM 5894  C C    . CYS B 2 7  ? 3.385   7.260   -3.687  1.00 0.00 ? 7  CYS B C    8  
ATOM 5895  O O    . CYS B 2 7  ? 3.491   6.543   -4.661  1.00 0.00 ? 7  CYS B O    8  
ATOM 5896  C CB   . CYS B 2 7  ? 5.271   8.112   -2.303  1.00 0.00 ? 7  CYS B CB   8  
ATOM 5897  S SG   . CYS B 2 7  ? 5.016   9.021   -0.759  1.00 0.00 ? 7  CYS B SG   8  
ATOM 5898  H H    . CYS B 2 7  ? 5.492   5.494   -3.262  1.00 0.00 ? 7  CYS B H    8  
ATOM 5899  H HA   . CYS B 2 7  ? 3.578   7.044   -1.565  1.00 0.00 ? 7  CYS B HA   8  
ATOM 5900  H HB2  . CYS B 2 7  ? 6.258   7.671   -2.306  1.00 0.00 ? 7  CYS B HB2  8  
ATOM 5901  H HB3  . CYS B 2 7  ? 5.176   8.787   -3.135  1.00 0.00 ? 7  CYS B HB3  8  
ATOM 5902  N N    . GLY B 2 8  ? 2.554   8.265   -3.673  1.00 0.00 ? 8  GLY B N    8  
ATOM 5903  C CA   . GLY B 2 8  ? 1.714   8.551   -4.871  1.00 0.00 ? 8  GLY B CA   8  
ATOM 5904  C C    . GLY B 2 8  ? 0.778   7.369   -5.128  1.00 0.00 ? 8  GLY B C    8  
ATOM 5905  O O    . GLY B 2 8  ? 0.207   6.807   -4.216  1.00 0.00 ? 8  GLY B O    8  
ATOM 5906  H H    . GLY B 2 8  ? 2.483   8.833   -2.877  1.00 0.00 ? 8  GLY B H    8  
ATOM 5907  H HA2  . GLY B 2 8  ? 1.130   9.444   -4.696  1.00 0.00 ? 8  GLY B HA2  8  
ATOM 5908  H HA3  . GLY B 2 8  ? 2.349   8.698   -5.730  1.00 0.00 ? 8  GLY B HA3  8  
ATOM 5909  N N    . SER B 2 9  ? 0.615   6.988   -6.366  1.00 0.00 ? 9  SER B N    8  
ATOM 5910  C CA   . SER B 2 9  ? -0.283  5.842   -6.680  1.00 0.00 ? 9  SER B CA   8  
ATOM 5911  C C    . SER B 2 9  ? 0.516   4.537   -6.654  1.00 0.00 ? 9  SER B C    8  
ATOM 5912  O O    . SER B 2 9  ? 0.066   3.513   -7.129  1.00 0.00 ? 9  SER B O    8  
ATOM 5913  C CB   . SER B 2 9  ? -0.894  6.040   -8.066  1.00 0.00 ? 9  SER B CB   8  
ATOM 5914  O OG   . SER B 2 9  ? 0.145   6.290   -9.006  1.00 0.00 ? 9  SER B OG   8  
ATOM 5915  H H    . SER B 2 9  ? 1.085   7.455   -7.088  1.00 0.00 ? 9  SER B H    8  
ATOM 5916  H HA   . SER B 2 9  ? -1.073  5.793   -5.944  1.00 0.00 ? 9  SER B HA   8  
ATOM 5917  H HB2  . SER B 2 9  ? -1.426  5.150   -8.357  1.00 0.00 ? 9  SER B HB2  8  
ATOM 5918  H HB3  . SER B 2 9  ? -1.579  6.875   -8.042  1.00 0.00 ? 9  SER B HB3  8  
ATOM 5919  H HG   . SER B 2 9  ? -0.255  6.637   -9.805  1.00 0.00 ? 9  SER B HG   8  
ATOM 5920  N N    . HIS B 2 10 ? 1.700   4.564   -6.105  1.00 0.00 ? 10 HIS B N    8  
ATOM 5921  C CA   . HIS B 2 10 ? 2.524   3.325   -6.051  1.00 0.00 ? 10 HIS B CA   8  
ATOM 5922  C C    . HIS B 2 10 ? 1.995   2.408   -4.947  1.00 0.00 ? 10 HIS B C    8  
ATOM 5923  O O    . HIS B 2 10 ? 1.842   1.218   -5.136  1.00 0.00 ? 10 HIS B O    8  
ATOM 5924  C CB   . HIS B 2 10 ? 3.980   3.692   -5.754  1.00 0.00 ? 10 HIS B CB   8  
ATOM 5925  C CG   . HIS B 2 10 ? 4.679   4.045   -7.036  1.00 0.00 ? 10 HIS B CG   8  
ATOM 5926  N ND1  . HIS B 2 10 ? 4.405   5.214   -7.730  1.00 0.00 ? 10 HIS B ND1  8  
ATOM 5927  C CD2  . HIS B 2 10 ? 5.643   3.392   -7.766  1.00 0.00 ? 10 HIS B CD2  8  
ATOM 5928  C CE1  . HIS B 2 10 ? 5.189   5.229   -8.824  1.00 0.00 ? 10 HIS B CE1  8  
ATOM 5929  N NE2  . HIS B 2 10 ? 5.964   4.143   -8.893  1.00 0.00 ? 10 HIS B NE2  8  
ATOM 5930  H H    . HIS B 2 10 ? 2.044   5.400   -5.728  1.00 0.00 ? 10 HIS B H    8  
ATOM 5931  H HA   . HIS B 2 10 ? 2.469   2.813   -6.999  1.00 0.00 ? 10 HIS B HA   8  
ATOM 5932  H HB2  . HIS B 2 10 ? 4.008   4.538   -5.084  1.00 0.00 ? 10 HIS B HB2  8  
ATOM 5933  H HB3  . HIS B 2 10 ? 4.477   2.851   -5.293  1.00 0.00 ? 10 HIS B HB3  8  
ATOM 5934  H HD1  . HIS B 2 10 ? 3.758   5.904   -7.471  1.00 0.00 ? 10 HIS B HD1  8  
ATOM 5935  H HD2  . HIS B 2 10 ? 6.085   2.443   -7.503  1.00 0.00 ? 10 HIS B HD2  8  
ATOM 5936  H HE1  . HIS B 2 10 ? 5.192   6.024   -9.555  1.00 0.00 ? 10 HIS B HE1  8  
ATOM 5937  N N    . LEU B 2 11 ? 1.712   2.951   -3.795  1.00 0.00 ? 11 LEU B N    8  
ATOM 5938  C CA   . LEU B 2 11 ? 1.192   2.106   -2.684  1.00 0.00 ? 11 LEU B CA   8  
ATOM 5939  C C    . LEU B 2 11 ? -0.122  1.456   -3.116  1.00 0.00 ? 11 LEU B C    8  
ATOM 5940  O O    . LEU B 2 11 ? -0.412  0.328   -2.771  1.00 0.00 ? 11 LEU B O    8  
ATOM 5941  C CB   . LEU B 2 11 ? 0.951   2.971   -1.446  1.00 0.00 ? 11 LEU B CB   8  
ATOM 5942  C CG   . LEU B 2 11 ? 1.214   2.142   -0.188  1.00 0.00 ? 11 LEU B CG   8  
ATOM 5943  C CD1  . LEU B 2 11 ? 1.835   3.031   0.887   1.00 0.00 ? 11 LEU B CD1  8  
ATOM 5944  C CD2  . LEU B 2 11 ? -0.109  1.559   0.326   1.00 0.00 ? 11 LEU B CD2  8  
ATOM 5945  H H    . LEU B 2 11 ? 1.840   3.913   -3.660  1.00 0.00 ? 11 LEU B H    8  
ATOM 5946  H HA   . LEU B 2 11 ? 1.913   1.336   -2.450  1.00 0.00 ? 11 LEU B HA   8  
ATOM 5947  H HB2  . LEU B 2 11 ? 1.617   3.820   -1.466  1.00 0.00 ? 11 LEU B HB2  8  
ATOM 5948  H HB3  . LEU B 2 11 ? -0.073  3.315   -1.441  1.00 0.00 ? 11 LEU B HB3  8  
ATOM 5949  H HG   . LEU B 2 11 ? 1.895   1.337   -0.426  1.00 0.00 ? 11 LEU B HG   8  
ATOM 5950  H HD11 . LEU B 2 11 ? 1.222   3.908   1.030   1.00 0.00 ? 11 LEU B HD11 8  
ATOM 5951  H HD12 . LEU B 2 11 ? 1.898   2.482   1.812   1.00 0.00 ? 11 LEU B HD12 8  
ATOM 5952  H HD13 . LEU B 2 11 ? 2.828   3.333   0.580   1.00 0.00 ? 11 LEU B HD13 8  
ATOM 5953  H HD21 . LEU B 2 11 ? -0.864  2.332   0.337   1.00 0.00 ? 11 LEU B HD21 8  
ATOM 5954  H HD22 . LEU B 2 11 ? -0.425  0.757   -0.324  1.00 0.00 ? 11 LEU B HD22 8  
ATOM 5955  H HD23 . LEU B 2 11 ? 0.029   1.179   1.330   1.00 0.00 ? 11 LEU B HD23 8  
ATOM 5956  N N    . VAL B 2 12 ? -0.916  2.157   -3.878  1.00 0.00 ? 12 VAL B N    8  
ATOM 5957  C CA   . VAL B 2 12 ? -2.206  1.575   -4.339  1.00 0.00 ? 12 VAL B CA   8  
ATOM 5958  C C    . VAL B 2 12 ? -1.915  0.365   -5.226  1.00 0.00 ? 12 VAL B C    8  
ATOM 5959  O O    . VAL B 2 12 ? -2.654  -0.599  -5.243  1.00 0.00 ? 12 VAL B O    8  
ATOM 5960  C CB   . VAL B 2 12 ? -2.985  2.622   -5.135  1.00 0.00 ? 12 VAL B CB   8  
ATOM 5961  C CG1  . VAL B 2 12 ? -4.193  1.964   -5.805  1.00 0.00 ? 12 VAL B CG1  8  
ATOM 5962  C CG2  . VAL B 2 12 ? -3.465  3.721   -4.186  1.00 0.00 ? 12 VAL B CG2  8  
ATOM 5963  H H    . VAL B 2 12 ? -0.663  3.063   -4.150  1.00 0.00 ? 12 VAL B H    8  
ATOM 5964  H HA   . VAL B 2 12 ? -2.790  1.265   -3.484  1.00 0.00 ? 12 VAL B HA   8  
ATOM 5965  H HB   . VAL B 2 12 ? -2.342  3.052   -5.890  1.00 0.00 ? 12 VAL B HB   8  
ATOM 5966  H HG11 . VAL B 2 12 ? -4.661  1.278   -5.113  1.00 0.00 ? 12 VAL B HG11 8  
ATOM 5967  H HG12 . VAL B 2 12 ? -4.903  2.724   -6.095  1.00 0.00 ? 12 VAL B HG12 8  
ATOM 5968  H HG13 . VAL B 2 12 ? -3.868  1.423   -6.682  1.00 0.00 ? 12 VAL B HG13 8  
ATOM 5969  H HG21 . VAL B 2 12 ? -3.225  3.448   -3.170  1.00 0.00 ? 12 VAL B HG21 8  
ATOM 5970  H HG22 . VAL B 2 12 ? -2.977  4.652   -4.434  1.00 0.00 ? 12 VAL B HG22 8  
ATOM 5971  H HG23 . VAL B 2 12 ? -4.536  3.839   -4.284  1.00 0.00 ? 12 VAL B HG23 8  
ATOM 5972  N N    . GLU B 2 13 ? -0.837  0.407   -5.958  1.00 0.00 ? 13 GLU B N    8  
ATOM 5973  C CA   . GLU B 2 13 ? -0.488  -0.741  -6.839  1.00 0.00 ? 13 GLU B CA   8  
ATOM 5974  C C    . GLU B 2 13 ? -0.148  -1.952  -5.969  1.00 0.00 ? 13 GLU B C    8  
ATOM 5975  O O    . GLU B 2 13 ? -0.224  -3.083  -6.406  1.00 0.00 ? 13 GLU B O    8  
ATOM 5976  C CB   . GLU B 2 13 ? 0.717   -0.372  -7.707  1.00 0.00 ? 13 GLU B CB   8  
ATOM 5977  C CG   . GLU B 2 13 ? 0.316   0.729   -8.690  1.00 0.00 ? 13 GLU B CG   8  
ATOM 5978  C CD   . GLU B 2 13 ? 1.450   0.961   -9.692  1.00 0.00 ? 13 GLU B CD   8  
ATOM 5979  O OE1  . GLU B 2 13 ? 2.566   1.183   -9.252  1.00 0.00 ? 13 GLU B OE1  8  
ATOM 5980  O OE2  . GLU B 2 13 ? 1.183   0.912   -10.881 1.00 0.00 ? 13 GLU B OE2  8  
ATOM 5981  H H    . GLU B 2 13 ? -0.251  1.193   -5.924  1.00 0.00 ? 13 GLU B H    8  
ATOM 5982  H HA   . GLU B 2 13 ? -1.331  -0.978  -7.472  1.00 0.00 ? 13 GLU B HA   8  
ATOM 5983  H HB2  . GLU B 2 13 ? 1.520   -0.018  -7.077  1.00 0.00 ? 13 GLU B HB2  8  
ATOM 5984  H HB3  . GLU B 2 13 ? 1.045   -1.242  -8.256  1.00 0.00 ? 13 GLU B HB3  8  
ATOM 5985  H HG2  . GLU B 2 13 ? -0.577  0.431   -9.221  1.00 0.00 ? 13 GLU B HG2  8  
ATOM 5986  H HG3  . GLU B 2 13 ? 0.126   1.644   -8.150  1.00 0.00 ? 13 GLU B HG3  8  
ATOM 5987  N N    . ALA B 2 14 ? 0.220   -1.724  -4.735  1.00 0.00 ? 14 ALA B N    8  
ATOM 5988  C CA   . ALA B 2 14 ? 0.555   -2.863  -3.835  1.00 0.00 ? 14 ALA B CA   8  
ATOM 5989  C C    . ALA B 2 14 ? -0.660  -3.183  -2.962  1.00 0.00 ? 14 ALA B C    8  
ATOM 5990  O O    . ALA B 2 14 ? -0.723  -4.211  -2.319  1.00 0.00 ? 14 ALA B O    8  
ATOM 5991  C CB   . ALA B 2 14 ? 1.741   -2.485  -2.945  1.00 0.00 ? 14 ALA B CB   8  
ATOM 5992  H H    . ALA B 2 14 ? 0.269   -0.804  -4.398  1.00 0.00 ? 14 ALA B H    8  
ATOM 5993  H HA   . ALA B 2 14 ? 0.809   -3.728  -4.429  1.00 0.00 ? 14 ALA B HA   8  
ATOM 5994  H HB1  . ALA B 2 14 ? 2.558   -2.141  -3.562  1.00 0.00 ? 14 ALA B HB1  8  
ATOM 5995  H HB2  . ALA B 2 14 ? 1.445   -1.697  -2.268  1.00 0.00 ? 14 ALA B HB2  8  
ATOM 5996  H HB3  . ALA B 2 14 ? 2.056   -3.348  -2.378  1.00 0.00 ? 14 ALA B HB3  8  
ATOM 5997  N N    . LEU B 2 15 ? -1.629  -2.308  -2.941  1.00 0.00 ? 15 LEU B N    8  
ATOM 5998  C CA   . LEU B 2 15 ? -2.843  -2.558  -2.116  1.00 0.00 ? 15 LEU B CA   8  
ATOM 5999  C C    . LEU B 2 15 ? -3.759  -3.535  -2.854  1.00 0.00 ? 15 LEU B C    8  
ATOM 6000  O O    . LEU B 2 15 ? -4.232  -4.504  -2.294  1.00 0.00 ? 15 LEU B O    8  
ATOM 6001  C CB   . LEU B 2 15 ? -3.585  -1.236  -1.889  1.00 0.00 ? 15 LEU B CB   8  
ATOM 6002  C CG   . LEU B 2 15 ? -2.847  -0.407  -0.838  1.00 0.00 ? 15 LEU B CG   8  
ATOM 6003  C CD1  . LEU B 2 15 ? -3.626  0.883   -0.567  1.00 0.00 ? 15 LEU B CD1  8  
ATOM 6004  C CD2  . LEU B 2 15 ? -2.729  -1.213  0.458   1.00 0.00 ? 15 LEU B CD2  8  
ATOM 6005  H H    . LEU B 2 15 ? -1.559  -1.487  -3.471  1.00 0.00 ? 15 LEU B H    8  
ATOM 6006  H HA   . LEU B 2 15 ? -2.554  -2.978  -1.165  1.00 0.00 ? 15 LEU B HA   8  
ATOM 6007  H HB2  . LEU B 2 15 ? -3.628  -0.686  -2.817  1.00 0.00 ? 15 LEU B HB2  8  
ATOM 6008  H HB3  . LEU B 2 15 ? -4.587  -1.441  -1.543  1.00 0.00 ? 15 LEU B HB3  8  
ATOM 6009  H HG   . LEU B 2 15 ? -1.859  -0.161  -1.202  1.00 0.00 ? 15 LEU B HG   8  
ATOM 6010  H HD11 . LEU B 2 15 ? -4.677  0.654   -0.470  1.00 0.00 ? 15 LEU B HD11 8  
ATOM 6011  H HD12 . LEU B 2 15 ? -3.269  1.335   0.347   1.00 0.00 ? 15 LEU B HD12 8  
ATOM 6012  H HD13 . LEU B 2 15 ? -3.481  1.569   -1.389  1.00 0.00 ? 15 LEU B HD13 8  
ATOM 6013  H HD21 . LEU B 2 15 ? -3.524  -1.940  0.502   1.00 0.00 ? 15 LEU B HD21 8  
ATOM 6014  H HD22 . LEU B 2 15 ? -1.775  -1.721  0.480   1.00 0.00 ? 15 LEU B HD22 8  
ATOM 6015  H HD23 . LEU B 2 15 ? -2.802  -0.547  1.305   1.00 0.00 ? 15 LEU B HD23 8  
ATOM 6016  N N    . HIS B 2 16 ? -4.012  -3.287  -4.111  1.00 0.00 ? 16 HIS B N    8  
ATOM 6017  C CA   . HIS B 2 16 ? -4.896  -4.199  -4.889  1.00 0.00 ? 16 HIS B CA   8  
ATOM 6018  C C    . HIS B 2 16 ? -4.188  -5.541  -5.094  1.00 0.00 ? 16 HIS B C    8  
ATOM 6019  O O    . HIS B 2 16 ? -4.807  -6.586  -5.129  1.00 0.00 ? 16 HIS B O    8  
ATOM 6020  C CB   . HIS B 2 16 ? -5.217  -3.559  -6.248  1.00 0.00 ? 16 HIS B CB   8  
ATOM 6021  C CG   . HIS B 2 16 ? -4.071  -3.762  -7.202  1.00 0.00 ? 16 HIS B CG   8  
ATOM 6022  N ND1  . HIS B 2 16 ? -4.206  -4.478  -8.381  1.00 0.00 ? 16 HIS B ND1  8  
ATOM 6023  C CD2  . HIS B 2 16 ? -2.764  -3.347  -7.161  1.00 0.00 ? 16 HIS B CD2  8  
ATOM 6024  C CE1  . HIS B 2 16 ? -3.009  -4.473  -8.996  1.00 0.00 ? 16 HIS B CE1  8  
ATOM 6025  N NE2  . HIS B 2 16 ? -2.094  -3.797  -8.296  1.00 0.00 ? 16 HIS B NE2  8  
ATOM 6026  H H    . HIS B 2 16 ? -3.620  -2.501  -4.541  1.00 0.00 ? 16 HIS B H    8  
ATOM 6027  H HA   . HIS B 2 16 ? -5.814  -4.359  -4.343  1.00 0.00 ? 16 HIS B HA   8  
ATOM 6028  H HB2  . HIS B 2 16 ? -6.107  -4.011  -6.656  1.00 0.00 ? 16 HIS B HB2  8  
ATOM 6029  H HB3  . HIS B 2 16 ? -5.381  -2.502  -6.112  1.00 0.00 ? 16 HIS B HB3  8  
ATOM 6030  H HD1  . HIS B 2 16 ? -5.023  -4.908  -8.709  1.00 0.00 ? 16 HIS B HD1  8  
ATOM 6031  H HD2  . HIS B 2 16 ? -2.327  -2.759  -6.369  1.00 0.00 ? 16 HIS B HD2  8  
ATOM 6032  H HE1  . HIS B 2 16 ? -2.811  -4.955  -9.942  1.00 0.00 ? 16 HIS B HE1  8  
ATOM 6033  N N    . LEU B 2 17 ? -2.890  -5.518  -5.230  1.00 0.00 ? 17 LEU B N    8  
ATOM 6034  C CA   . LEU B 2 17 ? -2.136  -6.785  -5.434  1.00 0.00 ? 17 LEU B CA   8  
ATOM 6035  C C    . LEU B 2 17 ? -2.258  -7.663  -4.187  1.00 0.00 ? 17 LEU B C    8  
ATOM 6036  O O    . LEU B 2 17 ? -2.340  -8.872  -4.271  1.00 0.00 ? 17 LEU B O    8  
ATOM 6037  C CB   . LEU B 2 17 ? -0.660  -6.465  -5.687  1.00 0.00 ? 17 LEU B CB   8  
ATOM 6038  C CG   . LEU B 2 17 ? 0.058   -7.722  -6.187  1.00 0.00 ? 17 LEU B CG   8  
ATOM 6039  C CD1  . LEU B 2 17 ? -0.589  -8.196  -7.490  1.00 0.00 ? 17 LEU B CD1  8  
ATOM 6040  C CD2  . LEU B 2 17 ? 1.533   -7.397  -6.438  1.00 0.00 ? 17 LEU B CD2  8  
ATOM 6041  H H    . LEU B 2 17 ? -2.411  -4.664  -5.200  1.00 0.00 ? 17 LEU B H    8  
ATOM 6042  H HA   . LEU B 2 17 ? -2.541  -7.313  -6.287  1.00 0.00 ? 17 LEU B HA   8  
ATOM 6043  H HB2  . LEU B 2 17 ? -0.585  -5.687  -6.434  1.00 0.00 ? 17 LEU B HB2  8  
ATOM 6044  H HB3  . LEU B 2 17 ? -0.201  -6.131  -4.770  1.00 0.00 ? 17 LEU B HB3  8  
ATOM 6045  H HG   . LEU B 2 17 ? -0.022  -8.500  -5.442  1.00 0.00 ? 17 LEU B HG   8  
ATOM 6046  H HD11 . LEU B 2 17 ? -0.856  -7.340  -8.091  1.00 0.00 ? 17 LEU B HD11 8  
ATOM 6047  H HD12 . LEU B 2 17 ? 0.111   -8.813  -8.034  1.00 0.00 ? 17 LEU B HD12 8  
ATOM 6048  H HD13 . LEU B 2 17 ? -1.475  -8.769  -7.264  1.00 0.00 ? 17 LEU B HD13 8  
ATOM 6049  H HD21 . LEU B 2 17 ? 1.654   -6.329  -6.538  1.00 0.00 ? 17 LEU B HD21 8  
ATOM 6050  H HD22 . LEU B 2 17 ? 2.124   -7.751  -5.607  1.00 0.00 ? 17 LEU B HD22 8  
ATOM 6051  H HD23 . LEU B 2 17 ? 1.857   -7.885  -7.345  1.00 0.00 ? 17 LEU B HD23 8  
ATOM 6052  N N    . VAL B 2 18 ? -2.271  -7.064  -3.026  1.00 0.00 ? 18 VAL B N    8  
ATOM 6053  C CA   . VAL B 2 18 ? -2.386  -7.866  -1.777  1.00 0.00 ? 18 VAL B CA   8  
ATOM 6054  C C    . VAL B 2 18 ? -3.814  -8.397  -1.642  1.00 0.00 ? 18 VAL B C    8  
ATOM 6055  O O    . VAL B 2 18 ? -4.036  -9.584  -1.512  1.00 0.00 ? 18 VAL B O    8  
ATOM 6056  C CB   . VAL B 2 18 ? -2.052  -6.987  -0.572  1.00 0.00 ? 18 VAL B CB   8  
ATOM 6057  C CG1  . VAL B 2 18 ? -2.251  -7.786  0.718   1.00 0.00 ? 18 VAL B CG1  8  
ATOM 6058  C CG2  . VAL B 2 18 ? -0.595  -6.531  -0.665  1.00 0.00 ? 18 VAL B CG2  8  
ATOM 6059  H H    . VAL B 2 18 ? -2.203  -6.087  -2.977  1.00 0.00 ? 18 VAL B H    8  
ATOM 6060  H HA   . VAL B 2 18 ? -1.696  -8.697  -1.819  1.00 0.00 ? 18 VAL B HA   8  
ATOM 6061  H HB   . VAL B 2 18 ? -2.702  -6.124  -0.565  1.00 0.00 ? 18 VAL B HB   8  
ATOM 6062  H HG11 . VAL B 2 18 ? -1.834  -8.775  0.596   1.00 0.00 ? 18 VAL B HG11 8  
ATOM 6063  H HG12 . VAL B 2 18 ? -1.753  -7.283  1.534   1.00 0.00 ? 18 VAL B HG12 8  
ATOM 6064  H HG13 . VAL B 2 18 ? -3.306  -7.864  0.933   1.00 0.00 ? 18 VAL B HG13 8  
ATOM 6065  H HG21 . VAL B 2 18 ? -0.166  -6.880  -1.593  1.00 0.00 ? 18 VAL B HG21 8  
ATOM 6066  H HG22 . VAL B 2 18 ? -0.552  -5.451  -0.633  1.00 0.00 ? 18 VAL B HG22 8  
ATOM 6067  H HG23 . VAL B 2 18 ? -0.036  -6.937  0.165   1.00 0.00 ? 18 VAL B HG23 8  
ATOM 6068  N N    . CYS B 2 19 ? -4.784  -7.527  -1.673  1.00 0.00 ? 19 CYS B N    8  
ATOM 6069  C CA   . CYS B 2 19 ? -6.195  -7.981  -1.546  1.00 0.00 ? 19 CYS B CA   8  
ATOM 6070  C C    . CYS B 2 19 ? -6.672  -8.541  -2.888  1.00 0.00 ? 19 CYS B C    8  
ATOM 6071  O O    . CYS B 2 19 ? -6.872  -9.730  -3.041  1.00 0.00 ? 19 CYS B O    8  
ATOM 6072  C CB   . CYS B 2 19 ? -7.076  -6.797  -1.146  1.00 0.00 ? 19 CYS B CB   8  
ATOM 6073  S SG   . CYS B 2 19 ? -6.227  -5.816  0.116   1.00 0.00 ? 19 CYS B SG   8  
ATOM 6074  H H    . CYS B 2 19 ? -4.585  -6.573  -1.779  1.00 0.00 ? 19 CYS B H    8  
ATOM 6075  H HA   . CYS B 2 19 ? -6.261  -8.751  -0.790  1.00 0.00 ? 19 CYS B HA   8  
ATOM 6076  H HB2  . CYS B 2 19 ? -7.263  -6.181  -2.013  1.00 0.00 ? 19 CYS B HB2  8  
ATOM 6077  H HB3  . CYS B 2 19 ? -8.014  -7.161  -0.752  1.00 0.00 ? 19 CYS B HB3  8  
ATOM 6078  N N    . GLY B 2 20 ? -6.851  -7.694  -3.863  1.00 0.00 ? 20 GLY B N    8  
ATOM 6079  C CA   . GLY B 2 20 ? -7.314  -8.179  -5.194  1.00 0.00 ? 20 GLY B CA   8  
ATOM 6080  C C    . GLY B 2 20 ? -8.776  -7.785  -5.406  1.00 0.00 ? 20 GLY B C    8  
ATOM 6081  O O    . GLY B 2 20 ? -9.155  -6.645  -5.219  1.00 0.00 ? 20 GLY B O    8  
ATOM 6082  H H    . GLY B 2 20 ? -6.684  -6.739  -3.720  1.00 0.00 ? 20 GLY B H    8  
ATOM 6083  H HA2  . GLY B 2 20 ? -6.703  -7.738  -5.969  1.00 0.00 ? 20 GLY B HA2  8  
ATOM 6084  H HA3  . GLY B 2 20 ? -7.225  -9.253  -5.233  1.00 0.00 ? 20 GLY B HA3  8  
ATOM 6085  N N    . GLU B 2 21 ? -9.600  -8.718  -5.799  1.00 0.00 ? 21 GLU B N    8  
ATOM 6086  C CA   . GLU B 2 21 ? -11.036 -8.398  -6.023  1.00 0.00 ? 21 GLU B CA   8  
ATOM 6087  C C    . GLU B 2 21 ? -11.640 -7.815  -4.744  1.00 0.00 ? 21 GLU B C    8  
ATOM 6088  O O    . GLU B 2 21 ? -12.435 -6.898  -4.784  1.00 0.00 ? 21 GLU B O    8  
ATOM 6089  C CB   . GLU B 2 21 ? -11.791 -9.672  -6.408  1.00 0.00 ? 21 GLU B CB   8  
ATOM 6090  C CG   . GLU B 2 21 ? -13.085 -9.303  -7.136  1.00 0.00 ? 21 GLU B CG   8  
ATOM 6091  C CD   . GLU B 2 21 ? -12.788 -9.067  -8.619  1.00 0.00 ? 21 GLU B CD   8  
ATOM 6092  O OE1  . GLU B 2 21 ? -12.365 -10.005 -9.274  1.00 0.00 ? 21 GLU B OE1  8  
ATOM 6093  O OE2  . GLU B 2 21 ? -12.986 -7.953  -9.074  1.00 0.00 ? 21 GLU B OE2  8  
ATOM 6094  H H    . GLU B 2 21 ? -9.273  -9.630  -5.944  1.00 0.00 ? 21 GLU B H    8  
ATOM 6095  H HA   . GLU B 2 21 ? -11.122 -7.675  -6.822  1.00 0.00 ? 21 GLU B HA   8  
ATOM 6096  H HB2  . GLU B 2 21 ? -11.171 -10.275 -7.056  1.00 0.00 ? 21 GLU B HB2  8  
ATOM 6097  H HB3  . GLU B 2 21 ? -12.030 -10.232 -5.516  1.00 0.00 ? 21 GLU B HB3  8  
ATOM 6098  H HG2  . GLU B 2 21 ? -13.797 -10.109 -7.035  1.00 0.00 ? 21 GLU B HG2  8  
ATOM 6099  H HG3  . GLU B 2 21 ? -13.496 -8.401  -6.706  1.00 0.00 ? 21 GLU B HG3  8  
ATOM 6100  N N    . ARG B 2 22 ? -11.268 -8.338  -3.608  1.00 0.00 ? 22 ARG B N    8  
ATOM 6101  C CA   . ARG B 2 22 ? -11.823 -7.807  -2.332  1.00 0.00 ? 22 ARG B CA   8  
ATOM 6102  C C    . ARG B 2 22 ? -11.771 -6.281  -2.355  1.00 0.00 ? 22 ARG B C    8  
ATOM 6103  O O    . ARG B 2 22 ? -12.643 -5.610  -1.839  1.00 0.00 ? 22 ARG B O    8  
ATOM 6104  C CB   . ARG B 2 22 ? -10.992 -8.330  -1.157  1.00 0.00 ? 22 ARG B CB   8  
ATOM 6105  C CG   . ARG B 2 22 ? -11.233 -9.830  -0.985  1.00 0.00 ? 22 ARG B CG   8  
ATOM 6106  C CD   . ARG B 2 22 ? -9.897  -10.542 -0.762  1.00 0.00 ? 22 ARG B CD   8  
ATOM 6107  N NE   . ARG B 2 22 ? -9.502  -10.417 0.670   1.00 0.00 ? 22 ARG B NE   8  
ATOM 6108  C CZ   . ARG B 2 22 ? -8.565  -11.183 1.162   1.00 0.00 ? 22 ARG B CZ   8  
ATOM 6109  N NH1  . ARG B 2 22 ? -7.966  -12.061 0.402   1.00 0.00 ? 22 ARG B NH1  8  
ATOM 6110  N NH2  . ARG B 2 22 ? -8.222  -11.069 2.416   1.00 0.00 ? 22 ARG B NH2  8  
ATOM 6111  H H    . ARG B 2 22 ? -10.624 -9.076  -3.594  1.00 0.00 ? 22 ARG B H    8  
ATOM 6112  H HA   . ARG B 2 22 ? -12.847 -8.132  -2.220  1.00 0.00 ? 22 ARG B HA   8  
ATOM 6113  H HB2  . ARG B 2 22 ? -9.944  -8.152  -1.352  1.00 0.00 ? 22 ARG B HB2  8  
ATOM 6114  H HB3  . ARG B 2 22 ? -11.282 -7.814  -0.254  1.00 0.00 ? 22 ARG B HB3  8  
ATOM 6115  H HG2  . ARG B 2 22 ? -11.878 -9.996  -0.133  1.00 0.00 ? 22 ARG B HG2  8  
ATOM 6116  H HG3  . ARG B 2 22 ? -11.703 -10.223 -1.873  1.00 0.00 ? 22 ARG B HG3  8  
ATOM 6117  H HD2  . ARG B 2 22 ? -9.998  -11.585 -1.020  1.00 0.00 ? 22 ARG B HD2  8  
ATOM 6118  H HD3  . ARG B 2 22 ? -9.141  -10.088 -1.385  1.00 0.00 ? 22 ARG B HD3  8  
ATOM 6119  H HE   . ARG B 2 22 ? -9.948  -9.761  1.245   1.00 0.00 ? 22 ARG B HE   8  
ATOM 6120  H HH11 . ARG B 2 22 ? -8.224  -12.150 -0.559  1.00 0.00 ? 22 ARG B HH11 8  
ATOM 6121  H HH12 . ARG B 2 22 ? -7.249  -12.645 0.782   1.00 0.00 ? 22 ARG B HH12 8  
ATOM 6122  H HH21 . ARG B 2 22 ? -8.679  -10.397 3.000   1.00 0.00 ? 22 ARG B HH21 8  
ATOM 6123  H HH22 . ARG B 2 22 ? -7.505  -11.653 2.795   1.00 0.00 ? 22 ARG B HH22 8  
ATOM 6124  N N    . GLY B 2 23 ? -10.751 -5.723  -2.950  1.00 0.00 ? 23 GLY B N    8  
ATOM 6125  C CA   . GLY B 2 23 ? -10.640 -4.239  -3.006  1.00 0.00 ? 23 GLY B CA   8  
ATOM 6126  C C    . GLY B 2 23 ? -9.836  -3.743  -1.805  1.00 0.00 ? 23 GLY B C    8  
ATOM 6127  O O    . GLY B 2 23 ? -9.419  -4.511  -0.964  1.00 0.00 ? 23 GLY B O    8  
ATOM 6128  H H    . GLY B 2 23 ? -10.057 -6.281  -3.358  1.00 0.00 ? 23 GLY B H    8  
ATOM 6129  H HA2  . GLY B 2 23 ? -10.140 -3.950  -3.921  1.00 0.00 ? 23 GLY B HA2  8  
ATOM 6130  H HA3  . GLY B 2 23 ? -11.626 -3.802  -2.980  1.00 0.00 ? 23 GLY B HA3  8  
ATOM 6131  N N    . PHE B 2 24 ? -9.613  -2.459  -1.719  1.00 0.00 ? 24 PHE B N    8  
ATOM 6132  C CA   . PHE B 2 24 ? -8.834  -1.919  -0.572  1.00 0.00 ? 24 PHE B CA   8  
ATOM 6133  C C    . PHE B 2 24 ? -9.276  -0.485  -0.280  1.00 0.00 ? 24 PHE B C    8  
ATOM 6134  O O    . PHE B 2 24 ? -9.420  0.326   -1.176  1.00 0.00 ? 24 PHE B O    8  
ATOM 6135  C CB   . PHE B 2 24 ? -7.343  -1.932  -0.916  1.00 0.00 ? 24 PHE B CB   8  
ATOM 6136  C CG   . PHE B 2 24 ? -7.118  -1.267  -2.248  1.00 0.00 ? 24 PHE B CG   8  
ATOM 6137  C CD1  . PHE B 2 24 ? -7.217  -2.016  -3.426  1.00 0.00 ? 24 PHE B CD1  8  
ATOM 6138  C CD2  . PHE B 2 24 ? -6.800  0.095   -2.309  1.00 0.00 ? 24 PHE B CD2  8  
ATOM 6139  C CE1  . PHE B 2 24 ? -7.003  -1.401  -4.664  1.00 0.00 ? 24 PHE B CE1  8  
ATOM 6140  C CE2  . PHE B 2 24 ? -6.584  0.710   -3.547  1.00 0.00 ? 24 PHE B CE2  8  
ATOM 6141  C CZ   . PHE B 2 24 ? -6.686  -0.038  -4.727  1.00 0.00 ? 24 PHE B CZ   8  
ATOM 6142  H H    . PHE B 2 24 ? -9.956  -1.854  -2.409  1.00 0.00 ? 24 PHE B H    8  
ATOM 6143  H HA   . PHE B 2 24 ? -9.007  -2.531  0.301   1.00 0.00 ? 24 PHE B HA   8  
ATOM 6144  H HB2  . PHE B 2 24 ? -6.794  -1.404  -0.150  1.00 0.00 ? 24 PHE B HB2  8  
ATOM 6145  H HB3  . PHE B 2 24 ? -6.996  -2.955  -0.963  1.00 0.00 ? 24 PHE B HB3  8  
ATOM 6146  H HD1  . PHE B 2 24 ? -7.462  -3.066  -3.375  1.00 0.00 ? 24 PHE B HD1  8  
ATOM 6147  H HD2  . PHE B 2 24 ? -6.723  0.673   -1.399  1.00 0.00 ? 24 PHE B HD2  8  
ATOM 6148  H HE1  . PHE B 2 24 ? -7.082  -1.980  -5.572  1.00 0.00 ? 24 PHE B HE1  8  
ATOM 6149  H HE2  . PHE B 2 24 ? -6.340  1.761   -3.595  1.00 0.00 ? 24 PHE B HE2  8  
ATOM 6150  H HZ   . PHE B 2 24 ? -6.517  0.436   -5.682  1.00 0.00 ? 24 PHE B HZ   8  
ATOM 6151  N N    . PHE B 2 25 ? -9.483  -0.161  0.966   1.00 0.00 ? 25 PHE B N    8  
ATOM 6152  C CA   . PHE B 2 25 ? -9.904  1.225   1.312   1.00 0.00 ? 25 PHE B CA   8  
ATOM 6153  C C    . PHE B 2 25 ? -8.656  2.080   1.532   1.00 0.00 ? 25 PHE B C    8  
ATOM 6154  O O    . PHE B 2 25 ? -8.273  2.365   2.648   1.00 0.00 ? 25 PHE B O    8  
ATOM 6155  C CB   . PHE B 2 25 ? -10.756 1.219   2.587   1.00 0.00 ? 25 PHE B CB   8  
ATOM 6156  C CG   . PHE B 2 25 ? -10.219 0.198   3.562   1.00 0.00 ? 25 PHE B CG   8  
ATOM 6157  C CD1  . PHE B 2 25 ? -9.234  0.563   4.488   1.00 0.00 ? 25 PHE B CD1  8  
ATOM 6158  C CD2  . PHE B 2 25 ? -10.711 -1.112  3.544   1.00 0.00 ? 25 PHE B CD2  8  
ATOM 6159  C CE1  . PHE B 2 25 ? -8.741  -0.383  5.393   1.00 0.00 ? 25 PHE B CE1  8  
ATOM 6160  C CE2  . PHE B 2 25 ? -10.217 -2.058  4.450   1.00 0.00 ? 25 PHE B CE2  8  
ATOM 6161  C CZ   . PHE B 2 25 ? -9.232  -1.694  5.374   1.00 0.00 ? 25 PHE B CZ   8  
ATOM 6162  H H    . PHE B 2 25 ? -9.352  -0.826  1.670   1.00 0.00 ? 25 PHE B H    8  
ATOM 6163  H HA   . PHE B 2 25 ? -10.480 1.639   0.496   1.00 0.00 ? 25 PHE B HA   8  
ATOM 6164  H HB2  . PHE B 2 25 ? -10.725 2.197   3.042   1.00 0.00 ? 25 PHE B HB2  8  
ATOM 6165  H HB3  . PHE B 2 25 ? -11.776 0.972   2.335   1.00 0.00 ? 25 PHE B HB3  8  
ATOM 6166  H HD1  . PHE B 2 25 ? -8.857  1.574   4.504   1.00 0.00 ? 25 PHE B HD1  8  
ATOM 6167  H HD2  . PHE B 2 25 ? -11.470 -1.394  2.830   1.00 0.00 ? 25 PHE B HD2  8  
ATOM 6168  H HE1  . PHE B 2 25 ? -7.980  -0.101  6.107   1.00 0.00 ? 25 PHE B HE1  8  
ATOM 6169  H HE2  . PHE B 2 25 ? -10.596 -3.069  4.437   1.00 0.00 ? 25 PHE B HE2  8  
ATOM 6170  H HZ   . PHE B 2 25 ? -8.850  -2.423  6.074   1.00 0.00 ? 25 PHE B HZ   8  
ATOM 6171  N N    . TYR B 2 26 ? -8.018  2.490   0.471   1.00 0.00 ? 26 TYR B N    8  
ATOM 6172  C CA   . TYR B 2 26 ? -6.793  3.321   0.613   1.00 0.00 ? 26 TYR B CA   8  
ATOM 6173  C C    . TYR B 2 26 ? -7.181  4.700   1.148   1.00 0.00 ? 26 TYR B C    8  
ATOM 6174  O O    . TYR B 2 26 ? -8.329  5.093   1.106   1.00 0.00 ? 26 TYR B O    8  
ATOM 6175  C CB   . TYR B 2 26 ? -6.121  3.472   -0.754  1.00 0.00 ? 26 TYR B CB   8  
ATOM 6176  C CG   . TYR B 2 26 ? -4.750  4.084   -0.587  1.00 0.00 ? 26 TYR B CG   8  
ATOM 6177  C CD1  . TYR B 2 26 ? -3.914  3.668   0.458   1.00 0.00 ? 26 TYR B CD1  8  
ATOM 6178  C CD2  . TYR B 2 26 ? -4.312  5.063   -1.484  1.00 0.00 ? 26 TYR B CD2  8  
ATOM 6179  C CE1  . TYR B 2 26 ? -2.643  4.235   0.603   1.00 0.00 ? 26 TYR B CE1  8  
ATOM 6180  C CE2  . TYR B 2 26 ? -3.041  5.627   -1.341  1.00 0.00 ? 26 TYR B CE2  8  
ATOM 6181  C CZ   . TYR B 2 26 ? -2.206  5.214   -0.299  1.00 0.00 ? 26 TYR B CZ   8  
ATOM 6182  O OH   . TYR B 2 26 ? -0.954  5.772   -0.160  1.00 0.00 ? 26 TYR B OH   8  
ATOM 6183  H H    . TYR B 2 26 ? -8.343  2.246   -0.421  1.00 0.00 ? 26 TYR B H    8  
ATOM 6184  H HA   . TYR B 2 26 ? -6.112  2.847   1.299   1.00 0.00 ? 26 TYR B HA   8  
ATOM 6185  H HB2  . TYR B 2 26 ? -6.027  2.499   -1.213  1.00 0.00 ? 26 TYR B HB2  8  
ATOM 6186  H HB3  . TYR B 2 26 ? -6.726  4.110   -1.381  1.00 0.00 ? 26 TYR B HB3  8  
ATOM 6187  H HD1  . TYR B 2 26 ? -4.250  2.913   1.153   1.00 0.00 ? 26 TYR B HD1  8  
ATOM 6188  H HD2  . TYR B 2 26 ? -4.955  5.383   -2.290  1.00 0.00 ? 26 TYR B HD2  8  
ATOM 6189  H HE1  . TYR B 2 26 ? -1.997  3.915   1.409   1.00 0.00 ? 26 TYR B HE1  8  
ATOM 6190  H HE2  . TYR B 2 26 ? -2.704  6.384   -2.035  1.00 0.00 ? 26 TYR B HE2  8  
ATOM 6191  H HH   . TYR B 2 26 ? -0.978  6.655   -0.536  1.00 0.00 ? 26 TYR B HH   8  
ATOM 6192  N N    . THR B 2 27 ? -6.231  5.440   1.648   1.00 0.00 ? 27 THR B N    8  
ATOM 6193  C CA   . THR B 2 27 ? -6.547  6.792   2.182   1.00 0.00 ? 27 THR B CA   8  
ATOM 6194  C C    . THR B 2 27 ? -5.633  7.830   1.523   1.00 0.00 ? 27 THR B C    8  
ATOM 6195  O O    . THR B 2 27 ? -4.904  8.529   2.197   1.00 0.00 ? 27 THR B O    8  
ATOM 6196  C CB   . THR B 2 27 ? -6.334  6.807   3.697   1.00 0.00 ? 27 THR B CB   8  
ATOM 6197  O OG1  . THR B 2 27 ? -6.337  8.150   4.162   1.00 0.00 ? 27 THR B OG1  8  
ATOM 6198  C CG2  . THR B 2 27 ? -4.993  6.151   4.032   1.00 0.00 ? 27 THR B CG2  8  
ATOM 6199  H H    . THR B 2 27 ? -5.310  5.106   1.673   1.00 0.00 ? 27 THR B H    8  
ATOM 6200  H HA   . THR B 2 27 ? -7.578  7.031   1.963   1.00 0.00 ? 27 THR B HA   8  
ATOM 6201  H HB   . THR B 2 27 ? -7.128  6.259   4.179   1.00 0.00 ? 27 THR B HB   8  
ATOM 6202  H HG1  . THR B 2 27 ? -5.761  8.201   4.929   1.00 0.00 ? 27 THR B HG1  8  
ATOM 6203  H HG21 . THR B 2 27 ? -4.245  6.486   3.332   1.00 0.00 ? 27 THR B HG21 8  
ATOM 6204  H HG22 . THR B 2 27 ? -4.698  6.425   5.035   1.00 0.00 ? 27 THR B HG22 8  
ATOM 6205  H HG23 . THR B 2 27 ? -5.092  5.078   3.968   1.00 0.00 ? 27 THR B HG23 8  
ATOM 6206  N N    . PRO B 2 28 ? -5.709  7.895   0.219   1.00 0.00 ? 28 PRO B N    8  
ATOM 6207  C CA   . PRO B 2 28 ? -4.906  8.837   -0.598  1.00 0.00 ? 28 PRO B CA   8  
ATOM 6208  C C    . PRO B 2 28 ? -5.174  10.277  -0.155  1.00 0.00 ? 28 PRO B C    8  
ATOM 6209  O O    . PRO B 2 28 ? -5.820  10.521  0.844   1.00 0.00 ? 28 PRO B O    8  
ATOM 6210  C CB   . PRO B 2 28 ? -5.363  8.632   -2.047  1.00 0.00 ? 28 PRO B CB   8  
ATOM 6211  C CG   . PRO B 2 28 ? -6.455  7.547   -2.040  1.00 0.00 ? 28 PRO B CG   8  
ATOM 6212  C CD   . PRO B 2 28 ? -6.601  7.044   -0.598  1.00 0.00 ? 28 PRO B CD   8  
ATOM 6213  H HA   . PRO B 2 28 ? -3.855  8.608   -0.509  1.00 0.00 ? 28 PRO B HA   8  
ATOM 6214  H HB2  . PRO B 2 28 ? -5.762  9.556   -2.438  1.00 0.00 ? 28 PRO B HB2  8  
ATOM 6215  H HB3  . PRO B 2 28 ? -4.531  8.304   -2.652  1.00 0.00 ? 28 PRO B HB3  8  
ATOM 6216  H HG2  . PRO B 2 28 ? -7.392  7.968   -2.380  1.00 0.00 ? 28 PRO B HG2  8  
ATOM 6217  H HG3  . PRO B 2 28 ? -6.168  6.728   -2.682  1.00 0.00 ? 28 PRO B HG3  8  
ATOM 6218  H HD2  . PRO B 2 28 ? -7.625  7.150   -0.268  1.00 0.00 ? 28 PRO B HD2  8  
ATOM 6219  H HD3  . PRO B 2 28 ? -6.290  6.013   -0.530  1.00 0.00 ? 28 PRO B HD3  8  
ATOM 6220  N N    . LYS B 2 29 ? -4.685  11.235  -0.894  1.00 0.00 ? 29 LYS B N    8  
ATOM 6221  C CA   . LYS B 2 29 ? -4.912  12.659  -0.518  1.00 0.00 ? 29 LYS B CA   8  
ATOM 6222  C C    . LYS B 2 29 ? -4.912  13.523  -1.779  1.00 0.00 ? 29 LYS B C    8  
ATOM 6223  O O    . LYS B 2 29 ? -4.271  14.553  -1.840  1.00 0.00 ? 29 LYS B O    8  
ATOM 6224  C CB   . LYS B 2 29 ? -3.793  13.124  0.420   1.00 0.00 ? 29 LYS B CB   8  
ATOM 6225  C CG   . LYS B 2 29 ? -4.062  14.563  0.867   1.00 0.00 ? 29 LYS B CG   8  
ATOM 6226  C CD   . LYS B 2 29 ? -2.743  15.331  0.929   1.00 0.00 ? 29 LYS B CD   8  
ATOM 6227  C CE   . LYS B 2 29 ? -2.037  15.029  2.253   1.00 0.00 ? 29 LYS B CE   8  
ATOM 6228  N NZ   . LYS B 2 29 ? -2.609  15.886  3.328   1.00 0.00 ? 29 LYS B NZ   8  
ATOM 6229  H H    . LYS B 2 29 ? -4.166  11.017  -1.697  1.00 0.00 ? 29 LYS B H    8  
ATOM 6230  H HA   . LYS B 2 29 ? -5.863  12.752  -0.016  1.00 0.00 ? 29 LYS B HA   8  
ATOM 6231  H HB2  . LYS B 2 29 ? -3.757  12.477  1.284   1.00 0.00 ? 29 LYS B HB2  8  
ATOM 6232  H HB3  . LYS B 2 29 ? -2.848  13.084  -0.100  1.00 0.00 ? 29 LYS B HB3  8  
ATOM 6233  H HG2  . LYS B 2 29 ? -4.728  15.039  0.162   1.00 0.00 ? 29 LYS B HG2  8  
ATOM 6234  H HG3  . LYS B 2 29 ? -4.520  14.555  1.846   1.00 0.00 ? 29 LYS B HG3  8  
ATOM 6235  H HD2  . LYS B 2 29 ? -2.111  15.029  0.107   1.00 0.00 ? 29 LYS B HD2  8  
ATOM 6236  H HD3  . LYS B 2 29 ? -2.938  16.391  0.862   1.00 0.00 ? 29 LYS B HD3  8  
ATOM 6237  H HE2  . LYS B 2 29 ? -2.179  13.989  2.507   1.00 0.00 ? 29 LYS B HE2  8  
ATOM 6238  H HE3  . LYS B 2 29 ? -0.981  15.234  2.152   1.00 0.00 ? 29 LYS B HE3  8  
ATOM 6239  H HZ1  . LYS B 2 29 ? -2.892  16.804  2.927   1.00 0.00 ? 29 LYS B HZ1  8  
ATOM 6240  H HZ2  . LYS B 2 29 ? -3.442  15.416  3.740   1.00 0.00 ? 29 LYS B HZ2  8  
ATOM 6241  H HZ3  . LYS B 2 29 ? -1.895  16.035  4.070   1.00 0.00 ? 29 LYS B HZ3  8  
ATOM 6242  N N    . THR B 2 30 ? -5.627  13.111  -2.790  1.00 0.00 ? 30 THR B N    8  
ATOM 6243  C CA   . THR B 2 30 ? -5.667  13.908  -4.049  1.00 0.00 ? 30 THR B CA   8  
ATOM 6244  C C    . THR B 2 30 ? -7.068  14.497  -4.236  1.00 0.00 ? 30 THR B C    8  
ATOM 6245  O O    . THR B 2 30 ? -8.005  13.930  -3.701  1.00 0.00 ? 30 THR B O    8  
ATOM 6246  C CB   . THR B 2 30 ? -5.333  13.002  -5.236  1.00 0.00 ? 30 THR B CB   8  
ATOM 6247  O OG1  . THR B 2 30 ? -4.993  11.708  -4.760  1.00 0.00 ? 30 THR B OG1  8  
ATOM 6248  C CG2  . THR B 2 30 ? -4.151  13.589  -6.011  1.00 0.00 ? 30 THR B CG2  8  
ATOM 6249  O OXT  . THR B 2 30 ? -7.178  15.509  -4.911  1.00 0.00 ? 30 THR B OXT  8  
ATOM 6250  H H    . THR B 2 30 ? -6.138  12.277  -2.723  1.00 0.00 ? 30 THR B H    8  
ATOM 6251  H HA   . THR B 2 30 ? -4.945  14.709  -3.991  1.00 0.00 ? 30 THR B HA   8  
ATOM 6252  H HB   . THR B 2 30 ? -6.187  12.933  -5.892  1.00 0.00 ? 30 THR B HB   8  
ATOM 6253  H HG1  . THR B 2 30 ? -5.788  11.306  -4.402  1.00 0.00 ? 30 THR B HG1  8  
ATOM 6254  H HG21 . THR B 2 30 ? -3.870  14.537  -5.575  1.00 0.00 ? 30 THR B HG21 8  
ATOM 6255  H HG22 . THR B 2 30 ? -3.314  12.909  -5.959  1.00 0.00 ? 30 THR B HG22 8  
ATOM 6256  H HG23 . THR B 2 30 ? -4.433  13.735  -7.042  1.00 0.00 ? 30 THR B HG23 8  
ATOM 6257  N N    . GLY A 1 1  ? -2.943  7.346   6.482   1.00 0.00 ? 1  GLY A N    9  
ATOM 6258  C CA   . GLY A 1 1  ? -3.008  5.946   6.992   1.00 0.00 ? 1  GLY A CA   9  
ATOM 6259  C C    . GLY A 1 1  ? -1.620  5.310   6.920   1.00 0.00 ? 1  GLY A C    9  
ATOM 6260  O O    . GLY A 1 1  ? -0.744  5.615   7.705   1.00 0.00 ? 1  GLY A O    9  
ATOM 6261  H H1   . GLY A 1 1  ? -2.033  7.495   5.999   1.00 0.00 ? 1  GLY A H1   9  
ATOM 6262  H H2   . GLY A 1 1  ? -3.721  7.508   5.816   1.00 0.00 ? 1  GLY A H2   9  
ATOM 6263  H H3   . GLY A 1 1  ? -3.024  8.009   7.279   1.00 0.00 ? 1  GLY A H3   9  
ATOM 6264  H HA2  . GLY A 1 1  ? -3.349  5.953   8.017   1.00 0.00 ? 1  GLY A HA2  9  
ATOM 6265  H HA3  . GLY A 1 1  ? -3.694  5.374   6.387   1.00 0.00 ? 1  GLY A HA3  9  
ATOM 6266  N N    . ILE A 1 2  ? -1.413  4.427   5.983   1.00 0.00 ? 2  ILE A N    9  
ATOM 6267  C CA   . ILE A 1 2  ? -0.080  3.768   5.860   1.00 0.00 ? 2  ILE A CA   9  
ATOM 6268  C C    . ILE A 1 2  ? 0.852   4.655   5.032   1.00 0.00 ? 2  ILE A C    9  
ATOM 6269  O O    . ILE A 1 2  ? 2.033   4.739   5.292   1.00 0.00 ? 2  ILE A O    9  
ATOM 6270  C CB   . ILE A 1 2  ? -0.250  2.410   5.172   1.00 0.00 ? 2  ILE A CB   9  
ATOM 6271  C CG1  . ILE A 1 2  ? -0.429  2.606   3.660   1.00 0.00 ? 2  ILE A CG1  9  
ATOM 6272  C CG2  . ILE A 1 2  ? -1.489  1.717   5.734   1.00 0.00 ? 2  ILE A CG2  9  
ATOM 6273  C CD1  . ILE A 1 2  ? -0.563  1.242   2.977   1.00 0.00 ? 2  ILE A CD1  9  
ATOM 6274  H H    . ILE A 1 2  ? -2.132  4.195   5.361   1.00 0.00 ? 2  ILE A H    9  
ATOM 6275  H HA   . ILE A 1 2  ? 0.340   3.624   6.844   1.00 0.00 ? 2  ILE A HA   9  
ATOM 6276  H HB   . ILE A 1 2  ? 0.621   1.800   5.358   1.00 0.00 ? 2  ILE A HB   9  
ATOM 6277  H HG12 . ILE A 1 2  ? -1.319  3.191   3.476   1.00 0.00 ? 2  ILE A HG12 9  
ATOM 6278  H HG13 . ILE A 1 2  ? 0.430   3.124   3.261   1.00 0.00 ? 2  ILE A HG13 9  
ATOM 6279  H HG21 . ILE A 1 2  ? -1.386  1.606   6.804   1.00 0.00 ? 2  ILE A HG21 9  
ATOM 6280  H HG22 . ILE A 1 2  ? -2.363  2.312   5.514   1.00 0.00 ? 2  ILE A HG22 9  
ATOM 6281  H HG23 . ILE A 1 2  ? -1.594  0.743   5.278   1.00 0.00 ? 2  ILE A HG23 9  
ATOM 6282  H HD11 . ILE A 1 2  ? -0.701  0.477   3.727   1.00 0.00 ? 2  ILE A HD11 9  
ATOM 6283  H HD12 . ILE A 1 2  ? -1.416  1.252   2.313   1.00 0.00 ? 2  ILE A HD12 9  
ATOM 6284  H HD13 . ILE A 1 2  ? 0.333   1.033   2.411   1.00 0.00 ? 2  ILE A HD13 9  
ATOM 6285  N N    . VAL A 1 3  ? 0.319   5.311   4.039   1.00 0.00 ? 3  VAL A N    9  
ATOM 6286  C CA   . VAL A 1 3  ? 1.150   6.197   3.175   1.00 0.00 ? 3  VAL A CA   9  
ATOM 6287  C C    . VAL A 1 3  ? 2.198   6.929   4.015   1.00 0.00 ? 3  VAL A C    9  
ATOM 6288  O O    . VAL A 1 3  ? 3.296   7.188   3.566   1.00 0.00 ? 3  VAL A O    9  
ATOM 6289  C CB   . VAL A 1 3  ? 0.232   7.203   2.497   1.00 0.00 ? 3  VAL A CB   9  
ATOM 6290  C CG1  . VAL A 1 3  ? 1.022   8.017   1.471   1.00 0.00 ? 3  VAL A CG1  9  
ATOM 6291  C CG2  . VAL A 1 3  ? -0.898  6.449   1.794   1.00 0.00 ? 3  VAL A CG2  9  
ATOM 6292  H H    . VAL A 1 3  ? -0.639  5.223   3.855   1.00 0.00 ? 3  VAL A H    9  
ATOM 6293  H HA   . VAL A 1 3  ? 1.645   5.601   2.422   1.00 0.00 ? 3  VAL A HA   9  
ATOM 6294  H HB   . VAL A 1 3  ? -0.184  7.864   3.242   1.00 0.00 ? 3  VAL A HB   9  
ATOM 6295  H HG11 . VAL A 1 3  ? 1.620   7.350   0.866   1.00 0.00 ? 3  VAL A HG11 9  
ATOM 6296  H HG12 . VAL A 1 3  ? 0.338   8.560   0.837   1.00 0.00 ? 3  VAL A HG12 9  
ATOM 6297  H HG13 . VAL A 1 3  ? 1.669   8.714   1.984   1.00 0.00 ? 3  VAL A HG13 9  
ATOM 6298  H HG21 . VAL A 1 3  ? -0.500  5.554   1.335   1.00 0.00 ? 3  VAL A HG21 9  
ATOM 6299  H HG22 . VAL A 1 3  ? -1.653  6.174   2.518   1.00 0.00 ? 3  VAL A HG22 9  
ATOM 6300  H HG23 . VAL A 1 3  ? -1.336  7.077   1.035   1.00 0.00 ? 3  VAL A HG23 9  
ATOM 6301  N N    . GLU A 1 4  ? 1.875   7.254   5.237   1.00 0.00 ? 4  GLU A N    9  
ATOM 6302  C CA   . GLU A 1 4  ? 2.863   7.959   6.105   1.00 0.00 ? 4  GLU A CA   9  
ATOM 6303  C C    . GLU A 1 4  ? 3.763   6.923   6.788   1.00 0.00 ? 4  GLU A C    9  
ATOM 6304  O O    . GLU A 1 4  ? 4.059   7.022   7.962   1.00 0.00 ? 4  GLU A O    9  
ATOM 6305  C CB   . GLU A 1 4  ? 2.120   8.775   7.167   1.00 0.00 ? 4  GLU A CB   9  
ATOM 6306  C CG   . GLU A 1 4  ? 2.920   10.038  7.496   1.00 0.00 ? 4  GLU A CG   9  
ATOM 6307  C CD   . GLU A 1 4  ? 1.966   11.143  7.953   1.00 0.00 ? 4  GLU A CD   9  
ATOM 6308  O OE1  . GLU A 1 4  ? 1.319   10.956  8.970   1.00 0.00 ? 4  GLU A OE1  9  
ATOM 6309  O OE2  . GLU A 1 4  ? 1.898   12.157  7.278   1.00 0.00 ? 4  GLU A OE2  9  
ATOM 6310  H H    . GLU A 1 4  ? 0.986   7.030   5.583   1.00 0.00 ? 4  GLU A H    9  
ATOM 6311  H HA   . GLU A 1 4  ? 3.469   8.619   5.502   1.00 0.00 ? 4  GLU A HA   9  
ATOM 6312  H HB2  . GLU A 1 4  ? 1.146   9.051   6.792   1.00 0.00 ? 4  GLU A HB2  9  
ATOM 6313  H HB3  . GLU A 1 4  ? 2.006   8.181   8.062   1.00 0.00 ? 4  GLU A HB3  9  
ATOM 6314  H HG2  . GLU A 1 4  ? 3.628   9.822   8.284   1.00 0.00 ? 4  GLU A HG2  9  
ATOM 6315  H HG3  . GLU A 1 4  ? 3.451   10.367  6.614   1.00 0.00 ? 4  GLU A HG3  9  
ATOM 6316  N N    . GLN A 1 5  ? 4.200   5.933   6.056   1.00 0.00 ? 5  GLN A N    9  
ATOM 6317  C CA   . GLN A 1 5  ? 5.080   4.886   6.647   1.00 0.00 ? 5  GLN A CA   9  
ATOM 6318  C C    . GLN A 1 5  ? 5.597   3.986   5.523   1.00 0.00 ? 5  GLN A C    9  
ATOM 6319  O O    . GLN A 1 5  ? 6.777   3.721   5.417   1.00 0.00 ? 5  GLN A O    9  
ATOM 6320  C CB   . GLN A 1 5  ? 4.279   4.046   7.646   1.00 0.00 ? 5  GLN A CB   9  
ATOM 6321  C CG   . GLN A 1 5  ? 4.609   4.495   9.073   1.00 0.00 ? 5  GLN A CG   9  
ATOM 6322  C CD   . GLN A 1 5  ? 3.332   4.501   9.914   1.00 0.00 ? 5  GLN A CD   9  
ATOM 6323  O OE1  . GLN A 1 5  ? 2.904   3.473   10.399  1.00 0.00 ? 5  GLN A OE1  9  
ATOM 6324  N NE2  . GLN A 1 5  ? 2.698   5.626   10.108  1.00 0.00 ? 5  GLN A NE2  9  
ATOM 6325  H H    . GLN A 1 5  ? 3.948   5.879   5.112   1.00 0.00 ? 5  GLN A H    9  
ATOM 6326  H HA   . GLN A 1 5  ? 5.914   5.354   7.149   1.00 0.00 ? 5  GLN A HA   9  
ATOM 6327  H HB2  . GLN A 1 5  ? 3.222   4.178   7.462   1.00 0.00 ? 5  GLN A HB2  9  
ATOM 6328  H HB3  . GLN A 1 5  ? 4.539   3.005   7.530   1.00 0.00 ? 5  GLN A HB3  9  
ATOM 6329  H HG2  . GLN A 1 5  ? 5.323   3.811   9.507   1.00 0.00 ? 5  GLN A HG2  9  
ATOM 6330  H HG3  . GLN A 1 5  ? 5.029   5.489   9.050   1.00 0.00 ? 5  GLN A HG3  9  
ATOM 6331  H HE21 . GLN A 1 5  ? 3.043   6.455   9.715   1.00 0.00 ? 5  GLN A HE21 9  
ATOM 6332  H HE22 . GLN A 1 5  ? 1.879   5.642   10.645  1.00 0.00 ? 5  GLN A HE22 9  
ATOM 6333  N N    . CYS A 1 6  ? 4.714   3.523   4.680   1.00 0.00 ? 6  CYS A N    9  
ATOM 6334  C CA   . CYS A 1 6  ? 5.138   2.646   3.554   1.00 0.00 ? 6  CYS A CA   9  
ATOM 6335  C C    . CYS A 1 6  ? 5.863   3.489   2.505   1.00 0.00 ? 6  CYS A C    9  
ATOM 6336  O O    . CYS A 1 6  ? 6.694   2.998   1.766   1.00 0.00 ? 6  CYS A O    9  
ATOM 6337  C CB   . CYS A 1 6  ? 3.901   2.000   2.930   1.00 0.00 ? 6  CYS A CB   9  
ATOM 6338  S SG   . CYS A 1 6  ? 3.192   0.811   4.095   1.00 0.00 ? 6  CYS A SG   9  
ATOM 6339  H H    . CYS A 1 6  ? 3.772   3.756   4.786   1.00 0.00 ? 6  CYS A H    9  
ATOM 6340  H HA   . CYS A 1 6  ? 5.799   1.877   3.923   1.00 0.00 ? 6  CYS A HA   9  
ATOM 6341  H HB2  . CYS A 1 6  ? 3.171   2.764   2.706   1.00 0.00 ? 6  CYS A HB2  9  
ATOM 6342  H HB3  . CYS A 1 6  ? 4.181   1.492   2.020   1.00 0.00 ? 6  CYS A HB3  9  
ATOM 6343  N N    . CYS A 1 7  ? 5.561   4.757   2.441   1.00 0.00 ? 7  CYS A N    9  
ATOM 6344  C CA   . CYS A 1 7  ? 6.243   5.632   1.448   1.00 0.00 ? 7  CYS A CA   9  
ATOM 6345  C C    . CYS A 1 7  ? 7.509   6.204   2.085   1.00 0.00 ? 7  CYS A C    9  
ATOM 6346  O O    . CYS A 1 7  ? 8.613   5.885   1.690   1.00 0.00 ? 7  CYS A O    9  
ATOM 6347  C CB   . CYS A 1 7  ? 5.309   6.779   1.048   1.00 0.00 ? 7  CYS A CB   9  
ATOM 6348  S SG   . CYS A 1 7  ? 6.242   8.027   0.125   1.00 0.00 ? 7  CYS A SG   9  
ATOM 6349  H H    . CYS A 1 7  ? 4.892   5.132   3.050   1.00 0.00 ? 7  CYS A H    9  
ATOM 6350  H HA   . CYS A 1 7  ? 6.504   5.055   0.574   1.00 0.00 ? 7  CYS A HA   9  
ATOM 6351  H HB2  . CYS A 1 7  ? 4.513   6.394   0.427   1.00 0.00 ? 7  CYS A HB2  9  
ATOM 6352  H HB3  . CYS A 1 7  ? 4.888   7.224   1.934   1.00 0.00 ? 7  CYS A HB3  9  
ATOM 6353  N N    . THR A 1 8  ? 7.356   7.040   3.078   1.00 0.00 ? 8  THR A N    9  
ATOM 6354  C CA   . THR A 1 8  ? 8.548   7.624   3.751   1.00 0.00 ? 8  THR A CA   9  
ATOM 6355  C C    . THR A 1 8  ? 9.580   6.522   3.979   1.00 0.00 ? 8  THR A C    9  
ATOM 6356  O O    . THR A 1 8  ? 10.768  6.767   4.039   1.00 0.00 ? 8  THR A O    9  
ATOM 6357  C CB   . THR A 1 8  ? 8.129   8.226   5.096   1.00 0.00 ? 8  THR A CB   9  
ATOM 6358  O OG1  . THR A 1 8  ? 7.543   7.215   5.902   1.00 0.00 ? 8  THR A OG1  9  
ATOM 6359  C CG2  . THR A 1 8  ? 7.116   9.347   4.863   1.00 0.00 ? 8  THR A CG2  9  
ATOM 6360  H H    . THR A 1 8  ? 6.456   7.278   3.383   1.00 0.00 ? 8  THR A H    9  
ATOM 6361  H HA   . THR A 1 8  ? 8.974   8.396   3.126   1.00 0.00 ? 8  THR A HA   9  
ATOM 6362  H HB   . THR A 1 8  ? 8.995   8.628   5.597   1.00 0.00 ? 8  THR A HB   9  
ATOM 6363  H HG1  . THR A 1 8  ? 8.208   6.539   6.060   1.00 0.00 ? 8  THR A HG1  9  
ATOM 6364  H HG21 . THR A 1 8  ? 6.465   9.080   4.043   1.00 0.00 ? 8  THR A HG21 9  
ATOM 6365  H HG22 . THR A 1 8  ? 6.527   9.492   5.758   1.00 0.00 ? 8  THR A HG22 9  
ATOM 6366  H HG23 . THR A 1 8  ? 7.639   10.262  4.623   1.00 0.00 ? 8  THR A HG23 9  
ATOM 6367  N N    . SER A 1 9  ? 9.131   5.302   4.101   1.00 0.00 ? 9  SER A N    9  
ATOM 6368  C CA   . SER A 1 9  ? 10.078  4.174   4.316   1.00 0.00 ? 9  SER A CA   9  
ATOM 6369  C C    . SER A 1 9  ? 9.453   2.889   3.771   1.00 0.00 ? 9  SER A C    9  
ATOM 6370  O O    . SER A 1 9  ? 8.283   2.847   3.452   1.00 0.00 ? 9  SER A O    9  
ATOM 6371  C CB   . SER A 1 9  ? 10.353  4.015   5.811   1.00 0.00 ? 9  SER A CB   9  
ATOM 6372  O OG   . SER A 1 9  ? 11.515  4.759   6.154   1.00 0.00 ? 9  SER A OG   9  
ATOM 6373  H H    . SER A 1 9  ? 8.169   5.128   4.044   1.00 0.00 ? 9  SER A H    9  
ATOM 6374  H HA   . SER A 1 9  ? 11.003  4.374   3.796   1.00 0.00 ? 9  SER A HA   9  
ATOM 6375  H HB2  . SER A 1 9  ? 9.514   4.388   6.376   1.00 0.00 ? 9  SER A HB2  9  
ATOM 6376  H HB3  . SER A 1 9  ? 10.501  2.968   6.039   1.00 0.00 ? 9  SER A HB3  9  
ATOM 6377  H HG   . SER A 1 9  ? 12.280  4.204   5.989   1.00 0.00 ? 9  SER A HG   9  
ATOM 6378  N N    . ILE A 1 10 ? 10.221  1.841   3.662   1.00 0.00 ? 10 ILE A N    9  
ATOM 6379  C CA   . ILE A 1 10 ? 9.661   0.565   3.135   1.00 0.00 ? 10 ILE A CA   9  
ATOM 6380  C C    . ILE A 1 10 ? 8.993   -0.206  4.273   1.00 0.00 ? 10 ILE A C    9  
ATOM 6381  O O    . ILE A 1 10 ? 9.646   -0.849  5.069   1.00 0.00 ? 10 ILE A O    9  
ATOM 6382  C CB   . ILE A 1 10 ? 10.788  -0.274  2.533   1.00 0.00 ? 10 ILE A CB   9  
ATOM 6383  C CG1  . ILE A 1 10 ? 11.683  0.623   1.672   1.00 0.00 ? 10 ILE A CG1  9  
ATOM 6384  C CG2  . ILE A 1 10 ? 10.188  -1.384  1.665   1.00 0.00 ? 10 ILE A CG2  9  
ATOM 6385  C CD1  . ILE A 1 10 ? 12.601  -0.240  0.805   1.00 0.00 ? 10 ILE A CD1  9  
ATOM 6386  H H    . ILE A 1 10 ? 11.164  1.893   3.924   1.00 0.00 ? 10 ILE A H    9  
ATOM 6387  H HA   . ILE A 1 10 ? 8.929   0.785   2.370   1.00 0.00 ? 10 ILE A HA   9  
ATOM 6388  H HB   . ILE A 1 10 ? 11.373  -0.714  3.327   1.00 0.00 ? 10 ILE A HB   9  
ATOM 6389  H HG12 . ILE A 1 10 ? 11.067  1.244   1.039   1.00 0.00 ? 10 ILE A HG12 9  
ATOM 6390  H HG13 . ILE A 1 10 ? 12.284  1.252   2.314   1.00 0.00 ? 10 ILE A HG13 9  
ATOM 6391  H HG21 . ILE A 1 10 ? 9.298   -1.769  2.138   1.00 0.00 ? 10 ILE A HG21 9  
ATOM 6392  H HG22 . ILE A 1 10 ? 9.939   -0.986  0.693   1.00 0.00 ? 10 ILE A HG22 9  
ATOM 6393  H HG23 . ILE A 1 10 ? 10.909  -2.182  1.553   1.00 0.00 ? 10 ILE A HG23 9  
ATOM 6394  H HD11 . ILE A 1 10 ? 12.815  -1.166  1.317   1.00 0.00 ? 10 ILE A HD11 9  
ATOM 6395  H HD12 . ILE A 1 10 ? 12.111  -0.453  -0.135  1.00 0.00 ? 10 ILE A HD12 9  
ATOM 6396  H HD13 . ILE A 1 10 ? 13.522  0.292   0.617   1.00 0.00 ? 10 ILE A HD13 9  
ATOM 6397  N N    . CYS A 1 11 ? 7.691   -0.142  4.356   1.00 0.00 ? 11 CYS A N    9  
ATOM 6398  C CA   . CYS A 1 11 ? 6.974   -0.865  5.444   1.00 0.00 ? 11 CYS A CA   9  
ATOM 6399  C C    . CYS A 1 11 ? 6.845   -2.346  5.079   1.00 0.00 ? 11 CYS A C    9  
ATOM 6400  O O    . CYS A 1 11 ? 7.583   -2.863  4.264   1.00 0.00 ? 11 CYS A O    9  
ATOM 6401  C CB   . CYS A 1 11 ? 5.578   -0.264  5.620   1.00 0.00 ? 11 CYS A CB   9  
ATOM 6402  S SG   . CYS A 1 11 ? 4.557   -0.673  4.179   1.00 0.00 ? 11 CYS A SG   9  
ATOM 6403  H H    . CYS A 1 11 ? 7.185   0.386   3.704   1.00 0.00 ? 11 CYS A H    9  
ATOM 6404  H HA   . CYS A 1 11 ? 7.526   -0.769  6.367   1.00 0.00 ? 11 CYS A HA   9  
ATOM 6405  H HB2  . CYS A 1 11 ? 5.121   -0.669  6.511   1.00 0.00 ? 11 CYS A HB2  9  
ATOM 6406  H HB3  . CYS A 1 11 ? 5.657   0.810   5.712   1.00 0.00 ? 11 CYS A HB3  9  
ATOM 6407  N N    . SER A 1 12 ? 5.905   -3.027  5.676   1.00 0.00 ? 12 SER A N    9  
ATOM 6408  C CA   . SER A 1 12 ? 5.718   -4.472  5.368   1.00 0.00 ? 12 SER A CA   9  
ATOM 6409  C C    . SER A 1 12 ? 4.350   -4.673  4.710   1.00 0.00 ? 12 SER A C    9  
ATOM 6410  O O    . SER A 1 12 ? 3.542   -3.768  4.651   1.00 0.00 ? 12 SER A O    9  
ATOM 6411  C CB   . SER A 1 12 ? 5.785   -5.277  6.662   1.00 0.00 ? 12 SER A CB   9  
ATOM 6412  O OG   . SER A 1 12 ? 5.219   -4.516  7.720   1.00 0.00 ? 12 SER A OG   9  
ATOM 6413  H H    . SER A 1 12 ? 5.321   -2.588  6.326   1.00 0.00 ? 12 SER A H    9  
ATOM 6414  H HA   . SER A 1 12 ? 6.494   -4.803  4.693   1.00 0.00 ? 12 SER A HA   9  
ATOM 6415  H HB2  . SER A 1 12 ? 5.231   -6.194  6.550   1.00 0.00 ? 12 SER A HB2  9  
ATOM 6416  H HB3  . SER A 1 12 ? 6.819   -5.509  6.886   1.00 0.00 ? 12 SER A HB3  9  
ATOM 6417  H HG   . SER A 1 12 ? 4.282   -4.408  7.541   1.00 0.00 ? 12 SER A HG   9  
ATOM 6418  N N    . LEU A 1 13 ? 4.084   -5.850  4.216   1.00 0.00 ? 13 LEU A N    9  
ATOM 6419  C CA   . LEU A 1 13 ? 2.766   -6.102  3.567   1.00 0.00 ? 13 LEU A CA   9  
ATOM 6420  C C    . LEU A 1 13 ? 1.686   -6.218  4.642   1.00 0.00 ? 13 LEU A C    9  
ATOM 6421  O O    . LEU A 1 13 ? 0.504   -6.218  4.355   1.00 0.00 ? 13 LEU A O    9  
ATOM 6422  C CB   . LEU A 1 13 ? 2.831   -7.401  2.762   1.00 0.00 ? 13 LEU A CB   9  
ATOM 6423  C CG   . LEU A 1 13 ? 1.899   -7.302  1.553   1.00 0.00 ? 13 LEU A CG   9  
ATOM 6424  C CD1  . LEU A 1 13 ? 2.455   -6.275  0.563   1.00 0.00 ? 13 LEU A CD1  9  
ATOM 6425  C CD2  . LEU A 1 13 ? 1.806   -8.669  0.871   1.00 0.00 ? 13 LEU A CD2  9  
ATOM 6426  H H    . LEU A 1 13 ? 4.749   -6.568  4.272   1.00 0.00 ? 13 LEU A H    9  
ATOM 6427  H HA   . LEU A 1 13 ? 2.529   -5.280  2.906   1.00 0.00 ? 13 LEU A HA   9  
ATOM 6428  H HB2  . LEU A 1 13 ? 3.844   -7.565  2.424   1.00 0.00 ? 13 LEU A HB2  9  
ATOM 6429  H HB3  . LEU A 1 13 ? 2.520   -8.227  3.386   1.00 0.00 ? 13 LEU A HB3  9  
ATOM 6430  H HG   . LEU A 1 13 ? 0.917   -6.992  1.880   1.00 0.00 ? 13 LEU A HG   9  
ATOM 6431  H HD11 . LEU A 1 13 ? 3.492   -6.496  0.360   1.00 0.00 ? 13 LEU A HD11 9  
ATOM 6432  H HD12 . LEU A 1 13 ? 1.888   -6.319  -0.356  1.00 0.00 ? 13 LEU A HD12 9  
ATOM 6433  H HD13 . LEU A 1 13 ? 2.372   -5.286  0.989   1.00 0.00 ? 13 LEU A HD13 9  
ATOM 6434  H HD21 . LEU A 1 13 ? 2.698   -9.238  1.082   1.00 0.00 ? 13 LEU A HD21 9  
ATOM 6435  H HD22 . LEU A 1 13 ? 0.944   -9.199  1.244   1.00 0.00 ? 13 LEU A HD22 9  
ATOM 6436  H HD23 . LEU A 1 13 ? 1.710   -8.532  -0.196  1.00 0.00 ? 13 LEU A HD23 9  
ATOM 6437  N N    . TYR A 1 14 ? 2.078   -6.314  5.883   1.00 0.00 ? 14 TYR A N    9  
ATOM 6438  C CA   . TYR A 1 14 ? 1.078   -6.428  6.980   1.00 0.00 ? 14 TYR A CA   9  
ATOM 6439  C C    . TYR A 1 14 ? 0.212   -5.165  7.004   1.00 0.00 ? 14 TYR A C    9  
ATOM 6440  O O    . TYR A 1 14 ? -0.989  -5.227  7.182   1.00 0.00 ? 14 TYR A O    9  
ATOM 6441  C CB   . TYR A 1 14 ? 1.813   -6.581  8.315   1.00 0.00 ? 14 TYR A CB   9  
ATOM 6442  C CG   . TYR A 1 14 ? 0.866   -6.311  9.461   1.00 0.00 ? 14 TYR A CG   9  
ATOM 6443  C CD1  . TYR A 1 14 ? -0.453  -6.775  9.403   1.00 0.00 ? 14 TYR A CD1  9  
ATOM 6444  C CD2  . TYR A 1 14 ? 1.310   -5.596  10.580  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 6445  C CE1  . TYR A 1 14 ? -1.330  -6.522  10.467  1.00 0.00 ? 14 TYR A CE1  9  
ATOM 6446  C CE2  . TYR A 1 14 ? 0.435   -5.345  11.643  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 6447  C CZ   . TYR A 1 14 ? -0.886  -5.808  11.587  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 6448  O OH   . TYR A 1 14 ? -1.749  -5.561  12.634  1.00 0.00 ? 14 TYR A OH   9  
ATOM 6449  H H    . TYR A 1 14 ? 3.036   -6.309  6.093   1.00 0.00 ? 14 TYR A H    9  
ATOM 6450  H HA   . TYR A 1 14 ? 0.451   -7.290  6.811   1.00 0.00 ? 14 TYR A HA   9  
ATOM 6451  H HB2  . TYR A 1 14 ? 2.200   -7.585  8.399   1.00 0.00 ? 14 TYR A HB2  9  
ATOM 6452  H HB3  . TYR A 1 14 ? 2.632   -5.877  8.356   1.00 0.00 ? 14 TYR A HB3  9  
ATOM 6453  H HD1  . TYR A 1 14 ? -0.797  -7.326  8.541   1.00 0.00 ? 14 TYR A HD1  9  
ATOM 6454  H HD2  . TYR A 1 14 ? 2.329   -5.240  10.623  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 6455  H HE1  . TYR A 1 14 ? -2.347  -6.879  10.423  1.00 0.00 ? 14 TYR A HE1  9  
ATOM 6456  H HE2  . TYR A 1 14 ? 0.777   -4.794  12.506  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 6457  H HH   . TYR A 1 14 ? -2.033  -4.646  12.574  1.00 0.00 ? 14 TYR A HH   9  
ATOM 6458  N N    . GLN A 1 15 ? 0.810   -4.021  6.828   1.00 0.00 ? 15 GLN A N    9  
ATOM 6459  C CA   . GLN A 1 15 ? 0.021   -2.759  6.842   1.00 0.00 ? 15 GLN A CA   9  
ATOM 6460  C C    . GLN A 1 15 ? -0.928  -2.738  5.643   1.00 0.00 ? 15 GLN A C    9  
ATOM 6461  O O    . GLN A 1 15 ? -2.043  -2.262  5.731   1.00 0.00 ? 15 GLN A O    9  
ATOM 6462  C CB   . GLN A 1 15 ? 0.971   -1.562  6.765   1.00 0.00 ? 15 GLN A CB   9  
ATOM 6463  C CG   . GLN A 1 15 ? 1.931   -1.597  7.955   1.00 0.00 ? 15 GLN A CG   9  
ATOM 6464  C CD   . GLN A 1 15 ? 1.485   -0.572  9.001   1.00 0.00 ? 15 GLN A CD   9  
ATOM 6465  O OE1  . GLN A 1 15 ? 2.299   0.139   9.557   1.00 0.00 ? 15 GLN A OE1  9  
ATOM 6466  N NE2  . GLN A 1 15 ? 0.218   -0.465  9.291   1.00 0.00 ? 15 GLN A NE2  9  
ATOM 6467  H H    . GLN A 1 15 ? 1.779   -3.993  6.686   1.00 0.00 ? 15 GLN A H    9  
ATOM 6468  H HA   . GLN A 1 15 ? -0.553  -2.705  7.756   1.00 0.00 ? 15 GLN A HA   9  
ATOM 6469  H HB2  . GLN A 1 15 ? 1.535   -1.608  5.845   1.00 0.00 ? 15 GLN A HB2  9  
ATOM 6470  H HB3  . GLN A 1 15 ? 0.399   -0.647  6.793   1.00 0.00 ? 15 GLN A HB3  9  
ATOM 6471  H HG2  . GLN A 1 15 ? 1.926   -2.586  8.393   1.00 0.00 ? 15 GLN A HG2  9  
ATOM 6472  H HG3  . GLN A 1 15 ? 2.928   -1.356  7.622   1.00 0.00 ? 15 GLN A HG3  9  
ATOM 6473  H HE21 . GLN A 1 15 ? -0.439  -1.037  8.842   1.00 0.00 ? 15 GLN A HE21 9  
ATOM 6474  H HE22 . GLN A 1 15 ? -0.078  0.188   9.960   1.00 0.00 ? 15 GLN A HE22 9  
ATOM 6475  N N    . LEU A 1 16 ? -0.498  -3.248  4.522   1.00 0.00 ? 16 LEU A N    9  
ATOM 6476  C CA   . LEU A 1 16 ? -1.379  -3.255  3.322   1.00 0.00 ? 16 LEU A CA   9  
ATOM 6477  C C    . LEU A 1 16 ? -2.533  -4.232  3.544   1.00 0.00 ? 16 LEU A C    9  
ATOM 6478  O O    . LEU A 1 16 ? -3.554  -4.160  2.888   1.00 0.00 ? 16 LEU A O    9  
ATOM 6479  C CB   . LEU A 1 16 ? -0.570  -3.675  2.089   1.00 0.00 ? 16 LEU A CB   9  
ATOM 6480  C CG   . LEU A 1 16 ? 0.641   -2.745  1.891   1.00 0.00 ? 16 LEU A CG   9  
ATOM 6481  C CD1  . LEU A 1 16 ? 0.926   -2.608  0.397   1.00 0.00 ? 16 LEU A CD1  9  
ATOM 6482  C CD2  . LEU A 1 16 ? 0.358   -1.352  2.466   1.00 0.00 ? 16 LEU A CD2  9  
ATOM 6483  H H    . LEU A 1 16 ? 0.403   -3.627  4.469   1.00 0.00 ? 16 LEU A H    9  
ATOM 6484  H HA   . LEU A 1 16 ? -1.777  -2.262  3.167   1.00 0.00 ? 16 LEU A HA   9  
ATOM 6485  H HB2  . LEU A 1 16 ? -0.222  -4.689  2.223   1.00 0.00 ? 16 LEU A HB2  9  
ATOM 6486  H HB3  . LEU A 1 16 ? -1.202  -3.629  1.216   1.00 0.00 ? 16 LEU A HB3  9  
ATOM 6487  H HG   . LEU A 1 16 ? 1.505   -3.173  2.381   1.00 0.00 ? 16 LEU A HG   9  
ATOM 6488  H HD11 . LEU A 1 16 ? 0.532   -3.468  -0.125  1.00 0.00 ? 16 LEU A HD11 9  
ATOM 6489  H HD12 . LEU A 1 16 ? 0.452   -1.711  0.023   1.00 0.00 ? 16 LEU A HD12 9  
ATOM 6490  H HD13 . LEU A 1 16 ? 1.991   -2.545  0.237   1.00 0.00 ? 16 LEU A HD13 9  
ATOM 6491  H HD21 . LEU A 1 16 ? -0.541  -0.953  2.021   1.00 0.00 ? 16 LEU A HD21 9  
ATOM 6492  H HD22 . LEU A 1 16 ? 0.228   -1.424  3.536   1.00 0.00 ? 16 LEU A HD22 9  
ATOM 6493  H HD23 . LEU A 1 16 ? 1.188   -0.697  2.248   1.00 0.00 ? 16 LEU A HD23 9  
ATOM 6494  N N    . GLU A 1 17 ? -2.387  -5.141  4.467   1.00 0.00 ? 17 GLU A N    9  
ATOM 6495  C CA   . GLU A 1 17 ? -3.487  -6.110  4.732   1.00 0.00 ? 17 GLU A CA   9  
ATOM 6496  C C    . GLU A 1 17 ? -4.677  -5.355  5.325   1.00 0.00 ? 17 GLU A C    9  
ATOM 6497  O O    . GLU A 1 17 ? -5.767  -5.879  5.432   1.00 0.00 ? 17 GLU A O    9  
ATOM 6498  C CB   . GLU A 1 17 ? -3.007  -7.175  5.718   1.00 0.00 ? 17 GLU A CB   9  
ATOM 6499  C CG   . GLU A 1 17 ? -1.958  -8.060  5.044   1.00 0.00 ? 17 GLU A CG   9  
ATOM 6500  C CD   . GLU A 1 17 ? -1.818  -9.371  5.820   1.00 0.00 ? 17 GLU A CD   9  
ATOM 6501  O OE1  . GLU A 1 17 ? -2.803  -9.803  6.395   1.00 0.00 ? 17 GLU A OE1  9  
ATOM 6502  O OE2  . GLU A 1 17 ? -0.728  -9.920  5.827   1.00 0.00 ? 17 GLU A OE2  9  
ATOM 6503  H H    . GLU A 1 17 ? -1.560  -5.183  4.991   1.00 0.00 ? 17 GLU A H    9  
ATOM 6504  H HA   . GLU A 1 17 ? -3.781  -6.580  3.806   1.00 0.00 ? 17 GLU A HA   9  
ATOM 6505  H HB2  . GLU A 1 17 ? -2.574  -6.695  6.585   1.00 0.00 ? 17 GLU A HB2  9  
ATOM 6506  H HB3  . GLU A 1 17 ? -3.845  -7.784  6.025   1.00 0.00 ? 17 GLU A HB3  9  
ATOM 6507  H HG2  . GLU A 1 17 ? -2.262  -8.271  4.030   1.00 0.00 ? 17 GLU A HG2  9  
ATOM 6508  H HG3  . GLU A 1 17 ? -1.008  -7.549  5.035   1.00 0.00 ? 17 GLU A HG3  9  
ATOM 6509  N N    . ASN A 1 18 ? -4.473  -4.122  5.709   1.00 0.00 ? 18 ASN A N    9  
ATOM 6510  C CA   . ASN A 1 18 ? -5.589  -3.324  6.289   1.00 0.00 ? 18 ASN A CA   9  
ATOM 6511  C C    . ASN A 1 18 ? -6.404  -2.699  5.157   1.00 0.00 ? 18 ASN A C    9  
ATOM 6512  O O    . ASN A 1 18 ? -7.544  -2.315  5.334   1.00 0.00 ? 18 ASN A O    9  
ATOM 6513  C CB   . ASN A 1 18 ? -5.017  -2.212  7.171   1.00 0.00 ? 18 ASN A CB   9  
ATOM 6514  C CG   . ASN A 1 18 ? -4.306  -2.829  8.376   1.00 0.00 ? 18 ASN A CG   9  
ATOM 6515  O OD1  . ASN A 1 18 ? -3.393  -3.615  8.221   1.00 0.00 ? 18 ASN A OD1  9  
ATOM 6516  N ND2  . ASN A 1 18 ? -4.693  -2.506  9.580   1.00 0.00 ? 18 ASN A ND2  9  
ATOM 6517  H H    . ASN A 1 18 ? -3.585  -3.719  5.610   1.00 0.00 ? 18 ASN A H    9  
ATOM 6518  H HA   . ASN A 1 18 ? -6.225  -3.965  6.883   1.00 0.00 ? 18 ASN A HA   9  
ATOM 6519  H HB2  . ASN A 1 18 ? -4.312  -1.625  6.598   1.00 0.00 ? 18 ASN A HB2  9  
ATOM 6520  H HB3  . ASN A 1 18 ? -5.819  -1.576  7.515   1.00 0.00 ? 18 ASN A HB3  9  
ATOM 6521  H HD21 . ASN A 1 18 ? -5.431  -1.873  9.704   1.00 0.00 ? 18 ASN A HD21 9  
ATOM 6522  H HD22 . ASN A 1 18 ? -4.244  -2.895  10.360  1.00 0.00 ? 18 ASN A HD22 9  
ATOM 6523  N N    . TYR A 1 19 ? -5.824  -2.586  3.994   1.00 0.00 ? 19 TYR A N    9  
ATOM 6524  C CA   . TYR A 1 19 ? -6.558  -1.978  2.849   1.00 0.00 ? 19 TYR A CA   9  
ATOM 6525  C C    . TYR A 1 19 ? -7.453  -3.026  2.186   1.00 0.00 ? 19 TYR A C    9  
ATOM 6526  O O    . TYR A 1 19 ? -8.004  -2.804  1.128   1.00 0.00 ? 19 TYR A O    9  
ATOM 6527  C CB   . TYR A 1 19 ? -5.550  -1.434  1.834   1.00 0.00 ? 19 TYR A CB   9  
ATOM 6528  C CG   . TYR A 1 19 ? -5.171  -0.037  2.235   1.00 0.00 ? 19 TYR A CG   9  
ATOM 6529  C CD1  . TYR A 1 19 ? -6.054  1.015   1.976   1.00 0.00 ? 19 TYR A CD1  9  
ATOM 6530  C CD2  . TYR A 1 19 ? -3.954  0.206   2.878   1.00 0.00 ? 19 TYR A CD2  9  
ATOM 6531  C CE1  . TYR A 1 19 ? -5.721  2.317   2.360   1.00 0.00 ? 19 TYR A CE1  9  
ATOM 6532  C CE2  . TYR A 1 19 ? -3.621  1.509   3.259   1.00 0.00 ? 19 TYR A CE2  9  
ATOM 6533  C CZ   . TYR A 1 19 ? -4.506  2.565   3.002   1.00 0.00 ? 19 TYR A CZ   9  
ATOM 6534  O OH   . TYR A 1 19 ? -4.175  3.850   3.380   1.00 0.00 ? 19 TYR A OH   9  
ATOM 6535  H H    . TYR A 1 19 ? -4.903  -2.895  3.875   1.00 0.00 ? 19 TYR A H    9  
ATOM 6536  H HA   . TYR A 1 19 ? -7.171  -1.166  3.211   1.00 0.00 ? 19 TYR A HA   9  
ATOM 6537  H HB2  . TYR A 1 19 ? -4.671  -2.060  1.820   1.00 0.00 ? 19 TYR A HB2  9  
ATOM 6538  H HB3  . TYR A 1 19 ? -5.998  -1.412  0.854   1.00 0.00 ? 19 TYR A HB3  9  
ATOM 6539  H HD1  . TYR A 1 19 ? -6.991  0.816   1.479   1.00 0.00 ? 19 TYR A HD1  9  
ATOM 6540  H HD2  . TYR A 1 19 ? -3.268  -0.609  3.071   1.00 0.00 ? 19 TYR A HD2  9  
ATOM 6541  H HE1  . TYR A 1 19 ? -6.403  3.129   2.159   1.00 0.00 ? 19 TYR A HE1  9  
ATOM 6542  H HE2  . TYR A 1 19 ? -2.687  1.702   3.757   1.00 0.00 ? 19 TYR A HE2  9  
ATOM 6543  H HH   . TYR A 1 19 ? -4.765  4.455   2.924   1.00 0.00 ? 19 TYR A HH   9  
ATOM 6544  N N    . CYS A 1 20 ? -7.616  -4.164  2.804   1.00 0.00 ? 20 CYS A N    9  
ATOM 6545  C CA   . CYS A 1 20 ? -8.489  -5.217  2.211   1.00 0.00 ? 20 CYS A CA   9  
ATOM 6546  C C    . CYS A 1 20 ? -9.882  -5.126  2.833   1.00 0.00 ? 20 CYS A C    9  
ATOM 6547  O O    . CYS A 1 20 ? -10.032 -4.845  4.006   1.00 0.00 ? 20 CYS A O    9  
ATOM 6548  C CB   . CYS A 1 20 ? -7.897  -6.592  2.500   1.00 0.00 ? 20 CYS A CB   9  
ATOM 6549  S SG   . CYS A 1 20 ? -7.547  -7.453  0.942   1.00 0.00 ? 20 CYS A SG   9  
ATOM 6550  H H    . CYS A 1 20 ? -7.171  -4.322  3.663   1.00 0.00 ? 20 CYS A H    9  
ATOM 6551  H HA   . CYS A 1 20 ? -8.561  -5.073  1.148   1.00 0.00 ? 20 CYS A HA   9  
ATOM 6552  H HB2  . CYS A 1 20 ? -6.985  -6.484  3.066   1.00 0.00 ? 20 CYS A HB2  9  
ATOM 6553  H HB3  . CYS A 1 20 ? -8.609  -7.163  3.069   1.00 0.00 ? 20 CYS A HB3  9  
ATOM 6554  N N    . ASN A 1 21 ? -10.905 -5.363  2.058   1.00 0.00 ? 21 ASN A N    9  
ATOM 6555  C CA   . ASN A 1 21 ? -12.288 -5.290  2.610   1.00 0.00 ? 21 ASN A CA   9  
ATOM 6556  C C    . ASN A 1 21 ? -12.765 -6.698  2.975   1.00 0.00 ? 21 ASN A C    9  
ATOM 6557  O O    . ASN A 1 21 ? -13.687 -7.174  2.333   1.00 0.00 ? 21 ASN A O    9  
ATOM 6558  C CB   . ASN A 1 21 ? -13.225 -4.690  1.561   1.00 0.00 ? 21 ASN A CB   9  
ATOM 6559  C CG   . ASN A 1 21 ? -14.377 -3.965  2.260   1.00 0.00 ? 21 ASN A CG   9  
ATOM 6560  O OD1  . ASN A 1 21 ? -14.917 -4.453  3.234   1.00 0.00 ? 21 ASN A OD1  9  
ATOM 6561  N ND2  . ASN A 1 21 ? -14.782 -2.813  1.801   1.00 0.00 ? 21 ASN A ND2  9  
ATOM 6562  O OXT  . ASN A 1 21 ? -12.199 -7.274  3.888   1.00 0.00 ? 21 ASN A OXT  9  
ATOM 6563  H H    . ASN A 1 21 ? -10.764 -5.588  1.116   1.00 0.00 ? 21 ASN A H    9  
ATOM 6564  H HA   . ASN A 1 21 ? -12.290 -4.670  3.493   1.00 0.00 ? 21 ASN A HA   9  
ATOM 6565  H HB2  . ASN A 1 21 ? -12.677 -3.989  0.948   1.00 0.00 ? 21 ASN A HB2  9  
ATOM 6566  H HB3  . ASN A 1 21 ? -13.622 -5.478  0.938   1.00 0.00 ? 21 ASN A HB3  9  
ATOM 6567  H HD21 . ASN A 1 21 ? -14.347 -2.418  1.015   1.00 0.00 ? 21 ASN A HD21 9  
ATOM 6568  H HD22 . ASN A 1 21 ? -15.519 -2.342  2.240   1.00 0.00 ? 21 ASN A HD22 9  
ATOM 6569  N N    . PHE B 2 1  ? 5.310   -7.414  -3.160  1.00 0.00 ? 1  PHE B N    9  
ATOM 6570  C CA   . PHE B 2 1  ? 6.298   -7.794  -2.109  1.00 0.00 ? 1  PHE B CA   9  
ATOM 6571  C C    . PHE B 2 1  ? 7.702   -7.378  -2.555  1.00 0.00 ? 1  PHE B C    9  
ATOM 6572  O O    . PHE B 2 1  ? 8.551   -8.204  -2.819  1.00 0.00 ? 1  PHE B O    9  
ATOM 6573  C CB   . PHE B 2 1  ? 6.267   -9.311  -1.878  1.00 0.00 ? 1  PHE B CB   9  
ATOM 6574  C CG   . PHE B 2 1  ? 5.710   -10.009 -3.097  1.00 0.00 ? 1  PHE B CG   9  
ATOM 6575  C CD1  . PHE B 2 1  ? 4.328   -10.183 -3.233  1.00 0.00 ? 1  PHE B CD1  9  
ATOM 6576  C CD2  . PHE B 2 1  ? 6.576   -10.485 -4.091  1.00 0.00 ? 1  PHE B CD2  9  
ATOM 6577  C CE1  . PHE B 2 1  ? 3.809   -10.829 -4.360  1.00 0.00 ? 1  PHE B CE1  9  
ATOM 6578  C CE2  . PHE B 2 1  ? 6.057   -11.132 -5.218  1.00 0.00 ? 1  PHE B CE2  9  
ATOM 6579  C CZ   . PHE B 2 1  ? 4.674   -11.304 -5.354  1.00 0.00 ? 1  PHE B CZ   9  
ATOM 6580  H H1   . PHE B 2 1  ? 5.594   -7.826  -4.069  1.00 0.00 ? 1  PHE B H1   9  
ATOM 6581  H H2   . PHE B 2 1  ? 4.368   -7.769  -2.895  1.00 0.00 ? 1  PHE B H2   9  
ATOM 6582  H H3   . PHE B 2 1  ? 5.278   -6.378  -3.248  1.00 0.00 ? 1  PHE B H3   9  
ATOM 6583  H HA   . PHE B 2 1  ? 6.052   -7.286  -1.187  1.00 0.00 ? 1  PHE B HA   9  
ATOM 6584  H HB2  . PHE B 2 1  ? 7.270   -9.665  -1.691  1.00 0.00 ? 1  PHE B HB2  9  
ATOM 6585  H HB3  . PHE B 2 1  ? 5.642   -9.530  -1.024  1.00 0.00 ? 1  PHE B HB3  9  
ATOM 6586  H HD1  . PHE B 2 1  ? 3.660   -9.815  -2.466  1.00 0.00 ? 1  PHE B HD1  9  
ATOM 6587  H HD2  . PHE B 2 1  ? 7.641   -10.350 -3.986  1.00 0.00 ? 1  PHE B HD2  9  
ATOM 6588  H HE1  . PHE B 2 1  ? 2.743   -10.962 -4.464  1.00 0.00 ? 1  PHE B HE1  9  
ATOM 6589  H HE2  . PHE B 2 1  ? 6.725   -11.498 -5.986  1.00 0.00 ? 1  PHE B HE2  9  
ATOM 6590  H HZ   . PHE B 2 1  ? 4.275   -11.803 -6.224  1.00 0.00 ? 1  PHE B HZ   9  
ATOM 6591  N N    . VAL B 2 2  ? 7.951   -6.099  -2.637  1.00 0.00 ? 2  VAL B N    9  
ATOM 6592  C CA   . VAL B 2 2  ? 9.299   -5.629  -3.061  1.00 0.00 ? 2  VAL B CA   9  
ATOM 6593  C C    . VAL B 2 2  ? 9.707   -4.419  -2.216  1.00 0.00 ? 2  VAL B C    9  
ATOM 6594  O O    . VAL B 2 2  ? 8.895   -3.574  -1.893  1.00 0.00 ? 2  VAL B O    9  
ATOM 6595  C CB   . VAL B 2 2  ? 9.261   -5.230  -4.538  1.00 0.00 ? 2  VAL B CB   9  
ATOM 6596  C CG1  . VAL B 2 2  ? 10.671  -5.300  -5.122  1.00 0.00 ? 2  VAL B CG1  9  
ATOM 6597  C CG2  . VAL B 2 2  ? 8.344   -6.191  -5.299  1.00 0.00 ? 2  VAL B CG2  9  
ATOM 6598  H H    . VAL B 2 2  ? 7.253   -5.447  -2.417  1.00 0.00 ? 2  VAL B H    9  
ATOM 6599  H HA   . VAL B 2 2  ? 10.019  -6.423  -2.922  1.00 0.00 ? 2  VAL B HA   9  
ATOM 6600  H HB   . VAL B 2 2  ? 8.882   -4.222  -4.627  1.00 0.00 ? 2  VAL B HB   9  
ATOM 6601  H HG11 . VAL B 2 2  ? 11.328  -5.787  -4.416  1.00 0.00 ? 2  VAL B HG11 9  
ATOM 6602  H HG12 . VAL B 2 2  ? 10.651  -5.865  -6.043  1.00 0.00 ? 2  VAL B HG12 9  
ATOM 6603  H HG13 . VAL B 2 2  ? 11.030  -4.303  -5.320  1.00 0.00 ? 2  VAL B HG13 9  
ATOM 6604  H HG21 . VAL B 2 2  ? 7.354   -6.162  -4.870  1.00 0.00 ? 2  VAL B HG21 9  
ATOM 6605  H HG22 . VAL B 2 2  ? 8.295   -5.893  -6.337  1.00 0.00 ? 2  VAL B HG22 9  
ATOM 6606  H HG23 . VAL B 2 2  ? 8.738   -7.193  -5.232  1.00 0.00 ? 2  VAL B HG23 9  
ATOM 6607  N N    . ASN B 2 3  ? 10.957  -4.332  -1.852  1.00 0.00 ? 3  ASN B N    9  
ATOM 6608  C CA   . ASN B 2 3  ? 11.414  -3.179  -1.024  1.00 0.00 ? 3  ASN B CA   9  
ATOM 6609  C C    . ASN B 2 3  ? 11.433  -1.910  -1.879  1.00 0.00 ? 3  ASN B C    9  
ATOM 6610  O O    . ASN B 2 3  ? 12.446  -1.543  -2.440  1.00 0.00 ? 3  ASN B O    9  
ATOM 6611  C CB   . ASN B 2 3  ? 12.821  -3.459  -0.493  1.00 0.00 ? 3  ASN B CB   9  
ATOM 6612  C CG   . ASN B 2 3  ? 12.749  -4.537  0.592   1.00 0.00 ? 3  ASN B CG   9  
ATOM 6613  O OD1  . ASN B 2 3  ? 12.736  -5.714  0.294   1.00 0.00 ? 3  ASN B OD1  9  
ATOM 6614  N ND2  . ASN B 2 3  ? 12.705  -4.181  1.846   1.00 0.00 ? 3  ASN B ND2  9  
ATOM 6615  H H    . ASN B 2 3  ? 11.595  -5.025  -2.121  1.00 0.00 ? 3  ASN B H    9  
ATOM 6616  H HA   . ASN B 2 3  ? 10.737  -3.043  -0.194  1.00 0.00 ? 3  ASN B HA   9  
ATOM 6617  H HB2  . ASN B 2 3  ? 13.450  -3.802  -1.303  1.00 0.00 ? 3  ASN B HB2  9  
ATOM 6618  H HB3  . ASN B 2 3  ? 13.235  -2.555  -0.073  1.00 0.00 ? 3  ASN B HB3  9  
ATOM 6619  H HD21 . ASN B 2 3  ? 12.715  -3.230  2.088   1.00 0.00 ? 3  ASN B HD21 9  
ATOM 6620  H HD22 . ASN B 2 3  ? 12.659  -4.863  2.548   1.00 0.00 ? 3  ASN B HD22 9  
ATOM 6621  N N    . GLN B 2 4  ? 10.319  -1.237  -1.979  1.00 0.00 ? 4  GLN B N    9  
ATOM 6622  C CA   . GLN B 2 4  ? 10.269  0.010   -2.794  1.00 0.00 ? 4  GLN B CA   9  
ATOM 6623  C C    . GLN B 2 4  ? 9.328   1.017   -2.132  1.00 0.00 ? 4  GLN B C    9  
ATOM 6624  O O    . GLN B 2 4  ? 8.222   0.686   -1.752  1.00 0.00 ? 4  GLN B O    9  
ATOM 6625  C CB   . GLN B 2 4  ? 9.749   -0.319  -4.196  1.00 0.00 ? 4  GLN B CB   9  
ATOM 6626  C CG   . GLN B 2 4  ? 10.846  -1.013  -5.004  1.00 0.00 ? 4  GLN B CG   9  
ATOM 6627  C CD   . GLN B 2 4  ? 11.251  -0.124  -6.182  1.00 0.00 ? 4  GLN B CD   9  
ATOM 6628  O OE1  . GLN B 2 4  ? 12.213  0.614   -6.099  1.00 0.00 ? 4  GLN B OE1  9  
ATOM 6629  N NE2  . GLN B 2 4  ? 10.550  -0.162  -7.283  1.00 0.00 ? 4  GLN B NE2  9  
ATOM 6630  H H    . GLN B 2 4  ? 9.514   -1.550  -1.516  1.00 0.00 ? 4  GLN B H    9  
ATOM 6631  H HA   . GLN B 2 4  ? 11.261  0.434   -2.868  1.00 0.00 ? 4  GLN B HA   9  
ATOM 6632  H HB2  . GLN B 2 4  ? 8.892   -0.972  -4.116  1.00 0.00 ? 4  GLN B HB2  9  
ATOM 6633  H HB3  . GLN B 2 4  ? 9.460   0.594   -4.695  1.00 0.00 ? 4  GLN B HB3  9  
ATOM 6634  H HG2  . GLN B 2 4  ? 11.704  -1.186  -4.371  1.00 0.00 ? 4  GLN B HG2  9  
ATOM 6635  H HG3  . GLN B 2 4  ? 10.475  -1.955  -5.377  1.00 0.00 ? 4  GLN B HG3  9  
ATOM 6636  H HE21 . GLN B 2 4  ? 9.775   -0.757  -7.349  1.00 0.00 ? 4  GLN B HE21 9  
ATOM 6637  H HE22 . GLN B 2 4  ? 10.801  0.403   -8.042  1.00 0.00 ? 4  GLN B HE22 9  
ATOM 6638  N N    . HIS B 2 5  ? 9.751   2.244   -1.994  1.00 0.00 ? 5  HIS B N    9  
ATOM 6639  C CA   . HIS B 2 5  ? 8.867   3.263   -1.363  1.00 0.00 ? 5  HIS B CA   9  
ATOM 6640  C C    . HIS B 2 5  ? 7.581   3.376   -2.182  1.00 0.00 ? 5  HIS B C    9  
ATOM 6641  O O    . HIS B 2 5  ? 7.609   3.408   -3.396  1.00 0.00 ? 5  HIS B O    9  
ATOM 6642  C CB   . HIS B 2 5  ? 9.586   4.614   -1.334  1.00 0.00 ? 5  HIS B CB   9  
ATOM 6643  C CG   . HIS B 2 5  ? 10.765  4.530   -0.403  1.00 0.00 ? 5  HIS B CG   9  
ATOM 6644  N ND1  . HIS B 2 5  ? 10.661  4.004   0.875   1.00 0.00 ? 5  HIS B ND1  9  
ATOM 6645  C CD2  . HIS B 2 5  ? 12.081  4.897   -0.550  1.00 0.00 ? 5  HIS B CD2  9  
ATOM 6646  C CE1  . HIS B 2 5  ? 11.881  4.068   1.441   1.00 0.00 ? 5  HIS B CE1  9  
ATOM 6647  N NE2  . HIS B 2 5  ? 12.784  4.604   0.615   1.00 0.00 ? 5  HIS B NE2  9  
ATOM 6648  H H    . HIS B 2 5  ? 10.644  2.494   -2.311  1.00 0.00 ? 5  HIS B H    9  
ATOM 6649  H HA   . HIS B 2 5  ? 8.628   2.959   -0.355  1.00 0.00 ? 5  HIS B HA   9  
ATOM 6650  H HB2  . HIS B 2 5  ? 9.929   4.861   -2.328  1.00 0.00 ? 5  HIS B HB2  9  
ATOM 6651  H HB3  . HIS B 2 5  ? 8.907   5.378   -0.986  1.00 0.00 ? 5  HIS B HB3  9  
ATOM 6652  H HD1  . HIS B 2 5  ? 9.848   3.650   1.291   1.00 0.00 ? 5  HIS B HD1  9  
ATOM 6653  H HD2  . HIS B 2 5  ? 12.505  5.346   -1.435  1.00 0.00 ? 5  HIS B HD2  9  
ATOM 6654  H HE1  . HIS B 2 5  ? 12.105  3.725   2.439   1.00 0.00 ? 5  HIS B HE1  9  
ATOM 6655  N N    . LEU B 2 6  ? 6.448   3.413   -1.533  1.00 0.00 ? 6  LEU B N    9  
ATOM 6656  C CA   . LEU B 2 6  ? 5.163   3.499   -2.284  1.00 0.00 ? 6  LEU B CA   9  
ATOM 6657  C C    . LEU B 2 6  ? 4.470   4.834   -2.002  1.00 0.00 ? 6  LEU B C    9  
ATOM 6658  O O    . LEU B 2 6  ? 3.845   5.013   -0.976  1.00 0.00 ? 6  LEU B O    9  
ATOM 6659  C CB   . LEU B 2 6  ? 4.249   2.356   -1.844  1.00 0.00 ? 6  LEU B CB   9  
ATOM 6660  C CG   . LEU B 2 6  ? 5.060   1.061   -1.752  1.00 0.00 ? 6  LEU B CG   9  
ATOM 6661  C CD1  . LEU B 2 6  ? 4.279   0.026   -0.940  1.00 0.00 ? 6  LEU B CD1  9  
ATOM 6662  C CD2  . LEU B 2 6  ? 5.315   0.515   -3.161  1.00 0.00 ? 6  LEU B CD2  9  
ATOM 6663  H H    . LEU B 2 6  ? 6.442   3.371   -0.555  1.00 0.00 ? 6  LEU B H    9  
ATOM 6664  H HA   . LEU B 2 6  ? 5.358   3.414   -3.341  1.00 0.00 ? 6  LEU B HA   9  
ATOM 6665  H HB2  . LEU B 2 6  ? 3.826   2.586   -0.877  1.00 0.00 ? 6  LEU B HB2  9  
ATOM 6666  H HB3  . LEU B 2 6  ? 3.456   2.230   -2.565  1.00 0.00 ? 6  LEU B HB3  9  
ATOM 6667  H HG   . LEU B 2 6  ? 6.004   1.260   -1.265  1.00 0.00 ? 6  LEU B HG   9  
ATOM 6668  H HD11 . LEU B 2 6  ? 3.663   0.530   -0.211  1.00 0.00 ? 6  LEU B HD11 9  
ATOM 6669  H HD12 . LEU B 2 6  ? 3.650   -0.552  -1.603  1.00 0.00 ? 6  LEU B HD12 9  
ATOM 6670  H HD13 . LEU B 2 6  ? 4.970   -0.633  -0.436  1.00 0.00 ? 6  LEU B HD13 9  
ATOM 6671  H HD21 . LEU B 2 6  ? 4.728   1.074   -3.874  1.00 0.00 ? 6  LEU B HD21 9  
ATOM 6672  H HD22 . LEU B 2 6  ? 6.363   0.613   -3.401  1.00 0.00 ? 6  LEU B HD22 9  
ATOM 6673  H HD23 . LEU B 2 6  ? 5.033   -0.527  -3.198  1.00 0.00 ? 6  LEU B HD23 9  
ATOM 6674  N N    . CYS B 2 7  ? 4.564   5.765   -2.910  1.00 0.00 ? 7  CYS B N    9  
ATOM 6675  C CA   . CYS B 2 7  ? 3.898   7.082   -2.699  1.00 0.00 ? 7  CYS B CA   9  
ATOM 6676  C C    . CYS B 2 7  ? 2.962   7.374   -3.872  1.00 0.00 ? 7  CYS B C    9  
ATOM 6677  O O    . CYS B 2 7  ? 3.388   7.495   -5.003  1.00 0.00 ? 7  CYS B O    9  
ATOM 6678  C CB   . CYS B 2 7  ? 4.950   8.182   -2.606  1.00 0.00 ? 7  CYS B CB   9  
ATOM 6679  S SG   . CYS B 2 7  ? 4.845   8.976   -0.982  1.00 0.00 ? 7  CYS B SG   9  
ATOM 6680  H H    . CYS B 2 7  ? 5.063   5.596   -3.736  1.00 0.00 ? 7  CYS B H    9  
ATOM 6681  H HA   . CYS B 2 7  ? 3.331   7.057   -1.787  1.00 0.00 ? 7  CYS B HA   9  
ATOM 6682  H HB2  . CYS B 2 7  ? 5.934   7.757   -2.739  1.00 0.00 ? 7  CYS B HB2  9  
ATOM 6683  H HB3  . CYS B 2 7  ? 4.766   8.911   -3.372  1.00 0.00 ? 7  CYS B HB3  9  
ATOM 6684  N N    . GLY B 2 8  ? 1.689   7.492   -3.610  1.00 0.00 ? 8  GLY B N    9  
ATOM 6685  C CA   . GLY B 2 8  ? 0.726   7.779   -4.710  1.00 0.00 ? 8  GLY B CA   9  
ATOM 6686  C C    . GLY B 2 8  ? 0.147   6.466   -5.242  1.00 0.00 ? 8  GLY B C    9  
ATOM 6687  O O    . GLY B 2 8  ? -0.079  5.530   -4.500  1.00 0.00 ? 8  GLY B O    9  
ATOM 6688  H H    . GLY B 2 8  ? 1.367   7.394   -2.690  1.00 0.00 ? 8  GLY B H    9  
ATOM 6689  H HA2  . GLY B 2 8  ? -0.076  8.398   -4.331  1.00 0.00 ? 8  GLY B HA2  9  
ATOM 6690  H HA3  . GLY B 2 8  ? 1.234   8.295   -5.509  1.00 0.00 ? 8  GLY B HA3  9  
ATOM 6691  N N    . SER B 2 9  ? -0.095  6.391   -6.522  1.00 0.00 ? 9  SER B N    9  
ATOM 6692  C CA   . SER B 2 9  ? -0.662  5.139   -7.103  1.00 0.00 ? 9  SER B CA   9  
ATOM 6693  C C    . SER B 2 9  ? 0.319   3.985   -6.889  1.00 0.00 ? 9  SER B C    9  
ATOM 6694  O O    . SER B 2 9  ? -0.041  2.829   -6.985  1.00 0.00 ? 9  SER B O    9  
ATOM 6695  C CB   . SER B 2 9  ? -0.896  5.337   -8.600  1.00 0.00 ? 9  SER B CB   9  
ATOM 6696  O OG   . SER B 2 9  ? 0.332   5.688   -9.227  1.00 0.00 ? 9  SER B OG   9  
ATOM 6697  H H    . SER B 2 9  ? 0.093   7.159   -7.102  1.00 0.00 ? 9  SER B H    9  
ATOM 6698  H HA   . SER B 2 9  ? -1.599  4.911   -6.619  1.00 0.00 ? 9  SER B HA   9  
ATOM 6699  H HB2  . SER B 2 9  ? -1.265  4.421   -9.032  1.00 0.00 ? 9  SER B HB2  9  
ATOM 6700  H HB3  . SER B 2 9  ? -1.626  6.123   -8.749  1.00 0.00 ? 9  SER B HB3  9  
ATOM 6701  H HG   . SER B 2 9  ? 0.133   6.010   -10.108 1.00 0.00 ? 9  SER B HG   9  
ATOM 6702  N N    . HIS B 2 10 ? 1.554   4.285   -6.597  1.00 0.00 ? 10 HIS B N    9  
ATOM 6703  C CA   . HIS B 2 10 ? 2.549   3.197   -6.378  1.00 0.00 ? 10 HIS B CA   9  
ATOM 6704  C C    . HIS B 2 10 ? 2.057   2.277   -5.262  1.00 0.00 ? 10 HIS B C    9  
ATOM 6705  O O    . HIS B 2 10 ? 2.079   1.069   -5.388  1.00 0.00 ? 10 HIS B O    9  
ATOM 6706  C CB   . HIS B 2 10 ? 3.895   3.806   -5.982  1.00 0.00 ? 10 HIS B CB   9  
ATOM 6707  C CG   . HIS B 2 10 ? 4.623   4.259   -7.216  1.00 0.00 ? 10 HIS B CG   9  
ATOM 6708  N ND1  . HIS B 2 10 ? 4.075   4.144   -8.484  1.00 0.00 ? 10 HIS B ND1  9  
ATOM 6709  C CD2  . HIS B 2 10 ? 5.861   4.828   -7.395  1.00 0.00 ? 10 HIS B CD2  9  
ATOM 6710  C CE1  . HIS B 2 10 ? 4.970   4.630   -9.361  1.00 0.00 ? 10 HIS B CE1  9  
ATOM 6711  N NE2  . HIS B 2 10 ? 6.077   5.061   -8.750  1.00 0.00 ? 10 HIS B NE2  9  
ATOM 6712  H H    . HIS B 2 10 ? 1.828   5.223   -6.524  1.00 0.00 ? 10 HIS B H    9  
ATOM 6713  H HA   . HIS B 2 10 ? 2.667   2.627   -7.289  1.00 0.00 ? 10 HIS B HA   9  
ATOM 6714  H HB2  . HIS B 2 10 ? 3.731   4.651   -5.328  1.00 0.00 ? 10 HIS B HB2  9  
ATOM 6715  H HB3  . HIS B 2 10 ? 4.488   3.064   -5.466  1.00 0.00 ? 10 HIS B HB3  9  
ATOM 6716  H HD1  . HIS B 2 10 ? 3.192   3.775   -8.700  1.00 0.00 ? 10 HIS B HD1  9  
ATOM 6717  H HD2  . HIS B 2 10 ? 6.560   5.059   -6.605  1.00 0.00 ? 10 HIS B HD2  9  
ATOM 6718  H HE1  . HIS B 2 10 ? 4.812   4.669   -10.428 1.00 0.00 ? 10 HIS B HE1  9  
ATOM 6719  N N    . LEU B 2 11 ? 1.612   2.833   -4.169  1.00 0.00 ? 11 LEU B N    9  
ATOM 6720  C CA   . LEU B 2 11 ? 1.117   1.979   -3.055  1.00 0.00 ? 11 LEU B CA   9  
ATOM 6721  C C    . LEU B 2 11 ? -0.133  1.234   -3.513  1.00 0.00 ? 11 LEU B C    9  
ATOM 6722  O O    . LEU B 2 11 ? -0.399  0.128   -3.086  1.00 0.00 ? 11 LEU B O    9  
ATOM 6723  C CB   . LEU B 2 11 ? 0.784   2.848   -1.841  1.00 0.00 ? 11 LEU B CB   9  
ATOM 6724  C CG   . LEU B 2 11 ? 1.383   2.209   -0.588  1.00 0.00 ? 11 LEU B CG   9  
ATOM 6725  C CD1  . LEU B 2 11 ? 1.832   3.304   0.381   1.00 0.00 ? 11 LEU B CD1  9  
ATOM 6726  C CD2  . LEU B 2 11 ? 0.329   1.324   0.085   1.00 0.00 ? 11 LEU B CD2  9  
ATOM 6727  H H    . LEU B 2 11 ? 1.600   3.810   -4.084  1.00 0.00 ? 11 LEU B H    9  
ATOM 6728  H HA   . LEU B 2 11 ? 1.880   1.263   -2.787  1.00 0.00 ? 11 LEU B HA   9  
ATOM 6729  H HB2  . LEU B 2 11 ? 1.201   3.836   -1.980  1.00 0.00 ? 11 LEU B HB2  9  
ATOM 6730  H HB3  . LEU B 2 11 ? -0.287  2.919   -1.730  1.00 0.00 ? 11 LEU B HB3  9  
ATOM 6731  H HG   . LEU B 2 11 ? 2.236   1.605   -0.866  1.00 0.00 ? 11 LEU B HG   9  
ATOM 6732  H HD11 . LEU B 2 11 ? 2.077   4.196   -0.174  1.00 0.00 ? 11 LEU B HD11 9  
ATOM 6733  H HD12 . LEU B 2 11 ? 1.034   3.518   1.077   1.00 0.00 ? 11 LEU B HD12 9  
ATOM 6734  H HD13 . LEU B 2 11 ? 2.703   2.968   0.924   1.00 0.00 ? 11 LEU B HD13 9  
ATOM 6735  H HD21 . LEU B 2 11 ? -0.300  0.879   -0.668  1.00 0.00 ? 11 LEU B HD21 9  
ATOM 6736  H HD22 . LEU B 2 11 ? 0.820   0.545   0.651   1.00 0.00 ? 11 LEU B HD22 9  
ATOM 6737  H HD23 . LEU B 2 11 ? -0.274  1.924   0.749   1.00 0.00 ? 11 LEU B HD23 9  
ATOM 6738  N N    . VAL B 2 12 ? -0.899  1.823   -4.389  1.00 0.00 ? 12 VAL B N    9  
ATOM 6739  C CA   . VAL B 2 12 ? -2.123  1.136   -4.884  1.00 0.00 ? 12 VAL B CA   9  
ATOM 6740  C C    . VAL B 2 12 ? -1.697  -0.104  -5.671  1.00 0.00 ? 12 VAL B C    9  
ATOM 6741  O O    . VAL B 2 12 ? -2.455  -1.039  -5.843  1.00 0.00 ? 12 VAL B O    9  
ATOM 6742  C CB   . VAL B 2 12 ? -2.910  2.080   -5.794  1.00 0.00 ? 12 VAL B CB   9  
ATOM 6743  C CG1  . VAL B 2 12 ? -3.967  1.285   -6.563  1.00 0.00 ? 12 VAL B CG1  9  
ATOM 6744  C CG2  . VAL B 2 12 ? -3.599  3.150   -4.945  1.00 0.00 ? 12 VAL B CG2  9  
ATOM 6745  H H    . VAL B 2 12 ? -0.663  2.711   -4.730  1.00 0.00 ? 12 VAL B H    9  
ATOM 6746  H HA   . VAL B 2 12 ? -2.736  0.840   -4.046  1.00 0.00 ? 12 VAL B HA   9  
ATOM 6747  H HB   . VAL B 2 12 ? -2.236  2.551   -6.495  1.00 0.00 ? 12 VAL B HB   9  
ATOM 6748  H HG11 . VAL B 2 12 ? -4.211  0.386   -6.016  1.00 0.00 ? 12 VAL B HG11 9  
ATOM 6749  H HG12 . VAL B 2 12 ? -4.856  1.887   -6.677  1.00 0.00 ? 12 VAL B HG12 9  
ATOM 6750  H HG13 . VAL B 2 12 ? -3.582  1.022   -7.537  1.00 0.00 ? 12 VAL B HG13 9  
ATOM 6751  H HG21 . VAL B 2 12 ? -3.857  2.734   -3.981  1.00 0.00 ? 12 VAL B HG21 9  
ATOM 6752  H HG22 . VAL B 2 12 ? -2.930  3.987   -4.809  1.00 0.00 ? 12 VAL B HG22 9  
ATOM 6753  H HG23 . VAL B 2 12 ? -4.496  3.483   -5.443  1.00 0.00 ? 12 VAL B HG23 9  
ATOM 6754  N N    . GLU B 2 13 ? -0.481  -0.116  -6.144  1.00 0.00 ? 13 GLU B N    9  
ATOM 6755  C CA   . GLU B 2 13 ? 0.015   -1.289  -6.915  1.00 0.00 ? 13 GLU B CA   9  
ATOM 6756  C C    . GLU B 2 13 ? 0.373   -2.415  -5.941  1.00 0.00 ? 13 GLU B C    9  
ATOM 6757  O O    . GLU B 2 13 ? 0.401   -3.575  -6.299  1.00 0.00 ? 13 GLU B O    9  
ATOM 6758  C CB   . GLU B 2 13 ? 1.256   -0.884  -7.714  1.00 0.00 ? 13 GLU B CB   9  
ATOM 6759  C CG   . GLU B 2 13 ? 0.830   -0.112  -8.963  1.00 0.00 ? 13 GLU B CG   9  
ATOM 6760  C CD   . GLU B 2 13 ? 0.500   -1.096  -10.086 1.00 0.00 ? 13 GLU B CD   9  
ATOM 6761  O OE1  . GLU B 2 13 ? -0.641  -1.522  -10.160 1.00 0.00 ? 13 GLU B OE1  9  
ATOM 6762  O OE2  . GLU B 2 13 ? 1.396   -1.410  -10.855 1.00 0.00 ? 13 GLU B OE2  9  
ATOM 6763  H H    . GLU B 2 13 ? 0.112   0.649   -5.986  1.00 0.00 ? 13 GLU B H    9  
ATOM 6764  H HA   . GLU B 2 13 ? -0.754  -1.630  -7.591  1.00 0.00 ? 13 GLU B HA   9  
ATOM 6765  H HB2  . GLU B 2 13 ? 1.891   -0.259  -7.101  1.00 0.00 ? 13 GLU B HB2  9  
ATOM 6766  H HB3  . GLU B 2 13 ? 1.801   -1.768  -8.008  1.00 0.00 ? 13 GLU B HB3  9  
ATOM 6767  H HG2  . GLU B 2 13 ? -0.043  0.482   -8.737  1.00 0.00 ? 13 GLU B HG2  9  
ATOM 6768  H HG3  . GLU B 2 13 ? 1.633   0.535   -9.278  1.00 0.00 ? 13 GLU B HG3  9  
ATOM 6769  N N    . ALA B 2 14 ? 0.638   -2.076  -4.709  1.00 0.00 ? 14 ALA B N    9  
ATOM 6770  C CA   . ALA B 2 14 ? 0.984   -3.121  -3.704  1.00 0.00 ? 14 ALA B CA   9  
ATOM 6771  C C    . ALA B 2 14 ? -0.248  -3.424  -2.849  1.00 0.00 ? 14 ALA B C    9  
ATOM 6772  O O    . ALA B 2 14 ? -0.304  -4.419  -2.156  1.00 0.00 ? 14 ALA B O    9  
ATOM 6773  C CB   . ALA B 2 14 ? 2.115   -2.612  -2.807  1.00 0.00 ? 14 ALA B CB   9  
ATOM 6774  H H    . ALA B 2 14 ? 0.602   -1.132  -4.442  1.00 0.00 ? 14 ALA B H    9  
ATOM 6775  H HA   . ALA B 2 14 ? 1.301   -4.018  -4.212  1.00 0.00 ? 14 ALA B HA   9  
ATOM 6776  H HB1  . ALA B 2 14 ? 2.948   -2.300  -3.419  1.00 0.00 ? 14 ALA B HB1  9  
ATOM 6777  H HB2  . ALA B 2 14 ? 1.764   -1.774  -2.223  1.00 0.00 ? 14 ALA B HB2  9  
ATOM 6778  H HB3  . ALA B 2 14 ? 2.431   -3.403  -2.144  1.00 0.00 ? 14 ALA B HB3  9  
ATOM 6779  N N    . LEU B 2 15 ? -1.236  -2.572  -2.895  1.00 0.00 ? 15 LEU B N    9  
ATOM 6780  C CA   . LEU B 2 15 ? -2.465  -2.809  -2.088  1.00 0.00 ? 15 LEU B CA   9  
ATOM 6781  C C    . LEU B 2 15 ? -3.383  -3.776  -2.837  1.00 0.00 ? 15 LEU B C    9  
ATOM 6782  O O    . LEU B 2 15 ? -3.914  -4.710  -2.268  1.00 0.00 ? 15 LEU B O    9  
ATOM 6783  C CB   . LEU B 2 15 ? -3.192  -1.482  -1.860  1.00 0.00 ? 15 LEU B CB   9  
ATOM 6784  C CG   . LEU B 2 15 ? -2.458  -0.690  -0.777  1.00 0.00 ? 15 LEU B CG   9  
ATOM 6785  C CD1  . LEU B 2 15 ? -3.236  0.587   -0.451  1.00 0.00 ? 15 LEU B CD1  9  
ATOM 6786  C CD2  . LEU B 2 15 ? -2.337  -1.548  0.484   1.00 0.00 ? 15 LEU B CD2  9  
ATOM 6787  H H    . LEU B 2 15 ? -1.171  -1.776  -3.463  1.00 0.00 ? 15 LEU B H    9  
ATOM 6788  H HA   . LEU B 2 15 ? -2.189  -3.235  -1.134  1.00 0.00 ? 15 LEU B HA   9  
ATOM 6789  H HB2  . LEU B 2 15 ? -3.202  -0.913  -2.779  1.00 0.00 ? 15 LEU B HB2  9  
ATOM 6790  H HB3  . LEU B 2 15 ? -4.204  -1.674  -1.540  1.00 0.00 ? 15 LEU B HB3  9  
ATOM 6791  H HG   . LEU B 2 15 ? -1.473  -0.432  -1.133  1.00 0.00 ? 15 LEU B HG   9  
ATOM 6792  H HD11 . LEU B 2 15 ? -4.292  0.368   -0.423  1.00 0.00 ? 15 LEU B HD11 9  
ATOM 6793  H HD12 . LEU B 2 15 ? -2.920  0.966   0.511   1.00 0.00 ? 15 LEU B HD12 9  
ATOM 6794  H HD13 . LEU B 2 15 ? -3.041  1.329   -1.212  1.00 0.00 ? 15 LEU B HD13 9  
ATOM 6795  H HD21 . LEU B 2 15 ? -2.988  -2.406  0.397   1.00 0.00 ? 15 LEU B HD21 9  
ATOM 6796  H HD22 . LEU B 2 15 ? -1.317  -1.882  0.594   1.00 0.00 ? 15 LEU B HD22 9  
ATOM 6797  H HD23 . LEU B 2 15 ? -2.621  -0.963  1.345   1.00 0.00 ? 15 LEU B HD23 9  
ATOM 6798  N N    . HIS B 2 16 ? -3.572  -3.562  -4.111  1.00 0.00 ? 16 HIS B N    9  
ATOM 6799  C CA   . HIS B 2 16 ? -4.451  -4.477  -4.894  1.00 0.00 ? 16 HIS B CA   9  
ATOM 6800  C C    . HIS B 2 16 ? -3.796  -5.858  -4.965  1.00 0.00 ? 16 HIS B C    9  
ATOM 6801  O O    . HIS B 2 16 ? -4.460  -6.875  -4.941  1.00 0.00 ? 16 HIS B O    9  
ATOM 6802  C CB   . HIS B 2 16 ? -4.651  -3.909  -6.309  1.00 0.00 ? 16 HIS B CB   9  
ATOM 6803  C CG   . HIS B 2 16 ? -3.490  -4.282  -7.192  1.00 0.00 ? 16 HIS B CG   9  
ATOM 6804  N ND1  . HIS B 2 16 ? -3.642  -5.069  -8.322  1.00 0.00 ? 16 HIS B ND1  9  
ATOM 6805  C CD2  . HIS B 2 16 ? -2.155  -3.983  -7.121  1.00 0.00 ? 16 HIS B CD2  9  
ATOM 6806  C CE1  . HIS B 2 16 ? -2.425  -5.216  -8.882  1.00 0.00 ? 16 HIS B CE1  9  
ATOM 6807  N NE2  . HIS B 2 16 ? -1.482  -4.573  -8.187  1.00 0.00 ? 16 HIS B NE2  9  
ATOM 6808  H H    . HIS B 2 16 ? -3.132  -2.807  -4.552  1.00 0.00 ? 16 HIS B H    9  
ATOM 6809  H HA   . HIS B 2 16 ? -5.408  -4.559  -4.402  1.00 0.00 ? 16 HIS B HA   9  
ATOM 6810  H HB2  . HIS B 2 16 ? -5.561  -4.306  -6.729  1.00 0.00 ? 16 HIS B HB2  9  
ATOM 6811  H HB3  . HIS B 2 16 ? -4.721  -2.833  -6.254  1.00 0.00 ? 16 HIS B HB3  9  
ATOM 6812  H HD1  . HIS B 2 16 ? -4.480  -5.448  -8.656  1.00 0.00 ? 16 HIS B HD1  9  
ATOM 6813  H HD2  . HIS B 2 16 ? -1.696  -3.384  -6.351  1.00 0.00 ? 16 HIS B HD2  9  
ATOM 6814  H HE1  . HIS B 2 16 ? -2.235  -5.785  -9.779  1.00 0.00 ? 16 HIS B HE1  9  
ATOM 6815  N N    . LEU B 2 17 ? -2.495  -5.898  -5.048  1.00 0.00 ? 17 LEU B N    9  
ATOM 6816  C CA   . LEU B 2 17 ? -1.789  -7.206  -5.115  1.00 0.00 ? 17 LEU B CA   9  
ATOM 6817  C C    . LEU B 2 17 ? -2.142  -8.024  -3.875  1.00 0.00 ? 17 LEU B C    9  
ATOM 6818  O O    . LEU B 2 17 ? -2.325  -9.223  -3.939  1.00 0.00 ? 17 LEU B O    9  
ATOM 6819  C CB   . LEU B 2 17 ? -0.280  -6.963  -5.157  1.00 0.00 ? 17 LEU B CB   9  
ATOM 6820  C CG   . LEU B 2 17 ? 0.450   -8.291  -5.351  1.00 0.00 ? 17 LEU B CG   9  
ATOM 6821  C CD1  . LEU B 2 17 ? -0.058  -8.978  -6.621  1.00 0.00 ? 17 LEU B CD1  9  
ATOM 6822  C CD2  . LEU B 2 17 ? 1.951   -8.025  -5.483  1.00 0.00 ? 17 LEU B CD2  9  
ATOM 6823  H H    . LEU B 2 17 ? -1.979  -5.062  -5.060  1.00 0.00 ? 17 LEU B H    9  
ATOM 6824  H HA   . LEU B 2 17 ? -2.097  -7.738  -6.002  1.00 0.00 ? 17 LEU B HA   9  
ATOM 6825  H HB2  . LEU B 2 17 ? -0.045  -6.299  -5.976  1.00 0.00 ? 17 LEU B HB2  9  
ATOM 6826  H HB3  . LEU B 2 17 ? 0.039   -6.514  -4.228  1.00 0.00 ? 17 LEU B HB3  9  
ATOM 6827  H HG   . LEU B 2 17 ? 0.269   -8.931  -4.499  1.00 0.00 ? 17 LEU B HG   9  
ATOM 6828  H HD11 . LEU B 2 17 ? -0.003  -8.288  -7.451  1.00 0.00 ? 17 LEU B HD11 9  
ATOM 6829  H HD12 . LEU B 2 17 ? 0.551   -9.845  -6.831  1.00 0.00 ? 17 LEU B HD12 9  
ATOM 6830  H HD13 . LEU B 2 17 ? -1.083  -9.286  -6.477  1.00 0.00 ? 17 LEU B HD13 9  
ATOM 6831  H HD21 . LEU B 2 17 ? 2.250   -7.290  -4.752  1.00 0.00 ? 17 LEU B HD21 9  
ATOM 6832  H HD22 . LEU B 2 17 ? 2.495   -8.943  -5.317  1.00 0.00 ? 17 LEU B HD22 9  
ATOM 6833  H HD23 . LEU B 2 17 ? 2.163   -7.654  -6.475  1.00 0.00 ? 17 LEU B HD23 9  
ATOM 6834  N N    . VAL B 2 18 ? -2.249  -7.381  -2.744  1.00 0.00 ? 18 VAL B N    9  
ATOM 6835  C CA   . VAL B 2 18 ? -2.599  -8.114  -1.500  1.00 0.00 ? 18 VAL B CA   9  
ATOM 6836  C C    . VAL B 2 18 ? -4.090  -8.456  -1.525  1.00 0.00 ? 18 VAL B C    9  
ATOM 6837  O O    . VAL B 2 18 ? -4.518  -9.458  -0.987  1.00 0.00 ? 18 VAL B O    9  
ATOM 6838  C CB   . VAL B 2 18 ? -2.294  -7.232  -0.286  1.00 0.00 ? 18 VAL B CB   9  
ATOM 6839  C CG1  . VAL B 2 18 ? -2.545  -8.026  0.996   1.00 0.00 ? 18 VAL B CG1  9  
ATOM 6840  C CG2  . VAL B 2 18 ? -0.831  -6.789  -0.333  1.00 0.00 ? 18 VAL B CG2  9  
ATOM 6841  H H    . VAL B 2 18 ? -2.103  -6.412  -2.718  1.00 0.00 ? 18 VAL B H    9  
ATOM 6842  H HA   . VAL B 2 18 ? -2.020  -9.024  -1.442  1.00 0.00 ? 18 VAL B HA   9  
ATOM 6843  H HB   . VAL B 2 18 ? -2.937  -6.363  -0.302  1.00 0.00 ? 18 VAL B HB   9  
ATOM 6844  H HG11 . VAL B 2 18 ? -3.242  -8.826  0.795   1.00 0.00 ? 18 VAL B HG11 9  
ATOM 6845  H HG12 . VAL B 2 18 ? -1.612  -8.442  1.350   1.00 0.00 ? 18 VAL B HG12 9  
ATOM 6846  H HG13 . VAL B 2 18 ? -2.955  -7.371  1.751   1.00 0.00 ? 18 VAL B HG13 9  
ATOM 6847  H HG21 . VAL B 2 18 ? -0.479  -6.814  -1.354  1.00 0.00 ? 18 VAL B HG21 9  
ATOM 6848  H HG22 . VAL B 2 18 ? -0.746  -5.784  0.052   1.00 0.00 ? 18 VAL B HG22 9  
ATOM 6849  H HG23 . VAL B 2 18 ? -0.233  -7.458  0.269   1.00 0.00 ? 18 VAL B HG23 9  
ATOM 6850  N N    . CYS B 2 19 ? -4.884  -7.628  -2.149  1.00 0.00 ? 19 CYS B N    9  
ATOM 6851  C CA   . CYS B 2 19 ? -6.348  -7.901  -2.218  1.00 0.00 ? 19 CYS B CA   9  
ATOM 6852  C C    . CYS B 2 19 ? -6.698  -8.422  -3.616  1.00 0.00 ? 19 CYS B C    9  
ATOM 6853  O O    . CYS B 2 19 ? -6.498  -9.582  -3.919  1.00 0.00 ? 19 CYS B O    9  
ATOM 6854  C CB   . CYS B 2 19 ? -7.118  -6.610  -1.926  1.00 0.00 ? 19 CYS B CB   9  
ATOM 6855  S SG   . CYS B 2 19 ? -6.728  -6.044  -0.250  1.00 0.00 ? 19 CYS B SG   9  
ATOM 6856  H H    . CYS B 2 19 ? -4.515  -6.828  -2.578  1.00 0.00 ? 19 CYS B H    9  
ATOM 6857  H HA   . CYS B 2 19 ? -6.607  -8.649  -1.481  1.00 0.00 ? 19 CYS B HA   9  
ATOM 6858  H HB2  . CYS B 2 19 ? -6.830  -5.850  -2.637  1.00 0.00 ? 19 CYS B HB2  9  
ATOM 6859  H HB3  . CYS B 2 19 ? -8.178  -6.797  -2.006  1.00 0.00 ? 19 CYS B HB3  9  
ATOM 6860  N N    . GLY B 2 20 ? -7.208  -7.580  -4.480  1.00 0.00 ? 20 GLY B N    9  
ATOM 6861  C CA   . GLY B 2 20 ? -7.551  -8.047  -5.855  1.00 0.00 ? 20 GLY B CA   9  
ATOM 6862  C C    . GLY B 2 20 ? -9.051  -8.313  -5.965  1.00 0.00 ? 20 GLY B C    9  
ATOM 6863  O O    . GLY B 2 20 ? -9.857  -7.402  -5.975  1.00 0.00 ? 20 GLY B O    9  
ATOM 6864  H H    . GLY B 2 20 ? -7.357  -6.646  -4.229  1.00 0.00 ? 20 GLY B H    9  
ATOM 6865  H HA2  . GLY B 2 20 ? -7.268  -7.292  -6.571  1.00 0.00 ? 20 GLY B HA2  9  
ATOM 6866  H HA3  . GLY B 2 20 ? -7.012  -8.958  -6.066  1.00 0.00 ? 20 GLY B HA3  9  
ATOM 6867  N N    . GLU B 2 21 ? -9.426  -9.557  -6.064  1.00 0.00 ? 21 GLU B N    9  
ATOM 6868  C CA   . GLU B 2 21 ? -10.871 -9.906  -6.189  1.00 0.00 ? 21 GLU B CA   9  
ATOM 6869  C C    . GLU B 2 21 ? -11.706 -9.020  -5.264  1.00 0.00 ? 21 GLU B C    9  
ATOM 6870  O O    . GLU B 2 21 ? -12.447 -8.166  -5.709  1.00 0.00 ? 21 GLU B O    9  
ATOM 6871  C CB   . GLU B 2 21 ? -11.073 -11.374 -5.806  1.00 0.00 ? 21 GLU B CB   9  
ATOM 6872  C CG   . GLU B 2 21 ? -11.392 -12.190 -7.061  1.00 0.00 ? 21 GLU B CG   9  
ATOM 6873  C CD   . GLU B 2 21 ? -11.704 -13.635 -6.666  1.00 0.00 ? 21 GLU B CD   9  
ATOM 6874  O OE1  . GLU B 2 21 ? -10.792 -14.320 -6.231  1.00 0.00 ? 21 GLU B OE1  9  
ATOM 6875  O OE2  . GLU B 2 21 ? -12.849 -14.032 -6.804  1.00 0.00 ? 21 GLU B OE2  9  
ATOM 6876  H H    . GLU B 2 21 ? -8.753  -10.265 -6.061  1.00 0.00 ? 21 GLU B H    9  
ATOM 6877  H HA   . GLU B 2 21 ? -11.189 -9.757  -7.210  1.00 0.00 ? 21 GLU B HA   9  
ATOM 6878  H HB2  . GLU B 2 21 ? -10.173 -11.753 -5.348  1.00 0.00 ? 21 GLU B HB2  9  
ATOM 6879  H HB3  . GLU B 2 21 ? -11.894 -11.455 -5.110  1.00 0.00 ? 21 GLU B HB3  9  
ATOM 6880  H HG2  . GLU B 2 21 ? -12.247 -11.759 -7.561  1.00 0.00 ? 21 GLU B HG2  9  
ATOM 6881  H HG3  . GLU B 2 21 ? -10.541 -12.176 -7.724  1.00 0.00 ? 21 GLU B HG3  9  
ATOM 6882  N N    . ARG B 2 22 ? -11.597 -9.215  -3.979  1.00 0.00 ? 22 ARG B N    9  
ATOM 6883  C CA   . ARG B 2 22 ? -12.390 -8.381  -3.034  1.00 0.00 ? 22 ARG B CA   9  
ATOM 6884  C C    . ARG B 2 22 ? -12.151 -6.903  -3.346  1.00 0.00 ? 22 ARG B C    9  
ATOM 6885  O O    . ARG B 2 22 ? -13.075 -6.160  -3.612  1.00 0.00 ? 22 ARG B O    9  
ATOM 6886  C CB   . ARG B 2 22 ? -11.957 -8.681  -1.596  1.00 0.00 ? 22 ARG B CB   9  
ATOM 6887  C CG   . ARG B 2 22 ? -12.459 -10.068 -1.188  1.00 0.00 ? 22 ARG B CG   9  
ATOM 6888  C CD   . ARG B 2 22 ? -13.944 -10.198 -1.533  1.00 0.00 ? 22 ARG B CD   9  
ATOM 6889  N NE   . ARG B 2 22 ? -14.652 -10.916 -0.436  1.00 0.00 ? 22 ARG B NE   9  
ATOM 6890  C CZ   . ARG B 2 22 ? -15.956 -10.882 -0.367  1.00 0.00 ? 22 ARG B CZ   9  
ATOM 6891  N NH1  . ARG B 2 22 ? -16.644 -10.219 -1.255  1.00 0.00 ? 22 ARG B NH1  9  
ATOM 6892  N NH2  . ARG B 2 22 ? -16.574 -11.513 0.594   1.00 0.00 ? 22 ARG B NH2  9  
ATOM 6893  H H    . ARG B 2 22 ? -10.995 -9.911  -3.638  1.00 0.00 ? 22 ARG B H    9  
ATOM 6894  H HA   . ARG B 2 22 ? -13.439 -8.607  -3.149  1.00 0.00 ? 22 ARG B HA   9  
ATOM 6895  H HB2  . ARG B 2 22 ? -10.879 -8.653  -1.533  1.00 0.00 ? 22 ARG B HB2  9  
ATOM 6896  H HB3  . ARG B 2 22 ? -12.377 -7.939  -0.934  1.00 0.00 ? 22 ARG B HB3  9  
ATOM 6897  H HG2  . ARG B 2 22 ? -11.896 -10.824 -1.719  1.00 0.00 ? 22 ARG B HG2  9  
ATOM 6898  H HG3  . ARG B 2 22 ? -12.325 -10.200 -0.126  1.00 0.00 ? 22 ARG B HG3  9  
ATOM 6899  H HD2  . ARG B 2 22 ? -14.372 -9.215  -1.655  1.00 0.00 ? 22 ARG B HD2  9  
ATOM 6900  H HD3  . ARG B 2 22 ? -14.051 -10.754 -2.455  1.00 0.00 ? 22 ARG B HD3  9  
ATOM 6901  H HE   . ARG B 2 22 ? -14.139 -11.415 0.233   1.00 0.00 ? 22 ARG B HE   9  
ATOM 6902  H HH11 . ARG B 2 22 ? -16.176 -9.732  -1.992  1.00 0.00 ? 22 ARG B HH11 9  
ATOM 6903  H HH12 . ARG B 2 22 ? -17.642 -10.195 -1.201  1.00 0.00 ? 22 ARG B HH12 9  
ATOM 6904  H HH21 . ARG B 2 22 ? -16.049 -12.022 1.277   1.00 0.00 ? 22 ARG B HH21 9  
ATOM 6905  H HH22 . ARG B 2 22 ? -17.572 -11.489 0.649   1.00 0.00 ? 22 ARG B HH22 9  
ATOM 6906  N N    . GLY B 2 23 ? -10.922 -6.472  -3.317  1.00 0.00 ? 23 GLY B N    9  
ATOM 6907  C CA   . GLY B 2 23 ? -10.626 -5.042  -3.616  1.00 0.00 ? 23 GLY B CA   9  
ATOM 6908  C C    . GLY B 2 23 ? -10.031 -4.371  -2.377  1.00 0.00 ? 23 GLY B C    9  
ATOM 6909  O O    . GLY B 2 23 ? -9.944  -4.963  -1.321  1.00 0.00 ? 23 GLY B O    9  
ATOM 6910  H H    . GLY B 2 23 ? -10.191 -7.090  -3.101  1.00 0.00 ? 23 GLY B H    9  
ATOM 6911  H HA2  . GLY B 2 23 ? -9.921  -4.985  -4.432  1.00 0.00 ? 23 GLY B HA2  9  
ATOM 6912  H HA3  . GLY B 2 23 ? -11.538 -4.537  -3.892  1.00 0.00 ? 23 GLY B HA3  9  
ATOM 6913  N N    . PHE B 2 24 ? -9.622  -3.138  -2.501  1.00 0.00 ? 24 PHE B N    9  
ATOM 6914  C CA   . PHE B 2 24 ? -9.033  -2.428  -1.331  1.00 0.00 ? 24 PHE B CA   9  
ATOM 6915  C C    . PHE B 2 24 ? -9.434  -0.952  -1.377  1.00 0.00 ? 24 PHE B C    9  
ATOM 6916  O O    . PHE B 2 24 ? -9.556  -0.365  -2.433  1.00 0.00 ? 24 PHE B O    9  
ATOM 6917  C CB   . PHE B 2 24 ? -7.508  -2.549  -1.380  1.00 0.00 ? 24 PHE B CB   9  
ATOM 6918  C CG   . PHE B 2 24 ? -7.007  -2.041  -2.705  1.00 0.00 ? 24 PHE B CG   9  
ATOM 6919  C CD1  . PHE B 2 24 ? -7.142  -2.838  -3.842  1.00 0.00 ? 24 PHE B CD1  9  
ATOM 6920  C CD2  . PHE B 2 24 ? -6.410  -0.776  -2.802  1.00 0.00 ? 24 PHE B CD2  9  
ATOM 6921  C CE1  . PHE B 2 24 ? -6.680  -2.380  -5.080  1.00 0.00 ? 24 PHE B CE1  9  
ATOM 6922  C CE2  . PHE B 2 24 ? -5.948  -0.314  -4.040  1.00 0.00 ? 24 PHE B CE2  9  
ATOM 6923  C CZ   . PHE B 2 24 ? -6.084  -1.117  -5.181  1.00 0.00 ? 24 PHE B CZ   9  
ATOM 6924  H H    . PHE B 2 24 ? -9.703  -2.678  -3.362  1.00 0.00 ? 24 PHE B H    9  
ATOM 6925  H HA   . PHE B 2 24 ? -9.402  -2.873  -0.419  1.00 0.00 ? 24 PHE B HA   9  
ATOM 6926  H HB2  . PHE B 2 24 ? -7.074  -1.968  -0.580  1.00 0.00 ? 24 PHE B HB2  9  
ATOM 6927  H HB3  . PHE B 2 24 ? -7.228  -3.585  -1.269  1.00 0.00 ? 24 PHE B HB3  9  
ATOM 6928  H HD1  . PHE B 2 24 ? -7.601  -3.813  -3.759  1.00 0.00 ? 24 PHE B HD1  9  
ATOM 6929  H HD2  . PHE B 2 24 ? -6.305  -0.160  -1.922  1.00 0.00 ? 24 PHE B HD2  9  
ATOM 6930  H HE1  . PHE B 2 24 ? -6.785  -2.997  -5.959  1.00 0.00 ? 24 PHE B HE1  9  
ATOM 6931  H HE2  . PHE B 2 24 ? -5.488  0.659   -4.116  1.00 0.00 ? 24 PHE B HE2  9  
ATOM 6932  H HZ   . PHE B 2 24 ? -5.728  -0.761  -6.135  1.00 0.00 ? 24 PHE B HZ   9  
ATOM 6933  N N    . PHE B 2 25 ? -9.635  -0.345  -0.238  1.00 0.00 ? 25 PHE B N    9  
ATOM 6934  C CA   . PHE B 2 25 ? -10.025 1.092   -0.218  1.00 0.00 ? 25 PHE B CA   9  
ATOM 6935  C C    . PHE B 2 25 ? -8.797  1.946   0.099   1.00 0.00 ? 25 PHE B C    9  
ATOM 6936  O O    . PHE B 2 25 ? -8.517  2.246   1.244   1.00 0.00 ? 25 PHE B O    9  
ATOM 6937  C CB   . PHE B 2 25 ? -11.098 1.318   0.852   1.00 0.00 ? 25 PHE B CB   9  
ATOM 6938  C CG   . PHE B 2 25 ? -10.783 0.485   2.072   1.00 0.00 ? 25 PHE B CG   9  
ATOM 6939  C CD1  . PHE B 2 25 ? -11.275 -0.820  2.172   1.00 0.00 ? 25 PHE B CD1  9  
ATOM 6940  C CD2  . PHE B 2 25 ? -9.999  1.021   3.102   1.00 0.00 ? 25 PHE B CD2  9  
ATOM 6941  C CE1  . PHE B 2 25 ? -10.986 -1.592  3.304   1.00 0.00 ? 25 PHE B CE1  9  
ATOM 6942  C CE2  . PHE B 2 25 ? -9.710  0.248   4.233   1.00 0.00 ? 25 PHE B CE2  9  
ATOM 6943  C CZ   . PHE B 2 25 ? -10.203 -1.057  4.334   1.00 0.00 ? 25 PHE B CZ   9  
ATOM 6944  H H    . PHE B 2 25 ? -9.530  -0.838  0.603   1.00 0.00 ? 25 PHE B H    9  
ATOM 6945  H HA   . PHE B 2 25 ? -10.417 1.372   -1.185  1.00 0.00 ? 25 PHE B HA   9  
ATOM 6946  H HB2  . PHE B 2 25 ? -11.117 2.363   1.125   1.00 0.00 ? 25 PHE B HB2  9  
ATOM 6947  H HB3  . PHE B 2 25 ? -12.061 1.031   0.461   1.00 0.00 ? 25 PHE B HB3  9  
ATOM 6948  H HD1  . PHE B 2 25 ? -11.878 -1.234  1.377   1.00 0.00 ? 25 PHE B HD1  9  
ATOM 6949  H HD2  . PHE B 2 25 ? -9.619  2.028   3.024   1.00 0.00 ? 25 PHE B HD2  9  
ATOM 6950  H HE1  . PHE B 2 25 ? -11.366 -2.599  3.381   1.00 0.00 ? 25 PHE B HE1  9  
ATOM 6951  H HE2  . PHE B 2 25 ? -9.107  0.662   5.029   1.00 0.00 ? 25 PHE B HE2  9  
ATOM 6952  H HZ   . PHE B 2 25 ? -9.979  -1.652  5.207   1.00 0.00 ? 25 PHE B HZ   9  
ATOM 6953  N N    . TYR B 2 26 ? -8.060  2.340   -0.903  1.00 0.00 ? 26 TYR B N    9  
ATOM 6954  C CA   . TYR B 2 26 ? -6.850  3.172   -0.652  1.00 0.00 ? 26 TYR B CA   9  
ATOM 6955  C C    . TYR B 2 26 ? -7.280  4.570   -0.204  1.00 0.00 ? 26 TYR B C    9  
ATOM 6956  O O    . TYR B 2 26 ? -8.365  5.024   -0.506  1.00 0.00 ? 26 TYR B O    9  
ATOM 6957  C CB   . TYR B 2 26 ? -6.021  3.275   -1.935  1.00 0.00 ? 26 TYR B CB   9  
ATOM 6958  C CG   . TYR B 2 26 ? -4.643  3.803   -1.609  1.00 0.00 ? 26 TYR B CG   9  
ATOM 6959  C CD1  . TYR B 2 26 ? -3.961  3.341   -0.477  1.00 0.00 ? 26 TYR B CD1  9  
ATOM 6960  C CD2  . TYR B 2 26 ? -4.047  4.756   -2.444  1.00 0.00 ? 26 TYR B CD2  9  
ATOM 6961  C CE1  . TYR B 2 26 ? -2.685  3.832   -0.179  1.00 0.00 ? 26 TYR B CE1  9  
ATOM 6962  C CE2  . TYR B 2 26 ? -2.769  5.248   -2.146  1.00 0.00 ? 26 TYR B CE2  9  
ATOM 6963  C CZ   . TYR B 2 26 ? -2.089  4.785   -1.013  1.00 0.00 ? 26 TYR B CZ   9  
ATOM 6964  O OH   . TYR B 2 26 ? -0.830  5.269   -0.721  1.00 0.00 ? 26 TYR B OH   9  
ATOM 6965  H H    . TYR B 2 26 ? -8.300  2.088   -1.818  1.00 0.00 ? 26 TYR B H    9  
ATOM 6966  H HA   . TYR B 2 26 ? -6.257  2.714   0.124   1.00 0.00 ? 26 TYR B HA   9  
ATOM 6967  H HB2  . TYR B 2 26 ? -5.936  2.297   -2.386  1.00 0.00 ? 26 TYR B HB2  9  
ATOM 6968  H HB3  . TYR B 2 26 ? -6.511  3.947   -2.625  1.00 0.00 ? 26 TYR B HB3  9  
ATOM 6969  H HD1  . TYR B 2 26 ? -4.418  2.606   0.169   1.00 0.00 ? 26 TYR B HD1  9  
ATOM 6970  H HD2  . TYR B 2 26 ? -4.571  5.112   -3.318  1.00 0.00 ? 26 TYR B HD2  9  
ATOM 6971  H HE1  . TYR B 2 26 ? -2.160  3.475   0.696   1.00 0.00 ? 26 TYR B HE1  9  
ATOM 6972  H HE2  . TYR B 2 26 ? -2.310  5.983   -2.791  1.00 0.00 ? 26 TYR B HE2  9  
ATOM 6973  H HH   . TYR B 2 26 ? -0.325  4.558   -0.316  1.00 0.00 ? 26 TYR B HH   9  
ATOM 6974  N N    . THR B 2 27 ? -6.435  5.258   0.515   1.00 0.00 ? 27 THR B N    9  
ATOM 6975  C CA   . THR B 2 27 ? -6.798  6.624   0.981   1.00 0.00 ? 27 THR B CA   9  
ATOM 6976  C C    . THR B 2 27 ? -5.618  7.573   0.757   1.00 0.00 ? 27 THR B C    9  
ATOM 6977  O O    . THR B 2 27 ? -5.023  8.055   1.702   1.00 0.00 ? 27 THR B O    9  
ATOM 6978  C CB   . THR B 2 27 ? -7.143  6.577   2.472   1.00 0.00 ? 27 THR B CB   9  
ATOM 6979  O OG1  . THR B 2 27 ? -8.003  5.473   2.722   1.00 0.00 ? 27 THR B OG1  9  
ATOM 6980  C CG2  . THR B 2 27 ? -7.845  7.875   2.877   1.00 0.00 ? 27 THR B CG2  9  
ATOM 6981  H H    . THR B 2 27 ? -5.563  4.874   0.748   1.00 0.00 ? 27 THR B H    9  
ATOM 6982  H HA   . THR B 2 27 ? -7.655  6.977   0.426   1.00 0.00 ? 27 THR B HA   9  
ATOM 6983  H HB   . THR B 2 27 ? -6.237  6.466   3.049   1.00 0.00 ? 27 THR B HB   9  
ATOM 6984  H HG1  . THR B 2 27 ? -8.494  5.293   1.918   1.00 0.00 ? 27 THR B HG1  9  
ATOM 6985  H HG21 . THR B 2 27 ? -8.347  8.295   2.019   1.00 0.00 ? 27 THR B HG21 9  
ATOM 6986  H HG22 . THR B 2 27 ? -8.567  7.666   3.652   1.00 0.00 ? 27 THR B HG22 9  
ATOM 6987  H HG23 . THR B 2 27 ? -7.113  8.579   3.245   1.00 0.00 ? 27 THR B HG23 9  
ATOM 6988  N N    . PRO B 2 28 ? -5.321  7.813   -0.493  1.00 0.00 ? 28 PRO B N    9  
ATOM 6989  C CA   . PRO B 2 28 ? -4.215  8.706   -0.912  1.00 0.00 ? 28 PRO B CA   9  
ATOM 6990  C C    . PRO B 2 28 ? -4.464  10.124  -0.390  1.00 0.00 ? 28 PRO B C    9  
ATOM 6991  O O    . PRO B 2 28 ? -4.967  10.975  -1.094  1.00 0.00 ? 28 PRO B O    9  
ATOM 6992  C CB   . PRO B 2 28 ? -4.221  8.694   -2.445  1.00 0.00 ? 28 PRO B CB   9  
ATOM 6993  C CG   . PRO B 2 28 ? -5.363  7.764   -2.899  1.00 0.00 ? 28 PRO B CG   9  
ATOM 6994  C CD   . PRO B 2 28 ? -6.049  7.222   -1.638  1.00 0.00 ? 28 PRO B CD   9  
ATOM 6995  H HA   . PRO B 2 28 ? -3.272  8.332   -0.547  1.00 0.00 ? 28 PRO B HA   9  
ATOM 6996  H HB2  . PRO B 2 28 ? -4.391  9.696   -2.816  1.00 0.00 ? 28 PRO B HB2  9  
ATOM 6997  H HB3  . PRO B 2 28 ? -3.280  8.319   -2.813  1.00 0.00 ? 28 PRO B HB3  9  
ATOM 6998  H HG2  . PRO B 2 28 ? -6.072  8.320   -3.494  1.00 0.00 ? 28 PRO B HG2  9  
ATOM 6999  H HG3  . PRO B 2 28 ? -4.962  6.944   -3.474  1.00 0.00 ? 28 PRO B HG3  9  
ATOM 7000  H HD2  . PRO B 2 28 ? -7.086  7.525   -1.621  1.00 0.00 ? 28 PRO B HD2  9  
ATOM 7001  H HD3  . PRO B 2 28 ? -5.974  6.145   -1.607  1.00 0.00 ? 28 PRO B HD3  9  
ATOM 7002  N N    . LYS B 2 29 ? -4.116  10.380  0.841   1.00 0.00 ? 29 LYS B N    9  
ATOM 7003  C CA   . LYS B 2 29 ? -4.334  11.742  1.406   1.00 0.00 ? 29 LYS B CA   9  
ATOM 7004  C C    . LYS B 2 29 ? -3.286  12.018  2.486   1.00 0.00 ? 29 LYS B C    9  
ATOM 7005  O O    . LYS B 2 29 ? -2.539  11.143  2.878   1.00 0.00 ? 29 LYS B O    9  
ATOM 7006  C CB   . LYS B 2 29 ? -5.734  11.819  2.022   1.00 0.00 ? 29 LYS B CB   9  
ATOM 7007  C CG   . LYS B 2 29 ? -6.160  13.285  2.138   1.00 0.00 ? 29 LYS B CG   9  
ATOM 7008  C CD   . LYS B 2 29 ? -7.676  13.363  2.327   1.00 0.00 ? 29 LYS B CD   9  
ATOM 7009  C CE   . LYS B 2 29 ? -8.169  14.756  1.929   1.00 0.00 ? 29 LYS B CE   9  
ATOM 7010  N NZ   . LYS B 2 29 ? -9.508  14.645  1.285   1.00 0.00 ? 29 LYS B NZ   9  
ATOM 7011  H H    . LYS B 2 29 ? -3.712  9.679   1.392   1.00 0.00 ? 29 LYS B H    9  
ATOM 7012  H HA   . LYS B 2 29 ? -4.244  12.477  0.621   1.00 0.00 ? 29 LYS B HA   9  
ATOM 7013  H HB2  . LYS B 2 29 ? -6.434  11.289  1.392   1.00 0.00 ? 29 LYS B HB2  9  
ATOM 7014  H HB3  . LYS B 2 29 ? -5.721  11.371  3.003   1.00 0.00 ? 29 LYS B HB3  9  
ATOM 7015  H HG2  . LYS B 2 29 ? -5.667  13.736  2.988   1.00 0.00 ? 29 LYS B HG2  9  
ATOM 7016  H HG3  . LYS B 2 29 ? -5.883  13.813  1.239   1.00 0.00 ? 29 LYS B HG3  9  
ATOM 7017  H HD2  . LYS B 2 29 ? -8.155  12.620  1.706   1.00 0.00 ? 29 LYS B HD2  9  
ATOM 7018  H HD3  . LYS B 2 29 ? -7.921  13.180  3.363   1.00 0.00 ? 29 LYS B HD3  9  
ATOM 7019  H HE2  . LYS B 2 29 ? -8.243  15.376  2.811   1.00 0.00 ? 29 LYS B HE2  9  
ATOM 7020  H HE3  . LYS B 2 29 ? -7.471  15.200  1.235   1.00 0.00 ? 29 LYS B HE3  9  
ATOM 7021  H HZ1  . LYS B 2 29 ? -9.555  13.767  0.731   1.00 0.00 ? 29 LYS B HZ1  9  
ATOM 7022  H HZ2  . LYS B 2 29 ? -10.245 14.631  2.016   1.00 0.00 ? 29 LYS B HZ2  9  
ATOM 7023  H HZ3  . LYS B 2 29 ? -9.658  15.461  0.655   1.00 0.00 ? 29 LYS B HZ3  9  
ATOM 7024  N N    . THR B 2 30 ? -3.223  13.228  2.971   1.00 0.00 ? 30 THR B N    9  
ATOM 7025  C CA   . THR B 2 30 ? -2.223  13.557  4.024   1.00 0.00 ? 30 THR B CA   9  
ATOM 7026  C C    . THR B 2 30 ? -2.751  13.108  5.389   1.00 0.00 ? 30 THR B C    9  
ATOM 7027  O O    . THR B 2 30 ? -2.013  13.219  6.354   1.00 0.00 ? 30 THR B O    9  
ATOM 7028  C CB   . THR B 2 30 ? -1.982  15.069  4.043   1.00 0.00 ? 30 THR B CB   9  
ATOM 7029  O OG1  . THR B 2 30 ? -1.920  15.552  2.708   1.00 0.00 ? 30 THR B OG1  9  
ATOM 7030  C CG2  . THR B 2 30 ? -0.665  15.368  4.760   1.00 0.00 ? 30 THR B CG2  9  
ATOM 7031  O OXT  . THR B 2 30 ? -3.884  12.659  5.444   1.00 0.00 ? 30 THR B OXT  9  
ATOM 7032  H H    . THR B 2 30 ? -3.835  13.920  2.643   1.00 0.00 ? 30 THR B H    9  
ATOM 7033  H HA   . THR B 2 30 ? -1.294  13.047  3.813   1.00 0.00 ? 30 THR B HA   9  
ATOM 7034  H HB   . THR B 2 30 ? -2.790  15.557  4.566   1.00 0.00 ? 30 THR B HB   9  
ATOM 7035  H HG1  . THR B 2 30 ? -1.047  15.356  2.362   1.00 0.00 ? 30 THR B HG1  9  
ATOM 7036  H HG21 . THR B 2 30 ? 0.038   14.571  4.565   1.00 0.00 ? 30 THR B HG21 9  
ATOM 7037  H HG22 . THR B 2 30 ? -0.260  16.301  4.394   1.00 0.00 ? 30 THR B HG22 9  
ATOM 7038  H HG23 . THR B 2 30 ? -0.840  15.442  5.823   1.00 0.00 ? 30 THR B HG23 9  
ATOM 7039  N N    . GLY A 1 1  ? -2.442  7.788   7.085   1.00 0.00 ? 1  GLY A N    10 
ATOM 7040  C CA   . GLY A 1 1  ? -2.639  6.311   7.157   1.00 0.00 ? 1  GLY A CA   10 
ATOM 7041  C C    . GLY A 1 1  ? -1.299  5.606   6.969   1.00 0.00 ? 1  GLY A C    10 
ATOM 7042  O O    . GLY A 1 1  ? -0.284  6.013   7.500   1.00 0.00 ? 1  GLY A O    10 
ATOM 7043  H H1   . GLY A 1 1  ? -1.735  8.007   6.353   1.00 0.00 ? 1  GLY A H1   10 
ATOM 7044  H H2   . GLY A 1 1  ? -3.341  8.247   6.846   1.00 0.00 ? 1  GLY A H2   10 
ATOM 7045  H H3   . GLY A 1 1  ? -2.108  8.138   8.006   1.00 0.00 ? 1  GLY A H3   10 
ATOM 7046  H HA2  . GLY A 1 1  ? -3.053  6.047   8.119   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 7047  H HA3  . GLY A 1 1  ? -3.314  5.998   6.374   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 7048  N N    . ILE A 1 2  ? -1.292  4.549   6.209   1.00 0.00 ? 2  ILE A N    10 
ATOM 7049  C CA   . ILE A 1 2  ? -0.029  3.804   5.966   1.00 0.00 ? 2  ILE A CA   10 
ATOM 7050  C C    . ILE A 1 2  ? 0.972   4.736   5.272   1.00 0.00 ? 2  ILE A C    10 
ATOM 7051  O O    . ILE A 1 2  ? 2.140   4.756   5.596   1.00 0.00 ? 2  ILE A O    10 
ATOM 7052  C CB   . ILE A 1 2  ? -0.359  2.585   5.082   1.00 0.00 ? 2  ILE A CB   10 
ATOM 7053  C CG1  . ILE A 1 2  ? 0.121   1.302   5.765   1.00 0.00 ? 2  ILE A CG1  10 
ATOM 7054  C CG2  . ILE A 1 2  ? 0.296   2.701   3.701   1.00 0.00 ? 2  ILE A CG2  10 
ATOM 7055  C CD1  . ILE A 1 2  ? -0.851  0.158   5.446   1.00 0.00 ? 2  ILE A CD1  10 
ATOM 7056  H H    . ILE A 1 2  ? -2.125  4.247   5.792   1.00 0.00 ? 2  ILE A H    10 
ATOM 7057  H HA   . ILE A 1 2  ? 0.380   3.469   6.908   1.00 0.00 ? 2  ILE A HA   10 
ATOM 7058  H HB   . ILE A 1 2  ? -1.424  2.540   4.953   1.00 0.00 ? 2  ILE A HB   10 
ATOM 7059  H HG12 . ILE A 1 2  ? 1.107   1.048   5.404   1.00 0.00 ? 2  ILE A HG12 10 
ATOM 7060  H HG13 . ILE A 1 2  ? 0.155   1.453   6.833   1.00 0.00 ? 2  ILE A HG13 10 
ATOM 7061  H HG21 . ILE A 1 2  ? 1.359   2.853   3.818   1.00 0.00 ? 2  ILE A HG21 10 
ATOM 7062  H HG22 . ILE A 1 2  ? 0.119   1.796   3.142   1.00 0.00 ? 2  ILE A HG22 10 
ATOM 7063  H HG23 . ILE A 1 2  ? -0.131  3.542   3.173   1.00 0.00 ? 2  ILE A HG23 10 
ATOM 7064  H HD11 . ILE A 1 2  ? -1.196  0.247   4.424   1.00 0.00 ? 2  ILE A HD11 10 
ATOM 7065  H HD12 . ILE A 1 2  ? -0.349  -0.789  5.571   1.00 0.00 ? 2  ILE A HD12 10 
ATOM 7066  H HD13 . ILE A 1 2  ? -1.697  0.208   6.114   1.00 0.00 ? 2  ILE A HD13 10 
ATOM 7067  N N    . VAL A 1 3  ? 0.504   5.492   4.311   1.00 0.00 ? 3  VAL A N    10 
ATOM 7068  C CA   . VAL A 1 3  ? 1.397   6.425   3.561   1.00 0.00 ? 3  VAL A CA   10 
ATOM 7069  C C    . VAL A 1 3  ? 2.472   6.997   4.492   1.00 0.00 ? 3  VAL A C    10 
ATOM 7070  O O    . VAL A 1 3  ? 3.599   7.210   4.090   1.00 0.00 ? 3  VAL A O    10 
ATOM 7071  C CB   . VAL A 1 3  ? 0.551   7.564   2.988   1.00 0.00 ? 3  VAL A CB   10 
ATOM 7072  C CG1  . VAL A 1 3  ? 1.446   8.532   2.213   1.00 0.00 ? 3  VAL A CG1  10 
ATOM 7073  C CG2  . VAL A 1 3  ? -0.508  6.983   2.044   1.00 0.00 ? 3  VAL A CG2  10 
ATOM 7074  H H    . VAL A 1 3  ? -0.444  5.440   4.075   1.00 0.00 ? 3  VAL A H    10 
ATOM 7075  H HA   . VAL A 1 3  ? 1.872   5.893   2.752   1.00 0.00 ? 3  VAL A HA   10 
ATOM 7076  H HB   . VAL A 1 3  ? 0.066   8.089   3.797   1.00 0.00 ? 3  VAL A HB   10 
ATOM 7077  H HG11 . VAL A 1 3  ? 2.408   8.072   2.039   1.00 0.00 ? 3  VAL A HG11 10 
ATOM 7078  H HG12 . VAL A 1 3  ? 0.983   8.771   1.267   1.00 0.00 ? 3  VAL A HG12 10 
ATOM 7079  H HG13 . VAL A 1 3  ? 1.579   9.437   2.786   1.00 0.00 ? 3  VAL A HG13 10 
ATOM 7080  H HG21 . VAL A 1 3  ? -0.184  6.016   1.688   1.00 0.00 ? 3  VAL A HG21 10 
ATOM 7081  H HG22 . VAL A 1 3  ? -1.444  6.876   2.573   1.00 0.00 ? 3  VAL A HG22 10 
ATOM 7082  H HG23 . VAL A 1 3  ? -0.646  7.647   1.205   1.00 0.00 ? 3  VAL A HG23 10 
ATOM 7083  N N    . GLU A 1 4  ? 2.140   7.237   5.728   1.00 0.00 ? 4  GLU A N    10 
ATOM 7084  C CA   . GLU A 1 4  ? 3.154   7.786   6.672   1.00 0.00 ? 4  GLU A CA   10 
ATOM 7085  C C    . GLU A 1 4  ? 3.932   6.630   7.311   1.00 0.00 ? 4  GLU A C    10 
ATOM 7086  O O    . GLU A 1 4  ? 4.185   6.619   8.499   1.00 0.00 ? 4  GLU A O    10 
ATOM 7087  C CB   . GLU A 1 4  ? 2.457   8.599   7.765   1.00 0.00 ? 4  GLU A CB   10 
ATOM 7088  C CG   . GLU A 1 4  ? 3.147   9.958   7.905   1.00 0.00 ? 4  GLU A CG   10 
ATOM 7089  C CD   . GLU A 1 4  ? 3.732   10.093  9.313   1.00 0.00 ? 4  GLU A CD   10 
ATOM 7090  O OE1  . GLU A 1 4  ? 2.981   10.427  10.214  1.00 0.00 ? 4  GLU A OE1  10 
ATOM 7091  O OE2  . GLU A 1 4  ? 4.919   9.864   9.463   1.00 0.00 ? 4  GLU A OE2  10 
ATOM 7092  H H    . GLU A 1 4  ? 1.228   7.055   6.037   1.00 0.00 ? 4  GLU A H    10 
ATOM 7093  H HA   . GLU A 1 4  ? 3.840   8.422   6.133   1.00 0.00 ? 4  GLU A HA   10 
ATOM 7094  H HB2  . GLU A 1 4  ? 1.421   8.747   7.497   1.00 0.00 ? 4  GLU A HB2  10 
ATOM 7095  H HB3  . GLU A 1 4  ? 2.517   8.069   8.703   1.00 0.00 ? 4  GLU A HB3  10 
ATOM 7096  H HG2  . GLU A 1 4  ? 3.941   10.034  7.176   1.00 0.00 ? 4  GLU A HG2  10 
ATOM 7097  H HG3  . GLU A 1 4  ? 2.427   10.745  7.738   1.00 0.00 ? 4  GLU A HG3  10 
ATOM 7098  N N    . GLN A 1 5  ? 4.312   5.658   6.525   1.00 0.00 ? 5  GLN A N    10 
ATOM 7099  C CA   . GLN A 1 5  ? 5.075   4.501   7.076   1.00 0.00 ? 5  GLN A CA   10 
ATOM 7100  C C    . GLN A 1 5  ? 5.562   3.623   5.921   1.00 0.00 ? 5  GLN A C    10 
ATOM 7101  O O    . GLN A 1 5  ? 6.648   3.079   5.955   1.00 0.00 ? 5  GLN A O    10 
ATOM 7102  C CB   . GLN A 1 5  ? 4.167   3.677   7.992   1.00 0.00 ? 5  GLN A CB   10 
ATOM 7103  C CG   . GLN A 1 5  ? 4.362   4.123   9.442   1.00 0.00 ? 5  GLN A CG   10 
ATOM 7104  C CD   . GLN A 1 5  ? 3.014   4.545   10.032  1.00 0.00 ? 5  GLN A CD   10 
ATOM 7105  O OE1  . GLN A 1 5  ? 2.111   4.914   9.310   1.00 0.00 ? 5  GLN A OE1  10 
ATOM 7106  N NE2  . GLN A 1 5  ? 2.841   4.504   11.326  1.00 0.00 ? 5  GLN A NE2  10 
ATOM 7107  H H    . GLN A 1 5  ? 4.097   5.690   5.570   1.00 0.00 ? 5  GLN A H    10 
ATOM 7108  H HA   . GLN A 1 5  ? 5.924   4.863   7.638   1.00 0.00 ? 5  GLN A HA   10 
ATOM 7109  H HB2  . GLN A 1 5  ? 3.137   3.825   7.704   1.00 0.00 ? 5  GLN A HB2  10 
ATOM 7110  H HB3  . GLN A 1 5  ? 4.419   2.632   7.904   1.00 0.00 ? 5  GLN A HB3  10 
ATOM 7111  H HG2  . GLN A 1 5  ? 4.770   3.306   10.020  1.00 0.00 ? 5  GLN A HG2  10 
ATOM 7112  H HG3  . GLN A 1 5  ? 5.042   4.961   9.473   1.00 0.00 ? 5  GLN A HG3  10 
ATOM 7113  H HE21 . GLN A 1 5  ? 3.570   4.207   11.909  1.00 0.00 ? 5  GLN A HE21 10 
ATOM 7114  H HE22 . GLN A 1 5  ? 1.981   4.774   11.714  1.00 0.00 ? 5  GLN A HE22 10 
ATOM 7115  N N    . CYS A 1 6  ? 4.765   3.485   4.896   1.00 0.00 ? 6  CYS A N    10 
ATOM 7116  C CA   . CYS A 1 6  ? 5.173   2.650   3.734   1.00 0.00 ? 6  CYS A CA   10 
ATOM 7117  C C    . CYS A 1 6  ? 5.910   3.528   2.722   1.00 0.00 ? 6  CYS A C    10 
ATOM 7118  O O    . CYS A 1 6  ? 6.684   3.051   1.916   1.00 0.00 ? 6  CYS A O    10 
ATOM 7119  C CB   . CYS A 1 6  ? 3.926   2.050   3.083   1.00 0.00 ? 6  CYS A CB   10 
ATOM 7120  S SG   . CYS A 1 6  ? 3.353   0.640   4.061   1.00 0.00 ? 6  CYS A SG   10 
ATOM 7121  H H    . CYS A 1 6  ? 3.899   3.935   4.891   1.00 0.00 ? 6  CYS A H    10 
ATOM 7122  H HA   . CYS A 1 6  ? 5.825   1.857   4.067   1.00 0.00 ? 6  CYS A HA   10 
ATOM 7123  H HB2  . CYS A 1 6  ? 3.150   2.797   3.042   1.00 0.00 ? 6  CYS A HB2  10 
ATOM 7124  H HB3  . CYS A 1 6  ? 4.165   1.722   2.082   1.00 0.00 ? 6  CYS A HB3  10 
ATOM 7125  N N    . CYS A 1 7  ? 5.678   4.812   2.764   1.00 0.00 ? 7  CYS A N    10 
ATOM 7126  C CA   . CYS A 1 7  ? 6.366   5.731   1.814   1.00 0.00 ? 7  CYS A CA   10 
ATOM 7127  C C    . CYS A 1 7  ? 7.637   6.267   2.479   1.00 0.00 ? 7  CYS A C    10 
ATOM 7128  O O    . CYS A 1 7  ? 8.669   6.400   1.850   1.00 0.00 ? 7  CYS A O    10 
ATOM 7129  C CB   . CYS A 1 7  ? 5.422   6.887   1.458   1.00 0.00 ? 7  CYS A CB   10 
ATOM 7130  S SG   . CYS A 1 7  ? 6.357   8.253   0.718   1.00 0.00 ? 7  CYS A SG   10 
ATOM 7131  H H    . CYS A 1 7  ? 5.053   5.174   3.426   1.00 0.00 ? 7  CYS A H    10 
ATOM 7132  H HA   . CYS A 1 7  ? 6.629   5.189   0.916   1.00 0.00 ? 7  CYS A HA   10 
ATOM 7133  H HB2  . CYS A 1 7  ? 4.684   6.540   0.752   1.00 0.00 ? 7  CYS A HB2  10 
ATOM 7134  H HB3  . CYS A 1 7  ? 4.926   7.230   2.351   1.00 0.00 ? 7  CYS A HB3  10 
ATOM 7135  N N    . THR A 1 8  ? 7.576   6.565   3.747   1.00 0.00 ? 8  THR A N    10 
ATOM 7136  C CA   . THR A 1 8  ? 8.786   7.079   4.453   1.00 0.00 ? 8  THR A CA   10 
ATOM 7137  C C    . THR A 1 8  ? 9.806   5.946   4.574   1.00 0.00 ? 8  THR A C    10 
ATOM 7138  O O    . THR A 1 8  ? 10.995  6.144   4.422   1.00 0.00 ? 8  THR A O    10 
ATOM 7139  C CB   . THR A 1 8  ? 8.402   7.568   5.852   1.00 0.00 ? 8  THR A CB   10 
ATOM 7140  O OG1  . THR A 1 8  ? 7.136   7.033   6.209   1.00 0.00 ? 8  THR A OG1  10 
ATOM 7141  C CG2  . THR A 1 8  ? 8.336   9.094   5.865   1.00 0.00 ? 8  THR A CG2  10 
ATOM 7142  H H    . THR A 1 8  ? 6.738   6.443   4.240   1.00 0.00 ? 8  THR A H    10 
ATOM 7143  H HA   . THR A 1 8  ? 9.216   7.894   3.887   1.00 0.00 ? 8  THR A HA   10 
ATOM 7144  H HB   . THR A 1 8  ? 9.145   7.238   6.563   1.00 0.00 ? 8  THR A HB   10 
ATOM 7145  H HG1  . THR A 1 8  ? 6.712   7.650   6.809   1.00 0.00 ? 8  THR A HG1  10 
ATOM 7146  H HG21 . THR A 1 8  ? 9.007   9.489   5.116   1.00 0.00 ? 8  THR A HG21 10 
ATOM 7147  H HG22 . THR A 1 8  ? 7.327   9.412   5.648   1.00 0.00 ? 8  THR A HG22 10 
ATOM 7148  H HG23 . THR A 1 8  ? 8.627   9.459   6.838   1.00 0.00 ? 8  THR A HG23 10 
ATOM 7149  N N    . SER A 1 9  ? 9.344   4.756   4.841   1.00 0.00 ? 9  SER A N    10 
ATOM 7150  C CA   . SER A 1 9  ? 10.276  3.602   4.970   1.00 0.00 ? 9  SER A CA   10 
ATOM 7151  C C    . SER A 1 9  ? 9.715   2.414   4.187   1.00 0.00 ? 9  SER A C    10 
ATOM 7152  O O    . SER A 1 9  ? 8.695   2.518   3.532   1.00 0.00 ? 9  SER A O    10 
ATOM 7153  C CB   . SER A 1 9  ? 10.416  3.220   6.442   1.00 0.00 ? 9  SER A CB   10 
ATOM 7154  O OG   . SER A 1 9  ? 10.452  4.401   7.233   1.00 0.00 ? 9  SER A OG   10 
ATOM 7155  H H    . SER A 1 9  ? 8.381   4.621   4.956   1.00 0.00 ? 9  SER A H    10 
ATOM 7156  H HA   . SER A 1 9  ? 11.244  3.875   4.573   1.00 0.00 ? 9  SER A HA   10 
ATOM 7157  H HB2  . SER A 1 9  ? 9.574   2.619   6.742   1.00 0.00 ? 9  SER A HB2  10 
ATOM 7158  H HB3  . SER A 1 9  ? 11.328  2.654   6.583   1.00 0.00 ? 9  SER A HB3  10 
ATOM 7159  H HG   . SER A 1 9  ? 9.917   4.251   8.016   1.00 0.00 ? 9  SER A HG   10 
ATOM 7160  N N    . ILE A 1 10 ? 10.365  1.286   4.251   1.00 0.00 ? 10 ILE A N    10 
ATOM 7161  C CA   . ILE A 1 10 ? 9.860   0.094   3.512   1.00 0.00 ? 10 ILE A CA   10 
ATOM 7162  C C    . ILE A 1 10 ? 9.055   -0.790  4.467   1.00 0.00 ? 10 ILE A C    10 
ATOM 7163  O O    . ILE A 1 10 ? 9.561   -1.746  5.019   1.00 0.00 ? 10 ILE A O    10 
ATOM 7164  C CB   . ILE A 1 10 ? 11.044  -0.699  2.954   1.00 0.00 ? 10 ILE A CB   10 
ATOM 7165  C CG1  . ILE A 1 10 ? 11.880  0.208   2.049   1.00 0.00 ? 10 ILE A CG1  10 
ATOM 7166  C CG2  . ILE A 1 10 ? 10.521  -1.886  2.141   1.00 0.00 ? 10 ILE A CG2  10 
ATOM 7167  C CD1  . ILE A 1 10 ? 12.917  -0.630  1.299   1.00 0.00 ? 10 ILE A CD1  10 
ATOM 7168  H H    . ILE A 1 10 ? 11.183  1.220   4.787   1.00 0.00 ? 10 ILE A H    10 
ATOM 7169  H HA   . ILE A 1 10 ? 9.226   0.417   2.701   1.00 0.00 ? 10 ILE A HA   10 
ATOM 7170  H HB   . ILE A 1 10 ? 11.652  -1.061  3.770   1.00 0.00 ? 10 ILE A HB   10 
ATOM 7171  H HG12 . ILE A 1 10 ? 11.234  0.702   1.339   1.00 0.00 ? 10 ILE A HG12 10 
ATOM 7172  H HG13 . ILE A 1 10 ? 12.386  0.948   2.651   1.00 0.00 ? 10 ILE A HG13 10 
ATOM 7173  H HG21 . ILE A 1 10 ? 9.924   -2.523  2.776   1.00 0.00 ? 10 ILE A HG21 10 
ATOM 7174  H HG22 . ILE A 1 10 ? 9.917   -1.524  1.323   1.00 0.00 ? 10 ILE A HG22 10 
ATOM 7175  H HG23 . ILE A 1 10 ? 11.357  -2.450  1.751   1.00 0.00 ? 10 ILE A HG23 10 
ATOM 7176  H HD11 . ILE A 1 10 ? 13.467  -1.238  2.002   1.00 0.00 ? 10 ILE A HD11 10 
ATOM 7177  H HD12 . ILE A 1 10 ? 12.417  -1.269  0.584   1.00 0.00 ? 10 ILE A HD12 10 
ATOM 7178  H HD13 . ILE A 1 10 ? 13.601  0.026   0.778   1.00 0.00 ? 10 ILE A HD13 10 
ATOM 7179  N N    . CYS A 1 11 ? 7.804   -0.474  4.668   1.00 0.00 ? 11 CYS A N    10 
ATOM 7180  C CA   . CYS A 1 11 ? 6.968   -1.294  5.589   1.00 0.00 ? 11 CYS A CA   10 
ATOM 7181  C C    . CYS A 1 11 ? 6.926   -2.741  5.091   1.00 0.00 ? 11 CYS A C    10 
ATOM 7182  O O    . CYS A 1 11 ? 7.595   -3.100  4.143   1.00 0.00 ? 11 CYS A O    10 
ATOM 7183  C CB   . CYS A 1 11 ? 5.546   -0.729  5.627   1.00 0.00 ? 11 CYS A CB   10 
ATOM 7184  S SG   . CYS A 1 11 ? 4.866   -0.692  3.951   1.00 0.00 ? 11 CYS A SG   10 
ATOM 7185  H H    . CYS A 1 11 ? 7.416   0.302   4.214   1.00 0.00 ? 11 CYS A H    10 
ATOM 7186  H HA   . CYS A 1 11 ? 7.392   -1.267  6.582   1.00 0.00 ? 11 CYS A HA   10 
ATOM 7187  H HB2  . CYS A 1 11 ? 4.927   -1.353  6.253   1.00 0.00 ? 11 CYS A HB2  10 
ATOM 7188  H HB3  . CYS A 1 11 ? 5.569   0.273   6.029   1.00 0.00 ? 11 CYS A HB3  10 
ATOM 7189  N N    . SER A 1 12 ? 6.144   -3.573  5.723   1.00 0.00 ? 12 SER A N    10 
ATOM 7190  C CA   . SER A 1 12 ? 6.059   -4.995  5.284   1.00 0.00 ? 12 SER A CA   10 
ATOM 7191  C C    . SER A 1 12 ? 4.734   -5.225  4.557   1.00 0.00 ? 12 SER A C    10 
ATOM 7192  O O    . SER A 1 12 ? 3.825   -4.424  4.633   1.00 0.00 ? 12 SER A O    10 
ATOM 7193  C CB   . SER A 1 12 ? 6.135   -5.915  6.505   1.00 0.00 ? 12 SER A CB   10 
ATOM 7194  O OG   . SER A 1 12 ? 5.556   -5.259  7.625   1.00 0.00 ? 12 SER A OG   10 
ATOM 7195  H H    . SER A 1 12 ? 5.611   -3.263  6.485   1.00 0.00 ? 12 SER A H    10 
ATOM 7196  H HA   . SER A 1 12 ? 6.879   -5.214  4.618   1.00 0.00 ? 12 SER A HA   10 
ATOM 7197  H HB2  . SER A 1 12 ? 5.593   -6.825  6.308   1.00 0.00 ? 12 SER A HB2  10 
ATOM 7198  H HB3  . SER A 1 12 ? 7.172   -6.155  6.710   1.00 0.00 ? 12 SER A HB3  10 
ATOM 7199  H HG   . SER A 1 12 ? 6.177   -5.317  8.357   1.00 0.00 ? 12 SER A HG   10 
ATOM 7200  N N    . LEU A 1 13 ? 4.618   -6.317  3.849   1.00 0.00 ? 13 LEU A N    10 
ATOM 7201  C CA   . LEU A 1 13 ? 3.353   -6.599  3.117   1.00 0.00 ? 13 LEU A CA   10 
ATOM 7202  C C    . LEU A 1 13 ? 2.244   -6.936  4.117   1.00 0.00 ? 13 LEU A C    10 
ATOM 7203  O O    . LEU A 1 13 ? 1.100   -7.122  3.749   1.00 0.00 ? 13 LEU A O    10 
ATOM 7204  C CB   . LEU A 1 13 ? 3.564   -7.782  2.171   1.00 0.00 ? 13 LEU A CB   10 
ATOM 7205  C CG   . LEU A 1 13 ? 3.523   -7.293  0.722   1.00 0.00 ? 13 LEU A CG   10 
ATOM 7206  C CD1  . LEU A 1 13 ? 3.640   -8.488  -0.225  1.00 0.00 ? 13 LEU A CD1  10 
ATOM 7207  C CD2  . LEU A 1 13 ? 2.199   -6.569  0.467   1.00 0.00 ? 13 LEU A CD2  10 
ATOM 7208  H H    . LEU A 1 13 ? 5.364   -6.951  3.802   1.00 0.00 ? 13 LEU A H    10 
ATOM 7209  H HA   . LEU A 1 13 ? 3.068   -5.729  2.545   1.00 0.00 ? 13 LEU A HA   10 
ATOM 7210  H HB2  . LEU A 1 13 ? 4.523   -8.236  2.372   1.00 0.00 ? 13 LEU A HB2  10 
ATOM 7211  H HB3  . LEU A 1 13 ? 2.782   -8.511  2.325   1.00 0.00 ? 13 LEU A HB3  10 
ATOM 7212  H HG   . LEU A 1 13 ? 4.346   -6.615  0.549   1.00 0.00 ? 13 LEU A HG   10 
ATOM 7213  H HD11 . LEU A 1 13 ? 4.276   -9.240  0.220   1.00 0.00 ? 13 LEU A HD11 10 
ATOM 7214  H HD12 . LEU A 1 13 ? 2.660   -8.904  -0.403  1.00 0.00 ? 13 LEU A HD12 10 
ATOM 7215  H HD13 . LEU A 1 13 ? 4.070   -8.164  -1.162  1.00 0.00 ? 13 LEU A HD13 10 
ATOM 7216  H HD21 . LEU A 1 13 ? 1.548   -6.697  1.321   1.00 0.00 ? 13 LEU A HD21 10 
ATOM 7217  H HD22 . LEU A 1 13 ? 2.386   -5.518  0.309   1.00 0.00 ? 13 LEU A HD22 10 
ATOM 7218  H HD23 . LEU A 1 13 ? 1.725   -6.987  -0.411  1.00 0.00 ? 13 LEU A HD23 10 
ATOM 7219  N N    . TYR A 1 14 ? 2.571   -7.021  5.378   1.00 0.00 ? 14 TYR A N    10 
ATOM 7220  C CA   . TYR A 1 14 ? 1.531   -7.350  6.393   1.00 0.00 ? 14 TYR A CA   10 
ATOM 7221  C C    . TYR A 1 14 ? 0.781   -6.076  6.790   1.00 0.00 ? 14 TYR A C    10 
ATOM 7222  O O    . TYR A 1 14 ? -0.365  -6.118  7.189   1.00 0.00 ? 14 TYR A O    10 
ATOM 7223  C CB   . TYR A 1 14 ? 2.199   -7.956  7.631   1.00 0.00 ? 14 TYR A CB   10 
ATOM 7224  C CG   . TYR A 1 14 ? 1.200   -8.015  8.762   1.00 0.00 ? 14 TYR A CG   10 
ATOM 7225  C CD1  . TYR A 1 14 ? 0.125   -8.909  8.701   1.00 0.00 ? 14 TYR A CD1  10 
ATOM 7226  C CD2  . TYR A 1 14 ? 1.349   -7.173  9.871   1.00 0.00 ? 14 TYR A CD2  10 
ATOM 7227  C CE1  . TYR A 1 14 ? -0.802  -8.961  9.747   1.00 0.00 ? 14 TYR A CE1  10 
ATOM 7228  C CE2  . TYR A 1 14 ? 0.421   -7.224  10.918  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 7229  C CZ   . TYR A 1 14 ? -0.654  -8.120  10.856  1.00 0.00 ? 14 TYR A CZ   10 
ATOM 7230  O OH   . TYR A 1 14 ? -1.570  -8.173  11.887  1.00 0.00 ? 14 TYR A OH   10 
ATOM 7231  H H    . TYR A 1 14 ? 3.496   -6.871  5.658   1.00 0.00 ? 14 TYR A H    10 
ATOM 7232  H HA   . TYR A 1 14 ? 0.832   -8.061  5.976   1.00 0.00 ? 14 TYR A HA   10 
ATOM 7233  H HB2  . TYR A 1 14 ? 2.543   -8.954  7.401   1.00 0.00 ? 14 TYR A HB2  10 
ATOM 7234  H HB3  . TYR A 1 14 ? 3.039   -7.344  7.923   1.00 0.00 ? 14 TYR A HB3  10 
ATOM 7235  H HD1  . TYR A 1 14 ? 0.013   -9.557  7.844   1.00 0.00 ? 14 TYR A HD1  10 
ATOM 7236  H HD2  . TYR A 1 14 ? 2.178   -6.483  9.918   1.00 0.00 ? 14 TYR A HD2  10 
ATOM 7237  H HE1  . TYR A 1 14 ? -1.630  -9.652  9.700   1.00 0.00 ? 14 TYR A HE1  10 
ATOM 7238  H HE2  . TYR A 1 14 ? 0.536   -6.577  11.774  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 7239  H HH   . TYR A 1 14 ? -1.174  -7.758  12.657  1.00 0.00 ? 14 TYR A HH   10 
ATOM 7240  N N    . GLN A 1 15 ? 1.419   -4.943  6.688   1.00 0.00 ? 15 GLN A N    10 
ATOM 7241  C CA   . GLN A 1 15 ? 0.739   -3.671  7.065   1.00 0.00 ? 15 GLN A CA   10 
ATOM 7242  C C    . GLN A 1 15 ? -0.318  -3.325  6.015   1.00 0.00 ? 15 GLN A C    10 
ATOM 7243  O O    . GLN A 1 15 ? -1.426  -2.947  6.338   1.00 0.00 ? 15 GLN A O    10 
ATOM 7244  C CB   . GLN A 1 15 ? 1.772   -2.549  7.149   1.00 0.00 ? 15 GLN A CB   10 
ATOM 7245  C CG   . GLN A 1 15 ? 2.729   -2.830  8.309   1.00 0.00 ? 15 GLN A CG   10 
ATOM 7246  C CD   . GLN A 1 15 ? 3.404   -1.529  8.746   1.00 0.00 ? 15 GLN A CD   10 
ATOM 7247  O OE1  . GLN A 1 15 ? 3.256   -0.508  8.106   1.00 0.00 ? 15 GLN A OE1  10 
ATOM 7248  N NE2  . GLN A 1 15 ? 4.146   -1.524  9.822   1.00 0.00 ? 15 GLN A NE2  10 
ATOM 7249  H H    . GLN A 1 15 ? 2.345   -4.928  6.368   1.00 0.00 ? 15 GLN A H    10 
ATOM 7250  H HA   . GLN A 1 15 ? 0.262   -3.793  8.026   1.00 0.00 ? 15 GLN A HA   10 
ATOM 7251  H HB2  . GLN A 1 15 ? 2.328   -2.501  6.224   1.00 0.00 ? 15 GLN A HB2  10 
ATOM 7252  H HB3  . GLN A 1 15 ? 1.271   -1.607  7.319   1.00 0.00 ? 15 GLN A HB3  10 
ATOM 7253  H HG2  . GLN A 1 15 ? 2.176   -3.245  9.138   1.00 0.00 ? 15 GLN A HG2  10 
ATOM 7254  H HG3  . GLN A 1 15 ? 3.484   -3.535  7.991   1.00 0.00 ? 15 GLN A HG3  10 
ATOM 7255  H HE21 . GLN A 1 15 ? 4.265   -2.347  10.339  1.00 0.00 ? 15 GLN A HE21 10 
ATOM 7256  H HE22 . GLN A 1 15 ? 4.584   -0.695  10.112  1.00 0.00 ? 15 GLN A HE22 10 
ATOM 7257  N N    . LEU A 1 16 ? 0.014   -3.449  4.757   1.00 0.00 ? 16 LEU A N    10 
ATOM 7258  C CA   . LEU A 1 16 ? -0.976  -3.127  3.692   1.00 0.00 ? 16 LEU A CA   10 
ATOM 7259  C C    . LEU A 1 16 ? -2.129  -4.131  3.745   1.00 0.00 ? 16 LEU A C    10 
ATOM 7260  O O    . LEU A 1 16 ? -3.126  -3.976  3.071   1.00 0.00 ? 16 LEU A O    10 
ATOM 7261  C CB   . LEU A 1 16 ? -0.306  -3.201  2.316   1.00 0.00 ? 16 LEU A CB   10 
ATOM 7262  C CG   . LEU A 1 16 ? 0.782   -2.124  2.192   1.00 0.00 ? 16 LEU A CG   10 
ATOM 7263  C CD1  . LEU A 1 16 ? 1.007   -1.804  0.713   1.00 0.00 ? 16 LEU A CD1  10 
ATOM 7264  C CD2  . LEU A 1 16 ? 0.346   -0.844  2.914   1.00 0.00 ? 16 LEU A CD2  10 
ATOM 7265  H H    . LEU A 1 16 ? 0.910   -3.755  4.514   1.00 0.00 ? 16 LEU A H    10 
ATOM 7266  H HA   . LEU A 1 16 ? -1.363  -2.133  3.852   1.00 0.00 ? 16 LEU A HA   10 
ATOM 7267  H HB2  . LEU A 1 16 ? 0.141   -4.175  2.187   1.00 0.00 ? 16 LEU A HB2  10 
ATOM 7268  H HB3  . LEU A 1 16 ? -1.051  -3.045  1.549   1.00 0.00 ? 16 LEU A HB3  10 
ATOM 7269  H HG   . LEU A 1 16 ? 1.701   -2.491  2.625   1.00 0.00 ? 16 LEU A HG   10 
ATOM 7270  H HD11 . LEU A 1 16 ? 0.622   -2.611  0.108   1.00 0.00 ? 16 LEU A HD11 10 
ATOM 7271  H HD12 . LEU A 1 16 ? 0.493   -0.890  0.463   1.00 0.00 ? 16 LEU A HD12 10 
ATOM 7272  H HD13 . LEU A 1 16 ? 2.064   -1.687  0.528   1.00 0.00 ? 16 LEU A HD13 10 
ATOM 7273  H HD21 . LEU A 1 16 ? -0.721  -0.716  2.809   1.00 0.00 ? 16 LEU A HD21 10 
ATOM 7274  H HD22 . LEU A 1 16 ? 0.601   -0.918  3.962   1.00 0.00 ? 16 LEU A HD22 10 
ATOM 7275  H HD23 . LEU A 1 16 ? 0.856   0.004   2.479   1.00 0.00 ? 16 LEU A HD23 10 
ATOM 7276  N N    . GLU A 1 17 ? -2.003  -5.157  4.543   1.00 0.00 ? 17 GLU A N    10 
ATOM 7277  C CA   . GLU A 1 17 ? -3.100  -6.159  4.632   1.00 0.00 ? 17 GLU A CA   10 
ATOM 7278  C C    . GLU A 1 17 ? -4.338  -5.483  5.225   1.00 0.00 ? 17 GLU A C    10 
ATOM 7279  O O    . GLU A 1 17 ? -5.455  -5.758  4.835   1.00 0.00 ? 17 GLU A O    10 
ATOM 7280  C CB   . GLU A 1 17 ? -2.667  -7.319  5.530   1.00 0.00 ? 17 GLU A CB   10 
ATOM 7281  C CG   . GLU A 1 17 ? -1.518  -8.079  4.859   1.00 0.00 ? 17 GLU A CG   10 
ATOM 7282  C CD   . GLU A 1 17 ? -1.305  -9.415  5.574   1.00 0.00 ? 17 GLU A CD   10 
ATOM 7283  O OE1  . GLU A 1 17 ? -1.920  -9.616  6.609   1.00 0.00 ? 17 GLU A OE1  10 
ATOM 7284  O OE2  . GLU A 1 17 ? -0.531  -10.215 5.075   1.00 0.00 ? 17 GLU A OE2  10 
ATOM 7285  H H    . GLU A 1 17 ? -1.193  -5.268  5.080   1.00 0.00 ? 17 GLU A H    10 
ATOM 7286  H HA   . GLU A 1 17 ? -3.332  -6.529  3.645   1.00 0.00 ? 17 GLU A HA   10 
ATOM 7287  H HB2  . GLU A 1 17 ? -2.337  -6.934  6.483   1.00 0.00 ? 17 GLU A HB2  10 
ATOM 7288  H HB3  . GLU A 1 17 ? -3.500  -7.989  5.679   1.00 0.00 ? 17 GLU A HB3  10 
ATOM 7289  H HG2  . GLU A 1 17 ? -1.763  -8.260  3.822   1.00 0.00 ? 17 GLU A HG2  10 
ATOM 7290  H HG3  . GLU A 1 17 ? -0.615  -7.493  4.918   1.00 0.00 ? 17 GLU A HG3  10 
ATOM 7291  N N    . ASN A 1 18 ? -4.145  -4.588  6.157   1.00 0.00 ? 18 ASN A N    10 
ATOM 7292  C CA   . ASN A 1 18 ? -5.310  -3.882  6.761   1.00 0.00 ? 18 ASN A CA   10 
ATOM 7293  C C    . ASN A 1 18 ? -6.118  -3.226  5.642   1.00 0.00 ? 18 ASN A C    10 
ATOM 7294  O O    . ASN A 1 18 ? -7.275  -2.897  5.804   1.00 0.00 ? 18 ASN A O    10 
ATOM 7295  C CB   . ASN A 1 18 ? -4.813  -2.809  7.734   1.00 0.00 ? 18 ASN A CB   10 
ATOM 7296  C CG   . ASN A 1 18 ? -5.397  -3.069  9.124   1.00 0.00 ? 18 ASN A CG   10 
ATOM 7297  O OD1  . ASN A 1 18 ? -6.585  -2.931  9.334   1.00 0.00 ? 18 ASN A OD1  10 
ATOM 7298  N ND2  . ASN A 1 18 ? -4.604  -3.447  10.090  1.00 0.00 ? 18 ASN A ND2  10 
ATOM 7299  H H    . ASN A 1 18 ? -3.234  -4.373  6.450   1.00 0.00 ? 18 ASN A H    10 
ATOM 7300  H HA   . ASN A 1 18 ? -5.931  -4.592  7.289   1.00 0.00 ? 18 ASN A HA   10 
ATOM 7301  H HB2  . ASN A 1 18 ? -3.734  -2.839  7.783   1.00 0.00 ? 18 ASN A HB2  10 
ATOM 7302  H HB3  . ASN A 1 18 ? -5.131  -1.835  7.390   1.00 0.00 ? 18 ASN A HB3  10 
ATOM 7303  H HD21 . ASN A 1 18 ? -3.647  -3.562  9.923   1.00 0.00 ? 18 ASN A HD21 10 
ATOM 7304  H HD22 . ASN A 1 18 ? -4.969  -3.617  10.985  1.00 0.00 ? 18 ASN A HD22 10 
ATOM 7305  N N    . TYR A 1 19 ? -5.505  -3.035  4.506   1.00 0.00 ? 19 TYR A N    10 
ATOM 7306  C CA   . TYR A 1 19 ? -6.214  -2.401  3.361   1.00 0.00 ? 19 TYR A CA   10 
ATOM 7307  C C    . TYR A 1 19 ? -6.992  -3.472  2.590   1.00 0.00 ? 19 TYR A C    10 
ATOM 7308  O O    . TYR A 1 19 ? -6.944  -3.538  1.378   1.00 0.00 ? 19 TYR A O    10 
ATOM 7309  C CB   . TYR A 1 19 ? -5.187  -1.744  2.437   1.00 0.00 ? 19 TYR A CB   10 
ATOM 7310  C CG   . TYR A 1 19 ? -4.912  -0.352  2.921   1.00 0.00 ? 19 TYR A CG   10 
ATOM 7311  C CD1  . TYR A 1 19 ? -5.792  0.685   2.593   1.00 0.00 ? 19 TYR A CD1  10 
ATOM 7312  C CD2  . TYR A 1 19 ? -3.786  -0.095  3.703   1.00 0.00 ? 19 TYR A CD2  10 
ATOM 7313  C CE1  . TYR A 1 19 ? -5.545  1.983   3.051   1.00 0.00 ? 19 TYR A CE1  10 
ATOM 7314  C CE2  . TYR A 1 19 ? -3.540  1.201   4.159   1.00 0.00 ? 19 TYR A CE2  10 
ATOM 7315  C CZ   . TYR A 1 19 ? -4.417  2.241   3.837   1.00 0.00 ? 19 TYR A CZ   10 
ATOM 7316  O OH   . TYR A 1 19 ? -4.171  3.520   4.291   1.00 0.00 ? 19 TYR A OH   10 
ATOM 7317  H H    . TYR A 1 19 ? -4.570  -3.306  4.408   1.00 0.00 ? 19 TYR A H    10 
ATOM 7318  H HA   . TYR A 1 19 ? -6.898  -1.652  3.729   1.00 0.00 ? 19 TYR A HA   10 
ATOM 7319  H HB2  . TYR A 1 19 ? -4.272  -2.318  2.447   1.00 0.00 ? 19 TYR A HB2  10 
ATOM 7320  H HB3  . TYR A 1 19 ? -5.572  -1.702  1.435   1.00 0.00 ? 19 TYR A HB3  10 
ATOM 7321  H HD1  . TYR A 1 19 ? -6.660  0.479   1.986   1.00 0.00 ? 19 TYR A HD1  10 
ATOM 7322  H HD2  . TYR A 1 19 ? -3.101  -0.897  3.949   1.00 0.00 ? 19 TYR A HD2  10 
ATOM 7323  H HE1  . TYR A 1 19 ? -6.223  2.786   2.800   1.00 0.00 ? 19 TYR A HE1  10 
ATOM 7324  H HE2  . TYR A 1 19 ? -2.676  1.396   4.763   1.00 0.00 ? 19 TYR A HE2  10 
ATOM 7325  H HH   . TYR A 1 19 ? -3.860  3.456   5.197   1.00 0.00 ? 19 TYR A HH   10 
ATOM 7326  N N    . CYS A 1 20 ? -7.710  -4.308  3.288   1.00 0.00 ? 20 CYS A N    10 
ATOM 7327  C CA   . CYS A 1 20 ? -8.493  -5.373  2.601   1.00 0.00 ? 20 CYS A CA   10 
ATOM 7328  C C    . CYS A 1 20 ? -9.958  -5.288  3.036   1.00 0.00 ? 20 CYS A C    10 
ATOM 7329  O O    . CYS A 1 20 ? -10.262 -5.070  4.193   1.00 0.00 ? 20 CYS A O    10 
ATOM 7330  C CB   . CYS A 1 20 ? -7.928  -6.743  2.975   1.00 0.00 ? 20 CYS A CB   10 
ATOM 7331  S SG   . CYS A 1 20 ? -6.838  -7.323  1.654   1.00 0.00 ? 20 CYS A SG   10 
ATOM 7332  H H    . CYS A 1 20 ? -7.736  -4.237  4.263   1.00 0.00 ? 20 CYS A H    10 
ATOM 7333  H HA   . CYS A 1 20 ? -8.427  -5.236  1.532   1.00 0.00 ? 20 CYS A HA   10 
ATOM 7334  H HB2  . CYS A 1 20 ? -7.370  -6.666  3.895   1.00 0.00 ? 20 CYS A HB2  10 
ATOM 7335  H HB3  . CYS A 1 20 ? -8.741  -7.442  3.103   1.00 0.00 ? 20 CYS A HB3  10 
ATOM 7336  N N    . ASN A 1 21 ? -10.870 -5.455  2.116   1.00 0.00 ? 21 ASN A N    10 
ATOM 7337  C CA   . ASN A 1 21 ? -12.315 -5.379  2.476   1.00 0.00 ? 21 ASN A CA   10 
ATOM 7338  C C    . ASN A 1 21 ? -13.058 -6.561  1.850   1.00 0.00 ? 21 ASN A C    10 
ATOM 7339  O O    . ASN A 1 21 ? -14.277 -6.547  1.875   1.00 0.00 ? 21 ASN A O    10 
ATOM 7340  C CB   . ASN A 1 21 ? -12.901 -4.068  1.950   1.00 0.00 ? 21 ASN A CB   10 
ATOM 7341  C CG   . ASN A 1 21 ? -14.294 -3.854  2.548   1.00 0.00 ? 21 ASN A CG   10 
ATOM 7342  O OD1  . ASN A 1 21 ? -15.238 -3.574  1.837   1.00 0.00 ? 21 ASN A OD1  10 
ATOM 7343  N ND2  . ASN A 1 21 ? -14.464 -3.974  3.837   1.00 0.00 ? 21 ASN A ND2  10 
ATOM 7344  O OXT  . ASN A 1 21 ? -12.397 -7.459  1.357   1.00 0.00 ? 21 ASN A OXT  10 
ATOM 7345  H H    . ASN A 1 21 ? -10.605 -5.628  1.190   1.00 0.00 ? 21 ASN A H    10 
ATOM 7346  H HA   . ASN A 1 21 ? -12.419 -5.416  3.550   1.00 0.00 ? 21 ASN A HA   10 
ATOM 7347  H HB2  . ASN A 1 21 ? -12.258 -3.248  2.232   1.00 0.00 ? 21 ASN A HB2  10 
ATOM 7348  H HB3  . ASN A 1 21 ? -12.978 -4.116  0.875   1.00 0.00 ? 21 ASN A HB3  10 
ATOM 7349  H HD21 . ASN A 1 21 ? -13.704 -4.200  4.413   1.00 0.00 ? 21 ASN A HD21 10 
ATOM 7350  H HD22 . ASN A 1 21 ? -15.351 -3.839  4.229   1.00 0.00 ? 21 ASN A HD22 10 
ATOM 7351  N N    . PHE B 2 1  ? 9.446   -10.331 -5.614  1.00 0.00 ? 1  PHE B N    10 
ATOM 7352  C CA   . PHE B 2 1  ? 8.510   -9.633  -4.689  1.00 0.00 ? 1  PHE B CA   10 
ATOM 7353  C C    . PHE B 2 1  ? 9.278   -8.592  -3.873  1.00 0.00 ? 1  PHE B C    10 
ATOM 7354  O O    . PHE B 2 1  ? 9.196   -8.555  -2.662  1.00 0.00 ? 1  PHE B O    10 
ATOM 7355  C CB   . PHE B 2 1  ? 7.868   -10.656 -3.746  1.00 0.00 ? 1  PHE B CB   10 
ATOM 7356  C CG   . PHE B 2 1  ? 8.884   -11.117 -2.728  1.00 0.00 ? 1  PHE B CG   10 
ATOM 7357  C CD1  . PHE B 2 1  ? 10.091  -11.684 -3.153  1.00 0.00 ? 1  PHE B CD1  10 
ATOM 7358  C CD2  . PHE B 2 1  ? 8.620   -10.976 -1.361  1.00 0.00 ? 1  PHE B CD2  10 
ATOM 7359  C CE1  . PHE B 2 1  ? 11.035  -12.109 -2.211  1.00 0.00 ? 1  PHE B CE1  10 
ATOM 7360  C CE2  . PHE B 2 1  ? 9.563   -11.400 -0.418  1.00 0.00 ? 1  PHE B CE2  10 
ATOM 7361  C CZ   . PHE B 2 1  ? 10.772  -11.967 -0.843  1.00 0.00 ? 1  PHE B CZ   10 
ATOM 7362  H H1   . PHE B 2 1  ? 10.420  -10.232 -5.262  1.00 0.00 ? 1  PHE B H1   10 
ATOM 7363  H H2   . PHE B 2 1  ? 9.196   -11.339 -5.666  1.00 0.00 ? 1  PHE B H2   10 
ATOM 7364  H H3   . PHE B 2 1  ? 9.378   -9.906  -6.561  1.00 0.00 ? 1  PHE B H3   10 
ATOM 7365  H HA   . PHE B 2 1  ? 7.739   -9.141  -5.264  1.00 0.00 ? 1  PHE B HA   10 
ATOM 7366  H HB2  . PHE B 2 1  ? 7.031   -10.200 -3.237  1.00 0.00 ? 1  PHE B HB2  10 
ATOM 7367  H HB3  . PHE B 2 1  ? 7.522   -11.504 -4.318  1.00 0.00 ? 1  PHE B HB3  10 
ATOM 7368  H HD1  . PHE B 2 1  ? 10.295  -11.794 -4.208  1.00 0.00 ? 1  PHE B HD1  10 
ATOM 7369  H HD2  . PHE B 2 1  ? 7.689   -10.539 -1.034  1.00 0.00 ? 1  PHE B HD2  10 
ATOM 7370  H HE1  . PHE B 2 1  ? 11.966  -12.546 -2.538  1.00 0.00 ? 1  PHE B HE1  10 
ATOM 7371  H HE2  . PHE B 2 1  ? 9.359   -11.292 0.638   1.00 0.00 ? 1  PHE B HE2  10 
ATOM 7372  H HZ   . PHE B 2 1  ? 11.500  -12.295 -0.115  1.00 0.00 ? 1  PHE B HZ   10 
ATOM 7373  N N    . VAL B 2 2  ? 10.023  -7.744  -4.527  1.00 0.00 ? 2  VAL B N    10 
ATOM 7374  C CA   . VAL B 2 2  ? 10.792  -6.705  -3.786  1.00 0.00 ? 2  VAL B CA   10 
ATOM 7375  C C    . VAL B 2 2  ? 9.872   -5.524  -3.468  1.00 0.00 ? 2  VAL B C    10 
ATOM 7376  O O    . VAL B 2 2  ? 9.242   -4.963  -4.343  1.00 0.00 ? 2  VAL B O    10 
ATOM 7377  C CB   . VAL B 2 2  ? 11.962  -6.222  -4.644  1.00 0.00 ? 2  VAL B CB   10 
ATOM 7378  C CG1  . VAL B 2 2  ? 12.978  -5.500  -3.757  1.00 0.00 ? 2  VAL B CG1  10 
ATOM 7379  C CG2  . VAL B 2 2  ? 12.633  -7.424  -5.315  1.00 0.00 ? 2  VAL B CG2  10 
ATOM 7380  H H    . VAL B 2 2  ? 10.073  -7.789  -5.505  1.00 0.00 ? 2  VAL B H    10 
ATOM 7381  H HA   . VAL B 2 2  ? 11.169  -7.125  -2.866  1.00 0.00 ? 2  VAL B HA   10 
ATOM 7382  H HB   . VAL B 2 2  ? 11.596  -5.542  -5.401  1.00 0.00 ? 2  VAL B HB   10 
ATOM 7383  H HG11 . VAL B 2 2  ? 12.457  -4.959  -2.981  1.00 0.00 ? 2  VAL B HG11 10 
ATOM 7384  H HG12 . VAL B 2 2  ? 13.641  -6.224  -3.309  1.00 0.00 ? 2  VAL B HG12 10 
ATOM 7385  H HG13 . VAL B 2 2  ? 13.551  -4.808  -4.355  1.00 0.00 ? 2  VAL B HG13 10 
ATOM 7386  H HG21 . VAL B 2 2  ? 12.680  -8.246  -4.618  1.00 0.00 ? 2  VAL B HG21 10 
ATOM 7387  H HG22 . VAL B 2 2  ? 12.059  -7.718  -6.182  1.00 0.00 ? 2  VAL B HG22 10 
ATOM 7388  H HG23 . VAL B 2 2  ? 13.632  -7.153  -5.620  1.00 0.00 ? 2  VAL B HG23 10 
ATOM 7389  N N    . ASN B 2 3  ? 9.785   -5.145  -2.223  1.00 0.00 ? 3  ASN B N    10 
ATOM 7390  C CA   . ASN B 2 3  ? 8.902   -4.004  -1.854  1.00 0.00 ? 3  ASN B CA   10 
ATOM 7391  C C    . ASN B 2 3  ? 9.731   -2.720  -1.760  1.00 0.00 ? 3  ASN B C    10 
ATOM 7392  O O    . ASN B 2 3  ? 10.743  -2.669  -1.090  1.00 0.00 ? 3  ASN B O    10 
ATOM 7393  C CB   . ASN B 2 3  ? 8.245   -4.286  -0.501  1.00 0.00 ? 3  ASN B CB   10 
ATOM 7394  C CG   . ASN B 2 3  ? 7.304   -5.484  -0.630  1.00 0.00 ? 3  ASN B CG   10 
ATOM 7395  O OD1  . ASN B 2 3  ? 6.117   -5.321  -0.831  1.00 0.00 ? 3  ASN B OD1  10 
ATOM 7396  N ND2  . ASN B 2 3  ? 7.788   -6.693  -0.522  1.00 0.00 ? 3  ASN B ND2  10 
ATOM 7397  H H    . ASN B 2 3  ? 10.299  -5.611  -1.532  1.00 0.00 ? 3  ASN B H    10 
ATOM 7398  H HA   . ASN B 2 3  ? 8.138   -3.884  -2.606  1.00 0.00 ? 3  ASN B HA   10 
ATOM 7399  H HB2  . ASN B 2 3  ? 9.008   -4.503  0.231   1.00 0.00 ? 3  ASN B HB2  10 
ATOM 7400  H HB3  . ASN B 2 3  ? 7.682   -3.421  -0.187  1.00 0.00 ? 3  ASN B HB3  10 
ATOM 7401  H HD21 . ASN B 2 3  ? 8.746   -6.824  -0.359  1.00 0.00 ? 3  ASN B HD21 10 
ATOM 7402  H HD22 . ASN B 2 3  ? 7.194   -7.467  -0.602  1.00 0.00 ? 3  ASN B HD22 10 
ATOM 7403  N N    . GLN B 2 4  ? 9.306   -1.681  -2.425  1.00 0.00 ? 4  GLN B N    10 
ATOM 7404  C CA   . GLN B 2 4  ? 10.064  -0.401  -2.373  1.00 0.00 ? 4  GLN B CA   10 
ATOM 7405  C C    . GLN B 2 4  ? 9.202   0.674   -1.712  1.00 0.00 ? 4  GLN B C    10 
ATOM 7406  O O    . GLN B 2 4  ? 8.144   0.396   -1.181  1.00 0.00 ? 4  GLN B O    10 
ATOM 7407  C CB   . GLN B 2 4  ? 10.422  0.039   -3.793  1.00 0.00 ? 4  GLN B CB   10 
ATOM 7408  C CG   . GLN B 2 4  ? 10.680  -1.193  -4.662  1.00 0.00 ? 4  GLN B CG   10 
ATOM 7409  C CD   . GLN B 2 4  ? 11.601  -0.813  -5.822  1.00 0.00 ? 4  GLN B CD   10 
ATOM 7410  O OE1  . GLN B 2 4  ? 11.213  -0.073  -6.705  1.00 0.00 ? 4  GLN B OE1  10 
ATOM 7411  N NE2  . GLN B 2 4  ? 12.815  -1.290  -5.861  1.00 0.00 ? 4  GLN B NE2  10 
ATOM 7412  H H    . GLN B 2 4  ? 8.485   -1.744  -2.957  1.00 0.00 ? 4  GLN B H    10 
ATOM 7413  H HA   . GLN B 2 4  ? 10.969  -0.541  -1.800  1.00 0.00 ? 4  GLN B HA   10 
ATOM 7414  H HB2  . GLN B 2 4  ? 9.603   0.608   -4.209  1.00 0.00 ? 4  GLN B HB2  10 
ATOM 7415  H HB3  . GLN B 2 4  ? 11.311  0.651   -3.768  1.00 0.00 ? 4  GLN B HB3  10 
ATOM 7416  H HG2  . GLN B 2 4  ? 11.148  -1.961  -4.066  1.00 0.00 ? 4  GLN B HG2  10 
ATOM 7417  H HG3  . GLN B 2 4  ? 9.743   -1.560  -5.052  1.00 0.00 ? 4  GLN B HG3  10 
ATOM 7418  H HE21 . GLN B 2 4  ? 13.128  -1.888  -5.149  1.00 0.00 ? 4  GLN B HE21 10 
ATOM 7419  H HE22 . GLN B 2 4  ? 13.413  -1.052  -6.599  1.00 0.00 ? 4  GLN B HE22 10 
ATOM 7420  N N    . HIS B 2 5  ? 9.641   1.903   -1.739  1.00 0.00 ? 5  HIS B N    10 
ATOM 7421  C CA   . HIS B 2 5  ? 8.842   2.993   -1.114  1.00 0.00 ? 5  HIS B CA   10 
ATOM 7422  C C    . HIS B 2 5  ? 7.583   3.241   -1.945  1.00 0.00 ? 5  HIS B C    10 
ATOM 7423  O O    . HIS B 2 5  ? 7.628   3.301   -3.158  1.00 0.00 ? 5  HIS B O    10 
ATOM 7424  C CB   . HIS B 2 5  ? 9.682   4.271   -1.053  1.00 0.00 ? 5  HIS B CB   10 
ATOM 7425  C CG   . HIS B 2 5  ? 10.712  4.136   0.033   1.00 0.00 ? 5  HIS B CG   10 
ATOM 7426  N ND1  . HIS B 2 5  ? 10.444  3.485   1.228   1.00 0.00 ? 5  HIS B ND1  10 
ATOM 7427  C CD2  . HIS B 2 5  ? 12.018  4.551   0.120   1.00 0.00 ? 5  HIS B CD2  10 
ATOM 7428  C CE1  . HIS B 2 5  ? 11.563  3.525   1.973   1.00 0.00 ? 5  HIS B CE1  10 
ATOM 7429  N NE2  . HIS B 2 5  ? 12.553  4.165   1.345   1.00 0.00 ? 5  HIS B NE2  10 
ATOM 7430  H H    . HIS B 2 5  ? 10.497  2.108   -2.175  1.00 0.00 ? 5  HIS B H    10 
ATOM 7431  H HA   . HIS B 2 5  ? 8.561   2.702   -0.114  1.00 0.00 ? 5  HIS B HA   10 
ATOM 7432  H HB2  . HIS B 2 5  ? 10.177  4.424   -2.002  1.00 0.00 ? 5  HIS B HB2  10 
ATOM 7433  H HB3  . HIS B 2 5  ? 9.043   5.114   -0.840  1.00 0.00 ? 5  HIS B HB3  10 
ATOM 7434  H HD1  . HIS B 2 5  ? 9.593   3.074   1.484   1.00 0.00 ? 5  HIS B HD1  10 
ATOM 7435  H HD2  . HIS B 2 5  ? 12.550  5.095   -0.646  1.00 0.00 ? 5  HIS B HD2  10 
ATOM 7436  H HE1  . HIS B 2 5  ? 11.652  3.086   2.953   1.00 0.00 ? 5  HIS B HE1  10 
ATOM 7437  N N    . LEU B 2 6  ? 6.455   3.379   -1.302  1.00 0.00 ? 6  LEU B N    10 
ATOM 7438  C CA   . LEU B 2 6  ? 5.188   3.614   -2.051  1.00 0.00 ? 6  LEU B CA   10 
ATOM 7439  C C    . LEU B 2 6  ? 4.642   5.003   -1.716  1.00 0.00 ? 6  LEU B C    10 
ATOM 7440  O O    . LEU B 2 6  ? 4.011   5.199   -0.697  1.00 0.00 ? 6  LEU B O    10 
ATOM 7441  C CB   . LEU B 2 6  ? 4.158   2.557   -1.653  1.00 0.00 ? 6  LEU B CB   10 
ATOM 7442  C CG   . LEU B 2 6  ? 4.730   1.162   -1.907  1.00 0.00 ? 6  LEU B CG   10 
ATOM 7443  C CD1  . LEU B 2 6  ? 4.005   0.147   -1.023  1.00 0.00 ? 6  LEU B CD1  10 
ATOM 7444  C CD2  . LEU B 2 6  ? 4.528   0.788   -3.379  1.00 0.00 ? 6  LEU B CD2  10 
ATOM 7445  H H    . LEU B 2 6  ? 6.441   3.321   -0.323  1.00 0.00 ? 6  LEU B H    10 
ATOM 7446  H HA   . LEU B 2 6  ? 5.377   3.549   -3.110  1.00 0.00 ? 6  LEU B HA   10 
ATOM 7447  H HB2  . LEU B 2 6  ? 3.922   2.667   -0.604  1.00 0.00 ? 6  LEU B HB2  10 
ATOM 7448  H HB3  . LEU B 2 6  ? 3.261   2.690   -2.240  1.00 0.00 ? 6  LEU B HB3  10 
ATOM 7449  H HG   . LEU B 2 6  ? 5.784   1.155   -1.674  1.00 0.00 ? 6  LEU B HG   10 
ATOM 7450  H HD11 . LEU B 2 6  ? 3.337   0.666   -0.353  1.00 0.00 ? 6  LEU B HD11 10 
ATOM 7451  H HD12 . LEU B 2 6  ? 3.437   -0.529  -1.644  1.00 0.00 ? 6  LEU B HD12 10 
ATOM 7452  H HD13 . LEU B 2 6  ? 4.728   -0.412  -0.450  1.00 0.00 ? 6  LEU B HD13 10 
ATOM 7453  H HD21 . LEU B 2 6  ? 4.047   1.603   -3.896  1.00 0.00 ? 6  LEU B HD21 10 
ATOM 7454  H HD22 . LEU B 2 6  ? 5.486   0.586   -3.834  1.00 0.00 ? 6  LEU B HD22 10 
ATOM 7455  H HD23 . LEU B 2 6  ? 3.907   -0.094  -3.444  1.00 0.00 ? 6  LEU B HD23 10 
ATOM 7456  N N    . CYS B 2 7  ? 4.873   5.964   -2.566  1.00 0.00 ? 7  CYS B N    10 
ATOM 7457  C CA   . CYS B 2 7  ? 4.360   7.336   -2.294  1.00 0.00 ? 7  CYS B CA   10 
ATOM 7458  C C    . CYS B 2 7  ? 3.434   7.770   -3.433  1.00 0.00 ? 7  CYS B C    10 
ATOM 7459  O O    . CYS B 2 7  ? 3.877   8.124   -4.507  1.00 0.00 ? 7  CYS B O    10 
ATOM 7460  C CB   . CYS B 2 7  ? 5.535   8.309   -2.193  1.00 0.00 ? 7  CYS B CB   10 
ATOM 7461  S SG   . CYS B 2 7  ? 6.819   7.597   -1.135  1.00 0.00 ? 7  CYS B SG   10 
ATOM 7462  H H    . CYS B 2 7  ? 5.380   5.784   -3.384  1.00 0.00 ? 7  CYS B H    10 
ATOM 7463  H HA   . CYS B 2 7  ? 3.811   7.337   -1.363  1.00 0.00 ? 7  CYS B HA   10 
ATOM 7464  H HB2  . CYS B 2 7  ? 5.939   8.489   -3.178  1.00 0.00 ? 7  CYS B HB2  10 
ATOM 7465  H HB3  . CYS B 2 7  ? 5.196   9.242   -1.769  1.00 0.00 ? 7  CYS B HB3  10 
ATOM 7466  N N    . GLY B 2 8  ? 2.148   7.745   -3.207  1.00 0.00 ? 8  GLY B N    10 
ATOM 7467  C CA   . GLY B 2 8  ? 1.195   8.155   -4.276  1.00 0.00 ? 8  GLY B CA   10 
ATOM 7468  C C    . GLY B 2 8  ? 0.398   6.938   -4.749  1.00 0.00 ? 8  GLY B C    10 
ATOM 7469  O O    . GLY B 2 8  ? 0.119   6.033   -3.988  1.00 0.00 ? 8  GLY B O    10 
ATOM 7470  H H    . GLY B 2 8  ? 1.810   7.456   -2.333  1.00 0.00 ? 8  GLY B H    10 
ATOM 7471  H HA2  . GLY B 2 8  ? 0.517   8.900   -3.887  1.00 0.00 ? 8  GLY B HA2  10 
ATOM 7472  H HA3  . GLY B 2 8  ? 1.744   8.566   -5.109  1.00 0.00 ? 8  GLY B HA3  10 
ATOM 7473  N N    . SER B 2 9  ? 0.031   6.907   -6.001  1.00 0.00 ? 9  SER B N    10 
ATOM 7474  C CA   . SER B 2 9  ? -0.747  5.747   -6.521  1.00 0.00 ? 9  SER B CA   10 
ATOM 7475  C C    . SER B 2 9  ? 0.110   4.482   -6.442  1.00 0.00 ? 9  SER B C    10 
ATOM 7476  O O    . SER B 2 9  ? -0.374  3.382   -6.612  1.00 0.00 ? 9  SER B O    10 
ATOM 7477  C CB   . SER B 2 9  ? -1.135  6.006   -7.978  1.00 0.00 ? 9  SER B CB   10 
ATOM 7478  O OG   . SER B 2 9  ? -1.254  7.408   -8.190  1.00 0.00 ? 9  SER B OG   10 
ATOM 7479  H H    . SER B 2 9  ? 0.267   7.646   -6.599  1.00 0.00 ? 9  SER B H    10 
ATOM 7480  H HA   . SER B 2 9  ? -1.639  5.616   -5.927  1.00 0.00 ? 9  SER B HA   10 
ATOM 7481  H HB2  . SER B 2 9  ? -0.375  5.613   -8.632  1.00 0.00 ? 9  SER B HB2  10 
ATOM 7482  H HB3  . SER B 2 9  ? -2.078  5.519   -8.188  1.00 0.00 ? 9  SER B HB3  10 
ATOM 7483  H HG   . SER B 2 9  ? -2.180  7.645   -8.090  1.00 0.00 ? 9  SER B HG   10 
ATOM 7484  N N    . HIS B 2 10 ? 1.381   4.631   -6.186  1.00 0.00 ? 10 HIS B N    10 
ATOM 7485  C CA   . HIS B 2 10 ? 2.271   3.436   -6.100  1.00 0.00 ? 10 HIS B CA   10 
ATOM 7486  C C    . HIS B 2 10 ? 1.812   2.536   -4.952  1.00 0.00 ? 10 HIS B C    10 
ATOM 7487  O O    . HIS B 2 10 ? 1.868   1.327   -5.045  1.00 0.00 ? 10 HIS B O    10 
ATOM 7488  C CB   . HIS B 2 10 ? 3.710   3.890   -5.850  1.00 0.00 ? 10 HIS B CB   10 
ATOM 7489  C CG   . HIS B 2 10 ? 4.219   4.630   -7.056  1.00 0.00 ? 10 HIS B CG   10 
ATOM 7490  N ND1  . HIS B 2 10 ? 3.917   5.962   -7.288  1.00 0.00 ? 10 HIS B ND1  10 
ATOM 7491  C CD2  . HIS B 2 10 ? 5.007   4.235   -8.109  1.00 0.00 ? 10 HIS B CD2  10 
ATOM 7492  C CE1  . HIS B 2 10 ? 4.514   6.320   -8.438  1.00 0.00 ? 10 HIS B CE1  10 
ATOM 7493  N NE2  . HIS B 2 10 ? 5.194   5.305   -8.980  1.00 0.00 ? 10 HIS B NE2  10 
ATOM 7494  H H    . HIS B 2 10 ? 1.753   5.528   -6.056  1.00 0.00 ? 10 HIS B H    10 
ATOM 7495  H HA   . HIS B 2 10 ? 2.224   2.885   -7.027  1.00 0.00 ? 10 HIS B HA   10 
ATOM 7496  H HB2  . HIS B 2 10 ? 3.739   4.542   -4.989  1.00 0.00 ? 10 HIS B HB2  10 
ATOM 7497  H HB3  . HIS B 2 10 ? 4.334   3.027   -5.669  1.00 0.00 ? 10 HIS B HB3  10 
ATOM 7498  H HD1  . HIS B 2 10 ? 3.368   6.539   -6.715  1.00 0.00 ? 10 HIS B HD1  10 
ATOM 7499  H HD2  . HIS B 2 10 ? 5.420   3.247   -8.241  1.00 0.00 ? 10 HIS B HD2  10 
ATOM 7500  H HE1  . HIS B 2 10 ? 4.454   7.308   -8.871  1.00 0.00 ? 10 HIS B HE1  10 
ATOM 7501  N N    . LEU B 2 11 ? 1.359   3.109   -3.870  1.00 0.00 ? 11 LEU B N    10 
ATOM 7502  C CA   . LEU B 2 11 ? 0.901   2.266   -2.730  1.00 0.00 ? 11 LEU B CA   10 
ATOM 7503  C C    . LEU B 2 11 ? -0.377  1.531   -3.126  1.00 0.00 ? 11 LEU B C    10 
ATOM 7504  O O    . LEU B 2 11 ? -0.629  0.428   -2.684  1.00 0.00 ? 11 LEU B O    10 
ATOM 7505  C CB   . LEU B 2 11 ? 0.630   3.142   -1.507  1.00 0.00 ? 11 LEU B CB   10 
ATOM 7506  C CG   . LEU B 2 11 ? 1.044   2.380   -0.247  1.00 0.00 ? 11 LEU B CG   10 
ATOM 7507  C CD1  . LEU B 2 11 ? 1.777   3.330   0.707   1.00 0.00 ? 11 LEU B CD1  10 
ATOM 7508  C CD2  . LEU B 2 11 ? -0.201  1.810   0.439   1.00 0.00 ? 11 LEU B CD2  10 
ATOM 7509  H H    . LEU B 2 11 ? 1.321   4.086   -3.807  1.00 0.00 ? 11 LEU B H    10 
ATOM 7510  H HA   . LEU B 2 11 ? 1.669   1.544   -2.489  1.00 0.00 ? 11 LEU B HA   10 
ATOM 7511  H HB2  . LEU B 2 11 ? 1.202   4.057   -1.585  1.00 0.00 ? 11 LEU B HB2  10 
ATOM 7512  H HB3  . LEU B 2 11 ? -0.423  3.375   -1.455  1.00 0.00 ? 11 LEU B HB3  10 
ATOM 7513  H HG   . LEU B 2 11 ? 1.707   1.573   -0.522  1.00 0.00 ? 11 LEU B HG   10 
ATOM 7514  H HD11 . LEU B 2 11 ? 2.347   4.046   0.135   1.00 0.00 ? 11 LEU B HD11 10 
ATOM 7515  H HD12 . LEU B 2 11 ? 1.055   3.849   1.320   1.00 0.00 ? 11 LEU B HD12 10 
ATOM 7516  H HD13 . LEU B 2 11 ? 2.442   2.762   1.337   1.00 0.00 ? 11 LEU B HD13 10 
ATOM 7517  H HD21 . LEU B 2 11 ? -0.888  2.612   0.668   1.00 0.00 ? 11 LEU B HD21 10 
ATOM 7518  H HD22 . LEU B 2 11 ? -0.680  1.101   -0.222  1.00 0.00 ? 11 LEU B HD22 10 
ATOM 7519  H HD23 . LEU B 2 11 ? 0.086   1.311   1.353   1.00 0.00 ? 11 LEU B HD23 10 
ATOM 7520  N N    . VAL B 2 12 ? -1.184  2.123   -3.961  1.00 0.00 ? 12 VAL B N    10 
ATOM 7521  C CA   . VAL B 2 12 ? -2.434  1.437   -4.387  1.00 0.00 ? 12 VAL B CA   10 
ATOM 7522  C C    . VAL B 2 12 ? -2.057  0.193   -5.190  1.00 0.00 ? 12 VAL B C    10 
ATOM 7523  O O    . VAL B 2 12 ? -2.833  -0.731  -5.330  1.00 0.00 ? 12 VAL B O    10 
ATOM 7524  C CB   . VAL B 2 12 ? -3.275  2.376   -5.251  1.00 0.00 ? 12 VAL B CB   10 
ATOM 7525  C CG1  . VAL B 2 12 ? -4.396  1.582   -5.923  1.00 0.00 ? 12 VAL B CG1  10 
ATOM 7526  C CG2  . VAL B 2 12 ? -3.885  3.467   -4.368  1.00 0.00 ? 12 VAL B CG2  10 
ATOM 7527  H H    . VAL B 2 12 ? -0.963  3.009   -4.317  1.00 0.00 ? 12 VAL B H    10 
ATOM 7528  H HA   . VAL B 2 12 ? -3.001  1.146   -3.513  1.00 0.00 ? 12 VAL B HA   10 
ATOM 7529  H HB   . VAL B 2 12 ? -2.649  2.830   -6.007  1.00 0.00 ? 12 VAL B HB   10 
ATOM 7530  H HG11 . VAL B 2 12 ? -4.892  0.968   -5.187  1.00 0.00 ? 12 VAL B HG11 10 
ATOM 7531  H HG12 . VAL B 2 12 ? -5.109  2.267   -6.361  1.00 0.00 ? 12 VAL B HG12 10 
ATOM 7532  H HG13 . VAL B 2 12 ? -3.980  0.954   -6.696  1.00 0.00 ? 12 VAL B HG13 10 
ATOM 7533  H HG21 . VAL B 2 12 ? -4.170  3.040   -3.417  1.00 0.00 ? 12 VAL B HG21 10 
ATOM 7534  H HG22 . VAL B 2 12 ? -3.160  4.251   -4.208  1.00 0.00 ? 12 VAL B HG22 10 
ATOM 7535  H HG23 . VAL B 2 12 ? -4.759  3.876   -4.853  1.00 0.00 ? 12 VAL B HG23 10 
ATOM 7536  N N    . GLU B 2 13 ? -0.858  0.164   -5.709  1.00 0.00 ? 13 GLU B N    10 
ATOM 7537  C CA   . GLU B 2 13 ? -0.410  -1.018  -6.493  1.00 0.00 ? 13 GLU B CA   10 
ATOM 7538  C C    . GLU B 2 13 ? -0.041  -2.143  -5.525  1.00 0.00 ? 13 GLU B C    10 
ATOM 7539  O O    . GLU B 2 13 ? -0.063  -3.308  -5.870  1.00 0.00 ? 13 GLU B O    10 
ATOM 7540  C CB   . GLU B 2 13 ? 0.813   -0.640  -7.332  1.00 0.00 ? 13 GLU B CB   10 
ATOM 7541  C CG   . GLU B 2 13 ? 0.362   0.094   -8.595  1.00 0.00 ? 13 GLU B CG   10 
ATOM 7542  C CD   . GLU B 2 13 ? 1.532   0.900   -9.163  1.00 0.00 ? 13 GLU B CD   10 
ATOM 7543  O OE1  . GLU B 2 13 ? 2.560   0.303   -9.432  1.00 0.00 ? 13 GLU B OE1  10 
ATOM 7544  O OE2  . GLU B 2 13 ? 1.378   2.100   -9.318  1.00 0.00 ? 13 GLU B OE2  10 
ATOM 7545  H H    . GLU B 2 13 ? -0.248  0.919   -5.572  1.00 0.00 ? 13 GLU B H    10 
ATOM 7546  H HA   . GLU B 2 13 ? -1.208  -1.347  -7.144  1.00 0.00 ? 13 GLU B HA   10 
ATOM 7547  H HB2  . GLU B 2 13 ? 1.460   0.003   -6.753  1.00 0.00 ? 13 GLU B HB2  10 
ATOM 7548  H HB3  . GLU B 2 13 ? 1.350   -1.535  -7.610  1.00 0.00 ? 13 GLU B HB3  10 
ATOM 7549  H HG2  . GLU B 2 13 ? 0.027   -0.627  -9.328  1.00 0.00 ? 13 GLU B HG2  10 
ATOM 7550  H HG3  . GLU B 2 13 ? -0.451  0.763   -8.353  1.00 0.00 ? 13 GLU B HG3  10 
ATOM 7551  N N    . ALA B 2 14 ? 0.291   -1.799  -4.312  1.00 0.00 ? 14 ALA B N    10 
ATOM 7552  C CA   . ALA B 2 14 ? 0.654   -2.839  -3.310  1.00 0.00 ? 14 ALA B CA   10 
ATOM 7553  C C    . ALA B 2 14 ? -0.579  -3.169  -2.469  1.00 0.00 ? 14 ALA B C    10 
ATOM 7554  O O    . ALA B 2 14 ? -0.653  -4.201  -1.830  1.00 0.00 ? 14 ALA B O    10 
ATOM 7555  C CB   . ALA B 2 14 ? 1.764   -2.308  -2.402  1.00 0.00 ? 14 ALA B CB   10 
ATOM 7556  H H    . ALA B 2 14 ? 0.295   -0.853  -4.054  1.00 0.00 ? 14 ALA B H    10 
ATOM 7557  H HA   . ALA B 2 14 ? 0.995   -3.729  -3.819  1.00 0.00 ? 14 ALA B HA   10 
ATOM 7558  H HB1  . ALA B 2 14 ? 2.447   -1.705  -2.983  1.00 0.00 ? 14 ALA B HB1  10 
ATOM 7559  H HB2  . ALA B 2 14 ? 1.330   -1.705  -1.618  1.00 0.00 ? 14 ALA B HB2  10 
ATOM 7560  H HB3  . ALA B 2 14 ? 2.301   -3.138  -1.966  1.00 0.00 ? 14 ALA B HB3  10 
ATOM 7561  N N    . LEU B 2 15 ? -1.551  -2.297  -2.466  1.00 0.00 ? 15 LEU B N    10 
ATOM 7562  C CA   . LEU B 2 15 ? -2.785  -2.552  -1.670  1.00 0.00 ? 15 LEU B CA   10 
ATOM 7563  C C    . LEU B 2 15 ? -3.637  -3.608  -2.382  1.00 0.00 ? 15 LEU B C    10 
ATOM 7564  O O    . LEU B 2 15 ? -4.054  -4.583  -1.791  1.00 0.00 ? 15 LEU B O    10 
ATOM 7565  C CB   . LEU B 2 15 ? -3.586  -1.255  -1.536  1.00 0.00 ? 15 LEU B CB   10 
ATOM 7566  C CG   . LEU B 2 15 ? -2.841  -0.294  -0.610  1.00 0.00 ? 15 LEU B CG   10 
ATOM 7567  C CD1  . LEU B 2 15 ? -3.705  0.940   -0.347  1.00 0.00 ? 15 LEU B CD1  10 
ATOM 7568  C CD2  . LEU B 2 15 ? -2.542  -0.996  0.718   1.00 0.00 ? 15 LEU B CD2  10 
ATOM 7569  H H    . LEU B 2 15 ? -1.471  -1.473  -2.990  1.00 0.00 ? 15 LEU B H    10 
ATOM 7570  H HA   . LEU B 2 15 ? -2.513  -2.910  -0.689  1.00 0.00 ? 15 LEU B HA   10 
ATOM 7571  H HB2  . LEU B 2 15 ? -3.702  -0.801  -2.510  1.00 0.00 ? 15 LEU B HB2  10 
ATOM 7572  H HB3  . LEU B 2 15 ? -4.558  -1.472  -1.122  1.00 0.00 ? 15 LEU B HB3  10 
ATOM 7573  H HG   . LEU B 2 15 ? -1.914  0.007   -1.074  1.00 0.00 ? 15 LEU B HG   10 
ATOM 7574  H HD11 . LEU B 2 15 ? -4.654  0.634   0.064   1.00 0.00 ? 15 LEU B HD11 10 
ATOM 7575  H HD12 . LEU B 2 15 ? -3.201  1.590   0.355   1.00 0.00 ? 15 LEU B HD12 10 
ATOM 7576  H HD13 . LEU B 2 15 ? -3.867  1.471   -1.276  1.00 0.00 ? 15 LEU B HD13 10 
ATOM 7577  H HD21 . LEU B 2 15 ? -3.288  -1.758  0.897   1.00 0.00 ? 15 LEU B HD21 10 
ATOM 7578  H HD22 . LEU B 2 15 ? -1.566  -1.454  0.673   1.00 0.00 ? 15 LEU B HD22 10 
ATOM 7579  H HD23 . LEU B 2 15 ? -2.566  -0.275  1.520   1.00 0.00 ? 15 LEU B HD23 10 
ATOM 7580  N N    . HIS B 2 16 ? -3.895  -3.419  -3.649  1.00 0.00 ? 16 HIS B N    10 
ATOM 7581  C CA   . HIS B 2 16 ? -4.716  -4.411  -4.398  1.00 0.00 ? 16 HIS B CA   10 
ATOM 7582  C C    . HIS B 2 16 ? -3.936  -5.725  -4.514  1.00 0.00 ? 16 HIS B C    10 
ATOM 7583  O O    . HIS B 2 16 ? -4.495  -6.802  -4.452  1.00 0.00 ? 16 HIS B O    10 
ATOM 7584  C CB   . HIS B 2 16 ? -5.035  -3.856  -5.798  1.00 0.00 ? 16 HIS B CB   10 
ATOM 7585  C CG   . HIS B 2 16 ? -3.885  -4.112  -6.737  1.00 0.00 ? 16 HIS B CG   10 
ATOM 7586  N ND1  . HIS B 2 16 ? -4.004  -4.949  -7.836  1.00 0.00 ? 16 HIS B ND1  10 
ATOM 7587  C CD2  . HIS B 2 16 ? -2.597  -3.643  -6.760  1.00 0.00 ? 16 HIS B CD2  10 
ATOM 7588  C CE1  . HIS B 2 16 ? -2.816  -4.958  -8.468  1.00 0.00 ? 16 HIS B CE1  10 
ATOM 7589  N NE2  . HIS B 2 16 ? -1.921  -4.180  -7.852  1.00 0.00 ? 16 HIS B NE2  10 
ATOM 7590  H H    . HIS B 2 16 ? -3.547  -2.626  -4.107  1.00 0.00 ? 16 HIS B H    10 
ATOM 7591  H HA   . HIS B 2 16 ? -5.638  -4.589  -3.865  1.00 0.00 ? 16 HIS B HA   10 
ATOM 7592  H HB2  . HIS B 2 16 ? -5.922  -4.337  -6.179  1.00 0.00 ? 16 HIS B HB2  10 
ATOM 7593  H HB3  . HIS B 2 16 ? -5.205  -2.794  -5.727  1.00 0.00 ? 16 HIS B HB3  10 
ATOM 7594  H HD1  . HIS B 2 16 ? -4.806  -5.445  -8.104  1.00 0.00 ? 16 HIS B HD1  10 
ATOM 7595  H HD2  . HIS B 2 16 ? -2.171  -2.966  -6.036  1.00 0.00 ? 16 HIS B HD2  10 
ATOM 7596  H HE1  . HIS B 2 16 ? -2.611  -5.526  -9.363  1.00 0.00 ? 16 HIS B HE1  10 
ATOM 7597  N N    . LEU B 2 17 ? -2.645  -5.637  -4.685  1.00 0.00 ? 17 LEU B N    10 
ATOM 7598  C CA   . LEU B 2 17 ? -1.819  -6.868  -4.805  1.00 0.00 ? 17 LEU B CA   10 
ATOM 7599  C C    . LEU B 2 17 ? -1.990  -7.720  -3.544  1.00 0.00 ? 17 LEU B C    10 
ATOM 7600  O O    . LEU B 2 17 ? -1.940  -8.934  -3.592  1.00 0.00 ? 17 LEU B O    10 
ATOM 7601  C CB   . LEU B 2 17 ? -0.349  -6.475  -4.968  1.00 0.00 ? 17 LEU B CB   10 
ATOM 7602  C CG   . LEU B 2 17 ? 0.496   -7.725  -5.222  1.00 0.00 ? 17 LEU B CG   10 
ATOM 7603  C CD1  . LEU B 2 17 ? 0.040   -8.400  -6.517  1.00 0.00 ? 17 LEU B CD1  10 
ATOM 7604  C CD2  . LEU B 2 17 ? 1.968   -7.324  -5.350  1.00 0.00 ? 17 LEU B CD2  10 
ATOM 7605  H H    . LEU B 2 17 ? -2.218  -4.757  -4.732  1.00 0.00 ? 17 LEU B H    10 
ATOM 7606  H HA   . LEU B 2 17 ? -2.139  -7.433  -5.668  1.00 0.00 ? 17 LEU B HA   10 
ATOM 7607  H HB2  . LEU B 2 17 ? -0.249  -5.798  -5.802  1.00 0.00 ? 17 LEU B HB2  10 
ATOM 7608  H HB3  . LEU B 2 17 ? -0.007  -5.989  -4.067  1.00 0.00 ? 17 LEU B HB3  10 
ATOM 7609  H HG   . LEU B 2 17 ? 0.380   -8.413  -4.397  1.00 0.00 ? 17 LEU B HG   10 
ATOM 7610  H HD11 . LEU B 2 17 ? 0.154   -7.711  -7.342  1.00 0.00 ? 17 LEU B HD11 10 
ATOM 7611  H HD12 . LEU B 2 17 ? 0.643   -9.278  -6.697  1.00 0.00 ? 17 LEU B HD12 10 
ATOM 7612  H HD13 . LEU B 2 17 ? -0.997  -8.687  -6.429  1.00 0.00 ? 17 LEU B HD13 10 
ATOM 7613  H HD21 . LEU B 2 17 ? 2.033   -6.314  -5.728  1.00 0.00 ? 17 LEU B HD21 10 
ATOM 7614  H HD22 . LEU B 2 17 ? 2.440   -7.376  -4.381  1.00 0.00 ? 17 LEU B HD22 10 
ATOM 7615  H HD23 . LEU B 2 17 ? 2.466   -7.996  -6.032  1.00 0.00 ? 17 LEU B HD23 10 
ATOM 7616  N N    . VAL B 2 18 ? -2.200  -7.096  -2.418  1.00 0.00 ? 18 VAL B N    10 
ATOM 7617  C CA   . VAL B 2 18 ? -2.380  -7.873  -1.160  1.00 0.00 ? 18 VAL B CA   10 
ATOM 7618  C C    . VAL B 2 18 ? -3.747  -8.559  -1.184  1.00 0.00 ? 18 VAL B C    10 
ATOM 7619  O O    . VAL B 2 18 ? -3.872  -9.728  -0.872  1.00 0.00 ? 18 VAL B O    10 
ATOM 7620  C CB   . VAL B 2 18 ? -2.305  -6.930  0.043   1.00 0.00 ? 18 VAL B CB   10 
ATOM 7621  C CG1  . VAL B 2 18 ? -2.624  -7.704  1.323   1.00 0.00 ? 18 VAL B CG1  10 
ATOM 7622  C CG2  . VAL B 2 18 ? -0.892  -6.348  0.142   1.00 0.00 ? 18 VAL B CG2  10 
ATOM 7623  H H    . VAL B 2 18 ? -2.240  -6.118  -2.401  1.00 0.00 ? 18 VAL B H    10 
ATOM 7624  H HA   . VAL B 2 18 ? -1.603  -8.619  -1.082  1.00 0.00 ? 18 VAL B HA   10 
ATOM 7625  H HB   . VAL B 2 18 ? -3.018  -6.127  -0.082  1.00 0.00 ? 18 VAL B HB   10 
ATOM 7626  H HG11 . VAL B 2 18 ? -2.531  -8.764  1.135   1.00 0.00 ? 18 VAL B HG11 10 
ATOM 7627  H HG12 . VAL B 2 18 ? -1.933  -7.415  2.102   1.00 0.00 ? 18 VAL B HG12 10 
ATOM 7628  H HG13 . VAL B 2 18 ? -3.632  -7.481  1.636   1.00 0.00 ? 18 VAL B HG13 10 
ATOM 7629  H HG21 . VAL B 2 18 ? -0.434  -6.346  -0.835  1.00 0.00 ? 18 VAL B HG21 10 
ATOM 7630  H HG22 . VAL B 2 18 ? -0.945  -5.338  0.517   1.00 0.00 ? 18 VAL B HG22 10 
ATOM 7631  H HG23 . VAL B 2 18 ? -0.301  -6.952  0.815   1.00 0.00 ? 18 VAL B HG23 10 
ATOM 7632  N N    . CYS B 2 19 ? -4.774  -7.846  -1.556  1.00 0.00 ? 19 CYS B N    10 
ATOM 7633  C CA   . CYS B 2 19 ? -6.130  -8.461  -1.608  1.00 0.00 ? 19 CYS B CA   10 
ATOM 7634  C C    . CYS B 2 19 ? -6.361  -9.074  -2.989  1.00 0.00 ? 19 CYS B C    10 
ATOM 7635  O O    . CYS B 2 19 ? -6.276  -10.272 -3.170  1.00 0.00 ? 19 CYS B O    10 
ATOM 7636  C CB   . CYS B 2 19 ? -7.190  -7.395  -1.347  1.00 0.00 ? 19 CYS B CB   10 
ATOM 7637  S SG   . CYS B 2 19 ? -8.103  -7.808  0.158   1.00 0.00 ? 19 CYS B SG   10 
ATOM 7638  H H    . CYS B 2 19 ? -4.652  -6.907  -1.809  1.00 0.00 ? 19 CYS B H    10 
ATOM 7639  H HA   . CYS B 2 19 ? -6.208  -9.228  -0.856  1.00 0.00 ? 19 CYS B HA   10 
ATOM 7640  H HB2  . CYS B 2 19 ? -6.716  -6.430  -1.232  1.00 0.00 ? 19 CYS B HB2  10 
ATOM 7641  H HB3  . CYS B 2 19 ? -7.869  -7.364  -2.181  1.00 0.00 ? 19 CYS B HB3  10 
ATOM 7642  N N    . GLY B 2 20 ? -6.651  -8.259  -3.965  1.00 0.00 ? 20 GLY B N    10 
ATOM 7643  C CA   . GLY B 2 20 ? -6.888  -8.792  -5.336  1.00 0.00 ? 20 GLY B CA   10 
ATOM 7644  C C    . GLY B 2 20 ? -8.043  -8.028  -5.987  1.00 0.00 ? 20 GLY B C    10 
ATOM 7645  O O    . GLY B 2 20 ? -8.191  -6.837  -5.807  1.00 0.00 ? 20 GLY B O    10 
ATOM 7646  H H    . GLY B 2 20 ? -6.715  -7.294  -3.797  1.00 0.00 ? 20 GLY B H    10 
ATOM 7647  H HA2  . GLY B 2 20 ? -5.993  -8.668  -5.930  1.00 0.00 ? 20 GLY B HA2  10 
ATOM 7648  H HA3  . GLY B 2 20 ? -7.141  -9.839  -5.277  1.00 0.00 ? 20 GLY B HA3  10 
ATOM 7649  N N    . GLU B 2 21 ? -8.861  -8.706  -6.743  1.00 0.00 ? 21 GLU B N    10 
ATOM 7650  C CA   . GLU B 2 21 ? -10.006 -8.022  -7.405  1.00 0.00 ? 21 GLU B CA   10 
ATOM 7651  C C    . GLU B 2 21 ? -11.041 -7.619  -6.354  1.00 0.00 ? 21 GLU B C    10 
ATOM 7652  O O    . GLU B 2 21 ? -11.816 -6.705  -6.550  1.00 0.00 ? 21 GLU B O    10 
ATOM 7653  C CB   . GLU B 2 21 ? -10.650 -8.976  -8.410  1.00 0.00 ? 21 GLU B CB   10 
ATOM 7654  C CG   . GLU B 2 21 ? -10.303 -8.534  -9.833  1.00 0.00 ? 21 GLU B CG   10 
ATOM 7655  C CD   . GLU B 2 21 ? -11.576 -8.101  -10.561 1.00 0.00 ? 21 GLU B CD   10 
ATOM 7656  O OE1  . GLU B 2 21 ? -12.555 -7.827  -9.888  1.00 0.00 ? 21 GLU B OE1  10 
ATOM 7657  O OE2  . GLU B 2 21 ? -11.551 -8.052  -11.779 1.00 0.00 ? 21 GLU B OE2  10 
ATOM 7658  H H    . GLU B 2 21 ? -8.722  -9.668  -6.875  1.00 0.00 ? 21 GLU B H    10 
ATOM 7659  H HA   . GLU B 2 21 ? -9.652  -7.141  -7.920  1.00 0.00 ? 21 GLU B HA   10 
ATOM 7660  H HB2  . GLU B 2 21 ? -10.281 -9.977  -8.241  1.00 0.00 ? 21 GLU B HB2  10 
ATOM 7661  H HB3  . GLU B 2 21 ? -11.722 -8.961  -8.283  1.00 0.00 ? 21 GLU B HB3  10 
ATOM 7662  H HG2  . GLU B 2 21 ? -9.609  -7.705  -9.792  1.00 0.00 ? 21 GLU B HG2  10 
ATOM 7663  H HG3  . GLU B 2 21 ? -9.847  -9.357  -10.364 1.00 0.00 ? 21 GLU B HG3  10 
ATOM 7664  N N    . ARG B 2 22 ? -11.058 -8.301  -5.240  1.00 0.00 ? 22 ARG B N    10 
ATOM 7665  C CA   . ARG B 2 22 ? -12.042 -7.971  -4.166  1.00 0.00 ? 22 ARG B CA   10 
ATOM 7666  C C    . ARG B 2 22 ? -12.189 -6.453  -4.046  1.00 0.00 ? 22 ARG B C    10 
ATOM 7667  O O    . ARG B 2 22 ? -13.218 -5.891  -4.367  1.00 0.00 ? 22 ARG B O    10 
ATOM 7668  C CB   . ARG B 2 22 ? -11.549 -8.538  -2.833  1.00 0.00 ? 22 ARG B CB   10 
ATOM 7669  C CG   . ARG B 2 22 ? -11.222 -10.023 -2.996  1.00 0.00 ? 22 ARG B CG   10 
ATOM 7670  C CD   . ARG B 2 22 ? -12.139 -10.849 -2.090  1.00 0.00 ? 22 ARG B CD   10 
ATOM 7671  N NE   . ARG B 2 22 ? -11.892 -12.299 -2.321  1.00 0.00 ? 22 ARG B NE   10 
ATOM 7672  C CZ   . ARG B 2 22 ? -12.334 -13.185 -1.468  1.00 0.00 ? 22 ARG B CZ   10 
ATOM 7673  N NH1  . ARG B 2 22 ? -12.990 -12.803 -0.404  1.00 0.00 ? 22 ARG B NH1  10 
ATOM 7674  N NH2  . ARG B 2 22 ? -12.120 -14.455 -1.678  1.00 0.00 ? 22 ARG B NH2  10 
ATOM 7675  H H    . ARG B 2 22 ? -10.424 -9.037  -5.111  1.00 0.00 ? 22 ARG B H    10 
ATOM 7676  H HA   . ARG B 2 22 ? -12.999 -8.407  -4.409  1.00 0.00 ? 22 ARG B HA   10 
ATOM 7677  H HB2  . ARG B 2 22 ? -10.662 -8.004  -2.522  1.00 0.00 ? 22 ARG B HB2  10 
ATOM 7678  H HB3  . ARG B 2 22 ? -12.318 -8.420  -2.084  1.00 0.00 ? 22 ARG B HB3  10 
ATOM 7679  H HG2  . ARG B 2 22 ? -11.374 -10.315 -4.025  1.00 0.00 ? 22 ARG B HG2  10 
ATOM 7680  H HG3  . ARG B 2 22 ? -10.193 -10.198 -2.718  1.00 0.00 ? 22 ARG B HG3  10 
ATOM 7681  H HD2  . ARG B 2 22 ? -11.932 -10.611 -1.055  1.00 0.00 ? 22 ARG B HD2  10 
ATOM 7682  H HD3  . ARG B 2 22 ? -13.168 -10.618 -2.314  1.00 0.00 ? 22 ARG B HD3  10 
ATOM 7683  H HE   . ARG B 2 22 ? -11.398 -12.590 -3.117  1.00 0.00 ? 22 ARG B HE   10 
ATOM 7684  H HH11 . ARG B 2 22 ? -13.155 -11.830 -0.241  1.00 0.00 ? 22 ARG B HH11 10 
ATOM 7685  H HH12 . ARG B 2 22 ? -13.326 -13.484 0.245   1.00 0.00 ? 22 ARG B HH12 10 
ATOM 7686  H HH21 . ARG B 2 22 ? -11.617 -14.750 -2.491  1.00 0.00 ? 22 ARG B HH21 10 
ATOM 7687  H HH22 . ARG B 2 22 ? -12.459 -15.133 -1.026  1.00 0.00 ? 22 ARG B HH22 10 
ATOM 7688  N N    . GLY B 2 23 ? -11.169 -5.782  -3.582  1.00 0.00 ? 23 GLY B N    10 
ATOM 7689  C CA   . GLY B 2 23 ? -11.254 -4.300  -3.441  1.00 0.00 ? 23 GLY B CA   10 
ATOM 7690  C C    . GLY B 2 23 ? -10.604 -3.871  -2.125  1.00 0.00 ? 23 GLY B C    10 
ATOM 7691  O O    . GLY B 2 23 ? -10.558 -4.623  -1.170  1.00 0.00 ? 23 GLY B O    10 
ATOM 7692  H H    . GLY B 2 23 ? -10.349 -6.253  -3.328  1.00 0.00 ? 23 GLY B H    10 
ATOM 7693  H HA2  . GLY B 2 23 ? -10.740 -3.831  -4.268  1.00 0.00 ? 23 GLY B HA2  10 
ATOM 7694  H HA3  . GLY B 2 23 ? -12.290 -3.997  -3.441  1.00 0.00 ? 23 GLY B HA3  10 
ATOM 7695  N N    . PHE B 2 24 ? -10.101 -2.669  -2.066  1.00 0.00 ? 24 PHE B N    10 
ATOM 7696  C CA   . PHE B 2 24 ? -9.454  -2.190  -0.812  1.00 0.00 ? 24 PHE B CA   10 
ATOM 7697  C C    . PHE B 2 24 ? -9.736  -0.698  -0.633  1.00 0.00 ? 24 PHE B C    10 
ATOM 7698  O O    . PHE B 2 24 ? -9.670  0.072   -1.572  1.00 0.00 ? 24 PHE B O    10 
ATOM 7699  C CB   . PHE B 2 24 ? -7.943  -2.412  -0.904  1.00 0.00 ? 24 PHE B CB   10 
ATOM 7700  C CG   . PHE B 2 24 ? -7.442  -1.871  -2.216  1.00 0.00 ? 24 PHE B CG   10 
ATOM 7701  C CD1  . PHE B 2 24 ? -7.592  -2.630  -3.378  1.00 0.00 ? 24 PHE B CD1  10 
ATOM 7702  C CD2  . PHE B 2 24 ? -6.834  -0.610  -2.274  1.00 0.00 ? 24 PHE B CD2  10 
ATOM 7703  C CE1  . PHE B 2 24 ? -7.133  -2.135  -4.602  1.00 0.00 ? 24 PHE B CE1  10 
ATOM 7704  C CE2  . PHE B 2 24 ? -6.375  -0.112  -3.498  1.00 0.00 ? 24 PHE B CE2  10 
ATOM 7705  C CZ   . PHE B 2 24 ? -6.525  -0.875  -4.664  1.00 0.00 ? 24 PHE B CZ   10 
ATOM 7706  H H    . PHE B 2 24 ? -10.148 -2.079  -2.848  1.00 0.00 ? 24 PHE B H    10 
ATOM 7707  H HA   . PHE B 2 24 ? -9.848  -2.737  0.031   1.00 0.00 ? 24 PHE B HA   10 
ATOM 7708  H HB2  . PHE B 2 24 ? -7.451  -1.901  -0.089  1.00 0.00 ? 24 PHE B HB2  10 
ATOM 7709  H HB3  . PHE B 2 24 ? -7.730  -3.469  -0.850  1.00 0.00 ? 24 PHE B HB3  10 
ATOM 7710  H HD1  . PHE B 2 24 ? -8.061  -3.602  -3.325  1.00 0.00 ? 24 PHE B HD1  10 
ATOM 7711  H HD2  . PHE B 2 24 ? -6.719  -0.022  -1.375  1.00 0.00 ? 24 PHE B HD2  10 
ATOM 7712  H HE1  . PHE B 2 24 ? -7.248  -2.723  -5.499  1.00 0.00 ? 24 PHE B HE1  10 
ATOM 7713  H HE2  . PHE B 2 24 ? -5.906  0.860   -3.545  1.00 0.00 ? 24 PHE B HE2  10 
ATOM 7714  H HZ   . PHE B 2 24 ? -6.171  -0.491  -5.610  1.00 0.00 ? 24 PHE B HZ   10 
ATOM 7715  N N    . PHE B 2 25 ? -10.051 -0.282  0.562   1.00 0.00 ? 25 PHE B N    10 
ATOM 7716  C CA   . PHE B 2 25 ? -10.337 1.161   0.796   1.00 0.00 ? 25 PHE B CA   10 
ATOM 7717  C C    . PHE B 2 25 ? -9.026  1.908   1.057   1.00 0.00 ? 25 PHE B C    10 
ATOM 7718  O O    . PHE B 2 25 ? -8.381  1.716   2.068   1.00 0.00 ? 25 PHE B O    10 
ATOM 7719  C CB   . PHE B 2 25 ? -11.266 1.308   2.005   1.00 0.00 ? 25 PHE B CB   10 
ATOM 7720  C CG   . PHE B 2 25 ? -10.547 0.879   3.260   1.00 0.00 ? 25 PHE B CG   10 
ATOM 7721  C CD1  . PHE B 2 25 ? -10.472 -0.480  3.596   1.00 0.00 ? 25 PHE B CD1  10 
ATOM 7722  C CD2  . PHE B 2 25 ? -9.954  1.837   4.090   1.00 0.00 ? 25 PHE B CD2  10 
ATOM 7723  C CE1  . PHE B 2 25 ? -9.806  -0.877  4.761   1.00 0.00 ? 25 PHE B CE1  10 
ATOM 7724  C CE2  . PHE B 2 25 ? -9.288  1.440   5.255   1.00 0.00 ? 25 PHE B CE2  10 
ATOM 7725  C CZ   . PHE B 2 25 ? -9.214  0.082   5.590   1.00 0.00 ? 25 PHE B CZ   10 
ATOM 7726  H H    . PHE B 2 25 ? -10.097 -0.920  1.307   1.00 0.00 ? 25 PHE B H    10 
ATOM 7727  H HA   . PHE B 2 25 ? -10.817 1.575   -0.078  1.00 0.00 ? 25 PHE B HA   10 
ATOM 7728  H HB2  . PHE B 2 25 ? -11.570 2.340   2.101   1.00 0.00 ? 25 PHE B HB2  10 
ATOM 7729  H HB3  . PHE B 2 25 ? -12.140 0.689   1.862   1.00 0.00 ? 25 PHE B HB3  10 
ATOM 7730  H HD1  . PHE B 2 25 ? -10.929 -1.220  2.955   1.00 0.00 ? 25 PHE B HD1  10 
ATOM 7731  H HD2  . PHE B 2 25 ? -10.011 2.883   3.831   1.00 0.00 ? 25 PHE B HD2  10 
ATOM 7732  H HE1  . PHE B 2 25 ? -9.749  -1.924  5.020   1.00 0.00 ? 25 PHE B HE1  10 
ATOM 7733  H HE2  . PHE B 2 25 ? -8.830  2.180   5.895   1.00 0.00 ? 25 PHE B HE2  10 
ATOM 7734  H HZ   . PHE B 2 25 ? -8.700  -0.224  6.490   1.00 0.00 ? 25 PHE B HZ   10 
ATOM 7735  N N    . TYR B 2 26 ? -8.630  2.760   0.152   1.00 0.00 ? 26 TYR B N    10 
ATOM 7736  C CA   . TYR B 2 26 ? -7.363  3.523   0.349   1.00 0.00 ? 26 TYR B CA   10 
ATOM 7737  C C    . TYR B 2 26 ? -7.695  4.902   0.924   1.00 0.00 ? 26 TYR B C    10 
ATOM 7738  O O    . TYR B 2 26 ? -8.848  5.261   1.064   1.00 0.00 ? 26 TYR B O    10 
ATOM 7739  C CB   . TYR B 2 26 ? -6.652  3.687   -0.999  1.00 0.00 ? 26 TYR B CB   10 
ATOM 7740  C CG   . TYR B 2 26 ? -5.235  4.162   -0.774  1.00 0.00 ? 26 TYR B CG   10 
ATOM 7741  C CD1  . TYR B 2 26 ? -4.459  3.605   0.250   1.00 0.00 ? 26 TYR B CD1  10 
ATOM 7742  C CD2  . TYR B 2 26 ? -4.698  5.163   -1.591  1.00 0.00 ? 26 TYR B CD2  10 
ATOM 7743  C CE1  . TYR B 2 26 ? -3.147  4.048   0.456   1.00 0.00 ? 26 TYR B CE1  10 
ATOM 7744  C CE2  . TYR B 2 26 ? -3.385  5.607   -1.384  1.00 0.00 ? 26 TYR B CE2  10 
ATOM 7745  C CZ   . TYR B 2 26 ? -2.611  5.048   -0.361  1.00 0.00 ? 26 TYR B CZ   10 
ATOM 7746  O OH   . TYR B 2 26 ? -1.318  5.485   -0.159  1.00 0.00 ? 26 TYR B OH   10 
ATOM 7747  H H    . TYR B 2 26 ? -9.165  2.903   -0.656  1.00 0.00 ? 26 TYR B H    10 
ATOM 7748  H HA   . TYR B 2 26 ? -6.723  2.989   1.033   1.00 0.00 ? 26 TYR B HA   10 
ATOM 7749  H HB2  . TYR B 2 26 ? -6.634  2.737   -1.514  1.00 0.00 ? 26 TYR B HB2  10 
ATOM 7750  H HB3  . TYR B 2 26 ? -7.183  4.411   -1.599  1.00 0.00 ? 26 TYR B HB3  10 
ATOM 7751  H HD1  . TYR B 2 26 ? -4.871  2.834   0.882   1.00 0.00 ? 26 TYR B HD1  10 
ATOM 7752  H HD2  . TYR B 2 26 ? -5.295  5.595   -2.379  1.00 0.00 ? 26 TYR B HD2  10 
ATOM 7753  H HE1  . TYR B 2 26 ? -2.550  3.617   1.245   1.00 0.00 ? 26 TYR B HE1  10 
ATOM 7754  H HE2  . TYR B 2 26 ? -2.971  6.380   -2.015  1.00 0.00 ? 26 TYR B HE2  10 
ATOM 7755  H HH   . TYR B 2 26 ? -1.120  6.149   -0.823  1.00 0.00 ? 26 TYR B HH   10 
ATOM 7756  N N    . THR B 2 27 ? -6.701  5.681   1.256   1.00 0.00 ? 27 THR B N    10 
ATOM 7757  C CA   . THR B 2 27 ? -6.981  7.031   1.818   1.00 0.00 ? 27 THR B CA   10 
ATOM 7758  C C    . THR B 2 27 ? -6.224  8.102   1.021   1.00 0.00 ? 27 THR B C    10 
ATOM 7759  O O    . THR B 2 27 ? -5.541  8.925   1.599   1.00 0.00 ? 27 THR B O    10 
ATOM 7760  C CB   . THR B 2 27 ? -6.535  7.078   3.280   1.00 0.00 ? 27 THR B CB   10 
ATOM 7761  O OG1  . THR B 2 27 ? -6.506  5.759   3.809   1.00 0.00 ? 27 THR B OG1  10 
ATOM 7762  C CG2  . THR B 2 27 ? -7.516  7.929   4.088   1.00 0.00 ? 27 THR B CG2  10 
ATOM 7763  H H    . THR B 2 27 ? -5.778  5.379   1.136   1.00 0.00 ? 27 THR B H    10 
ATOM 7764  H HA   . THR B 2 27 ? -8.041  7.227   1.761   1.00 0.00 ? 27 THR B HA   10 
ATOM 7765  H HB   . THR B 2 27 ? -5.549  7.513   3.344   1.00 0.00 ? 27 THR B HB   10 
ATOM 7766  H HG1  . THR B 2 27 ? -7.404  5.510   4.037   1.00 0.00 ? 27 THR B HG1  10 
ATOM 7767  H HG21 . THR B 2 27 ? -8.380  8.154   3.480   1.00 0.00 ? 27 THR B HG21 10 
ATOM 7768  H HG22 . THR B 2 27 ? -7.825  7.387   4.967   1.00 0.00 ? 27 THR B HG22 10 
ATOM 7769  H HG23 . THR B 2 27 ? -7.034  8.850   4.383   1.00 0.00 ? 27 THR B HG23 10 
ATOM 7770  N N    . PRO B 2 28 ? -6.377  8.072   -0.280  1.00 0.00 ? 28 PRO B N    10 
ATOM 7771  C CA   . PRO B 2 28 ? -5.729  9.041   -1.192  1.00 0.00 ? 28 PRO B CA   10 
ATOM 7772  C C    . PRO B 2 28 ? -6.214  10.457  -0.869  1.00 0.00 ? 28 PRO B C    10 
ATOM 7773  O O    . PRO B 2 28 ? -7.388  10.756  -0.962  1.00 0.00 ? 28 PRO B O    10 
ATOM 7774  C CB   . PRO B 2 28 ? -6.159  8.645   -2.607  1.00 0.00 ? 28 PRO B CB   10 
ATOM 7775  C CG   . PRO B 2 28 ? -7.124  7.451   -2.482  1.00 0.00 ? 28 PRO B CG   10 
ATOM 7776  C CD   . PRO B 2 28 ? -7.205  7.075   -0.997  1.00 0.00 ? 28 PRO B CD   10 
ATOM 7777  H HA   . PRO B 2 28 ? -4.656  8.982   -1.102  1.00 0.00 ? 28 PRO B HA   10 
ATOM 7778  H HB2  . PRO B 2 28 ? -6.661  9.478   -3.083  1.00 0.00 ? 28 PRO B HB2  10 
ATOM 7779  H HB3  . PRO B 2 28 ? -5.297  8.356   -3.186  1.00 0.00 ? 28 PRO B HB3  10 
ATOM 7780  H HG2  . PRO B 2 28 ? -8.103  7.731   -2.846  1.00 0.00 ? 28 PRO B HG2  10 
ATOM 7781  H HG3  . PRO B 2 28 ? -6.745  6.613   -3.047  1.00 0.00 ? 28 PRO B HG3  10 
ATOM 7782  H HD2  . PRO B 2 28 ? -8.229  7.120   -0.657  1.00 0.00 ? 28 PRO B HD2  10 
ATOM 7783  H HD3  . PRO B 2 28 ? -6.803  6.085   -0.850  1.00 0.00 ? 28 PRO B HD3  10 
ATOM 7784  N N    . LYS B 2 29 ? -5.323  11.328  -0.486  1.00 0.00 ? 29 LYS B N    10 
ATOM 7785  C CA   . LYS B 2 29 ? -5.741  12.720  -0.153  1.00 0.00 ? 29 LYS B CA   10 
ATOM 7786  C C    . LYS B 2 29 ? -5.122  13.699  -1.152  1.00 0.00 ? 29 LYS B C    10 
ATOM 7787  O O    . LYS B 2 29 ? -4.010  13.519  -1.606  1.00 0.00 ? 29 LYS B O    10 
ATOM 7788  C CB   . LYS B 2 29 ? -5.267  13.066  1.258   1.00 0.00 ? 29 LYS B CB   10 
ATOM 7789  C CG   . LYS B 2 29 ? -6.443  12.967  2.230   1.00 0.00 ? 29 LYS B CG   10 
ATOM 7790  C CD   . LYS B 2 29 ? -7.125  14.331  2.345   1.00 0.00 ? 29 LYS B CD   10 
ATOM 7791  C CE   . LYS B 2 29 ? -7.736  14.476  3.741   1.00 0.00 ? 29 LYS B CE   10 
ATOM 7792  N NZ   . LYS B 2 29 ? -8.419  13.205  4.116   1.00 0.00 ? 29 LYS B NZ   10 
ATOM 7793  H H    . LYS B 2 29 ? -4.383  11.067  -0.412  1.00 0.00 ? 29 LYS B H    10 
ATOM 7794  H HA   . LYS B 2 29 ? -6.819  12.794  -0.197  1.00 0.00 ? 29 LYS B HA   10 
ATOM 7795  H HB2  . LYS B 2 29 ? -4.493  12.374  1.557   1.00 0.00 ? 29 LYS B HB2  10 
ATOM 7796  H HB3  . LYS B 2 29 ? -4.876  14.073  1.270   1.00 0.00 ? 29 LYS B HB3  10 
ATOM 7797  H HG2  . LYS B 2 29 ? -7.153  12.239  1.863   1.00 0.00 ? 29 LYS B HG2  10 
ATOM 7798  H HG3  . LYS B 2 29 ? -6.084  12.664  3.201   1.00 0.00 ? 29 LYS B HG3  10 
ATOM 7799  H HD2  . LYS B 2 29 ? -6.398  15.113  2.186   1.00 0.00 ? 29 LYS B HD2  10 
ATOM 7800  H HD3  . LYS B 2 29 ? -7.908  14.408  1.604   1.00 0.00 ? 29 LYS B HD3  10 
ATOM 7801  H HE2  . LYS B 2 29 ? -6.954  14.691  4.455   1.00 0.00 ? 29 LYS B HE2  10 
ATOM 7802  H HE3  . LYS B 2 29 ? -8.453  15.284  3.738   1.00 0.00 ? 29 LYS B HE3  10 
ATOM 7803  H HZ1  . LYS B 2 29 ? -9.112  12.956  3.383   1.00 0.00 ? 29 LYS B HZ1  10 
ATOM 7804  H HZ2  . LYS B 2 29 ? -7.713  12.446  4.202   1.00 0.00 ? 29 LYS B HZ2  10 
ATOM 7805  H HZ3  . LYS B 2 29 ? -8.907  13.331  5.025   1.00 0.00 ? 29 LYS B HZ3  10 
ATOM 7806  N N    . THR B 2 30 ? -5.835  14.737  -1.495  1.00 0.00 ? 30 THR B N    10 
ATOM 7807  C CA   . THR B 2 30 ? -5.287  15.732  -2.461  1.00 0.00 ? 30 THR B CA   10 
ATOM 7808  C C    . THR B 2 30 ? -5.119  17.082  -1.759  1.00 0.00 ? 30 THR B C    10 
ATOM 7809  O O    . THR B 2 30 ? -5.224  18.095  -2.432  1.00 0.00 ? 30 THR B O    10 
ATOM 7810  C CB   . THR B 2 30 ? -6.251  15.886  -3.641  1.00 0.00 ? 30 THR B CB   10 
ATOM 7811  O OG1  . THR B 2 30 ? -7.547  15.453  -3.254  1.00 0.00 ? 30 THR B OG1  10 
ATOM 7812  C CG2  . THR B 2 30 ? -5.759  15.041  -4.819  1.00 0.00 ? 30 THR B CG2  10 
ATOM 7813  O OXT  . THR B 2 30 ? -4.890  17.080  -0.561  1.00 0.00 ? 30 THR B OXT  10 
ATOM 7814  H H    . THR B 2 30 ? -6.730  14.866  -1.116  1.00 0.00 ? 30 THR B H    10 
ATOM 7815  H HA   . THR B 2 30 ? -4.328  15.393  -2.822  1.00 0.00 ? 30 THR B HA   10 
ATOM 7816  H HB   . THR B 2 30 ? -6.291  16.922  -3.941  1.00 0.00 ? 30 THR B HB   10 
ATOM 7817  H HG1  . THR B 2 30 ? -8.021  15.188  -4.046  1.00 0.00 ? 30 THR B HG1  10 
ATOM 7818  H HG21 . THR B 2 30 ? -5.517  14.048  -4.471  1.00 0.00 ? 30 THR B HG21 10 
ATOM 7819  H HG22 . THR B 2 30 ? -6.533  14.983  -5.568  1.00 0.00 ? 30 THR B HG22 10 
ATOM 7820  H HG23 . THR B 2 30 ? -4.878  15.497  -5.244  1.00 0.00 ? 30 THR B HG23 10 
ATOM 7821  N N    . GLY A 1 1  ? -2.497  5.738   9.402   1.00 0.00 ? 1  GLY A N    11 
ATOM 7822  C CA   . GLY A 1 1  ? -2.460  5.753   7.912   1.00 0.00 ? 1  GLY A CA   11 
ATOM 7823  C C    . GLY A 1 1  ? -1.228  4.994   7.422   1.00 0.00 ? 1  GLY A C    11 
ATOM 7824  O O    . GLY A 1 1  ? -0.119  5.232   7.859   1.00 0.00 ? 1  GLY A O    11 
ATOM 7825  H H1   . GLY A 1 1  ? -1.696  5.184   9.764   1.00 0.00 ? 1  GLY A H1   11 
ATOM 7826  H H2   . GLY A 1 1  ? -2.435  6.713   9.759   1.00 0.00 ? 1  GLY A H2   11 
ATOM 7827  H H3   . GLY A 1 1  ? -3.388  5.306   9.723   1.00 0.00 ? 1  GLY A H3   11 
ATOM 7828  H HA2  . GLY A 1 1  ? -3.349  5.274   7.524   1.00 0.00 ? 1  GLY A HA2  11 
ATOM 7829  H HA3  . GLY A 1 1  ? -2.416  6.771   7.561   1.00 0.00 ? 1  GLY A HA3  11 
ATOM 7830  N N    . ILE A 1 2  ? -1.420  4.084   6.513   1.00 0.00 ? 2  ILE A N    11 
ATOM 7831  C CA   . ILE A 1 2  ? -0.280  3.296   5.974   1.00 0.00 ? 2  ILE A CA   11 
ATOM 7832  C C    . ILE A 1 2  ? 0.628   4.213   5.144   1.00 0.00 ? 2  ILE A C    11 
ATOM 7833  O O    . ILE A 1 2  ? 1.827   4.038   5.096   1.00 0.00 ? 2  ILE A O    11 
ATOM 7834  C CB   . ILE A 1 2  ? -0.856  2.162   5.117   1.00 0.00 ? 2  ILE A CB   11 
ATOM 7835  C CG1  . ILE A 1 2  ? 0.044   0.930   5.184   1.00 0.00 ? 2  ILE A CG1  11 
ATOM 7836  C CG2  . ILE A 1 2  ? -1.004  2.605   3.656   1.00 0.00 ? 2  ILE A CG2  11 
ATOM 7837  C CD1  . ILE A 1 2  ? -0.831  -0.325  5.090   1.00 0.00 ? 2  ILE A CD1  11 
ATOM 7838  H H    . ILE A 1 2  ? -2.326  3.917   6.180   1.00 0.00 ? 2  ILE A H    11 
ATOM 7839  H HA   . ILE A 1 2  ? 0.288   2.876   6.793   1.00 0.00 ? 2  ILE A HA   11 
ATOM 7840  H HB   . ILE A 1 2  ? -1.826  1.905   5.507   1.00 0.00 ? 2  ILE A HB   11 
ATOM 7841  H HG12 . ILE A 1 2  ? 0.745   0.948   4.362   1.00 0.00 ? 2  ILE A HG12 11 
ATOM 7842  H HG13 . ILE A 1 2  ? 0.581   0.925   6.120   1.00 0.00 ? 2  ILE A HG13 11 
ATOM 7843  H HG21 . ILE A 1 2  ? -1.554  3.535   3.616   1.00 0.00 ? 2  ILE A HG21 11 
ATOM 7844  H HG22 . ILE A 1 2  ? -0.025  2.748   3.223   1.00 0.00 ? 2  ILE A HG22 11 
ATOM 7845  H HG23 . ILE A 1 2  ? -1.537  1.848   3.101   1.00 0.00 ? 2  ILE A HG23 11 
ATOM 7846  H HD11 . ILE A 1 2  ? -1.475  -0.256  4.221   1.00 0.00 ? 2  ILE A HD11 11 
ATOM 7847  H HD12 . ILE A 1 2  ? -0.202  -1.195  5.004   1.00 0.00 ? 2  ILE A HD12 11 
ATOM 7848  H HD13 . ILE A 1 2  ? -1.437  -0.407  5.979   1.00 0.00 ? 2  ILE A HD13 11 
ATOM 7849  N N    . VAL A 1 3  ? 0.056   5.192   4.492   1.00 0.00 ? 3  VAL A N    11 
ATOM 7850  C CA   . VAL A 1 3  ? 0.878   6.123   3.667   1.00 0.00 ? 3  VAL A CA   11 
ATOM 7851  C C    . VAL A 1 3  ? 2.012   6.695   4.523   1.00 0.00 ? 3  VAL A C    11 
ATOM 7852  O O    . VAL A 1 3  ? 3.102   6.934   4.045   1.00 0.00 ? 3  VAL A O    11 
ATOM 7853  C CB   . VAL A 1 3  ? -0.003  7.266   3.163   1.00 0.00 ? 3  VAL A CB   11 
ATOM 7854  C CG1  . VAL A 1 3  ? 0.860   8.285   2.418   1.00 0.00 ? 3  VAL A CG1  11 
ATOM 7855  C CG2  . VAL A 1 3  ? -1.067  6.708   2.215   1.00 0.00 ? 3  VAL A CG2  11 
ATOM 7856  H H    . VAL A 1 3  ? -0.914  5.314   4.548   1.00 0.00 ? 3  VAL A H    11 
ATOM 7857  H HA   . VAL A 1 3  ? 1.294   5.590   2.827   1.00 0.00 ? 3  VAL A HA   11 
ATOM 7858  H HB   . VAL A 1 3  ? -0.483  7.746   4.004   1.00 0.00 ? 3  VAL A HB   11 
ATOM 7859  H HG11 . VAL A 1 3  ? 1.895   7.983   2.464   1.00 0.00 ? 3  VAL A HG11 11 
ATOM 7860  H HG12 . VAL A 1 3  ? 0.546   8.340   1.386   1.00 0.00 ? 3  VAL A HG12 11 
ATOM 7861  H HG13 . VAL A 1 3  ? 0.749   9.257   2.879   1.00 0.00 ? 3  VAL A HG13 11 
ATOM 7862  H HG21 . VAL A 1 3  ? -0.890  5.653   2.056   1.00 0.00 ? 3  VAL A HG21 11 
ATOM 7863  H HG22 . VAL A 1 3  ? -2.046  6.847   2.650   1.00 0.00 ? 3  VAL A HG22 11 
ATOM 7864  H HG23 . VAL A 1 3  ? -1.015  7.226   1.270   1.00 0.00 ? 3  VAL A HG23 11 
ATOM 7865  N N    . GLU A 1 4  ? 1.758   6.919   5.783   1.00 0.00 ? 4  GLU A N    11 
ATOM 7866  C CA   . GLU A 1 4  ? 2.819   7.477   6.673   1.00 0.00 ? 4  GLU A CA   11 
ATOM 7867  C C    . GLU A 1 4  ? 3.701   6.339   7.194   1.00 0.00 ? 4  GLU A C    11 
ATOM 7868  O O    . GLU A 1 4  ? 4.031   6.281   8.362   1.00 0.00 ? 4  GLU A O    11 
ATOM 7869  C CB   . GLU A 1 4  ? 2.167   8.201   7.851   1.00 0.00 ? 4  GLU A CB   11 
ATOM 7870  C CG   . GLU A 1 4  ? 1.193   9.257   7.323   1.00 0.00 ? 4  GLU A CG   11 
ATOM 7871  C CD   . GLU A 1 4  ? 1.977   10.478  6.839   1.00 0.00 ? 4  GLU A CD   11 
ATOM 7872  O OE1  . GLU A 1 4  ? 2.925   10.291  6.094   1.00 0.00 ? 4  GLU A OE1  11 
ATOM 7873  O OE2  . GLU A 1 4  ? 1.616   11.579  7.219   1.00 0.00 ? 4  GLU A OE2  11 
ATOM 7874  H H    . GLU A 1 4  ? 0.870   6.723   6.146   1.00 0.00 ? 4  GLU A H    11 
ATOM 7875  H HA   . GLU A 1 4  ? 3.426   8.175   6.113   1.00 0.00 ? 4  GLU A HA   11 
ATOM 7876  H HB2  . GLU A 1 4  ? 1.631   7.488   8.460   1.00 0.00 ? 4  GLU A HB2  11 
ATOM 7877  H HB3  . GLU A 1 4  ? 2.930   8.683   8.445   1.00 0.00 ? 4  GLU A HB3  11 
ATOM 7878  H HG2  . GLU A 1 4  ? 0.626   8.844   6.502   1.00 0.00 ? 4  GLU A HG2  11 
ATOM 7879  H HG3  . GLU A 1 4  ? 0.521   9.553   8.115   1.00 0.00 ? 4  GLU A HG3  11 
ATOM 7880  N N    . GLN A 1 5  ? 4.089   5.437   6.335   1.00 0.00 ? 5  GLN A N    11 
ATOM 7881  C CA   . GLN A 1 5  ? 4.951   4.303   6.772   1.00 0.00 ? 5  GLN A CA   11 
ATOM 7882  C C    . GLN A 1 5  ? 5.534   3.619   5.535   1.00 0.00 ? 5  GLN A C    11 
ATOM 7883  O O    . GLN A 1 5  ? 6.678   3.212   5.516   1.00 0.00 ? 5  GLN A O    11 
ATOM 7884  C CB   . GLN A 1 5  ? 4.115   3.297   7.568   1.00 0.00 ? 5  GLN A CB   11 
ATOM 7885  C CG   . GLN A 1 5  ? 5.028   2.201   8.121   1.00 0.00 ? 5  GLN A CG   11 
ATOM 7886  C CD   . GLN A 1 5  ? 4.826   2.079   9.632   1.00 0.00 ? 5  GLN A CD   11 
ATOM 7887  O OE1  . GLN A 1 5  ? 5.146   2.986   10.375  1.00 0.00 ? 5  GLN A OE1  11 
ATOM 7888  N NE2  . GLN A 1 5  ? 4.302   0.990   10.122  1.00 0.00 ? 5  GLN A NE2  11 
ATOM 7889  H H    . GLN A 1 5  ? 3.814   5.506   5.399   1.00 0.00 ? 5  GLN A H    11 
ATOM 7890  H HA   . GLN A 1 5  ? 5.754   4.677   7.390   1.00 0.00 ? 5  GLN A HA   11 
ATOM 7891  H HB2  . GLN A 1 5  ? 3.625   3.805   8.386   1.00 0.00 ? 5  GLN A HB2  11 
ATOM 7892  H HB3  . GLN A 1 5  ? 3.371   2.854   6.922   1.00 0.00 ? 5  GLN A HB3  11 
ATOM 7893  H HG2  . GLN A 1 5  ? 4.789   1.260   7.647   1.00 0.00 ? 5  GLN A HG2  11 
ATOM 7894  H HG3  . GLN A 1 5  ? 6.058   2.455   7.919   1.00 0.00 ? 5  GLN A HG3  11 
ATOM 7895  H HE21 . GLN A 1 5  ? 4.045   0.258   9.523   1.00 0.00 ? 5  GLN A HE21 11 
ATOM 7896  H HE22 . GLN A 1 5  ? 4.166   0.902   11.089  1.00 0.00 ? 5  GLN A HE22 11 
ATOM 7897  N N    . CYS A 1 6  ? 4.752   3.497   4.498   1.00 0.00 ? 6  CYS A N    11 
ATOM 7898  C CA   . CYS A 1 6  ? 5.253   2.851   3.254   1.00 0.00 ? 6  CYS A CA   11 
ATOM 7899  C C    . CYS A 1 6  ? 5.886   3.911   2.354   1.00 0.00 ? 6  CYS A C    11 
ATOM 7900  O O    . CYS A 1 6  ? 6.981   3.746   1.857   1.00 0.00 ? 6  CYS A O    11 
ATOM 7901  C CB   . CYS A 1 6  ? 4.084   2.191   2.522   1.00 0.00 ? 6  CYS A CB   11 
ATOM 7902  S SG   . CYS A 1 6  ? 3.220   1.068   3.647   1.00 0.00 ? 6  CYS A SG   11 
ATOM 7903  H H    . CYS A 1 6  ? 3.835   3.838   4.535   1.00 0.00 ? 6  CYS A H    11 
ATOM 7904  H HA   . CYS A 1 6  ? 5.988   2.103   3.505   1.00 0.00 ? 6  CYS A HA   11 
ATOM 7905  H HB2  . CYS A 1 6  ? 3.402   2.953   2.179   1.00 0.00 ? 6  CYS A HB2  11 
ATOM 7906  H HB3  . CYS A 1 6  ? 4.458   1.636   1.675   1.00 0.00 ? 6  CYS A HB3  11 
ATOM 7907  N N    . CYS A 1 7  ? 5.205   5.006   2.145   1.00 0.00 ? 7  CYS A N    11 
ATOM 7908  C CA   . CYS A 1 7  ? 5.766   6.080   1.280   1.00 0.00 ? 7  CYS A CA   11 
ATOM 7909  C C    . CYS A 1 7  ? 7.026   6.652   1.934   1.00 0.00 ? 7  CYS A C    11 
ATOM 7910  O O    . CYS A 1 7  ? 7.998   6.957   1.272   1.00 0.00 ? 7  CYS A O    11 
ATOM 7911  C CB   . CYS A 1 7  ? 4.727   7.192   1.114   1.00 0.00 ? 7  CYS A CB   11 
ATOM 7912  S SG   . CYS A 1 7  ? 5.491   8.624   0.314   1.00 0.00 ? 7  CYS A SG   11 
ATOM 7913  H H    . CYS A 1 7  ? 4.324   5.121   2.560   1.00 0.00 ? 7  CYS A H    11 
ATOM 7914  H HA   . CYS A 1 7  ? 6.016   5.672   0.313   1.00 0.00 ? 7  CYS A HA   11 
ATOM 7915  H HB2  . CYS A 1 7  ? 3.912   6.832   0.505   1.00 0.00 ? 7  CYS A HB2  11 
ATOM 7916  H HB3  . CYS A 1 7  ? 4.350   7.480   2.084   1.00 0.00 ? 7  CYS A HB3  11 
ATOM 7917  N N    . THR A 1 8  ? 7.014   6.798   3.231   1.00 0.00 ? 8  THR A N    11 
ATOM 7918  C CA   . THR A 1 8  ? 8.211   7.350   3.927   1.00 0.00 ? 8  THR A CA   11 
ATOM 7919  C C    . THR A 1 8  ? 9.255   6.244   4.098   1.00 0.00 ? 8  THR A C    11 
ATOM 7920  O O    . THR A 1 8  ? 10.412  6.412   3.763   1.00 0.00 ? 8  THR A O    11 
ATOM 7921  C CB   . THR A 1 8  ? 7.804   7.886   5.301   1.00 0.00 ? 8  THR A CB   11 
ATOM 7922  O OG1  . THR A 1 8  ? 6.515   7.388   5.641   1.00 0.00 ? 8  THR A OG1  11 
ATOM 7923  C CG2  . THR A 1 8  ? 7.770   9.414   5.268   1.00 0.00 ? 8  THR A CG2  11 
ATOM 7924  H H    . THR A 1 8  ? 6.220   6.547   3.745   1.00 0.00 ? 8  THR A H    11 
ATOM 7925  H HA   . THR A 1 8  ? 8.632   8.152   3.339   1.00 0.00 ? 8  THR A HA   11 
ATOM 7926  H HB   . THR A 1 8  ? 8.520   7.563   6.042   1.00 0.00 ? 8  THR A HB   11 
ATOM 7927  H HG1  . THR A 1 8  ? 6.206   7.868   6.412   1.00 0.00 ? 8  THR A HG1  11 
ATOM 7928  H HG21 . THR A 1 8  ? 8.632   9.781   4.731   1.00 0.00 ? 8  THR A HG21 11 
ATOM 7929  H HG22 . THR A 1 8  ? 6.869   9.744   4.772   1.00 0.00 ? 8  THR A HG22 11 
ATOM 7930  H HG23 . THR A 1 8  ? 7.785   9.797   6.278   1.00 0.00 ? 8  THR A HG23 11 
ATOM 7931  N N    . SER A 1 9  ? 8.858   5.115   4.615   1.00 0.00 ? 9  SER A N    11 
ATOM 7932  C CA   . SER A 1 9  ? 9.828   3.999   4.804   1.00 0.00 ? 9  SER A CA   11 
ATOM 7933  C C    . SER A 1 9  ? 9.304   2.745   4.104   1.00 0.00 ? 9  SER A C    11 
ATOM 7934  O O    . SER A 1 9  ? 8.230   2.742   3.536   1.00 0.00 ? 9  SER A O    11 
ATOM 7935  C CB   . SER A 1 9  ? 9.995   3.716   6.297   1.00 0.00 ? 9  SER A CB   11 
ATOM 7936  O OG   . SER A 1 9  ? 11.379  3.582   6.596   1.00 0.00 ? 9  SER A OG   11 
ATOM 7937  H H    . SER A 1 9  ? 7.920   4.998   4.877   1.00 0.00 ? 9  SER A H    11 
ATOM 7938  H HA   . SER A 1 9  ? 10.781  4.276   4.381   1.00 0.00 ? 9  SER A HA   11 
ATOM 7939  H HB2  . SER A 1 9  ? 9.585   4.531   6.869   1.00 0.00 ? 9  SER A HB2  11 
ATOM 7940  H HB3  . SER A 1 9  ? 9.472   2.803   6.550   1.00 0.00 ? 9  SER A HB3  11 
ATOM 7941  H HG   . SER A 1 9  ? 11.800  3.134   5.859   1.00 0.00 ? 9  SER A HG   11 
ATOM 7942  N N    . ILE A 1 10 ? 10.052  1.676   4.136   1.00 0.00 ? 10 ILE A N    11 
ATOM 7943  C CA   . ILE A 1 10 ? 9.592   0.428   3.467   1.00 0.00 ? 10 ILE A CA   11 
ATOM 7944  C C    . ILE A 1 10 ? 8.764   -0.406  4.448   1.00 0.00 ? 10 ILE A C    11 
ATOM 7945  O O    . ILE A 1 10 ? 9.276   -1.263  5.140   1.00 0.00 ? 10 ILE A O    11 
ATOM 7946  C CB   . ILE A 1 10 ? 10.806  -0.376  3.000   1.00 0.00 ? 10 ILE A CB   11 
ATOM 7947  C CG1  . ILE A 1 10 ? 11.753  0.568   2.229   1.00 0.00 ? 10 ILE A CG1  11 
ATOM 7948  C CG2  . ILE A 1 10 ? 10.330  -1.532  2.108   1.00 0.00 ? 10 ILE A CG2  11 
ATOM 7949  C CD1  . ILE A 1 10 ? 12.353  -0.129  0.997   1.00 0.00 ? 10 ILE A CD1  11 
ATOM 7950  H H    . ILE A 1 10 ? 10.915  1.696   4.598   1.00 0.00 ? 10 ILE A H    11 
ATOM 7951  H HA   . ILE A 1 10 ? 8.983   0.682   2.615   1.00 0.00 ? 10 ILE A HA   11 
ATOM 7952  H HB   . ILE A 1 10 ? 11.322  -0.778  3.861   1.00 0.00 ? 10 ILE A HB   11 
ATOM 7953  H HG12 . ILE A 1 10 ? 11.201  1.438   1.908   1.00 0.00 ? 10 ILE A HG12 11 
ATOM 7954  H HG13 . ILE A 1 10 ? 12.553  0.877   2.884   1.00 0.00 ? 10 ILE A HG13 11 
ATOM 7955  H HG21 . ILE A 1 10 ? 9.772   -1.134  1.273   1.00 0.00 ? 10 ILE A HG21 11 
ATOM 7956  H HG22 . ILE A 1 10 ? 11.184  -2.079  1.743   1.00 0.00 ? 10 ILE A HG22 11 
ATOM 7957  H HG23 . ILE A 1 10 ? 9.696   -2.191  2.683   1.00 0.00 ? 10 ILE A HG23 11 
ATOM 7958  H HD11 . ILE A 1 10 ? 12.699  -1.113  1.273   1.00 0.00 ? 10 ILE A HD11 11 
ATOM 7959  H HD12 . ILE A 1 10 ? 11.597  -0.212  0.228   1.00 0.00 ? 10 ILE A HD12 11 
ATOM 7960  H HD13 . ILE A 1 10 ? 13.182  0.454   0.625   1.00 0.00 ? 10 ILE A HD13 11 
ATOM 7961  N N    . CYS A 1 11 ? 7.485   -0.157  4.510   1.00 0.00 ? 11 CYS A N    11 
ATOM 7962  C CA   . CYS A 1 11 ? 6.616   -0.929  5.443   1.00 0.00 ? 11 CYS A CA   11 
ATOM 7963  C C    . CYS A 1 11 ? 6.536   -2.385  4.979   1.00 0.00 ? 11 CYS A C    11 
ATOM 7964  O O    . CYS A 1 11 ? 7.161   -2.775  4.012   1.00 0.00 ? 11 CYS A O    11 
ATOM 7965  C CB   . CYS A 1 11 ? 5.213   -0.320  5.452   1.00 0.00 ? 11 CYS A CB   11 
ATOM 7966  S SG   . CYS A 1 11 ? 4.462   -0.517  3.817   1.00 0.00 ? 11 CYS A SG   11 
ATOM 7967  H H    . CYS A 1 11 ? 7.094   0.540   3.941   1.00 0.00 ? 11 CYS A H    11 
ATOM 7968  H HA   . CYS A 1 11 ? 7.032   -0.890  6.438   1.00 0.00 ? 11 CYS A HA   11 
ATOM 7969  H HB2  . CYS A 1 11 ? 4.607   -0.822  6.189   1.00 0.00 ? 11 CYS A HB2  11 
ATOM 7970  H HB3  . CYS A 1 11 ? 5.279   0.732   5.693   1.00 0.00 ? 11 CYS A HB3  11 
ATOM 7971  N N    . SER A 1 12 ? 5.772   -3.192  5.663   1.00 0.00 ? 12 SER A N    11 
ATOM 7972  C CA   . SER A 1 12 ? 5.651   -4.624  5.263   1.00 0.00 ? 12 SER A CA   11 
ATOM 7973  C C    . SER A 1 12 ? 4.366   -4.822  4.457   1.00 0.00 ? 12 SER A C    11 
ATOM 7974  O O    . SER A 1 12 ? 3.528   -3.948  4.382   1.00 0.00 ? 12 SER A O    11 
ATOM 7975  C CB   . SER A 1 12 ? 5.605   -5.499  6.516   1.00 0.00 ? 12 SER A CB   11 
ATOM 7976  O OG   . SER A 1 12 ? 5.005   -4.771  7.577   1.00 0.00 ? 12 SER A OG   11 
ATOM 7977  H H    . SER A 1 12 ? 5.279   -2.858  6.441   1.00 0.00 ? 12 SER A H    11 
ATOM 7978  H HA   . SER A 1 12 ? 6.502   -4.902  4.661   1.00 0.00 ? 12 SER A HA   11 
ATOM 7979  H HB2  . SER A 1 12 ? 5.021   -6.382  6.317   1.00 0.00 ? 12 SER A HB2  11 
ATOM 7980  H HB3  . SER A 1 12 ? 6.610   -5.789  6.788   1.00 0.00 ? 12 SER A HB3  11 
ATOM 7981  H HG   . SER A 1 12 ? 4.831   -5.382  8.297   1.00 0.00 ? 12 SER A HG   11 
ATOM 7982  N N    . LEU A 1 13 ? 4.209   -5.966  3.850   1.00 0.00 ? 13 LEU A N    11 
ATOM 7983  C CA   . LEU A 1 13 ? 2.981   -6.220  3.046   1.00 0.00 ? 13 LEU A CA   11 
ATOM 7984  C C    . LEU A 1 13 ? 1.801   -6.498  3.981   1.00 0.00 ? 13 LEU A C    11 
ATOM 7985  O O    . LEU A 1 13 ? 0.662   -6.235  3.651   1.00 0.00 ? 13 LEU A O    11 
ATOM 7986  C CB   . LEU A 1 13 ? 3.205   -7.431  2.139   1.00 0.00 ? 13 LEU A CB   11 
ATOM 7987  C CG   . LEU A 1 13 ? 2.036   -7.554  1.162   1.00 0.00 ? 13 LEU A CG   11 
ATOM 7988  C CD1  . LEU A 1 13 ? 1.862   -6.237  0.406   1.00 0.00 ? 13 LEU A CD1  11 
ATOM 7989  C CD2  . LEU A 1 13 ? 2.324   -8.680  0.165   1.00 0.00 ? 13 LEU A CD2  11 
ATOM 7990  H H    . LEU A 1 13 ? 4.900   -6.659  3.921   1.00 0.00 ? 13 LEU A H    11 
ATOM 7991  H HA   . LEU A 1 13 ? 2.763   -5.353  2.441   1.00 0.00 ? 13 LEU A HA   11 
ATOM 7992  H HB2  . LEU A 1 13 ? 4.126   -7.301  1.588   1.00 0.00 ? 13 LEU A HB2  11 
ATOM 7993  H HB3  . LEU A 1 13 ? 3.268   -8.325  2.739   1.00 0.00 ? 13 LEU A HB3  11 
ATOM 7994  H HG   . LEU A 1 13 ? 1.131   -7.778  1.707   1.00 0.00 ? 13 LEU A HG   11 
ATOM 7995  H HD11 . LEU A 1 13 ? 2.818   -5.744  0.318   1.00 0.00 ? 13 LEU A HD11 11 
ATOM 7996  H HD12 . LEU A 1 13 ? 1.467   -6.437  -0.581  1.00 0.00 ? 13 LEU A HD12 11 
ATOM 7997  H HD13 . LEU A 1 13 ? 1.176   -5.601  0.947   1.00 0.00 ? 13 LEU A HD13 11 
ATOM 7998  H HD21 . LEU A 1 13 ? 3.258   -9.156  0.420   1.00 0.00 ? 13 LEU A HD21 11 
ATOM 7999  H HD22 . LEU A 1 13 ? 1.526   -9.405  0.204   1.00 0.00 ? 13 LEU A HD22 11 
ATOM 8000  H HD23 . LEU A 1 13 ? 2.390   -8.269  -0.832  1.00 0.00 ? 13 LEU A HD23 11 
ATOM 8001  N N    . TYR A 1 14 ? 2.062   -7.028  5.144   1.00 0.00 ? 14 TYR A N    11 
ATOM 8002  C CA   . TYR A 1 14 ? 0.950   -7.321  6.092   1.00 0.00 ? 14 TYR A CA   11 
ATOM 8003  C C    . TYR A 1 14 ? 0.171   -6.033  6.372   1.00 0.00 ? 14 TYR A C    11 
ATOM 8004  O O    . TYR A 1 14 ? -1.015  -6.057  6.631   1.00 0.00 ? 14 TYR A O    11 
ATOM 8005  C CB   . TYR A 1 14 ? 1.523   -7.869  7.401   1.00 0.00 ? 14 TYR A CB   11 
ATOM 8006  C CG   . TYR A 1 14 ? 0.449   -7.858  8.465   1.00 0.00 ? 14 TYR A CG   11 
ATOM 8007  C CD1  . TYR A 1 14 ? -0.878  -8.148  8.126   1.00 0.00 ? 14 TYR A CD1  11 
ATOM 8008  C CD2  . TYR A 1 14 ? 0.782   -7.552  9.791   1.00 0.00 ? 14 TYR A CD2  11 
ATOM 8009  C CE1  . TYR A 1 14 ? -1.872  -8.131  9.111   1.00 0.00 ? 14 TYR A CE1  11 
ATOM 8010  C CE2  . TYR A 1 14 ? -0.213  -7.535  10.775  1.00 0.00 ? 14 TYR A CE2  11 
ATOM 8011  C CZ   . TYR A 1 14 ? -1.538  -7.825  10.436  1.00 0.00 ? 14 TYR A CZ   11 
ATOM 8012  O OH   . TYR A 1 14 ? -2.519  -7.809  11.407  1.00 0.00 ? 14 TYR A OH   11 
ATOM 8013  H H    . TYR A 1 14 ? 2.986   -7.234  5.394   1.00 0.00 ? 14 TYR A H    11 
ATOM 8014  H HA   . TYR A 1 14 ? 0.289   -8.053  5.654   1.00 0.00 ? 14 TYR A HA   11 
ATOM 8015  H HB2  . TYR A 1 14 ? 1.867   -8.881  7.247   1.00 0.00 ? 14 TYR A HB2  11 
ATOM 8016  H HB3  . TYR A 1 14 ? 2.349   -7.253  7.718   1.00 0.00 ? 14 TYR A HB3  11 
ATOM 8017  H HD1  . TYR A 1 14 ? -1.135  -8.383  7.104   1.00 0.00 ? 14 TYR A HD1  11 
ATOM 8018  H HD2  . TYR A 1 14 ? 1.805   -7.327  10.053  1.00 0.00 ? 14 TYR A HD2  11 
ATOM 8019  H HE1  . TYR A 1 14 ? -2.895  -8.355  8.850   1.00 0.00 ? 14 TYR A HE1  11 
ATOM 8020  H HE2  . TYR A 1 14 ? 0.043   -7.298  11.797  1.00 0.00 ? 14 TYR A HE2  11 
ATOM 8021  H HH   . TYR A 1 14 ? -3.035  -7.006  11.295  1.00 0.00 ? 14 TYR A HH   11 
ATOM 8022  N N    . GLN A 1 15 ? 0.831   -4.909  6.327   1.00 0.00 ? 15 GLN A N    11 
ATOM 8023  C CA   . GLN A 1 15 ? 0.126   -3.625  6.595   1.00 0.00 ? 15 GLN A CA   11 
ATOM 8024  C C    . GLN A 1 15 ? -0.900  -3.363  5.490   1.00 0.00 ? 15 GLN A C    11 
ATOM 8025  O O    . GLN A 1 15 ? -2.055  -3.096  5.757   1.00 0.00 ? 15 GLN A O    11 
ATOM 8026  C CB   . GLN A 1 15 ? 1.144   -2.481  6.633   1.00 0.00 ? 15 GLN A CB   11 
ATOM 8027  C CG   . GLN A 1 15 ? 2.089   -2.675  7.819   1.00 0.00 ? 15 GLN A CG   11 
ATOM 8028  C CD   . GLN A 1 15 ? 1.305   -2.569  9.129   1.00 0.00 ? 15 GLN A CD   11 
ATOM 8029  O OE1  . GLN A 1 15 ? 0.487   -3.415  9.433   1.00 0.00 ? 15 GLN A OE1  11 
ATOM 8030  N NE2  . GLN A 1 15 ? 1.523   -1.559  9.927   1.00 0.00 ? 15 GLN A NE2  11 
ATOM 8031  H H    . GLN A 1 15 ? 1.788   -4.909  6.118   1.00 0.00 ? 15 GLN A H    11 
ATOM 8032  H HA   . GLN A 1 15 ? -0.381  -3.686  7.546   1.00 0.00 ? 15 GLN A HA   11 
ATOM 8033  H HB2  . GLN A 1 15 ? 1.713   -2.478  5.713   1.00 0.00 ? 15 GLN A HB2  11 
ATOM 8034  H HB3  . GLN A 1 15 ? 0.625   -1.541  6.737   1.00 0.00 ? 15 GLN A HB3  11 
ATOM 8035  H HG2  . GLN A 1 15 ? 2.553   -3.649  7.755   1.00 0.00 ? 15 GLN A HG2  11 
ATOM 8036  H HG3  . GLN A 1 15 ? 2.853   -1.912  7.797   1.00 0.00 ? 15 GLN A HG3  11 
ATOM 8037  H HE21 . GLN A 1 15 ? 2.184   -0.877  9.685   1.00 0.00 ? 15 GLN A HE21 11 
ATOM 8038  H HE22 . GLN A 1 15 ? 1.027   -1.483  10.768  1.00 0.00 ? 15 GLN A HE22 11 
ATOM 8039  N N    . LEU A 1 16 ? -0.493  -3.435  4.251   1.00 0.00 ? 16 LEU A N    11 
ATOM 8040  C CA   . LEU A 1 16 ? -1.451  -3.190  3.136   1.00 0.00 ? 16 LEU A CA   11 
ATOM 8041  C C    . LEU A 1 16 ? -2.617  -4.172  3.239   1.00 0.00 ? 16 LEU A C    11 
ATOM 8042  O O    . LEU A 1 16 ? -3.646  -3.991  2.617   1.00 0.00 ? 16 LEU A O    11 
ATOM 8043  C CB   . LEU A 1 16 ? -0.745  -3.377  1.786   1.00 0.00 ? 16 LEU A CB   11 
ATOM 8044  C CG   . LEU A 1 16 ? 0.545   -2.538  1.699   1.00 0.00 ? 16 LEU A CG   11 
ATOM 8045  C CD1  . LEU A 1 16 ? 0.623   -1.905  0.314   1.00 0.00 ? 16 LEU A CD1  11 
ATOM 8046  C CD2  . LEU A 1 16 ? 0.562   -1.419  2.751   1.00 0.00 ? 16 LEU A CD2  11 
ATOM 8047  H H    . LEU A 1 16 ? 0.441   -3.648  4.054   1.00 0.00 ? 16 LEU A H    11 
ATOM 8048  H HA   . LEU A 1 16 ? -1.829  -2.182  3.206   1.00 0.00 ? 16 LEU A HA   11 
ATOM 8049  H HB2  . LEU A 1 16 ? -0.493  -4.418  1.656   1.00 0.00 ? 16 LEU A HB2  11 
ATOM 8050  H HB3  . LEU A 1 16 ? -1.414  -3.077  0.993   1.00 0.00 ? 16 LEU A HB3  11 
ATOM 8051  H HG   . LEU A 1 16 ? 1.399   -3.184  1.844   1.00 0.00 ? 16 LEU A HG   11 
ATOM 8052  H HD11 . LEU A 1 16 ? 0.317   -2.630  -0.426  1.00 0.00 ? 16 LEU A HD11 11 
ATOM 8053  H HD12 . LEU A 1 16 ? -0.033  -1.049  0.273   1.00 0.00 ? 16 LEU A HD12 11 
ATOM 8054  H HD13 . LEU A 1 16 ? 1.638   -1.594  0.117   1.00 0.00 ? 16 LEU A HD13 11 
ATOM 8055  H HD21 . LEU A 1 16 ? -0.433  -1.020  2.870   1.00 0.00 ? 16 LEU A HD21 11 
ATOM 8056  H HD22 . LEU A 1 16 ? 0.910   -1.817  3.691   1.00 0.00 ? 16 LEU A HD22 11 
ATOM 8057  H HD23 . LEU A 1 16 ? 1.228   -0.634  2.426   1.00 0.00 ? 16 LEU A HD23 11 
ATOM 8058  N N    . GLU A 1 17 ? -2.475  -5.208  4.018   1.00 0.00 ? 17 GLU A N    11 
ATOM 8059  C CA   . GLU A 1 17 ? -3.589  -6.185  4.154   1.00 0.00 ? 17 GLU A CA   11 
ATOM 8060  C C    . GLU A 1 17 ? -4.797  -5.470  4.762   1.00 0.00 ? 17 GLU A C    11 
ATOM 8061  O O    . GLU A 1 17 ? -5.925  -5.689  4.367   1.00 0.00 ? 17 GLU A O    11 
ATOM 8062  C CB   . GLU A 1 17 ? -3.154  -7.337  5.064   1.00 0.00 ? 17 GLU A CB   11 
ATOM 8063  C CG   . GLU A 1 17 ? -2.004  -8.100  4.404   1.00 0.00 ? 17 GLU A CG   11 
ATOM 8064  C CD   . GLU A 1 17 ? -1.850  -9.470  5.068   1.00 0.00 ? 17 GLU A CD   11 
ATOM 8065  O OE1  . GLU A 1 17 ? -2.846  -9.991  5.543   1.00 0.00 ? 17 GLU A OE1  11 
ATOM 8066  O OE2  . GLU A 1 17 ? -0.741  -9.976  5.089   1.00 0.00 ? 17 GLU A OE2  11 
ATOM 8067  H H    . GLU A 1 17 ? -1.641  -5.341  4.515   1.00 0.00 ? 17 GLU A H    11 
ATOM 8068  H HA   . GLU A 1 17 ? -3.850  -6.571  3.181   1.00 0.00 ? 17 GLU A HA   11 
ATOM 8069  H HB2  . GLU A 1 17 ? -2.828  -6.941  6.015   1.00 0.00 ? 17 GLU A HB2  11 
ATOM 8070  H HB3  . GLU A 1 17 ? -3.987  -8.008  5.219   1.00 0.00 ? 17 GLU A HB3  11 
ATOM 8071  H HG2  . GLU A 1 17 ? -2.213  -8.230  3.351   1.00 0.00 ? 17 GLU A HG2  11 
ATOM 8072  H HG3  . GLU A 1 17 ? -1.088  -7.541  4.520   1.00 0.00 ? 17 GLU A HG3  11 
ATOM 8073  N N    . ASN A 1 18 ? -4.566  -4.600  5.711   1.00 0.00 ? 18 ASN A N    11 
ATOM 8074  C CA   . ASN A 1 18 ? -5.697  -3.856  6.330   1.00 0.00 ? 18 ASN A CA   11 
ATOM 8075  C C    . ASN A 1 18 ? -6.489  -3.159  5.223   1.00 0.00 ? 18 ASN A C    11 
ATOM 8076  O O    . ASN A 1 18 ? -7.658  -2.866  5.366   1.00 0.00 ? 18 ASN A O    11 
ATOM 8077  C CB   . ASN A 1 18 ? -5.151  -2.806  7.303   1.00 0.00 ? 18 ASN A CB   11 
ATOM 8078  C CG   . ASN A 1 18 ? -4.277  -3.492  8.355   1.00 0.00 ? 18 ASN A CG   11 
ATOM 8079  O OD1  . ASN A 1 18 ? -3.229  -4.022  8.040   1.00 0.00 ? 18 ASN A OD1  11 
ATOM 8080  N ND2  . ASN A 1 18 ? -4.666  -3.507  9.600   1.00 0.00 ? 18 ASN A ND2  11 
ATOM 8081  H H    . ASN A 1 18 ? -3.648  -4.430  6.005   1.00 0.00 ? 18 ASN A H    11 
ATOM 8082  H HA   . ASN A 1 18 ? -6.341  -4.544  6.858   1.00 0.00 ? 18 ASN A HA   11 
ATOM 8083  H HB2  . ASN A 1 18 ? -4.561  -2.080  6.757   1.00 0.00 ? 18 ASN A HB2  11 
ATOM 8084  H HB3  . ASN A 1 18 ? -5.974  -2.306  7.792   1.00 0.00 ? 18 ASN A HB3  11 
ATOM 8085  H HD21 . ASN A 1 18 ? -5.512  -3.081  9.855   1.00 0.00 ? 18 ASN A HD21 11 
ATOM 8086  H HD22 . ASN A 1 18 ? -4.113  -3.942  10.282  1.00 0.00 ? 18 ASN A HD22 11 
ATOM 8087  N N    . TYR A 1 19 ? -5.844  -2.889  4.122   1.00 0.00 ? 19 TYR A N    11 
ATOM 8088  C CA   . TYR A 1 19 ? -6.528  -2.208  2.991   1.00 0.00 ? 19 TYR A CA   11 
ATOM 8089  C C    . TYR A 1 19 ? -7.316  -3.226  2.159   1.00 0.00 ? 19 TYR A C    11 
ATOM 8090  O O    . TYR A 1 19 ? -7.285  -3.200  0.948   1.00 0.00 ? 19 TYR A O    11 
ATOM 8091  C CB   . TYR A 1 19 ? -5.474  -1.544  2.107   1.00 0.00 ? 19 TYR A CB   11 
ATOM 8092  C CG   . TYR A 1 19 ? -5.265  -0.136  2.573   1.00 0.00 ? 19 TYR A CG   11 
ATOM 8093  C CD1  . TYR A 1 19 ? -6.156  0.864   2.182   1.00 0.00 ? 19 TYR A CD1  11 
ATOM 8094  C CD2  . TYR A 1 19 ? -4.184  0.167   3.402   1.00 0.00 ? 19 TYR A CD2  11 
ATOM 8095  C CE1  . TYR A 1 19 ? -5.968  2.179   2.622   1.00 0.00 ? 19 TYR A CE1  11 
ATOM 8096  C CE2  . TYR A 1 19 ? -3.997  1.479   3.841   1.00 0.00 ? 19 TYR A CE2  11 
ATOM 8097  C CZ   . TYR A 1 19 ? -4.887  2.486   3.454   1.00 0.00 ? 19 TYR A CZ   11 
ATOM 8098  O OH   . TYR A 1 19 ? -4.697  3.782   3.890   1.00 0.00 ? 19 TYR A OH   11 
ATOM 8099  H H    . TYR A 1 19 ? -4.898  -3.126  4.043   1.00 0.00 ? 19 TYR A H    11 
ATOM 8100  H HA   . TYR A 1 19 ? -7.202  -1.457  3.374   1.00 0.00 ? 19 TYR A HA   11 
ATOM 8101  H HB2  . TYR A 1 19 ? -4.547  -2.093  2.176   1.00 0.00 ? 19 TYR A HB2  11 
ATOM 8102  H HB3  . TYR A 1 19 ? -5.810  -1.533  1.085   1.00 0.00 ? 19 TYR A HB3  11 
ATOM 8103  H HD1  . TYR A 1 19 ? -6.989  0.621   1.540   1.00 0.00 ? 19 TYR A HD1  11 
ATOM 8104  H HD2  . TYR A 1 19 ? -3.490  -0.610  3.698   1.00 0.00 ? 19 TYR A HD2  11 
ATOM 8105  H HE1  . TYR A 1 19 ? -6.656  2.953   2.322   1.00 0.00 ? 19 TYR A HE1  11 
ATOM 8106  H HE2  . TYR A 1 19 ? -3.169  1.711   4.482   1.00 0.00 ? 19 TYR A HE2  11 
ATOM 8107  H HH   . TYR A 1 19 ? -5.395  3.990   4.515   1.00 0.00 ? 19 TYR A HH   11 
ATOM 8108  N N    . CYS A 1 20 ? -8.026  -4.116  2.793   1.00 0.00 ? 20 CYS A N    11 
ATOM 8109  C CA   . CYS A 1 20 ? -8.812  -5.118  2.022   1.00 0.00 ? 20 CYS A CA   11 
ATOM 8110  C C    . CYS A 1 20 ? -10.286 -5.013  2.416   1.00 0.00 ? 20 CYS A C    11 
ATOM 8111  O O    . CYS A 1 20 ? -10.615 -4.694  3.542   1.00 0.00 ? 20 CYS A O    11 
ATOM 8112  C CB   . CYS A 1 20 ? -8.300  -6.527  2.336   1.00 0.00 ? 20 CYS A CB   11 
ATOM 8113  S SG   . CYS A 1 20 ? -6.582  -6.686  1.789   1.00 0.00 ? 20 CYS A SG   11 
ATOM 8114  H H    . CYS A 1 20 ? -8.045  -4.125  3.770   1.00 0.00 ? 20 CYS A H    11 
ATOM 8115  H HA   . CYS A 1 20 ? -8.709  -4.922  0.963   1.00 0.00 ? 20 CYS A HA   11 
ATOM 8116  H HB2  . CYS A 1 20 ? -8.355  -6.701  3.400   1.00 0.00 ? 20 CYS A HB2  11 
ATOM 8117  H HB3  . CYS A 1 20 ? -8.911  -7.253  1.822   1.00 0.00 ? 20 CYS A HB3  11 
ATOM 8118  N N    . ASN A 1 21 ? -11.175 -5.278  1.501   1.00 0.00 ? 21 ASN A N    11 
ATOM 8119  C CA   . ASN A 1 21 ? -12.625 -5.192  1.828   1.00 0.00 ? 21 ASN A CA   11 
ATOM 8120  C C    . ASN A 1 21 ? -13.243 -6.590  1.788   1.00 0.00 ? 21 ASN A C    11 
ATOM 8121  O O    . ASN A 1 21 ? -14.279 -6.742  1.163   1.00 0.00 ? 21 ASN A O    11 
ATOM 8122  C CB   . ASN A 1 21 ? -13.323 -4.293  0.805   1.00 0.00 ? 21 ASN A CB   11 
ATOM 8123  C CG   . ASN A 1 21 ? -14.462 -3.533  1.487   1.00 0.00 ? 21 ASN A CG   11 
ATOM 8124  O OD1  . ASN A 1 21 ? -15.110 -4.053  2.372   1.00 0.00 ? 21 ASN A OD1  11 
ATOM 8125  N ND2  . ASN A 1 21 ? -14.731 -2.313  1.110   1.00 0.00 ? 21 ASN A ND2  11 
ATOM 8126  O OXT  . ASN A 1 21 ? -12.669 -7.486  2.383   1.00 0.00 ? 21 ASN A OXT  11 
ATOM 8127  H H    . ASN A 1 21 ? -10.890 -5.533  0.599   1.00 0.00 ? 21 ASN A H    11 
ATOM 8128  H HA   . ASN A 1 21 ? -12.746 -4.772  2.816   1.00 0.00 ? 21 ASN A HA   11 
ATOM 8129  H HB2  . ASN A 1 21 ? -12.611 -3.589  0.400   1.00 0.00 ? 21 ASN A HB2  11 
ATOM 8130  H HB3  . ASN A 1 21 ? -13.724 -4.900  0.009   1.00 0.00 ? 21 ASN A HB3  11 
ATOM 8131  H HD21 . ASN A 1 21 ? -14.206 -1.895  0.397   1.00 0.00 ? 21 ASN A HD21 11 
ATOM 8132  H HD22 . ASN A 1 21 ? -15.459 -1.817  1.540   1.00 0.00 ? 21 ASN A HD22 11 
ATOM 8133  N N    . PHE B 2 1  ? 9.012   -9.685  -2.932  1.00 0.00 ? 1  PHE B N    11 
ATOM 8134  C CA   . PHE B 2 1  ? 8.456   -8.368  -3.347  1.00 0.00 ? 1  PHE B CA   11 
ATOM 8135  C C    . PHE B 2 1  ? 9.600   -7.369  -3.536  1.00 0.00 ? 1  PHE B C    11 
ATOM 8136  O O    . PHE B 2 1  ? 10.679  -7.542  -3.006  1.00 0.00 ? 1  PHE B O    11 
ATOM 8137  C CB   . PHE B 2 1  ? 7.498   -7.857  -2.265  1.00 0.00 ? 1  PHE B CB   11 
ATOM 8138  C CG   . PHE B 2 1  ? 6.603   -6.787  -2.843  1.00 0.00 ? 1  PHE B CG   11 
ATOM 8139  C CD1  . PHE B 2 1  ? 6.014   -6.969  -4.100  1.00 0.00 ? 1  PHE B CD1  11 
ATOM 8140  C CD2  . PHE B 2 1  ? 6.362   -5.611  -2.121  1.00 0.00 ? 1  PHE B CD2  11 
ATOM 8141  C CE1  . PHE B 2 1  ? 5.184   -5.976  -4.636  1.00 0.00 ? 1  PHE B CE1  11 
ATOM 8142  C CE2  . PHE B 2 1  ? 5.533   -4.619  -2.657  1.00 0.00 ? 1  PHE B CE2  11 
ATOM 8143  C CZ   . PHE B 2 1  ? 4.944   -4.801  -3.914  1.00 0.00 ? 1  PHE B CZ   11 
ATOM 8144  H H1   . PHE B 2 1  ? 10.043  -9.681  -3.054  1.00 0.00 ? 1  PHE B H1   11 
ATOM 8145  H H2   . PHE B 2 1  ? 8.782   -9.859  -1.931  1.00 0.00 ? 1  PHE B H2   11 
ATOM 8146  H H3   . PHE B 2 1  ? 8.599   -10.437 -3.519  1.00 0.00 ? 1  PHE B H3   11 
ATOM 8147  H HA   . PHE B 2 1  ? 7.920   -8.481  -4.277  1.00 0.00 ? 1  PHE B HA   11 
ATOM 8148  H HB2  . PHE B 2 1  ? 6.891   -8.676  -1.907  1.00 0.00 ? 1  PHE B HB2  11 
ATOM 8149  H HB3  . PHE B 2 1  ? 8.068   -7.447  -1.446  1.00 0.00 ? 1  PHE B HB3  11 
ATOM 8150  H HD1  . PHE B 2 1  ? 6.198   -7.875  -4.657  1.00 0.00 ? 1  PHE B HD1  11 
ATOM 8151  H HD2  . PHE B 2 1  ? 6.816   -5.470  -1.151  1.00 0.00 ? 1  PHE B HD2  11 
ATOM 8152  H HE1  . PHE B 2 1  ? 4.730   -6.116  -5.606  1.00 0.00 ? 1  PHE B HE1  11 
ATOM 8153  H HE2  . PHE B 2 1  ? 5.347   -3.712  -2.101  1.00 0.00 ? 1  PHE B HE2  11 
ATOM 8154  H HZ   . PHE B 2 1  ? 4.305   -4.035  -4.327  1.00 0.00 ? 1  PHE B HZ   11 
ATOM 8155  N N    . VAL B 2 2  ? 9.375   -6.328  -4.291  1.00 0.00 ? 2  VAL B N    11 
ATOM 8156  C CA   . VAL B 2 2  ? 10.454  -5.323  -4.516  1.00 0.00 ? 2  VAL B CA   11 
ATOM 8157  C C    . VAL B 2 2  ? 10.545  -4.389  -3.307  1.00 0.00 ? 2  VAL B C    11 
ATOM 8158  O O    . VAL B 2 2  ? 9.556   -3.845  -2.856  1.00 0.00 ? 2  VAL B O    11 
ATOM 8159  C CB   . VAL B 2 2  ? 10.136  -4.505  -5.769  1.00 0.00 ? 2  VAL B CB   11 
ATOM 8160  C CG1  . VAL B 2 2  ? 11.212  -3.436  -5.970  1.00 0.00 ? 2  VAL B CG1  11 
ATOM 8161  C CG2  . VAL B 2 2  ? 10.106  -5.430  -6.988  1.00 0.00 ? 2  VAL B CG2  11 
ATOM 8162  H H    . VAL B 2 2  ? 8.499   -6.208  -4.712  1.00 0.00 ? 2  VAL B H    11 
ATOM 8163  H HA   . VAL B 2 2  ? 11.398  -5.832  -4.649  1.00 0.00 ? 2  VAL B HA   11 
ATOM 8164  H HB   . VAL B 2 2  ? 9.174   -4.027  -5.653  1.00 0.00 ? 2  VAL B HB   11 
ATOM 8165  H HG11 . VAL B 2 2  ? 12.186  -3.906  -5.985  1.00 0.00 ? 2  VAL B HG11 11 
ATOM 8166  H HG12 . VAL B 2 2  ? 11.042  -2.926  -6.906  1.00 0.00 ? 2  VAL B HG12 11 
ATOM 8167  H HG13 . VAL B 2 2  ? 11.170  -2.724  -5.159  1.00 0.00 ? 2  VAL B HG13 11 
ATOM 8168  H HG21 . VAL B 2 2  ? 10.491  -6.400  -6.713  1.00 0.00 ? 2  VAL B HG21 11 
ATOM 8169  H HG22 . VAL B 2 2  ? 9.089   -5.531  -7.337  1.00 0.00 ? 2  VAL B HG22 11 
ATOM 8170  H HG23 . VAL B 2 2  ? 10.714  -5.007  -7.774  1.00 0.00 ? 2  VAL B HG23 11 
ATOM 8171  N N    . ASN B 2 3  ? 11.723  -4.202  -2.780  1.00 0.00 ? 3  ASN B N    11 
ATOM 8172  C CA   . ASN B 2 3  ? 11.877  -3.305  -1.601  1.00 0.00 ? 3  ASN B CA   11 
ATOM 8173  C C    . ASN B 2 3  ? 11.887  -1.848  -2.064  1.00 0.00 ? 3  ASN B C    11 
ATOM 8174  O O    . ASN B 2 3  ? 12.929  -1.275  -2.318  1.00 0.00 ? 3  ASN B O    11 
ATOM 8175  C CB   . ASN B 2 3  ? 13.192  -3.625  -0.885  1.00 0.00 ? 3  ASN B CB   11 
ATOM 8176  C CG   . ASN B 2 3  ? 14.332  -3.687  -1.905  1.00 0.00 ? 3  ASN B CG   11 
ATOM 8177  O OD1  . ASN B 2 3  ? 14.255  -3.087  -2.960  1.00 0.00 ? 3  ASN B OD1  11 
ATOM 8178  N ND2  . ASN B 2 3  ? 15.395  -4.393  -1.632  1.00 0.00 ? 3  ASN B ND2  11 
ATOM 8179  H H    . ASN B 2 3  ? 12.508  -4.652  -3.159  1.00 0.00 ? 3  ASN B H    11 
ATOM 8180  H HA   . ASN B 2 3  ? 11.052  -3.460  -0.921  1.00 0.00 ? 3  ASN B HA   11 
ATOM 8181  H HB2  . ASN B 2 3  ? 13.402  -2.854  -0.157  1.00 0.00 ? 3  ASN B HB2  11 
ATOM 8182  H HB3  . ASN B 2 3  ? 13.107  -4.577  -0.388  1.00 0.00 ? 3  ASN B HB3  11 
ATOM 8183  H HD21 . ASN B 2 3  ? 15.459  -4.874  -0.782  1.00 0.00 ? 3  ASN B HD21 11 
ATOM 8184  H HD22 . ASN B 2 3  ? 16.130  -4.441  -2.279  1.00 0.00 ? 3  ASN B HD22 11 
ATOM 8185  N N    . GLN B 2 4  ? 10.737  -1.244  -2.178  1.00 0.00 ? 4  GLN B N    11 
ATOM 8186  C CA   . GLN B 2 4  ? 10.682  0.175   -2.625  1.00 0.00 ? 4  GLN B CA   11 
ATOM 8187  C C    . GLN B 2 4  ? 9.591   0.911   -1.841  1.00 0.00 ? 4  GLN B C    11 
ATOM 8188  O O    . GLN B 2 4  ? 8.647   0.316   -1.363  1.00 0.00 ? 4  GLN B O    11 
ATOM 8189  C CB   . GLN B 2 4  ? 10.362  0.228   -4.120  1.00 0.00 ? 4  GLN B CB   11 
ATOM 8190  C CG   . GLN B 2 4  ? 10.592  1.646   -4.641  1.00 0.00 ? 4  GLN B CG   11 
ATOM 8191  C CD   . GLN B 2 4  ? 12.088  1.871   -4.876  1.00 0.00 ? 4  GLN B CD   11 
ATOM 8192  O OE1  . GLN B 2 4  ? 12.662  2.805   -4.353  1.00 0.00 ? 4  GLN B OE1  11 
ATOM 8193  N NE2  . GLN B 2 4  ? 12.747  1.048   -5.646  1.00 0.00 ? 4  GLN B NE2  11 
ATOM 8194  H H    . GLN B 2 4  ? 9.908   -1.726  -1.968  1.00 0.00 ? 4  GLN B H    11 
ATOM 8195  H HA   . GLN B 2 4  ? 11.635  0.647   -2.443  1.00 0.00 ? 4  GLN B HA   11 
ATOM 8196  H HB2  . GLN B 2 4  ? 11.006  -0.460  -4.649  1.00 0.00 ? 4  GLN B HB2  11 
ATOM 8197  H HB3  . GLN B 2 4  ? 9.332   -0.051  -4.279  1.00 0.00 ? 4  GLN B HB3  11 
ATOM 8198  H HG2  . GLN B 2 4  ? 10.057  1.778   -5.570  1.00 0.00 ? 4  GLN B HG2  11 
ATOM 8199  H HG3  . GLN B 2 4  ? 10.234  2.358   -3.914  1.00 0.00 ? 4  GLN B HG3  11 
ATOM 8200  H HE21 . GLN B 2 4  ? 12.285  0.294   -6.067  1.00 0.00 ? 4  GLN B HE21 11 
ATOM 8201  H HE22 . GLN B 2 4  ? 13.705  1.184   -5.803  1.00 0.00 ? 4  GLN B HE22 11 
ATOM 8202  N N    . HIS B 2 5  ? 9.718   2.203   -1.703  1.00 0.00 ? 5  HIS B N    11 
ATOM 8203  C CA   . HIS B 2 5  ? 8.693   2.976   -0.948  1.00 0.00 ? 5  HIS B CA   11 
ATOM 8204  C C    . HIS B 2 5  ? 7.374   2.979   -1.725  1.00 0.00 ? 5  HIS B C    11 
ATOM 8205  O O    . HIS B 2 5  ? 7.334   2.686   -2.904  1.00 0.00 ? 5  HIS B O    11 
ATOM 8206  C CB   . HIS B 2 5  ? 9.181   4.413   -0.760  1.00 0.00 ? 5  HIS B CB   11 
ATOM 8207  C CG   . HIS B 2 5  ? 10.347  4.421   0.190   1.00 0.00 ? 5  HIS B CG   11 
ATOM 8208  N ND1  . HIS B 2 5  ? 10.340  3.700   1.372   1.00 0.00 ? 5  HIS B ND1  11 
ATOM 8209  C CD2  . HIS B 2 5  ? 11.562  5.055   0.143   1.00 0.00 ? 5  HIS B CD2  11 
ATOM 8210  C CE1  . HIS B 2 5  ? 11.519  3.915   1.985   1.00 0.00 ? 5  HIS B CE1  11 
ATOM 8211  N NE2  . HIS B 2 5  ? 12.301  4.734   1.277   1.00 0.00 ? 5  HIS B NE2  11 
ATOM 8212  H H    . HIS B 2 5  ? 10.488  2.664   -2.093  1.00 0.00 ? 5  HIS B H    11 
ATOM 8213  H HA   . HIS B 2 5  ? 8.539   2.519   0.018   1.00 0.00 ? 5  HIS B HA   11 
ATOM 8214  H HB2  . HIS B 2 5  ? 9.488   4.816   -1.713  1.00 0.00 ? 5  HIS B HB2  11 
ATOM 8215  H HB3  . HIS B 2 5  ? 8.381   5.016   -0.355  1.00 0.00 ? 5  HIS B HB3  11 
ATOM 8216  H HD1  . HIS B 2 5  ? 9.610   3.137   1.704   1.00 0.00 ? 5  HIS B HD1  11 
ATOM 8217  H HD2  . HIS B 2 5  ? 11.897  5.701   -0.656  1.00 0.00 ? 5  HIS B HD2  11 
ATOM 8218  H HE1  . HIS B 2 5  ? 11.799  3.476   2.932   1.00 0.00 ? 5  HIS B HE1  11 
ATOM 8219  N N    . LEU B 2 6  ? 6.292   3.306   -1.071  1.00 0.00 ? 6  LEU B N    11 
ATOM 8220  C CA   . LEU B 2 6  ? 4.974   3.326   -1.769  1.00 0.00 ? 6  LEU B CA   11 
ATOM 8221  C C    . LEU B 2 6  ? 4.400   4.741   -1.730  1.00 0.00 ? 6  LEU B C    11 
ATOM 8222  O O    . LEU B 2 6  ? 3.498   5.036   -0.971  1.00 0.00 ? 6  LEU B O    11 
ATOM 8223  C CB   . LEU B 2 6  ? 4.013   2.366   -1.067  1.00 0.00 ? 6  LEU B CB   11 
ATOM 8224  C CG   . LEU B 2 6  ? 4.585   0.948   -1.111  1.00 0.00 ? 6  LEU B CG   11 
ATOM 8225  C CD1  . LEU B 2 6  ? 3.713   0.018   -0.264  1.00 0.00 ? 6  LEU B CD1  11 
ATOM 8226  C CD2  . LEU B 2 6  ? 4.600   0.455   -2.559  1.00 0.00 ? 6  LEU B CD2  11 
ATOM 8227  H H    . LEU B 2 6  ? 6.345   3.536   -0.122  1.00 0.00 ? 6  LEU B H    11 
ATOM 8228  H HA   . LEU B 2 6  ? 5.104   3.017   -2.793  1.00 0.00 ? 6  LEU B HA   11 
ATOM 8229  H HB2  . LEU B 2 6  ? 3.885   2.671   -0.038  1.00 0.00 ? 6  LEU B HB2  11 
ATOM 8230  H HB3  . LEU B 2 6  ? 3.058   2.382   -1.568  1.00 0.00 ? 6  LEU B HB3  11 
ATOM 8231  H HG   . LEU B 2 6  ? 5.592   0.954   -0.720  1.00 0.00 ? 6  LEU B HG   11 
ATOM 8232  H HD11 . LEU B 2 6  ? 3.294   0.572   0.562   1.00 0.00 ? 6  LEU B HD11 11 
ATOM 8233  H HD12 . LEU B 2 6  ? 2.916   -0.380  -0.873  1.00 0.00 ? 6  LEU B HD12 11 
ATOM 8234  H HD13 . LEU B 2 6  ? 4.316   -0.793  0.114   1.00 0.00 ? 6  LEU B HD13 11 
ATOM 8235  H HD21 . LEU B 2 6  ? 4.511   1.298   -3.228  1.00 0.00 ? 6  LEU B HD21 11 
ATOM 8236  H HD22 . LEU B 2 6  ? 5.530   -0.063  -2.753  1.00 0.00 ? 6  LEU B HD22 11 
ATOM 8237  H HD23 . LEU B 2 6  ? 3.773   -0.222  -2.719  1.00 0.00 ? 6  LEU B HD23 11 
ATOM 8238  N N    . CYS B 2 7  ? 4.912   5.622   -2.545  1.00 0.00 ? 7  CYS B N    11 
ATOM 8239  C CA   . CYS B 2 7  ? 4.394   7.017   -2.553  1.00 0.00 ? 7  CYS B CA   11 
ATOM 8240  C C    . CYS B 2 7  ? 3.476   7.215   -3.764  1.00 0.00 ? 7  CYS B C    11 
ATOM 8241  O O    . CYS B 2 7  ? 3.593   6.530   -4.760  1.00 0.00 ? 7  CYS B O    11 
ATOM 8242  C CB   . CYS B 2 7  ? 5.566   7.995   -2.639  1.00 0.00 ? 7  CYS B CB   11 
ATOM 8243  S SG   . CYS B 2 7  ? 6.605   7.825   -1.168  1.00 0.00 ? 7  CYS B SG   11 
ATOM 8244  H H    . CYS B 2 7  ? 5.639   5.365   -3.150  1.00 0.00 ? 7  CYS B H    11 
ATOM 8245  H HA   . CYS B 2 7  ? 3.837   7.199   -1.646  1.00 0.00 ? 7  CYS B HA   11 
ATOM 8246  H HB2  . CYS B 2 7  ? 6.151   7.778   -3.521  1.00 0.00 ? 7  CYS B HB2  11 
ATOM 8247  H HB3  . CYS B 2 7  ? 5.189   9.004   -2.699  1.00 0.00 ? 7  CYS B HB3  11 
ATOM 8248  N N    . GLY B 2 8  ? 2.568   8.148   -3.684  1.00 0.00 ? 8  GLY B N    11 
ATOM 8249  C CA   . GLY B 2 8  ? 1.649   8.392   -4.829  1.00 0.00 ? 8  GLY B CA   11 
ATOM 8250  C C    . GLY B 2 8  ? 0.726   7.184   -5.012  1.00 0.00 ? 8  GLY B C    11 
ATOM 8251  O O    . GLY B 2 8  ? 0.196   6.647   -4.061  1.00 0.00 ? 8  GLY B O    11 
ATOM 8252  H H    . GLY B 2 8  ? 2.493   8.691   -2.870  1.00 0.00 ? 8  GLY B H    11 
ATOM 8253  H HA2  . GLY B 2 8  ? 1.053   9.274   -4.633  1.00 0.00 ? 8  GLY B HA2  11 
ATOM 8254  H HA3  . GLY B 2 8  ? 2.224   8.540   -5.730  1.00 0.00 ? 8  GLY B HA3  11 
ATOM 8255  N N    . SER B 2 9  ? 0.534   6.754   -6.230  1.00 0.00 ? 9  SER B N    11 
ATOM 8256  C CA   . SER B 2 9  ? -0.353  5.584   -6.471  1.00 0.00 ? 9  SER B CA   11 
ATOM 8257  C C    . SER B 2 9  ? 0.446   4.288   -6.304  1.00 0.00 ? 9  SER B C    11 
ATOM 8258  O O    . SER B 2 9  ? -0.081  3.203   -6.443  1.00 0.00 ? 9  SER B O    11 
ATOM 8259  C CB   . SER B 2 9  ? -0.916  5.654   -7.890  1.00 0.00 ? 9  SER B CB   11 
ATOM 8260  O OG   . SER B 2 9  ? -0.513  6.874   -8.496  1.00 0.00 ? 9  SER B OG   11 
ATOM 8261  H H    . SER B 2 9  ? 0.970   7.202   -6.984  1.00 0.00 ? 9  SER B H    11 
ATOM 8262  H HA   . SER B 2 9  ? -1.168  5.597   -5.760  1.00 0.00 ? 9  SER B HA   11 
ATOM 8263  H HB2  . SER B 2 9  ? -0.537  4.829   -8.470  1.00 0.00 ? 9  SER B HB2  11 
ATOM 8264  H HB3  . SER B 2 9  ? -1.997  5.597   -7.851  1.00 0.00 ? 9  SER B HB3  11 
ATOM 8265  H HG   . SER B 2 9  ? 0.028   6.663   -9.260  1.00 0.00 ? 9  SER B HG   11 
ATOM 8266  N N    . HIS B 2 10 ? 1.715   4.391   -6.008  1.00 0.00 ? 10 HIS B N    11 
ATOM 8267  C CA   . HIS B 2 10 ? 2.539   3.162   -5.834  1.00 0.00 ? 10 HIS B CA   11 
ATOM 8268  C C    . HIS B 2 10 ? 1.900   2.271   -4.770  1.00 0.00 ? 10 HIS B C    11 
ATOM 8269  O O    . HIS B 2 10 ? 1.694   1.091   -4.974  1.00 0.00 ? 10 HIS B O    11 
ATOM 8270  C CB   . HIS B 2 10 ? 3.952   3.547   -5.392  1.00 0.00 ? 10 HIS B CB   11 
ATOM 8271  C CG   . HIS B 2 10 ? 4.813   3.777   -6.604  1.00 0.00 ? 10 HIS B CG   11 
ATOM 8272  N ND1  . HIS B 2 10 ? 4.868   5.003   -7.248  1.00 0.00 ? 10 HIS B ND1  11 
ATOM 8273  C CD2  . HIS B 2 10 ? 5.662   2.949   -7.299  1.00 0.00 ? 10 HIS B CD2  11 
ATOM 8274  C CE1  . HIS B 2 10 ? 5.722   4.882   -8.281  1.00 0.00 ? 10 HIS B CE1  11 
ATOM 8275  N NE2  . HIS B 2 10 ? 6.235   3.650   -8.356  1.00 0.00 ? 10 HIS B NE2  11 
ATOM 8276  H H    . HIS B 2 10 ? 2.123   5.275   -5.899  1.00 0.00 ? 10 HIS B H    11 
ATOM 8277  H HA   . HIS B 2 10 ? 2.588   2.624   -6.770  1.00 0.00 ? 10 HIS B HA   11 
ATOM 8278  H HB2  . HIS B 2 10 ? 3.910   4.450   -4.803  1.00 0.00 ? 10 HIS B HB2  11 
ATOM 8279  H HB3  . HIS B 2 10 ? 4.373   2.750   -4.798  1.00 0.00 ? 10 HIS B HB3  11 
ATOM 8280  H HD1  . HIS B 2 10 ? 4.374   5.810   -6.995  1.00 0.00 ? 10 HIS B HD1  11 
ATOM 8281  H HD2  . HIS B 2 10 ? 5.855   1.914   -7.061  1.00 0.00 ? 10 HIS B HD2  11 
ATOM 8282  H HE1  . HIS B 2 10 ? 5.963   5.680   -8.962  1.00 0.00 ? 10 HIS B HE1  11 
ATOM 8283  N N    . LEU B 2 11 ? 1.583   2.826   -3.632  1.00 0.00 ? 11 LEU B N    11 
ATOM 8284  C CA   . LEU B 2 11 ? 0.956   2.010   -2.556  1.00 0.00 ? 11 LEU B CA   11 
ATOM 8285  C C    . LEU B 2 11 ? -0.314  1.353   -3.093  1.00 0.00 ? 11 LEU B C    11 
ATOM 8286  O O    . LEU B 2 11 ? -0.645  0.241   -2.737  1.00 0.00 ? 11 LEU B O    11 
ATOM 8287  C CB   . LEU B 2 11 ? 0.604   2.908   -1.371  1.00 0.00 ? 11 LEU B CB   11 
ATOM 8288  C CG   . LEU B 2 11 ? 1.000   2.208   -0.072  1.00 0.00 ? 11 LEU B CG   11 
ATOM 8289  C CD1  . LEU B 2 11 ? 1.450   3.252   0.953   1.00 0.00 ? 11 LEU B CD1  11 
ATOM 8290  C CD2  . LEU B 2 11 ? -0.204  1.434   0.476   1.00 0.00 ? 11 LEU B CD2  11 
ATOM 8291  H H    . LEU B 2 11 ? 1.756   3.779   -3.488  1.00 0.00 ? 11 LEU B H    11 
ATOM 8292  H HA   . LEU B 2 11 ? 1.649   1.245   -2.235  1.00 0.00 ? 11 LEU B HA   11 
ATOM 8293  H HB2  . LEU B 2 11 ? 1.138   3.844   -1.456  1.00 0.00 ? 11 LEU B HB2  11 
ATOM 8294  H HB3  . LEU B 2 11 ? -0.459  3.098   -1.365  1.00 0.00 ? 11 LEU B HB3  11 
ATOM 8295  H HG   . LEU B 2 11 ? 1.813   1.522   -0.267  1.00 0.00 ? 11 LEU B HG   11 
ATOM 8296  H HD11 . LEU B 2 11 ? 0.737   4.061   0.980   1.00 0.00 ? 11 LEU B HD11 11 
ATOM 8297  H HD12 . LEU B 2 11 ? 1.515   2.794   1.928   1.00 0.00 ? 11 LEU B HD12 11 
ATOM 8298  H HD13 . LEU B 2 11 ? 2.422   3.635   0.669   1.00 0.00 ? 11 LEU B HD13 11 
ATOM 8299  H HD21 . LEU B 2 11 ? -0.543  0.726   -0.267  1.00 0.00 ? 11 LEU B HD21 11 
ATOM 8300  H HD22 . LEU B 2 11 ? 0.085   0.904   1.371   1.00 0.00 ? 11 LEU B HD22 11 
ATOM 8301  H HD23 . LEU B 2 11 ? -1.002  2.125   0.708   1.00 0.00 ? 11 LEU B HD23 11 
ATOM 8302  N N    . VAL B 2 12 ? -1.029  2.029   -3.950  1.00 0.00 ? 12 VAL B N    11 
ATOM 8303  C CA   . VAL B 2 12 ? -2.274  1.431   -4.507  1.00 0.00 ? 12 VAL B CA   11 
ATOM 8304  C C    . VAL B 2 12 ? -1.911  0.179   -5.303  1.00 0.00 ? 12 VAL B C    11 
ATOM 8305  O O    . VAL B 2 12 ? -2.623  -0.804  -5.296  1.00 0.00 ? 12 VAL B O    11 
ATOM 8306  C CB   . VAL B 2 12 ? -2.968  2.438   -5.423  1.00 0.00 ? 12 VAL B CB   11 
ATOM 8307  C CG1  . VAL B 2 12 ? -4.095  1.740   -6.183  1.00 0.00 ? 12 VAL B CG1  11 
ATOM 8308  C CG2  . VAL B 2 12 ? -3.549  3.574   -4.581  1.00 0.00 ? 12 VAL B CG2  11 
ATOM 8309  H H    . VAL B 2 12 ? -0.745  2.925   -4.229  1.00 0.00 ? 12 VAL B H    11 
ATOM 8310  H HA   . VAL B 2 12 ? -2.939  1.164   -3.697  1.00 0.00 ? 12 VAL B HA   11 
ATOM 8311  H HB   . VAL B 2 12 ? -2.251  2.839   -6.126  1.00 0.00 ? 12 VAL B HB   11 
ATOM 8312  H HG11 . VAL B 2 12 ? -4.752  1.252   -5.481  1.00 0.00 ? 12 VAL B HG11 11 
ATOM 8313  H HG12 . VAL B 2 12 ? -4.652  2.471   -6.750  1.00 0.00 ? 12 VAL B HG12 11 
ATOM 8314  H HG13 . VAL B 2 12 ? -3.675  1.006   -6.855  1.00 0.00 ? 12 VAL B HG13 11 
ATOM 8315  H HG21 . VAL B 2 12 ? -3.585  3.273   -3.543  1.00 0.00 ? 12 VAL B HG21 11 
ATOM 8316  H HG22 . VAL B 2 12 ? -2.928  4.452   -4.679  1.00 0.00 ? 12 VAL B HG22 11 
ATOM 8317  H HG23 . VAL B 2 12 ? -4.550  3.801   -4.923  1.00 0.00 ? 12 VAL B HG23 11 
ATOM 8318  N N    . GLU B 2 13 ? -0.800  0.208   -5.989  1.00 0.00 ? 13 GLU B N    11 
ATOM 8319  C CA   . GLU B 2 13 ? -0.386  -0.984  -6.780  1.00 0.00 ? 13 GLU B CA   11 
ATOM 8320  C C    . GLU B 2 13 ? 0.007   -2.107  -5.821  1.00 0.00 ? 13 GLU B C    11 
ATOM 8321  O O    . GLU B 2 13 ? 0.070   -3.262  -6.193  1.00 0.00 ? 13 GLU B O    11 
ATOM 8322  C CB   . GLU B 2 13 ? 0.808   -0.621  -7.668  1.00 0.00 ? 13 GLU B CB   11 
ATOM 8323  C CG   . GLU B 2 13 ? 0.358   0.355   -8.755  1.00 0.00 ? 13 GLU B CG   11 
ATOM 8324  C CD   . GLU B 2 13 ? 1.104   0.056   -10.057 1.00 0.00 ? 13 GLU B CD   11 
ATOM 8325  O OE1  . GLU B 2 13 ? 2.312   0.219   -10.074 1.00 0.00 ? 13 GLU B OE1  11 
ATOM 8326  O OE2  . GLU B 2 13 ? 0.456   -0.330  -11.014 1.00 0.00 ? 13 GLU B OE2  11 
ATOM 8327  H H    . GLU B 2 13 ? -0.237  1.010   -5.979  1.00 0.00 ? 13 GLU B H    11 
ATOM 8328  H HA   . GLU B 2 13 ? -1.209  -1.309  -7.398  1.00 0.00 ? 13 GLU B HA   11 
ATOM 8329  H HB2  . GLU B 2 13 ? 1.578   -0.161  -7.066  1.00 0.00 ? 13 GLU B HB2  11 
ATOM 8330  H HB3  . GLU B 2 13 ? 1.199   -1.517  -8.129  1.00 0.00 ? 13 GLU B HB3  11 
ATOM 8331  H HG2  . GLU B 2 13 ? -0.706  0.247   -8.917  1.00 0.00 ? 13 GLU B HG2  11 
ATOM 8332  H HG3  . GLU B 2 13 ? 0.571   1.366   -8.444  1.00 0.00 ? 13 GLU B HG3  11 
ATOM 8333  N N    . ALA B 2 14 ? 0.261   -1.778  -4.583  1.00 0.00 ? 14 ALA B N    11 
ATOM 8334  C CA   . ALA B 2 14 ? 0.640   -2.826  -3.595  1.00 0.00 ? 14 ALA B CA   11 
ATOM 8335  C C    . ALA B 2 14 ? -0.587  -3.187  -2.756  1.00 0.00 ? 14 ALA B C    11 
ATOM 8336  O O    . ALA B 2 14 ? -0.613  -4.192  -2.074  1.00 0.00 ? 14 ALA B O    11 
ATOM 8337  C CB   . ALA B 2 14 ? 1.745   -2.291  -2.681  1.00 0.00 ? 14 ALA B CB   11 
ATOM 8338  H H    . ALA B 2 14 ? 0.199   -0.841  -4.302  1.00 0.00 ? 14 ALA B H    11 
ATOM 8339  H HA   . ALA B 2 14 ? 0.994   -3.703  -4.116  1.00 0.00 ? 14 ALA B HA   11 
ATOM 8340  H HB1  . ALA B 2 14 ? 2.605   -2.020  -3.275  1.00 0.00 ? 14 ALA B HB1  11 
ATOM 8341  H HB2  . ALA B 2 14 ? 1.386   -1.422  -2.151  1.00 0.00 ? 14 ALA B HB2  11 
ATOM 8342  H HB3  . ALA B 2 14 ? 2.025   -3.056  -1.970  1.00 0.00 ? 14 ALA B HB3  11 
ATOM 8343  N N    . LEU B 2 15 ? -1.606  -2.371  -2.802  1.00 0.00 ? 15 LEU B N    11 
ATOM 8344  C CA   . LEU B 2 15 ? -2.832  -2.667  -2.011  1.00 0.00 ? 15 LEU B CA   11 
ATOM 8345  C C    . LEU B 2 15 ? -3.727  -3.625  -2.802  1.00 0.00 ? 15 LEU B C    11 
ATOM 8346  O O    . LEU B 2 15 ? -4.254  -4.581  -2.267  1.00 0.00 ? 15 LEU B O    11 
ATOM 8347  C CB   . LEU B 2 15 ? -3.594  -1.366  -1.743  1.00 0.00 ? 15 LEU B CB   11 
ATOM 8348  C CG   . LEU B 2 15 ? -2.807  -0.502  -0.754  1.00 0.00 ? 15 LEU B CG   11 
ATOM 8349  C CD1  . LEU B 2 15 ? -3.477  0.866   -0.626  1.00 0.00 ? 15 LEU B CD1  11 
ATOM 8350  C CD2  . LEU B 2 15 ? -2.781  -1.185  0.613   1.00 0.00 ? 15 LEU B CD2  11 
ATOM 8351  H H    . LEU B 2 15 ? -1.564  -1.567  -3.361  1.00 0.00 ? 15 LEU B H    11 
ATOM 8352  H HA   . LEU B 2 15 ? -2.555  -3.121  -1.073  1.00 0.00 ? 15 LEU B HA   11 
ATOM 8353  H HB2  . LEU B 2 15 ? -3.721  -0.827  -2.670  1.00 0.00 ? 15 LEU B HB2  11 
ATOM 8354  H HB3  . LEU B 2 15 ? -4.560  -1.596  -1.324  1.00 0.00 ? 15 LEU B HB3  11 
ATOM 8355  H HG   . LEU B 2 15 ? -1.795  -0.375  -1.114  1.00 0.00 ? 15 LEU B HG   11 
ATOM 8356  H HD11 . LEU B 2 15 ? -4.256  0.955   -1.370  1.00 0.00 ? 15 LEU B HD11 11 
ATOM 8357  H HD12 . LEU B 2 15 ? -3.908  0.963   0.359   1.00 0.00 ? 15 LEU B HD12 11 
ATOM 8358  H HD13 . LEU B 2 15 ? -2.743  1.644   -0.778  1.00 0.00 ? 15 LEU B HD13 11 
ATOM 8359  H HD21 . LEU B 2 15 ? -3.194  -2.180  0.528   1.00 0.00 ? 15 LEU B HD21 11 
ATOM 8360  H HD22 . LEU B 2 15 ? -1.762  -1.248  0.966   1.00 0.00 ? 15 LEU B HD22 11 
ATOM 8361  H HD23 . LEU B 2 15 ? -3.368  -0.611  1.313   1.00 0.00 ? 15 LEU B HD23 11 
ATOM 8362  N N    . HIS B 2 16 ? -3.901  -3.380  -4.072  1.00 0.00 ? 16 HIS B N    11 
ATOM 8363  C CA   . HIS B 2 16 ? -4.761  -4.280  -4.892  1.00 0.00 ? 16 HIS B CA   11 
ATOM 8364  C C    . HIS B 2 16 ? -4.080  -5.646  -5.029  1.00 0.00 ? 16 HIS B C    11 
ATOM 8365  O O    . HIS B 2 16 ? -4.725  -6.676  -5.047  1.00 0.00 ? 16 HIS B O    11 
ATOM 8366  C CB   . HIS B 2 16 ? -4.978  -3.653  -6.282  1.00 0.00 ? 16 HIS B CB   11 
ATOM 8367  C CG   . HIS B 2 16 ? -3.837  -3.996  -7.202  1.00 0.00 ? 16 HIS B CG   11 
ATOM 8368  N ND1  . HIS B 2 16 ? -4.008  -4.782  -8.331  1.00 0.00 ? 16 HIS B ND1  11 
ATOM 8369  C CD2  . HIS B 2 16 ? -2.507  -3.669  -7.170  1.00 0.00 ? 16 HIS B CD2  11 
ATOM 8370  C CE1  . HIS B 2 16 ? -2.808  -4.900  -8.928  1.00 0.00 ? 16 HIS B CE1  11 
ATOM 8371  N NE2  . HIS B 2 16 ? -1.857  -4.240  -8.262  1.00 0.00 ? 16 HIS B NE2  11 
ATOM 8372  H H    . HIS B 2 16 ? -3.466  -2.605  -4.487  1.00 0.00 ? 16 HIS B H    11 
ATOM 8373  H HA   . HIS B 2 16 ? -5.715  -4.405  -4.404  1.00 0.00 ? 16 HIS B HA   11 
ATOM 8374  H HB2  . HIS B 2 16 ? -5.901  -4.027  -6.701  1.00 0.00 ? 16 HIS B HB2  11 
ATOM 8375  H HB3  . HIS B 2 16 ? -5.041  -2.579  -6.180  1.00 0.00 ? 16 HIS B HB3  11 
ATOM 8376  H HD1  . HIS B 2 16 ? -4.850  -5.180  -8.637  1.00 0.00 ? 16 HIS B HD1  11 
ATOM 8377  H HD2  . HIS B 2 16 ? -2.035  -3.064  -6.412  1.00 0.00 ? 16 HIS B HD2  11 
ATOM 8378  H HE1  . HIS B 2 16 ? -2.636  -5.460  -9.835  1.00 0.00 ? 16 HIS B HE1  11 
ATOM 8379  N N    . LEU B 2 17 ? -2.781  -5.656  -5.128  1.00 0.00 ? 17 LEU B N    11 
ATOM 8380  C CA   . LEU B 2 17 ? -2.045  -6.944  -5.269  1.00 0.00 ? 17 LEU B CA   11 
ATOM 8381  C C    . LEU B 2 17 ? -2.214  -7.778  -3.995  1.00 0.00 ? 17 LEU B C    11 
ATOM 8382  O O    . LEU B 2 17 ? -2.108  -8.988  -4.017  1.00 0.00 ? 17 LEU B O    11 
ATOM 8383  C CB   . LEU B 2 17 ? -0.560  -6.652  -5.493  1.00 0.00 ? 17 LEU B CB   11 
ATOM 8384  C CG   . LEU B 2 17 ? 0.196   -7.966  -5.694  1.00 0.00 ? 17 LEU B CG   11 
ATOM 8385  C CD1  . LEU B 2 17 ? -0.197  -8.581  -7.037  1.00 0.00 ? 17 LEU B CD1  11 
ATOM 8386  C CD2  . LEU B 2 17 ? 1.701   -7.691  -5.679  1.00 0.00 ? 17 LEU B CD2  11 
ATOM 8387  H H    . LEU B 2 17 ? -2.284  -4.810  -5.113  1.00 0.00 ? 17 LEU B H    11 
ATOM 8388  H HA   . LEU B 2 17 ? -2.436  -7.491  -6.113  1.00 0.00 ? 17 LEU B HA   11 
ATOM 8389  H HB2  . LEU B 2 17 ? -0.445  -6.030  -6.368  1.00 0.00 ? 17 LEU B HB2  11 
ATOM 8390  H HB3  . LEU B 2 17 ? -0.162  -6.138  -4.630  1.00 0.00 ? 17 LEU B HB3  11 
ATOM 8391  H HG   . LEU B 2 17 ? -0.056  -8.649  -4.896  1.00 0.00 ? 17 LEU B HG   11 
ATOM 8392  H HD11 . LEU B 2 17 ? -1.266  -8.516  -7.165  1.00 0.00 ? 17 LEU B HD11 11 
ATOM 8393  H HD12 . LEU B 2 17 ? 0.297   -8.047  -7.835  1.00 0.00 ? 17 LEU B HD12 11 
ATOM 8394  H HD13 . LEU B 2 17 ? 0.106   -9.619  -7.059  1.00 0.00 ? 17 LEU B HD13 11 
ATOM 8395  H HD21 . LEU B 2 17 ? 1.881   -6.695  -5.301  1.00 0.00 ? 17 LEU B HD21 11 
ATOM 8396  H HD22 . LEU B 2 17 ? 2.191   -8.412  -5.043  1.00 0.00 ? 17 LEU B HD22 11 
ATOM 8397  H HD23 . LEU B 2 17 ? 2.091   -7.772  -6.682  1.00 0.00 ? 17 LEU B HD23 11 
ATOM 8398  N N    . VAL B 2 18 ? -2.468  -7.141  -2.884  1.00 0.00 ? 18 VAL B N    11 
ATOM 8399  C CA   . VAL B 2 18 ? -2.634  -7.897  -1.612  1.00 0.00 ? 18 VAL B CA   11 
ATOM 8400  C C    . VAL B 2 18 ? -4.068  -8.419  -1.501  1.00 0.00 ? 18 VAL B C    11 
ATOM 8401  O O    . VAL B 2 18 ? -4.300  -9.608  -1.403  1.00 0.00 ? 18 VAL B O    11 
ATOM 8402  C CB   . VAL B 2 18 ? -2.337  -6.970  -0.431  1.00 0.00 ? 18 VAL B CB   11 
ATOM 8403  C CG1  . VAL B 2 18 ? -2.626  -7.702  0.880   1.00 0.00 ? 18 VAL B CG1  11 
ATOM 8404  C CG2  . VAL B 2 18 ? -0.865  -6.555  -0.470  1.00 0.00 ? 18 VAL B CG2  11 
ATOM 8405  H H    . VAL B 2 18 ? -2.544  -6.164  -2.887  1.00 0.00 ? 18 VAL B H    11 
ATOM 8406  H HA   . VAL B 2 18 ? -1.946  -8.730  -1.596  1.00 0.00 ? 18 VAL B HA   11 
ATOM 8407  H HB   . VAL B 2 18 ? -2.962  -6.091  -0.498  1.00 0.00 ? 18 VAL B HB   11 
ATOM 8408  H HG11 . VAL B 2 18 ? -3.038  -8.677  0.666   1.00 0.00 ? 18 VAL B HG11 11 
ATOM 8409  H HG12 . VAL B 2 18 ? -1.711  -7.813  1.440   1.00 0.00 ? 18 VAL B HG12 11 
ATOM 8410  H HG13 . VAL B 2 18 ? -3.336  -7.133  1.462   1.00 0.00 ? 18 VAL B HG13 11 
ATOM 8411  H HG21 . VAL B 2 18 ? -0.445  -6.802  -1.433  1.00 0.00 ? 18 VAL B HG21 11 
ATOM 8412  H HG22 . VAL B 2 18 ? -0.787  -5.490  -0.306  1.00 0.00 ? 18 VAL B HG22 11 
ATOM 8413  H HG23 . VAL B 2 18 ? -0.323  -7.076  0.305   1.00 0.00 ? 18 VAL B HG23 11 
ATOM 8414  N N    . CYS B 2 19 ? -5.031  -7.539  -1.508  1.00 0.00 ? 19 CYS B N    11 
ATOM 8415  C CA   . CYS B 2 19 ? -6.448  -7.985  -1.393  1.00 0.00 ? 19 CYS B CA   11 
ATOM 8416  C C    . CYS B 2 19 ? -6.876  -8.685  -2.687  1.00 0.00 ? 19 CYS B C    11 
ATOM 8417  O O    . CYS B 2 19 ? -7.027  -9.890  -2.726  1.00 0.00 ? 19 CYS B O    11 
ATOM 8418  C CB   . CYS B 2 19 ? -7.332  -6.765  -1.144  1.00 0.00 ? 19 CYS B CB   11 
ATOM 8419  S SG   . CYS B 2 19 ? -6.516  -5.669  0.043   1.00 0.00 ? 19 CYS B SG   11 
ATOM 8420  H H    . CYS B 2 19 ? -4.824  -6.585  -1.583  1.00 0.00 ? 19 CYS B H    11 
ATOM 8421  H HA   . CYS B 2 19 ? -6.542  -8.671  -0.566  1.00 0.00 ? 19 CYS B HA   11 
ATOM 8422  H HB2  . CYS B 2 19 ? -7.485  -6.236  -2.073  1.00 0.00 ? 19 CYS B HB2  11 
ATOM 8423  H HB3  . CYS B 2 19 ? -8.284  -7.082  -0.747  1.00 0.00 ? 19 CYS B HB3  11 
ATOM 8424  N N    . GLY B 2 20 ? -7.071  -7.945  -3.743  1.00 0.00 ? 20 GLY B N    11 
ATOM 8425  C CA   . GLY B 2 20 ? -7.484  -8.579  -5.027  1.00 0.00 ? 20 GLY B CA   11 
ATOM 8426  C C    . GLY B 2 20 ? -9.011  -8.622  -5.119  1.00 0.00 ? 20 GLY B C    11 
ATOM 8427  O O    . GLY B 2 20 ? -9.670  -7.602  -5.193  1.00 0.00 ? 20 GLY B O    11 
ATOM 8428  H H    . GLY B 2 20 ? -6.941  -6.974  -3.693  1.00 0.00 ? 20 GLY B H    11 
ATOM 8429  H HA2  . GLY B 2 20 ? -7.090  -8.008  -5.853  1.00 0.00 ? 20 GLY B HA2  11 
ATOM 8430  H HA3  . GLY B 2 20 ? -7.098  -9.586  -5.070  1.00 0.00 ? 20 GLY B HA3  11 
ATOM 8431  N N    . GLU B 2 21 ? -9.577  -9.798  -5.124  1.00 0.00 ? 21 GLU B N    11 
ATOM 8432  C CA   . GLU B 2 21 ? -11.059 -9.925  -5.217  1.00 0.00 ? 21 GLU B CA   11 
ATOM 8433  C C    . GLU B 2 21 ? -11.727 -8.884  -4.319  1.00 0.00 ? 21 GLU B C    11 
ATOM 8434  O O    . GLU B 2 21 ? -12.296 -7.916  -4.785  1.00 0.00 ? 21 GLU B O    11 
ATOM 8435  C CB   . GLU B 2 21 ? -11.479 -11.324 -4.765  1.00 0.00 ? 21 GLU B CB   11 
ATOM 8436  C CG   . GLU B 2 21 ? -10.901 -12.371 -5.718  1.00 0.00 ? 21 GLU B CG   11 
ATOM 8437  C CD   . GLU B 2 21 ? -9.725  -13.082 -5.045  1.00 0.00 ? 21 GLU B CD   11 
ATOM 8438  O OE1  . GLU B 2 21 ? -9.637  -13.019 -3.829  1.00 0.00 ? 21 GLU B OE1  11 
ATOM 8439  O OE2  . GLU B 2 21 ? -8.932  -13.679 -5.755  1.00 0.00 ? 21 GLU B OE2  11 
ATOM 8440  H H    . GLU B 2 21 ? -9.022  -10.603 -5.069  1.00 0.00 ? 21 GLU B H    11 
ATOM 8441  H HA   . GLU B 2 21 ? -11.371 -9.770  -6.239  1.00 0.00 ? 21 GLU B HA   11 
ATOM 8442  H HB2  . GLU B 2 21 ? -11.109 -11.505 -3.765  1.00 0.00 ? 21 GLU B HB2  11 
ATOM 8443  H HB3  . GLU B 2 21 ? -12.556 -11.396 -4.765  1.00 0.00 ? 21 GLU B HB3  11 
ATOM 8444  H HG2  . GLU B 2 21 ? -11.665 -13.094 -5.966  1.00 0.00 ? 21 GLU B HG2  11 
ATOM 8445  H HG3  . GLU B 2 21 ? -10.557 -11.888 -6.619  1.00 0.00 ? 21 GLU B HG3  11 
ATOM 8446  N N    . ARG B 2 22 ? -11.667 -9.076  -3.030  1.00 0.00 ? 22 ARG B N    11 
ATOM 8447  C CA   . ARG B 2 22 ? -12.305 -8.106  -2.098  1.00 0.00 ? 22 ARG B CA   11 
ATOM 8448  C C    . ARG B 2 22 ? -11.989 -6.676  -2.544  1.00 0.00 ? 22 ARG B C    11 
ATOM 8449  O O    . ARG B 2 22 ? -12.853 -5.823  -2.576  1.00 0.00 ? 22 ARG B O    11 
ATOM 8450  C CB   . ARG B 2 22 ? -11.772 -8.329  -0.683  1.00 0.00 ? 22 ARG B CB   11 
ATOM 8451  C CG   . ARG B 2 22 ? -12.562 -9.460  -0.018  1.00 0.00 ? 22 ARG B CG   11 
ATOM 8452  C CD   . ARG B 2 22 ? -11.663 -10.197 0.977   1.00 0.00 ? 22 ARG B CD   11 
ATOM 8453  N NE   . ARG B 2 22 ? -10.921 -11.277 0.269   1.00 0.00 ? 22 ARG B NE   11 
ATOM 8454  C CZ   . ARG B 2 22 ? -9.892  -11.848 0.836   1.00 0.00 ? 22 ARG B CZ   11 
ATOM 8455  N NH1  . ARG B 2 22 ? -9.512  -11.477 2.029   1.00 0.00 ? 22 ARG B NH1  11 
ATOM 8456  N NH2  . ARG B 2 22 ? -9.243  -12.790 0.209   1.00 0.00 ? 22 ARG B NH2  11 
ATOM 8457  H H    . ARG B 2 22 ? -11.206 -9.866  -2.675  1.00 0.00 ? 22 ARG B H    11 
ATOM 8458  H HA   . ARG B 2 22 ? -13.371 -8.253  -2.104  1.00 0.00 ? 22 ARG B HA   11 
ATOM 8459  H HB2  . ARG B 2 22 ? -10.727 -8.597  -0.729  1.00 0.00 ? 22 ARG B HB2  11 
ATOM 8460  H HB3  . ARG B 2 22 ? -11.890 -7.425  -0.110  1.00 0.00 ? 22 ARG B HB3  11 
ATOM 8461  H HG2  . ARG B 2 22 ? -13.412 -9.046  0.505   1.00 0.00 ? 22 ARG B HG2  11 
ATOM 8462  H HG3  . ARG B 2 22 ? -12.903 -10.154 -0.771  1.00 0.00 ? 22 ARG B HG3  11 
ATOM 8463  H HD2  . ARG B 2 22 ? -10.960 -9.502  1.411   1.00 0.00 ? 22 ARG B HD2  11 
ATOM 8464  H HD3  . ARG B 2 22 ? -12.271 -10.628 1.758   1.00 0.00 ? 22 ARG B HD3  11 
ATOM 8465  H HE   . ARG B 2 22 ? -11.205 -11.560 -0.626  1.00 0.00 ? 22 ARG B HE   11 
ATOM 8466  H HH11 . ARG B 2 22 ? -10.008 -10.756 2.513   1.00 0.00 ? 22 ARG B HH11 11 
ATOM 8467  H HH12 . ARG B 2 22 ? -8.725  -11.917 2.461   1.00 0.00 ? 22 ARG B HH12 11 
ATOM 8468  H HH21 . ARG B 2 22 ? -9.535  -13.076 -0.705  1.00 0.00 ? 22 ARG B HH21 11 
ATOM 8469  H HH22 . ARG B 2 22 ? -8.455  -13.227 0.641   1.00 0.00 ? 22 ARG B HH22 11 
ATOM 8470  N N    . GLY B 2 23 ? -10.761 -6.404  -2.891  1.00 0.00 ? 23 GLY B N    11 
ATOM 8471  C CA   . GLY B 2 23 ? -10.405 -5.025  -3.330  1.00 0.00 ? 23 GLY B CA   11 
ATOM 8472  C C    . GLY B 2 23 ? -9.739  -4.278  -2.178  1.00 0.00 ? 23 GLY B C    11 
ATOM 8473  O O    . GLY B 2 23 ? -9.329  -4.863  -1.195  1.00 0.00 ? 23 GLY B O    11 
ATOM 8474  H H    . GLY B 2 23 ? -10.076 -7.103  -2.860  1.00 0.00 ? 23 GLY B H    11 
ATOM 8475  H HA2  . GLY B 2 23 ? -9.725  -5.076  -4.167  1.00 0.00 ? 23 GLY B HA2  11 
ATOM 8476  H HA3  . GLY B 2 23 ? -11.299 -4.499  -3.625  1.00 0.00 ? 23 GLY B HA3  11 
ATOM 8477  N N    . PHE B 2 24 ? -9.621  -2.986  -2.295  1.00 0.00 ? 24 PHE B N    11 
ATOM 8478  C CA   . PHE B 2 24 ? -8.976  -2.193  -1.212  1.00 0.00 ? 24 PHE B CA   11 
ATOM 8479  C C    . PHE B 2 24 ? -9.462  -0.745  -1.280  1.00 0.00 ? 24 PHE B C    11 
ATOM 8480  O O    . PHE B 2 24 ? -9.692  -0.204  -2.343  1.00 0.00 ? 24 PHE B O    11 
ATOM 8481  C CB   . PHE B 2 24 ? -7.459  -2.224  -1.401  1.00 0.00 ? 24 PHE B CB   11 
ATOM 8482  C CG   . PHE B 2 24 ? -7.118  -1.602  -2.728  1.00 0.00 ? 24 PHE B CG   11 
ATOM 8483  C CD1  . PHE B 2 24 ? -7.269  -2.350  -3.895  1.00 0.00 ? 24 PHE B CD1  11 
ATOM 8484  C CD2  . PHE B 2 24 ? -6.660  -0.283  -2.792  1.00 0.00 ? 24 PHE B CD2  11 
ATOM 8485  C CE1  . PHE B 2 24 ? -6.960  -1.782  -5.135  1.00 0.00 ? 24 PHE B CE1  11 
ATOM 8486  C CE2  . PHE B 2 24 ? -6.351  0.291   -4.032  1.00 0.00 ? 24 PHE B CE2  11 
ATOM 8487  C CZ   . PHE B 2 24 ? -6.501  -0.460  -5.204  1.00 0.00 ? 24 PHE B CZ   11 
ATOM 8488  H H    . PHE B 2 24 ? -9.954  -2.538  -3.099  1.00 0.00 ? 24 PHE B H    11 
ATOM 8489  H HA   . PHE B 2 24 ? -9.229  -2.617  -0.251  1.00 0.00 ? 24 PHE B HA   11 
ATOM 8490  H HB2  . PHE B 2 24 ? -6.982  -1.669  -0.607  1.00 0.00 ? 24 PHE B HB2  11 
ATOM 8491  H HB3  . PHE B 2 24 ? -7.117  -3.247  -1.388  1.00 0.00 ? 24 PHE B HB3  11 
ATOM 8492  H HD1  . PHE B 2 24 ? -7.621  -3.370  -3.836  1.00 0.00 ? 24 PHE B HD1  11 
ATOM 8493  H HD2  . PHE B 2 24 ? -6.543  0.294   -1.886  1.00 0.00 ? 24 PHE B HD2  11 
ATOM 8494  H HE1  . PHE B 2 24 ? -7.076  -2.360  -6.040  1.00 0.00 ? 24 PHE B HE1  11 
ATOM 8495  H HE2  . PHE B 2 24 ? -5.997  1.309   -4.083  1.00 0.00 ? 24 PHE B HE2  11 
ATOM 8496  H HZ   . PHE B 2 24 ? -6.264  -0.019  -6.162  1.00 0.00 ? 24 PHE B HZ   11 
ATOM 8497  N N    . PHE B 2 25 ? -9.614  -0.106  -0.152  1.00 0.00 ? 25 PHE B N    11 
ATOM 8498  C CA   . PHE B 2 25 ? -10.075 1.310   -0.154  1.00 0.00 ? 25 PHE B CA   11 
ATOM 8499  C C    . PHE B 2 25 ? -8.907  2.221   0.224   1.00 0.00 ? 25 PHE B C    11 
ATOM 8500  O O    . PHE B 2 25 ? -8.679  2.511   1.381   1.00 0.00 ? 25 PHE B O    11 
ATOM 8501  C CB   . PHE B 2 25 ? -11.212 1.485   0.857   1.00 0.00 ? 25 PHE B CB   11 
ATOM 8502  C CG   . PHE B 2 25 ? -11.009 0.541   2.020   1.00 0.00 ? 25 PHE B CG   11 
ATOM 8503  C CD1  . PHE B 2 25 ? -10.266 0.954   3.134   1.00 0.00 ? 25 PHE B CD1  11 
ATOM 8504  C CD2  . PHE B 2 25 ? -11.563 -0.741  1.985   1.00 0.00 ? 25 PHE B CD2  11 
ATOM 8505  C CE1  . PHE B 2 25 ? -10.080 0.080   4.211   1.00 0.00 ? 25 PHE B CE1  11 
ATOM 8506  C CE2  . PHE B 2 25 ? -11.375 -1.616  3.061   1.00 0.00 ? 25 PHE B CE2  11 
ATOM 8507  C CZ   . PHE B 2 25 ? -10.634 -1.205  4.174   1.00 0.00 ? 25 PHE B CZ   11 
ATOM 8508  H H    . PHE B 2 25 ? -9.418  -0.558  0.698   1.00 0.00 ? 25 PHE B H    11 
ATOM 8509  H HA   . PHE B 2 25 ? -10.429 1.570   -1.140  1.00 0.00 ? 25 PHE B HA   11 
ATOM 8510  H HB2  . PHE B 2 25 ? -11.220 2.503   1.216   1.00 0.00 ? 25 PHE B HB2  11 
ATOM 8511  H HB3  . PHE B 2 25 ? -12.156 1.266   0.380   1.00 0.00 ? 25 PHE B HB3  11 
ATOM 8512  H HD1  . PHE B 2 25 ? -9.839  1.945   3.162   1.00 0.00 ? 25 PHE B HD1  11 
ATOM 8513  H HD2  . PHE B 2 25 ? -12.136 -1.059  1.124   1.00 0.00 ? 25 PHE B HD2  11 
ATOM 8514  H HE1  . PHE B 2 25 ? -9.506  0.397   5.070   1.00 0.00 ? 25 PHE B HE1  11 
ATOM 8515  H HE2  . PHE B 2 25 ? -11.804 -2.607  3.033   1.00 0.00 ? 25 PHE B HE2  11 
ATOM 8516  H HZ   . PHE B 2 25 ? -10.489 -1.878  5.006   1.00 0.00 ? 25 PHE B HZ   11 
ATOM 8517  N N    . TYR B 2 26 ? -8.159  2.672   -0.747  1.00 0.00 ? 26 TYR B N    11 
ATOM 8518  C CA   . TYR B 2 26 ? -7.000  3.560   -0.446  1.00 0.00 ? 26 TYR B CA   11 
ATOM 8519  C C    . TYR B 2 26 ? -7.510  4.923   0.025   1.00 0.00 ? 26 TYR B C    11 
ATOM 8520  O O    . TYR B 2 26 ? -8.519  5.414   -0.438  1.00 0.00 ? 26 TYR B O    11 
ATOM 8521  C CB   . TYR B 2 26 ? -6.155  3.738   -1.710  1.00 0.00 ? 26 TYR B CB   11 
ATOM 8522  C CG   . TYR B 2 26 ? -4.775  4.223   -1.332  1.00 0.00 ? 26 TYR B CG   11 
ATOM 8523  C CD1  . TYR B 2 26 ? -4.087  3.626   -0.269  1.00 0.00 ? 26 TYR B CD1  11 
ATOM 8524  C CD2  . TYR B 2 26 ? -4.184  5.273   -2.045  1.00 0.00 ? 26 TYR B CD2  11 
ATOM 8525  C CE1  . TYR B 2 26 ? -2.806  4.077   0.079   1.00 0.00 ? 26 TYR B CE1  11 
ATOM 8526  C CE2  . TYR B 2 26 ? -2.905  5.725   -1.697  1.00 0.00 ? 26 TYR B CE2  11 
ATOM 8527  C CZ   . TYR B 2 26 ? -2.215  5.126   -0.635  1.00 0.00 ? 26 TYR B CZ   11 
ATOM 8528  O OH   . TYR B 2 26 ? -0.954  5.572   -0.291  1.00 0.00 ? 26 TYR B OH   11 
ATOM 8529  H H    . TYR B 2 26 ? -8.356  2.424   -1.673  1.00 0.00 ? 26 TYR B H    11 
ATOM 8530  H HA   . TYR B 2 26 ? -6.396  3.114   0.330   1.00 0.00 ? 26 TYR B HA   11 
ATOM 8531  H HB2  . TYR B 2 26 ? -6.074  2.793   -2.225  1.00 0.00 ? 26 TYR B HB2  11 
ATOM 8532  H HB3  . TYR B 2 26 ? -6.625  4.463   -2.356  1.00 0.00 ? 26 TYR B HB3  11 
ATOM 8533  H HD1  . TYR B 2 26 ? -4.542  2.816   0.281   1.00 0.00 ? 26 TYR B HD1  11 
ATOM 8534  H HD2  . TYR B 2 26 ? -4.714  5.736   -2.864  1.00 0.00 ? 26 TYR B HD2  11 
ATOM 8535  H HE1  . TYR B 2 26 ? -2.275  3.614   0.898   1.00 0.00 ? 26 TYR B HE1  11 
ATOM 8536  H HE2  . TYR B 2 26 ? -2.449  6.533   -2.249  1.00 0.00 ? 26 TYR B HE2  11 
ATOM 8537  H HH   . TYR B 2 26 ? -0.348  4.830   -0.359  1.00 0.00 ? 26 TYR B HH   11 
ATOM 8538  N N    . THR B 2 27 ? -6.822  5.536   0.948   1.00 0.00 ? 27 THR B N    11 
ATOM 8539  C CA   . THR B 2 27 ? -7.268  6.865   1.451   1.00 0.00 ? 27 THR B CA   11 
ATOM 8540  C C    . THR B 2 27 ? -6.058  7.797   1.573   1.00 0.00 ? 27 THR B C    11 
ATOM 8541  O O    . THR B 2 27 ? -5.680  8.182   2.661   1.00 0.00 ? 27 THR B O    11 
ATOM 8542  C CB   . THR B 2 27 ? -7.924  6.696   2.823   1.00 0.00 ? 27 THR B CB   11 
ATOM 8543  O OG1  . THR B 2 27 ? -8.985  5.756   2.724   1.00 0.00 ? 27 THR B OG1  11 
ATOM 8544  C CG2  . THR B 2 27 ? -8.475  8.039   3.300   1.00 0.00 ? 27 THR B CG2  11 
ATOM 8545  H H    . THR B 2 27 ? -6.010  5.122   1.309   1.00 0.00 ? 27 THR B H    11 
ATOM 8546  H HA   . THR B 2 27 ? -7.981  7.290   0.761   1.00 0.00 ? 27 THR B HA   11 
ATOM 8547  H HB   . THR B 2 27 ? -7.191  6.339   3.531   1.00 0.00 ? 27 THR B HB   11 
ATOM 8548  H HG1  . THR B 2 27 ? -9.308  5.579   3.611   1.00 0.00 ? 27 THR B HG1  11 
ATOM 8549  H HG21 . THR B 2 27 ? -9.187  8.412   2.579   1.00 0.00 ? 27 THR B HG21 11 
ATOM 8550  H HG22 . THR B 2 27 ? -8.961  7.911   4.255   1.00 0.00 ? 27 THR B HG22 11 
ATOM 8551  H HG23 . THR B 2 27 ? -7.663  8.746   3.402   1.00 0.00 ? 27 THR B HG23 11 
ATOM 8552  N N    . PRO B 2 28 ? -5.487  8.127   0.444   1.00 0.00 ? 28 PRO B N    11 
ATOM 8553  C CA   . PRO B 2 28 ? -4.305  9.015   0.356   1.00 0.00 ? 28 PRO B CA   11 
ATOM 8554  C C    . PRO B 2 28 ? -4.628  10.385  0.959   1.00 0.00 ? 28 PRO B C    11 
ATOM 8555  O O    . PRO B 2 28 ? -5.701  10.605  1.487   1.00 0.00 ? 28 PRO B O    11 
ATOM 8556  C CB   . PRO B 2 28 ? -3.992  9.154   -1.137  1.00 0.00 ? 28 PRO B CB   11 
ATOM 8557  C CG   . PRO B 2 28 ? -5.031  8.321   -1.911  1.00 0.00 ? 28 PRO B CG   11 
ATOM 8558  C CD   . PRO B 2 28 ? -5.951  7.655   -0.880  1.00 0.00 ? 28 PRO B CD   11 
ATOM 8559  H HA   . PRO B 2 28 ? -3.465  8.571   0.866   1.00 0.00 ? 28 PRO B HA   11 
ATOM 8560  H HB2  . PRO B 2 28 ? -4.057  10.194  -1.431  1.00 0.00 ? 28 PRO B HB2  11 
ATOM 8561  H HB3  . PRO B 2 28 ? -3.001  8.777   -1.342  1.00 0.00 ? 28 PRO B HB3  11 
ATOM 8562  H HG2  . PRO B 2 28 ? -5.609  8.968   -2.558  1.00 0.00 ? 28 PRO B HG2  11 
ATOM 8563  H HG3  . PRO B 2 28 ? -4.534  7.565   -2.497  1.00 0.00 ? 28 PRO B HG3  11 
ATOM 8564  H HD2  . PRO B 2 28 ? -6.976  7.957   -1.048  1.00 0.00 ? 28 PRO B HD2  11 
ATOM 8565  H HD3  . PRO B 2 28 ? -5.862  6.580   -0.942  1.00 0.00 ? 28 PRO B HD3  11 
ATOM 8566  N N    . LYS B 2 29 ? -3.707  11.307  0.886   1.00 0.00 ? 29 LYS B N    11 
ATOM 8567  C CA   . LYS B 2 29 ? -3.959  12.662  1.454   1.00 0.00 ? 29 LYS B CA   11 
ATOM 8568  C C    . LYS B 2 29 ? -3.466  13.728  0.474   1.00 0.00 ? 29 LYS B C    11 
ATOM 8569  O O    . LYS B 2 29 ? -2.752  14.641  0.843   1.00 0.00 ? 29 LYS B O    11 
ATOM 8570  C CB   . LYS B 2 29 ? -3.210  12.807  2.781   1.00 0.00 ? 29 LYS B CB   11 
ATOM 8571  C CG   . LYS B 2 29 ? -3.915  11.988  3.863   1.00 0.00 ? 29 LYS B CG   11 
ATOM 8572  C CD   . LYS B 2 29 ? -2.870  11.366  4.791   1.00 0.00 ? 29 LYS B CD   11 
ATOM 8573  C CE   . LYS B 2 29 ? -2.909  9.842   4.660   1.00 0.00 ? 29 LYS B CE   11 
ATOM 8574  N NZ   . LYS B 2 29 ? -2.665  9.226   5.993   1.00 0.00 ? 29 LYS B NZ   11 
ATOM 8575  H H    . LYS B 2 29 ? -2.848  11.108  0.457   1.00 0.00 ? 29 LYS B H    11 
ATOM 8576  H HA   . LYS B 2 29 ? -5.018  12.790  1.623   1.00 0.00 ? 29 LYS B HA   11 
ATOM 8577  H HB2  . LYS B 2 29 ? -2.197  12.450  2.663   1.00 0.00 ? 29 LYS B HB2  11 
ATOM 8578  H HB3  . LYS B 2 29 ? -3.193  13.847  3.073   1.00 0.00 ? 29 LYS B HB3  11 
ATOM 8579  H HG2  . LYS B 2 29 ? -4.568  12.633  4.435   1.00 0.00 ? 29 LYS B HG2  11 
ATOM 8580  H HG3  . LYS B 2 29 ? -4.495  11.205  3.402   1.00 0.00 ? 29 LYS B HG3  11 
ATOM 8581  H HD2  . LYS B 2 29 ? -1.888  11.725  4.517   1.00 0.00 ? 29 LYS B HD2  11 
ATOM 8582  H HD3  . LYS B 2 29 ? -3.084  11.643  5.812   1.00 0.00 ? 29 LYS B HD3  11 
ATOM 8583  H HE2  . LYS B 2 29 ? -3.879  9.538   4.295   1.00 0.00 ? 29 LYS B HE2  11 
ATOM 8584  H HE3  . LYS B 2 29 ? -2.145  9.521   3.968   1.00 0.00 ? 29 LYS B HE3  11 
ATOM 8585  H HZ1  . LYS B 2 29 ? -2.873  9.920   6.741   1.00 0.00 ? 29 LYS B HZ1  11 
ATOM 8586  H HZ2  . LYS B 2 29 ? -3.278  8.395   6.110   1.00 0.00 ? 29 LYS B HZ2  11 
ATOM 8587  H HZ3  . LYS B 2 29 ? -1.671  8.930   6.062   1.00 0.00 ? 29 LYS B HZ3  11 
ATOM 8588  N N    . THR B 2 30 ? -3.837  13.624  -0.773  1.00 0.00 ? 30 THR B N    11 
ATOM 8589  C CA   . THR B 2 30 ? -3.388  14.633  -1.772  1.00 0.00 ? 30 THR B CA   11 
ATOM 8590  C C    . THR B 2 30 ? -4.607  15.339  -2.366  1.00 0.00 ? 30 THR B C    11 
ATOM 8591  O O    . THR B 2 30 ? -5.712  14.912  -2.077  1.00 0.00 ? 30 THR B O    11 
ATOM 8592  C CB   . THR B 2 30 ? -2.606  13.935  -2.888  1.00 0.00 ? 30 THR B CB   11 
ATOM 8593  O OG1  . THR B 2 30 ? -1.618  13.090  -2.314  1.00 0.00 ? 30 THR B OG1  11 
ATOM 8594  C CG2  . THR B 2 30 ? -1.933  14.984  -3.774  1.00 0.00 ? 30 THR B CG2  11 
ATOM 8595  O OXT  . THR B 2 30 ? -4.414  16.296  -3.099  1.00 0.00 ? 30 THR B OXT  11 
ATOM 8596  H H    . THR B 2 30 ? -4.412  12.880  -1.051  1.00 0.00 ? 30 THR B H    11 
ATOM 8597  H HA   . THR B 2 30 ? -2.750  15.359  -1.288  1.00 0.00 ? 30 THR B HA   11 
ATOM 8598  H HB   . THR B 2 30 ? -3.282  13.346  -3.487  1.00 0.00 ? 30 THR B HB   11 
ATOM 8599  H HG1  . THR B 2 30 ? -1.287  12.511  -3.005  1.00 0.00 ? 30 THR B HG1  11 
ATOM 8600  H HG21 . THR B 2 30 ? -2.683  15.634  -4.199  1.00 0.00 ? 30 THR B HG21 11 
ATOM 8601  H HG22 . THR B 2 30 ? -1.244  15.568  -3.182  1.00 0.00 ? 30 THR B HG22 11 
ATOM 8602  H HG23 . THR B 2 30 ? -1.393  14.489  -4.570  1.00 0.00 ? 30 THR B HG23 11 
ATOM 8603  N N    . GLY A 1 1  ? -2.815  6.431   8.425   1.00 0.00 ? 1  GLY A N    12 
ATOM 8604  C CA   . GLY A 1 1  ? -2.694  6.059   6.987   1.00 0.00 ? 1  GLY A CA   12 
ATOM 8605  C C    . GLY A 1 1  ? -1.487  5.143   6.794   1.00 0.00 ? 1  GLY A C    12 
ATOM 8606  O O    . GLY A 1 1  ? -0.603  5.077   7.627   1.00 0.00 ? 1  GLY A O    12 
ATOM 8607  H H1   . GLY A 1 1  ? -2.131  5.884   8.985   1.00 0.00 ? 1  GLY A H1   12 
ATOM 8608  H H2   . GLY A 1 1  ? -2.623  7.448   8.537   1.00 0.00 ? 1  GLY A H2   12 
ATOM 8609  H H3   . GLY A 1 1  ? -3.777  6.221   8.760   1.00 0.00 ? 1  GLY A H3   12 
ATOM 8610  H HA2  . GLY A 1 1  ? -3.592  5.538   6.673   1.00 0.00 ? 1  GLY A HA2  12 
ATOM 8611  H HA3  . GLY A 1 1  ? -2.566  6.948   6.391   1.00 0.00 ? 1  GLY A HA3  12 
ATOM 8612  N N    . ILE A 1 2  ? -1.449  4.428   5.707   1.00 0.00 ? 2  ILE A N    12 
ATOM 8613  C CA   . ILE A 1 2  ? -0.309  3.506   5.457   1.00 0.00 ? 2  ILE A CA   12 
ATOM 8614  C C    . ILE A 1 2  ? 0.793   4.236   4.686   1.00 0.00 ? 2  ILE A C    12 
ATOM 8615  O O    . ILE A 1 2  ? 1.822   3.672   4.376   1.00 0.00 ? 2  ILE A O    12 
ATOM 8616  C CB   . ILE A 1 2  ? -0.819  2.305   4.656   1.00 0.00 ? 2  ILE A CB   12 
ATOM 8617  C CG1  . ILE A 1 2  ? 0.037   1.079   4.966   1.00 0.00 ? 2  ILE A CG1  12 
ATOM 8618  C CG2  . ILE A 1 2  ? -0.777  2.596   3.153   1.00 0.00 ? 2  ILE A CG2  12 
ATOM 8619  C CD1  . ILE A 1 2  ? -0.873  -0.073  5.390   1.00 0.00 ? 2  ILE A CD1  12 
ATOM 8620  H H    . ILE A 1 2  ? -2.178  4.492   5.055   1.00 0.00 ? 2  ILE A H    12 
ATOM 8621  H HA   . ILE A 1 2  ? 0.084   3.162   6.401   1.00 0.00 ? 2  ILE A HA   12 
ATOM 8622  H HB   . ILE A 1 2  ? -1.837  2.108   4.944   1.00 0.00 ? 2  ILE A HB   12 
ATOM 8623  H HG12 . ILE A 1 2  ? 0.593   0.794   4.084   1.00 0.00 ? 2  ILE A HG12 12 
ATOM 8624  H HG13 . ILE A 1 2  ? 0.724   1.310   5.767   1.00 0.00 ? 2  ILE A HG13 12 
ATOM 8625  H HG21 . ILE A 1 2  ? -1.241  3.552   2.956   1.00 0.00 ? 2  ILE A HG21 12 
ATOM 8626  H HG22 . ILE A 1 2  ? 0.250   2.619   2.819   1.00 0.00 ? 2  ILE A HG22 12 
ATOM 8627  H HG23 . ILE A 1 2  ? -1.310  1.820   2.622   1.00 0.00 ? 2  ILE A HG23 12 
ATOM 8628  H HD11 . ILE A 1 2  ? -1.464  0.231   6.241   1.00 0.00 ? 2  ILE A HD11 12 
ATOM 8629  H HD12 . ILE A 1 2  ? -1.529  -0.335  4.572   1.00 0.00 ? 2  ILE A HD12 12 
ATOM 8630  H HD13 . ILE A 1 2  ? -0.271  -0.927  5.658   1.00 0.00 ? 2  ILE A HD13 12 
ATOM 8631  N N    . VAL A 1 3  ? 0.588   5.482   4.371   1.00 0.00 ? 3  VAL A N    12 
ATOM 8632  C CA   . VAL A 1 3  ? 1.629   6.236   3.622   1.00 0.00 ? 3  VAL A CA   12 
ATOM 8633  C C    . VAL A 1 3  ? 2.807   6.524   4.552   1.00 0.00 ? 3  VAL A C    12 
ATOM 8634  O O    . VAL A 1 3  ? 3.876   5.971   4.400   1.00 0.00 ? 3  VAL A O    12 
ATOM 8635  C CB   . VAL A 1 3  ? 1.041   7.550   3.111   1.00 0.00 ? 3  VAL A CB   12 
ATOM 8636  C CG1  . VAL A 1 3  ? 2.104   8.314   2.319   1.00 0.00 ? 3  VAL A CG1  12 
ATOM 8637  C CG2  . VAL A 1 3  ? -0.154  7.251   2.203   1.00 0.00 ? 3  VAL A CG2  12 
ATOM 8638  H H    . VAL A 1 3  ? -0.250  5.924   4.624   1.00 0.00 ? 3  VAL A H    12 
ATOM 8639  H HA   . VAL A 1 3  ? 1.970   5.644   2.784   1.00 0.00 ? 3  VAL A HA   12 
ATOM 8640  H HB   . VAL A 1 3  ? 0.716   8.150   3.949   1.00 0.00 ? 3  VAL A HB   12 
ATOM 8641  H HG11 . VAL A 1 3  ? 2.622   7.633   1.662   1.00 0.00 ? 3  VAL A HG11 12 
ATOM 8642  H HG12 . VAL A 1 3  ? 1.629   9.087   1.734   1.00 0.00 ? 3  VAL A HG12 12 
ATOM 8643  H HG13 . VAL A 1 3  ? 2.811   8.761   3.001   1.00 0.00 ? 3  VAL A HG13 12 
ATOM 8644  H HG21 . VAL A 1 3  ? -0.040  6.268   1.768   1.00 0.00 ? 3  VAL A HG21 12 
ATOM 8645  H HG22 . VAL A 1 3  ? -1.066  7.281   2.784   1.00 0.00 ? 3  VAL A HG22 12 
ATOM 8646  H HG23 . VAL A 1 3  ? -0.205  7.988   1.416   1.00 0.00 ? 3  VAL A HG23 12 
ATOM 8647  N N    . GLU A 1 4  ? 2.610   7.389   5.516   1.00 0.00 ? 4  GLU A N    12 
ATOM 8648  C CA   . GLU A 1 4  ? 3.705   7.737   6.473   1.00 0.00 ? 4  GLU A CA   12 
ATOM 8649  C C    . GLU A 1 4  ? 4.581   6.513   6.764   1.00 0.00 ? 4  GLU A C    12 
ATOM 8650  O O    . GLU A 1 4  ? 5.759   6.635   7.037   1.00 0.00 ? 4  GLU A O    12 
ATOM 8651  C CB   . GLU A 1 4  ? 3.086   8.232   7.781   1.00 0.00 ? 4  GLU A CB   12 
ATOM 8652  C CG   . GLU A 1 4  ? 2.414   7.060   8.501   1.00 0.00 ? 4  GLU A CG   12 
ATOM 8653  C CD   . GLU A 1 4  ? 1.197   7.566   9.277   1.00 0.00 ? 4  GLU A CD   12 
ATOM 8654  O OE1  . GLU A 1 4  ? 0.400   8.281   8.691   1.00 0.00 ? 4  GLU A OE1  12 
ATOM 8655  O OE2  . GLU A 1 4  ? 1.082   7.229   10.444  1.00 0.00 ? 4  GLU A OE2  12 
ATOM 8656  H H    . GLU A 1 4  ? 1.733   7.815   5.608   1.00 0.00 ? 4  GLU A H    12 
ATOM 8657  H HA   . GLU A 1 4  ? 4.316   8.520   6.049   1.00 0.00 ? 4  GLU A HA   12 
ATOM 8658  H HB2  . GLU A 1 4  ? 3.860   8.649   8.412   1.00 0.00 ? 4  GLU A HB2  12 
ATOM 8659  H HB3  . GLU A 1 4  ? 2.348   8.991   7.567   1.00 0.00 ? 4  GLU A HB3  12 
ATOM 8660  H HG2  . GLU A 1 4  ? 2.099   6.326   7.773   1.00 0.00 ? 4  GLU A HG2  12 
ATOM 8661  H HG3  . GLU A 1 4  ? 3.114   6.610   9.187   1.00 0.00 ? 4  GLU A HG3  12 
ATOM 8662  N N    . GLN A 1 5  ? 4.019   5.336   6.717   1.00 0.00 ? 5  GLN A N    12 
ATOM 8663  C CA   . GLN A 1 5  ? 4.828   4.117   6.998   1.00 0.00 ? 5  GLN A CA   12 
ATOM 8664  C C    . GLN A 1 5  ? 5.447   3.584   5.701   1.00 0.00 ? 5  GLN A C    12 
ATOM 8665  O O    . GLN A 1 5  ? 6.645   3.635   5.506   1.00 0.00 ? 5  GLN A O    12 
ATOM 8666  C CB   . GLN A 1 5  ? 3.930   3.039   7.607   1.00 0.00 ? 5  GLN A CB   12 
ATOM 8667  C CG   . GLN A 1 5  ? 3.975   3.133   9.133   1.00 0.00 ? 5  GLN A CG   12 
ATOM 8668  C CD   . GLN A 1 5  ? 2.663   2.602   9.713   1.00 0.00 ? 5  GLN A CD   12 
ATOM 8669  O OE1  . GLN A 1 5  ? 2.656   1.621   10.429  1.00 0.00 ? 5  GLN A OE1  12 
ATOM 8670  N NE2  . GLN A 1 5  ? 1.545   3.212   9.431   1.00 0.00 ? 5  GLN A NE2  12 
ATOM 8671  H H    . GLN A 1 5  ? 3.067   5.254   6.501   1.00 0.00 ? 5  GLN A H    12 
ATOM 8672  H HA   . GLN A 1 5  ? 5.616   4.360   7.697   1.00 0.00 ? 5  GLN A HA   12 
ATOM 8673  H HB2  . GLN A 1 5  ? 2.914   3.184   7.267   1.00 0.00 ? 5  GLN A HB2  12 
ATOM 8674  H HB3  . GLN A 1 5  ? 4.276   2.064   7.298   1.00 0.00 ? 5  GLN A HB3  12 
ATOM 8675  H HG2  . GLN A 1 5  ? 4.801   2.544   9.505   1.00 0.00 ? 5  GLN A HG2  12 
ATOM 8676  H HG3  . GLN A 1 5  ? 4.105   4.163   9.428   1.00 0.00 ? 5  GLN A HG3  12 
ATOM 8677  H HE21 . GLN A 1 5  ? 1.553   4.003   8.851   1.00 0.00 ? 5  GLN A HE21 12 
ATOM 8678  H HE22 . GLN A 1 5  ? 0.699   2.882   9.796   1.00 0.00 ? 5  GLN A HE22 12 
ATOM 8679  N N    . CYS A 1 6  ? 4.639   3.056   4.822   1.00 0.00 ? 6  CYS A N    12 
ATOM 8680  C CA   . CYS A 1 6  ? 5.179   2.499   3.549   1.00 0.00 ? 6  CYS A CA   12 
ATOM 8681  C C    . CYS A 1 6  ? 5.378   3.605   2.506   1.00 0.00 ? 6  CYS A C    12 
ATOM 8682  O O    . CYS A 1 6  ? 5.068   3.432   1.347   1.00 0.00 ? 6  CYS A O    12 
ATOM 8683  C CB   . CYS A 1 6  ? 4.212   1.447   3.000   1.00 0.00 ? 6  CYS A CB   12 
ATOM 8684  S SG   . CYS A 1 6  ? 5.073   -0.140  2.853   1.00 0.00 ? 6  CYS A SG   12 
ATOM 8685  H H    . CYS A 1 6  ? 3.679   3.010   5.007   1.00 0.00 ? 6  CYS A H    12 
ATOM 8686  H HA   . CYS A 1 6  ? 6.130   2.028   3.746   1.00 0.00 ? 6  CYS A HA   12 
ATOM 8687  H HB2  . CYS A 1 6  ? 3.376   1.342   3.674   1.00 0.00 ? 6  CYS A HB2  12 
ATOM 8688  H HB3  . CYS A 1 6  ? 3.857   1.757   2.029   1.00 0.00 ? 6  CYS A HB3  12 
ATOM 8689  N N    . CYS A 1 7  ? 5.904   4.730   2.901   1.00 0.00 ? 7  CYS A N    12 
ATOM 8690  C CA   . CYS A 1 7  ? 6.139   5.832   1.926   1.00 0.00 ? 7  CYS A CA   12 
ATOM 8691  C C    . CYS A 1 7  ? 7.457   6.523   2.278   1.00 0.00 ? 7  CYS A C    12 
ATOM 8692  O O    . CYS A 1 7  ? 8.422   6.448   1.547   1.00 0.00 ? 7  CYS A O    12 
ATOM 8693  C CB   . CYS A 1 7  ? 4.992   6.832   2.003   1.00 0.00 ? 7  CYS A CB   12 
ATOM 8694  S SG   . CYS A 1 7  ? 5.405   8.310   1.043   1.00 0.00 ? 7  CYS A SG   12 
ATOM 8695  H H    . CYS A 1 7  ? 6.153   4.852   3.837   1.00 0.00 ? 7  CYS A H    12 
ATOM 8696  H HA   . CYS A 1 7  ? 6.203   5.424   0.925   1.00 0.00 ? 7  CYS A HA   12 
ATOM 8697  H HB2  . CYS A 1 7  ? 4.099   6.379   1.607   1.00 0.00 ? 7  CYS A HB2  12 
ATOM 8698  H HB3  . CYS A 1 7  ? 4.827   7.106   3.029   1.00 0.00 ? 7  CYS A HB3  12 
ATOM 8699  N N    . THR A 1 8  ? 7.510   7.177   3.406   1.00 0.00 ? 8  THR A N    12 
ATOM 8700  C CA   . THR A 1 8  ? 8.774   7.849   3.811   1.00 0.00 ? 8  THR A CA   12 
ATOM 8701  C C    . THR A 1 8  ? 9.857   6.783   3.969   1.00 0.00 ? 8  THR A C    12 
ATOM 8702  O O    . THR A 1 8  ? 11.039  7.068   3.948   1.00 0.00 ? 8  THR A O    12 
ATOM 8703  C CB   . THR A 1 8  ? 8.568   8.574   5.143   1.00 0.00 ? 8  THR A CB   12 
ATOM 8704  O OG1  . THR A 1 8  ? 8.600   7.626   6.201   1.00 0.00 ? 8  THR A OG1  12 
ATOM 8705  C CG2  . THR A 1 8  ? 7.217   9.290   5.138   1.00 0.00 ? 8  THR A CG2  12 
ATOM 8706  H H    . THR A 1 8  ? 6.723   7.213   3.992   1.00 0.00 ? 8  THR A H    12 
ATOM 8707  H HA   . THR A 1 8  ? 9.069   8.560   3.051   1.00 0.00 ? 8  THR A HA   12 
ATOM 8708  H HB   . THR A 1 8  ? 9.354   9.299   5.284   1.00 0.00 ? 8  THR A HB   12 
ATOM 8709  H HG1  . THR A 1 8  ? 9.261   7.911   6.835   1.00 0.00 ? 8  THR A HG1  12 
ATOM 8710  H HG21 . THR A 1 8  ? 6.846   9.350   4.124   1.00 0.00 ? 8  THR A HG21 12 
ATOM 8711  H HG22 . THR A 1 8  ? 6.516   8.739   5.747   1.00 0.00 ? 8  THR A HG22 12 
ATOM 8712  H HG23 . THR A 1 8  ? 7.336   10.288  5.537   1.00 0.00 ? 8  THR A HG23 12 
ATOM 8713  N N    . SER A 1 9  ? 9.453   5.551   4.123   1.00 0.00 ? 9  SER A N    12 
ATOM 8714  C CA   . SER A 1 9  ? 10.439  4.445   4.277   1.00 0.00 ? 9  SER A CA   12 
ATOM 8715  C C    . SER A 1 9  ? 9.819   3.152   3.740   1.00 0.00 ? 9  SER A C    12 
ATOM 8716  O O    . SER A 1 9  ? 8.875   3.180   2.973   1.00 0.00 ? 9  SER A O    12 
ATOM 8717  C CB   . SER A 1 9  ? 10.786  4.269   5.757   1.00 0.00 ? 9  SER A CB   12 
ATOM 8718  O OG   . SER A 1 9  ? 10.291  5.381   6.490   1.00 0.00 ? 9  SER A OG   12 
ATOM 8719  H H    . SER A 1 9  ? 8.495   5.352   4.131   1.00 0.00 ? 9  SER A H    12 
ATOM 8720  H HA   . SER A 1 9  ? 11.335  4.675   3.719   1.00 0.00 ? 9  SER A HA   12 
ATOM 8721  H HB2  . SER A 1 9  ? 10.334  3.367   6.130   1.00 0.00 ? 9  SER A HB2  12 
ATOM 8722  H HB3  . SER A 1 9  ? 11.860  4.202   5.866   1.00 0.00 ? 9  SER A HB3  12 
ATOM 8723  H HG   . SER A 1 9  ? 11.037  5.820   6.905   1.00 0.00 ? 9  SER A HG   12 
ATOM 8724  N N    . ILE A 1 10 ? 10.331  2.022   4.135   1.00 0.00 ? 10 ILE A N    12 
ATOM 8725  C CA   . ILE A 1 10 ? 9.760   0.736   3.643   1.00 0.00 ? 10 ILE A CA   12 
ATOM 8726  C C    . ILE A 1 10 ? 9.047   0.027   4.796   1.00 0.00 ? 10 ILE A C    12 
ATOM 8727  O O    . ILE A 1 10 ? 9.583   -0.108  5.880   1.00 0.00 ? 10 ILE A O    12 
ATOM 8728  C CB   . ILE A 1 10 ? 10.887  -0.150  3.106   1.00 0.00 ? 10 ILE A CB   12 
ATOM 8729  C CG1  . ILE A 1 10 ? 11.586  0.570   1.949   1.00 0.00 ? 10 ILE A CG1  12 
ATOM 8730  C CG2  . ILE A 1 10 ? 10.306  -1.473  2.605   1.00 0.00 ? 10 ILE A CG2  12 
ATOM 8731  C CD1  . ILE A 1 10 ? 12.645  -0.351  1.338   1.00 0.00 ? 10 ILE A CD1  12 
ATOM 8732  H H    . ILE A 1 10 ? 11.089  2.015   4.757   1.00 0.00 ? 10 ILE A H    12 
ATOM 8733  H HA   . ILE A 1 10 ? 9.052   0.936   2.854   1.00 0.00 ? 10 ILE A HA   12 
ATOM 8734  H HB   . ILE A 1 10 ? 11.600  -0.346  3.893   1.00 0.00 ? 10 ILE A HB   12 
ATOM 8735  H HG12 . ILE A 1 10 ? 10.857  0.829   1.195   1.00 0.00 ? 10 ILE A HG12 12 
ATOM 8736  H HG13 . ILE A 1 10 ? 12.060  1.465   2.316   1.00 0.00 ? 10 ILE A HG13 12 
ATOM 8737  H HG21 . ILE A 1 10 ? 9.586   -1.276  1.823   1.00 0.00 ? 10 ILE A HG21 12 
ATOM 8738  H HG22 . ILE A 1 10 ? 11.102  -2.091  2.214   1.00 0.00 ? 10 ILE A HG22 12 
ATOM 8739  H HG23 . ILE A 1 10 ? 9.819   -1.985  3.420   1.00 0.00 ? 10 ILE A HG23 12 
ATOM 8740  H HD11 . ILE A 1 10 ? 13.118  -0.924  2.121   1.00 0.00 ? 10 ILE A HD11 12 
ATOM 8741  H HD12 . ILE A 1 10 ? 12.174  -1.022  0.634   1.00 0.00 ? 10 ILE A HD12 12 
ATOM 8742  H HD13 . ILE A 1 10 ? 13.388  0.243   0.827   1.00 0.00 ? 10 ILE A HD13 12 
ATOM 8743  N N    . CYS A 1 11 ? 7.840   -0.420  4.578   1.00 0.00 ? 11 CYS A N    12 
ATOM 8744  C CA   . CYS A 1 11 ? 7.094   -1.109  5.670   1.00 0.00 ? 11 CYS A CA   12 
ATOM 8745  C C    . CYS A 1 11 ? 6.985   -2.606  5.359   1.00 0.00 ? 11 CYS A C    12 
ATOM 8746  O O    . CYS A 1 11 ? 7.770   -3.154  4.610   1.00 0.00 ? 11 CYS A O    12 
ATOM 8747  C CB   . CYS A 1 11 ? 5.693   -0.490  5.807   1.00 0.00 ? 11 CYS A CB   12 
ATOM 8748  S SG   . CYS A 1 11 ? 4.577   -1.144  4.535   1.00 0.00 ? 11 CYS A SG   12 
ATOM 8749  H H    . CYS A 1 11 ? 7.423   -0.298  3.702   1.00 0.00 ? 11 CYS A H    12 
ATOM 8750  H HA   . CYS A 1 11 ? 7.630   -0.982  6.600   1.00 0.00 ? 11 CYS A HA   12 
ATOM 8751  H HB2  . CYS A 1 11 ? 5.295   -0.724  6.783   1.00 0.00 ? 11 CYS A HB2  12 
ATOM 8752  H HB3  . CYS A 1 11 ? 5.767   0.582   5.701   1.00 0.00 ? 11 CYS A HB3  12 
ATOM 8753  N N    . SER A 1 12 ? 6.020   -3.273  5.931   1.00 0.00 ? 12 SER A N    12 
ATOM 8754  C CA   . SER A 1 12 ? 5.864   -4.731  5.673   1.00 0.00 ? 12 SER A CA   12 
ATOM 8755  C C    . SER A 1 12 ? 4.562   -4.988  4.912   1.00 0.00 ? 12 SER A C    12 
ATOM 8756  O O    . SER A 1 12 ? 3.665   -4.170  4.898   1.00 0.00 ? 12 SER A O    12 
ATOM 8757  C CB   . SER A 1 12 ? 5.827   -5.477  7.007   1.00 0.00 ? 12 SER A CB   12 
ATOM 8758  O OG   . SER A 1 12 ? 5.209   -4.656  7.987   1.00 0.00 ? 12 SER A OG   12 
ATOM 8759  H H    . SER A 1 12 ? 5.400   -2.813  6.535   1.00 0.00 ? 12 SER A H    12 
ATOM 8760  H HA   . SER A 1 12 ? 6.700   -5.084  5.087   1.00 0.00 ? 12 SER A HA   12 
ATOM 8761  H HB2  . SER A 1 12 ? 5.258   -6.387  6.897   1.00 0.00 ? 12 SER A HB2  12 
ATOM 8762  H HB3  . SER A 1 12 ? 6.836   -5.719  7.309   1.00 0.00 ? 12 SER A HB3  12 
ATOM 8763  H HG   . SER A 1 12 ? 5.542   -4.920  8.848   1.00 0.00 ? 12 SER A HG   12 
ATOM 8764  N N    . LEU A 1 13 ? 4.453   -6.130  4.286   1.00 0.00 ? 13 LEU A N    12 
ATOM 8765  C CA   . LEU A 1 13 ? 3.210   -6.456  3.531   1.00 0.00 ? 13 LEU A CA   12 
ATOM 8766  C C    . LEU A 1 13 ? 2.070   -6.716  4.520   1.00 0.00 ? 13 LEU A C    12 
ATOM 8767  O O    . LEU A 1 13 ? 0.934   -6.918  4.137   1.00 0.00 ? 13 LEU A O    12 
ATOM 8768  C CB   . LEU A 1 13 ? 3.449   -7.712  2.687   1.00 0.00 ? 13 LEU A CB   12 
ATOM 8769  C CG   . LEU A 1 13 ? 3.245   -7.386  1.206   1.00 0.00 ? 13 LEU A CG   12 
ATOM 8770  C CD1  . LEU A 1 13 ? 1.920   -6.644  1.023   1.00 0.00 ? 13 LEU A CD1  12 
ATOM 8771  C CD2  . LEU A 1 13 ? 4.394   -6.505  0.711   1.00 0.00 ? 13 LEU A CD2  12 
ATOM 8772  H H    . LEU A 1 13 ? 5.188   -6.777  4.319   1.00 0.00 ? 13 LEU A H    12 
ATOM 8773  H HA   . LEU A 1 13 ? 2.949   -5.630  2.885   1.00 0.00 ? 13 LEU A HA   12 
ATOM 8774  H HB2  . LEU A 1 13 ? 4.461   -8.060  2.841   1.00 0.00 ? 13 LEU A HB2  12 
ATOM 8775  H HB3  . LEU A 1 13 ? 2.754   -8.483  2.985   1.00 0.00 ? 13 LEU A HB3  12 
ATOM 8776  H HG   . LEU A 1 13 ? 3.221   -8.305  0.636   1.00 0.00 ? 13 LEU A HG   12 
ATOM 8777  H HD11 . LEU A 1 13 ? 1.288   -6.819  1.882   1.00 0.00 ? 13 LEU A HD11 12 
ATOM 8778  H HD12 . LEU A 1 13 ? 2.112   -5.585  0.927   1.00 0.00 ? 13 LEU A HD12 12 
ATOM 8779  H HD13 . LEU A 1 13 ? 1.425   -7.003  0.133   1.00 0.00 ? 13 LEU A HD13 12 
ATOM 8780  H HD21 . LEU A 1 13 ? 4.669   -5.806  1.485   1.00 0.00 ? 13 LEU A HD21 12 
ATOM 8781  H HD22 . LEU A 1 13 ? 5.244   -7.126  0.469   1.00 0.00 ? 13 LEU A HD22 12 
ATOM 8782  H HD23 . LEU A 1 13 ? 4.080   -5.963  -0.168  1.00 0.00 ? 13 LEU A HD23 12 
ATOM 8783  N N    . TYR A 1 14 ? 2.365   -6.719  5.793   1.00 0.00 ? 14 TYR A N    12 
ATOM 8784  C CA   . TYR A 1 14 ? 1.307   -6.968  6.809   1.00 0.00 ? 14 TYR A CA   12 
ATOM 8785  C C    . TYR A 1 14 ? 0.434   -5.725  6.974   1.00 0.00 ? 14 TYR A C    12 
ATOM 8786  O O    . TYR A 1 14 ? -0.763  -5.818  7.155   1.00 0.00 ? 14 TYR A O    12 
ATOM 8787  C CB   . TYR A 1 14 ? 1.970   -7.303  8.144   1.00 0.00 ? 14 TYR A CB   12 
ATOM 8788  C CG   . TYR A 1 14 ? 0.957   -7.952  9.051   1.00 0.00 ? 14 TYR A CG   12 
ATOM 8789  C CD1  . TYR A 1 14 ? -0.165  -7.231  9.465   1.00 0.00 ? 14 TYR A CD1  12 
ATOM 8790  C CD2  . TYR A 1 14 ? 1.138   -9.273  9.470   1.00 0.00 ? 14 TYR A CD2  12 
ATOM 8791  C CE1  . TYR A 1 14 ? -1.110  -7.828  10.306  1.00 0.00 ? 14 TYR A CE1  12 
ATOM 8792  C CE2  . TYR A 1 14 ? 0.193   -9.873  10.311  1.00 0.00 ? 14 TYR A CE2  12 
ATOM 8793  C CZ   . TYR A 1 14 ? -0.932  -9.152  10.729  1.00 0.00 ? 14 TYR A CZ   12 
ATOM 8794  O OH   . TYR A 1 14 ? -1.862  -9.742  11.558  1.00 0.00 ? 14 TYR A OH   12 
ATOM 8795  H H    . TYR A 1 14 ? 3.289   -6.558  6.079   1.00 0.00 ? 14 TYR A H    12 
ATOM 8796  H HA   . TYR A 1 14 ? 0.695   -7.798  6.499   1.00 0.00 ? 14 TYR A HA   12 
ATOM 8797  H HB2  . TYR A 1 14 ? 2.794   -7.984  7.979   1.00 0.00 ? 14 TYR A HB2  12 
ATOM 8798  H HB3  . TYR A 1 14 ? 2.336   -6.398  8.604   1.00 0.00 ? 14 TYR A HB3  12 
ATOM 8799  H HD1  . TYR A 1 14 ? -0.301  -6.214  9.139   1.00 0.00 ? 14 TYR A HD1  12 
ATOM 8800  H HD2  . TYR A 1 14 ? 2.004   -9.827  9.144   1.00 0.00 ? 14 TYR A HD2  12 
ATOM 8801  H HE1  . TYR A 1 14 ? -1.976  -7.269  10.626  1.00 0.00 ? 14 TYR A HE1  12 
ATOM 8802  H HE2  . TYR A 1 14 ? 0.332   -10.894 10.636  1.00 0.00 ? 14 TYR A HE2  12 
ATOM 8803  H HH   . TYR A 1 14 ? -1.633  -9.524  12.464  1.00 0.00 ? 14 TYR A HH   12 
ATOM 8804  N N    . GLN A 1 15 ? 1.021   -4.565  6.927   1.00 0.00 ? 15 GLN A N    12 
ATOM 8805  C CA   . GLN A 1 15 ? 0.219   -3.320  7.094   1.00 0.00 ? 15 GLN A CA   12 
ATOM 8806  C C    . GLN A 1 15 ? -0.798  -3.187  5.957   1.00 0.00 ? 15 GLN A C    12 
ATOM 8807  O O    . GLN A 1 15 ? -1.874  -2.655  6.138   1.00 0.00 ? 15 GLN A O    12 
ATOM 8808  C CB   . GLN A 1 15 ? 1.155   -2.111  7.082   1.00 0.00 ? 15 GLN A CB   12 
ATOM 8809  C CG   . GLN A 1 15 ? 2.269   -2.320  8.108   1.00 0.00 ? 15 GLN A CG   12 
ATOM 8810  C CD   . GLN A 1 15 ? 2.029   -1.407  9.311   1.00 0.00 ? 15 GLN A CD   12 
ATOM 8811  O OE1  . GLN A 1 15 ? 1.670   -0.257  9.154   1.00 0.00 ? 15 GLN A OE1  12 
ATOM 8812  N NE2  . GLN A 1 15 ? 2.213   -1.872  10.516  1.00 0.00 ? 15 GLN A NE2  12 
ATOM 8813  H H    . GLN A 1 15 ? 1.989   -4.508  6.787   1.00 0.00 ? 15 GLN A H    12 
ATOM 8814  H HA   . GLN A 1 15 ? -0.303  -3.359  8.039   1.00 0.00 ? 15 GLN A HA   12 
ATOM 8815  H HB2  . GLN A 1 15 ? 1.587   -2.000  6.096   1.00 0.00 ? 15 GLN A HB2  12 
ATOM 8816  H HB3  . GLN A 1 15 ? 0.597   -1.221  7.334   1.00 0.00 ? 15 GLN A HB3  12 
ATOM 8817  H HG2  . GLN A 1 15 ? 2.269   -3.351  8.433   1.00 0.00 ? 15 GLN A HG2  12 
ATOM 8818  H HG3  . GLN A 1 15 ? 3.221   -2.082  7.662   1.00 0.00 ? 15 GLN A HG3  12 
ATOM 8819  H HE21 . GLN A 1 15 ? 2.502   -2.800  10.642  1.00 0.00 ? 15 GLN A HE21 12 
ATOM 8820  H HE22 . GLN A 1 15 ? 2.064   -1.295  11.292  1.00 0.00 ? 15 GLN A HE22 12 
ATOM 8821  N N    . LEU A 1 16 ? -0.468  -3.654  4.783   1.00 0.00 ? 16 LEU A N    12 
ATOM 8822  C CA   . LEU A 1 16 ? -1.425  -3.531  3.647   1.00 0.00 ? 16 LEU A CA   12 
ATOM 8823  C C    . LEU A 1 16 ? -2.507  -4.608  3.752   1.00 0.00 ? 16 LEU A C    12 
ATOM 8824  O O    . LEU A 1 16 ? -3.457  -4.620  2.997   1.00 0.00 ? 16 LEU A O    12 
ATOM 8825  C CB   . LEU A 1 16 ? -0.676  -3.688  2.320   1.00 0.00 ? 16 LEU A CB   12 
ATOM 8826  C CG   . LEU A 1 16 ? 0.464   -2.659  2.205   1.00 0.00 ? 16 LEU A CG   12 
ATOM 8827  C CD1  . LEU A 1 16 ? 0.537   -2.166  0.763   1.00 0.00 ? 16 LEU A CD1  12 
ATOM 8828  C CD2  . LEU A 1 16 ? 0.217   -1.452  3.120   1.00 0.00 ? 16 LEU A CD2  12 
ATOM 8829  H H    . LEU A 1 16 ? 0.407   -4.074  4.647   1.00 0.00 ? 16 LEU A H    12 
ATOM 8830  H HA   . LEU A 1 16 ? -1.891  -2.558  3.680   1.00 0.00 ? 16 LEU A HA   12 
ATOM 8831  H HB2  . LEU A 1 16 ? -0.263  -4.683  2.259   1.00 0.00 ? 16 LEU A HB2  12 
ATOM 8832  H HB3  . LEU A 1 16 ? -1.369  -3.541  1.503   1.00 0.00 ? 16 LEU A HB3  12 
ATOM 8833  H HG   . LEU A 1 16 ? 1.399   -3.131  2.470   1.00 0.00 ? 16 LEU A HG   12 
ATOM 8834  H HD11 . LEU A 1 16 ? 0.018   -2.861  0.121   1.00 0.00 ? 16 LEU A HD11 12 
ATOM 8835  H HD12 . LEU A 1 16 ? 0.071   -1.194  0.695   1.00 0.00 ? 16 LEU A HD12 12 
ATOM 8836  H HD13 . LEU A 1 16 ? 1.570   -2.095  0.458   1.00 0.00 ? 16 LEU A HD13 12 
ATOM 8837  H HD21 . LEU A 1 16 ? -0.818  -1.149  3.043   1.00 0.00 ? 16 LEU A HD21 12 
ATOM 8838  H HD22 . LEU A 1 16 ? 0.439   -1.726  4.141   1.00 0.00 ? 16 LEU A HD22 12 
ATOM 8839  H HD23 . LEU A 1 16 ? 0.855   -0.635  2.816   1.00 0.00 ? 16 LEU A HD23 12 
ATOM 8840  N N    . GLU A 1 17 ? -2.374  -5.510  4.684   1.00 0.00 ? 17 GLU A N    12 
ATOM 8841  C CA   . GLU A 1 17 ? -3.402  -6.576  4.835   1.00 0.00 ? 17 GLU A CA   12 
ATOM 8842  C C    . GLU A 1 17 ? -4.728  -5.934  5.246   1.00 0.00 ? 17 GLU A C    12 
ATOM 8843  O O    . GLU A 1 17 ? -5.792  -6.386  4.873   1.00 0.00 ? 17 GLU A O    12 
ATOM 8844  C CB   . GLU A 1 17 ? -2.964  -7.564  5.916   1.00 0.00 ? 17 GLU A CB   12 
ATOM 8845  C CG   . GLU A 1 17 ? -1.573  -8.108  5.583   1.00 0.00 ? 17 GLU A CG   12 
ATOM 8846  C CD   . GLU A 1 17 ? -1.185  -9.174  6.609   1.00 0.00 ? 17 GLU A CD   12 
ATOM 8847  O OE1  . GLU A 1 17 ? -1.243  -8.879  7.792   1.00 0.00 ? 17 GLU A OE1  12 
ATOM 8848  O OE2  . GLU A 1 17 ? -0.835  -10.267 6.196   1.00 0.00 ? 17 GLU A OE2  12 
ATOM 8849  H H    . GLU A 1 17 ? -1.602  -5.482  5.284   1.00 0.00 ? 17 GLU A H    12 
ATOM 8850  H HA   . GLU A 1 17 ? -3.526  -7.095  3.896   1.00 0.00 ? 17 GLU A HA   12 
ATOM 8851  H HB2  . GLU A 1 17 ? -2.934  -7.062  6.871   1.00 0.00 ? 17 GLU A HB2  12 
ATOM 8852  H HB3  . GLU A 1 17 ? -3.666  -8.382  5.960   1.00 0.00 ? 17 GLU A HB3  12 
ATOM 8853  H HG2  . GLU A 1 17 ? -1.583  -8.544  4.596   1.00 0.00 ? 17 GLU A HG2  12 
ATOM 8854  H HG3  . GLU A 1 17 ? -0.857  -7.302  5.614   1.00 0.00 ? 17 GLU A HG3  12 
ATOM 8855  N N    . ASN A 1 18 ? -4.668  -4.884  6.020   1.00 0.00 ? 18 ASN A N    12 
ATOM 8856  C CA   . ASN A 1 18 ? -5.923  -4.210  6.468   1.00 0.00 ? 18 ASN A CA   12 
ATOM 8857  C C    . ASN A 1 18 ? -6.510  -3.380  5.324   1.00 0.00 ? 18 ASN A C    12 
ATOM 8858  O O    . ASN A 1 18 ? -7.596  -2.845  5.429   1.00 0.00 ? 18 ASN A O    12 
ATOM 8859  C CB   . ASN A 1 18 ? -5.605  -3.292  7.649   1.00 0.00 ? 18 ASN A CB   12 
ATOM 8860  C CG   . ASN A 1 18 ? -4.673  -4.015  8.622   1.00 0.00 ? 18 ASN A CG   12 
ATOM 8861  O OD1  . ASN A 1 18 ? -4.771  -5.214  8.796   1.00 0.00 ? 18 ASN A OD1  12 
ATOM 8862  N ND2  . ASN A 1 18 ? -3.769  -3.335  9.271   1.00 0.00 ? 18 ASN A ND2  12 
ATOM 8863  H H    . ASN A 1 18 ? -3.796  -4.544  6.311   1.00 0.00 ? 18 ASN A H    12 
ATOM 8864  H HA   . ASN A 1 18 ? -6.641  -4.956  6.777   1.00 0.00 ? 18 ASN A HA   12 
ATOM 8865  H HB2  . ASN A 1 18 ? -5.125  -2.394  7.289   1.00 0.00 ? 18 ASN A HB2  12 
ATOM 8866  H HB3  . ASN A 1 18 ? -6.522  -3.030  8.157   1.00 0.00 ? 18 ASN A HB3  12 
ATOM 8867  H HD21 . ASN A 1 18 ? -3.691  -2.367  9.131   1.00 0.00 ? 18 ASN A HD21 12 
ATOM 8868  H HD22 . ASN A 1 18 ? -3.168  -3.790  9.896   1.00 0.00 ? 18 ASN A HD22 12 
ATOM 8869  N N    . TYR A 1 19 ? -5.806  -3.265  4.232   1.00 0.00 ? 19 TYR A N    12 
ATOM 8870  C CA   . TYR A 1 19 ? -6.328  -2.467  3.087   1.00 0.00 ? 19 TYR A CA   12 
ATOM 8871  C C    . TYR A 1 19 ? -7.204  -3.351  2.198   1.00 0.00 ? 19 TYR A C    12 
ATOM 8872  O O    . TYR A 1 19 ? -7.446  -3.044  1.048   1.00 0.00 ? 19 TYR A O    12 
ATOM 8873  C CB   . TYR A 1 19 ? -5.155  -1.925  2.270   1.00 0.00 ? 19 TYR A CB   12 
ATOM 8874  C CG   . TYR A 1 19 ? -4.760  -0.573  2.804   1.00 0.00 ? 19 TYR A CG   12 
ATOM 8875  C CD1  . TYR A 1 19 ? -3.994  -0.493  3.962   1.00 0.00 ? 19 TYR A CD1  12 
ATOM 8876  C CD2  . TYR A 1 19 ? -5.162  0.594   2.144   1.00 0.00 ? 19 TYR A CD2  12 
ATOM 8877  C CE1  . TYR A 1 19 ? -3.625  0.754   4.474   1.00 0.00 ? 19 TYR A CE1  12 
ATOM 8878  C CE2  . TYR A 1 19 ? -4.795  1.847   2.654   1.00 0.00 ? 19 TYR A CE2  12 
ATOM 8879  C CZ   . TYR A 1 19 ? -4.026  1.925   3.821   1.00 0.00 ? 19 TYR A CZ   12 
ATOM 8880  O OH   . TYR A 1 19 ? -3.660  3.157   4.326   1.00 0.00 ? 19 TYR A OH   12 
ATOM 8881  H H    . TYR A 1 19 ? -4.931  -3.701  4.166   1.00 0.00 ? 19 TYR A H    12 
ATOM 8882  H HA   . TYR A 1 19 ? -6.914  -1.641  3.461   1.00 0.00 ? 19 TYR A HA   12 
ATOM 8883  H HB2  . TYR A 1 19 ? -4.317  -2.599  2.356   1.00 0.00 ? 19 TYR A HB2  12 
ATOM 8884  H HB3  . TYR A 1 19 ? -5.443  -1.833  1.234   1.00 0.00 ? 19 TYR A HB3  12 
ATOM 8885  H HD1  . TYR A 1 19 ? -3.680  -1.398  4.461   1.00 0.00 ? 19 TYR A HD1  12 
ATOM 8886  H HD2  . TYR A 1 19 ? -5.756  0.527   1.245   1.00 0.00 ? 19 TYR A HD2  12 
ATOM 8887  H HE1  . TYR A 1 19 ? -3.034  0.813   5.375   1.00 0.00 ? 19 TYR A HE1  12 
ATOM 8888  H HE2  . TYR A 1 19 ? -5.099  2.752   2.148   1.00 0.00 ? 19 TYR A HE2  12 
ATOM 8889  H HH   . TYR A 1 19 ? -3.324  3.687   3.599   1.00 0.00 ? 19 TYR A HH   12 
ATOM 8890  N N    . CYS A 1 20 ? -7.686  -4.448  2.716   1.00 0.00 ? 20 CYS A N    12 
ATOM 8891  C CA   . CYS A 1 20 ? -8.545  -5.347  1.893   1.00 0.00 ? 20 CYS A CA   12 
ATOM 8892  C C    . CYS A 1 20 ? -9.981  -5.313  2.420   1.00 0.00 ? 20 CYS A C    12 
ATOM 8893  O O    . CYS A 1 20 ? -10.216 -5.252  3.610   1.00 0.00 ? 20 CYS A O    12 
ATOM 8894  C CB   . CYS A 1 20 ? -8.010  -6.778  1.968   1.00 0.00 ? 20 CYS A CB   12 
ATOM 8895  S SG   . CYS A 1 20 ? -6.330  -6.829  1.295   1.00 0.00 ? 20 CYS A SG   12 
ATOM 8896  H H    . CYS A 1 20 ? -7.482  -4.682  3.645   1.00 0.00 ? 20 CYS A H    12 
ATOM 8897  H HA   . CYS A 1 20 ? -8.532  -5.012  0.865   1.00 0.00 ? 20 CYS A HA   12 
ATOM 8898  H HB2  . CYS A 1 20 ? -7.994  -7.103  2.997   1.00 0.00 ? 20 CYS A HB2  12 
ATOM 8899  H HB3  . CYS A 1 20 ? -8.648  -7.432  1.392   1.00 0.00 ? 20 CYS A HB3  12 
ATOM 8900  N N    . ASN A 1 21 ? -10.944 -5.353  1.539   1.00 0.00 ? 21 ASN A N    12 
ATOM 8901  C CA   . ASN A 1 21 ? -12.365 -5.327  1.980   1.00 0.00 ? 21 ASN A CA   12 
ATOM 8902  C C    . ASN A 1 21 ? -12.645 -6.537  2.876   1.00 0.00 ? 21 ASN A C    12 
ATOM 8903  O O    . ASN A 1 21 ? -12.720 -6.354  4.079   1.00 0.00 ? 21 ASN A O    12 
ATOM 8904  C CB   . ASN A 1 21 ? -13.277 -5.378  0.754   1.00 0.00 ? 21 ASN A CB   12 
ATOM 8905  C CG   . ASN A 1 21 ? -14.666 -4.857  1.123   1.00 0.00 ? 21 ASN A CG   12 
ATOM 8906  O OD1  . ASN A 1 21 ? -15.419 -5.526  1.803   1.00 0.00 ? 21 ASN A OD1  12 
ATOM 8907  N ND2  . ASN A 1 21 ? -15.041 -3.681  0.699   1.00 0.00 ? 21 ASN A ND2  12 
ATOM 8908  O OXT  . ASN A 1 21 ? -12.778 -7.626  2.341   1.00 0.00 ? 21 ASN A OXT  12 
ATOM 8909  H H    . ASN A 1 21 ? -10.730 -5.404  0.585   1.00 0.00 ? 21 ASN A H    12 
ATOM 8910  H HA   . ASN A 1 21 ? -12.555 -4.418  2.534   1.00 0.00 ? 21 ASN A HA   12 
ATOM 8911  H HB2  . ASN A 1 21 ? -12.859 -4.767  -0.032  1.00 0.00 ? 21 ASN A HB2  12 
ATOM 8912  H HB3  . ASN A 1 21 ? -13.359 -6.399  0.408   1.00 0.00 ? 21 ASN A HB3  12 
ATOM 8913  H HD21 . ASN A 1 21 ? -14.436 -3.142  0.149   1.00 0.00 ? 21 ASN A HD21 12 
ATOM 8914  H HD22 . ASN A 1 21 ? -15.930 -3.337  0.931   1.00 0.00 ? 21 ASN A HD22 12 
ATOM 8915  N N    . PHE B 2 1  ? 5.490   -7.914  -6.768  1.00 0.00 ? 1  PHE B N    12 
ATOM 8916  C CA   . PHE B 2 1  ? 5.694   -7.444  -5.367  1.00 0.00 ? 1  PHE B CA   12 
ATOM 8917  C C    . PHE B 2 1  ? 7.164   -7.060  -5.167  1.00 0.00 ? 1  PHE B C    12 
ATOM 8918  O O    . PHE B 2 1  ? 8.061   -7.779  -5.558  1.00 0.00 ? 1  PHE B O    12 
ATOM 8919  C CB   . PHE B 2 1  ? 5.312   -8.565  -4.393  1.00 0.00 ? 1  PHE B CB   12 
ATOM 8920  C CG   . PHE B 2 1  ? 6.400   -9.614  -4.359  1.00 0.00 ? 1  PHE B CG   12 
ATOM 8921  C CD1  . PHE B 2 1  ? 6.860   -10.187 -5.551  1.00 0.00 ? 1  PHE B CD1  12 
ATOM 8922  C CD2  . PHE B 2 1  ? 6.948   -10.012 -3.133  1.00 0.00 ? 1  PHE B CD2  12 
ATOM 8923  C CE1  . PHE B 2 1  ? 7.868   -11.157 -5.516  1.00 0.00 ? 1  PHE B CE1  12 
ATOM 8924  C CE2  . PHE B 2 1  ? 7.957   -10.982 -3.099  1.00 0.00 ? 1  PHE B CE2  12 
ATOM 8925  C CZ   . PHE B 2 1  ? 8.416   -11.555 -4.290  1.00 0.00 ? 1  PHE B CZ   12 
ATOM 8926  H H1   . PHE B 2 1  ? 6.413   -8.089  -7.214  1.00 0.00 ? 1  PHE B H1   12 
ATOM 8927  H H2   . PHE B 2 1  ? 4.937   -8.794  -6.763  1.00 0.00 ? 1  PHE B H2   12 
ATOM 8928  H H3   . PHE B 2 1  ? 4.978   -7.184  -7.305  1.00 0.00 ? 1  PHE B H3   12 
ATOM 8929  H HA   . PHE B 2 1  ? 5.070   -6.581  -5.185  1.00 0.00 ? 1  PHE B HA   12 
ATOM 8930  H HB2  . PHE B 2 1  ? 5.182   -8.150  -3.403  1.00 0.00 ? 1  PHE B HB2  12 
ATOM 8931  H HB3  . PHE B 2 1  ? 4.386   -9.019  -4.715  1.00 0.00 ? 1  PHE B HB3  12 
ATOM 8932  H HD1  . PHE B 2 1  ? 6.438   -9.880  -6.495  1.00 0.00 ? 1  PHE B HD1  12 
ATOM 8933  H HD2  . PHE B 2 1  ? 6.594   -9.569  -2.214  1.00 0.00 ? 1  PHE B HD2  12 
ATOM 8934  H HE1  . PHE B 2 1  ? 8.224   -11.601 -6.435  1.00 0.00 ? 1  PHE B HE1  12 
ATOM 8935  H HE2  . PHE B 2 1  ? 8.380   -11.288 -2.153  1.00 0.00 ? 1  PHE B HE2  12 
ATOM 8936  H HZ   . PHE B 2 1  ? 9.193   -12.304 -4.264  1.00 0.00 ? 1  PHE B HZ   12 
ATOM 8937  N N    . VAL B 2 2  ? 7.415   -5.932  -4.561  1.00 0.00 ? 2  VAL B N    12 
ATOM 8938  C CA   . VAL B 2 2  ? 8.826   -5.505  -4.339  1.00 0.00 ? 2  VAL B CA   12 
ATOM 8939  C C    . VAL B 2 2  ? 8.883   -4.516  -3.171  1.00 0.00 ? 2  VAL B C    12 
ATOM 8940  O O    . VAL B 2 2  ? 8.221   -3.497  -3.175  1.00 0.00 ? 2  VAL B O    12 
ATOM 8941  C CB   . VAL B 2 2  ? 9.359   -4.835  -5.606  1.00 0.00 ? 2  VAL B CB   12 
ATOM 8942  C CG1  . VAL B 2 2  ? 10.815  -4.420  -5.393  1.00 0.00 ? 2  VAL B CG1  12 
ATOM 8943  C CG2  . VAL B 2 2  ? 9.278   -5.821  -6.775  1.00 0.00 ? 2  VAL B CG2  12 
ATOM 8944  H H    . VAL B 2 2  ? 6.677   -5.367  -4.252  1.00 0.00 ? 2  VAL B H    12 
ATOM 8945  H HA   . VAL B 2 2  ? 9.431   -6.370  -4.107  1.00 0.00 ? 2  VAL B HA   12 
ATOM 8946  H HB   . VAL B 2 2  ? 8.765   -3.960  -5.828  1.00 0.00 ? 2  VAL B HB   12 
ATOM 8947  H HG11 . VAL B 2 2  ? 11.400  -5.286  -5.121  1.00 0.00 ? 2  VAL B HG11 12 
ATOM 8948  H HG12 . VAL B 2 2  ? 11.205  -3.994  -6.306  1.00 0.00 ? 2  VAL B HG12 12 
ATOM 8949  H HG13 . VAL B 2 2  ? 10.869  -3.687  -4.602  1.00 0.00 ? 2  VAL B HG13 12 
ATOM 8950  H HG21 . VAL B 2 2  ? 9.674   -6.776  -6.468  1.00 0.00 ? 2  VAL B HG21 12 
ATOM 8951  H HG22 . VAL B 2 2  ? 8.247   -5.937  -7.075  1.00 0.00 ? 2  VAL B HG22 12 
ATOM 8952  H HG23 . VAL B 2 2  ? 9.854   -5.442  -7.606  1.00 0.00 ? 2  VAL B HG23 12 
ATOM 8953  N N    . ASN B 2 3  ? 9.668   -4.811  -2.169  1.00 0.00 ? 3  ASN B N    12 
ATOM 8954  C CA   . ASN B 2 3  ? 9.766   -3.888  -1.001  1.00 0.00 ? 3  ASN B CA   12 
ATOM 8955  C C    . ASN B 2 3  ? 10.363  -2.552  -1.449  1.00 0.00 ? 3  ASN B C    12 
ATOM 8956  O O    . ASN B 2 3  ? 11.566  -2.376  -1.475  1.00 0.00 ? 3  ASN B O    12 
ATOM 8957  C CB   . ASN B 2 3  ? 10.660  -4.511  0.072   1.00 0.00 ? 3  ASN B CB   12 
ATOM 8958  C CG   . ASN B 2 3  ? 12.045  -4.797  -0.514  1.00 0.00 ? 3  ASN B CG   12 
ATOM 8959  O OD1  . ASN B 2 3  ? 12.178  -5.574  -1.437  1.00 0.00 ? 3  ASN B OD1  12 
ATOM 8960  N ND2  . ASN B 2 3  ? 13.088  -4.197  -0.009  1.00 0.00 ? 3  ASN B ND2  12 
ATOM 8961  H H    . ASN B 2 3  ? 10.193  -5.637  -2.184  1.00 0.00 ? 3  ASN B H    12 
ATOM 8962  H HA   . ASN B 2 3  ? 8.780   -3.720  -0.593  1.00 0.00 ? 3  ASN B HA   12 
ATOM 8963  H HB2  . ASN B 2 3  ? 10.755  -3.826  0.904   1.00 0.00 ? 3  ASN B HB2  12 
ATOM 8964  H HB3  . ASN B 2 3  ? 10.220  -5.435  0.417   1.00 0.00 ? 3  ASN B HB3  12 
ATOM 8965  H HD21 . ASN B 2 3  ? 12.982  -3.571  0.737   1.00 0.00 ? 3  ASN B HD21 12 
ATOM 8966  H HD22 . ASN B 2 3  ? 13.980  -4.373  -0.377  1.00 0.00 ? 3  ASN B HD22 12 
ATOM 8967  N N    . GLN B 2 4  ? 9.532   -1.608  -1.798  1.00 0.00 ? 4  GLN B N    12 
ATOM 8968  C CA   . GLN B 2 4  ? 10.050  -0.282  -2.241  1.00 0.00 ? 4  GLN B CA   12 
ATOM 8969  C C    . GLN B 2 4  ? 9.217   0.825   -1.592  1.00 0.00 ? 4  GLN B C    12 
ATOM 8970  O O    . GLN B 2 4  ? 8.149   0.581   -1.065  1.00 0.00 ? 4  GLN B O    12 
ATOM 8971  C CB   . GLN B 2 4  ? 9.945   -0.179  -3.763  1.00 0.00 ? 4  GLN B CB   12 
ATOM 8972  C CG   . GLN B 2 4  ? 10.660  1.088   -4.241  1.00 0.00 ? 4  GLN B CG   12 
ATOM 8973  C CD   . GLN B 2 4  ? 11.058  0.928   -5.708  1.00 0.00 ? 4  GLN B CD   12 
ATOM 8974  O OE1  . GLN B 2 4  ? 10.280  1.218   -6.595  1.00 0.00 ? 4  GLN B OE1  12 
ATOM 8975  N NE2  . GLN B 2 4  ? 12.246  0.475   -6.006  1.00 0.00 ? 4  GLN B NE2  12 
ATOM 8976  H H    . GLN B 2 4  ? 8.567   -1.770  -1.767  1.00 0.00 ? 4  GLN B H    12 
ATOM 8977  H HA   . GLN B 2 4  ? 11.082  -0.179  -1.942  1.00 0.00 ? 4  GLN B HA   12 
ATOM 8978  H HB2  . GLN B 2 4  ? 10.407  -1.044  -4.215  1.00 0.00 ? 4  GLN B HB2  12 
ATOM 8979  H HB3  . GLN B 2 4  ? 8.907   -0.131  -4.052  1.00 0.00 ? 4  GLN B HB3  12 
ATOM 8980  H HG2  . GLN B 2 4  ? 9.999   1.936   -4.136  1.00 0.00 ? 4  GLN B HG2  12 
ATOM 8981  H HG3  . GLN B 2 4  ? 11.547  1.246   -3.644  1.00 0.00 ? 4  GLN B HG3  12 
ATOM 8982  H HE21 . GLN B 2 4  ? 12.874  0.242   -5.290  1.00 0.00 ? 4  GLN B HE21 12 
ATOM 8983  H HE22 . GLN B 2 4  ? 12.510  0.370   -6.943  1.00 0.00 ? 4  GLN B HE22 12 
ATOM 8984  N N    . HIS B 2 5  ? 9.694   2.042   -1.620  1.00 0.00 ? 5  HIS B N    12 
ATOM 8985  C CA   . HIS B 2 5  ? 8.923   3.153   -0.997  1.00 0.00 ? 5  HIS B CA   12 
ATOM 8986  C C    . HIS B 2 5  ? 7.607   3.353   -1.752  1.00 0.00 ? 5  HIS B C    12 
ATOM 8987  O O    . HIS B 2 5  ? 7.582   3.474   -2.960  1.00 0.00 ? 5  HIS B O    12 
ATOM 8988  C CB   . HIS B 2 5  ? 9.739   4.445   -1.054  1.00 0.00 ? 5  HIS B CB   12 
ATOM 8989  C CG   . HIS B 2 5  ? 11.037  4.250   -0.319  1.00 0.00 ? 5  HIS B CG   12 
ATOM 8990  N ND1  . HIS B 2 5  ? 11.091  3.683   0.944   1.00 0.00 ? 5  HIS B ND1  12 
ATOM 8991  C CD2  . HIS B 2 5  ? 12.335  4.541   -0.656  1.00 0.00 ? 5  HIS B CD2  12 
ATOM 8992  C CE1  . HIS B 2 5  ? 12.384  3.650   1.317   1.00 0.00 ? 5  HIS B CE1  12 
ATOM 8993  N NE2  . HIS B 2 5  ? 13.185  4.160   0.379   1.00 0.00 ? 5  HIS B NE2  12 
ATOM 8994  H H    . HIS B 2 5  ? 10.557  2.220   -2.047  1.00 0.00 ? 5  HIS B H    12 
ATOM 8995  H HA   . HIS B 2 5  ? 8.710   2.910   0.032   1.00 0.00 ? 5  HIS B HA   12 
ATOM 8996  H HB2  . HIS B 2 5  ? 9.942   4.699   -2.085  1.00 0.00 ? 5  HIS B HB2  12 
ATOM 8997  H HB3  . HIS B 2 5  ? 9.178   5.244   -0.589  1.00 0.00 ? 5  HIS B HB3  12 
ATOM 8998  H HD1  . HIS B 2 5  ? 10.329  3.364   1.469   1.00 0.00 ? 5  HIS B HD1  12 
ATOM 8999  H HD2  . HIS B 2 5  ? 12.650  4.995   -1.584  1.00 0.00 ? 5  HIS B HD2  12 
ATOM 9000  H HE1  . HIS B 2 5  ? 12.732  3.256   2.262   1.00 0.00 ? 5  HIS B HE1  12 
ATOM 9001  N N    . LEU B 2 6  ? 6.516   3.384   -1.041  1.00 0.00 ? 6  LEU B N    12 
ATOM 9002  C CA   . LEU B 2 6  ? 5.195   3.575   -1.703  1.00 0.00 ? 6  LEU B CA   12 
ATOM 9003  C C    . LEU B 2 6  ? 4.649   4.961   -1.355  1.00 0.00 ? 6  LEU B C    12 
ATOM 9004  O O    . LEU B 2 6  ? 4.401   5.271   -0.207  1.00 0.00 ? 6  LEU B O    12 
ATOM 9005  C CB   . LEU B 2 6  ? 4.223   2.500   -1.218  1.00 0.00 ? 6  LEU B CB   12 
ATOM 9006  C CG   . LEU B 2 6  ? 4.932   1.146   -1.203  1.00 0.00 ? 6  LEU B CG   12 
ATOM 9007  C CD1  . LEU B 2 6  ? 4.089   0.133   -0.424  1.00 0.00 ? 6  LEU B CD1  12 
ATOM 9008  C CD2  . LEU B 2 6  ? 5.115   0.654   -2.639  1.00 0.00 ? 6  LEU B CD2  12 
ATOM 9009  H H    . LEU B 2 6  ? 6.566   3.284   -0.069  1.00 0.00 ? 6  LEU B H    12 
ATOM 9010  H HA   . LEU B 2 6  ? 5.315   3.496   -2.772  1.00 0.00 ? 6  LEU B HA   12 
ATOM 9011  H HB2  . LEU B 2 6  ? 3.883   2.742   -0.223  1.00 0.00 ? 6  LEU B HB2  12 
ATOM 9012  H HB3  . LEU B 2 6  ? 3.379   2.453   -1.886  1.00 0.00 ? 6  LEU B HB3  12 
ATOM 9013  H HG   . LEU B 2 6  ? 5.897   1.249   -0.730  1.00 0.00 ? 6  LEU B HG   12 
ATOM 9014  H HD11 . LEU B 2 6  ? 3.533   0.647   0.347   1.00 0.00 ? 6  LEU B HD11 12 
ATOM 9015  H HD12 . LEU B 2 6  ? 3.405   -0.358  -1.097  1.00 0.00 ? 6  LEU B HD12 12 
ATOM 9016  H HD13 . LEU B 2 6  ? 4.739   -0.601  0.029   1.00 0.00 ? 6  LEU B HD13 12 
ATOM 9017  H HD21 . LEU B 2 6  ? 4.157   0.637   -3.139  1.00 0.00 ? 6  LEU B HD21 12 
ATOM 9018  H HD22 . LEU B 2 6  ? 5.783   1.320   -3.165  1.00 0.00 ? 6  LEU B HD22 12 
ATOM 9019  H HD23 . LEU B 2 6  ? 5.533   -0.341  -2.630  1.00 0.00 ? 6  LEU B HD23 12 
ATOM 9020  N N    . CYS B 2 7  ? 4.460   5.796   -2.340  1.00 0.00 ? 7  CYS B N    12 
ATOM 9021  C CA   . CYS B 2 7  ? 3.932   7.162   -2.069  1.00 0.00 ? 7  CYS B CA   12 
ATOM 9022  C C    . CYS B 2 7  ? 3.014   7.587   -3.214  1.00 0.00 ? 7  CYS B C    12 
ATOM 9023  O O    . CYS B 2 7  ? 3.458   8.086   -4.229  1.00 0.00 ? 7  CYS B O    12 
ATOM 9024  C CB   . CYS B 2 7  ? 5.100   8.145   -1.956  1.00 0.00 ? 7  CYS B CB   12 
ATOM 9025  S SG   . CYS B 2 7  ? 6.227   7.591   -0.653  1.00 0.00 ? 7  CYS B SG   12 
ATOM 9026  H H    . CYS B 2 7  ? 4.669   5.525   -3.259  1.00 0.00 ? 7  CYS B H    12 
ATOM 9027  H HA   . CYS B 2 7  ? 3.376   7.157   -1.143  1.00 0.00 ? 7  CYS B HA   12 
ATOM 9028  H HB2  . CYS B 2 7  ? 5.629   8.185   -2.897  1.00 0.00 ? 7  CYS B HB2  12 
ATOM 9029  H HB3  . CYS B 2 7  ? 4.722   9.126   -1.712  1.00 0.00 ? 7  CYS B HB3  12 
ATOM 9030  N N    . GLY B 2 8  ? 1.734   7.390   -3.060  1.00 0.00 ? 8  GLY B N    12 
ATOM 9031  C CA   . GLY B 2 8  ? 0.783   7.776   -4.139  1.00 0.00 ? 8  GLY B CA   12 
ATOM 9032  C C    . GLY B 2 8  ? 0.226   6.515   -4.798  1.00 0.00 ? 8  GLY B C    12 
ATOM 9033  O O    . GLY B 2 8  ? -0.171  5.578   -4.131  1.00 0.00 ? 8  GLY B O    12 
ATOM 9034  H H    . GLY B 2 8  ? 1.396   6.984   -2.234  1.00 0.00 ? 8  GLY B H    12 
ATOM 9035  H HA2  . GLY B 2 8  ? -0.028  8.354   -3.716  1.00 0.00 ? 8  GLY B HA2  12 
ATOM 9036  H HA3  . GLY B 2 8  ? 1.298   8.368   -4.881  1.00 0.00 ? 8  GLY B HA3  12 
ATOM 9037  N N    . SER B 2 9  ? 0.195   6.478   -6.102  1.00 0.00 ? 9  SER B N    12 
ATOM 9038  C CA   . SER B 2 9  ? -0.332  5.271   -6.799  1.00 0.00 ? 9  SER B CA   12 
ATOM 9039  C C    . SER B 2 9  ? 0.563   4.071   -6.487  1.00 0.00 ? 9  SER B C    12 
ATOM 9040  O O    . SER B 2 9  ? 0.155   2.934   -6.604  1.00 0.00 ? 9  SER B O    12 
ATOM 9041  C CB   . SER B 2 9  ? -0.344  5.518   -8.309  1.00 0.00 ? 9  SER B CB   12 
ATOM 9042  O OG   . SER B 2 9  ? 0.951   5.932   -8.726  1.00 0.00 ? 9  SER B OG   12 
ATOM 9043  H H    . SER B 2 9  ? 0.523   7.242   -6.622  1.00 0.00 ? 9  SER B H    12 
ATOM 9044  H HA   . SER B 2 9  ? -1.338  5.070   -6.461  1.00 0.00 ? 9  SER B HA   12 
ATOM 9045  H HB2  . SER B 2 9  ? -0.608  4.609   -8.822  1.00 0.00 ? 9  SER B HB2  12 
ATOM 9046  H HB3  . SER B 2 9  ? -1.071  6.286   -8.542  1.00 0.00 ? 9  SER B HB3  12 
ATOM 9047  H HG   . SER B 2 9  ? 0.856   6.426   -9.543  1.00 0.00 ? 9  SER B HG   12 
ATOM 9048  N N    . HIS B 2 10 ? 1.782   4.317   -6.089  1.00 0.00 ? 10 HIS B N    12 
ATOM 9049  C CA   . HIS B 2 10 ? 2.701   3.188   -5.769  1.00 0.00 ? 10 HIS B CA   12 
ATOM 9050  C C    . HIS B 2 10 ? 2.083   2.323   -4.670  1.00 0.00 ? 10 HIS B C    12 
ATOM 9051  O O    . HIS B 2 10 ? 1.901   1.132   -4.836  1.00 0.00 ? 10 HIS B O    12 
ATOM 9052  C CB   . HIS B 2 10 ? 4.043   3.742   -5.287  1.00 0.00 ? 10 HIS B CB   12 
ATOM 9053  C CG   . HIS B 2 10 ? 5.008   3.784   -6.437  1.00 0.00 ? 10 HIS B CG   12 
ATOM 9054  N ND1  . HIS B 2 10 ? 4.988   4.797   -7.386  1.00 0.00 ? 10 HIS B ND1  12 
ATOM 9055  C CD2  . HIS B 2 10 ? 6.029   2.945   -6.808  1.00 0.00 ? 10 HIS B CD2  12 
ATOM 9056  C CE1  . HIS B 2 10 ? 5.967   4.542   -8.270  1.00 0.00 ? 10 HIS B CE1  12 
ATOM 9057  N NE2  . HIS B 2 10 ? 6.633   3.425   -7.966  1.00 0.00 ? 10 HIS B NE2  12 
ATOM 9058  H H    . HIS B 2 10 ? 2.093   5.242   -6.001  1.00 0.00 ? 10 HIS B H    12 
ATOM 9059  H HA   . HIS B 2 10 ? 2.856   2.588   -6.653  1.00 0.00 ? 10 HIS B HA   12 
ATOM 9060  H HB2  . HIS B 2 10 ? 3.902   4.740   -4.897  1.00 0.00 ? 10 HIS B HB2  12 
ATOM 9061  H HB3  . HIS B 2 10 ? 4.437   3.104   -4.510  1.00 0.00 ? 10 HIS B HB3  12 
ATOM 9062  H HD1  . HIS B 2 10 ? 4.369   5.557   -7.406  1.00 0.00 ? 10 HIS B HD1  12 
ATOM 9063  H HD2  . HIS B 2 10 ? 6.319   2.048   -6.281  1.00 0.00 ? 10 HIS B HD2  12 
ATOM 9064  H HE1  . HIS B 2 10 ? 6.188   5.165   -9.125  1.00 0.00 ? 10 HIS B HE1  12 
ATOM 9065  N N    . LEU B 2 11 ? 1.758   2.907   -3.549  1.00 0.00 ? 11 LEU B N    12 
ATOM 9066  C CA   . LEU B 2 11 ? 1.152   2.106   -2.449  1.00 0.00 ? 11 LEU B CA   12 
ATOM 9067  C C    . LEU B 2 11 ? -0.107  1.420   -2.967  1.00 0.00 ? 11 LEU B C    12 
ATOM 9068  O O    . LEU B 2 11 ? -0.447  0.330   -2.552  1.00 0.00 ? 11 LEU B O    12 
ATOM 9069  C CB   . LEU B 2 11 ? 0.795   3.021   -1.277  1.00 0.00 ? 11 LEU B CB   12 
ATOM 9070  C CG   . LEU B 2 11 ? 1.135   2.314   0.034   1.00 0.00 ? 11 LEU B CG   12 
ATOM 9071  C CD1  . LEU B 2 11 ? 1.681   3.330   1.042   1.00 0.00 ? 11 LEU B CD1  12 
ATOM 9072  C CD2  . LEU B 2 11 ? -0.129  1.652   0.594   1.00 0.00 ? 11 LEU B CD2  12 
ATOM 9073  H H    . LEU B 2 11 ? 1.911   3.868   -3.432  1.00 0.00 ? 11 LEU B H    12 
ATOM 9074  H HA   . LEU B 2 11 ? 1.859   1.358   -2.119  1.00 0.00 ? 11 LEU B HA   12 
ATOM 9075  H HB2  . LEU B 2 11 ? 1.364   3.939   -1.352  1.00 0.00 ? 11 LEU B HB2  12 
ATOM 9076  H HB3  . LEU B 2 11 ? -0.259  3.247   -1.302  1.00 0.00 ? 11 LEU B HB3  12 
ATOM 9077  H HG   . LEU B 2 11 ? 1.885   1.557   -0.152  1.00 0.00 ? 11 LEU B HG   12 
ATOM 9078  H HD11 . LEU B 2 11 ? 2.480   3.898   0.586   1.00 0.00 ? 11 LEU B HD11 12 
ATOM 9079  H HD12 . LEU B 2 11 ? 0.889   4.002   1.341   1.00 0.00 ? 11 LEU B HD12 12 
ATOM 9080  H HD13 . LEU B 2 11 ? 2.058   2.811   1.911   1.00 0.00 ? 11 LEU B HD13 12 
ATOM 9081  H HD21 . LEU B 2 11 ? -0.891  2.403   0.758   1.00 0.00 ? 11 LEU B HD21 12 
ATOM 9082  H HD22 . LEU B 2 11 ? -0.495  0.916   -0.109  1.00 0.00 ? 11 LEU B HD22 12 
ATOM 9083  H HD23 . LEU B 2 11 ? 0.103   1.166   1.531   1.00 0.00 ? 11 LEU B HD23 12 
ATOM 9084  N N    . VAL B 2 12 ? -0.800  2.038   -3.882  1.00 0.00 ? 12 VAL B N    12 
ATOM 9085  C CA   . VAL B 2 12 ? -2.027  1.406   -4.430  1.00 0.00 ? 12 VAL B CA   12 
ATOM 9086  C C    . VAL B 2 12 ? -1.635  0.106   -5.135  1.00 0.00 ? 12 VAL B C    12 
ATOM 9087  O O    . VAL B 2 12 ? -2.338  -0.883  -5.077  1.00 0.00 ? 12 VAL B O    12 
ATOM 9088  C CB   . VAL B 2 12 ? -2.692  2.352   -5.427  1.00 0.00 ? 12 VAL B CB   12 
ATOM 9089  C CG1  . VAL B 2 12 ? -3.841  1.627   -6.130  1.00 0.00 ? 12 VAL B CG1  12 
ATOM 9090  C CG2  . VAL B 2 12 ? -3.240  3.562   -4.673  1.00 0.00 ? 12 VAL B CG2  12 
ATOM 9091  H H    . VAL B 2 12 ? -0.508  2.914   -4.213  1.00 0.00 ? 12 VAL B H    12 
ATOM 9092  H HA   . VAL B 2 12 ? -2.715  1.193   -3.625  1.00 0.00 ? 12 VAL B HA   12 
ATOM 9093  H HB   . VAL B 2 12 ? -1.967  2.677   -6.160  1.00 0.00 ? 12 VAL B HB   12 
ATOM 9094  H HG11 . VAL B 2 12 ? -3.466  0.730   -6.599  1.00 0.00 ? 12 VAL B HG11 12 
ATOM 9095  H HG12 . VAL B 2 12 ? -4.597  1.364   -5.404  1.00 0.00 ? 12 VAL B HG12 12 
ATOM 9096  H HG13 . VAL B 2 12 ? -4.271  2.275   -6.879  1.00 0.00 ? 12 VAL B HG13 12 
ATOM 9097  H HG21 . VAL B 2 12 ? -3.175  3.377   -3.611  1.00 0.00 ? 12 VAL B HG21 12 
ATOM 9098  H HG22 . VAL B 2 12 ? -2.659  4.438   -4.924  1.00 0.00 ? 12 VAL B HG22 12 
ATOM 9099  H HG23 . VAL B 2 12 ? -4.274  3.722   -4.947  1.00 0.00 ? 12 VAL B HG23 12 
ATOM 9100  N N    . GLU B 2 13 ? -0.503  0.101   -5.789  1.00 0.00 ? 13 GLU B N    12 
ATOM 9101  C CA   . GLU B 2 13 ? -0.048  -1.131  -6.489  1.00 0.00 ? 13 GLU B CA   12 
ATOM 9102  C C    . GLU B 2 13 ? 0.296   -2.200  -5.450  1.00 0.00 ? 13 GLU B C    12 
ATOM 9103  O O    . GLU B 2 13 ? 0.335   -3.377  -5.742  1.00 0.00 ? 13 GLU B O    12 
ATOM 9104  C CB   . GLU B 2 13 ? 1.189   -0.816  -7.332  1.00 0.00 ? 13 GLU B CB   12 
ATOM 9105  C CG   . GLU B 2 13 ? 0.753   -0.350  -8.721  1.00 0.00 ? 13 GLU B CG   12 
ATOM 9106  C CD   . GLU B 2 13 ? 1.972   -0.285  -9.643  1.00 0.00 ? 13 GLU B CD   12 
ATOM 9107  O OE1  . GLU B 2 13 ? 2.535   -1.328  -9.924  1.00 0.00 ? 13 GLU B OE1  12 
ATOM 9108  O OE2  . GLU B 2 13 ? 2.321   0.811   -10.053 1.00 0.00 ? 13 GLU B OE2  12 
ATOM 9109  H H    . GLU B 2 13 ? 0.050   0.909   -5.815  1.00 0.00 ? 13 GLU B H    12 
ATOM 9110  H HA   . GLU B 2 13 ? -0.839  -1.494  -7.130  1.00 0.00 ? 13 GLU B HA   12 
ATOM 9111  H HB2  . GLU B 2 13 ? 1.761   -0.035  -6.852  1.00 0.00 ? 13 GLU B HB2  12 
ATOM 9112  H HB3  . GLU B 2 13 ? 1.796   -1.703  -7.425  1.00 0.00 ? 13 GLU B HB3  12 
ATOM 9113  H HG2  . GLU B 2 13 ? 0.031   -1.046  -9.125  1.00 0.00 ? 13 GLU B HG2  12 
ATOM 9114  H HG3  . GLU B 2 13 ? 0.305   0.630   -8.649  1.00 0.00 ? 13 GLU B HG3  12 
ATOM 9115  N N    . ALA B 2 14 ? 0.538   -1.793  -4.233  1.00 0.00 ? 14 ALA B N    12 
ATOM 9116  C CA   . ALA B 2 14 ? 0.867   -2.783  -3.171  1.00 0.00 ? 14 ALA B CA   12 
ATOM 9117  C C    . ALA B 2 14 ? -0.402  -3.096  -2.379  1.00 0.00 ? 14 ALA B C    12 
ATOM 9118  O O    . ALA B 2 14 ? -0.448  -4.029  -1.601  1.00 0.00 ? 14 ALA B O    12 
ATOM 9119  C CB   . ALA B 2 14 ? 1.929   -2.197  -2.238  1.00 0.00 ? 14 ALA B CB   12 
ATOM 9120  H H    . ALA B 2 14 ? 0.495   -0.839  -4.015  1.00 0.00 ? 14 ALA B H    12 
ATOM 9121  H HA   . ALA B 2 14 ? 1.243   -3.686  -3.625  1.00 0.00 ? 14 ALA B HA   12 
ATOM 9122  H HB1  . ALA B 2 14 ? 2.710   -1.738  -2.825  1.00 0.00 ? 14 ALA B HB1  12 
ATOM 9123  H HB2  . ALA B 2 14 ? 1.476   -1.452  -1.599  1.00 0.00 ? 14 ALA B HB2  12 
ATOM 9124  H HB3  . ALA B 2 14 ? 2.350   -2.983  -1.632  1.00 0.00 ? 14 ALA B HB3  12 
ATOM 9125  N N    . LEU B 2 15 ? -1.439  -2.324  -2.573  1.00 0.00 ? 15 LEU B N    12 
ATOM 9126  C CA   . LEU B 2 15 ? -2.707  -2.576  -1.839  1.00 0.00 ? 15 LEU B CA   12 
ATOM 9127  C C    . LEU B 2 15 ? -3.550  -3.598  -2.605  1.00 0.00 ? 15 LEU B C    12 
ATOM 9128  O O    . LEU B 2 15 ? -4.078  -4.533  -2.034  1.00 0.00 ? 15 LEU B O    12 
ATOM 9129  C CB   . LEU B 2 15 ? -3.487  -1.265  -1.703  1.00 0.00 ? 15 LEU B CB   12 
ATOM 9130  C CG   . LEU B 2 15 ? -2.829  -0.400  -0.628  1.00 0.00 ? 15 LEU B CG   12 
ATOM 9131  C CD1  . LEU B 2 15 ? -3.688  0.836   -0.363  1.00 0.00 ? 15 LEU B CD1  12 
ATOM 9132  C CD2  . LEU B 2 15 ? -2.699  -1.212  0.661   1.00 0.00 ? 15 LEU B CD2  12 
ATOM 9133  H H    . LEU B 2 15 ? -1.383  -1.577  -3.205  1.00 0.00 ? 15 LEU B H    12 
ATOM 9134  H HA   . LEU B 2 15 ? -2.481  -2.961  -0.855  1.00 0.00 ? 15 LEU B HA   12 
ATOM 9135  H HB2  . LEU B 2 15 ? -3.479  -0.740  -2.646  1.00 0.00 ? 15 LEU B HB2  12 
ATOM 9136  H HB3  . LEU B 2 15 ? -4.506  -1.480  -1.415  1.00 0.00 ? 15 LEU B HB3  12 
ATOM 9137  H HG   . LEU B 2 15 ? -1.848  -0.096  -0.963  1.00 0.00 ? 15 LEU B HG   12 
ATOM 9138  H HD11 . LEU B 2 15 ? -4.733  0.567   -0.415  1.00 0.00 ? 15 LEU B HD11 12 
ATOM 9139  H HD12 . LEU B 2 15 ? -3.465  1.224   0.621   1.00 0.00 ? 15 LEU B HD12 12 
ATOM 9140  H HD13 . LEU B 2 15 ? -3.473  1.590   -1.104  1.00 0.00 ? 15 LEU B HD13 12 
ATOM 9141  H HD21 . LEU B 2 15 ? -3.462  -1.976  0.681   1.00 0.00 ? 15 LEU B HD21 12 
ATOM 9142  H HD22 . LEU B 2 15 ? -1.728  -1.679  0.696   1.00 0.00 ? 15 LEU B HD22 12 
ATOM 9143  H HD23 . LEU B 2 15 ? -2.817  -0.561  1.513   1.00 0.00 ? 15 LEU B HD23 12 
ATOM 9144  N N    . HIS B 2 16 ? -3.678  -3.436  -3.895  1.00 0.00 ? 16 HIS B N    12 
ATOM 9145  C CA   . HIS B 2 16 ? -4.483  -4.407  -4.689  1.00 0.00 ? 16 HIS B CA   12 
ATOM 9146  C C    . HIS B 2 16 ? -3.780  -5.767  -4.682  1.00 0.00 ? 16 HIS B C    12 
ATOM 9147  O O    . HIS B 2 16 ? -4.408  -6.807  -4.627  1.00 0.00 ? 16 HIS B O    12 
ATOM 9148  C CB   . HIS B 2 16 ? -4.636  -3.895  -6.133  1.00 0.00 ? 16 HIS B CB   12 
ATOM 9149  C CG   . HIS B 2 16 ? -3.421  -4.251  -6.951  1.00 0.00 ? 16 HIS B CG   12 
ATOM 9150  N ND1  . HIS B 2 16 ? -3.483  -5.118  -8.031  1.00 0.00 ? 16 HIS B ND1  12 
ATOM 9151  C CD2  . HIS B 2 16 ? -2.109  -3.865  -6.856  1.00 0.00 ? 16 HIS B CD2  12 
ATOM 9152  C CE1  . HIS B 2 16 ? -2.240  -5.222  -8.538  1.00 0.00 ? 16 HIS B CE1  12 
ATOM 9153  N NE2  . HIS B 2 16 ? -1.363  -4.477  -7.859  1.00 0.00 ? 16 HIS B NE2  12 
ATOM 9154  H H    . HIS B 2 16 ? -3.241  -2.680  -4.341  1.00 0.00 ? 16 HIS B H    12 
ATOM 9155  H HA   . HIS B 2 16 ? -5.461  -4.509  -4.242  1.00 0.00 ? 16 HIS B HA   12 
ATOM 9156  H HB2  . HIS B 2 16 ? -5.511  -4.341  -6.580  1.00 0.00 ? 16 HIS B HB2  12 
ATOM 9157  H HB3  . HIS B 2 16 ? -4.750  -2.822  -6.118  1.00 0.00 ? 16 HIS B HB3  12 
ATOM 9158  H HD1  . HIS B 2 16 ? -4.285  -5.570  -8.366  1.00 0.00 ? 16 HIS B HD1  12 
ATOM 9159  H HD2  . HIS B 2 16 ? -1.715  -3.190  -6.113  1.00 0.00 ? 16 HIS B HD2  12 
ATOM 9160  H HE1  . HIS B 2 16 ? -1.982  -5.833  -9.392  1.00 0.00 ? 16 HIS B HE1  12 
ATOM 9161  N N    . LEU B 2 17 ? -2.476  -5.764  -4.739  1.00 0.00 ? 17 LEU B N    12 
ATOM 9162  C CA   . LEU B 2 17 ? -1.722  -7.047  -4.735  1.00 0.00 ? 17 LEU B CA   12 
ATOM 9163  C C    . LEU B 2 17 ? -2.077  -7.841  -3.478  1.00 0.00 ? 17 LEU B C    12 
ATOM 9164  O O    . LEU B 2 17 ? -2.233  -9.046  -3.515  1.00 0.00 ? 17 LEU B O    12 
ATOM 9165  C CB   . LEU B 2 17 ? -0.222  -6.747  -4.743  1.00 0.00 ? 17 LEU B CB   12 
ATOM 9166  C CG   . LEU B 2 17 ? 0.563   -8.049  -4.895  1.00 0.00 ? 17 LEU B CG   12 
ATOM 9167  C CD1  . LEU B 2 17 ? 0.225   -8.696  -6.239  1.00 0.00 ? 17 LEU B CD1  12 
ATOM 9168  C CD2  . LEU B 2 17 ? 2.060   -7.744  -4.837  1.00 0.00 ? 17 LEU B CD2  12 
ATOM 9169  H H    . LEU B 2 17 ? -1.993  -4.913  -4.781  1.00 0.00 ? 17 LEU B H    12 
ATOM 9170  H HA   . LEU B 2 17 ? -1.979  -7.622  -5.613  1.00 0.00 ? 17 LEU B HA   12 
ATOM 9171  H HB2  . LEU B 2 17 ? 0.009   -6.089  -5.569  1.00 0.00 ? 17 LEU B HB2  12 
ATOM 9172  H HB3  . LEU B 2 17 ? 0.054   -6.269  -3.815  1.00 0.00 ? 17 LEU B HB3  12 
ATOM 9173  H HG   . LEU B 2 17 ? 0.298   -8.726  -4.093  1.00 0.00 ? 17 LEU B HG   12 
ATOM 9174  H HD11 . LEU B 2 17 ? 0.024   -7.925  -6.968  1.00 0.00 ? 17 LEU B HD11 12 
ATOM 9175  H HD12 . LEU B 2 17 ? 1.060   -9.296  -6.570  1.00 0.00 ? 17 LEU B HD12 12 
ATOM 9176  H HD13 . LEU B 2 17 ? -0.647  -9.323  -6.128  1.00 0.00 ? 17 LEU B HD13 12 
ATOM 9177  H HD21 . LEU B 2 17 ? 2.213   -6.677  -4.917  1.00 0.00 ? 17 LEU B HD21 12 
ATOM 9178  H HD22 . LEU B 2 17 ? 2.464   -8.095  -3.899  1.00 0.00 ? 17 LEU B HD22 12 
ATOM 9179  H HD23 . LEU B 2 17 ? 2.561   -8.241  -5.653  1.00 0.00 ? 17 LEU B HD23 12 
ATOM 9180  N N    . VAL B 2 18 ? -2.206  -7.173  -2.365  1.00 0.00 ? 18 VAL B N    12 
ATOM 9181  C CA   . VAL B 2 18 ? -2.550  -7.887  -1.106  1.00 0.00 ? 18 VAL B CA   12 
ATOM 9182  C C    . VAL B 2 18 ? -4.016  -8.321  -1.147  1.00 0.00 ? 18 VAL B C    12 
ATOM 9183  O O    . VAL B 2 18 ? -4.381  -9.358  -0.632  1.00 0.00 ? 18 VAL B O    12 
ATOM 9184  C CB   . VAL B 2 18 ? -2.331  -6.951  0.083   1.00 0.00 ? 18 VAL B CB   12 
ATOM 9185  C CG1  . VAL B 2 18 ? -2.629  -7.701  1.382   1.00 0.00 ? 18 VAL B CG1  12 
ATOM 9186  C CG2  . VAL B 2 18 ? -0.878  -6.471  0.096   1.00 0.00 ? 18 VAL B CG2  12 
ATOM 9187  H H    . VAL B 2 18 ? -2.075  -6.203  -2.360  1.00 0.00 ? 18 VAL B H    12 
ATOM 9188  H HA   . VAL B 2 18 ? -1.919  -8.757  -1.000  1.00 0.00 ? 18 VAL B HA   12 
ATOM 9189  H HB   . VAL B 2 18 ? -2.993  -6.101  -0.001  1.00 0.00 ? 18 VAL B HB   12 
ATOM 9190  H HG11 . VAL B 2 18 ? -3.418  -8.418  1.211   1.00 0.00 ? 18 VAL B HG11 12 
ATOM 9191  H HG12 . VAL B 2 18 ? -1.739  -8.216  1.712   1.00 0.00 ? 18 VAL B HG12 12 
ATOM 9192  H HG13 . VAL B 2 18 ? -2.940  -6.997  2.139   1.00 0.00 ? 18 VAL B HG13 12 
ATOM 9193  H HG21 . VAL B 2 18 ? -0.340  -6.932  -0.719  1.00 0.00 ? 18 VAL B HG21 12 
ATOM 9194  H HG22 . VAL B 2 18 ? -0.853  -5.398  -0.017  1.00 0.00 ? 18 VAL B HG22 12 
ATOM 9195  H HG23 . VAL B 2 18 ? -0.416  -6.747  1.033   1.00 0.00 ? 18 VAL B HG23 12 
ATOM 9196  N N    . CYS B 2 19 ? -4.862  -7.532  -1.749  1.00 0.00 ? 19 CYS B N    12 
ATOM 9197  C CA   . CYS B 2 19 ? -6.304  -7.898  -1.816  1.00 0.00 ? 19 CYS B CA   12 
ATOM 9198  C C    . CYS B 2 19 ? -6.615  -8.513  -3.183  1.00 0.00 ? 19 CYS B C    12 
ATOM 9199  O O    . CYS B 2 19 ? -6.844  -9.700  -3.301  1.00 0.00 ? 19 CYS B O    12 
ATOM 9200  C CB   . CYS B 2 19 ? -7.150  -6.641  -1.614  1.00 0.00 ? 19 CYS B CB   12 
ATOM 9201  S SG   . CYS B 2 19 ? -6.408  -5.617  -0.319  1.00 0.00 ? 19 CYS B SG   12 
ATOM 9202  H H    . CYS B 2 19 ? -4.552  -6.696  -2.156  1.00 0.00 ? 19 CYS B H    12 
ATOM 9203  H HA   . CYS B 2 19 ? -6.530  -8.614  -1.039  1.00 0.00 ? 19 CYS B HA   12 
ATOM 9204  H HB2  . CYS B 2 19 ? -7.188  -6.082  -2.537  1.00 0.00 ? 19 CYS B HB2  12 
ATOM 9205  H HB3  . CYS B 2 19 ? -8.151  -6.924  -1.322  1.00 0.00 ? 19 CYS B HB3  12 
ATOM 9206  N N    . GLY B 2 20 ? -6.628  -7.715  -4.215  1.00 0.00 ? 20 GLY B N    12 
ATOM 9207  C CA   . GLY B 2 20 ? -6.926  -8.257  -5.572  1.00 0.00 ? 20 GLY B CA   12 
ATOM 9208  C C    . GLY B 2 20 ? -8.405  -8.038  -5.895  1.00 0.00 ? 20 GLY B C    12 
ATOM 9209  O O    . GLY B 2 20 ? -8.897  -6.927  -5.885  1.00 0.00 ? 20 GLY B O    12 
ATOM 9210  H H    . GLY B 2 20 ? -6.443  -6.761  -4.099  1.00 0.00 ? 20 GLY B H    12 
ATOM 9211  H HA2  . GLY B 2 20 ? -6.318  -7.745  -6.304  1.00 0.00 ? 20 GLY B HA2  12 
ATOM 9212  H HA3  . GLY B 2 20 ? -6.709  -9.312  -5.594  1.00 0.00 ? 20 GLY B HA3  12 
ATOM 9213  N N    . GLU B 2 21 ? -9.120  -9.091  -6.181  1.00 0.00 ? 21 GLU B N    12 
ATOM 9214  C CA   . GLU B 2 21 ? -10.567 -8.943  -6.507  1.00 0.00 ? 21 GLU B CA   12 
ATOM 9215  C C    . GLU B 2 21 ? -11.298 -8.336  -5.307  1.00 0.00 ? 21 GLU B C    12 
ATOM 9216  O O    . GLU B 2 21 ? -12.188 -7.521  -5.457  1.00 0.00 ? 21 GLU B O    12 
ATOM 9217  C CB   . GLU B 2 21 ? -11.161 -10.316 -6.826  1.00 0.00 ? 21 GLU B CB   12 
ATOM 9218  C CG   . GLU B 2 21 ? -10.382 -10.953 -7.978  1.00 0.00 ? 21 GLU B CG   12 
ATOM 9219  C CD   . GLU B 2 21 ? -10.645 -10.167 -9.266  1.00 0.00 ? 21 GLU B CD   12 
ATOM 9220  O OE1  . GLU B 2 21 ? -11.614 -10.481 -9.939  1.00 0.00 ? 21 GLU B OE1  12 
ATOM 9221  O OE2  . GLU B 2 21 ? -9.874  -9.269  -9.556  1.00 0.00 ? 21 GLU B OE2  12 
ATOM 9222  H H    . GLU B 2 21 ? -8.707  -9.978  -6.185  1.00 0.00 ? 21 GLU B H    12 
ATOM 9223  H HA   . GLU B 2 21 ? -10.679 -8.293  -7.362  1.00 0.00 ? 21 GLU B HA   12 
ATOM 9224  H HB2  . GLU B 2 21 ? -11.096 -10.950 -5.952  1.00 0.00 ? 21 GLU B HB2  12 
ATOM 9225  H HB3  . GLU B 2 21 ? -12.196 -10.203 -7.111  1.00 0.00 ? 21 GLU B HB3  12 
ATOM 9226  H HG2  . GLU B 2 21 ? -9.325  -10.932 -7.753  1.00 0.00 ? 21 GLU B HG2  12 
ATOM 9227  H HG3  . GLU B 2 21 ? -10.704 -11.974 -8.111  1.00 0.00 ? 21 GLU B HG3  12 
ATOM 9228  N N    . ARG B 2 22 ? -10.929 -8.726  -4.117  1.00 0.00 ? 22 ARG B N    12 
ATOM 9229  C CA   . ARG B 2 22 ? -11.604 -8.170  -2.909  1.00 0.00 ? 22 ARG B CA   12 
ATOM 9230  C C    . ARG B 2 22 ? -11.576 -6.643  -2.968  1.00 0.00 ? 22 ARG B C    12 
ATOM 9231  O O    . ARG B 2 22 ? -12.423 -5.974  -2.409  1.00 0.00 ? 22 ARG B O    12 
ATOM 9232  C CB   . ARG B 2 22 ? -10.869 -8.637  -1.653  1.00 0.00 ? 22 ARG B CB   12 
ATOM 9233  C CG   . ARG B 2 22 ? -11.204 -10.104 -1.377  1.00 0.00 ? 22 ARG B CG   12 
ATOM 9234  C CD   . ARG B 2 22 ? -11.646 -10.262 0.079   1.00 0.00 ? 22 ARG B CD   12 
ATOM 9235  N NE   . ARG B 2 22 ? -10.455 -10.187 0.972   1.00 0.00 ? 22 ARG B NE   12 
ATOM 9236  C CZ   . ARG B 2 22 ? -10.605 -10.008 2.257   1.00 0.00 ? 22 ARG B CZ   12 
ATOM 9237  N NH1  . ARG B 2 22 ? -11.800 -9.893  2.769   1.00 0.00 ? 22 ARG B NH1  12 
ATOM 9238  N NH2  . ARG B 2 22 ? -9.556  -9.944  3.032   1.00 0.00 ? 22 ARG B NH2  12 
ATOM 9239  H H    . ARG B 2 22 ? -10.212 -9.384  -4.018  1.00 0.00 ? 22 ARG B H    12 
ATOM 9240  H HA   . ARG B 2 22 ? -12.626 -8.512  -2.875  1.00 0.00 ? 22 ARG B HA   12 
ATOM 9241  H HB2  . ARG B 2 22 ? -9.804  -8.532  -1.799  1.00 0.00 ? 22 ARG B HB2  12 
ATOM 9242  H HB3  . ARG B 2 22 ? -11.177 -8.036  -0.812  1.00 0.00 ? 22 ARG B HB3  12 
ATOM 9243  H HG2  . ARG B 2 22 ? -12.001 -10.422 -2.034  1.00 0.00 ? 22 ARG B HG2  12 
ATOM 9244  H HG3  . ARG B 2 22 ? -10.328 -10.713 -1.553  1.00 0.00 ? 22 ARG B HG3  12 
ATOM 9245  H HD2  . ARG B 2 22 ? -12.335 -9.470  0.333   1.00 0.00 ? 22 ARG B HD2  12 
ATOM 9246  H HD3  . ARG B 2 22 ? -12.134 -11.216 0.206   1.00 0.00 ? 22 ARG B HD3  12 
ATOM 9247  H HE   . ARG B 2 22 ? -9.555  -10.272 0.593   1.00 0.00 ? 22 ARG B HE   12 
ATOM 9248  H HH11 . ARG B 2 22 ? -12.606 -9.940  2.178   1.00 0.00 ? 22 ARG B HH11 12 
ATOM 9249  H HH12 . ARG B 2 22 ? -11.910 -9.755  3.754   1.00 0.00 ? 22 ARG B HH12 12 
ATOM 9250  H HH21 . ARG B 2 22 ? -8.641  -10.032 2.642   1.00 0.00 ? 22 ARG B HH21 12 
ATOM 9251  H HH22 . ARG B 2 22 ? -9.670  -9.807  4.017   1.00 0.00 ? 22 ARG B HH22 12 
ATOM 9252  N N    . GLY B 2 23 ? -10.605 -6.085  -3.637  1.00 0.00 ? 23 GLY B N    12 
ATOM 9253  C CA   . GLY B 2 23 ? -10.519 -4.602  -3.723  1.00 0.00 ? 23 GLY B CA   12 
ATOM 9254  C C    . GLY B 2 23 ? -9.835  -4.065  -2.466  1.00 0.00 ? 23 GLY B C    12 
ATOM 9255  O O    . GLY B 2 23 ? -9.564  -4.796  -1.535  1.00 0.00 ? 23 GLY B O    12 
ATOM 9256  H H    . GLY B 2 23 ? -9.929  -6.641  -4.076  1.00 0.00 ? 23 GLY B H    12 
ATOM 9257  H HA2  . GLY B 2 23 ? -9.947  -4.323  -4.596  1.00 0.00 ? 23 GLY B HA2  12 
ATOM 9258  H HA3  . GLY B 2 23 ? -11.513 -4.186  -3.792  1.00 0.00 ? 23 GLY B HA3  12 
ATOM 9259  N N    . PHE B 2 24 ? -9.548  -2.794  -2.430  1.00 0.00 ? 24 PHE B N    12 
ATOM 9260  C CA   . PHE B 2 24 ? -8.879  -2.216  -1.231  1.00 0.00 ? 24 PHE B CA   12 
ATOM 9261  C C    . PHE B 2 24 ? -9.295  -0.755  -1.067  1.00 0.00 ? 24 PHE B C    12 
ATOM 9262  O O    . PHE B 2 24 ? -9.336  -0.001  -2.019  1.00 0.00 ? 24 PHE B O    12 
ATOM 9263  C CB   . PHE B 2 24 ? -7.362  -2.297  -1.410  1.00 0.00 ? 24 PHE B CB   12 
ATOM 9264  C CG   . PHE B 2 24 ? -6.977  -1.665  -2.724  1.00 0.00 ? 24 PHE B CG   12 
ATOM 9265  C CD1  . PHE B 2 24 ? -6.977  -2.436  -3.893  1.00 0.00 ? 24 PHE B CD1  12 
ATOM 9266  C CD2  . PHE B 2 24 ? -6.622  -0.313  -2.778  1.00 0.00 ? 24 PHE B CD2  12 
ATOM 9267  C CE1  . PHE B 2 24 ? -6.622  -1.855  -5.115  1.00 0.00 ? 24 PHE B CE1  12 
ATOM 9268  C CE2  . PHE B 2 24 ? -6.266  0.270   -4.000  1.00 0.00 ? 24 PHE B CE2  12 
ATOM 9269  C CZ   . PHE B 2 24 ? -6.265  -0.501  -5.168  1.00 0.00 ? 24 PHE B CZ   12 
ATOM 9270  H H    . PHE B 2 24 ? -9.773  -2.217  -3.191  1.00 0.00 ? 24 PHE B H    12 
ATOM 9271  H HA   . PHE B 2 24 ? -9.168  -2.776  -0.352  1.00 0.00 ? 24 PHE B HA   12 
ATOM 9272  H HB2  . PHE B 2 24 ? -6.876  -1.772  -0.601  1.00 0.00 ? 24 PHE B HB2  12 
ATOM 9273  H HB3  . PHE B 2 24 ? -7.053  -3.332  -1.405  1.00 0.00 ? 24 PHE B HB3  12 
ATOM 9274  H HD1  . PHE B 2 24 ? -7.252  -3.479  -3.850  1.00 0.00 ? 24 PHE B HD1  12 
ATOM 9275  H HD2  . PHE B 2 24 ? -6.622  0.280   -1.876  1.00 0.00 ? 24 PHE B HD2  12 
ATOM 9276  H HE1  . PHE B 2 24 ? -6.622  -2.449  -6.017  1.00 0.00 ? 24 PHE B HE1  12 
ATOM 9277  H HE2  . PHE B 2 24 ? -5.991  1.314   -4.042  1.00 0.00 ? 24 PHE B HE2  12 
ATOM 9278  H HZ   . PHE B 2 24 ? -5.991  -0.052  -6.112  1.00 0.00 ? 24 PHE B HZ   12 
ATOM 9279  N N    . PHE B 2 25 ? -9.601  -0.346  0.135   1.00 0.00 ? 25 PHE B N    12 
ATOM 9280  C CA   . PHE B 2 25 ? -10.007 1.073   0.352   1.00 0.00 ? 25 PHE B CA   12 
ATOM 9281  C C    . PHE B 2 25 ? -8.763  1.914   0.635   1.00 0.00 ? 25 PHE B C    12 
ATOM 9282  O O    . PHE B 2 25 ? -8.502  2.300   1.757   1.00 0.00 ? 25 PHE B O    12 
ATOM 9283  C CB   . PHE B 2 25 ? -10.976 1.173   1.537   1.00 0.00 ? 25 PHE B CB   12 
ATOM 9284  C CG   . PHE B 2 25 ? -10.607 0.159   2.594   1.00 0.00 ? 25 PHE B CG   12 
ATOM 9285  C CD1  . PHE B 2 25 ? -9.650  0.478   3.565   1.00 0.00 ? 25 PHE B CD1  12 
ATOM 9286  C CD2  . PHE B 2 25 ? -11.220 -1.098  2.602   1.00 0.00 ? 25 PHE B CD2  12 
ATOM 9287  C CE1  . PHE B 2 25 ? -9.308  -0.462  4.546   1.00 0.00 ? 25 PHE B CE1  12 
ATOM 9288  C CE2  . PHE B 2 25 ? -10.879 -2.037  3.581   1.00 0.00 ? 25 PHE B CE2  12 
ATOM 9289  C CZ   . PHE B 2 25 ? -9.924  -1.720  4.554   1.00 0.00 ? 25 PHE B CZ   12 
ATOM 9290  H H    . PHE B 2 25 ? -9.557  -0.969  0.887   1.00 0.00 ? 25 PHE B H    12 
ATOM 9291  H HA   . PHE B 2 25 ? -10.493 1.445   -0.540  1.00 0.00 ? 25 PHE B HA   12 
ATOM 9292  H HB2  . PHE B 2 25 ? -10.925 2.165   1.958   1.00 0.00 ? 25 PHE B HB2  12 
ATOM 9293  H HB3  . PHE B 2 25 ? -11.982 0.980   1.194   1.00 0.00 ? 25 PHE B HB3  12 
ATOM 9294  H HD1  . PHE B 2 25 ? -9.176  1.448   3.559   1.00 0.00 ? 25 PHE B HD1  12 
ATOM 9295  H HD2  . PHE B 2 25 ? -11.958 -1.343  1.852   1.00 0.00 ? 25 PHE B HD2  12 
ATOM 9296  H HE1  . PHE B 2 25 ? -8.571  -0.216  5.295   1.00 0.00 ? 25 PHE B HE1  12 
ATOM 9297  H HE2  . PHE B 2 25 ? -11.353 -3.008  3.587   1.00 0.00 ? 25 PHE B HE2  12 
ATOM 9298  H HZ   . PHE B 2 25 ? -9.659  -2.445  5.309   1.00 0.00 ? 25 PHE B HZ   12 
ATOM 9299  N N    . TYR B 2 26 ? -7.990  2.198   -0.379  1.00 0.00 ? 26 TYR B N    12 
ATOM 9300  C CA   . TYR B 2 26 ? -6.759  3.013   -0.174  1.00 0.00 ? 26 TYR B CA   12 
ATOM 9301  C C    . TYR B 2 26 ? -7.152  4.456   0.151   1.00 0.00 ? 26 TYR B C    12 
ATOM 9302  O O    . TYR B 2 26 ? -8.075  5.001   -0.423  1.00 0.00 ? 26 TYR B O    12 
ATOM 9303  C CB   . TYR B 2 26 ? -5.914  2.983   -1.449  1.00 0.00 ? 26 TYR B CB   12 
ATOM 9304  C CG   . TYR B 2 26 ? -4.802  3.998   -1.349  1.00 0.00 ? 26 TYR B CG   12 
ATOM 9305  C CD1  . TYR B 2 26 ? -4.033  4.087   -0.182  1.00 0.00 ? 26 TYR B CD1  12 
ATOM 9306  C CD2  . TYR B 2 26 ? -4.534  4.849   -2.428  1.00 0.00 ? 26 TYR B CD2  12 
ATOM 9307  C CE1  . TYR B 2 26 ? -2.998  5.026   -0.096  1.00 0.00 ? 26 TYR B CE1  12 
ATOM 9308  C CE2  . TYR B 2 26 ? -3.501  5.787   -2.341  1.00 0.00 ? 26 TYR B CE2  12 
ATOM 9309  C CZ   . TYR B 2 26 ? -2.731  5.876   -1.175  1.00 0.00 ? 26 TYR B CZ   12 
ATOM 9310  O OH   . TYR B 2 26 ? -1.713  6.801   -1.089  1.00 0.00 ? 26 TYR B OH   12 
ATOM 9311  H H    . TYR B 2 26 ? -8.219  1.876   -1.275  1.00 0.00 ? 26 TYR B H    12 
ATOM 9312  H HA   . TYR B 2 26 ? -6.189  2.604   0.646   1.00 0.00 ? 26 TYR B HA   12 
ATOM 9313  H HB2  . TYR B 2 26 ? -5.490  1.998   -1.575  1.00 0.00 ? 26 TYR B HB2  12 
ATOM 9314  H HB3  . TYR B 2 26 ? -6.537  3.215   -2.299  1.00 0.00 ? 26 TYR B HB3  12 
ATOM 9315  H HD1  . TYR B 2 26 ? -4.237  3.433   0.651   1.00 0.00 ? 26 TYR B HD1  12 
ATOM 9316  H HD2  . TYR B 2 26 ? -5.127  4.780   -3.329  1.00 0.00 ? 26 TYR B HD2  12 
ATOM 9317  H HE1  . TYR B 2 26 ? -2.407  5.093   0.804   1.00 0.00 ? 26 TYR B HE1  12 
ATOM 9318  H HE2  . TYR B 2 26 ? -3.295  6.440   -3.175  1.00 0.00 ? 26 TYR B HE2  12 
ATOM 9319  H HH   . TYR B 2 26 ? -0.897  6.330   -0.911  1.00 0.00 ? 26 TYR B HH   12 
ATOM 9320  N N    . THR B 2 27 ? -6.467  5.076   1.071   1.00 0.00 ? 27 THR B N    12 
ATOM 9321  C CA   . THR B 2 27 ? -6.812  6.479   1.434   1.00 0.00 ? 27 THR B CA   12 
ATOM 9322  C C    . THR B 2 27 ? -5.638  7.408   1.101   1.00 0.00 ? 27 THR B C    12 
ATOM 9323  O O    . THR B 2 27 ? -4.914  7.831   1.981   1.00 0.00 ? 27 THR B O    12 
ATOM 9324  C CB   . THR B 2 27 ? -7.113  6.557   2.932   1.00 0.00 ? 27 THR B CB   12 
ATOM 9325  O OG1  . THR B 2 27 ? -7.287  5.242   3.446   1.00 0.00 ? 27 THR B OG1  12 
ATOM 9326  C CG2  . THR B 2 27 ? -8.389  7.368   3.158   1.00 0.00 ? 27 THR B CG2  12 
ATOM 9327  H H    . THR B 2 27 ? -5.730  4.618   1.526   1.00 0.00 ? 27 THR B H    12 
ATOM 9328  H HA   . THR B 2 27 ? -7.682  6.787   0.878   1.00 0.00 ? 27 THR B HA   12 
ATOM 9329  H HB   . THR B 2 27 ? -6.290  7.036   3.441   1.00 0.00 ? 27 THR B HB   12 
ATOM 9330  H HG1  . THR B 2 27 ? -6.427  4.816   3.465   1.00 0.00 ? 27 THR B HG1  12 
ATOM 9331  H HG21 . THR B 2 27 ? -9.079  7.188   2.348   1.00 0.00 ? 27 THR B HG21 12 
ATOM 9332  H HG22 . THR B 2 27 ? -8.843  7.069   4.091   1.00 0.00 ? 27 THR B HG22 12 
ATOM 9333  H HG23 . THR B 2 27 ? -8.145  8.419   3.197   1.00 0.00 ? 27 THR B HG23 12 
ATOM 9334  N N    . PRO B 2 28 ? -5.494  7.702   -0.165  1.00 0.00 ? 28 PRO B N    12 
ATOM 9335  C CA   . PRO B 2 28 ? -4.423  8.588   -0.679  1.00 0.00 ? 28 PRO B CA   12 
ATOM 9336  C C    . PRO B 2 28 ? -4.528  9.971   -0.029  1.00 0.00 ? 28 PRO B C    12 
ATOM 9337  O O    . PRO B 2 28 ? -5.282  10.176  0.901   1.00 0.00 ? 28 PRO B O    12 
ATOM 9338  C CB   . PRO B 2 28 ? -4.648  8.688   -2.193  1.00 0.00 ? 28 PRO B CB   12 
ATOM 9339  C CG   . PRO B 2 28 ? -5.858  7.798   -2.542  1.00 0.00 ? 28 PRO B CG   12 
ATOM 9340  C CD   . PRO B 2 28 ? -6.376  7.185   -1.235  1.00 0.00 ? 28 PRO B CD   12 
ATOM 9341  H HA   . PRO B 2 28 ? -3.455  8.157   -0.481  1.00 0.00 ? 28 PRO B HA   12 
ATOM 9342  H HB2  . PRO B 2 28 ? -4.852  9.713   -2.465  1.00 0.00 ? 28 PRO B HB2  12 
ATOM 9343  H HB3  . PRO B 2 28 ? -3.774  8.334   -2.719  1.00 0.00 ? 28 PRO B HB3  12 
ATOM 9344  H HG2  . PRO B 2 28 ? -6.631  8.397   -3.003  1.00 0.00 ? 28 PRO B HG2  12 
ATOM 9345  H HG3  . PRO B 2 28 ? -5.551  7.011   -3.214  1.00 0.00 ? 28 PRO B HG3  12 
ATOM 9346  H HD2  . PRO B 2 28 ? -7.398  7.497   -1.060  1.00 0.00 ? 28 PRO B HD2  12 
ATOM 9347  H HD3  . PRO B 2 28 ? -6.314  6.109   -1.276  1.00 0.00 ? 28 PRO B HD3  12 
ATOM 9348  N N    . LYS B 2 29 ? -3.776  10.922  -0.514  1.00 0.00 ? 29 LYS B N    12 
ATOM 9349  C CA   . LYS B 2 29 ? -3.831  12.291  0.079   1.00 0.00 ? 29 LYS B CA   12 
ATOM 9350  C C    . LYS B 2 29 ? -4.636  13.215  -0.838  1.00 0.00 ? 29 LYS B C    12 
ATOM 9351  O O    . LYS B 2 29 ? -5.098  12.814  -1.888  1.00 0.00 ? 29 LYS B O    12 
ATOM 9352  C CB   . LYS B 2 29 ? -2.409  12.839  0.231   1.00 0.00 ? 29 LYS B CB   12 
ATOM 9353  C CG   . LYS B 2 29 ? -1.451  11.693  0.564   1.00 0.00 ? 29 LYS B CG   12 
ATOM 9354  C CD   . LYS B 2 29 ? -0.311  12.220  1.440   1.00 0.00 ? 29 LYS B CD   12 
ATOM 9355  C CE   . LYS B 2 29 ? 0.486   13.272  0.665   1.00 0.00 ? 29 LYS B CE   12 
ATOM 9356  N NZ   . LYS B 2 29 ? 0.378   14.588  1.358   1.00 0.00 ? 29 LYS B NZ   12 
ATOM 9357  H H    . LYS B 2 29 ? -3.173  10.737  -1.264  1.00 0.00 ? 29 LYS B H    12 
ATOM 9358  H HA   . LYS B 2 29 ? -4.306  12.243  1.048   1.00 0.00 ? 29 LYS B HA   12 
ATOM 9359  H HB2  . LYS B 2 29 ? -2.104  13.307  -0.692  1.00 0.00 ? 29 LYS B HB2  12 
ATOM 9360  H HB3  . LYS B 2 29 ? -2.389  13.566  1.028   1.00 0.00 ? 29 LYS B HB3  12 
ATOM 9361  H HG2  . LYS B 2 29 ? -1.986  10.919  1.095   1.00 0.00 ? 29 LYS B HG2  12 
ATOM 9362  H HG3  . LYS B 2 29 ? -1.043  11.288  -0.350  1.00 0.00 ? 29 LYS B HG3  12 
ATOM 9363  H HD2  . LYS B 2 29 ? -0.721  12.666  2.335   1.00 0.00 ? 29 LYS B HD2  12 
ATOM 9364  H HD3  . LYS B 2 29 ? 0.342   11.404  1.710   1.00 0.00 ? 29 LYS B HD3  12 
ATOM 9365  H HE2  . LYS B 2 29 ? 1.523   12.975  0.617   1.00 0.00 ? 29 LYS B HE2  12 
ATOM 9366  H HE3  . LYS B 2 29 ? 0.090   13.359  -0.336  1.00 0.00 ? 29 LYS B HE3  12 
ATOM 9367  H HZ1  . LYS B 2 29 ? -0.619  14.785  1.577   1.00 0.00 ? 29 LYS B HZ1  12 
ATOM 9368  H HZ2  . LYS B 2 29 ? 0.928   14.561  2.241   1.00 0.00 ? 29 LYS B HZ2  12 
ATOM 9369  H HZ3  . LYS B 2 29 ? 0.749   15.337  0.741   1.00 0.00 ? 29 LYS B HZ3  12 
ATOM 9370  N N    . THR B 2 30 ? -4.807  14.450  -0.450  1.00 0.00 ? 30 THR B N    12 
ATOM 9371  C CA   . THR B 2 30 ? -5.582  15.398  -1.298  1.00 0.00 ? 30 THR B CA   12 
ATOM 9372  C C    . THR B 2 30 ? -4.633  16.107  -2.266  1.00 0.00 ? 30 THR B C    12 
ATOM 9373  O O    . THR B 2 30 ? -3.475  16.271  -1.915  1.00 0.00 ? 30 THR B O    12 
ATOM 9374  C CB   . THR B 2 30 ? -6.273  16.435  -0.407  1.00 0.00 ? 30 THR B CB   12 
ATOM 9375  O OG1  . THR B 2 30 ? -6.178  16.028  0.950   1.00 0.00 ? 30 THR B OG1  12 
ATOM 9376  C CG2  . THR B 2 30 ? -7.744  16.553  -0.806  1.00 0.00 ? 30 THR B CG2  12 
ATOM 9377  O OXT  . THR B 2 30 ? -5.078  16.477  -3.339  1.00 0.00 ? 30 THR B OXT  12 
ATOM 9378  H H    . THR B 2 30 ? -4.425  14.752  0.402   1.00 0.00 ? 30 THR B H    12 
ATOM 9379  H HA   . THR B 2 30 ? -6.326  14.853  -1.861  1.00 0.00 ? 30 THR B HA   12 
ATOM 9380  H HB   . THR B 2 30 ? -5.792  17.393  -0.531  1.00 0.00 ? 30 THR B HB   12 
ATOM 9381  H HG1  . THR B 2 30 ? -6.056  16.815  1.488   1.00 0.00 ? 30 THR B HG1  12 
ATOM 9382  H HG21 . THR B 2 30 ? -8.045  15.664  -1.338  1.00 0.00 ? 30 THR B HG21 12 
ATOM 9383  H HG22 . THR B 2 30 ? -8.349  16.667  0.081   1.00 0.00 ? 30 THR B HG22 12 
ATOM 9384  H HG23 . THR B 2 30 ? -7.876  17.414  -1.443  1.00 0.00 ? 30 THR B HG23 12 
ATOM 9385  N N    . GLY A 1 1  ? -2.944  4.356   8.761   1.00 0.00 ? 1  GLY A N    13 
ATOM 9386  C CA   . GLY A 1 1  ? -2.701  3.721   7.434   1.00 0.00 ? 1  GLY A CA   13 
ATOM 9387  C C    . GLY A 1 1  ? -1.226  3.334   7.314   1.00 0.00 ? 1  GLY A C    13 
ATOM 9388  O O    . GLY A 1 1  ? -0.409  3.704   8.134   1.00 0.00 ? 1  GLY A O    13 
ATOM 9389  H H1   . GLY A 1 1  ? -2.432  3.830   9.497   1.00 0.00 ? 1  GLY A H1   13 
ATOM 9390  H H2   . GLY A 1 1  ? -2.608  5.341   8.742   1.00 0.00 ? 1  GLY A H2   13 
ATOM 9391  H H3   . GLY A 1 1  ? -3.961  4.341   8.973   1.00 0.00 ? 1  GLY A H3   13 
ATOM 9392  H HA2  . GLY A 1 1  ? -3.315  2.836   7.342   1.00 0.00 ? 1  GLY A HA2  13 
ATOM 9393  H HA3  . GLY A 1 1  ? -2.953  4.417   6.651   1.00 0.00 ? 1  GLY A HA3  13 
ATOM 9394  N N    . ILE A 1 2  ? -0.877  2.596   6.297   1.00 0.00 ? 2  ILE A N    13 
ATOM 9395  C CA   . ILE A 1 2  ? 0.547   2.189   6.124   1.00 0.00 ? 2  ILE A CA   13 
ATOM 9396  C C    . ILE A 1 2  ? 1.273   3.240   5.275   1.00 0.00 ? 2  ILE A C    13 
ATOM 9397  O O    . ILE A 1 2  ? 2.481   3.221   5.143   1.00 0.00 ? 2  ILE A O    13 
ATOM 9398  C CB   . ILE A 1 2  ? 0.617   0.787   5.468   1.00 0.00 ? 2  ILE A CB   13 
ATOM 9399  C CG1  . ILE A 1 2  ? 0.811   0.886   3.944   1.00 0.00 ? 2  ILE A CG1  13 
ATOM 9400  C CG2  . ILE A 1 2  ? -0.678  0.019   5.751   1.00 0.00 ? 2  ILE A CG2  13 
ATOM 9401  C CD1  . ILE A 1 2  ? -0.496  1.328   3.280   1.00 0.00 ? 2  ILE A CD1  13 
ATOM 9402  H H    . ILE A 1 2  ? -1.551  2.311   5.645   1.00 0.00 ? 2  ILE A H    13 
ATOM 9403  H HA   . ILE A 1 2  ? 1.018   2.144   7.098   1.00 0.00 ? 2  ILE A HA   13 
ATOM 9404  H HB   . ILE A 1 2  ? 1.448   0.242   5.897   1.00 0.00 ? 2  ILE A HB   13 
ATOM 9405  H HG12 . ILE A 1 2  ? 1.589   1.597   3.719   1.00 0.00 ? 2  ILE A HG12 13 
ATOM 9406  H HG13 . ILE A 1 2  ? 1.094   -0.081  3.559   1.00 0.00 ? 2  ILE A HG13 13 
ATOM 9407  H HG21 . ILE A 1 2  ? -0.855  -0.007  6.816   1.00 0.00 ? 2  ILE A HG21 13 
ATOM 9408  H HG22 . ILE A 1 2  ? -1.502  0.510   5.261   1.00 0.00 ? 2  ILE A HG22 13 
ATOM 9409  H HG23 . ILE A 1 2  ? -0.591  -0.990  5.376   1.00 0.00 ? 2  ILE A HG23 13 
ATOM 9410  H HD11 . ILE A 1 2  ? -0.869  2.215   3.770   1.00 0.00 ? 2  ILE A HD11 13 
ATOM 9411  H HD12 . ILE A 1 2  ? -0.316  1.542   2.238   1.00 0.00 ? 2  ILE A HD12 13 
ATOM 9412  H HD13 . ILE A 1 2  ? -1.230  0.536   3.361   1.00 0.00 ? 2  ILE A HD13 13 
ATOM 9413  N N    . VAL A 1 3  ? 0.541   4.154   4.699   1.00 0.00 ? 3  VAL A N    13 
ATOM 9414  C CA   . VAL A 1 3  ? 1.181   5.208   3.857   1.00 0.00 ? 3  VAL A CA   13 
ATOM 9415  C C    . VAL A 1 3  ? 2.296   5.889   4.648   1.00 0.00 ? 3  VAL A C    13 
ATOM 9416  O O    . VAL A 1 3  ? 3.317   6.258   4.101   1.00 0.00 ? 3  VAL A O    13 
ATOM 9417  C CB   . VAL A 1 3  ? 0.132   6.241   3.457   1.00 0.00 ? 3  VAL A CB   13 
ATOM 9418  C CG1  . VAL A 1 3  ? 0.748   7.242   2.476   1.00 0.00 ? 3  VAL A CG1  13 
ATOM 9419  C CG2  . VAL A 1 3  ? -1.045  5.529   2.788   1.00 0.00 ? 3  VAL A CG2  13 
ATOM 9420  H H    . VAL A 1 3  ? -0.431  4.151   4.818   1.00 0.00 ? 3  VAL A H    13 
ATOM 9421  H HA   . VAL A 1 3  ? 1.595   4.754   2.969   1.00 0.00 ? 3  VAL A HA   13 
ATOM 9422  H HB   . VAL A 1 3  ? -0.213  6.766   4.337   1.00 0.00 ? 3  VAL A HB   13 
ATOM 9423  H HG11 . VAL A 1 3  ? 1.818   7.098   2.441   1.00 0.00 ? 3  VAL A HG11 13 
ATOM 9424  H HG12 . VAL A 1 3  ? 0.332   7.084   1.492   1.00 0.00 ? 3  VAL A HG12 13 
ATOM 9425  H HG13 . VAL A 1 3  ? 0.531   8.248   2.801   1.00 0.00 ? 3  VAL A HG13 13 
ATOM 9426  H HG21 . VAL A 1 3  ? -0.687  4.648   2.275   1.00 0.00 ? 3  VAL A HG21 13 
ATOM 9427  H HG22 . VAL A 1 3  ? -1.766  5.241   3.539   1.00 0.00 ? 3  VAL A HG22 13 
ATOM 9428  H HG23 . VAL A 1 3  ? -1.511  6.195   2.076   1.00 0.00 ? 3  VAL A HG23 13 
ATOM 9429  N N    . GLU A 1 4  ? 2.117   6.052   5.929   1.00 0.00 ? 4  GLU A N    13 
ATOM 9430  C CA   . GLU A 1 4  ? 3.178   6.700   6.750   1.00 0.00 ? 4  GLU A CA   13 
ATOM 9431  C C    . GLU A 1 4  ? 4.184   5.634   7.186   1.00 0.00 ? 4  GLU A C    13 
ATOM 9432  O O    . GLU A 1 4  ? 4.582   5.568   8.332   1.00 0.00 ? 4  GLU A O    13 
ATOM 9433  C CB   . GLU A 1 4  ? 2.551   7.355   7.984   1.00 0.00 ? 4  GLU A CB   13 
ATOM 9434  C CG   . GLU A 1 4  ? 3.301   8.647   8.309   1.00 0.00 ? 4  GLU A CG   13 
ATOM 9435  C CD   . GLU A 1 4  ? 3.833   8.584   9.742   1.00 0.00 ? 4  GLU A CD   13 
ATOM 9436  O OE1  . GLU A 1 4  ? 4.168   7.496   10.182  1.00 0.00 ? 4  GLU A OE1  13 
ATOM 9437  O OE2  . GLU A 1 4  ? 3.894   9.625   10.376  1.00 0.00 ? 4  GLU A OE2  13 
ATOM 9438  H H    . GLU A 1 4  ? 1.290   5.741   6.353   1.00 0.00 ? 4  GLU A H    13 
ATOM 9439  H HA   . GLU A 1 4  ? 3.682   7.450   6.158   1.00 0.00 ? 4  GLU A HA   13 
ATOM 9440  H HB2  . GLU A 1 4  ? 1.513   7.578   7.782   1.00 0.00 ? 4  GLU A HB2  13 
ATOM 9441  H HB3  . GLU A 1 4  ? 2.618   6.679   8.824   1.00 0.00 ? 4  GLU A HB3  13 
ATOM 9442  H HG2  . GLU A 1 4  ? 4.128   8.767   7.624   1.00 0.00 ? 4  GLU A HG2  13 
ATOM 9443  H HG3  . GLU A 1 4  ? 2.629   9.487   8.215   1.00 0.00 ? 4  GLU A HG3  13 
ATOM 9444  N N    . GLN A 1 5  ? 4.593   4.795   6.274   1.00 0.00 ? 5  GLN A N    13 
ATOM 9445  C CA   . GLN A 1 5  ? 5.566   3.725   6.612   1.00 0.00 ? 5  GLN A CA   13 
ATOM 9446  C C    . GLN A 1 5  ? 6.205   3.215   5.320   1.00 0.00 ? 5  GLN A C    13 
ATOM 9447  O O    . GLN A 1 5  ? 7.390   2.949   5.260   1.00 0.00 ? 5  GLN A O    13 
ATOM 9448  C CB   . GLN A 1 5  ? 4.836   2.573   7.308   1.00 0.00 ? 5  GLN A CB   13 
ATOM 9449  C CG   . GLN A 1 5  ? 5.833   1.753   8.125   1.00 0.00 ? 5  GLN A CG   13 
ATOM 9450  C CD   . GLN A 1 5  ? 5.610   2.020   9.615   1.00 0.00 ? 5  GLN A CD   13 
ATOM 9451  O OE1  . GLN A 1 5  ? 6.520   2.419   10.316  1.00 0.00 ? 5  GLN A OE1  13 
ATOM 9452  N NE2  . GLN A 1 5  ? 4.431   1.814   10.132  1.00 0.00 ? 5  GLN A NE2  13 
ATOM 9453  H H    . GLN A 1 5  ? 4.254   4.870   5.359   1.00 0.00 ? 5  GLN A H    13 
ATOM 9454  H HA   . GLN A 1 5  ? 6.331   4.119   7.266   1.00 0.00 ? 5  GLN A HA   13 
ATOM 9455  H HB2  . GLN A 1 5  ? 4.074   2.975   7.962   1.00 0.00 ? 5  GLN A HB2  13 
ATOM 9456  H HB3  . GLN A 1 5  ? 4.373   1.940   6.566   1.00 0.00 ? 5  GLN A HB3  13 
ATOM 9457  H HG2  . GLN A 1 5  ? 5.690   0.703   7.921   1.00 0.00 ? 5  GLN A HG2  13 
ATOM 9458  H HG3  . GLN A 1 5  ? 6.840   2.039   7.857   1.00 0.00 ? 5  GLN A HG3  13 
ATOM 9459  H HE21 . GLN A 1 5  ? 3.698   1.491   9.566   1.00 0.00 ? 5  GLN A HE21 13 
ATOM 9460  H HE22 . GLN A 1 5  ? 4.278   1.980   11.084  1.00 0.00 ? 5  GLN A HE22 13 
ATOM 9461  N N    . CYS A 1 6  ? 5.424   3.083   4.282   1.00 0.00 ? 6  CYS A N    13 
ATOM 9462  C CA   . CYS A 1 6  ? 5.974   2.596   2.988   1.00 0.00 ? 6  CYS A CA   13 
ATOM 9463  C C    . CYS A 1 6  ? 6.432   3.789   2.145   1.00 0.00 ? 6  CYS A C    13 
ATOM 9464  O O    . CYS A 1 6  ? 7.521   3.798   1.608   1.00 0.00 ? 6  CYS A O    13 
ATOM 9465  C CB   . CYS A 1 6  ? 4.893   1.822   2.234   1.00 0.00 ? 6  CYS A CB   13 
ATOM 9466  S SG   . CYS A 1 6  ? 5.462   0.130   1.940   1.00 0.00 ? 6  CYS A SG   13 
ATOM 9467  H H    . CYS A 1 6  ? 4.473   3.308   4.355   1.00 0.00 ? 6  CYS A H    13 
ATOM 9468  H HA   . CYS A 1 6  ? 6.812   1.946   3.175   1.00 0.00 ? 6  CYS A HA   13 
ATOM 9469  H HB2  . CYS A 1 6  ? 3.988   1.800   2.824   1.00 0.00 ? 6  CYS A HB2  13 
ATOM 9470  H HB3  . CYS A 1 6  ? 4.696   2.305   1.291   1.00 0.00 ? 6  CYS A HB3  13 
ATOM 9471  N N    . CYS A 1 7  ? 5.608   4.794   2.022   1.00 0.00 ? 7  CYS A N    13 
ATOM 9472  C CA   . CYS A 1 7  ? 6.000   5.982   1.213   1.00 0.00 ? 7  CYS A CA   13 
ATOM 9473  C C    . CYS A 1 7  ? 7.157   6.710   1.903   1.00 0.00 ? 7  CYS A C    13 
ATOM 9474  O O    . CYS A 1 7  ? 8.236   6.836   1.359   1.00 0.00 ? 7  CYS A O    13 
ATOM 9475  C CB   . CYS A 1 7  ? 4.804   6.930   1.083   1.00 0.00 ? 7  CYS A CB   13 
ATOM 9476  S SG   . CYS A 1 7  ? 5.344   8.480   0.323   1.00 0.00 ? 7  CYS A SG   13 
ATOM 9477  H H    . CYS A 1 7  ? 4.734   4.767   2.464   1.00 0.00 ? 7  CYS A H    13 
ATOM 9478  H HA   . CYS A 1 7  ? 6.312   5.661   0.231   1.00 0.00 ? 7  CYS A HA   13 
ATOM 9479  H HB2  . CYS A 1 7  ? 4.047   6.470   0.464   1.00 0.00 ? 7  CYS A HB2  13 
ATOM 9480  H HB3  . CYS A 1 7  ? 4.397   7.132   2.062   1.00 0.00 ? 7  CYS A HB3  13 
ATOM 9481  N N    . THR A 1 8  ? 6.940   7.190   3.097   1.00 0.00 ? 8  THR A N    13 
ATOM 9482  C CA   . THR A 1 8  ? 8.029   7.905   3.819   1.00 0.00 ? 8  THR A CA   13 
ATOM 9483  C C    . THR A 1 8  ? 9.292   7.046   3.806   1.00 0.00 ? 8  THR A C    13 
ATOM 9484  O O    . THR A 1 8  ? 10.302  7.416   3.238   1.00 0.00 ? 8  THR A O    13 
ATOM 9485  C CB   . THR A 1 8  ? 7.601   8.163   5.266   1.00 0.00 ? 8  THR A CB   13 
ATOM 9486  O OG1  . THR A 1 8  ? 6.982   6.994   5.787   1.00 0.00 ? 8  THR A OG1  13 
ATOM 9487  C CG2  . THR A 1 8  ? 6.610   9.327   5.309   1.00 0.00 ? 8  THR A CG2  13 
ATOM 9488  H H    . THR A 1 8  ? 6.063   7.078   3.520   1.00 0.00 ? 8  THR A H    13 
ATOM 9489  H HA   . THR A 1 8  ? 8.226   8.849   3.329   1.00 0.00 ? 8  THR A HA   13 
ATOM 9490  H HB   . THR A 1 8  ? 8.465   8.409   5.860   1.00 0.00 ? 8  THR A HB   13 
ATOM 9491  H HG1  . THR A 1 8  ? 6.107   6.921   5.399   1.00 0.00 ? 8  THR A HG1  13 
ATOM 9492  H HG21 . THR A 1 8  ? 6.398   9.656   4.303   1.00 0.00 ? 8  THR A HG21 13 
ATOM 9493  H HG22 . THR A 1 8  ? 5.694   9.004   5.781   1.00 0.00 ? 8  THR A HG22 13 
ATOM 9494  H HG23 . THR A 1 8  ? 7.039   10.142  5.873   1.00 0.00 ? 8  THR A HG23 13 
ATOM 9495  N N    . SER A 1 9  ? 9.246   5.898   4.425   1.00 0.00 ? 9  SER A N    13 
ATOM 9496  C CA   . SER A 1 9  ? 10.443  5.013   4.443   1.00 0.00 ? 9  SER A CA   13 
ATOM 9497  C C    . SER A 1 9  ? 10.116  3.702   3.717   1.00 0.00 ? 9  SER A C    13 
ATOM 9498  O O    . SER A 1 9  ? 10.172  3.629   2.505   1.00 0.00 ? 9  SER A O    13 
ATOM 9499  C CB   . SER A 1 9  ? 10.838  4.718   5.893   1.00 0.00 ? 9  SER A CB   13 
ATOM 9500  O OG   . SER A 1 9  ? 9.664   4.629   6.690   1.00 0.00 ? 9  SER A OG   13 
ATOM 9501  H H    . SER A 1 9  ? 8.422   5.618   4.873   1.00 0.00 ? 9  SER A H    13 
ATOM 9502  H HA   . SER A 1 9  ? 11.263  5.507   3.942   1.00 0.00 ? 9  SER A HA   13 
ATOM 9503  H HB2  . SER A 1 9  ? 11.371  3.783   5.940   1.00 0.00 ? 9  SER A HB2  13 
ATOM 9504  H HB3  . SER A 1 9  ? 11.476  5.513   6.259   1.00 0.00 ? 9  SER A HB3  13 
ATOM 9505  H HG   . SER A 1 9  ? 9.740   5.271   7.400   1.00 0.00 ? 9  SER A HG   13 
ATOM 9506  N N    . ILE A 1 10 ? 9.773   2.671   4.442   1.00 0.00 ? 10 ILE A N    13 
ATOM 9507  C CA   . ILE A 1 10 ? 9.441   1.376   3.780   1.00 0.00 ? 10 ILE A CA   13 
ATOM 9508  C C    . ILE A 1 10 ? 8.527   0.558   4.693   1.00 0.00 ? 10 ILE A C    13 
ATOM 9509  O O    . ILE A 1 10 ? 8.602   0.649   5.903   1.00 0.00 ? 10 ILE A O    13 
ATOM 9510  C CB   . ILE A 1 10 ? 10.729  0.596   3.509   1.00 0.00 ? 10 ILE A CB   13 
ATOM 9511  C CG1  . ILE A 1 10 ? 11.624  1.405   2.569   1.00 0.00 ? 10 ILE A CG1  13 
ATOM 9512  C CG2  . ILE A 1 10 ? 10.386  -0.744  2.858   1.00 0.00 ? 10 ILE A CG2  13 
ATOM 9513  C CD1  . ILE A 1 10 ? 12.878  0.598   2.233   1.00 0.00 ? 10 ILE A CD1  13 
ATOM 9514  H H    . ILE A 1 10 ? 9.730   2.745   5.417   1.00 0.00 ? 10 ILE A H    13 
ATOM 9515  H HA   . ILE A 1 10 ? 8.936   1.571   2.845   1.00 0.00 ? 10 ILE A HA   13 
ATOM 9516  H HB   . ILE A 1 10 ? 11.247  0.421   4.442   1.00 0.00 ? 10 ILE A HB   13 
ATOM 9517  H HG12 . ILE A 1 10 ? 11.084  1.628   1.660   1.00 0.00 ? 10 ILE A HG12 13 
ATOM 9518  H HG13 . ILE A 1 10 ? 11.912  2.328   3.051   1.00 0.00 ? 10 ILE A HG13 13 
ATOM 9519  H HG21 . ILE A 1 10 ? 9.466   -0.649  2.300   1.00 0.00 ? 10 ILE A HG21 13 
ATOM 9520  H HG22 . ILE A 1 10 ? 11.183  -1.035  2.190   1.00 0.00 ? 10 ILE A HG22 13 
ATOM 9521  H HG23 . ILE A 1 10 ? 10.266  -1.497  3.624   1.00 0.00 ? 10 ILE A HG23 13 
ATOM 9522  H HD11 . ILE A 1 10 ? 12.775  -0.405  2.621   1.00 0.00 ? 10 ILE A HD11 13 
ATOM 9523  H HD12 . ILE A 1 10 ? 13.004  0.557   1.160   1.00 0.00 ? 10 ILE A HD12 13 
ATOM 9524  H HD13 . ILE A 1 10 ? 13.742  1.070   2.679   1.00 0.00 ? 10 ILE A HD13 13 
ATOM 9525  N N    . CYS A 1 11 ? 7.664   -0.242  4.128   1.00 0.00 ? 11 CYS A N    13 
ATOM 9526  C CA   . CYS A 1 11 ? 6.751   -1.064  4.972   1.00 0.00 ? 11 CYS A CA   13 
ATOM 9527  C C    . CYS A 1 11 ? 6.757   -2.512  4.472   1.00 0.00 ? 11 CYS A C    13 
ATOM 9528  O O    . CYS A 1 11 ? 7.630   -2.921  3.735   1.00 0.00 ? 11 CYS A O    13 
ATOM 9529  C CB   . CYS A 1 11 ? 5.330   -0.487  4.905   1.00 0.00 ? 11 CYS A CB   13 
ATOM 9530  S SG   . CYS A 1 11 ? 4.522   -0.965  3.353   1.00 0.00 ? 11 CYS A SG   13 
ATOM 9531  H H    . CYS A 1 11 ? 7.620   -0.304  3.151   1.00 0.00 ? 11 CYS A H    13 
ATOM 9532  H HA   . CYS A 1 11 ? 7.098   -1.041  5.995   1.00 0.00 ? 11 CYS A HA   13 
ATOM 9533  H HB2  . CYS A 1 11 ? 4.752   -0.863  5.737   1.00 0.00 ? 11 CYS A HB2  13 
ATOM 9534  H HB3  . CYS A 1 11 ? 5.379   0.592   4.966   1.00 0.00 ? 11 CYS A HB3  13 
ATOM 9535  N N    . SER A 1 12 ? 5.784   -3.289  4.866   1.00 0.00 ? 12 SER A N    13 
ATOM 9536  C CA   . SER A 1 12 ? 5.731   -4.708  4.412   1.00 0.00 ? 12 SER A CA   13 
ATOM 9537  C C    . SER A 1 12 ? 4.366   -4.984  3.784   1.00 0.00 ? 12 SER A C    13 
ATOM 9538  O O    . SER A 1 12 ? 3.426   -4.240  3.974   1.00 0.00 ? 12 SER A O    13 
ATOM 9539  C CB   . SER A 1 12 ? 5.941   -5.636  5.609   1.00 0.00 ? 12 SER A CB   13 
ATOM 9540  O OG   . SER A 1 12 ? 5.116   -5.208  6.684   1.00 0.00 ? 12 SER A OG   13 
ATOM 9541  H H    . SER A 1 12 ? 5.088   -2.938  5.461   1.00 0.00 ? 12 SER A H    13 
ATOM 9542  H HA   . SER A 1 12 ? 6.507   -4.880  3.680   1.00 0.00 ? 12 SER A HA   13 
ATOM 9543  H HB2  . SER A 1 12 ? 5.675   -6.643  5.336   1.00 0.00 ? 12 SER A HB2  13 
ATOM 9544  H HB3  . SER A 1 12 ? 6.981   -5.608  5.906   1.00 0.00 ? 12 SER A HB3  13 
ATOM 9545  H HG   . SER A 1 12 ? 5.296   -5.773  7.440   1.00 0.00 ? 12 SER A HG   13 
ATOM 9546  N N    . LEU A 1 13 ? 4.245   -6.046  3.035   1.00 0.00 ? 13 LEU A N    13 
ATOM 9547  C CA   . LEU A 1 13 ? 2.934   -6.360  2.401   1.00 0.00 ? 13 LEU A CA   13 
ATOM 9548  C C    . LEU A 1 13 ? 1.893   -6.614  3.494   1.00 0.00 ? 13 LEU A C    13 
ATOM 9549  O O    . LEU A 1 13 ? 0.725   -6.321  3.331   1.00 0.00 ? 13 LEU A O    13 
ATOM 9550  C CB   . LEU A 1 13 ? 3.071   -7.605  1.523   1.00 0.00 ? 13 LEU A CB   13 
ATOM 9551  C CG   . LEU A 1 13 ? 2.908   -7.212  0.054   1.00 0.00 ? 13 LEU A CG   13 
ATOM 9552  C CD1  . LEU A 1 13 ? 2.856   -8.471  -0.811  1.00 0.00 ? 13 LEU A CD1  13 
ATOM 9553  C CD2  . LEU A 1 13 ? 1.609   -6.423  -0.120  1.00 0.00 ? 13 LEU A CD2  13 
ATOM 9554  H H    . LEU A 1 13 ? 5.015   -6.634  2.890   1.00 0.00 ? 13 LEU A H    13 
ATOM 9555  H HA   . LEU A 1 13 ? 2.620   -5.524  1.794   1.00 0.00 ? 13 LEU A HA   13 
ATOM 9556  H HB2  . LEU A 1 13 ? 4.046   -8.047  1.674   1.00 0.00 ? 13 LEU A HB2  13 
ATOM 9557  H HB3  . LEU A 1 13 ? 2.306   -8.319  1.789   1.00 0.00 ? 13 LEU A HB3  13 
ATOM 9558  H HG   . LEU A 1 13 ? 3.748   -6.600  -0.251  1.00 0.00 ? 13 LEU A HG   13 
ATOM 9559  H HD11 . LEU A 1 13 ? 2.498   -9.301  -0.220  1.00 0.00 ? 13 LEU A HD11 13 
ATOM 9560  H HD12 . LEU A 1 13 ? 2.189   -8.310  -1.644  1.00 0.00 ? 13 LEU A HD12 13 
ATOM 9561  H HD13 . LEU A 1 13 ? 3.846   -8.695  -1.182  1.00 0.00 ? 13 LEU A HD13 13 
ATOM 9562  H HD21 . LEU A 1 13 ? 0.849   -6.834  0.526   1.00 0.00 ? 13 LEU A HD21 13 
ATOM 9563  H HD22 . LEU A 1 13 ? 1.780   -5.388  0.134   1.00 0.00 ? 13 LEU A HD22 13 
ATOM 9564  H HD23 . LEU A 1 13 ? 1.282   -6.491  -1.148  1.00 0.00 ? 13 LEU A HD23 13 
ATOM 9565  N N    . TYR A 1 14 ? 2.308   -7.148  4.611   1.00 0.00 ? 14 TYR A N    13 
ATOM 9566  C CA   . TYR A 1 14 ? 1.341   -7.411  5.712   1.00 0.00 ? 14 TYR A CA   13 
ATOM 9567  C C    . TYR A 1 14 ? 0.609   -6.110  6.052   1.00 0.00 ? 14 TYR A C    13 
ATOM 9568  O O    . TYR A 1 14 ? -0.498  -6.120  6.550   1.00 0.00 ? 14 TYR A O    13 
ATOM 9569  C CB   . TYR A 1 14 ? 2.101   -7.917  6.946   1.00 0.00 ? 14 TYR A CB   13 
ATOM 9570  C CG   . TYR A 1 14 ? 1.218   -7.813  8.167   1.00 0.00 ? 14 TYR A CG   13 
ATOM 9571  C CD1  . TYR A 1 14 ? -0.108  -8.260  8.115   1.00 0.00 ? 14 TYR A CD1  13 
ATOM 9572  C CD2  . TYR A 1 14 ? 1.726   -7.264  9.352   1.00 0.00 ? 14 TYR A CD2  13 
ATOM 9573  C CE1  . TYR A 1 14 ? -0.925  -8.160  9.247   1.00 0.00 ? 14 TYR A CE1  13 
ATOM 9574  C CE2  . TYR A 1 14 ? 0.907   -7.166  10.484  1.00 0.00 ? 14 TYR A CE2  13 
ATOM 9575  C CZ   . TYR A 1 14 ? -0.418  -7.613  10.431  1.00 0.00 ? 14 TYR A CZ   13 
ATOM 9576  O OH   . TYR A 1 14 ? -1.225  -7.515  11.546  1.00 0.00 ? 14 TYR A OH   13 
ATOM 9577  H H    . TYR A 1 14 ? 3.256   -7.371  4.725   1.00 0.00 ? 14 TYR A H    13 
ATOM 9578  H HA   . TYR A 1 14 ? 0.627   -8.155  5.396   1.00 0.00 ? 14 TYR A HA   13 
ATOM 9579  H HB2  . TYR A 1 14 ? 2.383   -8.949  6.793   1.00 0.00 ? 14 TYR A HB2  13 
ATOM 9580  H HB3  . TYR A 1 14 ? 2.988   -7.319  7.092   1.00 0.00 ? 14 TYR A HB3  13 
ATOM 9581  H HD1  . TYR A 1 14 ? -0.500  -8.682  7.201   1.00 0.00 ? 14 TYR A HD1  13 
ATOM 9582  H HD2  . TYR A 1 14 ? 2.747   -6.921  9.394   1.00 0.00 ? 14 TYR A HD2  13 
ATOM 9583  H HE1  . TYR A 1 14 ? -1.948  -8.504  9.205   1.00 0.00 ? 14 TYR A HE1  13 
ATOM 9584  H HE2  . TYR A 1 14 ? 1.299   -6.745  11.398  1.00 0.00 ? 14 TYR A HE2  13 
ATOM 9585  H HH   . TYR A 1 14 ? -1.985  -8.087  11.414  1.00 0.00 ? 14 TYR A HH   13 
ATOM 9586  N N    . GLN A 1 15 ? 1.223   -4.991  5.786   1.00 0.00 ? 15 GLN A N    13 
ATOM 9587  C CA   . GLN A 1 15 ? 0.569   -3.690  6.091   1.00 0.00 ? 15 GLN A CA   13 
ATOM 9588  C C    . GLN A 1 15 ? -0.591  -3.460  5.119   1.00 0.00 ? 15 GLN A C    13 
ATOM 9589  O O    . GLN A 1 15 ? -1.659  -3.031  5.505   1.00 0.00 ? 15 GLN A O    13 
ATOM 9590  C CB   . GLN A 1 15 ? 1.593   -2.563  5.949   1.00 0.00 ? 15 GLN A CB   13 
ATOM 9591  C CG   . GLN A 1 15 ? 2.345   -2.389  7.269   1.00 0.00 ? 15 GLN A CG   13 
ATOM 9592  C CD   . GLN A 1 15 ? 1.875   -1.108  7.958   1.00 0.00 ? 15 GLN A CD   13 
ATOM 9593  O OE1  . GLN A 1 15 ? 0.771   -1.044  8.462   1.00 0.00 ? 15 GLN A OE1  13 
ATOM 9594  N NE2  . GLN A 1 15 ? 2.673   -0.074  8.003   1.00 0.00 ? 15 GLN A NE2  13 
ATOM 9595  H H    . GLN A 1 15 ? 2.116   -5.009  5.386   1.00 0.00 ? 15 GLN A H    13 
ATOM 9596  H HA   . GLN A 1 15 ? 0.194   -3.703  7.101   1.00 0.00 ? 15 GLN A HA   13 
ATOM 9597  H HB2  . GLN A 1 15 ? 2.292   -2.810  5.164   1.00 0.00 ? 15 GLN A HB2  13 
ATOM 9598  H HB3  . GLN A 1 15 ? 1.086   -1.648  5.704   1.00 0.00 ? 15 GLN A HB3  13 
ATOM 9599  H HG2  . GLN A 1 15 ? 2.149   -3.237  7.909   1.00 0.00 ? 15 GLN A HG2  13 
ATOM 9600  H HG3  . GLN A 1 15 ? 3.404   -2.323  7.073   1.00 0.00 ? 15 GLN A HG3  13 
ATOM 9601  H HE21 . GLN A 1 15 ? 3.562   -0.125  7.595   1.00 0.00 ? 15 GLN A HE21 13 
ATOM 9602  H HE22 . GLN A 1 15 ? 2.380   0.751   8.441   1.00 0.00 ? 15 GLN A HE22 13 
ATOM 9603  N N    . LEU A 1 16 ? -0.390  -3.740  3.859   1.00 0.00 ? 16 LEU A N    13 
ATOM 9604  C CA   . LEU A 1 16 ? -1.479  -3.541  2.864   1.00 0.00 ? 16 LEU A CA   13 
ATOM 9605  C C    . LEU A 1 16 ? -2.623  -4.513  3.154   1.00 0.00 ? 16 LEU A C    13 
ATOM 9606  O O    . LEU A 1 16 ? -3.730  -4.338  2.686   1.00 0.00 ? 16 LEU A O    13 
ATOM 9607  C CB   . LEU A 1 16 ? -0.940  -3.796  1.452   1.00 0.00 ? 16 LEU A CB   13 
ATOM 9608  C CG   . LEU A 1 16 ? 0.389   -3.050  1.222   1.00 0.00 ? 16 LEU A CG   13 
ATOM 9609  C CD1  . LEU A 1 16 ? 0.437   -2.553  -0.220  1.00 0.00 ? 16 LEU A CD1  13 
ATOM 9610  C CD2  . LEU A 1 16 ? 0.510   -1.843  2.162   1.00 0.00 ? 16 LEU A CD2  13 
ATOM 9611  H H    . LEU A 1 16 ? 0.478   -4.083  3.568   1.00 0.00 ? 16 LEU A H    13 
ATOM 9612  H HA   . LEU A 1 16 ? -1.846  -2.526  2.931   1.00 0.00 ? 16 LEU A HA   13 
ATOM 9613  H HB2  . LEU A 1 16 ? -0.778  -4.856  1.321   1.00 0.00 ? 16 LEU A HB2  13 
ATOM 9614  H HB3  . LEU A 1 16 ? -1.666  -3.458  0.727   1.00 0.00 ? 16 LEU A HB3  13 
ATOM 9615  H HG   . LEU A 1 16 ? 1.212   -3.729  1.394   1.00 0.00 ? 16 LEU A HG   13 
ATOM 9616  H HD11 . LEU A 1 16 ? -0.262  -3.118  -0.819  1.00 0.00 ? 16 LEU A HD11 13 
ATOM 9617  H HD12 . LEU A 1 16 ? 0.166   -1.506  -0.245  1.00 0.00 ? 16 LEU A HD12 13 
ATOM 9618  H HD13 . LEU A 1 16 ? 1.434   -2.678  -0.612  1.00 0.00 ? 16 LEU A HD13 13 
ATOM 9619  H HD21 . LEU A 1 16 ? -0.469  -1.422  2.337   1.00 0.00 ? 16 LEU A HD21 13 
ATOM 9620  H HD22 . LEU A 1 16 ? 0.938   -2.160  3.101   1.00 0.00 ? 16 LEU A HD22 13 
ATOM 9621  H HD23 . LEU A 1 16 ? 1.148   -1.099  1.710   1.00 0.00 ? 16 LEU A HD23 13 
ATOM 9622  N N    . GLU A 1 17 ? -2.368  -5.535  3.921   1.00 0.00 ? 17 GLU A N    13 
ATOM 9623  C CA   . GLU A 1 17 ? -3.449  -6.504  4.238   1.00 0.00 ? 17 GLU A CA   13 
ATOM 9624  C C    . GLU A 1 17 ? -4.552  -5.778  5.009   1.00 0.00 ? 17 GLU A C    13 
ATOM 9625  O O    . GLU A 1 17 ? -5.683  -6.216  5.060   1.00 0.00 ? 17 GLU A O    13 
ATOM 9626  C CB   . GLU A 1 17 ? -2.883  -7.642  5.089   1.00 0.00 ? 17 GLU A CB   13 
ATOM 9627  C CG   . GLU A 1 17 ? -2.037  -8.561  4.207   1.00 0.00 ? 17 GLU A CG   13 
ATOM 9628  C CD   . GLU A 1 17 ? -2.227  -10.014 4.650   1.00 0.00 ? 17 GLU A CD   13 
ATOM 9629  O OE1  . GLU A 1 17 ? -3.293  -10.323 5.155   1.00 0.00 ? 17 GLU A OE1  13 
ATOM 9630  O OE2  . GLU A 1 17 ? -1.303  -10.792 4.473   1.00 0.00 ? 17 GLU A OE2  13 
ATOM 9631  H H    . GLU A 1 17 ? -1.469  -5.660  4.292   1.00 0.00 ? 17 GLU A H    13 
ATOM 9632  H HA   . GLU A 1 17 ? -3.853  -6.906  3.321   1.00 0.00 ? 17 GLU A HA   13 
ATOM 9633  H HB2  . GLU A 1 17 ? -2.267  -7.230  5.877   1.00 0.00 ? 17 GLU A HB2  13 
ATOM 9634  H HB3  . GLU A 1 17 ? -3.694  -8.207  5.522   1.00 0.00 ? 17 GLU A HB3  13 
ATOM 9635  H HG2  . GLU A 1 17 ? -2.345  -8.454  3.176   1.00 0.00 ? 17 GLU A HG2  13 
ATOM 9636  H HG3  . GLU A 1 17 ? -0.997  -8.293  4.300   1.00 0.00 ? 17 GLU A HG3  13 
ATOM 9637  N N    . ASN A 1 18 ? -4.223  -4.661  5.598   1.00 0.00 ? 18 ASN A N    13 
ATOM 9638  C CA   . ASN A 1 18 ? -5.243  -3.884  6.360   1.00 0.00 ? 18 ASN A CA   13 
ATOM 9639  C C    . ASN A 1 18 ? -6.149  -3.152  5.374   1.00 0.00 ? 18 ASN A C    13 
ATOM 9640  O O    . ASN A 1 18 ? -7.299  -2.874  5.653   1.00 0.00 ? 18 ASN A O    13 
ATOM 9641  C CB   . ASN A 1 18 ? -4.538  -2.862  7.255   1.00 0.00 ? 18 ASN A CB   13 
ATOM 9642  C CG   . ASN A 1 18 ? -3.556  -3.583  8.178   1.00 0.00 ? 18 ASN A CG   13 
ATOM 9643  O OD1  . ASN A 1 18 ? -3.384  -4.783  8.082   1.00 0.00 ? 18 ASN A OD1  13 
ATOM 9644  N ND2  . ASN A 1 18 ? -2.898  -2.899  9.074   1.00 0.00 ? 18 ASN A ND2  13 
ATOM 9645  H H    . ASN A 1 18 ? -3.307  -4.327  5.535   1.00 0.00 ? 18 ASN A H    13 
ATOM 9646  H HA   . ASN A 1 18 ? -5.832  -4.555  6.968   1.00 0.00 ? 18 ASN A HA   13 
ATOM 9647  H HB2  . ASN A 1 18 ? -4.000  -2.152  6.637   1.00 0.00 ? 18 ASN A HB2  13 
ATOM 9648  H HB3  . ASN A 1 18 ? -5.271  -2.337  7.850   1.00 0.00 ? 18 ASN A HB3  13 
ATOM 9649  H HD21 . ASN A 1 18 ? -3.037  -1.933  9.151   1.00 0.00 ? 18 ASN A HD21 13 
ATOM 9650  H HD22 . ASN A 1 18 ? -2.268  -3.354  9.670   1.00 0.00 ? 18 ASN A HD22 13 
ATOM 9651  N N    . TYR A 1 19 ? -5.633  -2.834  4.220   1.00 0.00 ? 19 TYR A N    13 
ATOM 9652  C CA   . TYR A 1 19 ? -6.450  -2.116  3.205   1.00 0.00 ? 19 TYR A CA   13 
ATOM 9653  C C    . TYR A 1 19 ? -7.365  -3.108  2.484   1.00 0.00 ? 19 TYR A C    13 
ATOM 9654  O O    . TYR A 1 19 ? -8.106  -2.746  1.592   1.00 0.00 ? 19 TYR A O    13 
ATOM 9655  C CB   . TYR A 1 19 ? -5.514  -1.442  2.198   1.00 0.00 ? 19 TYR A CB   13 
ATOM 9656  C CG   . TYR A 1 19 ? -5.130  -0.083  2.714   1.00 0.00 ? 19 TYR A CG   13 
ATOM 9657  C CD1  . TYR A 1 19 ? -6.043  0.969   2.614   1.00 0.00 ? 19 TYR A CD1  13 
ATOM 9658  C CD2  . TYR A 1 19 ? -3.874  0.125   3.292   1.00 0.00 ? 19 TYR A CD2  13 
ATOM 9659  C CE1  . TYR A 1 19 ? -5.703  2.237   3.095   1.00 0.00 ? 19 TYR A CE1  13 
ATOM 9660  C CE2  . TYR A 1 19 ? -3.534  1.395   3.773   1.00 0.00 ? 19 TYR A CE2  13 
ATOM 9661  C CZ   . TYR A 1 19 ? -4.448  2.452   3.677   1.00 0.00 ? 19 TYR A CZ   13 
ATOM 9662  O OH   . TYR A 1 19 ? -4.110  3.702   4.150   1.00 0.00 ? 19 TYR A OH   13 
ATOM 9663  H H    . TYR A 1 19 ? -4.704  -3.066  4.021   1.00 0.00 ? 19 TYR A H    13 
ATOM 9664  H HA   . TYR A 1 19 ? -7.050  -1.364  3.696   1.00 0.00 ? 19 TYR A HA   13 
ATOM 9665  H HB2  . TYR A 1 19 ? -4.629  -2.043  2.066   1.00 0.00 ? 19 TYR A HB2  13 
ATOM 9666  H HB3  . TYR A 1 19 ? -6.020  -1.331  1.253   1.00 0.00 ? 19 TYR A HB3  13 
ATOM 9667  H HD1  . TYR A 1 19 ? -7.009  0.801   2.166   1.00 0.00 ? 19 TYR A HD1  13 
ATOM 9668  H HD2  . TYR A 1 19 ? -3.164  -0.693  3.361   1.00 0.00 ? 19 TYR A HD2  13 
ATOM 9669  H HE1  . TYR A 1 19 ? -6.407  3.052   3.019   1.00 0.00 ? 19 TYR A HE1  13 
ATOM 9670  H HE2  . TYR A 1 19 ? -2.571  1.561   4.221   1.00 0.00 ? 19 TYR A HE2  13 
ATOM 9671  H HH   . TYR A 1 19 ? -4.201  4.328   3.428   1.00 0.00 ? 19 TYR A HH   13 
ATOM 9672  N N    . CYS A 1 20 ? -7.327  -4.356  2.865   1.00 0.00 ? 20 CYS A N    13 
ATOM 9673  C CA   . CYS A 1 20 ? -8.202  -5.363  2.200   1.00 0.00 ? 20 CYS A CA   13 
ATOM 9674  C C    . CYS A 1 20 ? -9.481  -5.545  3.020   1.00 0.00 ? 20 CYS A C    13 
ATOM 9675  O O    . CYS A 1 20 ? -9.442  -5.704  4.224   1.00 0.00 ? 20 CYS A O    13 
ATOM 9676  C CB   . CYS A 1 20 ? -7.462  -6.699  2.104   1.00 0.00 ? 20 CYS A CB   13 
ATOM 9677  S SG   . CYS A 1 20 ? -5.986  -6.498  1.073   1.00 0.00 ? 20 CYS A SG   13 
ATOM 9678  H H    . CYS A 1 20 ? -6.728  -4.629  3.590   1.00 0.00 ? 20 CYS A H    13 
ATOM 9679  H HA   . CYS A 1 20 ? -8.459  -5.020  1.210   1.00 0.00 ? 20 CYS A HA   13 
ATOM 9680  H HB2  . CYS A 1 20 ? -7.168  -7.022  3.091   1.00 0.00 ? 20 CYS A HB2  13 
ATOM 9681  H HB3  . CYS A 1 20 ? -8.110  -7.439  1.661   1.00 0.00 ? 20 CYS A HB3  13 
ATOM 9682  N N    . ASN A 1 21 ? -10.617 -5.522  2.377   1.00 0.00 ? 21 ASN A N    13 
ATOM 9683  C CA   . ASN A 1 21 ? -11.897 -5.692  3.118   1.00 0.00 ? 21 ASN A CA   13 
ATOM 9684  C C    . ASN A 1 21 ? -11.970 -7.107  3.697   1.00 0.00 ? 21 ASN A C    13 
ATOM 9685  O O    . ASN A 1 21 ? -12.488 -7.977  3.017   1.00 0.00 ? 21 ASN A O    13 
ATOM 9686  C CB   . ASN A 1 21 ? -13.073 -5.471  2.164   1.00 0.00 ? 21 ASN A CB   13 
ATOM 9687  C CG   . ASN A 1 21 ? -14.371 -5.912  2.843   1.00 0.00 ? 21 ASN A CG   13 
ATOM 9688  O OD1  . ASN A 1 21 ? -14.929 -6.936  2.504   1.00 0.00 ? 21 ASN A OD1  13 
ATOM 9689  N ND2  . ASN A 1 21 ? -14.876 -5.175  3.795   1.00 0.00 ? 21 ASN A ND2  13 
ATOM 9690  O OXT  . ASN A 1 21 ? -11.510 -7.295  4.811   1.00 0.00 ? 21 ASN A OXT  13 
ATOM 9691  H H    . ASN A 1 21 ? -10.627 -5.390  1.405   1.00 0.00 ? 21 ASN A H    13 
ATOM 9692  H HA   . ASN A 1 21 ? -11.947 -4.970  3.922   1.00 0.00 ? 21 ASN A HA   13 
ATOM 9693  H HB2  . ASN A 1 21 ? -13.137 -4.423  1.908   1.00 0.00 ? 21 ASN A HB2  13 
ATOM 9694  H HB3  . ASN A 1 21 ? -12.923 -6.052  1.266   1.00 0.00 ? 21 ASN A HB3  13 
ATOM 9695  H HD21 . ASN A 1 21 ? -14.426 -4.350  4.066   1.00 0.00 ? 21 ASN A HD21 13 
ATOM 9696  H HD22 . ASN A 1 21 ? -15.707 -5.450  4.236   1.00 0.00 ? 21 ASN A HD22 13 
ATOM 9697  N N    . PHE B 2 1  ? 7.295   -8.190  -3.676  1.00 0.00 ? 1  PHE B N    13 
ATOM 9698  C CA   . PHE B 2 1  ? 7.693   -8.358  -2.249  1.00 0.00 ? 1  PHE B CA   13 
ATOM 9699  C C    . PHE B 2 1  ? 9.117   -7.832  -2.050  1.00 0.00 ? 1  PHE B C    13 
ATOM 9700  O O    . PHE B 2 1  ? 10.031  -8.579  -1.768  1.00 0.00 ? 1  PHE B O    13 
ATOM 9701  C CB   . PHE B 2 1  ? 7.641   -9.840  -1.867  1.00 0.00 ? 1  PHE B CB   13 
ATOM 9702  C CG   . PHE B 2 1  ? 7.959   -10.691 -3.075  1.00 0.00 ? 1  PHE B CG   13 
ATOM 9703  C CD1  . PHE B 2 1  ? 9.292   -10.928 -3.432  1.00 0.00 ? 1  PHE B CD1  13 
ATOM 9704  C CD2  . PHE B 2 1  ? 6.921   -11.244 -3.834  1.00 0.00 ? 1  PHE B CD2  13 
ATOM 9705  C CE1  . PHE B 2 1  ? 9.587   -11.720 -4.550  1.00 0.00 ? 1  PHE B CE1  13 
ATOM 9706  C CE2  . PHE B 2 1  ? 7.215   -12.034 -4.951  1.00 0.00 ? 1  PHE B CE2  13 
ATOM 9707  C CZ   . PHE B 2 1  ? 8.548   -12.272 -5.309  1.00 0.00 ? 1  PHE B CZ   13 
ATOM 9708  H H1   . PHE B 2 1  ? 8.018   -8.618  -4.290  1.00 0.00 ? 1  PHE B H1   13 
ATOM 9709  H H2   . PHE B 2 1  ? 6.379   -8.656  -3.836  1.00 0.00 ? 1  PHE B H2   13 
ATOM 9710  H H3   . PHE B 2 1  ? 7.211   -7.177  -3.897  1.00 0.00 ? 1  PHE B H3   13 
ATOM 9711  H HA   . PHE B 2 1  ? 7.015   -7.800  -1.620  1.00 0.00 ? 1  PHE B HA   13 
ATOM 9712  H HB2  . PHE B 2 1  ? 8.363   -10.037 -1.088  1.00 0.00 ? 1  PHE B HB2  13 
ATOM 9713  H HB3  . PHE B 2 1  ? 6.651   -10.084 -1.509  1.00 0.00 ? 1  PHE B HB3  13 
ATOM 9714  H HD1  . PHE B 2 1  ? 10.093  -10.503 -2.846  1.00 0.00 ? 1  PHE B HD1  13 
ATOM 9715  H HD2  . PHE B 2 1  ? 5.894   -11.059 -3.559  1.00 0.00 ? 1  PHE B HD2  13 
ATOM 9716  H HE1  . PHE B 2 1  ? 10.615  -11.902 -4.825  1.00 0.00 ? 1  PHE B HE1  13 
ATOM 9717  H HE2  . PHE B 2 1  ? 6.415   -12.460 -5.538  1.00 0.00 ? 1  PHE B HE2  13 
ATOM 9718  H HZ   . PHE B 2 1  ? 8.776   -12.882 -6.171  1.00 0.00 ? 1  PHE B HZ   13 
ATOM 9719  N N    . VAL B 2 2  ? 9.311   -6.550  -2.199  1.00 0.00 ? 2  VAL B N    13 
ATOM 9720  C CA   . VAL B 2 2  ? 10.675  -5.977  -2.020  1.00 0.00 ? 2  VAL B CA   13 
ATOM 9721  C C    . VAL B 2 2  ? 10.609  -4.785  -1.061  1.00 0.00 ? 2  VAL B C    13 
ATOM 9722  O O    . VAL B 2 2  ? 9.632   -4.066  -1.017  1.00 0.00 ? 2  VAL B O    13 
ATOM 9723  C CB   . VAL B 2 2  ? 11.217  -5.514  -3.373  1.00 0.00 ? 2  VAL B CB   13 
ATOM 9724  C CG1  . VAL B 2 2  ? 12.697  -5.162  -3.240  1.00 0.00 ? 2  VAL B CG1  13 
ATOM 9725  C CG2  . VAL B 2 2  ? 11.052  -6.640  -4.398  1.00 0.00 ? 2  VAL B CG2  13 
ATOM 9726  H H    . VAL B 2 2  ? 8.560   -5.962  -2.427  1.00 0.00 ? 2  VAL B H    13 
ATOM 9727  H HA   . VAL B 2 2  ? 11.330  -6.732  -1.609  1.00 0.00 ? 2  VAL B HA   13 
ATOM 9728  H HB   . VAL B 2 2  ? 10.667  -4.644  -3.702  1.00 0.00 ? 2  VAL B HB   13 
ATOM 9729  H HG11 . VAL B 2 2  ? 12.897  -4.814  -2.235  1.00 0.00 ? 2  VAL B HG11 13 
ATOM 9730  H HG12 . VAL B 2 2  ? 13.297  -6.037  -3.441  1.00 0.00 ? 2  VAL B HG12 13 
ATOM 9731  H HG13 . VAL B 2 2  ? 12.948  -4.384  -3.947  1.00 0.00 ? 2  VAL B HG13 13 
ATOM 9732  H HG21 . VAL B 2 2  ? 11.339  -7.580  -3.950  1.00 0.00 ? 2  VAL B HG21 13 
ATOM 9733  H HG22 . VAL B 2 2  ? 10.020  -6.692  -4.713  1.00 0.00 ? 2  VAL B HG22 13 
ATOM 9734  H HG23 . VAL B 2 2  ? 11.681  -6.442  -5.253  1.00 0.00 ? 2  VAL B HG23 13 
ATOM 9735  N N    . ASN B 2 3  ? 11.643  -4.573  -0.296  1.00 0.00 ? 3  ASN B N    13 
ATOM 9736  C CA   . ASN B 2 3  ? 11.643  -3.429  0.659   1.00 0.00 ? 3  ASN B CA   13 
ATOM 9737  C C    . ASN B 2 3  ? 11.925  -2.131  -0.100  1.00 0.00 ? 3  ASN B C    13 
ATOM 9738  O O    . ASN B 2 3  ? 13.030  -1.625  -0.095  1.00 0.00 ? 3  ASN B O    13 
ATOM 9739  C CB   . ASN B 2 3  ? 12.730  -3.647  1.713   1.00 0.00 ? 3  ASN B CB   13 
ATOM 9740  C CG   . ASN B 2 3  ? 14.082  -3.827  1.019   1.00 0.00 ? 3  ASN B CG   13 
ATOM 9741  O OD1  . ASN B 2 3  ? 14.389  -4.894  0.527   1.00 0.00 ? 3  ASN B OD1  13 
ATOM 9742  N ND2  . ASN B 2 3  ? 14.908  -2.819  0.957   1.00 0.00 ? 3  ASN B ND2  13 
ATOM 9743  H H    . ASN B 2 3  ? 12.423  -5.165  -0.349  1.00 0.00 ? 3  ASN B H    13 
ATOM 9744  H HA   . ASN B 2 3  ? 10.680  -3.363  1.142   1.00 0.00 ? 3  ASN B HA   13 
ATOM 9745  H HB2  . ASN B 2 3  ? 12.772  -2.791  2.370   1.00 0.00 ? 3  ASN B HB2  13 
ATOM 9746  H HB3  . ASN B 2 3  ? 12.502  -4.533  2.286   1.00 0.00 ? 3  ASN B HB3  13 
ATOM 9747  H HD21 . ASN B 2 3  ? 14.661  -1.956  1.351   1.00 0.00 ? 3  ASN B HD21 13 
ATOM 9748  H HD22 . ASN B 2 3  ? 15.777  -2.923  0.514   1.00 0.00 ? 3  ASN B HD22 13 
ATOM 9749  N N    . GLN B 2 4  ? 10.936  -1.585  -0.754  1.00 0.00 ? 4  GLN B N    13 
ATOM 9750  C CA   . GLN B 2 4  ? 11.153  -0.321  -1.510  1.00 0.00 ? 4  GLN B CA   13 
ATOM 9751  C C    . GLN B 2 4  ? 10.285  0.788   -0.910  1.00 0.00 ? 4  GLN B C    13 
ATOM 9752  O O    . GLN B 2 4  ? 9.823   0.691   0.210   1.00 0.00 ? 4  GLN B O    13 
ATOM 9753  C CB   . GLN B 2 4  ? 10.766  -0.530  -2.975  1.00 0.00 ? 4  GLN B CB   13 
ATOM 9754  C CG   . GLN B 2 4  ? 11.372  -1.839  -3.482  1.00 0.00 ? 4  GLN B CG   13 
ATOM 9755  C CD   . GLN B 2 4  ? 12.549  -1.530  -4.408  1.00 0.00 ? 4  GLN B CD   13 
ATOM 9756  O OE1  . GLN B 2 4  ? 13.668  -1.927  -4.143  1.00 0.00 ? 4  GLN B OE1  13 
ATOM 9757  N NE2  . GLN B 2 4  ? 12.346  -0.835  -5.494  1.00 0.00 ? 4  GLN B NE2  13 
ATOM 9758  H H    . GLN B 2 4  ? 10.051  -2.007  -0.746  1.00 0.00 ? 4  GLN B H    13 
ATOM 9759  H HA   . GLN B 2 4  ? 12.192  -0.037  -1.450  1.00 0.00 ? 4  GLN B HA   13 
ATOM 9760  H HB2  . GLN B 2 4  ? 9.689   -0.575  -3.060  1.00 0.00 ? 4  GLN B HB2  13 
ATOM 9761  H HB3  . GLN B 2 4  ? 11.141  0.291   -3.567  1.00 0.00 ? 4  GLN B HB3  13 
ATOM 9762  H HG2  . GLN B 2 4  ? 11.718  -2.425  -2.642  1.00 0.00 ? 4  GLN B HG2  13 
ATOM 9763  H HG3  . GLN B 2 4  ? 10.625  -2.396  -4.026  1.00 0.00 ? 4  GLN B HG3  13 
ATOM 9764  H HE21 . GLN B 2 4  ? 11.444  -0.517  -5.709  1.00 0.00 ? 4  GLN B HE21 13 
ATOM 9765  H HE22 . GLN B 2 4  ? 13.092  -0.633  -6.096  1.00 0.00 ? 4  GLN B HE22 13 
ATOM 9766  N N    . HIS B 2 5  ? 10.060  1.840   -1.648  1.00 0.00 ? 5  HIS B N    13 
ATOM 9767  C CA   . HIS B 2 5  ? 9.223   2.954   -1.121  1.00 0.00 ? 5  HIS B CA   13 
ATOM 9768  C C    . HIS B 2 5  ? 7.944   3.065   -1.952  1.00 0.00 ? 5  HIS B C    13 
ATOM 9769  O O    . HIS B 2 5  ? 7.987   3.214   -3.158  1.00 0.00 ? 5  HIS B O    13 
ATOM 9770  C CB   . HIS B 2 5  ? 10.005  4.265   -1.207  1.00 0.00 ? 5  HIS B CB   13 
ATOM 9771  C CG   . HIS B 2 5  ? 11.179  4.209   -0.271  1.00 0.00 ? 5  HIS B CG   13 
ATOM 9772  N ND1  . HIS B 2 5  ? 12.094  3.167   -0.296  1.00 0.00 ? 5  HIS B ND1  13 
ATOM 9773  C CD2  . HIS B 2 5  ? 11.603  5.055   0.723   1.00 0.00 ? 5  HIS B CD2  13 
ATOM 9774  C CE1  . HIS B 2 5  ? 13.014  3.410   0.656   1.00 0.00 ? 5  HIS B CE1  13 
ATOM 9775  N NE2  . HIS B 2 5  ? 12.761  4.550   1.308   1.00 0.00 ? 5  HIS B NE2  13 
ATOM 9776  H H    . HIS B 2 5  ? 10.441  1.897   -2.548  1.00 0.00 ? 5  HIS B H    13 
ATOM 9777  H HA   . HIS B 2 5  ? 8.965   2.754   -0.091  1.00 0.00 ? 5  HIS B HA   13 
ATOM 9778  H HB2  . HIS B 2 5  ? 10.355  4.409   -2.219  1.00 0.00 ? 5  HIS B HB2  13 
ATOM 9779  H HB3  . HIS B 2 5  ? 9.361   5.086   -0.928  1.00 0.00 ? 5  HIS B HB3  13 
ATOM 9780  H HD1  . HIS B 2 5  ? 12.075  2.393   -0.897  1.00 0.00 ? 5  HIS B HD1  13 
ATOM 9781  H HD2  . HIS B 2 5  ? 11.113  5.974   1.008   1.00 0.00 ? 5  HIS B HD2  13 
ATOM 9782  H HE1  . HIS B 2 5  ? 13.852  2.764   0.869   1.00 0.00 ? 5  HIS B HE1  13 
ATOM 9783  N N    . LEU B 2 6  ? 6.806   2.994   -1.321  1.00 0.00 ? 6  LEU B N    13 
ATOM 9784  C CA   . LEU B 2 6  ? 5.526   3.096   -2.076  1.00 0.00 ? 6  LEU B CA   13 
ATOM 9785  C C    . LEU B 2 6  ? 4.948   4.502   -1.913  1.00 0.00 ? 6  LEU B C    13 
ATOM 9786  O O    . LEU B 2 6  ? 4.016   4.720   -1.166  1.00 0.00 ? 6  LEU B O    13 
ATOM 9787  C CB   . LEU B 2 6  ? 4.530   2.068   -1.538  1.00 0.00 ? 6  LEU B CB   13 
ATOM 9788  C CG   . LEU B 2 6  ? 5.142   0.668   -1.635  1.00 0.00 ? 6  LEU B CG   13 
ATOM 9789  C CD1  . LEU B 2 6  ? 4.233   -0.335  -0.924  1.00 0.00 ? 6  LEU B CD1  13 
ATOM 9790  C CD2  . LEU B 2 6  ? 5.281   0.277   -3.109  1.00 0.00 ? 6  LEU B CD2  13 
ATOM 9791  H H    . LEU B 2 6  ? 6.791   2.872   -0.347  1.00 0.00 ? 6  LEU B H    13 
ATOM 9792  H HA   . LEU B 2 6  ? 5.710   2.903   -3.122  1.00 0.00 ? 6  LEU B HA   13 
ATOM 9793  H HB2  . LEU B 2 6  ? 4.305   2.290   -0.508  1.00 0.00 ? 6  LEU B HB2  13 
ATOM 9794  H HB3  . LEU B 2 6  ? 3.626   2.105   -2.122  1.00 0.00 ? 6  LEU B HB3  13 
ATOM 9795  H HG   . LEU B 2 6  ? 6.116   0.667   -1.167  1.00 0.00 ? 6  LEU B HG   13 
ATOM 9796  H HD11 . LEU B 2 6  ? 3.538   0.194   -0.292  1.00 0.00 ? 6  LEU B HD11 13 
ATOM 9797  H HD12 . LEU B 2 6  ? 3.687   -0.911  -1.658  1.00 0.00 ? 6  LEU B HD12 13 
ATOM 9798  H HD13 . LEU B 2 6  ? 4.835   -1.001  -0.320  1.00 0.00 ? 6  LEU B HD13 13 
ATOM 9799  H HD21 . LEU B 2 6  ? 5.293   1.169   -3.717  1.00 0.00 ? 6  LEU B HD21 13 
ATOM 9800  H HD22 . LEU B 2 6  ? 6.201   -0.269  -3.250  1.00 0.00 ? 6  LEU B HD22 13 
ATOM 9801  H HD23 . LEU B 2 6  ? 4.445   -0.344  -3.395  1.00 0.00 ? 6  LEU B HD23 13 
ATOM 9802  N N    . CYS B 2 7  ? 5.498   5.461   -2.609  1.00 0.00 ? 7  CYS B N    13 
ATOM 9803  C CA   . CYS B 2 7  ? 4.985   6.854   -2.497  1.00 0.00 ? 7  CYS B CA   13 
ATOM 9804  C C    . CYS B 2 7  ? 4.055   7.153   -3.674  1.00 0.00 ? 7  CYS B C    13 
ATOM 9805  O O    . CYS B 2 7  ? 4.154   6.548   -4.725  1.00 0.00 ? 7  CYS B O    13 
ATOM 9806  C CB   . CYS B 2 7  ? 6.161   7.832   -2.516  1.00 0.00 ? 7  CYS B CB   13 
ATOM 9807  S SG   . CYS B 2 7  ? 6.887   7.937   -0.863  1.00 0.00 ? 7  CYS B SG   13 
ATOM 9808  H H    . CYS B 2 7  ? 6.250   5.262   -3.206  1.00 0.00 ? 7  CYS B H    13 
ATOM 9809  H HA   . CYS B 2 7  ? 4.440   6.964   -1.570  1.00 0.00 ? 7  CYS B HA   13 
ATOM 9810  H HB2  . CYS B 2 7  ? 6.907   7.484   -3.217  1.00 0.00 ? 7  CYS B HB2  13 
ATOM 9811  H HB3  . CYS B 2 7  ? 5.813   8.808   -2.820  1.00 0.00 ? 7  CYS B HB3  13 
ATOM 9812  N N    . GLY B 2 8  ? 3.150   8.079   -3.511  1.00 0.00 ? 8  GLY B N    13 
ATOM 9813  C CA   . GLY B 2 8  ? 2.216   8.413   -4.622  1.00 0.00 ? 8  GLY B CA   13 
ATOM 9814  C C    . GLY B 2 8  ? 1.177   7.299   -4.768  1.00 0.00 ? 8  GLY B C    13 
ATOM 9815  O O    . GLY B 2 8  ? 0.720   6.733   -3.796  1.00 0.00 ? 8  GLY B O    13 
ATOM 9816  H H    . GLY B 2 8  ? 3.086   8.556   -2.656  1.00 0.00 ? 8  GLY B H    13 
ATOM 9817  H HA2  . GLY B 2 8  ? 1.718   9.347   -4.403  1.00 0.00 ? 8  GLY B HA2  13 
ATOM 9818  H HA3  . GLY B 2 8  ? 2.771   8.507   -5.543  1.00 0.00 ? 8  GLY B HA3  13 
ATOM 9819  N N    . SER B 2 9  ? 0.804   6.979   -5.977  1.00 0.00 ? 9  SER B N    13 
ATOM 9820  C CA   . SER B 2 9  ? -0.202  5.900   -6.183  1.00 0.00 ? 9  SER B CA   13 
ATOM 9821  C C    . SER B 2 9  ? 0.510   4.548   -6.264  1.00 0.00 ? 9  SER B C    13 
ATOM 9822  O O    . SER B 2 9  ? -0.112  3.505   -6.255  1.00 0.00 ? 9  SER B O    13 
ATOM 9823  C CB   . SER B 2 9  ? -0.962  6.154   -7.485  1.00 0.00 ? 9  SER B CB   13 
ATOM 9824  O OG   . SER B 2 9  ? -0.630  7.446   -7.977  1.00 0.00 ? 9  SER B OG   13 
ATOM 9825  H H    . SER B 2 9  ? 1.187   7.446   -6.749  1.00 0.00 ? 9  SER B H    13 
ATOM 9826  H HA   . SER B 2 9  ? -0.898  5.893   -5.357  1.00 0.00 ? 9  SER B HA   13 
ATOM 9827  H HB2  . SER B 2 9  ? -0.684  5.413   -8.216  1.00 0.00 ? 9  SER B HB2  13 
ATOM 9828  H HB3  . SER B 2 9  ? -2.026  6.091   -7.298  1.00 0.00 ? 9  SER B HB3  13 
ATOM 9829  H HG   . SER B 2 9  ? -0.924  8.094   -7.334  1.00 0.00 ? 9  SER B HG   13 
ATOM 9830  N N    . HIS B 2 10 ? 1.815   4.560   -6.341  1.00 0.00 ? 10 HIS B N    13 
ATOM 9831  C CA   . HIS B 2 10 ? 2.568   3.277   -6.422  1.00 0.00 ? 10 HIS B CA   13 
ATOM 9832  C C    . HIS B 2 10 ? 2.123   2.352   -5.287  1.00 0.00 ? 10 HIS B C    13 
ATOM 9833  O O    . HIS B 2 10 ? 1.994   1.156   -5.464  1.00 0.00 ? 10 HIS B O    13 
ATOM 9834  C CB   . HIS B 2 10 ? 4.066   3.558   -6.293  1.00 0.00 ? 10 HIS B CB   13 
ATOM 9835  C CG   . HIS B 2 10 ? 4.470   4.605   -7.296  1.00 0.00 ? 10 HIS B CG   13 
ATOM 9836  N ND1  . HIS B 2 10 ? 3.717   4.873   -8.430  1.00 0.00 ? 10 HIS B ND1  13 
ATOM 9837  C CD2  . HIS B 2 10 ? 5.545   5.456   -7.351  1.00 0.00 ? 10 HIS B CD2  13 
ATOM 9838  C CE1  . HIS B 2 10 ? 4.344   5.848   -9.110  1.00 0.00 ? 10 HIS B CE1  13 
ATOM 9839  N NE2  . HIS B 2 10 ? 5.465   6.240   -8.497  1.00 0.00 ? 10 HIS B NE2  13 
ATOM 9840  H H    . HIS B 2 10 ? 2.297   5.412   -6.346  1.00 0.00 ? 10 HIS B H    13 
ATOM 9841  H HA   . HIS B 2 10 ? 2.371   2.803   -7.370  1.00 0.00 ? 10 HIS B HA   13 
ATOM 9842  H HB2  . HIS B 2 10 ? 4.281   3.915   -5.295  1.00 0.00 ? 10 HIS B HB2  13 
ATOM 9843  H HB3  . HIS B 2 10 ? 4.620   2.650   -6.476  1.00 0.00 ? 10 HIS B HB3  13 
ATOM 9844  H HD1  . HIS B 2 10 ? 2.880   4.431   -8.686  1.00 0.00 ? 10 HIS B HD1  13 
ATOM 9845  H HD2  . HIS B 2 10 ? 6.334   5.508   -6.616  1.00 0.00 ? 10 HIS B HD2  13 
ATOM 9846  H HE1  . HIS B 2 10 ? 3.986   6.265   -10.041 1.00 0.00 ? 10 HIS B HE1  13 
ATOM 9847  N N    . LEU B 2 11 ? 1.888   2.893   -4.122  1.00 0.00 ? 11 LEU B N    13 
ATOM 9848  C CA   . LEU B 2 11 ? 1.455   2.041   -2.981  1.00 0.00 ? 11 LEU B CA   13 
ATOM 9849  C C    . LEU B 2 11 ? 0.075   1.454   -3.275  1.00 0.00 ? 11 LEU B C    13 
ATOM 9850  O O    . LEU B 2 11 ? -0.211  0.321   -2.938  1.00 0.00 ? 11 LEU B O    13 
ATOM 9851  C CB   . LEU B 2 11 ? 1.390   2.880   -1.704  1.00 0.00 ? 11 LEU B CB   13 
ATOM 9852  C CG   . LEU B 2 11 ? 1.405   1.955   -0.486  1.00 0.00 ? 11 LEU B CG   13 
ATOM 9853  C CD1  . LEU B 2 11 ? 2.137   2.645   0.668   1.00 0.00 ? 11 LEU B CD1  13 
ATOM 9854  C CD2  . LEU B 2 11 ? -0.035  1.640   -0.071  1.00 0.00 ? 11 LEU B CD2  13 
ATOM 9855  H H    . LEU B 2 11 ? 1.998   3.860   -3.999  1.00 0.00 ? 11 LEU B H    13 
ATOM 9856  H HA   . LEU B 2 11 ? 2.162   1.235   -2.845  1.00 0.00 ? 11 LEU B HA   13 
ATOM 9857  H HB2  . LEU B 2 11 ? 2.244   3.542   -1.665  1.00 0.00 ? 11 LEU B HB2  13 
ATOM 9858  H HB3  . LEU B 2 11 ? 0.482   3.463   -1.701  1.00 0.00 ? 11 LEU B HB3  13 
ATOM 9859  H HG   . LEU B 2 11 ? 1.918   1.039   -0.738  1.00 0.00 ? 11 LEU B HG   13 
ATOM 9860  H HD11 . LEU B 2 11 ? 2.837   3.366   0.270   1.00 0.00 ? 11 LEU B HD11 13 
ATOM 9861  H HD12 . LEU B 2 11 ? 1.418   3.150   1.300   1.00 0.00 ? 11 LEU B HD12 13 
ATOM 9862  H HD13 . LEU B 2 11 ? 2.673   1.908   1.248   1.00 0.00 ? 11 LEU B HD13 13 
ATOM 9863  H HD21 . LEU B 2 11 ? -0.661  1.587   -0.951  1.00 0.00 ? 11 LEU B HD21 13 
ATOM 9864  H HD22 . LEU B 2 11 ? -0.062  0.692   0.447   1.00 0.00 ? 11 LEU B HD22 13 
ATOM 9865  H HD23 . LEU B 2 11 ? -0.400  2.417   0.586   1.00 0.00 ? 11 LEU B HD23 13 
ATOM 9866  N N    . VAL B 2 12 ? -0.785  2.206   -3.904  1.00 0.00 ? 12 VAL B N    13 
ATOM 9867  C CA   . VAL B 2 12 ? -2.139  1.672   -4.220  1.00 0.00 ? 12 VAL B CA   13 
ATOM 9868  C C    . VAL B 2 12 ? -1.990  0.499   -5.190  1.00 0.00 ? 12 VAL B C    13 
ATOM 9869  O O    . VAL B 2 12 ? -2.798  -0.406  -5.214  1.00 0.00 ? 12 VAL B O    13 
ATOM 9870  C CB   . VAL B 2 12 ? -2.993  2.765   -4.863  1.00 0.00 ? 12 VAL B CB   13 
ATOM 9871  C CG1  . VAL B 2 12 ? -4.326  2.166   -5.313  1.00 0.00 ? 12 VAL B CG1  13 
ATOM 9872  C CG2  . VAL B 2 12 ? -3.251  3.872   -3.842  1.00 0.00 ? 12 VAL B CG2  13 
ATOM 9873  H H    . VAL B 2 12 ? -0.540  3.117   -4.173  1.00 0.00 ? 12 VAL B H    13 
ATOM 9874  H HA   . VAL B 2 12 ? -2.613  1.331   -3.311  1.00 0.00 ? 12 VAL B HA   13 
ATOM 9875  H HB   . VAL B 2 12 ? -2.472  3.172   -5.719  1.00 0.00 ? 12 VAL B HB   13 
ATOM 9876  H HG11 . VAL B 2 12 ? -4.683  1.477   -4.561  1.00 0.00 ? 12 VAL B HG11 13 
ATOM 9877  H HG12 . VAL B 2 12 ? -5.049  2.957   -5.449  1.00 0.00 ? 12 VAL B HG12 13 
ATOM 9878  H HG13 . VAL B 2 12 ? -4.190  1.641   -6.247  1.00 0.00 ? 12 VAL B HG13 13 
ATOM 9879  H HG21 . VAL B 2 12 ? -2.950  3.535   -2.862  1.00 0.00 ? 12 VAL B HG21 13 
ATOM 9880  H HG22 . VAL B 2 12 ? -2.684  4.752   -4.110  1.00 0.00 ? 12 VAL B HG22 13 
ATOM 9881  H HG23 . VAL B 2 12 ? -4.304  4.114   -3.831  1.00 0.00 ? 12 VAL B HG23 13 
ATOM 9882  N N    . GLU B 2 13 ? -0.955  0.507   -5.984  1.00 0.00 ? 13 GLU B N    13 
ATOM 9883  C CA   . GLU B 2 13 ? -0.745  -0.611  -6.945  1.00 0.00 ? 13 GLU B CA   13 
ATOM 9884  C C    . GLU B 2 13 ? -0.457  -1.889  -6.159  1.00 0.00 ? 13 GLU B C    13 
ATOM 9885  O O    . GLU B 2 13 ? -0.702  -2.986  -6.622  1.00 0.00 ? 13 GLU B O    13 
ATOM 9886  C CB   . GLU B 2 13 ? 0.441   -0.289  -7.858  1.00 0.00 ? 13 GLU B CB   13 
ATOM 9887  C CG   . GLU B 2 13 ? 0.052   0.841   -8.814  1.00 0.00 ? 13 GLU B CG   13 
ATOM 9888  C CD   . GLU B 2 13 ? 0.306   0.399   -10.258 1.00 0.00 ? 13 GLU B CD   13 
ATOM 9889  O OE1  . GLU B 2 13 ? -0.010  -0.738  -10.571 1.00 0.00 ? 13 GLU B OE1  13 
ATOM 9890  O OE2  . GLU B 2 13 ? 0.809   1.203   -11.023 1.00 0.00 ? 13 GLU B OE2  13 
ATOM 9891  H H    . GLU B 2 13 ? -0.310  1.244   -5.944  1.00 0.00 ? 13 GLU B H    13 
ATOM 9892  H HA   . GLU B 2 13 ? -1.636  -0.747  -7.541  1.00 0.00 ? 13 GLU B HA   13 
ATOM 9893  H HB2  . GLU B 2 13 ? 1.284   0.021   -7.258  1.00 0.00 ? 13 GLU B HB2  13 
ATOM 9894  H HB3  . GLU B 2 13 ? 0.706   -1.165  -8.428  1.00 0.00 ? 13 GLU B HB3  13 
ATOM 9895  H HG2  . GLU B 2 13 ? -0.994  1.078   -8.687  1.00 0.00 ? 13 GLU B HG2  13 
ATOM 9896  H HG3  . GLU B 2 13 ? 0.649   1.715   -8.600  1.00 0.00 ? 13 GLU B HG3  13 
ATOM 9897  N N    . ALA B 2 14 ? 0.051   -1.751  -4.966  1.00 0.00 ? 14 ALA B N    13 
ATOM 9898  C CA   . ALA B 2 14 ? 0.345   -2.951  -4.133  1.00 0.00 ? 14 ALA B CA   13 
ATOM 9899  C C    . ALA B 2 14 ? -0.826  -3.189  -3.181  1.00 0.00 ? 14 ALA B C    13 
ATOM 9900  O O    . ALA B 2 14 ? -0.959  -4.245  -2.594  1.00 0.00 ? 14 ALA B O    13 
ATOM 9901  C CB   . ALA B 2 14 ? 1.624   -2.714  -3.325  1.00 0.00 ? 14 ALA B CB   13 
ATOM 9902  H H    . ALA B 2 14 ? 0.231   -0.856  -4.611  1.00 0.00 ? 14 ALA B H    13 
ATOM 9903  H HA   . ALA B 2 14 ? 0.475   -3.813  -4.772  1.00 0.00 ? 14 ALA B HA   13 
ATOM 9904  H HB1  . ALA B 2 14 ? 2.329   -2.154  -3.922  1.00 0.00 ? 14 ALA B HB1  13 
ATOM 9905  H HB2  . ALA B 2 14 ? 1.385   -2.155  -2.432  1.00 0.00 ? 14 ALA B HB2  13 
ATOM 9906  H HB3  . ALA B 2 14 ? 2.057   -3.664  -3.050  1.00 0.00 ? 14 ALA B HB3  13 
ATOM 9907  N N    . LEU B 2 15 ? -1.679  -2.213  -3.026  1.00 0.00 ? 15 LEU B N    13 
ATOM 9908  C CA   . LEU B 2 15 ? -2.845  -2.376  -2.113  1.00 0.00 ? 15 LEU B CA   13 
ATOM 9909  C C    . LEU B 2 15 ? -3.938  -3.181  -2.819  1.00 0.00 ? 15 LEU B C    13 
ATOM 9910  O O    . LEU B 2 15 ? -4.515  -4.091  -2.256  1.00 0.00 ? 15 LEU B O    13 
ATOM 9911  C CB   . LEU B 2 15 ? -3.393  -0.997  -1.741  1.00 0.00 ? 15 LEU B CB   13 
ATOM 9912  C CG   . LEU B 2 15 ? -2.507  -0.369  -0.666  1.00 0.00 ? 15 LEU B CG   13 
ATOM 9913  C CD1  . LEU B 2 15 ? -3.075  0.992   -0.266  1.00 0.00 ? 15 LEU B CD1  13 
ATOM 9914  C CD2  . LEU B 2 15 ? -2.472  -1.278  0.561   1.00 0.00 ? 15 LEU B CD2  13 
ATOM 9915  H H    . LEU B 2 15 ? -1.552  -1.371  -3.510  1.00 0.00 ? 15 LEU B H    13 
ATOM 9916  H HA   . LEU B 2 15 ? -2.534  -2.892  -1.218  1.00 0.00 ? 15 LEU B HA   13 
ATOM 9917  H HB2  . LEU B 2 15 ? -3.404  -0.366  -2.617  1.00 0.00 ? 15 LEU B HB2  13 
ATOM 9918  H HB3  . LEU B 2 15 ? -4.400  -1.100  -1.360  1.00 0.00 ? 15 LEU B HB3  13 
ATOM 9919  H HG   . LEU B 2 15 ? -1.506  -0.241  -1.053  1.00 0.00 ? 15 LEU B HG   13 
ATOM 9920  H HD11 . LEU B 2 15 ? -4.148  0.983   -0.389  1.00 0.00 ? 15 LEU B HD11 13 
ATOM 9921  H HD12 . LEU B 2 15 ? -2.833  1.195   0.766   1.00 0.00 ? 15 LEU B HD12 13 
ATOM 9922  H HD13 . LEU B 2 15 ? -2.648  1.760   -0.895  1.00 0.00 ? 15 LEU B HD13 13 
ATOM 9923  H HD21 . LEU B 2 15 ? -3.097  -2.141  0.389   1.00 0.00 ? 15 LEU B HD21 13 
ATOM 9924  H HD22 . LEU B 2 15 ? -1.457  -1.599  0.743   1.00 0.00 ? 15 LEU B HD22 13 
ATOM 9925  H HD23 . LEU B 2 15 ? -2.835  -0.738  1.419   1.00 0.00 ? 15 LEU B HD23 13 
ATOM 9926  N N    . HIS B 2 16 ? -4.227  -2.851  -4.048  1.00 0.00 ? 16 HIS B N    13 
ATOM 9927  C CA   . HIS B 2 16 ? -5.283  -3.589  -4.793  1.00 0.00 ? 16 HIS B CA   13 
ATOM 9928  C C    . HIS B 2 16 ? -4.762  -4.981  -5.170  1.00 0.00 ? 16 HIS B C    13 
ATOM 9929  O O    . HIS B 2 16 ? -5.522  -5.878  -5.477  1.00 0.00 ? 16 HIS B O    13 
ATOM 9930  C CB   . HIS B 2 16 ? -5.653  -2.802  -6.058  1.00 0.00 ? 16 HIS B CB   13 
ATOM 9931  C CG   . HIS B 2 16 ? -4.671  -3.089  -7.162  1.00 0.00 ? 16 HIS B CG   13 
ATOM 9932  N ND1  . HIS B 2 16 ? -5.045  -3.705  -8.346  1.00 0.00 ? 16 HIS B ND1  13 
ATOM 9933  C CD2  . HIS B 2 16 ? -3.326  -2.851  -7.273  1.00 0.00 ? 16 HIS B CD2  13 
ATOM 9934  C CE1  . HIS B 2 16 ? -3.945  -3.815  -9.112  1.00 0.00 ? 16 HIS B CE1  13 
ATOM 9935  N NE2  . HIS B 2 16 ? -2.867  -3.309  -8.505  1.00 0.00 ? 16 HIS B NE2  13 
ATOM 9936  H H    . HIS B 2 16 ? -3.750  -2.112  -4.479  1.00 0.00 ? 16 HIS B H    13 
ATOM 9937  H HA   . HIS B 2 16 ? -6.156  -3.693  -4.168  1.00 0.00 ? 16 HIS B HA   13 
ATOM 9938  H HB2  . HIS B 2 16 ? -6.645  -3.084  -6.380  1.00 0.00 ? 16 HIS B HB2  13 
ATOM 9939  H HB3  . HIS B 2 16 ? -5.635  -1.745  -5.836  1.00 0.00 ? 16 HIS B HB3  13 
ATOM 9940  H HD1  . HIS B 2 16 ? -5.948  -4.005  -8.583  1.00 0.00 ? 16 HIS B HD1  13 
ATOM 9941  H HD2  . HIS B 2 16 ? -2.716  -2.377  -6.518  1.00 0.00 ? 16 HIS B HD2  13 
ATOM 9942  H HE1  . HIS B 2 16 ? -3.934  -4.256  -10.097 1.00 0.00 ? 16 HIS B HE1  13 
ATOM 9943  N N    . LEU B 2 17 ? -3.471  -5.161  -5.154  1.00 0.00 ? 17 LEU B N    13 
ATOM 9944  C CA   . LEU B 2 17 ? -2.895  -6.485  -5.514  1.00 0.00 ? 17 LEU B CA   13 
ATOM 9945  C C    . LEU B 2 17 ? -2.968  -7.424  -4.307  1.00 0.00 ? 17 LEU B C    13 
ATOM 9946  O O    . LEU B 2 17 ? -3.011  -8.630  -4.448  1.00 0.00 ? 17 LEU B O    13 
ATOM 9947  C CB   . LEU B 2 17 ? -1.433  -6.306  -5.930  1.00 0.00 ? 17 LEU B CB   13 
ATOM 9948  C CG   . LEU B 2 17 ? -0.862  -7.648  -6.385  1.00 0.00 ? 17 LEU B CG   13 
ATOM 9949  C CD1  . LEU B 2 17 ? -1.689  -8.184  -7.553  1.00 0.00 ? 17 LEU B CD1  13 
ATOM 9950  C CD2  . LEU B 2 17 ? 0.588   -7.456  -6.832  1.00 0.00 ? 17 LEU B CD2  13 
ATOM 9951  H H    . LEU B 2 17 ? -2.878  -4.421  -4.907  1.00 0.00 ? 17 LEU B H    13 
ATOM 9952  H HA   . LEU B 2 17 ? -3.452  -6.910  -6.336  1.00 0.00 ? 17 LEU B HA   13 
ATOM 9953  H HB2  . LEU B 2 17 ? -1.375  -5.596  -6.743  1.00 0.00 ? 17 LEU B HB2  13 
ATOM 9954  H HB3  . LEU B 2 17 ? -0.864  -5.940  -5.090  1.00 0.00 ? 17 LEU B HB3  13 
ATOM 9955  H HG   . LEU B 2 17 ? -0.898  -8.352  -5.565  1.00 0.00 ? 17 LEU B HG   13 
ATOM 9956  H HD11 . LEU B 2 17 ? -1.879  -7.385  -8.255  1.00 0.00 ? 17 LEU B HD11 13 
ATOM 9957  H HD12 . LEU B 2 17 ? -1.145  -8.976  -8.047  1.00 0.00 ? 17 LEU B HD12 13 
ATOM 9958  H HD13 . LEU B 2 17 ? -2.627  -8.570  -7.183  1.00 0.00 ? 17 LEU B HD13 13 
ATOM 9959  H HD21 . LEU B 2 17 ? 0.779   -6.405  -6.993  1.00 0.00 ? 17 LEU B HD21 13 
ATOM 9960  H HD22 . LEU B 2 17 ? 1.255   -7.830  -6.068  1.00 0.00 ? 17 LEU B HD22 13 
ATOM 9961  H HD23 . LEU B 2 17 ? 0.756   -7.996  -7.753  1.00 0.00 ? 17 LEU B HD23 13 
ATOM 9962  N N    . VAL B 2 18 ? -2.979  -6.879  -3.122  1.00 0.00 ? 18 VAL B N    13 
ATOM 9963  C CA   . VAL B 2 18 ? -3.046  -7.738  -1.906  1.00 0.00 ? 18 VAL B CA   13 
ATOM 9964  C C    . VAL B 2 18 ? -4.497  -8.136  -1.633  1.00 0.00 ? 18 VAL B C    13 
ATOM 9965  O O    . VAL B 2 18 ? -4.770  -9.173  -1.063  1.00 0.00 ? 18 VAL B O    13 
ATOM 9966  C CB   . VAL B 2 18 ? -2.503  -6.957  -0.708  1.00 0.00 ? 18 VAL B CB   13 
ATOM 9967  C CG1  . VAL B 2 18 ? -2.565  -7.832  0.546   1.00 0.00 ? 18 VAL B CG1  13 
ATOM 9968  C CG2  . VAL B 2 18 ? -1.052  -6.560  -0.982  1.00 0.00 ? 18 VAL B CG2  13 
ATOM 9969  H H    . VAL B 2 18 ? -2.938  -5.903  -3.030  1.00 0.00 ? 18 VAL B H    13 
ATOM 9970  H HA   . VAL B 2 18 ? -2.449  -8.624  -2.057  1.00 0.00 ? 18 VAL B HA   13 
ATOM 9971  H HB   . VAL B 2 18 ? -3.099  -6.068  -0.558  1.00 0.00 ? 18 VAL B HB   13 
ATOM 9972  H HG11 . VAL B 2 18 ? -2.339  -8.855  0.282   1.00 0.00 ? 18 VAL B HG11 13 
ATOM 9973  H HG12 . VAL B 2 18 ? -1.843  -7.478  1.266   1.00 0.00 ? 18 VAL B HG12 13 
ATOM 9974  H HG13 . VAL B 2 18 ? -3.554  -7.780  0.971   1.00 0.00 ? 18 VAL B HG13 13 
ATOM 9975  H HG21 . VAL B 2 18 ? -0.950  -6.256  -2.013  1.00 0.00 ? 18 VAL B HG21 13 
ATOM 9976  H HG22 . VAL B 2 18 ? -0.774  -5.741  -0.335  1.00 0.00 ? 18 VAL B HG22 13 
ATOM 9977  H HG23 . VAL B 2 18 ? -0.407  -7.403  -0.790  1.00 0.00 ? 18 VAL B HG23 13 
ATOM 9978  N N    . CYS B 2 19 ? -5.431  -7.316  -2.031  1.00 0.00 ? 19 CYS B N    13 
ATOM 9979  C CA   . CYS B 2 19 ? -6.862  -7.644  -1.790  1.00 0.00 ? 19 CYS B CA   13 
ATOM 9980  C C    . CYS B 2 19 ? -7.454  -8.292  -3.042  1.00 0.00 ? 19 CYS B C    13 
ATOM 9981  O O    . CYS B 2 19 ? -8.428  -9.016  -2.979  1.00 0.00 ? 19 CYS B O    13 
ATOM 9982  C CB   . CYS B 2 19 ? -7.622  -6.358  -1.469  1.00 0.00 ? 19 CYS B CB   13 
ATOM 9983  S SG   . CYS B 2 19 ? -6.593  -5.293  -0.429  1.00 0.00 ? 19 CYS B SG   13 
ATOM 9984  H H    . CYS B 2 19 ? -5.192  -6.482  -2.485  1.00 0.00 ? 19 CYS B H    13 
ATOM 9985  H HA   . CYS B 2 19 ? -6.942  -8.327  -0.957  1.00 0.00 ? 19 CYS B HA   13 
ATOM 9986  H HB2  . CYS B 2 19 ? -7.856  -5.844  -2.389  1.00 0.00 ? 19 CYS B HB2  13 
ATOM 9987  H HB3  . CYS B 2 19 ? -8.537  -6.598  -0.945  1.00 0.00 ? 19 CYS B HB3  13 
ATOM 9988  N N    . GLY B 2 20 ? -6.874  -8.035  -4.181  1.00 0.00 ? 20 GLY B N    13 
ATOM 9989  C CA   . GLY B 2 20 ? -7.398  -8.634  -5.439  1.00 0.00 ? 20 GLY B CA   13 
ATOM 9990  C C    . GLY B 2 20 ? -8.837  -8.167  -5.666  1.00 0.00 ? 20 GLY B C    13 
ATOM 9991  O O    . GLY B 2 20 ? -9.107  -6.986  -5.772  1.00 0.00 ? 20 GLY B O    13 
ATOM 9992  H H    . GLY B 2 20 ? -6.089  -7.449  -4.208  1.00 0.00 ? 20 GLY B H    13 
ATOM 9993  H HA2  . GLY B 2 20 ? -6.781  -8.324  -6.269  1.00 0.00 ? 20 GLY B HA2  13 
ATOM 9994  H HA3  . GLY B 2 20 ? -7.382  -9.710  -5.360  1.00 0.00 ? 20 GLY B HA3  13 
ATOM 9995  N N    . GLU B 2 21 ? -9.762  -9.083  -5.749  1.00 0.00 ? 21 GLU B N    13 
ATOM 9996  C CA   . GLU B 2 21 ? -11.181 -8.693  -5.974  1.00 0.00 ? 21 GLU B CA   13 
ATOM 9997  C C    . GLU B 2 21 ? -11.758 -8.092  -4.689  1.00 0.00 ? 21 GLU B C    13 
ATOM 9998  O O    . GLU B 2 21 ? -12.621 -7.239  -4.726  1.00 0.00 ? 21 GLU B O    13 
ATOM 9999  C CB   . GLU B 2 21 ? -11.990 -9.930  -6.367  1.00 0.00 ? 21 GLU B CB   13 
ATOM 10000 C CG   . GLU B 2 21 ? -12.589 -9.727  -7.760  1.00 0.00 ? 21 GLU B CG   13 
ATOM 10001 C CD   . GLU B 2 21 ? -13.665 -10.786 -8.011  1.00 0.00 ? 21 GLU B CD   13 
ATOM 10002 O OE1  . GLU B 2 21 ? -14.155 -11.345 -7.043  1.00 0.00 ? 21 GLU B OE1  13 
ATOM 10003 O OE2  . GLU B 2 21 ? -13.982 -11.019 -9.167  1.00 0.00 ? 21 GLU B OE2  13 
ATOM 10004 H H    . GLU B 2 21 ? -9.523  -10.029 -5.664  1.00 0.00 ? 21 GLU B H    13 
ATOM 10005 H HA   . GLU B 2 21 ? -11.233 -7.961  -6.767  1.00 0.00 ? 21 GLU B HA   13 
ATOM 10006 H HB2  . GLU B 2 21 ? -11.344 -10.796 -6.375  1.00 0.00 ? 21 GLU B HB2  13 
ATOM 10007 H HB3  . GLU B 2 21 ? -12.786 -10.081 -5.654  1.00 0.00 ? 21 GLU B HB3  13 
ATOM 10008 H HG2  . GLU B 2 21 ? -13.030 -8.743  -7.823  1.00 0.00 ? 21 GLU B HG2  13 
ATOM 10009 H HG3  . GLU B 2 21 ? -11.813 -9.822  -8.504  1.00 0.00 ? 21 GLU B HG3  13 
ATOM 10010 N N    . ARG B 2 22 ? -11.291 -8.533  -3.555  1.00 0.00 ? 22 ARG B N    13 
ATOM 10011 C CA   . ARG B 2 22 ? -11.816 -7.988  -2.270  1.00 0.00 ? 22 ARG B CA   13 
ATOM 10012 C C    . ARG B 2 22 ? -11.796 -6.458  -2.316  1.00 0.00 ? 22 ARG B C    13 
ATOM 10013 O O    . ARG B 2 22 ? -12.527 -5.797  -1.606  1.00 0.00 ? 22 ARG B O    13 
ATOM 10014 C CB   . ARG B 2 22 ? -10.942 -8.475  -1.113  1.00 0.00 ? 22 ARG B CB   13 
ATOM 10015 C CG   . ARG B 2 22 ? -11.129 -9.984  -0.934  1.00 0.00 ? 22 ARG B CG   13 
ATOM 10016 C CD   . ARG B 2 22 ? -9.882  -10.577 -0.278  1.00 0.00 ? 22 ARG B CD   13 
ATOM 10017 N NE   . ARG B 2 22 ? -10.291 -11.499 0.820   1.00 0.00 ? 22 ARG B NE   13 
ATOM 10018 C CZ   . ARG B 2 22 ? -9.427  -12.333 1.334   1.00 0.00 ? 22 ARG B CZ   13 
ATOM 10019 N NH1  . ARG B 2 22 ? -8.200  -12.362 0.890   1.00 0.00 ? 22 ARG B NH1  13 
ATOM 10020 N NH2  . ARG B 2 22 ? -9.792  -13.141 2.291   1.00 0.00 ? 22 ARG B NH2  13 
ATOM 10021 H H    . ARG B 2 22 ? -10.596 -9.224  -3.545  1.00 0.00 ? 22 ARG B H    13 
ATOM 10022 H HA   . ARG B 2 22 ? -12.832 -8.328  -2.125  1.00 0.00 ? 22 ARG B HA   13 
ATOM 10023 H HB2  . ARG B 2 22 ? -9.906  -8.263  -1.330  1.00 0.00 ? 22 ARG B HB2  13 
ATOM 10024 H HB3  . ARG B 2 22 ? -11.233 -7.969  -0.204  1.00 0.00 ? 22 ARG B HB3  13 
ATOM 10025 H HG2  . ARG B 2 22 ? -11.991 -10.169 -0.308  1.00 0.00 ? 22 ARG B HG2  13 
ATOM 10026 H HG3  . ARG B 2 22 ? -11.279 -10.445 -1.899  1.00 0.00 ? 22 ARG B HG3  13 
ATOM 10027 H HD2  . ARG B 2 22 ? -9.313  -11.125 -1.012  1.00 0.00 ? 22 ARG B HD2  13 
ATOM 10028 H HD3  . ARG B 2 22 ? -9.275  -9.781  0.128   1.00 0.00 ? 22 ARG B HD3  13 
ATOM 10029 H HE   . ARG B 2 22 ? -11.212 -11.480 1.157   1.00 0.00 ? 22 ARG B HE   13 
ATOM 10030 H HH11 . ARG B 2 22 ? -7.916  -11.745 0.156   1.00 0.00 ? 22 ARG B HH11 13 
ATOM 10031 H HH12 . ARG B 2 22 ? -7.541  -13.001 1.285   1.00 0.00 ? 22 ARG B HH12 13 
ATOM 10032 H HH21 . ARG B 2 22 ? -10.733 -13.118 2.631   1.00 0.00 ? 22 ARG B HH21 13 
ATOM 10033 H HH22 . ARG B 2 22 ? -9.133  -13.779 2.685   1.00 0.00 ? 22 ARG B HH22 13 
ATOM 10034 N N    . GLY B 2 23 ? -10.964 -5.889  -3.145  1.00 0.00 ? 23 GLY B N    13 
ATOM 10035 C CA   . GLY B 2 23 ? -10.898 -4.402  -3.233  1.00 0.00 ? 23 GLY B CA   13 
ATOM 10036 C C    . GLY B 2 23 ? -10.171 -3.850  -2.007  1.00 0.00 ? 23 GLY B C    13 
ATOM 10037 O O    . GLY B 2 23 ? -9.643  -4.589  -1.200  1.00 0.00 ? 23 GLY B O    13 
ATOM 10038 H H    . GLY B 2 23 ? -10.382 -6.440  -3.710  1.00 0.00 ? 23 GLY B H    13 
ATOM 10039 H HA2  . GLY B 2 23 ? -10.365 -4.119  -4.130  1.00 0.00 ? 23 GLY B HA2  13 
ATOM 10040 H HA3  . GLY B 2 23 ? -11.899 -3.999  -3.266  1.00 0.00 ? 23 GLY B HA3  13 
ATOM 10041 N N    . PHE B 2 24 ? -10.134 -2.553  -1.859  1.00 0.00 ? 24 PHE B N    13 
ATOM 10042 C CA   . PHE B 2 24 ? -9.438  -1.956  -0.683  1.00 0.00 ? 24 PHE B CA   13 
ATOM 10043 C C    . PHE B 2 24 ? -9.841  -0.487  -0.544  1.00 0.00 ? 24 PHE B C    13 
ATOM 10044 O O    . PHE B 2 24 ? -9.895  0.248   -1.509  1.00 0.00 ? 24 PHE B O    13 
ATOM 10045 C CB   . PHE B 2 24 ? -7.924  -2.061  -0.887  1.00 0.00 ? 24 PHE B CB   13 
ATOM 10046 C CG   . PHE B 2 24 ? -7.524  -1.309  -2.126  1.00 0.00 ? 24 PHE B CG   13 
ATOM 10047 C CD1  . PHE B 2 24 ? -7.840  -1.833  -3.377  1.00 0.00 ? 24 PHE B CD1  13 
ATOM 10048 C CD2  . PHE B 2 24 ? -6.835  -0.095  -2.026  1.00 0.00 ? 24 PHE B CD2  13 
ATOM 10049 C CE1  . PHE B 2 24 ? -7.472  -1.146  -4.539  1.00 0.00 ? 24 PHE B CE1  13 
ATOM 10050 C CE2  . PHE B 2 24 ? -6.466  0.597   -3.186  1.00 0.00 ? 24 PHE B CE2  13 
ATOM 10051 C CZ   . PHE B 2 24 ? -6.783  0.070   -4.443  1.00 0.00 ? 24 PHE B CZ   13 
ATOM 10052 H H    . PHE B 2 24 ? -10.565 -1.972  -2.520  1.00 0.00 ? 24 PHE B H    13 
ATOM 10053 H HA   . PHE B 2 24 ? -9.719  -2.492  0.209   1.00 0.00 ? 24 PHE B HA   13 
ATOM 10054 H HB2  . PHE B 2 24 ? -7.413  -1.647  -0.032  1.00 0.00 ? 24 PHE B HB2  13 
ATOM 10055 H HB3  . PHE B 2 24 ? -7.654  -3.099  -1.004  1.00 0.00 ? 24 PHE B HB3  13 
ATOM 10056 H HD1  . PHE B 2 24 ? -8.368  -2.773  -3.444  1.00 0.00 ? 24 PHE B HD1  13 
ATOM 10057 H HD2  . PHE B 2 24 ? -6.588  0.307   -1.055  1.00 0.00 ? 24 PHE B HD2  13 
ATOM 10058 H HE1  . PHE B 2 24 ? -7.719  -1.554  -5.509  1.00 0.00 ? 24 PHE B HE1  13 
ATOM 10059 H HE2  . PHE B 2 24 ? -5.934  1.533   -3.110  1.00 0.00 ? 24 PHE B HE2  13 
ATOM 10060 H HZ   . PHE B 2 24 ? -6.498  0.602   -5.339  1.00 0.00 ? 24 PHE B HZ   13 
ATOM 10061 N N    . PHE B 2 25 ? -10.125 -0.053  0.655   1.00 0.00 ? 25 PHE B N    13 
ATOM 10062 C CA   . PHE B 2 25 ? -10.527 1.369   0.855   1.00 0.00 ? 25 PHE B CA   13 
ATOM 10063 C C    . PHE B 2 25 ? -9.286  2.202   1.188   1.00 0.00 ? 25 PHE B C    13 
ATOM 10064 O O    . PHE B 2 25 ? -8.945  2.402   2.335   1.00 0.00 ? 25 PHE B O    13 
ATOM 10065 C CB   . PHE B 2 25 ? -11.556 1.476   1.991   1.00 0.00 ? 25 PHE B CB   13 
ATOM 10066 C CG   . PHE B 2 25 ? -11.045 0.794   3.242   1.00 0.00 ? 25 PHE B CG   13 
ATOM 10067 C CD1  . PHE B 2 25 ? -11.223 -0.585  3.414   1.00 0.00 ? 25 PHE B CD1  13 
ATOM 10068 C CD2  . PHE B 2 25 ? -10.405 1.545   4.238   1.00 0.00 ? 25 PHE B CD2  13 
ATOM 10069 C CE1  . PHE B 2 25 ? -10.757 -1.212  4.576   1.00 0.00 ? 25 PHE B CE1  13 
ATOM 10070 C CE2  . PHE B 2 25 ? -9.942  0.917   5.399   1.00 0.00 ? 25 PHE B CE2  13 
ATOM 10071 C CZ   . PHE B 2 25 ? -10.117 -0.461  5.568   1.00 0.00 ? 25 PHE B CZ   13 
ATOM 10072 H H    . PHE B 2 25 ? -10.075 -0.662  1.419   1.00 0.00 ? 25 PHE B H    13 
ATOM 10073 H HA   . PHE B 2 25 ? -10.966 1.742   -0.059  1.00 0.00 ? 25 PHE B HA   13 
ATOM 10074 H HB2  . PHE B 2 25 ? -11.742 2.517   2.204   1.00 0.00 ? 25 PHE B HB2  13 
ATOM 10075 H HB3  . PHE B 2 25 ? -12.477 1.006   1.681   1.00 0.00 ? 25 PHE B HB3  13 
ATOM 10076 H HD1  . PHE B 2 25 ? -11.716 -1.165  2.649   1.00 0.00 ? 25 PHE B HD1  13 
ATOM 10077 H HD2  . PHE B 2 25 ? -10.267 2.608   4.106   1.00 0.00 ? 25 PHE B HD2  13 
ATOM 10078 H HE1  . PHE B 2 25 ? -10.894 -2.276  4.707   1.00 0.00 ? 25 PHE B HE1  13 
ATOM 10079 H HE2  . PHE B 2 25 ? -9.449  1.497   6.167   1.00 0.00 ? 25 PHE B HE2  13 
ATOM 10080 H HZ   . PHE B 2 25 ? -9.760  -0.945  6.466   1.00 0.00 ? 25 PHE B HZ   13 
ATOM 10081 N N    . TYR B 2 26 ? -8.606  2.688   0.185   1.00 0.00 ? 26 TYR B N    13 
ATOM 10082 C CA   . TYR B 2 26 ? -7.386  3.503   0.437   1.00 0.00 ? 26 TYR B CA   13 
ATOM 10083 C C    . TYR B 2 26 ? -7.784  4.875   0.987   1.00 0.00 ? 26 TYR B C    13 
ATOM 10084 O O    . TYR B 2 26 ? -8.950  5.213   1.052   1.00 0.00 ? 26 TYR B O    13 
ATOM 10085 C CB   . TYR B 2 26 ? -6.617  3.689   -0.871  1.00 0.00 ? 26 TYR B CB   13 
ATOM 10086 C CG   . TYR B 2 26 ? -5.185  4.051   -0.566  1.00 0.00 ? 26 TYR B CG   13 
ATOM 10087 C CD1  . TYR B 2 26 ? -4.471  3.327   0.395   1.00 0.00 ? 26 TYR B CD1  13 
ATOM 10088 C CD2  . TYR B 2 26 ? -4.571  5.110   -1.245  1.00 0.00 ? 26 TYR B CD2  13 
ATOM 10089 C CE1  . TYR B 2 26 ? -3.141  3.660   0.678   1.00 0.00 ? 26 TYR B CE1  13 
ATOM 10090 C CE2  . TYR B 2 26 ? -3.241  5.445   -0.961  1.00 0.00 ? 26 TYR B CE2  13 
ATOM 10091 C CZ   . TYR B 2 26 ? -2.526  4.719   -0.002  1.00 0.00 ? 26 TYR B CZ   13 
ATOM 10092 O OH   . TYR B 2 26 ? -1.215  5.048   0.275   1.00 0.00 ? 26 TYR B OH   13 
ATOM 10093 H H    . TYR B 2 26 ? -8.896  2.514   -0.734  1.00 0.00 ? 26 TYR B H    13 
ATOM 10094 H HA   . TYR B 2 26 ? -6.757  2.998   1.154   1.00 0.00 ? 26 TYR B HA   13 
ATOM 10095 H HB2  . TYR B 2 26 ? -6.645  2.769   -1.438  1.00 0.00 ? 26 TYR B HB2  13 
ATOM 10096 H HB3  . TYR B 2 26 ? -7.074  4.480   -1.448  1.00 0.00 ? 26 TYR B HB3  13 
ATOM 10097 H HD1  . TYR B 2 26 ? -4.945  2.510   0.917   1.00 0.00 ? 26 TYR B HD1  13 
ATOM 10098 H HD2  . TYR B 2 26 ? -5.123  5.670   -1.986  1.00 0.00 ? 26 TYR B HD2  13 
ATOM 10099 H HE1  . TYR B 2 26 ? -2.589  3.101   1.423   1.00 0.00 ? 26 TYR B HE1  13 
ATOM 10100 H HE2  . TYR B 2 26 ? -2.768  6.262   -1.486  1.00 0.00 ? 26 TYR B HE2  13 
ATOM 10101 H HH   . TYR B 2 26 ? -0.990  5.826   -0.239  1.00 0.00 ? 26 TYR B HH   13 
ATOM 10102 N N    . THR B 2 27 ? -6.824  5.667   1.377   1.00 0.00 ? 27 THR B N    13 
ATOM 10103 C CA   . THR B 2 27 ? -7.145  7.016   1.917   1.00 0.00 ? 27 THR B CA   13 
ATOM 10104 C C    . THR B 2 27 ? -6.228  8.058   1.269   1.00 0.00 ? 27 THR B C    13 
ATOM 10105 O O    . THR B 2 27 ? -5.494  8.746   1.951   1.00 0.00 ? 27 THR B O    13 
ATOM 10106 C CB   . THR B 2 27 ? -6.930  7.023   3.432   1.00 0.00 ? 27 THR B CB   13 
ATOM 10107 O OG1  . THR B 2 27 ? -6.868  8.365   3.895   1.00 0.00 ? 27 THR B OG1  13 
ATOM 10108 C CG2  . THR B 2 27 ? -5.622  6.305   3.768   1.00 0.00 ? 27 THR B CG2  13 
ATOM 10109 H H    . THR B 2 27 ? -5.892  5.374   1.313   1.00 0.00 ? 27 THR B H    13 
ATOM 10110 H HA   . THR B 2 27 ? -8.175  7.257   1.698   1.00 0.00 ? 27 THR B HA   13 
ATOM 10111 H HB   . THR B 2 27 ? -7.750  6.512   3.914   1.00 0.00 ? 27 THR B HB   13 
ATOM 10112 H HG1  . THR B 2 27 ? -6.344  8.378   4.699   1.00 0.00 ? 27 THR B HG1  13 
ATOM 10113 H HG21 . THR B 2 27 ? -4.982  6.300   2.899   1.00 0.00 ? 27 THR B HG21 13 
ATOM 10114 H HG22 . THR B 2 27 ? -5.127  6.816   4.579   1.00 0.00 ? 27 THR B HG22 13 
ATOM 10115 H HG23 . THR B 2 27 ? -5.836  5.287   4.063   1.00 0.00 ? 27 THR B HG23 13 
ATOM 10116 N N    . PRO B 2 28 ? -6.301  8.142   -0.036  1.00 0.00 ? 28 PRO B N    13 
ATOM 10117 C CA   . PRO B 2 28 ? -5.495  9.089   -0.836  1.00 0.00 ? 28 PRO B CA   13 
ATOM 10118 C C    . PRO B 2 28 ? -5.922  10.525  -0.525  1.00 0.00 ? 28 PRO B C    13 
ATOM 10119 O O    . PRO B 2 28 ? -7.095  10.833  -0.457  1.00 0.00 ? 28 PRO B O    13 
ATOM 10120 C CB   . PRO B 2 28 ? -5.787  8.758   -2.302  1.00 0.00 ? 28 PRO B CB   13 
ATOM 10121 C CG   . PRO B 2 28 ? -6.903  7.697   -2.323  1.00 0.00 ? 28 PRO B CG   13 
ATOM 10122 C CD   . PRO B 2 28 ? -7.193  7.304   -0.868  1.00 0.00 ? 28 PRO B CD   13 
ATOM 10123 H HA   . PRO B 2 28 ? -4.443  8.956   -0.632  1.00 0.00 ? 28 PRO B HA   13 
ATOM 10124 H HB2  . PRO B 2 28 ? -6.111  9.648   -2.822  1.00 0.00 ? 28 PRO B HB2  13 
ATOM 10125 H HB3  . PRO B 2 28 ? -4.901  8.359   -2.773  1.00 0.00 ? 28 PRO B HB3  13 
ATOM 10126 H HG2  . PRO B 2 28 ? -7.794  8.112   -2.776  1.00 0.00 ? 28 PRO B HG2  13 
ATOM 10127 H HG3  . PRO B 2 28 ? -6.579  6.830   -2.876  1.00 0.00 ? 28 PRO B HG3  13 
ATOM 10128 H HD2  . PRO B 2 28 ? -8.227  7.509   -0.627  1.00 0.00 ? 28 PRO B HD2  13 
ATOM 10129 H HD3  . PRO B 2 28 ? -6.970  6.259   -0.715  1.00 0.00 ? 28 PRO B HD3  13 
ATOM 10130 N N    . LYS B 2 29 ? -4.980  11.406  -0.334  1.00 0.00 ? 29 LYS B N    13 
ATOM 10131 C CA   . LYS B 2 29 ? -5.332  12.820  -0.028  1.00 0.00 ? 29 LYS B CA   13 
ATOM 10132 C C    . LYS B 2 29 ? -4.877  13.723  -1.176  1.00 0.00 ? 29 LYS B C    13 
ATOM 10133 O O    . LYS B 2 29 ? -3.702  13.968  -1.356  1.00 0.00 ? 29 LYS B O    13 
ATOM 10134 C CB   . LYS B 2 29 ? -4.638  13.248  1.266   1.00 0.00 ? 29 LYS B CB   13 
ATOM 10135 C CG   . LYS B 2 29 ? -4.808  14.757  1.461   1.00 0.00 ? 29 LYS B CG   13 
ATOM 10136 C CD   . LYS B 2 29 ? -6.287  15.126  1.326   1.00 0.00 ? 29 LYS B CD   13 
ATOM 10137 C CE   . LYS B 2 29 ? -6.445  16.644  1.446   1.00 0.00 ? 29 LYS B CE   13 
ATOM 10138 N NZ   . LYS B 2 29 ? -5.929  17.094  2.769   1.00 0.00 ? 29 LYS B NZ   13 
ATOM 10139 H H    . LYS B 2 29 ? -4.041  11.135  -0.394  1.00 0.00 ? 29 LYS B H    13 
ATOM 10140 H HA   . LYS B 2 29 ? -6.403  12.904  0.094   1.00 0.00 ? 29 LYS B HA   13 
ATOM 10141 H HB2  . LYS B 2 29 ? -5.078  12.726  2.101   1.00 0.00 ? 29 LYS B HB2  13 
ATOM 10142 H HB3  . LYS B 2 29 ? -3.587  13.012  1.207   1.00 0.00 ? 29 LYS B HB3  13 
ATOM 10143 H HG2  . LYS B 2 29 ? -4.453  15.035  2.444   1.00 0.00 ? 29 LYS B HG2  13 
ATOM 10144 H HG3  . LYS B 2 29 ? -4.236  15.284  0.711   1.00 0.00 ? 29 LYS B HG3  13 
ATOM 10145 H HD2  . LYS B 2 29 ? -6.653  14.800  0.365   1.00 0.00 ? 29 LYS B HD2  13 
ATOM 10146 H HD3  . LYS B 2 29 ? -6.850  14.645  2.111   1.00 0.00 ? 29 LYS B HD3  13 
ATOM 10147 H HE2  . LYS B 2 29 ? -5.888  17.127  0.658   1.00 0.00 ? 29 LYS B HE2  13 
ATOM 10148 H HE3  . LYS B 2 29 ? -7.489  16.903  1.360   1.00 0.00 ? 29 LYS B HE3  13 
ATOM 10149 H HZ1  . LYS B 2 29 ? -5.727  16.265  3.364   1.00 0.00 ? 29 LYS B HZ1  13 
ATOM 10150 H HZ2  . LYS B 2 29 ? -5.056  17.642  2.631   1.00 0.00 ? 29 LYS B HZ2  13 
ATOM 10151 H HZ3  . LYS B 2 29 ? -6.643  17.687  3.236   1.00 0.00 ? 29 LYS B HZ3  13 
ATOM 10152 N N    . THR B 2 30 ? -5.800  14.220  -1.953  1.00 0.00 ? 30 THR B N    13 
ATOM 10153 C CA   . THR B 2 30 ? -5.420  15.107  -3.088  1.00 0.00 ? 30 THR B CA   13 
ATOM 10154 C C    . THR B 2 30 ? -6.515  16.152  -3.307  1.00 0.00 ? 30 THR B C    13 
ATOM 10155 O O    . THR B 2 30 ? -6.229  17.162  -3.930  1.00 0.00 ? 30 THR B O    13 
ATOM 10156 C CB   . THR B 2 30 ? -5.251  14.272  -4.359  1.00 0.00 ? 30 THR B CB   13 
ATOM 10157 O OG1  . THR B 2 30 ? -5.466  12.901  -4.053  1.00 0.00 ? 30 THR B OG1  13 
ATOM 10158 C CG2  . THR B 2 30 ? -3.839  14.458  -4.912  1.00 0.00 ? 30 THR B CG2  13 
ATOM 10159 O OXT  . THR B 2 30 ? -7.624  15.925  -2.849  1.00 0.00 ? 30 THR B OXT  13 
ATOM 10160 H H    . THR B 2 30 ? -6.744  14.010  -1.789  1.00 0.00 ? 30 THR B H    13 
ATOM 10161 H HA   . THR B 2 30 ? -4.490  15.604  -2.858  1.00 0.00 ? 30 THR B HA   13 
ATOM 10162 H HB   . THR B 2 30 ? -5.968  14.593  -5.099  1.00 0.00 ? 30 THR B HB   13 
ATOM 10163 H HG1  . THR B 2 30 ? -5.174  12.381  -4.805  1.00 0.00 ? 30 THR B HG1  13 
ATOM 10164 H HG21 . THR B 2 30 ? -3.178  14.773  -4.117  1.00 0.00 ? 30 THR B HG21 13 
ATOM 10165 H HG22 . THR B 2 30 ? -3.486  13.524  -5.324  1.00 0.00 ? 30 THR B HG22 13 
ATOM 10166 H HG23 . THR B 2 30 ? -3.851  15.210  -5.687  1.00 0.00 ? 30 THR B HG23 13 
ATOM 10167 N N    . GLY A 1 1  ? -2.658  5.959   8.951   1.00 0.00 ? 1  GLY A N    14 
ATOM 10168 C CA   . GLY A 1 1  ? -2.414  5.823   7.486   1.00 0.00 ? 1  GLY A CA   14 
ATOM 10169 C C    . GLY A 1 1  ? -1.201  4.928   7.250   1.00 0.00 ? 1  GLY A C    14 
ATOM 10170 O O    . GLY A 1 1  ? -0.266  4.906   8.026   1.00 0.00 ? 1  GLY A O    14 
ATOM 10171 H H1   . GLY A 1 1  ? -1.783  6.266   9.420   1.00 0.00 ? 1  GLY A H1   14 
ATOM 10172 H H2   . GLY A 1 1  ? -3.406  6.663   9.113   1.00 0.00 ? 1  GLY A H2   14 
ATOM 10173 H H3   . GLY A 1 1  ? -2.954  5.041   9.339   1.00 0.00 ? 1  GLY A H3   14 
ATOM 10174 H HA2  . GLY A 1 1  ? -3.282  5.377   7.016   1.00 0.00 ? 1  GLY A HA2  14 
ATOM 10175 H HA3  . GLY A 1 1  ? -2.230  6.795   7.057   1.00 0.00 ? 1  GLY A HA3  14 
ATOM 10176 N N    . ILE A 1 2  ? -1.218  4.187   6.183   1.00 0.00 ? 2  ILE A N    14 
ATOM 10177 C CA   . ILE A 1 2  ? -0.083  3.278   5.875   1.00 0.00 ? 2  ILE A CA   14 
ATOM 10178 C C    . ILE A 1 2  ? 0.946   4.017   5.011   1.00 0.00 ? 2  ILE A C    14 
ATOM 10179 O O    . ILE A 1 2  ? 2.009   3.505   4.720   1.00 0.00 ? 2  ILE A O    14 
ATOM 10180 C CB   . ILE A 1 2  ? -0.643  2.059   5.132   1.00 0.00 ? 2  ILE A CB   14 
ATOM 10181 C CG1  . ILE A 1 2  ? 0.143   0.805   5.504   1.00 0.00 ? 2  ILE A CG1  14 
ATOM 10182 C CG2  . ILE A 1 2  ? -0.575  2.268   3.611   1.00 0.00 ? 2  ILE A CG2  14 
ATOM 10183 C CD1  . ILE A 1 2  ? -0.669  -0.430  5.103   1.00 0.00 ? 2  ILE A CD1  14 
ATOM 10184 H H    . ILE A 1 2  ? -1.988  4.222   5.579   1.00 0.00 ? 2  ILE A H    14 
ATOM 10185 H HA   . ILE A 1 2  ? 0.385   2.955   6.795   1.00 0.00 ? 2  ILE A HA   14 
ATOM 10186 H HB   . ILE A 1 2  ? -1.672  1.925   5.427   1.00 0.00 ? 2  ILE A HB   14 
ATOM 10187 H HG12 . ILE A 1 2  ? 1.088   0.806   4.982   1.00 0.00 ? 2  ILE A HG12 14 
ATOM 10188 H HG13 . ILE A 1 2  ? 0.316   0.790   6.570   1.00 0.00 ? 2  ILE A HG13 14 
ATOM 10189 H HG21 . ILE A 1 2  ? -1.026  3.216   3.359   1.00 0.00 ? 2  ILE A HG21 14 
ATOM 10190 H HG22 . ILE A 1 2  ? 0.457   2.265   3.294   1.00 0.00 ? 2  ILE A HG22 14 
ATOM 10191 H HG23 . ILE A 1 2  ? -1.108  1.473   3.113   1.00 0.00 ? 2  ILE A HG23 14 
ATOM 10192 H HD11 . ILE A 1 2  ? -1.249  -0.212  4.213   1.00 0.00 ? 2  ILE A HD11 14 
ATOM 10193 H HD12 . ILE A 1 2  ? 0.004   -1.247  4.901   1.00 0.00 ? 2  ILE A HD12 14 
ATOM 10194 H HD13 . ILE A 1 2  ? -1.334  -0.701  5.907   1.00 0.00 ? 2  ILE A HD13 14 
ATOM 10195 N N    . VAL A 1 3  ? 0.634   5.215   4.591   1.00 0.00 ? 3  VAL A N    14 
ATOM 10196 C CA   . VAL A 1 3  ? 1.588   5.981   3.742   1.00 0.00 ? 3  VAL A CA   14 
ATOM 10197 C C    . VAL A 1 3  ? 2.716   6.535   4.613   1.00 0.00 ? 3  VAL A C    14 
ATOM 10198 O O    . VAL A 1 3  ? 3.855   6.605   4.199   1.00 0.00 ? 3  VAL A O    14 
ATOM 10199 C CB   . VAL A 1 3  ? 0.852   7.138   3.065   1.00 0.00 ? 3  VAL A CB   14 
ATOM 10200 C CG1  . VAL A 1 3  ? 1.840   7.954   2.229   1.00 0.00 ? 3  VAL A CG1  14 
ATOM 10201 C CG2  . VAL A 1 3  ? -0.245  6.581   2.155   1.00 0.00 ? 3  VAL A CG2  14 
ATOM 10202 H H    . VAL A 1 3  ? -0.233  5.606   4.832   1.00 0.00 ? 3  VAL A H    14 
ATOM 10203 H HA   . VAL A 1 3  ? 2.002   5.329   2.989   1.00 0.00 ? 3  VAL A HA   14 
ATOM 10204 H HB   . VAL A 1 3  ? 0.409   7.773   3.818   1.00 0.00 ? 3  VAL A HB   14 
ATOM 10205 H HG11 . VAL A 1 3  ? 2.775   8.043   2.763   1.00 0.00 ? 3  VAL A HG11 14 
ATOM 10206 H HG12 . VAL A 1 3  ? 2.013   7.455   1.287   1.00 0.00 ? 3  VAL A HG12 14 
ATOM 10207 H HG13 . VAL A 1 3  ? 1.433   8.937   2.047   1.00 0.00 ? 3  VAL A HG13 14 
ATOM 10208 H HG21 . VAL A 1 3  ? 0.030   5.591   1.824   1.00 0.00 ? 3  VAL A HG21 14 
ATOM 10209 H HG22 . VAL A 1 3  ? -1.176  6.533   2.700   1.00 0.00 ? 3  VAL A HG22 14 
ATOM 10210 H HG23 . VAL A 1 3  ? -0.363  7.226   1.297   1.00 0.00 ? 3  VAL A HG23 14 
ATOM 10211 N N    . GLU A 1 4  ? 2.409   6.928   5.818   1.00 0.00 ? 4  GLU A N    14 
ATOM 10212 C CA   . GLU A 1 4  ? 3.466   7.475   6.715   1.00 0.00 ? 4  GLU A CA   14 
ATOM 10213 C C    . GLU A 1 4  ? 4.385   6.339   7.177   1.00 0.00 ? 4  GLU A C    14 
ATOM 10214 O O    . GLU A 1 4  ? 5.354   6.560   7.875   1.00 0.00 ? 4  GLU A O    14 
ATOM 10215 C CB   . GLU A 1 4  ? 2.812   8.130   7.934   1.00 0.00 ? 4  GLU A CB   14 
ATOM 10216 C CG   . GLU A 1 4  ? 3.838   9.004   8.657   1.00 0.00 ? 4  GLU A CG   14 
ATOM 10217 C CD   . GLU A 1 4  ? 3.295   9.401   10.032  1.00 0.00 ? 4  GLU A CD   14 
ATOM 10218 O OE1  . GLU A 1 4  ? 2.120   9.182   10.268  1.00 0.00 ? 4  GLU A OE1  14 
ATOM 10219 O OE2  . GLU A 1 4  ? 4.067   9.916   10.825  1.00 0.00 ? 4  GLU A OE2  14 
ATOM 10220 H H    . GLU A 1 4  ? 1.482   6.863   6.135   1.00 0.00 ? 4  GLU A H    14 
ATOM 10221 H HA   . GLU A 1 4  ? 4.045   8.211   6.179   1.00 0.00 ? 4  GLU A HA   14 
ATOM 10222 H HB2  . GLU A 1 4  ? 1.981   8.741   7.611   1.00 0.00 ? 4  GLU A HB2  14 
ATOM 10223 H HB3  . GLU A 1 4  ? 2.457   7.364   8.606   1.00 0.00 ? 4  GLU A HB3  14 
ATOM 10224 H HG2  . GLU A 1 4  ? 4.759   8.452   8.779   1.00 0.00 ? 4  GLU A HG2  14 
ATOM 10225 H HG3  . GLU A 1 4  ? 4.026   9.893   8.076   1.00 0.00 ? 4  GLU A HG3  14 
ATOM 10226 N N    . GLN A 1 5  ? 4.086   5.126   6.796   1.00 0.00 ? 5  GLN A N    14 
ATOM 10227 C CA   . GLN A 1 5  ? 4.943   3.981   7.217   1.00 0.00 ? 5  GLN A CA   14 
ATOM 10228 C C    . GLN A 1 5  ? 5.458   3.241   5.980   1.00 0.00 ? 5  GLN A C    14 
ATOM 10229 O O    . GLN A 1 5  ? 6.432   2.515   6.039   1.00 0.00 ? 5  GLN A O    14 
ATOM 10230 C CB   . GLN A 1 5  ? 4.114   3.019   8.070   1.00 0.00 ? 5  GLN A CB   14 
ATOM 10231 C CG   . GLN A 1 5  ? 5.024   1.925   8.635   1.00 0.00 ? 5  GLN A CG   14 
ATOM 10232 C CD   . GLN A 1 5  ? 5.636   2.401   9.955   1.00 0.00 ? 5  GLN A CD   14 
ATOM 10233 O OE1  . GLN A 1 5  ? 6.366   3.371   9.983   1.00 0.00 ? 5  GLN A OE1  14 
ATOM 10234 N NE2  . GLN A 1 5  ? 5.368   1.751   11.055  1.00 0.00 ? 5  GLN A NE2  14 
ATOM 10235 H H    . GLN A 1 5  ? 3.298   4.968   6.238   1.00 0.00 ? 5  GLN A H    14 
ATOM 10236 H HA   . GLN A 1 5  ? 5.779   4.346   7.794   1.00 0.00 ? 5  GLN A HA   14 
ATOM 10237 H HB2  . GLN A 1 5  ? 3.657   3.564   8.883   1.00 0.00 ? 5  GLN A HB2  14 
ATOM 10238 H HB3  . GLN A 1 5  ? 3.347   2.570   7.458   1.00 0.00 ? 5  GLN A HB3  14 
ATOM 10239 H HG2  . GLN A 1 5  ? 4.445   1.030   8.807   1.00 0.00 ? 5  GLN A HG2  14 
ATOM 10240 H HG3  . GLN A 1 5  ? 5.813   1.714   7.929   1.00 0.00 ? 5  GLN A HG3  14 
ATOM 10241 H HE21 . GLN A 1 5  ? 4.782   0.968   11.032  1.00 0.00 ? 5  GLN A HE21 14 
ATOM 10242 H HE22 . GLN A 1 5  ? 5.756   2.049   11.905  1.00 0.00 ? 5  GLN A HE22 14 
ATOM 10243 N N    . CYS A 1 6  ? 4.808   3.411   4.863   1.00 0.00 ? 6  CYS A N    14 
ATOM 10244 C CA   . CYS A 1 6  ? 5.250   2.715   3.621   1.00 0.00 ? 6  CYS A CA   14 
ATOM 10245 C C    . CYS A 1 6  ? 6.066   3.673   2.753   1.00 0.00 ? 6  CYS A C    14 
ATOM 10246 O O    . CYS A 1 6  ? 7.193   3.397   2.397   1.00 0.00 ? 6  CYS A O    14 
ATOM 10247 C CB   . CYS A 1 6  ? 4.021   2.256   2.837   1.00 0.00 ? 6  CYS A CB   14 
ATOM 10248 S SG   . CYS A 1 6  ? 3.230   0.876   3.698   1.00 0.00 ? 6  CYS A SG   14 
ATOM 10249 H H    . CYS A 1 6  ? 4.024   3.994   4.842   1.00 0.00 ? 6  CYS A H    14 
ATOM 10250 H HA   . CYS A 1 6  ? 5.852   1.858   3.880   1.00 0.00 ? 6  CYS A HA   14 
ATOM 10251 H HB2  . CYS A 1 6  ? 3.323   3.076   2.757   1.00 0.00 ? 6  CYS A HB2  14 
ATOM 10252 H HB3  . CYS A 1 6  ? 4.322   1.940   1.848   1.00 0.00 ? 6  CYS A HB3  14 
ATOM 10253 N N    . CYS A 1 7  ? 5.498   4.793   2.403   1.00 0.00 ? 7  CYS A N    14 
ATOM 10254 C CA   . CYS A 1 7  ? 6.233   5.766   1.550   1.00 0.00 ? 7  CYS A CA   14 
ATOM 10255 C C    . CYS A 1 7  ? 7.399   6.368   2.337   1.00 0.00 ? 7  CYS A C    14 
ATOM 10256 O O    . CYS A 1 7  ? 8.529   6.355   1.895   1.00 0.00 ? 7  CYS A O    14 
ATOM 10257 C CB   . CYS A 1 7  ? 5.276   6.878   1.115   1.00 0.00 ? 7  CYS A CB   14 
ATOM 10258 S SG   . CYS A 1 7  ? 6.213   8.228   0.352   1.00 0.00 ? 7  CYS A SG   14 
ATOM 10259 H H    . CYS A 1 7  ? 4.584   4.991   2.696   1.00 0.00 ? 7  CYS A H    14 
ATOM 10260 H HA   . CYS A 1 7  ? 6.615   5.261   0.675   1.00 0.00 ? 7  CYS A HA   14 
ATOM 10261 H HB2  . CYS A 1 7  ? 4.569   6.484   0.400   1.00 0.00 ? 7  CYS A HB2  14 
ATOM 10262 H HB3  . CYS A 1 7  ? 4.742   7.251   1.977   1.00 0.00 ? 7  CYS A HB3  14 
ATOM 10263 N N    . THR A 1 8  ? 7.139   6.900   3.500   1.00 0.00 ? 8  THR A N    14 
ATOM 10264 C CA   . THR A 1 8  ? 8.243   7.502   4.300   1.00 0.00 ? 8  THR A CA   14 
ATOM 10265 C C    . THR A 1 8  ? 9.304   6.437   4.587   1.00 0.00 ? 8  THR A C    14 
ATOM 10266 O O    . THR A 1 8  ? 10.458  6.591   4.238   1.00 0.00 ? 8  THR A O    14 
ATOM 10267 C CB   . THR A 1 8  ? 7.683   8.039   5.621   1.00 0.00 ? 8  THR A CB   14 
ATOM 10268 O OG1  . THR A 1 8  ? 7.046   6.984   6.326   1.00 0.00 ? 8  THR A OG1  14 
ATOM 10269 C CG2  . THR A 1 8  ? 6.672   9.150   5.332   1.00 0.00 ? 8  THR A CG2  14 
ATOM 10270 H H    . THR A 1 8  ? 6.222   6.906   3.844   1.00 0.00 ? 8  THR A H    14 
ATOM 10271 H HA   . THR A 1 8  ? 8.689   8.313   3.744   1.00 0.00 ? 8  THR A HA   14 
ATOM 10272 H HB   . THR A 1 8  ? 8.489   8.437   6.218   1.00 0.00 ? 8  THR A HB   14 
ATOM 10273 H HG1  . THR A 1 8  ? 7.707   6.551   6.873   1.00 0.00 ? 8  THR A HG1  14 
ATOM 10274 H HG21 . THR A 1 8  ? 7.151   9.936   4.768   1.00 0.00 ? 8  THR A HG21 14 
ATOM 10275 H HG22 . THR A 1 8  ? 5.847   8.748   4.761   1.00 0.00 ? 8  THR A HG22 14 
ATOM 10276 H HG23 . THR A 1 8  ? 6.301   9.549   6.265   1.00 0.00 ? 8  THR A HG23 14 
ATOM 10277 N N    . SER A 1 9  ? 8.926   5.359   5.216   1.00 0.00 ? 9  SER A N    14 
ATOM 10278 C CA   . SER A 1 9  ? 9.916   4.288   5.519   1.00 0.00 ? 9  SER A CA   14 
ATOM 10279 C C    . SER A 1 9  ? 9.660   3.084   4.606   1.00 0.00 ? 9  SER A C    14 
ATOM 10280 O O    . SER A 1 9  ? 9.244   3.231   3.475   1.00 0.00 ? 9  SER A O    14 
ATOM 10281 C CB   . SER A 1 9  ? 9.776   3.864   6.981   1.00 0.00 ? 9  SER A CB   14 
ATOM 10282 O OG   . SER A 1 9  ? 9.160   4.914   7.716   1.00 0.00 ? 9  SER A OG   14 
ATOM 10283 H H    . SER A 1 9  ? 7.990   5.253   5.489   1.00 0.00 ? 9  SER A H    14 
ATOM 10284 H HA   . SER A 1 9  ? 10.915  4.662   5.347   1.00 0.00 ? 9  SER A HA   14 
ATOM 10285 H HB2  . SER A 1 9  ? 9.163   2.980   7.044   1.00 0.00 ? 9  SER A HB2  14 
ATOM 10286 H HB3  . SER A 1 9  ? 10.755  3.649   7.388   1.00 0.00 ? 9  SER A HB3  14 
ATOM 10287 H HG   . SER A 1 9  ? 8.379   4.556   8.145   1.00 0.00 ? 9  SER A HG   14 
ATOM 10288 N N    . ILE A 1 10 ? 9.905   1.894   5.087   1.00 0.00 ? 10 ILE A N    14 
ATOM 10289 C CA   . ILE A 1 10 ? 9.673   0.687   4.245   1.00 0.00 ? 10 ILE A CA   14 
ATOM 10290 C C    . ILE A 1 10 ? 8.793   -0.303  5.010   1.00 0.00 ? 10 ILE A C    14 
ATOM 10291 O O    . ILE A 1 10 ? 9.278   -1.207  5.663   1.00 0.00 ? 10 ILE A O    14 
ATOM 10292 C CB   . ILE A 1 10 ? 11.013  0.030   3.912   1.00 0.00 ? 10 ILE A CB   14 
ATOM 10293 C CG1  . ILE A 1 10 ? 11.976  1.086   3.367   1.00 0.00 ? 10 ILE A CG1  14 
ATOM 10294 C CG2  . ILE A 1 10 ? 10.799  -1.060  2.859   1.00 0.00 ? 10 ILE A CG2  14 
ATOM 10295 C CD1  . ILE A 1 10 ? 13.192  0.401   2.742   1.00 0.00 ? 10 ILE A CD1  14 
ATOM 10296 H H    . ILE A 1 10 ? 10.242  1.797   6.003   1.00 0.00 ? 10 ILE A H    14 
ATOM 10297 H HA   . ILE A 1 10 ? 9.178   0.979   3.330   1.00 0.00 ? 10 ILE A HA   14 
ATOM 10298 H HB   . ILE A 1 10 ? 11.428  -0.412  4.807   1.00 0.00 ? 10 ILE A HB   14 
ATOM 10299 H HG12 . ILE A 1 10 ? 11.472  1.680   2.617   1.00 0.00 ? 10 ILE A HG12 14 
ATOM 10300 H HG13 . ILE A 1 10 ? 12.301  1.728   4.174   1.00 0.00 ? 10 ILE A HG13 14 
ATOM 10301 H HG21 . ILE A 1 10 ? 9.757   -1.345  2.844   1.00 0.00 ? 10 ILE A HG21 14 
ATOM 10302 H HG22 . ILE A 1 10 ? 11.085  -0.683  1.888   1.00 0.00 ? 10 ILE A HG22 14 
ATOM 10303 H HG23 . ILE A 1 10 ? 11.403  -1.921  3.104   1.00 0.00 ? 10 ILE A HG23 14 
ATOM 10304 H HD11 . ILE A 1 10 ? 12.862  -0.338  2.027   1.00 0.00 ? 10 ILE A HD11 14 
ATOM 10305 H HD12 . ILE A 1 10 ? 13.804  1.138   2.243   1.00 0.00 ? 10 ILE A HD12 14 
ATOM 10306 H HD13 . ILE A 1 10 ? 13.771  -0.081  3.516   1.00 0.00 ? 10 ILE A HD13 14 
ATOM 10307 N N    . CYS A 1 11 ? 7.500   -0.139  4.937   1.00 0.00 ? 11 CYS A N    14 
ATOM 10308 C CA   . CYS A 1 11 ? 6.586   -1.067  5.662   1.00 0.00 ? 11 CYS A CA   14 
ATOM 10309 C C    . CYS A 1 11 ? 6.678   -2.468  5.051   1.00 0.00 ? 11 CYS A C    14 
ATOM 10310 O O    . CYS A 1 11 ? 7.482   -2.722  4.175   1.00 0.00 ? 11 CYS A O    14 
ATOM 10311 C CB   . CYS A 1 11 ? 5.150   -0.555  5.541   1.00 0.00 ? 11 CYS A CB   14 
ATOM 10312 S SG   . CYS A 1 11 ? 4.667   -0.539  3.797   1.00 0.00 ? 11 CYS A SG   14 
ATOM 10313 H H    . CYS A 1 11 ? 7.129   0.597   4.407   1.00 0.00 ? 11 CYS A H    14 
ATOM 10314 H HA   . CYS A 1 11 ? 6.865   -1.109  6.704   1.00 0.00 ? 11 CYS A HA   14 
ATOM 10315 H HB2  . CYS A 1 11 ? 4.488   -1.205  6.093   1.00 0.00 ? 11 CYS A HB2  14 
ATOM 10316 H HB3  . CYS A 1 11 ? 5.091   0.447   5.940   1.00 0.00 ? 11 CYS A HB3  14 
ATOM 10317 N N    . SER A 1 12 ? 5.859   -3.376  5.508   1.00 0.00 ? 12 SER A N    14 
ATOM 10318 C CA   . SER A 1 12 ? 5.898   -4.761  4.958   1.00 0.00 ? 12 SER A CA   14 
ATOM 10319 C C    . SER A 1 12 ? 4.599   -5.050  4.202   1.00 0.00 ? 12 SER A C    14 
ATOM 10320 O O    . SER A 1 12 ? 3.634   -4.317  4.302   1.00 0.00 ? 12 SER A O    14 
ATOM 10321 C CB   . SER A 1 12 ? 6.043   -5.761  6.106   1.00 0.00 ? 12 SER A CB   14 
ATOM 10322 O OG   . SER A 1 12 ? 5.322   -5.285  7.235   1.00 0.00 ? 12 SER A OG   14 
ATOM 10323 H H    . SER A 1 12 ? 5.220   -3.150  6.215   1.00 0.00 ? 12 SER A H    14 
ATOM 10324 H HA   . SER A 1 12 ? 6.737   -4.860  4.285   1.00 0.00 ? 12 SER A HA   14 
ATOM 10325 H HB2  . SER A 1 12 ? 5.645   -6.715  5.808   1.00 0.00 ? 12 SER A HB2  14 
ATOM 10326 H HB3  . SER A 1 12 ? 7.092   -5.871  6.355   1.00 0.00 ? 12 SER A HB3  14 
ATOM 10327 H HG   . SER A 1 12 ? 4.887   -6.035  7.646   1.00 0.00 ? 12 SER A HG   14 
ATOM 10328 N N    . LEU A 1 13 ? 4.564   -6.115  3.448   1.00 0.00 ? 13 LEU A N    14 
ATOM 10329 C CA   . LEU A 1 13 ? 3.326   -6.453  2.692   1.00 0.00 ? 13 LEU A CA   14 
ATOM 10330 C C    . LEU A 1 13 ? 2.201   -6.762  3.682   1.00 0.00 ? 13 LEU A C    14 
ATOM 10331 O O    . LEU A 1 13 ? 1.033   -6.715  3.346   1.00 0.00 ? 13 LEU A O    14 
ATOM 10332 C CB   . LEU A 1 13 ? 3.581   -7.675  1.806   1.00 0.00 ? 13 LEU A CB   14 
ATOM 10333 C CG   . LEU A 1 13 ? 3.253   -7.334  0.351   1.00 0.00 ? 13 LEU A CG   14 
ATOM 10334 C CD1  . LEU A 1 13 ? 1.784   -6.922  0.239   1.00 0.00 ? 13 LEU A CD1  14 
ATOM 10335 C CD2  . LEU A 1 13 ? 4.143   -6.178  -0.114  1.00 0.00 ? 13 LEU A CD2  14 
ATOM 10336 H H    . LEU A 1 13 ? 5.351   -6.695  3.382   1.00 0.00 ? 13 LEU A H    14 
ATOM 10337 H HA   . LEU A 1 13 ? 3.040   -5.612  2.075   1.00 0.00 ? 13 LEU A HA   14 
ATOM 10338 H HB2  . LEU A 1 13 ? 4.620   -7.961  1.884   1.00 0.00 ? 13 LEU A HB2  14 
ATOM 10339 H HB3  . LEU A 1 13 ? 2.957   -8.494  2.131   1.00 0.00 ? 13 LEU A HB3  14 
ATOM 10340 H HG   . LEU A 1 13 ? 3.432   -8.201  -0.270  1.00 0.00 ? 13 LEU A HG   14 
ATOM 10341 H HD11 . LEU A 1 13 ? 1.214   -7.407  1.015   1.00 0.00 ? 13 LEU A HD11 14 
ATOM 10342 H HD12 . LEU A 1 13 ? 1.701   -5.850  0.349   1.00 0.00 ? 13 LEU A HD12 14 
ATOM 10343 H HD13 . LEU A 1 13 ? 1.401   -7.215  -0.727  1.00 0.00 ? 13 LEU A HD13 14 
ATOM 10344 H HD21 . LEU A 1 13 ? 5.111   -6.255  0.360   1.00 0.00 ? 13 LEU A HD21 14 
ATOM 10345 H HD22 . LEU A 1 13 ? 4.263   -6.226  -1.186  1.00 0.00 ? 13 LEU A HD22 14 
ATOM 10346 H HD23 . LEU A 1 13 ? 3.684   -5.239  0.156   1.00 0.00 ? 13 LEU A HD23 14 
ATOM 10347 N N    . TYR A 1 14 ? 2.543   -7.075  4.902   1.00 0.00 ? 14 TYR A N    14 
ATOM 10348 C CA   . TYR A 1 14 ? 1.496   -7.383  5.919   1.00 0.00 ? 14 TYR A CA   14 
ATOM 10349 C C    . TYR A 1 14 ? 0.730   -6.105  6.265   1.00 0.00 ? 14 TYR A C    14 
ATOM 10350 O O    . TYR A 1 14 ? -0.430  -6.146  6.629   1.00 0.00 ? 14 TYR A O    14 
ATOM 10351 C CB   . TYR A 1 14 ? 2.163   -7.938  7.182   1.00 0.00 ? 14 TYR A CB   14 
ATOM 10352 C CG   . TYR A 1 14 ? 1.158   -7.976  8.308   1.00 0.00 ? 14 TYR A CG   14 
ATOM 10353 C CD1  . TYR A 1 14 ? 0.114   -8.907  8.284   1.00 0.00 ? 14 TYR A CD1  14 
ATOM 10354 C CD2  . TYR A 1 14 ? 1.271   -7.078  9.378   1.00 0.00 ? 14 TYR A CD2  14 
ATOM 10355 C CE1  . TYR A 1 14 ? -0.818  -8.942  9.328   1.00 0.00 ? 14 TYR A CE1  14 
ATOM 10356 C CE2  . TYR A 1 14 ? 0.341   -7.113  10.422  1.00 0.00 ? 14 TYR A CE2  14 
ATOM 10357 C CZ   . TYR A 1 14 ? -0.706  -8.043  10.396  1.00 0.00 ? 14 TYR A CZ   14 
ATOM 10358 O OH   . TYR A 1 14 ? -1.625  -8.078  11.425  1.00 0.00 ? 14 TYR A OH   14 
ATOM 10359 H H    . TYR A 1 14 ? 3.491   -7.103  5.152   1.00 0.00 ? 14 TYR A H    14 
ATOM 10360 H HA   . TYR A 1 14 ? 0.811   -8.117  5.522   1.00 0.00 ? 14 TYR A HA   14 
ATOM 10361 H HB2  . TYR A 1 14 ? 2.525   -8.939  6.988   1.00 0.00 ? 14 TYR A HB2  14 
ATOM 10362 H HB3  . TYR A 1 14 ? 2.990   -7.304  7.461   1.00 0.00 ? 14 TYR A HB3  14 
ATOM 10363 H HD1  . TYR A 1 14 ? 0.026   -9.599  7.460   1.00 0.00 ? 14 TYR A HD1  14 
ATOM 10364 H HD2  . TYR A 1 14 ? 2.078   -6.361  9.396   1.00 0.00 ? 14 TYR A HD2  14 
ATOM 10365 H HE1  . TYR A 1 14 ? -1.624  -9.659  9.309   1.00 0.00 ? 14 TYR A HE1  14 
ATOM 10366 H HE2  . TYR A 1 14 ? 0.427   -6.421  11.247  1.00 0.00 ? 14 TYR A HE2  14 
ATOM 10367 H HH   . TYR A 1 14 ? -2.485  -7.856  11.061  1.00 0.00 ? 14 TYR A HH   14 
ATOM 10368 N N    . GLN A 1 15 ? 1.363   -4.970  6.152   1.00 0.00 ? 15 GLN A N    14 
ATOM 10369 C CA   . GLN A 1 15 ? 0.664   -3.696  6.474   1.00 0.00 ? 15 GLN A CA   14 
ATOM 10370 C C    . GLN A 1 15 ? -0.436  -3.447  5.440   1.00 0.00 ? 15 GLN A C    14 
ATOM 10371 O O    . GLN A 1 15 ? -1.555  -3.120  5.779   1.00 0.00 ? 15 GLN A O    14 
ATOM 10372 C CB   . GLN A 1 15 ? 1.666   -2.540  6.451   1.00 0.00 ? 15 GLN A CB   14 
ATOM 10373 C CG   . GLN A 1 15 ? 2.588   -2.641  7.668   1.00 0.00 ? 15 GLN A CG   14 
ATOM 10374 C CD   . GLN A 1 15 ? 1.746   -2.678  8.946   1.00 0.00 ? 15 GLN A CD   14 
ATOM 10375 O OE1  . GLN A 1 15 ? 0.585   -2.316  8.934   1.00 0.00 ? 15 GLN A OE1  14 
ATOM 10376 N NE2  . GLN A 1 15 ? 2.283   -3.103  10.059  1.00 0.00 ? 15 GLN A NE2  14 
ATOM 10377 H H    . GLN A 1 15 ? 2.298   -4.957  5.856   1.00 0.00 ? 15 GLN A H    14 
ATOM 10378 H HA   . GLN A 1 15 ? 0.221   -3.768  7.457   1.00 0.00 ? 15 GLN A HA   14 
ATOM 10379 H HB2  . GLN A 1 15 ? 2.254   -2.592  5.547   1.00 0.00 ? 15 GLN A HB2  14 
ATOM 10380 H HB3  . GLN A 1 15 ? 1.134   -1.602  6.483   1.00 0.00 ? 15 GLN A HB3  14 
ATOM 10381 H HG2  . GLN A 1 15 ? 3.177   -3.545  7.601   1.00 0.00 ? 15 GLN A HG2  14 
ATOM 10382 H HG3  . GLN A 1 15 ? 3.243   -1.785  7.697   1.00 0.00 ? 15 GLN A HG3  14 
ATOM 10383 H HE21 . GLN A 1 15 ? 3.219   -3.395  10.069  1.00 0.00 ? 15 GLN A HE21 14 
ATOM 10384 H HE22 . GLN A 1 15 ? 1.751   -3.131  10.880  1.00 0.00 ? 15 GLN A HE22 14 
ATOM 10385 N N    . LEU A 1 16 ? -0.125  -3.594  4.180   1.00 0.00 ? 16 LEU A N    14 
ATOM 10386 C CA   . LEU A 1 16 ? -1.153  -3.366  3.128   1.00 0.00 ? 16 LEU A CA   14 
ATOM 10387 C C    . LEU A 1 16 ? -2.313  -4.343  3.324   1.00 0.00 ? 16 LEU A C    14 
ATOM 10388 O O    . LEU A 1 16 ? -3.364  -4.195  2.733   1.00 0.00 ? 16 LEU A O    14 
ATOM 10389 C CB   . LEU A 1 16 ? -0.537  -3.581  1.743   1.00 0.00 ? 16 LEU A CB   14 
ATOM 10390 C CG   . LEU A 1 16 ? 0.673   -2.657  1.529   1.00 0.00 ? 16 LEU A CG   14 
ATOM 10391 C CD1  . LEU A 1 16 ? 0.793   -2.334  0.044   1.00 0.00 ? 16 LEU A CD1  14 
ATOM 10392 C CD2  . LEU A 1 16 ? 0.503   -1.342  2.302   1.00 0.00 ? 16 LEU A CD2  14 
ATOM 10393 H H    . LEU A 1 16 ? 0.780   -3.852  3.926   1.00 0.00 ? 16 LEU A H    14 
ATOM 10394 H HA   . LEU A 1 16 ? -1.524  -2.354  3.202   1.00 0.00 ? 16 LEU A HA   14 
ATOM 10395 H HB2  . LEU A 1 16 ? -0.216  -4.610  1.654   1.00 0.00 ? 16 LEU A HB2  14 
ATOM 10396 H HB3  . LEU A 1 16 ? -1.279  -3.377  0.987   1.00 0.00 ? 16 LEU A HB3  14 
ATOM 10397 H HG   . LEU A 1 16 ? 1.571   -3.159  1.861   1.00 0.00 ? 16 LEU A HG   14 
ATOM 10398 H HD11 . LEU A 1 16 ? -0.027  -2.792  -0.489  1.00 0.00 ? 16 LEU A HD11 14 
ATOM 10399 H HD12 . LEU A 1 16 ? 0.758   -1.264  -0.093  1.00 0.00 ? 16 LEU A HD12 14 
ATOM 10400 H HD13 . LEU A 1 16 ? 1.729   -2.716  -0.335  1.00 0.00 ? 16 LEU A HD13 14 
ATOM 10401 H HD21 . LEU A 1 16 ? -0.541  -1.071  2.332   1.00 0.00 ? 16 LEU A HD21 14 
ATOM 10402 H HD22 . LEU A 1 16 ? 0.874   -1.468  3.308   1.00 0.00 ? 16 LEU A HD22 14 
ATOM 10403 H HD23 . LEU A 1 16 ? 1.063   -0.561  1.809   1.00 0.00 ? 16 LEU A HD23 14 
ATOM 10404 N N    . GLU A 1 17 ? -2.141  -5.335  4.154   1.00 0.00 ? 17 GLU A N    14 
ATOM 10405 C CA   . GLU A 1 17 ? -3.250  -6.298  4.386   1.00 0.00 ? 17 GLU A CA   14 
ATOM 10406 C C    . GLU A 1 17 ? -4.434  -5.532  4.977   1.00 0.00 ? 17 GLU A C    14 
ATOM 10407 O O    . GLU A 1 17 ? -5.580  -5.809  4.680   1.00 0.00 ? 17 GLU A O    14 
ATOM 10408 C CB   . GLU A 1 17 ? -2.792  -7.382  5.361   1.00 0.00 ? 17 GLU A CB   14 
ATOM 10409 C CG   . GLU A 1 17 ? -1.721  -8.247  4.692   1.00 0.00 ? 17 GLU A CG   14 
ATOM 10410 C CD   . GLU A 1 17 ? -1.527  -9.534  5.493   1.00 0.00 ? 17 GLU A CD   14 
ATOM 10411 O OE1  . GLU A 1 17 ? -2.213  -9.698  6.489   1.00 0.00 ? 17 GLU A OE1  14 
ATOM 10412 O OE2  . GLU A 1 17 ? -0.699  -10.338 5.097   1.00 0.00 ? 17 GLU A OE2  14 
ATOM 10413 H H    . GLU A 1 17 ? -1.291  -5.441  4.628   1.00 0.00 ? 17 GLU A H    14 
ATOM 10414 H HA   . GLU A 1 17 ? -3.540  -6.749  3.448   1.00 0.00 ? 17 GLU A HA   14 
ATOM 10415 H HB2  . GLU A 1 17 ? -2.382  -6.920  6.247   1.00 0.00 ? 17 GLU A HB2  14 
ATOM 10416 H HB3  . GLU A 1 17 ? -3.632  -8.002  5.634   1.00 0.00 ? 17 GLU A HB3  14 
ATOM 10417 H HG2  . GLU A 1 17 ? -2.032  -8.490  3.686   1.00 0.00 ? 17 GLU A HG2  14 
ATOM 10418 H HG3  . GLU A 1 17 ? -0.788  -7.703  4.659   1.00 0.00 ? 17 GLU A HG3  14 
ATOM 10419 N N    . ASN A 1 18 ? -4.159  -4.556  5.800   1.00 0.00 ? 18 ASN A N    14 
ATOM 10420 C CA   . ASN A 1 18 ? -5.258  -3.747  6.401   1.00 0.00 ? 18 ASN A CA   14 
ATOM 10421 C C    . ASN A 1 18 ? -6.089  -3.134  5.276   1.00 0.00 ? 18 ASN A C    14 
ATOM 10422 O O    . ASN A 1 18 ? -7.264  -2.863  5.427   1.00 0.00 ? 18 ASN A O    14 
ATOM 10423 C CB   . ASN A 1 18 ? -4.662  -2.621  7.252   1.00 0.00 ? 18 ASN A CB   14 
ATOM 10424 C CG   . ASN A 1 18 ? -4.226  -3.176  8.610   1.00 0.00 ? 18 ASN A CG   14 
ATOM 10425 O OD1  . ASN A 1 18 ? -4.530  -2.605  9.639   1.00 0.00 ? 18 ASN A OD1  14 
ATOM 10426 N ND2  . ASN A 1 18 ? -3.523  -4.276  8.659   1.00 0.00 ? 18 ASN A ND2  14 
ATOM 10427 H H    . ASN A 1 18 ? -3.225  -4.347  6.011   1.00 0.00 ? 18 ASN A H    14 
ATOM 10428 H HA   . ASN A 1 18 ? -5.882  -4.379  7.016   1.00 0.00 ? 18 ASN A HA   14 
ATOM 10429 H HB2  . ASN A 1 18 ? -3.806  -2.197  6.741   1.00 0.00 ? 18 ASN A HB2  14 
ATOM 10430 H HB3  . ASN A 1 18 ? -5.405  -1.853  7.402   1.00 0.00 ? 18 ASN A HB3  14 
ATOM 10431 H HD21 . ASN A 1 18 ? -3.280  -4.739  7.831   1.00 0.00 ? 18 ASN A HD21 14 
ATOM 10432 H HD22 . ASN A 1 18 ? -3.241  -4.639  9.524   1.00 0.00 ? 18 ASN A HD22 14 
ATOM 10433 N N    . TYR A 1 19 ? -5.474  -2.908  4.149   1.00 0.00 ? 19 TYR A N    14 
ATOM 10434 C CA   . TYR A 1 19 ? -6.198  -2.300  2.997   1.00 0.00 ? 19 TYR A CA   14 
ATOM 10435 C C    . TYR A 1 19 ? -7.015  -3.355  2.244   1.00 0.00 ? 19 TYR A C    14 
ATOM 10436 O O    . TYR A 1 19 ? -7.145  -3.298  1.042   1.00 0.00 ? 19 TYR A O    14 
ATOM 10437 C CB   . TYR A 1 19 ? -5.174  -1.684  2.043   1.00 0.00 ? 19 TYR A CB   14 
ATOM 10438 C CG   . TYR A 1 19 ? -4.938  -0.262  2.446   1.00 0.00 ? 19 TYR A CG   14 
ATOM 10439 C CD1  . TYR A 1 19 ? -5.882  0.714   2.117   1.00 0.00 ? 19 TYR A CD1  14 
ATOM 10440 C CD2  . TYR A 1 19 ? -3.788  0.079   3.159   1.00 0.00 ? 19 TYR A CD2  14 
ATOM 10441 C CE1  . TYR A 1 19 ? -5.679  2.042   2.505   1.00 0.00 ? 19 TYR A CE1  14 
ATOM 10442 C CE2  . TYR A 1 19 ? -3.587  1.405   3.545   1.00 0.00 ? 19 TYR A CE2  14 
ATOM 10443 C CZ   . TYR A 1 19 ? -4.530  2.388   3.222   1.00 0.00 ? 19 TYR A CZ   14 
ATOM 10444 O OH   . TYR A 1 19 ? -4.324  3.696   3.608   1.00 0.00 ? 19 TYR A OH   14 
ATOM 10445 H H    . TYR A 1 19 ? -4.526  -3.125  4.064   1.00 0.00 ? 19 TYR A H    14 
ATOM 10446 H HA   . TYR A 1 19 ? -6.858  -1.526  3.357   1.00 0.00 ? 19 TYR A HA   14 
ATOM 10447 H HB2  . TYR A 1 19 ? -4.248  -2.237  2.099   1.00 0.00 ? 19 TYR A HB2  14 
ATOM 10448 H HB3  . TYR A 1 19 ? -5.551  -1.709  1.037   1.00 0.00 ? 19 TYR A HB3  14 
ATOM 10449 H HD1  . TYR A 1 19 ? -6.765  0.438   1.563   1.00 0.00 ? 19 TYR A HD1  14 
ATOM 10450 H HD2  . TYR A 1 19 ? -3.051  -0.680  3.402   1.00 0.00 ? 19 TYR A HD2  14 
ATOM 10451 H HE1  . TYR A 1 19 ? -6.408  2.798   2.252   1.00 0.00 ? 19 TYR A HE1  14 
ATOM 10452 H HE2  . TYR A 1 19 ? -2.712  1.668   4.101   1.00 0.00 ? 19 TYR A HE2  14 
ATOM 10453 H HH   . TYR A 1 19 ? -3.464  3.970   3.283   1.00 0.00 ? 19 TYR A HH   14 
ATOM 10454 N N    . CYS A 1 20 ? -7.578  -4.310  2.933   1.00 0.00 ? 20 CYS A N    14 
ATOM 10455 C CA   . CYS A 1 20 ? -8.389  -5.343  2.232   1.00 0.00 ? 20 CYS A CA   14 
ATOM 10456 C C    . CYS A 1 20 ? -9.744  -5.483  2.929   1.00 0.00 ? 20 CYS A C    14 
ATOM 10457 O O    . CYS A 1 20 ? -9.819  -5.648  4.131   1.00 0.00 ? 20 CYS A O    14 
ATOM 10458 C CB   . CYS A 1 20 ? -7.657  -6.685  2.269   1.00 0.00 ? 20 CYS A CB   14 
ATOM 10459 S SG   . CYS A 1 20 ? -6.130  -6.573  1.302   1.00 0.00 ? 20 CYS A SG   14 
ATOM 10460 H H    . CYS A 1 20 ? -7.479  -4.343  3.905   1.00 0.00 ? 20 CYS A H    14 
ATOM 10461 H HA   . CYS A 1 20 ? -8.544  -5.044  1.204   1.00 0.00 ? 20 CYS A HA   14 
ATOM 10462 H HB2  . CYS A 1 20 ? -7.418  -6.935  3.293   1.00 0.00 ? 20 CYS A HB2  14 
ATOM 10463 H HB3  . CYS A 1 20 ? -8.293  -7.451  1.851   1.00 0.00 ? 20 CYS A HB3  14 
ATOM 10464 N N    . ASN A 1 21 ? -10.816 -5.416  2.187   1.00 0.00 ? 21 ASN A N    14 
ATOM 10465 C CA   . ASN A 1 21 ? -12.163 -5.544  2.812   1.00 0.00 ? 21 ASN A CA   14 
ATOM 10466 C C    . ASN A 1 21 ? -12.490 -7.022  3.020   1.00 0.00 ? 21 ASN A C    14 
ATOM 10467 O O    . ASN A 1 21 ? -11.586 -7.768  3.359   1.00 0.00 ? 21 ASN A O    14 
ATOM 10468 C CB   . ASN A 1 21 ? -13.214 -4.911  1.896   1.00 0.00 ? 21 ASN A CB   14 
ATOM 10469 C CG   . ASN A 1 21 ? -14.433 -4.502  2.724   1.00 0.00 ? 21 ASN A CG   14 
ATOM 10470 O OD1  . ASN A 1 21 ? -14.318 -4.223  3.902   1.00 0.00 ? 21 ASN A OD1  14 
ATOM 10471 N ND2  . ASN A 1 21 ? -15.607 -4.458  2.155   1.00 0.00 ? 21 ASN A ND2  14 
ATOM 10472 O OXT  . ASN A 1 21 ? -13.640 -7.386  2.837   1.00 0.00 ? 21 ASN A OXT  14 
ATOM 10473 H H    . ASN A 1 21 ? -10.732 -5.282  1.220   1.00 0.00 ? 21 ASN A H    14 
ATOM 10474 H HA   . ASN A 1 21 ? -12.166 -5.037  3.766   1.00 0.00 ? 21 ASN A HA   14 
ATOM 10475 H HB2  . ASN A 1 21 ? -12.794 -4.038  1.415   1.00 0.00 ? 21 ASN A HB2  14 
ATOM 10476 H HB3  . ASN A 1 21 ? -13.514 -5.627  1.145   1.00 0.00 ? 21 ASN A HB3  14 
ATOM 10477 H HD21 . ASN A 1 21 ? -15.700 -4.684  1.208   1.00 0.00 ? 21 ASN A HD21 14 
ATOM 10478 H HD22 . ASN A 1 21 ? -16.395 -4.196  2.677   1.00 0.00 ? 21 ASN A HD22 14 
ATOM 10479 N N    . PHE B 2 1  ? 7.907   -9.449  -5.688  1.00 0.00 ? 1  PHE B N    14 
ATOM 10480 C CA   . PHE B 2 1  ? 7.808   -7.964  -5.615  1.00 0.00 ? 1  PHE B CA   14 
ATOM 10481 C C    . PHE B 2 1  ? 8.884   -7.424  -4.671  1.00 0.00 ? 1  PHE B C    14 
ATOM 10482 O O    . PHE B 2 1  ? 9.290   -8.083  -3.734  1.00 0.00 ? 1  PHE B O    14 
ATOM 10483 C CB   . PHE B 2 1  ? 6.425   -7.570  -5.091  1.00 0.00 ? 1  PHE B CB   14 
ATOM 10484 C CG   . PHE B 2 1  ? 6.207   -6.090  -5.305  1.00 0.00 ? 1  PHE B CG   14 
ATOM 10485 C CD1  . PHE B 2 1  ? 6.453   -5.520  -6.559  1.00 0.00 ? 1  PHE B CD1  14 
ATOM 10486 C CD2  . PHE B 2 1  ? 5.756   -5.291  -4.249  1.00 0.00 ? 1  PHE B CD2  14 
ATOM 10487 C CE1  . PHE B 2 1  ? 6.249   -4.149  -6.757  1.00 0.00 ? 1  PHE B CE1  14 
ATOM 10488 C CE2  . PHE B 2 1  ? 5.551   -3.919  -4.445  1.00 0.00 ? 1  PHE B CE2  14 
ATOM 10489 C CZ   . PHE B 2 1  ? 5.798   -3.349  -5.700  1.00 0.00 ? 1  PHE B CZ   14 
ATOM 10490 H H1   . PHE B 2 1  ? 8.115   -9.829  -4.741  1.00 0.00 ? 1  PHE B H1   14 
ATOM 10491 H H2   . PHE B 2 1  ? 7.006   -9.840  -6.028  1.00 0.00 ? 1  PHE B H2   14 
ATOM 10492 H H3   . PHE B 2 1  ? 8.669   -9.715  -6.343  1.00 0.00 ? 1  PHE B H3   14 
ATOM 10493 H HA   . PHE B 2 1  ? 7.953   -7.545  -6.601  1.00 0.00 ? 1  PHE B HA   14 
ATOM 10494 H HB2  . PHE B 2 1  ? 5.668   -8.125  -5.623  1.00 0.00 ? 1  PHE B HB2  14 
ATOM 10495 H HB3  . PHE B 2 1  ? 6.363   -7.792  -4.037  1.00 0.00 ? 1  PHE B HB3  14 
ATOM 10496 H HD1  . PHE B 2 1  ? 6.801   -6.136  -7.374  1.00 0.00 ? 1  PHE B HD1  14 
ATOM 10497 H HD2  . PHE B 2 1  ? 5.566   -5.731  -3.280  1.00 0.00 ? 1  PHE B HD2  14 
ATOM 10498 H HE1  . PHE B 2 1  ? 6.439   -3.708  -7.724  1.00 0.00 ? 1  PHE B HE1  14 
ATOM 10499 H HE2  . PHE B 2 1  ? 5.203   -3.303  -3.631  1.00 0.00 ? 1  PHE B HE2  14 
ATOM 10500 H HZ   . PHE B 2 1  ? 5.639   -2.292  -5.853  1.00 0.00 ? 1  PHE B HZ   14 
ATOM 10501 N N    . VAL B 2 2  ? 9.350   -6.227  -4.909  1.00 0.00 ? 2  VAL B N    14 
ATOM 10502 C CA   . VAL B 2 2  ? 10.399  -5.645  -4.025  1.00 0.00 ? 2  VAL B CA   14 
ATOM 10503 C C    . VAL B 2 2  ? 9.737   -4.781  -2.951  1.00 0.00 ? 2  VAL B C    14 
ATOM 10504 O O    . VAL B 2 2  ? 8.657   -4.260  -3.139  1.00 0.00 ? 2  VAL B O    14 
ATOM 10505 C CB   . VAL B 2 2  ? 11.348  -4.779  -4.860  1.00 0.00 ? 2  VAL B CB   14 
ATOM 10506 C CG1  . VAL B 2 2  ? 12.677  -4.619  -4.120  1.00 0.00 ? 2  VAL B CG1  14 
ATOM 10507 C CG2  . VAL B 2 2  ? 11.595  -5.451  -6.212  1.00 0.00 ? 2  VAL B CG2  14 
ATOM 10508 H H    . VAL B 2 2  ? 9.010   -5.712  -5.670  1.00 0.00 ? 2  VAL B H    14 
ATOM 10509 H HA   . VAL B 2 2  ? 10.958  -6.440  -3.556  1.00 0.00 ? 2  VAL B HA   14 
ATOM 10510 H HB   . VAL B 2 2  ? 10.902  -3.808  -5.015  1.00 0.00 ? 2  VAL B HB   14 
ATOM 10511 H HG11 . VAL B 2 2  ? 13.049  -5.592  -3.833  1.00 0.00 ? 2  VAL B HG11 14 
ATOM 10512 H HG12 . VAL B 2 2  ? 13.393  -4.137  -4.769  1.00 0.00 ? 2  VAL B HG12 14 
ATOM 10513 H HG13 . VAL B 2 2  ? 12.525  -4.015  -3.238  1.00 0.00 ? 2  VAL B HG13 14 
ATOM 10514 H HG21 . VAL B 2 2  ? 10.651  -5.711  -6.665  1.00 0.00 ? 2  VAL B HG21 14 
ATOM 10515 H HG22 . VAL B 2 2  ? 12.129  -4.770  -6.859  1.00 0.00 ? 2  VAL B HG22 14 
ATOM 10516 H HG23 . VAL B 2 2  ? 12.185  -6.345  -6.068  1.00 0.00 ? 2  VAL B HG23 14 
ATOM 10517 N N    . ASN B 2 3  ? 10.377  -4.625  -1.823  1.00 0.00 ? 3  ASN B N    14 
ATOM 10518 C CA   . ASN B 2 3  ? 9.783   -3.793  -0.738  1.00 0.00 ? 3  ASN B CA   14 
ATOM 10519 C C    . ASN B 2 3  ? 10.510  -2.449  -0.673  1.00 0.00 ? 3  ASN B C    14 
ATOM 10520 O O    . ASN B 2 3  ? 11.677  -2.379  -0.340  1.00 0.00 ? 3  ASN B O    14 
ATOM 10521 C CB   . ASN B 2 3  ? 9.927   -4.520  0.601   1.00 0.00 ? 3  ASN B CB   14 
ATOM 10522 C CG   . ASN B 2 3  ? 8.702   -4.232  1.471   1.00 0.00 ? 3  ASN B CG   14 
ATOM 10523 O OD1  . ASN B 2 3  ? 8.388   -3.088  1.739   1.00 0.00 ? 3  ASN B OD1  14 
ATOM 10524 N ND2  . ASN B 2 3  ? 7.992   -5.227  1.928   1.00 0.00 ? 3  ASN B ND2  14 
ATOM 10525 H H    . ASN B 2 3  ? 11.248  -5.054  -1.692  1.00 0.00 ? 3  ASN B H    14 
ATOM 10526 H HA   . ASN B 2 3  ? 8.736   -3.626  -0.946  1.00 0.00 ? 3  ASN B HA   14 
ATOM 10527 H HB2  . ASN B 2 3  ? 10.003  -5.584  0.426   1.00 0.00 ? 3  ASN B HB2  14 
ATOM 10528 H HB3  . ASN B 2 3  ? 10.815  -4.171  1.106   1.00 0.00 ? 3  ASN B HB3  14 
ATOM 10529 H HD21 . ASN B 2 3  ? 8.244   -6.148  1.711   1.00 0.00 ? 3  ASN B HD21 14 
ATOM 10530 H HD22 . ASN B 2 3  ? 7.206   -5.052  2.486   1.00 0.00 ? 3  ASN B HD22 14 
ATOM 10531 N N    . GLN B 2 4  ? 9.832   -1.381  -0.989  1.00 0.00 ? 4  GLN B N    14 
ATOM 10532 C CA   . GLN B 2 4  ? 10.487  -0.044  -0.947  1.00 0.00 ? 4  GLN B CA   14 
ATOM 10533 C C    . GLN B 2 4  ? 9.474   1.006   -0.486  1.00 0.00 ? 4  GLN B C    14 
ATOM 10534 O O    . GLN B 2 4  ? 8.550   0.715   0.246   1.00 0.00 ? 4  GLN B O    14 
ATOM 10535 C CB   . GLN B 2 4  ? 10.999  0.314   -2.343  1.00 0.00 ? 4  GLN B CB   14 
ATOM 10536 C CG   . GLN B 2 4  ? 11.533  -0.946  -3.029  1.00 0.00 ? 4  GLN B CG   14 
ATOM 10537 C CD   . GLN B 2 4  ? 12.399  -0.546  -4.226  1.00 0.00 ? 4  GLN B CD   14 
ATOM 10538 O OE1  . GLN B 2 4  ? 12.125  0.435   -4.888  1.00 0.00 ? 4  GLN B OE1  14 
ATOM 10539 N NE2  . GLN B 2 4  ? 13.439  -1.271  -4.534  1.00 0.00 ? 4  GLN B NE2  14 
ATOM 10540 H H    . GLN B 2 4  ? 8.892   -1.458  -1.258  1.00 0.00 ? 4  GLN B H    14 
ATOM 10541 H HA   . GLN B 2 4  ? 11.316  -0.072  -0.256  1.00 0.00 ? 4  GLN B HA   14 
ATOM 10542 H HB2  . GLN B 2 4  ? 10.189  0.728   -2.927  1.00 0.00 ? 4  GLN B HB2  14 
ATOM 10543 H HB3  . GLN B 2 4  ? 11.791  1.041   -2.261  1.00 0.00 ? 4  GLN B HB3  14 
ATOM 10544 H HG2  . GLN B 2 4  ? 12.125  -1.514  -2.328  1.00 0.00 ? 4  GLN B HG2  14 
ATOM 10545 H HG3  . GLN B 2 4  ? 10.704  -1.548  -3.372  1.00 0.00 ? 4  GLN B HG3  14 
ATOM 10546 H HE21 . GLN B 2 4  ? 13.660  -2.063  -4.000  1.00 0.00 ? 4  GLN B HE21 14 
ATOM 10547 H HE22 . GLN B 2 4  ? 14.000  -1.024  -5.296  1.00 0.00 ? 4  GLN B HE22 14 
ATOM 10548 N N    . HIS B 2 5  ? 9.642   2.229   -0.911  1.00 0.00 ? 5  HIS B N    14 
ATOM 10549 C CA   . HIS B 2 5  ? 8.691   3.299   -0.500  1.00 0.00 ? 5  HIS B CA   14 
ATOM 10550 C C    . HIS B 2 5  ? 7.591   3.433   -1.555  1.00 0.00 ? 5  HIS B C    14 
ATOM 10551 O O    . HIS B 2 5  ? 7.847   3.366   -2.741  1.00 0.00 ? 5  HIS B O    14 
ATOM 10552 C CB   . HIS B 2 5  ? 9.451   4.621   -0.369  1.00 0.00 ? 5  HIS B CB   14 
ATOM 10553 C CG   . HIS B 2 5  ? 10.663  4.413   0.498   1.00 0.00 ? 5  HIS B CG   14 
ATOM 10554 N ND1  . HIS B 2 5  ? 11.782  3.729   0.050   1.00 0.00 ? 5  HIS B ND1  14 
ATOM 10555 C CD2  . HIS B 2 5  ? 10.943  4.783   1.792   1.00 0.00 ? 5  HIS B CD2  14 
ATOM 10556 C CE1  . HIS B 2 5  ? 12.674  3.708   1.058   1.00 0.00 ? 5  HIS B CE1  14 
ATOM 10557 N NE2  . HIS B 2 5  ? 12.213  4.336   2.143   1.00 0.00 ? 5  HIS B NE2  14 
ATOM 10558 H H    . HIS B 2 5  ? 10.395  2.442   -1.501  1.00 0.00 ? 5  HIS B H    14 
ATOM 10559 H HA   . HIS B 2 5  ? 8.249   3.043   0.451   1.00 0.00 ? 5  HIS B HA   14 
ATOM 10560 H HB2  . HIS B 2 5  ? 9.761   4.957   -1.349  1.00 0.00 ? 5  HIS B HB2  14 
ATOM 10561 H HB3  . HIS B 2 5  ? 8.810   5.364   0.079   1.00 0.00 ? 5  HIS B HB3  14 
ATOM 10562 H HD1  . HIS B 2 5  ? 11.902  3.332   -0.837  1.00 0.00 ? 5  HIS B HD1  14 
ATOM 10563 H HD2  . HIS B 2 5  ? 10.277  5.333   2.440   1.00 0.00 ? 5  HIS B HD2  14 
ATOM 10564 H HE1  . HIS B 2 5  ? 13.643  3.235   0.998   1.00 0.00 ? 5  HIS B HE1  14 
ATOM 10565 N N    . LEU B 2 6  ? 6.366   3.609   -1.137  1.00 0.00 ? 6  LEU B N    14 
ATOM 10566 C CA   . LEU B 2 6  ? 5.255   3.730   -2.123  1.00 0.00 ? 6  LEU B CA   14 
ATOM 10567 C C    . LEU B 2 6  ? 4.514   5.054   -1.926  1.00 0.00 ? 6  LEU B C    14 
ATOM 10568 O O    . LEU B 2 6  ? 3.720   5.202   -1.019  1.00 0.00 ? 6  LEU B O    14 
ATOM 10569 C CB   . LEU B 2 6  ? 4.280   2.570   -1.928  1.00 0.00 ? 6  LEU B CB   14 
ATOM 10570 C CG   . LEU B 2 6  ? 5.056   1.254   -1.912  1.00 0.00 ? 6  LEU B CG   14 
ATOM 10571 C CD1  . LEU B 2 6  ? 4.271   0.205   -1.122  1.00 0.00 ? 6  LEU B CD1  14 
ATOM 10572 C CD2  . LEU B 2 6  ? 5.257   0.765   -3.348  1.00 0.00 ? 6  LEU B CD2  14 
ATOM 10573 H H    . LEU B 2 6  ? 6.175   3.651   -0.176  1.00 0.00 ? 6  LEU B H    14 
ATOM 10574 H HA   . LEU B 2 6  ? 5.656   3.691   -3.123  1.00 0.00 ? 6  LEU B HA   14 
ATOM 10575 H HB2  . LEU B 2 6  ? 3.759   2.694   -0.990  1.00 0.00 ? 6  LEU B HB2  14 
ATOM 10576 H HB3  . LEU B 2 6  ? 3.567   2.558   -2.739  1.00 0.00 ? 6  LEU B HB3  14 
ATOM 10577 H HG   . LEU B 2 6  ? 6.018   1.410   -1.444  1.00 0.00 ? 6  LEU B HG   14 
ATOM 10578 H HD11 . LEU B 2 6  ? 4.069   0.579   -0.130  1.00 0.00 ? 6  LEU B HD11 14 
ATOM 10579 H HD12 . LEU B 2 6  ? 3.340   -0.002  -1.626  1.00 0.00 ? 6  LEU B HD12 14 
ATOM 10580 H HD13 . LEU B 2 6  ? 4.851   -0.702  -1.055  1.00 0.00 ? 6  LEU B HD13 14 
ATOM 10581 H HD21 . LEU B 2 6  ? 5.226   1.608   -4.024  1.00 0.00 ? 6  LEU B HD21 14 
ATOM 10582 H HD22 . LEU B 2 6  ? 6.216   0.275   -3.429  1.00 0.00 ? 6  LEU B HD22 14 
ATOM 10583 H HD23 . LEU B 2 6  ? 4.472   0.069   -3.605  1.00 0.00 ? 6  LEU B HD23 14 
ATOM 10584 N N    . CYS B 2 7  ? 4.756   6.014   -2.777  1.00 0.00 ? 7  CYS B N    14 
ATOM 10585 C CA   . CYS B 2 7  ? 4.057   7.323   -2.643  1.00 0.00 ? 7  CYS B CA   14 
ATOM 10586 C C    . CYS B 2 7  ? 3.248   7.602   -3.910  1.00 0.00 ? 7  CYS B C    14 
ATOM 10587 O O    . CYS B 2 7  ? 3.795   7.768   -4.983  1.00 0.00 ? 7  CYS B O    14 
ATOM 10588 C CB   . CYS B 2 7  ? 5.079   8.437   -2.444  1.00 0.00 ? 7  CYS B CB   14 
ATOM 10589 S SG   . CYS B 2 7  ? 4.858   9.175   -0.807  1.00 0.00 ? 7  CYS B SG   14 
ATOM 10590 H H    . CYS B 2 7  ? 5.392   5.872   -3.507  1.00 0.00 ? 7  CYS B H    14 
ATOM 10591 H HA   . CYS B 2 7  ? 3.394   7.294   -1.795  1.00 0.00 ? 7  CYS B HA   14 
ATOM 10592 H HB2  . CYS B 2 7  ? 6.076   8.033   -2.529  1.00 0.00 ? 7  CYS B HB2  14 
ATOM 10593 H HB3  . CYS B 2 7  ? 4.929   9.191   -3.198  1.00 0.00 ? 7  CYS B HB3  14 
ATOM 10594 N N    . GLY B 2 8  ? 1.948   7.659   -3.795  1.00 0.00 ? 8  GLY B N    14 
ATOM 10595 C CA   . GLY B 2 8  ? 1.106   7.934   -4.994  1.00 0.00 ? 8  GLY B CA   14 
ATOM 10596 C C    . GLY B 2 8  ? 0.420   6.647   -5.456  1.00 0.00 ? 8  GLY B C    14 
ATOM 10597 O O    . GLY B 2 8  ? -0.053  5.862   -4.659  1.00 0.00 ? 8  GLY B O    14 
ATOM 10598 H H    . GLY B 2 8  ? 1.528   7.526   -2.921  1.00 0.00 ? 8  GLY B H    14 
ATOM 10599 H HA2  . GLY B 2 8  ? 0.355   8.670   -4.742  1.00 0.00 ? 8  GLY B HA2  14 
ATOM 10600 H HA3  . GLY B 2 8  ? 1.728   8.312   -5.791  1.00 0.00 ? 8  GLY B HA3  14 
ATOM 10601 N N    . SER B 2 9  ? 0.363   6.429   -6.742  1.00 0.00 ? 9  SER B N    14 
ATOM 10602 C CA   . SER B 2 9  ? -0.293  5.196   -7.262  1.00 0.00 ? 9  SER B CA   14 
ATOM 10603 C C    . SER B 2 9  ? 0.619   3.990   -7.030  1.00 0.00 ? 9  SER B C    14 
ATOM 10604 O O    . SER B 2 9  ? 0.251   2.862   -7.292  1.00 0.00 ? 9  SER B O    14 
ATOM 10605 C CB   . SER B 2 9  ? -0.551  5.355   -8.760  1.00 0.00 ? 9  SER B CB   14 
ATOM 10606 O OG   . SER B 2 9  ? 0.669   5.675   -9.416  1.00 0.00 ? 9  SER B OG   14 
ATOM 10607 H H    . SER B 2 9  ? 0.751   7.077   -7.365  1.00 0.00 ? 9  SER B H    14 
ATOM 10608 H HA   . SER B 2 9  ? -1.230  5.043   -6.749  1.00 0.00 ? 9  SER B HA   14 
ATOM 10609 H HB2  . SER B 2 9  ? -0.938  4.432   -9.162  1.00 0.00 ? 9  SER B HB2  14 
ATOM 10610 H HB3  . SER B 2 9  ? -1.274  6.145   -8.919  1.00 0.00 ? 9  SER B HB3  14 
ATOM 10611 H HG   . SER B 2 9  ? 0.459   6.171   -10.211 1.00 0.00 ? 9  SER B HG   14 
ATOM 10612 N N    . HIS B 2 10 ? 1.808   4.217   -6.540  1.00 0.00 ? 10 HIS B N    14 
ATOM 10613 C CA   . HIS B 2 10 ? 2.739   3.080   -6.293  1.00 0.00 ? 10 HIS B CA   14 
ATOM 10614 C C    . HIS B 2 10 ? 2.201   2.221   -5.147  1.00 0.00 ? 10 HIS B C    14 
ATOM 10615 O O    . HIS B 2 10 ? 2.129   1.013   -5.247  1.00 0.00 ? 10 HIS B O    14 
ATOM 10616 C CB   . HIS B 2 10 ? 4.121   3.624   -5.926  1.00 0.00 ? 10 HIS B CB   14 
ATOM 10617 C CG   . HIS B 2 10 ? 4.874   3.957   -7.185  1.00 0.00 ? 10 HIS B CG   14 
ATOM 10618 N ND1  . HIS B 2 10 ? 4.625   5.113   -7.912  1.00 0.00 ? 10 HIS B ND1  14 
ATOM 10619 C CD2  . HIS B 2 10 ? 5.866   3.295   -7.864  1.00 0.00 ? 10 HIS B CD2  14 
ATOM 10620 C CE1  . HIS B 2 10 ? 5.451   5.109   -8.973  1.00 0.00 ? 10 HIS B CE1  14 
ATOM 10621 N NE2  . HIS B 2 10 ? 6.228   4.024   -8.994  1.00 0.00 ? 10 HIS B NE2  14 
ATOM 10622 H H    . HIS B 2 10 ? 2.088   5.133   -6.335  1.00 0.00 ? 10 HIS B H    14 
ATOM 10623 H HA   . HIS B 2 10 ? 2.815   2.479   -7.187  1.00 0.00 ? 10 HIS B HA   14 
ATOM 10624 H HB2  . HIS B 2 10 ? 4.011   4.513   -5.323  1.00 0.00 ? 10 HIS B HB2  14 
ATOM 10625 H HB3  . HIS B 2 10 ? 4.666   2.877   -5.370  1.00 0.00 ? 10 HIS B HB3  14 
ATOM 10626 H HD1  . HIS B 2 10 ? 3.968   5.805   -7.690  1.00 0.00 ? 10 HIS B HD1  14 
ATOM 10627 H HD2  . HIS B 2 10 ? 6.298   2.351   -7.569  1.00 0.00 ? 10 HIS B HD2  14 
ATOM 10628 H HE1  . HIS B 2 10 ? 5.480   5.890   -9.720  1.00 0.00 ? 10 HIS B HE1  14 
ATOM 10629 N N    . LEU B 2 11 ? 1.817   2.834   -4.060  1.00 0.00 ? 11 LEU B N    14 
ATOM 10630 C CA   . LEU B 2 11 ? 1.282   2.043   -2.916  1.00 0.00 ? 11 LEU B CA   14 
ATOM 10631 C C    . LEU B 2 11 ? -0.013  1.351   -3.344  1.00 0.00 ? 11 LEU B C    14 
ATOM 10632 O O    . LEU B 2 11 ? -0.301  0.245   -2.934  1.00 0.00 ? 11 LEU B O    14 
ATOM 10633 C CB   . LEU B 2 11 ? 0.997   2.971   -1.733  1.00 0.00 ? 11 LEU B CB   14 
ATOM 10634 C CG   . LEU B 2 11 ? 1.440   2.291   -0.438  1.00 0.00 ? 11 LEU B CG   14 
ATOM 10635 C CD1  . LEU B 2 11 ? 1.896   3.350   0.567   1.00 0.00 ? 11 LEU B CD1  14 
ATOM 10636 C CD2  . LEU B 2 11 ? 0.267   1.502   0.151   1.00 0.00 ? 11 LEU B CD2  14 
ATOM 10637 H H    . LEU B 2 11 ? 1.879   3.810   -3.997  1.00 0.00 ? 11 LEU B H    14 
ATOM 10638 H HA   . LEU B 2 11 ? 2.006   1.298   -2.623  1.00 0.00 ? 11 LEU B HA   14 
ATOM 10639 H HB2  . LEU B 2 11 ? 1.540   3.896   -1.862  1.00 0.00 ? 11 LEU B HB2  14 
ATOM 10640 H HB3  . LEU B 2 11 ? -0.062  3.178   -1.686  1.00 0.00 ? 11 LEU B HB3  14 
ATOM 10641 H HG   . LEU B 2 11 ? 2.260   1.619   -0.648  1.00 0.00 ? 11 LEU B HG   14 
ATOM 10642 H HD11 . LEU B 2 11 ? 1.196   4.173   0.563   1.00 0.00 ? 11 LEU B HD11 14 
ATOM 10643 H HD12 . LEU B 2 11 ? 1.934   2.916   1.553   1.00 0.00 ? 11 LEU B HD12 14 
ATOM 10644 H HD13 . LEU B 2 11 ? 2.876   3.711   0.291   1.00 0.00 ? 11 LEU B HD13 14 
ATOM 10645 H HD21 . LEU B 2 11 ? -0.624  2.110   0.128   1.00 0.00 ? 11 LEU B HD21 14 
ATOM 10646 H HD22 . LEU B 2 11 ? 0.108   0.606   -0.433  1.00 0.00 ? 11 LEU B HD22 14 
ATOM 10647 H HD23 . LEU B 2 11 ? 0.491   1.230   1.172   1.00 0.00 ? 11 LEU B HD23 14 
ATOM 10648 N N    . VAL B 2 12 ? -0.794  1.992   -4.168  1.00 0.00 ? 12 VAL B N    14 
ATOM 10649 C CA   . VAL B 2 12 ? -2.063  1.364   -4.624  1.00 0.00 ? 12 VAL B CA   14 
ATOM 10650 C C    . VAL B 2 12 ? -1.737  0.111   -5.435  1.00 0.00 ? 12 VAL B C    14 
ATOM 10651 O O    . VAL B 2 12 ? -2.448  -0.873  -5.394  1.00 0.00 ? 12 VAL B O    14 
ATOM 10652 C CB   . VAL B 2 12 ? -2.843  2.350   -5.496  1.00 0.00 ? 12 VAL B CB   14 
ATOM 10653 C CG1  . VAL B 2 12 ? -3.993  1.620   -6.188  1.00 0.00 ? 12 VAL B CG1  14 
ATOM 10654 C CG2  . VAL B 2 12 ? -3.406  3.471   -4.619  1.00 0.00 ? 12 VAL B CG2  14 
ATOM 10655 H H    . VAL B 2 12 ? -0.543  2.884   -4.492  1.00 0.00 ? 12 VAL B H    14 
ATOM 10656 H HA   . VAL B 2 12 ? -2.660  1.093   -3.765  1.00 0.00 ? 12 VAL B HA   14 
ATOM 10657 H HB   . VAL B 2 12 ? -2.182  2.770   -6.243  1.00 0.00 ? 12 VAL B HB   14 
ATOM 10658 H HG11 . VAL B 2 12 ? -4.313  0.788   -5.574  1.00 0.00 ? 12 VAL B HG11 14 
ATOM 10659 H HG12 . VAL B 2 12 ? -4.818  2.300   -6.330  1.00 0.00 ? 12 VAL B HG12 14 
ATOM 10660 H HG13 . VAL B 2 12 ? -3.661  1.250   -7.147  1.00 0.00 ? 12 VAL B HG13 14 
ATOM 10661 H HG21 . VAL B 2 12 ? -3.451  3.137   -3.594  1.00 0.00 ? 12 VAL B HG21 14 
ATOM 10662 H HG22 . VAL B 2 12 ? -2.765  4.337   -4.688  1.00 0.00 ? 12 VAL B HG22 14 
ATOM 10663 H HG23 . VAL B 2 12 ? -4.397  3.729   -4.959  1.00 0.00 ? 12 VAL B HG23 14 
ATOM 10664 N N    . GLU B 2 13 ? -0.658  0.138   -6.169  1.00 0.00 ? 13 GLU B N    14 
ATOM 10665 C CA   . GLU B 2 13 ? -0.278  -1.055  -6.976  1.00 0.00 ? 13 GLU B CA   14 
ATOM 10666 C C    . GLU B 2 13 ? 0.053   -2.210  -6.032  1.00 0.00 ? 13 GLU B C    14 
ATOM 10667 O O    . GLU B 2 13 ? 0.036   -3.364  -6.413  1.00 0.00 ? 13 GLU B O    14 
ATOM 10668 C CB   . GLU B 2 13 ? 0.948   -0.725  -7.833  1.00 0.00 ? 13 GLU B CB   14 
ATOM 10669 C CG   . GLU B 2 13 ? 0.513   0.098   -9.047  1.00 0.00 ? 13 GLU B CG   14 
ATOM 10670 C CD   . GLU B 2 13 ? 1.729   0.383   -9.933  1.00 0.00 ? 13 GLU B CD   14 
ATOM 10671 O OE1  . GLU B 2 13 ? 2.035   -0.447  -10.772 1.00 0.00 ? 13 GLU B OE1  14 
ATOM 10672 O OE2  . GLU B 2 13 ? 2.332   1.429   -9.756  1.00 0.00 ? 13 GLU B OE2  14 
ATOM 10673 H H    . GLU B 2 13 ? -0.092  0.938   -6.183  1.00 0.00 ? 13 GLU B H    14 
ATOM 10674 H HA   . GLU B 2 13 ? -1.103  -1.335  -7.616  1.00 0.00 ? 13 GLU B HA   14 
ATOM 10675 H HB2  . GLU B 2 13 ? 1.654   -0.158  -7.244  1.00 0.00 ? 13 GLU B HB2  14 
ATOM 10676 H HB3  . GLU B 2 13 ? 1.410   -1.643  -8.168  1.00 0.00 ? 13 GLU B HB3  14 
ATOM 10677 H HG2  . GLU B 2 13 ? -0.222  -0.456  -9.612  1.00 0.00 ? 13 GLU B HG2  14 
ATOM 10678 H HG3  . GLU B 2 13 ? 0.086   1.031   -8.715  1.00 0.00 ? 13 GLU B HG3  14 
ATOM 10679 N N    . ALA B 2 14 ? 0.350   -1.908  -4.797  1.00 0.00 ? 14 ALA B N    14 
ATOM 10680 C CA   . ALA B 2 14 ? 0.678   -2.983  -3.821  1.00 0.00 ? 14 ALA B CA   14 
ATOM 10681 C C    . ALA B 2 14 ? -0.549  -3.264  -2.947  1.00 0.00 ? 14 ALA B C    14 
ATOM 10682 O O    . ALA B 2 14 ? -0.648  -4.298  -2.316  1.00 0.00 ? 14 ALA B O    14 
ATOM 10683 C CB   . ALA B 2 14 ? 1.844   -2.532  -2.941  1.00 0.00 ? 14 ALA B CB   14 
ATOM 10684 H H    . ALA B 2 14 ? 0.354   -0.970  -4.511  1.00 0.00 ? 14 ALA B H    14 
ATOM 10685 H HA   . ALA B 2 14 ? 0.954   -3.882  -4.355  1.00 0.00 ? 14 ALA B HA   14 
ATOM 10686 H HB1  . ALA B 2 14 ? 2.557   -1.980  -3.541  1.00 0.00 ? 14 ALA B HB1  14 
ATOM 10687 H HB2  . ALA B 2 14 ? 1.473   -1.898  -2.150  1.00 0.00 ? 14 ALA B HB2  14 
ATOM 10688 H HB3  . ALA B 2 14 ? 2.328   -3.397  -2.513  1.00 0.00 ? 14 ALA B HB3  14 
ATOM 10689 N N    . LEU B 2 15 ? -1.479  -2.350  -2.904  1.00 0.00 ? 15 LEU B N    14 
ATOM 10690 C CA   . LEU B 2 15 ? -2.697  -2.559  -2.069  1.00 0.00 ? 15 LEU B CA   14 
ATOM 10691 C C    . LEU B 2 15 ? -3.630  -3.561  -2.756  1.00 0.00 ? 15 LEU B C    14 
ATOM 10692 O O    . LEU B 2 15 ? -4.124  -4.485  -2.140  1.00 0.00 ? 15 LEU B O    14 
ATOM 10693 C CB   . LEU B 2 15 ? -3.426  -1.223  -1.890  1.00 0.00 ? 15 LEU B CB   14 
ATOM 10694 C CG   . LEU B 2 15 ? -2.637  -0.335  -0.925  1.00 0.00 ? 15 LEU B CG   14 
ATOM 10695 C CD1  . LEU B 2 15 ? -3.459  0.910   -0.586  1.00 0.00 ? 15 LEU B CD1  14 
ATOM 10696 C CD2  . LEU B 2 15 ? -2.347  -1.112  0.361   1.00 0.00 ? 15 LEU B CD2  14 
ATOM 10697 H H    . LEU B 2 15 ? -1.378  -1.522  -3.420  1.00 0.00 ? 15 LEU B H    14 
ATOM 10698 H HA   . LEU B 2 15 ? -2.409  -2.942  -1.101  1.00 0.00 ? 15 LEU B HA   14 
ATOM 10699 H HB2  . LEU B 2 15 ? -3.511  -0.730  -2.846  1.00 0.00 ? 15 LEU B HB2  14 
ATOM 10700 H HB3  . LEU B 2 15 ? -4.411  -1.403  -1.487  1.00 0.00 ? 15 LEU B HB3  14 
ATOM 10701 H HG   . LEU B 2 15 ? -1.707  -0.037  -1.388  1.00 0.00 ? 15 LEU B HG   14 
ATOM 10702 H HD11 . LEU B 2 15 ? -3.833  1.354   -1.497  1.00 0.00 ? 15 LEU B HD11 14 
ATOM 10703 H HD12 . LEU B 2 15 ? -4.289  0.634   0.048   1.00 0.00 ? 15 LEU B HD12 14 
ATOM 10704 H HD13 . LEU B 2 15 ? -2.834  1.623   -0.068  1.00 0.00 ? 15 LEU B HD13 14 
ATOM 10705 H HD21 . LEU B 2 15 ? -3.170  -1.780  0.571   1.00 0.00 ? 15 LEU B HD21 14 
ATOM 10706 H HD22 . LEU B 2 15 ? -1.441  -1.684  0.235   1.00 0.00 ? 15 LEU B HD22 14 
ATOM 10707 H HD23 . LEU B 2 15 ? -2.225  -0.419  1.179   1.00 0.00 ? 15 LEU B HD23 14 
ATOM 10708 N N    . HIS B 2 16 ? -3.876  -3.383  -4.025  1.00 0.00 ? 16 HIS B N    14 
ATOM 10709 C CA   . HIS B 2 16 ? -4.781  -4.322  -4.750  1.00 0.00 ? 16 HIS B CA   14 
ATOM 10710 C C    . HIS B 2 16 ? -4.162  -5.723  -4.765  1.00 0.00 ? 16 HIS B C    14 
ATOM 10711 O O    . HIS B 2 16 ? -4.857  -6.720  -4.805  1.00 0.00 ? 16 HIS B O    14 
ATOM 10712 C CB   . HIS B 2 16 ? -4.981  -3.822  -6.187  1.00 0.00 ? 16 HIS B CB   14 
ATOM 10713 C CG   . HIS B 2 16 ? -3.791  -4.185  -7.032  1.00 0.00 ? 16 HIS B CG   14 
ATOM 10714 N ND1  . HIS B 2 16 ? -3.894  -4.999  -8.149  1.00 0.00 ? 16 HIS B ND1  14 
ATOM 10715 C CD2  . HIS B 2 16 ? -2.466  -3.850  -6.932  1.00 0.00 ? 16 HIS B CD2  14 
ATOM 10716 C CE1  . HIS B 2 16 ? -2.662  -5.123  -8.673  1.00 0.00 ? 16 HIS B CE1  14 
ATOM 10717 N NE2  . HIS B 2 16 ? -1.753  -4.442  -7.969  1.00 0.00 ? 16 HIS B NE2  14 
ATOM 10718 H H    . HIS B 2 16 ? -3.470  -2.629  -4.501  1.00 0.00 ? 16 HIS B H    14 
ATOM 10719 H HA   . HIS B 2 16 ? -5.736  -4.357  -4.247  1.00 0.00 ? 16 HIS B HA   14 
ATOM 10720 H HB2  . HIS B 2 16 ? -5.868  -4.272  -6.606  1.00 0.00 ? 16 HIS B HB2  14 
ATOM 10721 H HB3  . HIS B 2 16 ? -5.094  -2.749  -6.179  1.00 0.00 ? 16 HIS B HB3  14 
ATOM 10722 H HD1  . HIS B 2 16 ? -4.714  -5.406  -8.494  1.00 0.00 ? 16 HIS B HD1  14 
ATOM 10723 H HD2  . HIS B 2 16 ? -2.045  -3.221  -6.164  1.00 0.00 ? 16 HIS B HD2  14 
ATOM 10724 H HE1  . HIS B 2 16 ? -2.434  -5.702  -9.555  1.00 0.00 ? 16 HIS B HE1  14 
ATOM 10725 N N    . LEU B 2 17 ? -2.861  -5.804  -4.741  1.00 0.00 ? 17 LEU B N    14 
ATOM 10726 C CA   . LEU B 2 17 ? -2.191  -7.133  -4.761  1.00 0.00 ? 17 LEU B CA   14 
ATOM 10727 C C    . LEU B 2 17 ? -2.352  -7.816  -3.401  1.00 0.00 ? 17 LEU B C    14 
ATOM 10728 O O    . LEU B 2 17 ? -2.236  -9.020  -3.283  1.00 0.00 ? 17 LEU B O    14 
ATOM 10729 C CB   . LEU B 2 17 ? -0.703  -6.938  -5.065  1.00 0.00 ? 17 LEU B CB   14 
ATOM 10730 C CG   . LEU B 2 17 ? -0.021  -8.298  -5.197  1.00 0.00 ? 17 LEU B CG   14 
ATOM 10731 C CD1  . LEU B 2 17 ? -0.584  -9.043  -6.409  1.00 0.00 ? 17 LEU B CD1  14 
ATOM 10732 C CD2  . LEU B 2 17 ? 1.482   -8.091  -5.383  1.00 0.00 ? 17 LEU B CD2  14 
ATOM 10733 H H    . LEU B 2 17 ? -2.323  -4.985  -4.714  1.00 0.00 ? 17 LEU B H    14 
ATOM 10734 H HA   . LEU B 2 17 ? -2.637  -7.749  -5.529  1.00 0.00 ? 17 LEU B HA   14 
ATOM 10735 H HB2  . LEU B 2 17 ? -0.594  -6.390  -5.990  1.00 0.00 ? 17 LEU B HB2  14 
ATOM 10736 H HB3  . LEU B 2 17 ? -0.244  -6.383  -4.262  1.00 0.00 ? 17 LEU B HB3  14 
ATOM 10737 H HG   . LEU B 2 17 ? -0.199  -8.879  -4.303  1.00 0.00 ? 17 LEU B HG   14 
ATOM 10738 H HD11 . LEU B 2 17 ? -0.581  -8.387  -7.266  1.00 0.00 ? 17 LEU B HD11 14 
ATOM 10739 H HD12 . LEU B 2 17 ? 0.027   -9.909  -6.614  1.00 0.00 ? 17 LEU B HD12 14 
ATOM 10740 H HD13 . LEU B 2 17 ? -1.597  -9.357  -6.201  1.00 0.00 ? 17 LEU B HD13 14 
ATOM 10741 H HD21 . LEU B 2 17 ? 1.664   -7.088  -5.744  1.00 0.00 ? 17 LEU B HD21 14 
ATOM 10742 H HD22 . LEU B 2 17 ? 1.985   -8.227  -4.435  1.00 0.00 ? 17 LEU B HD22 14 
ATOM 10743 H HD23 . LEU B 2 17 ? 1.860   -8.805  -6.098  1.00 0.00 ? 17 LEU B HD23 14 
ATOM 10744 N N    . VAL B 2 18 ? -2.613  -7.059  -2.371  1.00 0.00 ? 18 VAL B N    14 
ATOM 10745 C CA   . VAL B 2 18 ? -2.776  -7.668  -1.022  1.00 0.00 ? 18 VAL B CA   14 
ATOM 10746 C C    . VAL B 2 18 ? -4.218  -8.148  -0.836  1.00 0.00 ? 18 VAL B C    14 
ATOM 10747 O O    . VAL B 2 18 ? -4.501  -8.971  0.012   1.00 0.00 ? 18 VAL B O    14 
ATOM 10748 C CB   . VAL B 2 18 ? -2.448  -6.627  0.049   1.00 0.00 ? 18 VAL B CB   14 
ATOM 10749 C CG1  . VAL B 2 18 ? -2.308  -7.317  1.407   1.00 0.00 ? 18 VAL B CG1  14 
ATOM 10750 C CG2  . VAL B 2 18 ? -1.135  -5.929  -0.308  1.00 0.00 ? 18 VAL B CG2  14 
ATOM 10751 H H    . VAL B 2 18 ? -2.700  -6.090  -2.485  1.00 0.00 ? 18 VAL B H    14 
ATOM 10752 H HA   . VAL B 2 18 ? -2.102  -8.507  -0.923  1.00 0.00 ? 18 VAL B HA   14 
ATOM 10753 H HB   . VAL B 2 18 ? -3.245  -5.899  0.096   1.00 0.00 ? 18 VAL B HB   14 
ATOM 10754 H HG11 . VAL B 2 18 ? -1.515  -8.048  1.357   1.00 0.00 ? 18 VAL B HG11 14 
ATOM 10755 H HG12 . VAL B 2 18 ? -2.073  -6.582  2.161   1.00 0.00 ? 18 VAL B HG12 14 
ATOM 10756 H HG13 . VAL B 2 18 ? -3.237  -7.808  1.658   1.00 0.00 ? 18 VAL B HG13 14 
ATOM 10757 H HG21 . VAL B 2 18 ? -0.771  -6.307  -1.251  1.00 0.00 ? 18 VAL B HG21 14 
ATOM 10758 H HG22 . VAL B 2 18 ? -1.302  -4.864  -0.385  1.00 0.00 ? 18 VAL B HG22 14 
ATOM 10759 H HG23 . VAL B 2 18 ? -0.403  -6.122  0.464   1.00 0.00 ? 18 VAL B HG23 14 
ATOM 10760 N N    . CYS B 2 19 ? -5.134  -7.638  -1.614  1.00 0.00 ? 19 CYS B N    14 
ATOM 10761 C CA   . CYS B 2 19 ? -6.553  -8.066  -1.467  1.00 0.00 ? 19 CYS B CA   14 
ATOM 10762 C C    . CYS B 2 19 ? -6.961  -8.943  -2.656  1.00 0.00 ? 19 CYS B C    14 
ATOM 10763 O O    . CYS B 2 19 ? -7.086  -10.146 -2.534  1.00 0.00 ? 19 CYS B O    14 
ATOM 10764 C CB   . CYS B 2 19 ? -7.446  -6.826  -1.412  1.00 0.00 ? 19 CYS B CB   14 
ATOM 10765 S SG   . CYS B 2 19 ? -6.664  -5.572  -0.371  1.00 0.00 ? 19 CYS B SG   14 
ATOM 10766 H H    . CYS B 2 19 ? -4.891  -6.971  -2.290  1.00 0.00 ? 19 CYS B H    14 
ATOM 10767 H HA   . CYS B 2 19 ? -6.665  -8.627  -0.552  1.00 0.00 ? 19 CYS B HA   14 
ATOM 10768 H HB2  . CYS B 2 19 ? -7.575  -6.433  -2.408  1.00 0.00 ? 19 CYS B HB2  14 
ATOM 10769 H HB3  . CYS B 2 19 ? -8.406  -7.090  -0.999  1.00 0.00 ? 19 CYS B HB3  14 
ATOM 10770 N N    . GLY B 2 20 ? -7.170  -8.356  -3.803  1.00 0.00 ? 20 GLY B N    14 
ATOM 10771 C CA   . GLY B 2 20 ? -7.570  -9.165  -4.989  1.00 0.00 ? 20 GLY B CA   14 
ATOM 10772 C C    . GLY B 2 20 ? -8.964  -8.744  -5.458  1.00 0.00 ? 20 GLY B C    14 
ATOM 10773 O O    . GLY B 2 20 ? -9.189  -7.611  -5.837  1.00 0.00 ? 20 GLY B O    14 
ATOM 10774 H H    . GLY B 2 20 ? -7.065  -7.386  -3.886  1.00 0.00 ? 20 GLY B H    14 
ATOM 10775 H HA2  . GLY B 2 20 ? -6.857  -9.008  -5.788  1.00 0.00 ? 20 GLY B HA2  14 
ATOM 10776 H HA3  . GLY B 2 20 ? -7.586  -10.211 -4.723  1.00 0.00 ? 20 GLY B HA3  14 
ATOM 10777 N N    . GLU B 2 21 ? -9.904  -9.650  -5.441  1.00 0.00 ? 21 GLU B N    14 
ATOM 10778 C CA   . GLU B 2 21 ? -11.284 -9.313  -5.892  1.00 0.00 ? 21 GLU B CA   14 
ATOM 10779 C C    . GLU B 2 21 ? -11.945 -8.365  -4.885  1.00 0.00 ? 21 GLU B C    14 
ATOM 10780 O O    . GLU B 2 21 ? -12.465 -7.327  -5.248  1.00 0.00 ? 21 GLU B O    14 
ATOM 10781 C CB   . GLU B 2 21 ? -12.111 -10.595 -5.997  1.00 0.00 ? 21 GLU B CB   14 
ATOM 10782 C CG   . GLU B 2 21 ? -12.961 -10.553 -7.270  1.00 0.00 ? 21 GLU B CG   14 
ATOM 10783 C CD   . GLU B 2 21 ? -12.790 -11.864 -8.041  1.00 0.00 ? 21 GLU B CD   14 
ATOM 10784 O OE1  . GLU B 2 21 ? -12.729 -12.901 -7.403  1.00 0.00 ? 21 GLU B OE1  14 
ATOM 10785 O OE2  . GLU B 2 21 ? -12.722 -11.805 -9.258  1.00 0.00 ? 21 GLU B OE2  14 
ATOM 10786 H H    . GLU B 2 21 ? -9.699  -10.559 -5.138  1.00 0.00 ? 21 GLU B H    14 
ATOM 10787 H HA   . GLU B 2 21 ? -11.239 -8.834  -6.860  1.00 0.00 ? 21 GLU B HA   14 
ATOM 10788 H HB2  . GLU B 2 21 ? -11.448 -11.448 -6.035  1.00 0.00 ? 21 GLU B HB2  14 
ATOM 10789 H HB3  . GLU B 2 21 ? -12.758 -10.679 -5.138  1.00 0.00 ? 21 GLU B HB3  14 
ATOM 10790 H HG2  . GLU B 2 21 ? -14.001 -10.427 -7.002  1.00 0.00 ? 21 GLU B HG2  14 
ATOM 10791 H HG3  . GLU B 2 21 ? -12.645 -9.727  -7.889  1.00 0.00 ? 21 GLU B HG3  14 
ATOM 10792 N N    . ARG B 2 22 ? -11.940 -8.717  -3.629  1.00 0.00 ? 22 ARG B N    14 
ATOM 10793 C CA   . ARG B 2 22 ? -12.577 -7.843  -2.601  1.00 0.00 ? 22 ARG B CA   14 
ATOM 10794 C C    . ARG B 2 22 ? -12.234 -6.378  -2.879  1.00 0.00 ? 22 ARG B C    14 
ATOM 10795 O O    . ARG B 2 22 ? -13.068 -5.503  -2.763  1.00 0.00 ? 22 ARG B O    14 
ATOM 10796 C CB   . ARG B 2 22 ? -12.069 -8.229  -1.215  1.00 0.00 ? 22 ARG B CB   14 
ATOM 10797 C CG   . ARG B 2 22 ? -12.920 -9.374  -0.661  1.00 0.00 ? 22 ARG B CG   14 
ATOM 10798 C CD   . ARG B 2 22 ? -12.043 -10.307 0.172   1.00 0.00 ? 22 ARG B CD   14 
ATOM 10799 N NE   . ARG B 2 22 ? -12.525 -11.711 0.017   1.00 0.00 ? 22 ARG B NE   14 
ATOM 10800 C CZ   . ARG B 2 22 ? -11.769 -12.709 0.387   1.00 0.00 ? 22 ARG B CZ   14 
ATOM 10801 N NH1  . ARG B 2 22 ? -10.583 -12.486 0.882   1.00 0.00 ? 22 ARG B NH1  14 
ATOM 10802 N NH2  . ARG B 2 22 ? -12.202 -13.935 0.256   1.00 0.00 ? 22 ARG B NH2  14 
ATOM 10803 H H    . ARG B 2 22 ? -11.520 -9.562  -3.359  1.00 0.00 ? 22 ARG B H    14 
ATOM 10804 H HA   . ARG B 2 22 ? -13.646 -7.970  -2.634  1.00 0.00 ? 22 ARG B HA   14 
ATOM 10805 H HB2  . ARG B 2 22 ? -11.038 -8.546  -1.284  1.00 0.00 ? 22 ARG B HB2  14 
ATOM 10806 H HB3  . ARG B 2 22 ? -12.142 -7.379  -0.557  1.00 0.00 ? 22 ARG B HB3  14 
ATOM 10807 H HG2  . ARG B 2 22 ? -13.707 -8.967  -0.040  1.00 0.00 ? 22 ARG B HG2  14 
ATOM 10808 H HG3  . ARG B 2 22 ? -13.356 -9.926  -1.478  1.00 0.00 ? 22 ARG B HG3  14 
ATOM 10809 H HD2  . ARG B 2 22 ? -11.020 -10.240 -0.165  1.00 0.00 ? 22 ARG B HD2  14 
ATOM 10810 H HD3  . ARG B 2 22 ? -12.100 -10.022 1.213   1.00 0.00 ? 22 ARG B HD3  14 
ATOM 10811 H HE   . ARG B 2 22 ? -13.414 -11.882 -0.360  1.00 0.00 ? 22 ARG B HE   14 
ATOM 10812 H HH11 . ARG B 2 22 ? -10.248 -11.548 0.979   1.00 0.00 ? 22 ARG B HH11 14 
ATOM 10813 H HH12 . ARG B 2 22 ? -10.006 -13.252 1.163   1.00 0.00 ? 22 ARG B HH12 14 
ATOM 10814 H HH21 . ARG B 2 22 ? -13.110 -14.106 -0.124  1.00 0.00 ? 22 ARG B HH21 14 
ATOM 10815 H HH22 . ARG B 2 22 ? -11.624 -14.701 0.537   1.00 0.00 ? 22 ARG B HH22 14 
ATOM 10816 N N    . GLY B 2 23 ? -11.012 -6.102  -3.244  1.00 0.00 ? 23 GLY B N    14 
ATOM 10817 C CA   . GLY B 2 23 ? -10.620 -4.693  -3.527  1.00 0.00 ? 23 GLY B CA   14 
ATOM 10818 C C    . GLY B 2 23 ? -10.050 -4.055  -2.258  1.00 0.00 ? 23 GLY B C    14 
ATOM 10819 O O    . GLY B 2 23 ? -9.939  -4.690  -1.229  1.00 0.00 ? 23 GLY B O    14 
ATOM 10820 H H    . GLY B 2 23 ? -10.352 -6.821  -3.331  1.00 0.00 ? 23 GLY B H    14 
ATOM 10821 H HA2  . GLY B 2 23 ? -9.873  -4.678  -4.308  1.00 0.00 ? 23 GLY B HA2  14 
ATOM 10822 H HA3  . GLY B 2 23 ? -11.488 -4.135  -3.848  1.00 0.00 ? 23 GLY B HA3  14 
ATOM 10823 N N    . PHE B 2 24 ? -9.686  -2.802  -2.325  1.00 0.00 ? 24 PHE B N    14 
ATOM 10824 C CA   . PHE B 2 24 ? -9.120  -2.126  -1.124  1.00 0.00 ? 24 PHE B CA   14 
ATOM 10825 C C    . PHE B 2 24 ? -9.597  -0.674  -1.081  1.00 0.00 ? 24 PHE B C    14 
ATOM 10826 O O    . PHE B 2 24 ? -9.965  -0.101  -2.086  1.00 0.00 ? 24 PHE B O    14 
ATOM 10827 C CB   . PHE B 2 24 ? -7.593  -2.156  -1.198  1.00 0.00 ? 24 PHE B CB   14 
ATOM 10828 C CG   . PHE B 2 24 ? -7.148  -1.612  -2.530  1.00 0.00 ? 24 PHE B CG   14 
ATOM 10829 C CD1  . PHE B 2 24 ? -7.260  -2.412  -3.666  1.00 0.00 ? 24 PHE B CD1  14 
ATOM 10830 C CD2  . PHE B 2 24 ? -6.635  -0.315  -2.631  1.00 0.00 ? 24 PHE B CD2  14 
ATOM 10831 C CE1  . PHE B 2 24 ? -6.855  -1.920  -4.912  1.00 0.00 ? 24 PHE B CE1  14 
ATOM 10832 C CE2  . PHE B 2 24 ? -6.230  0.181   -3.876  1.00 0.00 ? 24 PHE B CE2  14 
ATOM 10833 C CZ   . PHE B 2 24 ? -6.340  -0.622  -5.018  1.00 0.00 ? 24 PHE B CZ   14 
ATOM 10834 H H    . PHE B 2 24 ? -9.780  -2.308  -3.165  1.00 0.00 ? 24 PHE B H    14 
ATOM 10835 H HA   . PHE B 2 24 ? -9.447  -2.642  -0.233  1.00 0.00 ? 24 PHE B HA   14 
ATOM 10836 H HB2  . PHE B 2 24 ? -7.178  -1.553  -0.403  1.00 0.00 ? 24 PHE B HB2  14 
ATOM 10837 H HB3  . PHE B 2 24 ? -7.248  -3.173  -1.099  1.00 0.00 ? 24 PHE B HB3  14 
ATOM 10838 H HD1  . PHE B 2 24 ? -7.655  -3.415  -3.577  1.00 0.00 ? 24 PHE B HD1  14 
ATOM 10839 H HD2  . PHE B 2 24 ? -6.548  0.303   -1.749  1.00 0.00 ? 24 PHE B HD2  14 
ATOM 10840 H HE1  . PHE B 2 24 ? -6.942  -2.541  -5.792  1.00 0.00 ? 24 PHE B HE1  14 
ATOM 10841 H HE2  . PHE B 2 24 ? -5.832  1.183   -3.956  1.00 0.00 ? 24 PHE B HE2  14 
ATOM 10842 H HZ   . PHE B 2 24 ? -6.028  -0.240  -5.979  1.00 0.00 ? 24 PHE B HZ   14 
ATOM 10843 N N    . PHE B 2 25 ? -9.592  -0.075  0.077   1.00 0.00 ? 25 PHE B N    14 
ATOM 10844 C CA   . PHE B 2 25 ? -10.042 1.341   0.188   1.00 0.00 ? 25 PHE B CA   14 
ATOM 10845 C C    . PHE B 2 25 ? -8.835  2.231   0.488   1.00 0.00 ? 25 PHE B C    14 
ATOM 10846 O O    . PHE B 2 25 ? -8.511  2.489   1.631   1.00 0.00 ? 25 PHE B O    14 
ATOM 10847 C CB   . PHE B 2 25 ? -11.068 1.475   1.320   1.00 0.00 ? 25 PHE B CB   14 
ATOM 10848 C CG   . PHE B 2 25 ? -10.832 0.402   2.356   1.00 0.00 ? 25 PHE B CG   14 
ATOM 10849 C CD1  . PHE B 2 25 ? -9.839  0.571   3.327   1.00 0.00 ? 25 PHE B CD1  14 
ATOM 10850 C CD2  . PHE B 2 25 ? -11.604 -0.766  2.341   1.00 0.00 ? 25 PHE B CD2  14 
ATOM 10851 C CE1  . PHE B 2 25 ? -9.618  -0.428  4.286   1.00 0.00 ? 25 PHE B CE1  14 
ATOM 10852 C CE2  . PHE B 2 25 ? -11.385 -1.764  3.298   1.00 0.00 ? 25 PHE B CE2  14 
ATOM 10853 C CZ   . PHE B 2 25 ? -10.390 -1.594  4.270   1.00 0.00 ? 25 PHE B CZ   14 
ATOM 10854 H H    . PHE B 2 25 ? -9.289  -0.557  0.877   1.00 0.00 ? 25 PHE B H    14 
ATOM 10855 H HA   . PHE B 2 25 ? -10.491 1.649   -0.744  1.00 0.00 ? 25 PHE B HA   14 
ATOM 10856 H HB2  . PHE B 2 25 ? -10.969 2.447   1.780   1.00 0.00 ? 25 PHE B HB2  14 
ATOM 10857 H HB3  . PHE B 2 25 ? -12.065 1.370   0.915   1.00 0.00 ? 25 PHE B HB3  14 
ATOM 10858 H HD1  . PHE B 2 25 ? -9.243  1.471   3.340   1.00 0.00 ? 25 PHE B HD1  14 
ATOM 10859 H HD2  . PHE B 2 25 ? -12.370 -0.896  1.591   1.00 0.00 ? 25 PHE B HD2  14 
ATOM 10860 H HE1  . PHE B 2 25 ? -8.852  -0.297  5.036   1.00 0.00 ? 25 PHE B HE1  14 
ATOM 10861 H HE2  . PHE B 2 25 ? -11.981 -2.664  3.285   1.00 0.00 ? 25 PHE B HE2  14 
ATOM 10862 H HZ   . PHE B 2 25 ? -10.221 -2.365  5.008   1.00 0.00 ? 25 PHE B HZ   14 
ATOM 10863 N N    . TYR B 2 26 ? -8.165  2.700   -0.526  1.00 0.00 ? 26 TYR B N    14 
ATOM 10864 C CA   . TYR B 2 26 ? -6.979  3.572   -0.293  1.00 0.00 ? 26 TYR B CA   14 
ATOM 10865 C C    . TYR B 2 26 ? -7.443  4.920   0.259   1.00 0.00 ? 26 TYR B C    14 
ATOM 10866 O O    . TYR B 2 26 ? -8.615  5.242   0.234   1.00 0.00 ? 26 TYR B O    14 
ATOM 10867 C CB   . TYR B 2 26 ? -6.231  3.786   -1.609  1.00 0.00 ? 26 TYR B CB   14 
ATOM 10868 C CG   . TYR B 2 26 ? -4.821  4.248   -1.324  1.00 0.00 ? 26 TYR B CG   14 
ATOM 10869 C CD1  . TYR B 2 26 ? -4.075  3.643   -0.305  1.00 0.00 ? 26 TYR B CD1  14 
ATOM 10870 C CD2  . TYR B 2 26 ? -4.261  5.286   -2.077  1.00 0.00 ? 26 TYR B CD2  14 
ATOM 10871 C CE1  . TYR B 2 26 ? -2.770  4.075   -0.041  1.00 0.00 ? 26 TYR B CE1  14 
ATOM 10872 C CE2  . TYR B 2 26 ? -2.955  5.718   -1.814  1.00 0.00 ? 26 TYR B CE2  14 
ATOM 10873 C CZ   . TYR B 2 26 ? -2.210  5.111   -0.796  1.00 0.00 ? 26 TYR B CZ   14 
ATOM 10874 O OH   . TYR B 2 26 ? -0.923  5.536   -0.534  1.00 0.00 ? 26 TYR B OH   14 
ATOM 10875 H H    . TYR B 2 26 ? -8.440  2.480   -1.443  1.00 0.00 ? 26 TYR B H    14 
ATOM 10876 H HA   . TYR B 2 26 ? -6.324  3.098   0.421   1.00 0.00 ? 26 TYR B HA   14 
ATOM 10877 H HB2  . TYR B 2 26 ? -6.200  2.858   -2.162  1.00 0.00 ? 26 TYR B HB2  14 
ATOM 10878 H HB3  . TYR B 2 26 ? -6.742  4.534   -2.197  1.00 0.00 ? 26 TYR B HB3  14 
ATOM 10879 H HD1  . TYR B 2 26 ? -4.505  2.842   0.279   1.00 0.00 ? 26 TYR B HD1  14 
ATOM 10880 H HD2  . TYR B 2 26 ? -4.833  5.753   -2.864  1.00 0.00 ? 26 TYR B HD2  14 
ATOM 10881 H HE1  . TYR B 2 26 ? -2.195  3.608   0.744   1.00 0.00 ? 26 TYR B HE1  14 
ATOM 10882 H HE2  . TYR B 2 26 ? -2.523  6.518   -2.396  1.00 0.00 ? 26 TYR B HE2  14 
ATOM 10883 H HH   . TYR B 2 26 ? -0.815  6.408   -0.919  1.00 0.00 ? 26 TYR B HH   14 
ATOM 10884 N N    . THR B 2 27 ? -6.535  5.714   0.759   1.00 0.00 ? 27 THR B N    14 
ATOM 10885 C CA   . THR B 2 27 ? -6.929  7.038   1.312   1.00 0.00 ? 27 THR B CA   14 
ATOM 10886 C C    . THR B 2 27 ? -6.053  8.139   0.705   1.00 0.00 ? 27 THR B C    14 
ATOM 10887 O O    . THR B 2 27 ? -5.440  8.904   1.422   1.00 0.00 ? 27 THR B O    14 
ATOM 10888 C CB   . THR B 2 27 ? -6.744  7.026   2.832   1.00 0.00 ? 27 THR B CB   14 
ATOM 10889 O OG1  . THR B 2 27 ? -7.135  8.284   3.362   1.00 0.00 ? 27 THR B OG1  14 
ATOM 10890 C CG2  . THR B 2 27 ? -5.275  6.763   3.163   1.00 0.00 ? 27 THR B CG2  14 
ATOM 10891 H H    . THR B 2 27 ? -5.594  5.435   0.770   1.00 0.00 ? 27 THR B H    14 
ATOM 10892 H HA   . THR B 2 27 ? -7.966  7.230   1.079   1.00 0.00 ? 27 THR B HA   14 
ATOM 10893 H HB   . THR B 2 27 ? -7.352  6.246   3.263   1.00 0.00 ? 27 THR B HB   14 
ATOM 10894 H HG1  . THR B 2 27 ? -7.452  8.143   4.257   1.00 0.00 ? 27 THR B HG1  14 
ATOM 10895 H HG21 . THR B 2 27 ? -4.877  6.027   2.479   1.00 0.00 ? 27 THR B HG21 14 
ATOM 10896 H HG22 . THR B 2 27 ? -4.714  7.681   3.070   1.00 0.00 ? 27 THR B HG22 14 
ATOM 10897 H HG23 . THR B 2 27 ? -5.194  6.392   4.175   1.00 0.00 ? 27 THR B HG23 14 
ATOM 10898 N N    . PRO B 2 28 ? -6.029  8.187   -0.601  1.00 0.00 ? 28 PRO B N    14 
ATOM 10899 C CA   . PRO B 2 28 ? -5.243  9.188   -1.362  1.00 0.00 ? 28 PRO B CA   14 
ATOM 10900 C C    . PRO B 2 28 ? -5.739  10.600  -1.031  1.00 0.00 ? 28 PRO B C    14 
ATOM 10901 O O    . PRO B 2 28 ? -6.704  11.075  -1.594  1.00 0.00 ? 28 PRO B O    14 
ATOM 10902 C CB   . PRO B 2 28 ? -5.488  8.878   -2.842  1.00 0.00 ? 28 PRO B CB   14 
ATOM 10903 C CG   . PRO B 2 28 ? -6.513  7.730   -2.913  1.00 0.00 ? 28 PRO B CG   14 
ATOM 10904 C CD   . PRO B 2 28 ? -6.776  7.255   -1.478  1.00 0.00 ? 28 PRO B CD   14 
ATOM 10905 H HA   . PRO B 2 28 ? -4.193  9.094   -1.134  1.00 0.00 ? 28 PRO B HA   14 
ATOM 10906 H HB2  . PRO B 2 28 ? -5.876  9.753   -3.342  1.00 0.00 ? 28 PRO B HB2  14 
ATOM 10907 H HB3  . PRO B 2 28 ? -4.565  8.568   -3.310  1.00 0.00 ? 28 PRO B HB3  14 
ATOM 10908 H HG2  . PRO B 2 28 ? -7.432  8.089   -3.357  1.00 0.00 ? 28 PRO B HG2  14 
ATOM 10909 H HG3  . PRO B 2 28 ? -6.116  6.916   -3.498  1.00 0.00 ? 28 PRO B HG3  14 
ATOM 10910 H HD2  . PRO B 2 28 ? -7.833  7.300   -1.257  1.00 0.00 ? 28 PRO B HD2  14 
ATOM 10911 H HD3  . PRO B 2 28 ? -6.407  6.251   -1.346  1.00 0.00 ? 28 PRO B HD3  14 
ATOM 10912 N N    . LYS B 2 29 ? -5.089  11.275  -0.120  1.00 0.00 ? 29 LYS B N    14 
ATOM 10913 C CA   . LYS B 2 29 ? -5.532  12.650  0.240   1.00 0.00 ? 29 LYS B CA   14 
ATOM 10914 C C    . LYS B 2 29 ? -4.418  13.650  -0.079  1.00 0.00 ? 29 LYS B C    14 
ATOM 10915 O O    . LYS B 2 29 ? -3.251  13.383  0.132   1.00 0.00 ? 29 LYS B O    14 
ATOM 10916 C CB   . LYS B 2 29 ? -5.859  12.707  1.733   1.00 0.00 ? 29 LYS B CB   14 
ATOM 10917 C CG   . LYS B 2 29 ? -4.629  12.291  2.543   1.00 0.00 ? 29 LYS B CG   14 
ATOM 10918 C CD   . LYS B 2 29 ? -4.549  13.131  3.819   1.00 0.00 ? 29 LYS B CD   14 
ATOM 10919 C CE   . LYS B 2 29 ? -3.745  12.373  4.877   1.00 0.00 ? 29 LYS B CE   14 
ATOM 10920 N NZ   . LYS B 2 29 ? -2.290  12.612  4.660   1.00 0.00 ? 29 LYS B NZ   14 
ATOM 10921 H H    . LYS B 2 29 ? -4.313  10.877  0.327   1.00 0.00 ? 29 LYS B H    14 
ATOM 10922 H HA   . LYS B 2 29 ? -6.414  12.903  -0.330  1.00 0.00 ? 29 LYS B HA   14 
ATOM 10923 H HB2  . LYS B 2 29 ? -6.143  13.713  2.002   1.00 0.00 ? 29 LYS B HB2  14 
ATOM 10924 H HB3  . LYS B 2 29 ? -6.673  12.033  1.948   1.00 0.00 ? 29 LYS B HB3  14 
ATOM 10925 H HG2  . LYS B 2 29 ? -4.706  11.245  2.802   1.00 0.00 ? 29 LYS B HG2  14 
ATOM 10926 H HG3  . LYS B 2 29 ? -3.738  12.451  1.954   1.00 0.00 ? 29 LYS B HG3  14 
ATOM 10927 H HD2  . LYS B 2 29 ? -4.064  14.071  3.602   1.00 0.00 ? 29 LYS B HD2  14 
ATOM 10928 H HD3  . LYS B 2 29 ? -5.545  13.316  4.192   1.00 0.00 ? 29 LYS B HD3  14 
ATOM 10929 H HE2  . LYS B 2 29 ? -4.024  12.723  5.860   1.00 0.00 ? 29 LYS B HE2  14 
ATOM 10930 H HE3  . LYS B 2 29 ? -3.954  11.315  4.800   1.00 0.00 ? 29 LYS B HE3  14 
ATOM 10931 H HZ1  . LYS B 2 29 ? -2.163  13.279  3.875   1.00 0.00 ? 29 LYS B HZ1  14 
ATOM 10932 H HZ2  . LYS B 2 29 ? -1.870  13.008  5.523   1.00 0.00 ? 29 LYS B HZ2  14 
ATOM 10933 H HZ3  . LYS B 2 29 ? -1.823  11.711  4.427   1.00 0.00 ? 29 LYS B HZ3  14 
ATOM 10934 N N    . THR B 2 30 ? -4.770  14.800  -0.586  1.00 0.00 ? 30 THR B N    14 
ATOM 10935 C CA   . THR B 2 30 ? -3.732  15.816  -0.919  1.00 0.00 ? 30 THR B CA   14 
ATOM 10936 C C    . THR B 2 30 ? -4.376  17.203  -0.965  1.00 0.00 ? 30 THR B C    14 
ATOM 10937 O O    . THR B 2 30 ? -5.586  17.277  -0.831  1.00 0.00 ? 30 THR B O    14 
ATOM 10938 C CB   . THR B 2 30 ? -3.119  15.492  -2.283  1.00 0.00 ? 30 THR B CB   14 
ATOM 10939 O OG1  . THR B 2 30 ? -1.991  16.328  -2.503  1.00 0.00 ? 30 THR B OG1  14 
ATOM 10940 C CG2  . THR B 2 30 ? -4.157  15.729  -3.381  1.00 0.00 ? 30 THR B CG2  14 
ATOM 10941 O OXT  . THR B 2 30 ? -3.649  18.168  -1.133  1.00 0.00 ? 30 THR B OXT  14 
ATOM 10942 H H    . THR B 2 30 ? -5.715  14.993  -0.748  1.00 0.00 ? 30 THR B H    14 
ATOM 10943 H HA   . THR B 2 30 ? -2.960  15.803  -0.164  1.00 0.00 ? 30 THR B HA   14 
ATOM 10944 H HB   . THR B 2 30 ? -2.811  14.456  -2.303  1.00 0.00 ? 30 THR B HB   14 
ATOM 10945 H HG1  . THR B 2 30 ? -2.277  17.080  -3.029  1.00 0.00 ? 30 THR B HG1  14 
ATOM 10946 H HG21 . THR B 2 30 ? -5.087  15.251  -3.108  1.00 0.00 ? 30 THR B HG21 14 
ATOM 10947 H HG22 . THR B 2 30 ? -4.318  16.790  -3.500  1.00 0.00 ? 30 THR B HG22 14 
ATOM 10948 H HG23 . THR B 2 30 ? -3.798  15.314  -4.311  1.00 0.00 ? 30 THR B HG23 14 
ATOM 10949 N N    . GLY A 1 1  ? -3.011  7.958   6.128   1.00 0.00 ? 1  GLY A N    15 
ATOM 10950 C CA   . GLY A 1 1  ? -3.241  6.516   6.438   1.00 0.00 ? 1  GLY A CA   15 
ATOM 10951 C C    . GLY A 1 1  ? -1.908  5.770   6.422   1.00 0.00 ? 1  GLY A C    15 
ATOM 10952 O O    . GLY A 1 1  ? -0.930  6.204   6.997   1.00 0.00 ? 1  GLY A O    15 
ATOM 10953 H H1   . GLY A 1 1  ? -1.999  8.117   5.952   1.00 0.00 ? 1  GLY A H1   15 
ATOM 10954 H H2   . GLY A 1 1  ? -3.556  8.218   5.281   1.00 0.00 ? 1  GLY A H2   15 
ATOM 10955 H H3   . GLY A 1 1  ? -3.319  8.540   6.933   1.00 0.00 ? 1  GLY A H3   15 
ATOM 10956 H HA2  . GLY A 1 1  ? -3.694  6.426   7.414   1.00 0.00 ? 1  GLY A HA2  15 
ATOM 10957 H HA3  . GLY A 1 1  ? -3.895  6.087   5.694   1.00 0.00 ? 1  GLY A HA3  15 
ATOM 10958 N N    . ILE A 1 2  ? -1.867  4.646   5.765   1.00 0.00 ? 2  ILE A N    15 
ATOM 10959 C CA   . ILE A 1 2  ? -0.608  3.857   5.699   1.00 0.00 ? 2  ILE A CA   15 
ATOM 10960 C C    . ILE A 1 2  ? 0.512   4.740   5.135   1.00 0.00 ? 2  ILE A C    15 
ATOM 10961 O O    . ILE A 1 2  ? 1.661   4.604   5.503   1.00 0.00 ? 2  ILE A O    15 
ATOM 10962 C CB   . ILE A 1 2  ? -0.855  2.623   4.809   1.00 0.00 ? 2  ILE A CB   15 
ATOM 10963 C CG1  . ILE A 1 2  ? -0.408  1.358   5.548   1.00 0.00 ? 2  ILE A CG1  15 
ATOM 10964 C CG2  . ILE A 1 2  ? -0.101  2.725   3.480   1.00 0.00 ? 2  ILE A CG2  15 
ATOM 10965 C CD1  . ILE A 1 2  ? -1.077  0.130   4.915   1.00 0.00 ? 2  ILE A CD1  15 
ATOM 10966 H H    . ILE A 1 2  ? -2.671  4.320   5.310   1.00 0.00 ? 2  ILE A H    15 
ATOM 10967 H HA   . ILE A 1 2  ? -0.336  3.532   6.694   1.00 0.00 ? 2  ILE A HA   15 
ATOM 10968 H HB   . ILE A 1 2  ? -1.908  2.558   4.602   1.00 0.00 ? 2  ILE A HB   15 
ATOM 10969 H HG12 . ILE A 1 2  ? 0.665   1.260   5.476   1.00 0.00 ? 2  ILE A HG12 15 
ATOM 10970 H HG13 . ILE A 1 2  ? -0.694  1.427   6.586   1.00 0.00 ? 2  ILE A HG13 15 
ATOM 10971 H HG21 . ILE A 1 2  ? -0.316  3.677   3.015   1.00 0.00 ? 2  ILE A HG21 15 
ATOM 10972 H HG22 . ILE A 1 2  ? 0.961   2.648   3.662   1.00 0.00 ? 2  ILE A HG22 15 
ATOM 10973 H HG23 . ILE A 1 2  ? -0.413  1.926   2.827   1.00 0.00 ? 2  ILE A HG23 15 
ATOM 10974 H HD11 . ILE A 1 2  ? -1.277  0.320   3.870   1.00 0.00 ? 2  ILE A HD11 15 
ATOM 10975 H HD12 . ILE A 1 2  ? -0.424  -0.723  5.008   1.00 0.00 ? 2  ILE A HD12 15 
ATOM 10976 H HD13 . ILE A 1 2  ? -2.008  -0.074  5.424   1.00 0.00 ? 2  ILE A HD13 15 
ATOM 10977 N N    . VAL A 1 3  ? 0.178   5.634   4.241   1.00 0.00 ? 3  VAL A N    15 
ATOM 10978 C CA   . VAL A 1 3  ? 1.212   6.531   3.640   1.00 0.00 ? 3  VAL A CA   15 
ATOM 10979 C C    . VAL A 1 3  ? 2.221   6.942   4.713   1.00 0.00 ? 3  VAL A C    15 
ATOM 10980 O O    . VAL A 1 3  ? 3.395   7.109   4.445   1.00 0.00 ? 3  VAL A O    15 
ATOM 10981 C CB   . VAL A 1 3  ? 0.532   7.777   3.079   1.00 0.00 ? 3  VAL A CB   15 
ATOM 10982 C CG1  . VAL A 1 3  ? 1.582   8.697   2.455   1.00 0.00 ? 3  VAL A CG1  15 
ATOM 10983 C CG2  . VAL A 1 3  ? -0.486  7.367   2.010   1.00 0.00 ? 3  VAL A CG2  15 
ATOM 10984 H H    . VAL A 1 3  ? -0.758  5.718   3.962   1.00 0.00 ? 3  VAL A H    15 
ATOM 10985 H HA   . VAL A 1 3  ? 1.721   6.007   2.843   1.00 0.00 ? 3  VAL A HA   15 
ATOM 10986 H HB   . VAL A 1 3  ? 0.026   8.301   3.878   1.00 0.00 ? 3  VAL A HB   15 
ATOM 10987 H HG11 . VAL A 1 3  ? 2.569   8.374   2.758   1.00 0.00 ? 3  VAL A HG11 15 
ATOM 10988 H HG12 . VAL A 1 3  ? 1.506   8.654   1.379   1.00 0.00 ? 3  VAL A HG12 15 
ATOM 10989 H HG13 . VAL A 1 3  ? 1.418   9.712   2.787   1.00 0.00 ? 3  VAL A HG13 15 
ATOM 10990 H HG21 . VAL A 1 3  ? -0.514  6.290   1.936   1.00 0.00 ? 3  VAL A HG21 15 
ATOM 10991 H HG22 . VAL A 1 3  ? -1.464  7.736   2.284   1.00 0.00 ? 3  VAL A HG22 15 
ATOM 10992 H HG23 . VAL A 1 3  ? -0.197  7.785   1.059   1.00 0.00 ? 3  VAL A HG23 15 
ATOM 10993 N N    . GLU A 1 4  ? 1.773   7.105   5.928   1.00 0.00 ? 4  GLU A N    15 
ATOM 10994 C CA   . GLU A 1 4  ? 2.703   7.497   7.024   1.00 0.00 ? 4  GLU A CA   15 
ATOM 10995 C C    . GLU A 1 4  ? 3.350   6.235   7.603   1.00 0.00 ? 4  GLU A C    15 
ATOM 10996 O O    . GLU A 1 4  ? 3.390   6.038   8.802   1.00 0.00 ? 4  GLU A O    15 
ATOM 10997 C CB   . GLU A 1 4  ? 1.924   8.223   8.122   1.00 0.00 ? 4  GLU A CB   15 
ATOM 10998 C CG   . GLU A 1 4  ? 2.612   9.551   8.444   1.00 0.00 ? 4  GLU A CG   15 
ATOM 10999 C CD   . GLU A 1 4  ? 2.513   10.484  7.236   1.00 0.00 ? 4  GLU A CD   15 
ATOM 11000 O OE1  . GLU A 1 4  ? 1.401   10.764  6.819   1.00 0.00 ? 4  GLU A OE1  15 
ATOM 11001 O OE2  . GLU A 1 4  ? 3.550   10.902  6.748   1.00 0.00 ? 4  GLU A OE2  15 
ATOM 11002 H H    . GLU A 1 4  ? 0.823   6.963   6.120   1.00 0.00 ? 4  GLU A H    15 
ATOM 11003 H HA   . GLU A 1 4  ? 3.469   8.148   6.631   1.00 0.00 ? 4  GLU A HA   15 
ATOM 11004 H HB2  . GLU A 1 4  ? 0.916   8.411   7.785   1.00 0.00 ? 4  GLU A HB2  15 
ATOM 11005 H HB3  . GLU A 1 4  ? 1.897   7.609   9.012   1.00 0.00 ? 4  GLU A HB3  15 
ATOM 11006 H HG2  . GLU A 1 4  ? 2.130   10.009  9.296   1.00 0.00 ? 4  GLU A HG2  15 
ATOM 11007 H HG3  . GLU A 1 4  ? 3.653   9.371   8.673   1.00 0.00 ? 4  GLU A HG3  15 
ATOM 11008 N N    . GLN A 1 5  ? 3.852   5.382   6.755   1.00 0.00 ? 5  GLN A N    15 
ATOM 11009 C CA   . GLN A 1 5  ? 4.494   4.127   7.238   1.00 0.00 ? 5  GLN A CA   15 
ATOM 11010 C C    . GLN A 1 5  ? 5.023   3.341   6.038   1.00 0.00 ? 5  GLN A C    15 
ATOM 11011 O O    . GLN A 1 5  ? 6.033   2.669   6.115   1.00 0.00 ? 5  GLN A O    15 
ATOM 11012 C CB   . GLN A 1 5  ? 3.458   3.281   7.986   1.00 0.00 ? 5  GLN A CB   15 
ATOM 11013 C CG   . GLN A 1 5  ? 3.802   3.250   9.476   1.00 0.00 ? 5  GLN A CG   15 
ATOM 11014 C CD   . GLN A 1 5  ? 2.608   2.712   10.264  1.00 0.00 ? 5  GLN A CD   15 
ATOM 11015 O OE1  . GLN A 1 5  ? 2.067   1.674   9.938   1.00 0.00 ? 5  GLN A OE1  15 
ATOM 11016 N NE2  . GLN A 1 5  ? 2.169   3.378   11.297  1.00 0.00 ? 5  GLN A NE2  15 
ATOM 11017 H H    . GLN A 1 5  ? 3.804   5.564   5.795   1.00 0.00 ? 5  GLN A H    15 
ATOM 11018 H HA   . GLN A 1 5  ? 5.310   4.370   7.903   1.00 0.00 ? 5  GLN A HA   15 
ATOM 11019 H HB2  . GLN A 1 5  ? 2.476   3.709   7.848   1.00 0.00 ? 5  GLN A HB2  15 
ATOM 11020 H HB3  . GLN A 1 5  ? 3.470   2.273   7.595   1.00 0.00 ? 5  GLN A HB3  15 
ATOM 11021 H HG2  . GLN A 1 5  ? 4.658   2.611   9.635   1.00 0.00 ? 5  GLN A HG2  15 
ATOM 11022 H HG3  . GLN A 1 5  ? 4.031   4.250   9.814   1.00 0.00 ? 5  GLN A HG3  15 
ATOM 11023 H HE21 . GLN A 1 5  ? 2.606   4.215   11.561  1.00 0.00 ? 5  GLN A HE21 15 
ATOM 11024 H HE22 . GLN A 1 5  ? 1.404   3.041   11.808  1.00 0.00 ? 5  GLN A HE22 15 
ATOM 11025 N N    . CYS A 1 6  ? 4.347   3.427   4.924   1.00 0.00 ? 6  CYS A N    15 
ATOM 11026 C CA   . CYS A 1 6  ? 4.798   2.697   3.710   1.00 0.00 ? 6  CYS A CA   15 
ATOM 11027 C C    . CYS A 1 6  ? 5.608   3.647   2.824   1.00 0.00 ? 6  CYS A C    15 
ATOM 11028 O O    . CYS A 1 6  ? 6.499   3.237   2.108   1.00 0.00 ? 6  CYS A O    15 
ATOM 11029 C CB   . CYS A 1 6  ? 3.574   2.201   2.943   1.00 0.00 ? 6  CYS A CB   15 
ATOM 11030 S SG   . CYS A 1 6  ? 2.987   0.652   3.676   1.00 0.00 ? 6  CYS A SG   15 
ATOM 11031 H H    . CYS A 1 6  ? 3.540   3.976   4.888   1.00 0.00 ? 6  CYS A H    15 
ATOM 11032 H HA   . CYS A 1 6  ? 5.409   1.857   3.995   1.00 0.00 ? 6  CYS A HA   15 
ATOM 11033 H HB2  . CYS A 1 6  ? 2.793   2.944   3.004   1.00 0.00 ? 6  CYS A HB2  15 
ATOM 11034 H HB3  . CYS A 1 6  ? 3.835   2.036   1.908   1.00 0.00 ? 6  CYS A HB3  15 
ATOM 11035 N N    . CYS A 1 7  ? 5.301   4.914   2.870   1.00 0.00 ? 7  CYS A N    15 
ATOM 11036 C CA   . CYS A 1 7  ? 6.051   5.895   2.037   1.00 0.00 ? 7  CYS A CA   15 
ATOM 11037 C C    . CYS A 1 7  ? 7.216   6.465   2.851   1.00 0.00 ? 7  CYS A C    15 
ATOM 11038 O O    . CYS A 1 7  ? 8.218   6.887   2.310   1.00 0.00 ? 7  CYS A O    15 
ATOM 11039 C CB   . CYS A 1 7  ? 5.111   7.032   1.624   1.00 0.00 ? 7  CYS A CB   15 
ATOM 11040 S SG   . CYS A 1 7  ? 6.071   8.391   0.907   1.00 0.00 ? 7  CYS A SG   15 
ATOM 11041 H H    . CYS A 1 7  ? 4.580   5.222   3.458   1.00 0.00 ? 7  CYS A H    15 
ATOM 11042 H HA   . CYS A 1 7  ? 6.431   5.402   1.156   1.00 0.00 ? 7  CYS A HA   15 
ATOM 11043 H HB2  . CYS A 1 7  ? 4.405   6.665   0.892   1.00 0.00 ? 7  CYS A HB2  15 
ATOM 11044 H HB3  . CYS A 1 7  ? 4.575   7.389   2.492   1.00 0.00 ? 7  CYS A HB3  15 
ATOM 11045 N N    . THR A 1 8  ? 7.089   6.483   4.150   1.00 0.00 ? 8  THR A N    15 
ATOM 11046 C CA   . THR A 1 8  ? 8.184   7.028   5.003   1.00 0.00 ? 8  THR A CA   15 
ATOM 11047 C C    . THR A 1 8  ? 9.336   6.025   5.067   1.00 0.00 ? 8  THR A C    15 
ATOM 11048 O O    . THR A 1 8  ? 10.393  6.313   5.591   1.00 0.00 ? 8  THR A O    15 
ATOM 11049 C CB   . THR A 1 8  ? 7.652   7.282   6.414   1.00 0.00 ? 8  THR A CB   15 
ATOM 11050 O OG1  . THR A 1 8  ? 7.095   6.082   6.930   1.00 0.00 ? 8  THR A OG1  15 
ATOM 11051 C CG2  . THR A 1 8  ? 6.577   8.369   6.368   1.00 0.00 ? 8  THR A CG2  15 
ATOM 11052 H H    . THR A 1 8  ? 6.270   6.138   4.567   1.00 0.00 ? 8  THR A H    15 
ATOM 11053 H HA   . THR A 1 8  ? 8.538   7.956   4.579   1.00 0.00 ? 8  THR A HA   15 
ATOM 11054 H HB   . THR A 1 8  ? 8.460   7.609   7.050   1.00 0.00 ? 8  THR A HB   15 
ATOM 11055 H HG1  . THR A 1 8  ? 7.808   5.562   7.307   1.00 0.00 ? 8  THR A HG1  15 
ATOM 11056 H HG21 . THR A 1 8  ? 6.863   9.130   5.655   1.00 0.00 ? 8  THR A HG21 15 
ATOM 11057 H HG22 . THR A 1 8  ? 5.636   7.932   6.068   1.00 0.00 ? 8  THR A HG22 15 
ATOM 11058 H HG23 . THR A 1 8  ? 6.472   8.814   7.346   1.00 0.00 ? 8  THR A HG23 15 
ATOM 11059 N N    . SER A 1 9  ? 9.141   4.847   4.540   1.00 0.00 ? 9  SER A N    15 
ATOM 11060 C CA   . SER A 1 9  ? 10.228  3.828   4.575   1.00 0.00 ? 9  SER A CA   15 
ATOM 11061 C C    . SER A 1 9  ? 9.893   2.691   3.611   1.00 0.00 ? 9  SER A C    15 
ATOM 11062 O O    . SER A 1 9  ? 9.176   2.874   2.647   1.00 0.00 ? 9  SER A O    15 
ATOM 11063 C CB   . SER A 1 9  ? 10.358  3.273   5.994   1.00 0.00 ? 9  SER A CB   15 
ATOM 11064 O OG   . SER A 1 9  ? 10.384  4.351   6.920   1.00 0.00 ? 9  SER A OG   15 
ATOM 11065 H H    . SER A 1 9  ? 8.281   4.632   4.123   1.00 0.00 ? 9  SER A H    15 
ATOM 11066 H HA   . SER A 1 9  ? 11.161  4.287   4.283   1.00 0.00 ? 9  SER A HA   15 
ATOM 11067 H HB2  . SER A 1 9  ? 9.516   2.638   6.213   1.00 0.00 ? 9  SER A HB2  15 
ATOM 11068 H HB3  . SER A 1 9  ? 11.270  2.696   6.070   1.00 0.00 ? 9  SER A HB3  15 
ATOM 11069 H HG   . SER A 1 9  ? 10.928  4.088   7.665   1.00 0.00 ? 9  SER A HG   15 
ATOM 11070 N N    . ILE A 1 10 ? 10.407  1.518   3.861   1.00 0.00 ? 10 ILE A N    15 
ATOM 11071 C CA   . ILE A 1 10 ? 10.116  0.371   2.957   1.00 0.00 ? 10 ILE A CA   15 
ATOM 11072 C C    . ILE A 1 10 ? 8.797   -0.284  3.370   1.00 0.00 ? 10 ILE A C    15 
ATOM 11073 O O    . ILE A 1 10 ? 8.742   -1.057  4.307   1.00 0.00 ? 10 ILE A O    15 
ATOM 11074 C CB   . ILE A 1 10 ? 11.250  -0.649  3.046   1.00 0.00 ? 10 ILE A CB   15 
ATOM 11075 C CG1  . ILE A 1 10 ? 12.577  0.051   2.677   1.00 0.00 ? 10 ILE A CG1  15 
ATOM 11076 C CG2  . ILE A 1 10 ? 10.947  -1.822  2.103   1.00 0.00 ? 10 ILE A CG2  15 
ATOM 11077 C CD1  . ILE A 1 10 ? 13.234  -0.595  1.449   1.00 0.00 ? 10 ILE A CD1  15 
ATOM 11078 H H    . ILE A 1 10 ? 10.984  1.393   4.644   1.00 0.00 ? 10 ILE A H    15 
ATOM 11079 H HA   . ILE A 1 10 ? 10.035  0.729   1.941   1.00 0.00 ? 10 ILE A HA   15 
ATOM 11080 H HB   . ILE A 1 10 ? 11.310  -1.020  4.060   1.00 0.00 ? 10 ILE A HB   15 
ATOM 11081 H HG12 . ILE A 1 10 ? 12.379  1.091   2.465   1.00 0.00 ? 10 ILE A HG12 15 
ATOM 11082 H HG13 . ILE A 1 10 ? 13.255  -0.014  3.517   1.00 0.00 ? 10 ILE A HG13 15 
ATOM 11083 H HG21 . ILE A 1 10 ? 10.620  -1.440  1.147   1.00 0.00 ? 10 ILE A HG21 15 
ATOM 11084 H HG22 . ILE A 1 10 ? 11.841  -2.414  1.966   1.00 0.00 ? 10 ILE A HG22 15 
ATOM 11085 H HG23 . ILE A 1 10 ? 10.170  -2.437  2.531   1.00 0.00 ? 10 ILE A HG23 15 
ATOM 11086 H HD11 . ILE A 1 10 ? 12.526  -0.622  0.635   1.00 0.00 ? 10 ILE A HD11 15 
ATOM 11087 H HD12 . ILE A 1 10 ? 14.097  -0.014  1.156   1.00 0.00 ? 10 ILE A HD12 15 
ATOM 11088 H HD13 . ILE A 1 10 ? 13.544  -1.600  1.693   1.00 0.00 ? 10 ILE A HD13 15 
ATOM 11089 N N    . CYS A 1 11 ? 7.735   0.021   2.679   1.00 0.00 ? 11 CYS A N    15 
ATOM 11090 C CA   . CYS A 1 11 ? 6.418   -0.580  3.028   1.00 0.00 ? 11 CYS A CA   15 
ATOM 11091 C C    . CYS A 1 11 ? 6.529   -2.104  3.023   1.00 0.00 ? 11 CYS A C    15 
ATOM 11092 O O    . CYS A 1 11 ? 7.386   -2.673  2.375   1.00 0.00 ? 11 CYS A O    15 
ATOM 11093 C CB   . CYS A 1 11 ? 5.374   -0.145  2.002   1.00 0.00 ? 11 CYS A CB   15 
ATOM 11094 S SG   . CYS A 1 11 ? 3.752   -0.787  2.484   1.00 0.00 ? 11 CYS A SG   15 
ATOM 11095 H H    . CYS A 1 11 ? 7.802   0.647   1.929   1.00 0.00 ? 11 CYS A H    15 
ATOM 11096 H HA   . CYS A 1 11 ? 6.119   -0.244  4.011   1.00 0.00 ? 11 CYS A HA   15 
ATOM 11097 H HB2  . CYS A 1 11 ? 5.336   0.933   1.958   1.00 0.00 ? 11 CYS A HB2  15 
ATOM 11098 H HB3  . CYS A 1 11 ? 5.640   -0.536  1.031   1.00 0.00 ? 11 CYS A HB3  15 
ATOM 11099 N N    . SER A 1 12 ? 5.664   -2.772  3.737   1.00 0.00 ? 12 SER A N    15 
ATOM 11100 C CA   . SER A 1 12 ? 5.711   -4.260  3.771   1.00 0.00 ? 12 SER A CA   15 
ATOM 11101 C C    . SER A 1 12 ? 4.399   -4.817  3.215   1.00 0.00 ? 12 SER A C    15 
ATOM 11102 O O    . SER A 1 12 ? 3.479   -4.083  2.918   1.00 0.00 ? 12 SER A O    15 
ATOM 11103 C CB   . SER A 1 12 ? 5.897   -4.731  5.215   1.00 0.00 ? 12 SER A CB   15 
ATOM 11104 O OG   . SER A 1 12 ? 4.885   -4.156  6.030   1.00 0.00 ? 12 SER A OG   15 
ATOM 11105 H H    . SER A 1 12 ? 4.978   -2.291  4.249   1.00 0.00 ? 12 SER A H    15 
ATOM 11106 H HA   . SER A 1 12 ? 6.535   -4.609  3.168   1.00 0.00 ? 12 SER A HA   15 
ATOM 11107 H HB2  . SER A 1 12 ? 5.818   -5.804  5.259   1.00 0.00 ? 12 SER A HB2  15 
ATOM 11108 H HB3  . SER A 1 12 ? 6.874   -4.429  5.566   1.00 0.00 ? 12 SER A HB3  15 
ATOM 11109 H HG   . SER A 1 12 ? 5.302   -3.515  6.612   1.00 0.00 ? 12 SER A HG   15 
ATOM 11110 N N    . LEU A 1 13 ? 4.306   -6.111  3.069   1.00 0.00 ? 13 LEU A N    15 
ATOM 11111 C CA   . LEU A 1 13 ? 3.053   -6.711  2.530   1.00 0.00 ? 13 LEU A CA   15 
ATOM 11112 C C    . LEU A 1 13 ? 2.088   -7.004  3.682   1.00 0.00 ? 13 LEU A C    15 
ATOM 11113 O O    . LEU A 1 13 ? 1.064   -7.633  3.500   1.00 0.00 ? 13 LEU A O    15 
ATOM 11114 C CB   . LEU A 1 13 ? 3.388   -8.012  1.802   1.00 0.00 ? 13 LEU A CB   15 
ATOM 11115 C CG   . LEU A 1 13 ? 3.295   -7.785  0.292   1.00 0.00 ? 13 LEU A CG   15 
ATOM 11116 C CD1  . LEU A 1 13 ? 1.879   -7.327  -0.069  1.00 0.00 ? 13 LEU A CD1  15 
ATOM 11117 C CD2  . LEU A 1 13 ? 4.299   -6.710  -0.122  1.00 0.00 ? 13 LEU A CD2  15 
ATOM 11118 H H    . LEU A 1 13 ? 5.061   -6.687  3.315   1.00 0.00 ? 13 LEU A H    15 
ATOM 11119 H HA   . LEU A 1 13 ? 2.591   -6.020  1.841   1.00 0.00 ? 13 LEU A HA   15 
ATOM 11120 H HB2  . LEU A 1 13 ? 4.390   -8.323  2.059   1.00 0.00 ? 13 LEU A HB2  15 
ATOM 11121 H HB3  . LEU A 1 13 ? 2.686   -8.778  2.092   1.00 0.00 ? 13 LEU A HB3  15 
ATOM 11122 H HG   . LEU A 1 13 ? 3.515   -8.708  -0.226  1.00 0.00 ? 13 LEU A HG   15 
ATOM 11123 H HD11 . LEU A 1 13 ? 1.264   -7.330  0.820   1.00 0.00 ? 13 LEU A HD11 15 
ATOM 11124 H HD12 . LEU A 1 13 ? 1.919   -6.328  -0.475  1.00 0.00 ? 13 LEU A HD12 15 
ATOM 11125 H HD13 . LEU A 1 13 ? 1.458   -7.999  -0.801  1.00 0.00 ? 13 LEU A HD13 15 
ATOM 11126 H HD21 . LEU A 1 13 ? 4.406   -5.989  0.675   1.00 0.00 ? 13 LEU A HD21 15 
ATOM 11127 H HD22 . LEU A 1 13 ? 5.257   -7.170  -0.322  1.00 0.00 ? 13 LEU A HD22 15 
ATOM 11128 H HD23 . LEU A 1 13 ? 3.947   -6.211  -1.013  1.00 0.00 ? 13 LEU A HD23 15 
ATOM 11129 N N    . TYR A 1 14 ? 2.408   -6.555  4.865   1.00 0.00 ? 14 TYR A N    15 
ATOM 11130 C CA   . TYR A 1 14 ? 1.514   -6.809  6.029   1.00 0.00 ? 14 TYR A CA   15 
ATOM 11131 C C    . TYR A 1 14 ? 0.673   -5.560  6.311   1.00 0.00 ? 14 TYR A C    15 
ATOM 11132 O O    . TYR A 1 14 ? -0.490  -5.646  6.651   1.00 0.00 ? 14 TYR A O    15 
ATOM 11133 C CB   . TYR A 1 14 ? 2.373   -7.152  7.254   1.00 0.00 ? 14 TYR A CB   15 
ATOM 11134 C CG   . TYR A 1 14 ? 1.570   -6.970  8.521   1.00 0.00 ? 14 TYR A CG   15 
ATOM 11135 C CD1  . TYR A 1 14 ? 0.340   -7.621  8.673   1.00 0.00 ? 14 TYR A CD1  15 
ATOM 11136 C CD2  . TYR A 1 14 ? 2.057   -6.147  9.544   1.00 0.00 ? 14 TYR A CD2  15 
ATOM 11137 C CE1  . TYR A 1 14 ? -0.401  -7.450  9.847   1.00 0.00 ? 14 TYR A CE1  15 
ATOM 11138 C CE2  . TYR A 1 14 ? 1.315   -5.975  10.717  1.00 0.00 ? 14 TYR A CE2  15 
ATOM 11139 C CZ   . TYR A 1 14 ? 0.086   -6.627  10.870  1.00 0.00 ? 14 TYR A CZ   15 
ATOM 11140 O OH   . TYR A 1 14 ? -0.646  -6.457  12.029  1.00 0.00 ? 14 TYR A OH   15 
ATOM 11141 H H    . TYR A 1 14 ? 3.239   -6.053  4.988   1.00 0.00 ? 14 TYR A H    15 
ATOM 11142 H HA   . TYR A 1 14 ? 0.858   -7.639  5.806   1.00 0.00 ? 14 TYR A HA   15 
ATOM 11143 H HB2  . TYR A 1 14 ? 2.704   -8.176  7.183   1.00 0.00 ? 14 TYR A HB2  15 
ATOM 11144 H HB3  . TYR A 1 14 ? 3.234   -6.499  7.279   1.00 0.00 ? 14 TYR A HB3  15 
ATOM 11145 H HD1  . TYR A 1 14 ? -0.036  -8.255  7.883   1.00 0.00 ? 14 TYR A HD1  15 
ATOM 11146 H HD2  . TYR A 1 14 ? 3.007   -5.645  9.425   1.00 0.00 ? 14 TYR A HD2  15 
ATOM 11147 H HE1  . TYR A 1 14 ? -1.350  -7.952  9.966   1.00 0.00 ? 14 TYR A HE1  15 
ATOM 11148 H HE2  . TYR A 1 14 ? 1.693   -5.342  11.507  1.00 0.00 ? 14 TYR A HE2  15 
ATOM 11149 H HH   . TYR A 1 14 ? -1.560  -6.304  11.782  1.00 0.00 ? 14 TYR A HH   15 
ATOM 11150 N N    . GLN A 1 15 ? 1.253   -4.398  6.181   1.00 0.00 ? 15 GLN A N    15 
ATOM 11151 C CA   . GLN A 1 15 ? 0.486   -3.149  6.448   1.00 0.00 ? 15 GLN A CA   15 
ATOM 11152 C C    . GLN A 1 15 ? -0.654  -3.015  5.437   1.00 0.00 ? 15 GLN A C    15 
ATOM 11153 O O    . GLN A 1 15 ? -1.725  -2.541  5.756   1.00 0.00 ? 15 GLN A O    15 
ATOM 11154 C CB   . GLN A 1 15 ? 1.420   -1.944  6.330   1.00 0.00 ? 15 GLN A CB   15 
ATOM 11155 C CG   . GLN A 1 15 ? 2.686   -2.201  7.150   1.00 0.00 ? 15 GLN A CG   15 
ATOM 11156 C CD   . GLN A 1 15 ? 3.392   -0.874  7.433   1.00 0.00 ? 15 GLN A CD   15 
ATOM 11157 O OE1  . GLN A 1 15 ? 4.291   -0.486  6.715   1.00 0.00 ? 15 GLN A OE1  15 
ATOM 11158 N NE2  . GLN A 1 15 ? 3.018   -0.158  8.458   1.00 0.00 ? 15 GLN A NE2  15 
ATOM 11159 H H    . GLN A 1 15 ? 2.193   -4.349  5.911   1.00 0.00 ? 15 GLN A H    15 
ATOM 11160 H HA   . GLN A 1 15 ? 0.075   -3.187  7.447   1.00 0.00 ? 15 GLN A HA   15 
ATOM 11161 H HB2  . GLN A 1 15 ? 1.684   -1.793  5.293   1.00 0.00 ? 15 GLN A HB2  15 
ATOM 11162 H HB3  . GLN A 1 15 ? 0.923   -1.063  6.707   1.00 0.00 ? 15 GLN A HB3  15 
ATOM 11163 H HG2  . GLN A 1 15 ? 2.420   -2.675  8.083   1.00 0.00 ? 15 GLN A HG2  15 
ATOM 11164 H HG3  . GLN A 1 15 ? 3.349   -2.848  6.594   1.00 0.00 ? 15 GLN A HG3  15 
ATOM 11165 H HE21 . GLN A 1 15 ? 2.293   -0.470  9.036   1.00 0.00 ? 15 GLN A HE21 15 
ATOM 11166 H HE22 . GLN A 1 15 ? 3.464   0.695   8.647   1.00 0.00 ? 15 GLN A HE22 15 
ATOM 11167 N N    . LEU A 1 16 ? -0.435  -3.426  4.217   1.00 0.00 ? 16 LEU A N    15 
ATOM 11168 C CA   . LEU A 1 16 ? -1.513  -3.315  3.195   1.00 0.00 ? 16 LEU A CA   15 
ATOM 11169 C C    . LEU A 1 16 ? -2.537  -4.432  3.402   1.00 0.00 ? 16 LEU A C    15 
ATOM 11170 O O    . LEU A 1 16 ? -3.576  -4.456  2.776   1.00 0.00 ? 16 LEU A O    15 
ATOM 11171 C CB   . LEU A 1 16 ? -0.914  -3.426  1.791   1.00 0.00 ? 16 LEU A CB   15 
ATOM 11172 C CG   . LEU A 1 16 ? 0.208   -2.395  1.589   1.00 0.00 ? 16 LEU A CG   15 
ATOM 11173 C CD1  . LEU A 1 16 ? 0.243   -1.984  0.120   1.00 0.00 ? 16 LEU A CD1  15 
ATOM 11174 C CD2  . LEU A 1 16 ? -0.037  -1.146  2.444   1.00 0.00 ? 16 LEU A CD2  15 
ATOM 11175 H H    . LEU A 1 16 ? 0.435   -3.805  3.975   1.00 0.00 ? 16 LEU A H    15 
ATOM 11176 H HA   . LEU A 1 16 ? -2.005  -2.359  3.300   1.00 0.00 ? 16 LEU A HA   15 
ATOM 11177 H HB2  . LEU A 1 16 ? -0.512  -4.419  1.656   1.00 0.00 ? 16 LEU A HB2  15 
ATOM 11178 H HB3  . LEU A 1 16 ? -1.689  -3.256  1.058   1.00 0.00 ? 16 LEU A HB3  15 
ATOM 11179 H HG   . LEU A 1 16 ? 1.156   -2.839  1.859   1.00 0.00 ? 16 LEU A HG   15 
ATOM 11180 H HD11 . LEU A 1 16 ? -0.744  -1.671  -0.187  1.00 0.00 ? 16 LEU A HD11 15 
ATOM 11181 H HD12 . LEU A 1 16 ? 0.936   -1.165  -0.009  1.00 0.00 ? 16 LEU A HD12 15 
ATOM 11182 H HD13 . LEU A 1 16 ? 0.559   -2.823  -0.480  1.00 0.00 ? 16 LEU A HD13 15 
ATOM 11183 H HD21 . LEU A 1 16 ? -1.095  -0.947  2.500   1.00 0.00 ? 16 LEU A HD21 15 
ATOM 11184 H HD22 . LEU A 1 16 ? 0.353   -1.310  3.438   1.00 0.00 ? 16 LEU A HD22 15 
ATOM 11185 H HD23 . LEU A 1 16 ? 0.465   -0.300  1.999   1.00 0.00 ? 16 LEU A HD23 15 
ATOM 11186 N N    . GLU A 1 17 ? -2.255  -5.357  4.278   1.00 0.00 ? 17 GLU A N    15 
ATOM 11187 C CA   . GLU A 1 17 ? -3.222  -6.461  4.519   1.00 0.00 ? 17 GLU A CA   15 
ATOM 11188 C C    . GLU A 1 17 ? -4.470  -5.889  5.194   1.00 0.00 ? 17 GLU A C    15 
ATOM 11189 O O    . GLU A 1 17 ? -5.519  -6.503  5.207   1.00 0.00 ? 17 GLU A O    15 
ATOM 11190 C CB   . GLU A 1 17 ? -2.580  -7.515  5.423   1.00 0.00 ? 17 GLU A CB   15 
ATOM 11191 C CG   . GLU A 1 17 ? -1.629  -8.383  4.596   1.00 0.00 ? 17 GLU A CG   15 
ATOM 11192 C CD   . GLU A 1 17 ? -1.683  -9.826  5.101   1.00 0.00 ? 17 GLU A CD   15 
ATOM 11193 O OE1  . GLU A 1 17 ? -2.081  -10.020 6.238   1.00 0.00 ? 17 GLU A OE1  15 
ATOM 11194 O OE2  . GLU A 1 17 ? -1.329  -10.712 4.341   1.00 0.00 ? 17 GLU A OE2  15 
ATOM 11195 H H    . GLU A 1 17 ? -1.413  -5.321  4.776   1.00 0.00 ? 17 GLU A H    15 
ATOM 11196 H HA   . GLU A 1 17 ? -3.497  -6.912  3.577   1.00 0.00 ? 17 GLU A HA   15 
ATOM 11197 H HB2  . GLU A 1 17 ? -2.029  -7.024  6.212   1.00 0.00 ? 17 GLU A HB2  15 
ATOM 11198 H HB3  . GLU A 1 17 ? -3.351  -8.138  5.854   1.00 0.00 ? 17 GLU A HB3  15 
ATOM 11199 H HG2  . GLU A 1 17 ? -1.926  -8.351  3.557   1.00 0.00 ? 17 GLU A HG2  15 
ATOM 11200 H HG3  . GLU A 1 17 ? -0.621  -8.006  4.693   1.00 0.00 ? 17 GLU A HG3  15 
ATOM 11201 N N    . ASN A 1 18 ? -4.364  -4.713  5.748   1.00 0.00 ? 18 ASN A N    15 
ATOM 11202 C CA   . ASN A 1 18 ? -5.539  -4.090  6.419   1.00 0.00 ? 18 ASN A CA   15 
ATOM 11203 C C    . ASN A 1 18 ? -6.355  -3.308  5.388   1.00 0.00 ? 18 ASN A C    15 
ATOM 11204 O O    . ASN A 1 18 ? -7.468  -2.890  5.645   1.00 0.00 ? 18 ASN A O    15 
ATOM 11205 C CB   . ASN A 1 18 ? -5.057  -3.136  7.515   1.00 0.00 ? 18 ASN A CB   15 
ATOM 11206 C CG   . ASN A 1 18 ? -4.129  -3.887  8.472   1.00 0.00 ? 18 ASN A CG   15 
ATOM 11207 O OD1  . ASN A 1 18 ? -3.091  -4.372  8.074   1.00 0.00 ? 18 ASN A OD1  15 
ATOM 11208 N ND2  . ASN A 1 18 ? -4.467  -4.002  9.727   1.00 0.00 ? 18 ASN A ND2  15 
ATOM 11209 H H    . ASN A 1 18 ? -3.505  -4.238  5.722   1.00 0.00 ? 18 ASN A H    15 
ATOM 11210 H HA   . ASN A 1 18 ? -6.155  -4.862  6.857   1.00 0.00 ? 18 ASN A HA   15 
ATOM 11211 H HB2  . ASN A 1 18 ? -4.521  -2.313  7.063   1.00 0.00 ? 18 ASN A HB2  15 
ATOM 11212 H HB3  . ASN A 1 18 ? -5.906  -2.758  8.061   1.00 0.00 ? 18 ASN A HB3  15 
ATOM 11213 H HD21 . ASN A 1 18 ? -5.306  -3.611  10.049  1.00 0.00 ? 18 ASN A HD21 15 
ATOM 11214 H HD22 . ASN A 1 18 ? -3.880  -4.483  10.350  1.00 0.00 ? 18 ASN A HD22 15 
ATOM 11215 N N    . TYR A 1 19 ? -5.807  -3.103  4.219   1.00 0.00 ? 19 TYR A N    15 
ATOM 11216 C CA   . TYR A 1 19 ? -6.540  -2.343  3.166   1.00 0.00 ? 19 TYR A CA   15 
ATOM 11217 C C    . TYR A 1 19 ? -7.541  -3.257  2.450   1.00 0.00 ? 19 TYR A C    15 
ATOM 11218 O O    . TYR A 1 19 ? -8.081  -2.908  1.419   1.00 0.00 ? 19 TYR A O    15 
ATOM 11219 C CB   . TYR A 1 19 ? -5.531  -1.789  2.159   1.00 0.00 ? 19 TYR A CB   15 
ATOM 11220 C CG   . TYR A 1 19 ? -5.162  -0.388  2.560   1.00 0.00 ? 19 TYR A CG   15 
ATOM 11221 C CD1  . TYR A 1 19 ? -4.163  -0.186  3.508   1.00 0.00 ? 19 TYR A CD1  15 
ATOM 11222 C CD2  . TYR A 1 19 ? -5.828  0.708   1.994   1.00 0.00 ? 19 TYR A CD2  15 
ATOM 11223 C CE1  . TYR A 1 19 ? -3.823  1.110   3.898   1.00 0.00 ? 19 TYR A CE1  15 
ATOM 11224 C CE2  . TYR A 1 19 ? -5.489  2.009   2.386   1.00 0.00 ? 19 TYR A CE2  15 
ATOM 11225 C CZ   . TYR A 1 19 ? -4.486  2.208   3.341   1.00 0.00 ? 19 TYR A CZ   15 
ATOM 11226 O OH   . TYR A 1 19 ? -4.150  3.488   3.730   1.00 0.00 ? 19 TYR A OH   15 
ATOM 11227 H H    . TYR A 1 19 ? -4.907  -3.441  4.038   1.00 0.00 ? 19 TYR A H    15 
ATOM 11228 H HA   . TYR A 1 19 ? -7.073  -1.523  3.625   1.00 0.00 ? 19 TYR A HA   15 
ATOM 11229 H HB2  . TYR A 1 19 ? -4.645  -2.406  2.158   1.00 0.00 ? 19 TYR A HB2  15 
ATOM 11230 H HB3  . TYR A 1 19 ? -5.964  -1.777  1.175   1.00 0.00 ? 19 TYR A HB3  15 
ATOM 11231 H HD1  . TYR A 1 19 ? -3.645  -1.034  3.933   1.00 0.00 ? 19 TYR A HD1  15 
ATOM 11232 H HD2  . TYR A 1 19 ? -6.601  0.548   1.258   1.00 0.00 ? 19 TYR A HD2  15 
ATOM 11233 H HE1  . TYR A 1 19 ? -3.059  1.260   4.634   1.00 0.00 ? 19 TYR A HE1  15 
ATOM 11234 H HE2  . TYR A 1 19 ? -5.996  2.857   1.952   1.00 0.00 ? 19 TYR A HE2  15 
ATOM 11235 H HH   . TYR A 1 19 ? -4.716  4.103   3.253   1.00 0.00 ? 19 TYR A HH   15 
ATOM 11236 N N    . CYS A 1 20 ? -7.798  -4.420  2.985   1.00 0.00 ? 20 CYS A N    15 
ATOM 11237 C CA   . CYS A 1 20 ? -8.771  -5.343  2.331   1.00 0.00 ? 20 CYS A CA   15 
ATOM 11238 C C    . CYS A 1 20 ? -10.183 -5.018  2.820   1.00 0.00 ? 20 CYS A C    15 
ATOM 11239 O O    . CYS A 1 20 ? -10.369 -4.283  3.769   1.00 0.00 ? 20 CYS A O    15 
ATOM 11240 C CB   . CYS A 1 20 ? -8.429  -6.784  2.692   1.00 0.00 ? 20 CYS A CB   15 
ATOM 11241 S SG   . CYS A 1 20 ? -8.041  -7.719  1.190   1.00 0.00 ? 20 CYS A SG   15 
ATOM 11242 H H    . CYS A 1 20 ? -7.359  -4.685  3.818   1.00 0.00 ? 20 CYS A H    15 
ATOM 11243 H HA   . CYS A 1 20 ? -8.726  -5.220  1.263   1.00 0.00 ? 20 CYS A HA   15 
ATOM 11244 H HB2  . CYS A 1 20 ? -7.578  -6.799  3.357   1.00 0.00 ? 20 CYS A HB2  15 
ATOM 11245 H HB3  . CYS A 1 20 ? -9.276  -7.231  3.183   1.00 0.00 ? 20 CYS A HB3  15 
ATOM 11246 N N    . ASN A 1 21 ? -11.183 -5.560  2.180   1.00 0.00 ? 21 ASN A N    15 
ATOM 11247 C CA   . ASN A 1 21 ? -12.582 -5.283  2.610   1.00 0.00 ? 21 ASN A CA   15 
ATOM 11248 C C    . ASN A 1 21 ? -12.832 -5.929  3.975   1.00 0.00 ? 21 ASN A C    15 
ATOM 11249 O O    . ASN A 1 21 ? -12.188 -5.522  4.928   1.00 0.00 ? 21 ASN A O    15 
ATOM 11250 C CB   . ASN A 1 21 ? -13.559 -5.864  1.586   1.00 0.00 ? 21 ASN A CB   15 
ATOM 11251 C CG   . ASN A 1 21 ? -14.128 -4.736  0.724   1.00 0.00 ? 21 ASN A CG   15 
ATOM 11252 O OD1  . ASN A 1 21 ? -14.058 -4.786  -0.488  1.00 0.00 ? 21 ASN A OD1  15 
ATOM 11253 N ND2  . ASN A 1 21 ? -14.695 -3.712  1.301   1.00 0.00 ? 21 ASN A ND2  15 
ATOM 11254 O OXT  . ASN A 1 21 ? -13.661 -6.819  4.045   1.00 0.00 ? 21 ASN A OXT  15 
ATOM 11255 H H    . ASN A 1 21 ? -11.013 -6.151  1.415   1.00 0.00 ? 21 ASN A H    15 
ATOM 11256 H HA   . ASN A 1 21 ? -12.731 -4.217  2.685   1.00 0.00 ? 21 ASN A HA   15 
ATOM 11257 H HB2  . ASN A 1 21 ? -13.041 -6.572  0.956   1.00 0.00 ? 21 ASN A HB2  15 
ATOM 11258 H HB3  . ASN A 1 21 ? -14.366 -6.363  2.100   1.00 0.00 ? 21 ASN A HB3  15 
ATOM 11259 H HD21 . ASN A 1 21 ? -14.752 -3.671  2.279   1.00 0.00 ? 21 ASN A HD21 15 
ATOM 11260 H HD22 . ASN A 1 21 ? -15.063 -2.984  0.757   1.00 0.00 ? 21 ASN A HD22 15 
ATOM 11261 N N    . PHE B 2 1  ? 5.907   -6.769  -5.040  1.00 0.00 ? 1  PHE B N    15 
ATOM 11262 C CA   . PHE B 2 1  ? 5.953   -6.826  -3.551  1.00 0.00 ? 1  PHE B CA   15 
ATOM 11263 C C    . PHE B 2 1  ? 7.408   -6.931  -3.089  1.00 0.00 ? 1  PHE B C    15 
ATOM 11264 O O    . PHE B 2 1  ? 7.767   -7.809  -2.330  1.00 0.00 ? 1  PHE B O    15 
ATOM 11265 C CB   . PHE B 2 1  ? 5.171   -8.048  -3.063  1.00 0.00 ? 1  PHE B CB   15 
ATOM 11266 C CG   . PHE B 2 1  ? 5.903   -9.307  -3.463  1.00 0.00 ? 1  PHE B CG   15 
ATOM 11267 C CD1  . PHE B 2 1  ? 5.955   -9.689  -4.809  1.00 0.00 ? 1  PHE B CD1  15 
ATOM 11268 C CD2  . PHE B 2 1  ? 6.529   -10.092 -2.487  1.00 0.00 ? 1  PHE B CD2  15 
ATOM 11269 C CE1  . PHE B 2 1  ? 6.633   -10.856 -5.179  1.00 0.00 ? 1  PHE B CE1  15 
ATOM 11270 C CE2  . PHE B 2 1  ? 7.207   -11.259 -2.858  1.00 0.00 ? 1  PHE B CE2  15 
ATOM 11271 C CZ   . PHE B 2 1  ? 7.259   -11.643 -4.203  1.00 0.00 ? 1  PHE B CZ   15 
ATOM 11272 H H1   . PHE B 2 1  ? 6.606   -7.429  -5.434  1.00 0.00 ? 1  PHE B H1   15 
ATOM 11273 H H2   . PHE B 2 1  ? 4.956   -7.033  -5.367  1.00 0.00 ? 1  PHE B H2   15 
ATOM 11274 H H3   . PHE B 2 1  ? 6.128   -5.804  -5.358  1.00 0.00 ? 1  PHE B H3   15 
ATOM 11275 H HA   . PHE B 2 1  ? 5.510   -5.929  -3.143  1.00 0.00 ? 1  PHE B HA   15 
ATOM 11276 H HB2  . PHE B 2 1  ? 5.079   -8.011  -1.988  1.00 0.00 ? 1  PHE B HB2  15 
ATOM 11277 H HB3  . PHE B 2 1  ? 4.188   -8.047  -3.508  1.00 0.00 ? 1  PHE B HB3  15 
ATOM 11278 H HD1  . PHE B 2 1  ? 5.471   -9.084  -5.562  1.00 0.00 ? 1  PHE B HD1  15 
ATOM 11279 H HD2  . PHE B 2 1  ? 6.488   -9.798  -1.449  1.00 0.00 ? 1  PHE B HD2  15 
ATOM 11280 H HE1  . PHE B 2 1  ? 6.674   -11.153 -6.217  1.00 0.00 ? 1  PHE B HE1  15 
ATOM 11281 H HE2  . PHE B 2 1  ? 7.690   -11.865 -2.106  1.00 0.00 ? 1  PHE B HE2  15 
ATOM 11282 H HZ   . PHE B 2 1  ? 7.782   -12.543 -4.488  1.00 0.00 ? 1  PHE B HZ   15 
ATOM 11283 N N    . VAL B 2 2  ? 8.250   -6.043  -3.542  1.00 0.00 ? 2  VAL B N    15 
ATOM 11284 C CA   . VAL B 2 2  ? 9.681   -6.093  -3.129  1.00 0.00 ? 2  VAL B CA   15 
ATOM 11285 C C    . VAL B 2 2  ? 9.949   -5.006  -2.085  1.00 0.00 ? 2  VAL B C    15 
ATOM 11286 O O    . VAL B 2 2  ? 9.112   -4.165  -1.823  1.00 0.00 ? 2  VAL B O    15 
ATOM 11287 C CB   . VAL B 2 2  ? 10.572  -5.857  -4.349  1.00 0.00 ? 2  VAL B CB   15 
ATOM 11288 C CG1  . VAL B 2 2  ? 12.002  -6.293  -4.030  1.00 0.00 ? 2  VAL B CG1  15 
ATOM 11289 C CG2  . VAL B 2 2  ? 10.042  -6.674  -5.529  1.00 0.00 ? 2  VAL B CG2  15 
ATOM 11290 H H    . VAL B 2 2  ? 7.941   -5.343  -4.155  1.00 0.00 ? 2  VAL B H    15 
ATOM 11291 H HA   . VAL B 2 2  ? 9.898   -7.061  -2.704  1.00 0.00 ? 2  VAL B HA   15 
ATOM 11292 H HB   . VAL B 2 2  ? 10.563  -4.807  -4.602  1.00 0.00 ? 2  VAL B HB   15 
ATOM 11293 H HG11 . VAL B 2 2  ? 11.997  -6.936  -3.163  1.00 0.00 ? 2  VAL B HG11 15 
ATOM 11294 H HG12 . VAL B 2 2  ? 12.411  -6.828  -4.874  1.00 0.00 ? 2  VAL B HG12 15 
ATOM 11295 H HG13 . VAL B 2 2  ? 12.608  -5.422  -3.828  1.00 0.00 ? 2  VAL B HG13 15 
ATOM 11296 H HG21 . VAL B 2 2  ? 9.324   -7.398  -5.173  1.00 0.00 ? 2  VAL B HG21 15 
ATOM 11297 H HG22 . VAL B 2 2  ? 9.564   -6.014  -6.239  1.00 0.00 ? 2  VAL B HG22 15 
ATOM 11298 H HG23 . VAL B 2 2  ? 10.863  -7.185  -6.010  1.00 0.00 ? 2  VAL B HG23 15 
ATOM 11299 N N    . ASN B 2 3  ? 11.108  -5.017  -1.487  1.00 0.00 ? 3  ASN B N    15 
ATOM 11300 C CA   . ASN B 2 3  ? 11.428  -3.983  -0.463  1.00 0.00 ? 3  ASN B CA   15 
ATOM 11301 C C    . ASN B 2 3  ? 11.606  -2.627  -1.147  1.00 0.00 ? 3  ASN B C    15 
ATOM 11302 O O    . ASN B 2 3  ? 12.706  -2.225  -1.472  1.00 0.00 ? 3  ASN B O    15 
ATOM 11303 C CB   . ASN B 2 3  ? 12.721  -4.363  0.261   1.00 0.00 ? 3  ASN B CB   15 
ATOM 11304 C CG   . ASN B 2 3  ? 12.395  -4.809  1.688   1.00 0.00 ? 3  ASN B CG   15 
ATOM 11305 O OD1  . ASN B 2 3  ? 11.250  -5.054  2.014   1.00 0.00 ? 3  ASN B OD1  15 
ATOM 11306 N ND2  . ASN B 2 3  ? 13.360  -4.927  2.559   1.00 0.00 ? 3  ASN B ND2  15 
ATOM 11307 H H    . ASN B 2 3  ? 11.769  -5.704  -1.712  1.00 0.00 ? 3  ASN B H    15 
ATOM 11308 H HA   . ASN B 2 3  ? 10.620  -3.922  0.251   1.00 0.00 ? 3  ASN B HA   15 
ATOM 11309 H HB2  . ASN B 2 3  ? 13.206  -5.172  -0.268  1.00 0.00 ? 3  ASN B HB2  15 
ATOM 11310 H HB3  . ASN B 2 3  ? 13.379  -3.508  0.295   1.00 0.00 ? 3  ASN B HB3  15 
ATOM 11311 H HD21 . ASN B 2 3  ? 14.284  -4.731  2.297   1.00 0.00 ? 3  ASN B HD21 15 
ATOM 11312 H HD22 . ASN B 2 3  ? 13.161  -5.213  3.475   1.00 0.00 ? 3  ASN B HD22 15 
ATOM 11313 N N    . GLN B 2 4  ? 10.534  -1.921  -1.373  1.00 0.00 ? 4  GLN B N    15 
ATOM 11314 C CA   . GLN B 2 4  ? 10.642  -0.592  -2.039  1.00 0.00 ? 4  GLN B CA   15 
ATOM 11315 C C    . GLN B 2 4  ? 9.857   0.447   -1.236  1.00 0.00 ? 4  GLN B C    15 
ATOM 11316 O O    . GLN B 2 4  ? 9.554   0.252   -0.075  1.00 0.00 ? 4  GLN B O    15 
ATOM 11317 C CB   . GLN B 2 4  ? 10.069  -0.682  -3.454  1.00 0.00 ? 4  GLN B CB   15 
ATOM 11318 C CG   . GLN B 2 4  ? 10.364  -2.066  -4.038  1.00 0.00 ? 4  GLN B CG   15 
ATOM 11319 C CD   . GLN B 2 4  ? 10.846  -1.917  -5.482  1.00 0.00 ? 4  GLN B CD   15 
ATOM 11320 O OE1  . GLN B 2 4  ? 10.395  -1.049  -6.200  1.00 0.00 ? 4  GLN B OE1  15 
ATOM 11321 N NE2  . GLN B 2 4  ? 11.752  -2.740  -5.943  1.00 0.00 ? 4  GLN B NE2  15 
ATOM 11322 H H    . GLN B 2 4  ? 9.656   -2.263  -1.105  1.00 0.00 ? 4  GLN B H    15 
ATOM 11323 H HA   . GLN B 2 4  ? 11.680  -0.298  -2.089  1.00 0.00 ? 4  GLN B HA   15 
ATOM 11324 H HB2  . GLN B 2 4  ? 9.001   -0.526  -3.419  1.00 0.00 ? 4  GLN B HB2  15 
ATOM 11325 H HB3  . GLN B 2 4  ? 10.525  0.073   -4.076  1.00 0.00 ? 4  GLN B HB3  15 
ATOM 11326 H HG2  . GLN B 2 4  ? 11.131  -2.549  -3.449  1.00 0.00 ? 4  GLN B HG2  15 
ATOM 11327 H HG3  . GLN B 2 4  ? 9.465   -2.663  -4.019  1.00 0.00 ? 4  GLN B HG3  15 
ATOM 11328 H HE21 . GLN B 2 4  ? 12.116  -3.441  -5.363  1.00 0.00 ? 4  GLN B HE21 15 
ATOM 11329 H HE22 . GLN B 2 4  ? 12.068  -2.651  -6.867  1.00 0.00 ? 4  GLN B HE22 15 
ATOM 11330 N N    . HIS B 2 5  ? 9.524   1.551   -1.845  1.00 0.00 ? 5  HIS B N    15 
ATOM 11331 C CA   . HIS B 2 5  ? 8.758   2.601   -1.119  1.00 0.00 ? 5  HIS B CA   15 
ATOM 11332 C C    . HIS B 2 5  ? 7.394   2.793   -1.788  1.00 0.00 ? 5  HIS B C    15 
ATOM 11333 O O    . HIS B 2 5  ? 7.231   2.545   -2.966  1.00 0.00 ? 5  HIS B O    15 
ATOM 11334 C CB   . HIS B 2 5  ? 9.533   3.917   -1.157  1.00 0.00 ? 5  HIS B CB   15 
ATOM 11335 C CG   . HIS B 2 5  ? 10.813  3.769   -0.381  1.00 0.00 ? 5  HIS B CG   15 
ATOM 11336 N ND1  . HIS B 2 5  ? 11.951  3.201   -0.934  1.00 0.00 ? 5  HIS B ND1  15 
ATOM 11337 C CD2  . HIS B 2 5  ? 11.151  4.110   0.905   1.00 0.00 ? 5  HIS B CD2  15 
ATOM 11338 C CE1  . HIS B 2 5  ? 12.911  3.216   0.010   1.00 0.00 ? 5  HIS B CE1  15 
ATOM 11339 N NE2  . HIS B 2 5  ? 12.476  3.760   1.149   1.00 0.00 ? 5  HIS B NE2  15 
ATOM 11340 H H    . HIS B 2 5  ? 9.776   1.691   -2.781  1.00 0.00 ? 5  HIS B H    15 
ATOM 11341 H HA   . HIS B 2 5  ? 8.614   2.297   -0.092  1.00 0.00 ? 5  HIS B HA   15 
ATOM 11342 H HB2  . HIS B 2 5  ? 9.762   4.171   -2.183  1.00 0.00 ? 5  HIS B HB2  15 
ATOM 11343 H HB3  . HIS B 2 5  ? 8.937   4.702   -0.718  1.00 0.00 ? 5  HIS B HB3  15 
ATOM 11344 H HD1  . HIS B 2 5  ? 12.042  2.852   -1.845  1.00 0.00 ? 5  HIS B HD1  15 
ATOM 11345 H HD2  . HIS B 2 5  ? 10.490  4.578   1.618   1.00 0.00 ? 5  HIS B HD2  15 
ATOM 11346 H HE1  . HIS B 2 5  ? 13.910  2.834   -0.137  1.00 0.00 ? 5  HIS B HE1  15 
ATOM 11347 N N    . LEU B 2 6  ? 6.415   3.233   -1.046  1.00 0.00 ? 6  LEU B N    15 
ATOM 11348 C CA   . LEU B 2 6  ? 5.064   3.441   -1.642  1.00 0.00 ? 6  LEU B CA   15 
ATOM 11349 C C    . LEU B 2 6  ? 4.643   4.899   -1.451  1.00 0.00 ? 6  LEU B C    15 
ATOM 11350 O O    . LEU B 2 6  ? 3.896   5.227   -0.551  1.00 0.00 ? 6  LEU B O    15 
ATOM 11351 C CB   . LEU B 2 6  ? 4.058   2.523   -0.946  1.00 0.00 ? 6  LEU B CB   15 
ATOM 11352 C CG   . LEU B 2 6  ? 4.563   1.081   -0.993  1.00 0.00 ? 6  LEU B CG   15 
ATOM 11353 C CD1  . LEU B 2 6  ? 3.521   0.156   -0.361  1.00 0.00 ? 6  LEU B CD1  15 
ATOM 11354 C CD2  . LEU B 2 6  ? 4.791   0.670   -2.447  1.00 0.00 ? 6  LEU B CD2  15 
ATOM 11355 H H    . LEU B 2 6  ? 6.567   3.427   -0.099  1.00 0.00 ? 6  LEU B H    15 
ATOM 11356 H HA   . LEU B 2 6  ? 5.095   3.208   -2.696  1.00 0.00 ? 6  LEU B HA   15 
ATOM 11357 H HB2  . LEU B 2 6  ? 3.941   2.832   0.083   1.00 0.00 ? 6  LEU B HB2  15 
ATOM 11358 H HB3  . LEU B 2 6  ? 3.104   2.585   -1.451  1.00 0.00 ? 6  LEU B HB3  15 
ATOM 11359 H HG   . LEU B 2 6  ? 5.490   1.007   -0.444  1.00 0.00 ? 6  LEU B HG   15 
ATOM 11360 H HD11 . LEU B 2 6  ? 3.102   0.629   0.515   1.00 0.00 ? 6  LEU B HD11 15 
ATOM 11361 H HD12 . LEU B 2 6  ? 2.735   -0.039  -1.076  1.00 0.00 ? 6  LEU B HD12 15 
ATOM 11362 H HD13 . LEU B 2 6  ? 3.991   -0.774  -0.078  1.00 0.00 ? 6  LEU B HD13 15 
ATOM 11363 H HD21 . LEU B 2 6  ? 4.495   1.479   -3.100  1.00 0.00 ? 6  LEU B HD21 15 
ATOM 11364 H HD22 . LEU B 2 6  ? 5.837   0.449   -2.600  1.00 0.00 ? 6  LEU B HD22 15 
ATOM 11365 H HD23 . LEU B 2 6  ? 4.200   -0.206  -2.671  1.00 0.00 ? 6  LEU B HD23 15 
ATOM 11366 N N    . CYS B 2 7  ? 5.117   5.776   -2.293  1.00 0.00 ? 7  CYS B N    15 
ATOM 11367 C CA   . CYS B 2 7  ? 4.745   7.213   -2.158  1.00 0.00 ? 7  CYS B CA   15 
ATOM 11368 C C    . CYS B 2 7  ? 3.900   7.640   -3.360  1.00 0.00 ? 7  CYS B C    15 
ATOM 11369 O O    . CYS B 2 7  ? 4.355   7.628   -4.487  1.00 0.00 ? 7  CYS B O    15 
ATOM 11370 C CB   . CYS B 2 7  ? 6.015   8.061   -2.099  1.00 0.00 ? 7  CYS B CB   15 
ATOM 11371 S SG   . CYS B 2 7  ? 7.012   7.556   -0.675  1.00 0.00 ? 7  CYS B SG   15 
ATOM 11372 H H    . CYS B 2 7  ? 5.718   5.491   -3.012  1.00 0.00 ? 7  CYS B H    15 
ATOM 11373 H HA   . CYS B 2 7  ? 4.176   7.352   -1.251  1.00 0.00 ? 7  CYS B HA   15 
ATOM 11374 H HB2  . CYS B 2 7  ? 6.586   7.919   -3.006  1.00 0.00 ? 7  CYS B HB2  15 
ATOM 11375 H HB3  . CYS B 2 7  ? 5.748   9.103   -2.000  1.00 0.00 ? 7  CYS B HB3  15 
ATOM 11376 N N    . GLY B 2 8  ? 2.672   8.018   -3.131  1.00 0.00 ? 8  GLY B N    15 
ATOM 11377 C CA   . GLY B 2 8  ? 1.801   8.448   -4.261  1.00 0.00 ? 8  GLY B CA   15 
ATOM 11378 C C    . GLY B 2 8  ? 0.859   7.305   -4.644  1.00 0.00 ? 8  GLY B C    15 
ATOM 11379 O O    . GLY B 2 8  ? 0.278   6.655   -3.796  1.00 0.00 ? 8  GLY B O    15 
ATOM 11380 H H    . GLY B 2 8  ? 2.324   8.020   -2.214  1.00 0.00 ? 8  GLY B H    15 
ATOM 11381 H HA2  . GLY B 2 8  ? 1.221   9.308   -3.961  1.00 0.00 ? 8  GLY B HA2  15 
ATOM 11382 H HA3  . GLY B 2 8  ? 2.414   8.705   -5.110  1.00 0.00 ? 8  GLY B HA3  15 
ATOM 11383 N N    . SER B 2 9  ? 0.702   7.055   -5.915  1.00 0.00 ? 9  SER B N    15 
ATOM 11384 C CA   . SER B 2 9  ? -0.204  5.956   -6.352  1.00 0.00 ? 9  SER B CA   15 
ATOM 11385 C C    . SER B 2 9  ? 0.553   4.626   -6.312  1.00 0.00 ? 9  SER B C    15 
ATOM 11386 O O    . SER B 2 9  ? -0.018  3.572   -6.513  1.00 0.00 ? 9  SER B O    15 
ATOM 11387 C CB   . SER B 2 9  ? -0.683  6.227   -7.778  1.00 0.00 ? 9  SER B CB   15 
ATOM 11388 O OG   . SER B 2 9  ? -0.497  7.604   -8.083  1.00 0.00 ? 9  SER B OG   15 
ATOM 11389 H H    . SER B 2 9  ? 1.178   7.592   -6.582  1.00 0.00 ? 9  SER B H    15 
ATOM 11390 H HA   . SER B 2 9  ? -1.055  5.907   -5.690  1.00 0.00 ? 9  SER B HA   15 
ATOM 11391 H HB2  . SER B 2 9  ? -0.114  5.631   -8.472  1.00 0.00 ? 9  SER B HB2  15 
ATOM 11392 H HB3  . SER B 2 9  ? -1.731  5.968   -7.861  1.00 0.00 ? 9  SER B HB3  15 
ATOM 11393 H HG   . SER B 2 9  ? -0.690  8.111   -7.292  1.00 0.00 ? 9  SER B HG   15 
ATOM 11394 N N    . HIS B 2 10 ? 1.832   4.665   -6.054  1.00 0.00 ? 10 HIS B N    15 
ATOM 11395 C CA   . HIS B 2 10 ? 2.619   3.401   -6.001  1.00 0.00 ? 10 HIS B CA   15 
ATOM 11396 C C    . HIS B 2 10 ? 2.100   2.528   -4.860  1.00 0.00 ? 10 HIS B C    15 
ATOM 11397 O O    . HIS B 2 10 ? 2.203   1.317   -4.897  1.00 0.00 ? 10 HIS B O    15 
ATOM 11398 C CB   . HIS B 2 10 ? 4.094   3.727   -5.764  1.00 0.00 ? 10 HIS B CB   15 
ATOM 11399 C CG   . HIS B 2 10 ? 4.818   3.750   -7.083  1.00 0.00 ? 10 HIS B CG   15 
ATOM 11400 N ND1  . HIS B 2 10 ? 5.734   4.739   -7.404  1.00 0.00 ? 10 HIS B ND1  15 
ATOM 11401 C CD2  . HIS B 2 10 ? 4.768   2.915   -8.171  1.00 0.00 ? 10 HIS B CD2  15 
ATOM 11402 C CE1  . HIS B 2 10 ? 6.195   4.475   -8.642  1.00 0.00 ? 10 HIS B CE1  15 
ATOM 11403 N NE2  . HIS B 2 10 ? 5.637   3.375   -9.154  1.00 0.00 ? 10 HIS B NE2  15 
ATOM 11404 H H    . HIS B 2 10 ? 2.274   5.526   -5.895  1.00 0.00 ? 10 HIS B H    15 
ATOM 11405 H HA   . HIS B 2 10 ? 2.514   2.872   -6.937  1.00 0.00 ? 10 HIS B HA   15 
ATOM 11406 H HB2  . HIS B 2 10 ? 4.178   4.694   -5.290  1.00 0.00 ? 10 HIS B HB2  15 
ATOM 11407 H HB3  . HIS B 2 10 ? 4.531   2.972   -5.128  1.00 0.00 ? 10 HIS B HB3  15 
ATOM 11408 H HD1  . HIS B 2 10 ? 6.001   5.490   -6.835  1.00 0.00 ? 10 HIS B HD1  15 
ATOM 11409 H HD2  . HIS B 2 10 ? 4.148   2.036   -8.251  1.00 0.00 ? 10 HIS B HD2  15 
ATOM 11410 H HE1  . HIS B 2 10 ? 6.926   5.081   -9.157  1.00 0.00 ? 10 HIS B HE1  15 
ATOM 11411 N N    . LEU B 2 11 ? 1.542   3.127   -3.844  1.00 0.00 ? 11 LEU B N    15 
ATOM 11412 C CA   . LEU B 2 11 ? 1.021   2.323   -2.703  1.00 0.00 ? 11 LEU B CA   15 
ATOM 11413 C C    . LEU B 2 11 ? -0.228  1.559   -3.147  1.00 0.00 ? 11 LEU B C    15 
ATOM 11414 O O    . LEU B 2 11 ? -0.447  0.431   -2.754  1.00 0.00 ? 11 LEU B O    15 
ATOM 11415 C CB   . LEU B 2 11 ? 0.664   3.247   -1.538  1.00 0.00 ? 11 LEU B CB   15 
ATOM 11416 C CG   . LEU B 2 11 ? 0.933   2.521   -0.219  1.00 0.00 ? 11 LEU B CG   15 
ATOM 11417 C CD1  . LEU B 2 11 ? 1.379   3.530   0.842   1.00 0.00 ? 11 LEU B CD1  15 
ATOM 11418 C CD2  . LEU B 2 11 ? -0.345  1.814   0.246   1.00 0.00 ? 11 LEU B CD2  15 
ATOM 11419 H H    . LEU B 2 11 ? 1.467   4.104   -3.831  1.00 0.00 ? 11 LEU B H    15 
ATOM 11420 H HA   . LEU B 2 11 ? 1.776   1.621   -2.385  1.00 0.00 ? 11 LEU B HA   15 
ATOM 11421 H HB2  . LEU B 2 11 ? 1.268   4.142   -1.590  1.00 0.00 ? 11 LEU B HB2  15 
ATOM 11422 H HB3  . LEU B 2 11 ? -0.381  3.513   -1.593  1.00 0.00 ? 11 LEU B HB3  15 
ATOM 11423 H HG   . LEU B 2 11 ? 1.715   1.790   -0.367  1.00 0.00 ? 11 LEU B HG   15 
ATOM 11424 H HD11 . LEU B 2 11 ? 0.650   4.323   0.916   1.00 0.00 ? 11 LEU B HD11 15 
ATOM 11425 H HD12 . LEU B 2 11 ? 1.462   3.031   1.794   1.00 0.00 ? 11 LEU B HD12 15 
ATOM 11426 H HD13 . LEU B 2 11 ? 2.338   3.945   0.568   1.00 0.00 ? 11 LEU B HD13 15 
ATOM 11427 H HD21 . LEU B 2 11 ? -0.701  1.162   -0.539  1.00 0.00 ? 11 LEU B HD21 15 
ATOM 11428 H HD22 . LEU B 2 11 ? -0.134  1.231   1.128   1.00 0.00 ? 11 LEU B HD22 15 
ATOM 11429 H HD23 . LEU B 2 11 ? -1.104  2.550   0.472   1.00 0.00 ? 11 LEU B HD23 15 
ATOM 11430 N N    . VAL B 2 12 ? -1.047  2.161   -3.966  1.00 0.00 ? 12 VAL B N    15 
ATOM 11431 C CA   . VAL B 2 12 ? -2.274  1.458   -4.433  1.00 0.00 ? 12 VAL B CA   15 
ATOM 11432 C C    . VAL B 2 12 ? -1.866  0.233   -5.253  1.00 0.00 ? 12 VAL B C    15 
ATOM 11433 O O    . VAL B 2 12 ? -2.483  -0.812  -5.177  1.00 0.00 ? 12 VAL B O    15 
ATOM 11434 C CB   . VAL B 2 12 ? -3.110  2.402   -5.298  1.00 0.00 ? 12 VAL B CB   15 
ATOM 11435 C CG1  . VAL B 2 12 ? -4.205  1.604   -6.008  1.00 0.00 ? 12 VAL B CG1  15 
ATOM 11436 C CG2  . VAL B 2 12 ? -3.756  3.464   -4.406  1.00 0.00 ? 12 VAL B CG2  15 
ATOM 11437 H H    . VAL B 2 12 ? -0.853  3.070   -4.277  1.00 0.00 ? 12 VAL B H    15 
ATOM 11438 H HA   . VAL B 2 12 ? -2.854  1.144   -3.578  1.00 0.00 ? 12 VAL B HA   15 
ATOM 11439 H HB   . VAL B 2 12 ? -2.477  2.878   -6.032  1.00 0.00 ? 12 VAL B HB   15 
ATOM 11440 H HG11 . VAL B 2 12 ? -4.766  1.033   -5.280  1.00 0.00 ? 12 VAL B HG11 15 
ATOM 11441 H HG12 . VAL B 2 12 ? -4.870  2.282   -6.522  1.00 0.00 ? 12 VAL B HG12 15 
ATOM 11442 H HG13 . VAL B 2 12 ? -3.755  0.931   -6.722  1.00 0.00 ? 12 VAL B HG13 15 
ATOM 11443 H HG21 . VAL B 2 12 ? -3.993  3.030   -3.445  1.00 0.00 ? 12 VAL B HG21 15 
ATOM 11444 H HG22 . VAL B 2 12 ? -3.068  4.286   -4.269  1.00 0.00 ? 12 VAL B HG22 15 
ATOM 11445 H HG23 . VAL B 2 12 ? -4.661  3.826   -4.872  1.00 0.00 ? 12 VAL B HG23 15 
ATOM 11446 N N    . GLU B 2 13 ? -0.825  0.349   -6.034  1.00 0.00 ? 13 GLU B N    15 
ATOM 11447 C CA   . GLU B 2 13 ? -0.372  -0.812  -6.849  1.00 0.00 ? 13 GLU B CA   15 
ATOM 11448 C C    . GLU B 2 13 ? 0.069   -1.938  -5.913  1.00 0.00 ? 13 GLU B C    15 
ATOM 11449 O O    . GLU B 2 13 ? 0.161   -3.085  -6.302  1.00 0.00 ? 13 GLU B O    15 
ATOM 11450 C CB   . GLU B 2 13 ? 0.805   -0.389  -7.731  1.00 0.00 ? 13 GLU B CB   15 
ATOM 11451 C CG   . GLU B 2 13 ? 0.277   0.245   -9.020  1.00 0.00 ? 13 GLU B CG   15 
ATOM 11452 C CD   . GLU B 2 13 ? 0.707   -0.601  -10.219 1.00 0.00 ? 13 GLU B CD   15 
ATOM 11453 O OE1  . GLU B 2 13 ? 1.884   -0.587  -10.538 1.00 0.00 ? 13 GLU B OE1  15 
ATOM 11454 O OE2  . GLU B 2 13 ? -0.149  -1.251  -10.799 1.00 0.00 ? 13 GLU B OE2  15 
ATOM 11455 H H    . GLU B 2 13 ? -0.337  1.198   -6.076  1.00 0.00 ? 13 GLU B H    15 
ATOM 11456 H HA   . GLU B 2 13 ? -1.185  -1.157  -7.471  1.00 0.00 ? 13 GLU B HA   15 
ATOM 11457 H HB2  . GLU B 2 13 ? 1.414   0.328   -7.200  1.00 0.00 ? 13 GLU B HB2  15 
ATOM 11458 H HB3  . GLU B 2 13 ? 1.401   -1.255  -7.977  1.00 0.00 ? 13 GLU B HB3  15 
ATOM 11459 H HG2  . GLU B 2 13 ? -0.802  0.295   -8.980  1.00 0.00 ? 13 GLU B HG2  15 
ATOM 11460 H HG3  . GLU B 2 13 ? 0.679   1.241   -9.122  1.00 0.00 ? 13 GLU B HG3  15 
ATOM 11461 N N    . ALA B 2 14 ? 0.336   -1.617  -4.676  1.00 0.00 ? 14 ALA B N    15 
ATOM 11462 C CA   . ALA B 2 14 ? 0.759   -2.663  -3.706  1.00 0.00 ? 14 ALA B CA   15 
ATOM 11463 C C    . ALA B 2 14 ? -0.444  -3.069  -2.857  1.00 0.00 ? 14 ALA B C    15 
ATOM 11464 O O    . ALA B 2 14 ? -0.458  -4.115  -2.240  1.00 0.00 ? 14 ALA B O    15 
ATOM 11465 C CB   . ALA B 2 14 ? 1.858   -2.104  -2.798  1.00 0.00 ? 14 ALA B CB   15 
ATOM 11466 H H    . ALA B 2 14 ? 0.248   -0.686  -4.383  1.00 0.00 ? 14 ALA B H    15 
ATOM 11467 H HA   . ALA B 2 14 ? 1.134   -3.524  -4.241  1.00 0.00 ? 14 ALA B HA   15 
ATOM 11468 H HB1  . ALA B 2 14 ? 1.688   -1.051  -2.636  1.00 0.00 ? 14 ALA B HB1  15 
ATOM 11469 H HB2  . ALA B 2 14 ? 1.837   -2.621  -1.851  1.00 0.00 ? 14 ALA B HB2  15 
ATOM 11470 H HB3  . ALA B 2 14 ? 2.820   -2.247  -3.267  1.00 0.00 ? 14 ALA B HB3  15 
ATOM 11471 N N    . LEU B 2 15 ? -1.453  -2.243  -2.821  1.00 0.00 ? 15 LEU B N    15 
ATOM 11472 C CA   . LEU B 2 15 ? -2.662  -2.569  -2.011  1.00 0.00 ? 15 LEU B CA   15 
ATOM 11473 C C    . LEU B 2 15 ? -3.496  -3.626  -2.738  1.00 0.00 ? 15 LEU B C    15 
ATOM 11474 O O    . LEU B 2 15 ? -3.898  -4.616  -2.160  1.00 0.00 ? 15 LEU B O    15 
ATOM 11475 C CB   . LEU B 2 15 ? -3.498  -1.304  -1.815  1.00 0.00 ? 15 LEU B CB   15 
ATOM 11476 C CG   . LEU B 2 15 ? -2.782  -0.363  -0.845  1.00 0.00 ? 15 LEU B CG   15 
ATOM 11477 C CD1  . LEU B 2 15 ? -3.334  1.054   -1.005  1.00 0.00 ? 15 LEU B CD1  15 
ATOM 11478 C CD2  . LEU B 2 15 ? -3.018  -0.840  0.590   1.00 0.00 ? 15 LEU B CD2  15 
ATOM 11479 H H    . LEU B 2 15 ? -1.417  -1.404  -3.328  1.00 0.00 ? 15 LEU B H    15 
ATOM 11480 H HA   . LEU B 2 15 ? -2.355  -2.949  -1.048  1.00 0.00 ? 15 LEU B HA   15 
ATOM 11481 H HB2  . LEU B 2 15 ? -3.631  -0.808  -2.767  1.00 0.00 ? 15 LEU B HB2  15 
ATOM 11482 H HB3  . LEU B 2 15 ? -4.463  -1.569  -1.411  1.00 0.00 ? 15 LEU B HB3  15 
ATOM 11483 H HG   . LEU B 2 15 ? -1.723  -0.363  -1.058  1.00 0.00 ? 15 LEU B HG   15 
ATOM 11484 H HD11 . LEU B 2 15 ? -3.913  1.114   -1.915  1.00 0.00 ? 15 LEU B HD11 15 
ATOM 11485 H HD12 . LEU B 2 15 ? -3.963  1.292   -0.160  1.00 0.00 ? 15 LEU B HD12 15 
ATOM 11486 H HD13 . LEU B 2 15 ? -2.514  1.756   -1.052  1.00 0.00 ? 15 LEU B HD13 15 
ATOM 11487 H HD21 . LEU B 2 15 ? -3.816  -1.565  0.599   1.00 0.00 ? 15 LEU B HD21 15 
ATOM 11488 H HD22 . LEU B 2 15 ? -2.117  -1.293  0.973   1.00 0.00 ? 15 LEU B HD22 15 
ATOM 11489 H HD23 . LEU B 2 15 ? -3.288  0.001   1.208   1.00 0.00 ? 15 LEU B HD23 15 
ATOM 11490 N N    . HIS B 2 16 ? -3.761  -3.427  -4.000  1.00 0.00 ? 16 HIS B N    15 
ATOM 11491 C CA   . HIS B 2 16 ? -4.571  -4.422  -4.758  1.00 0.00 ? 16 HIS B CA   15 
ATOM 11492 C C    . HIS B 2 16 ? -3.810  -5.751  -4.819  1.00 0.00 ? 16 HIS B C    15 
ATOM 11493 O O    . HIS B 2 16 ? -4.393  -6.816  -4.791  1.00 0.00 ? 16 HIS B O    15 
ATOM 11494 C CB   . HIS B 2 16 ? -4.833  -3.894  -6.177  1.00 0.00 ? 16 HIS B CB   15 
ATOM 11495 C CG   . HIS B 2 16 ? -3.646  -4.163  -7.062  1.00 0.00 ? 16 HIS B CG   15 
ATOM 11496 N ND1  . HIS B 2 16 ? -3.732  -4.957  -8.195  1.00 0.00 ? 16 HIS B ND1  15 
ATOM 11497 C CD2  . HIS B 2 16 ? -2.342  -3.746  -6.994  1.00 0.00 ? 16 HIS B CD2  15 
ATOM 11498 C CE1  . HIS B 2 16 ? -2.509  -4.991  -8.759  1.00 0.00 ? 16 HIS B CE1  15 
ATOM 11499 N NE2  . HIS B 2 16 ? -1.624  -4.270  -8.064  1.00 0.00 ? 16 HIS B NE2  15 
ATOM 11500 H H    . HIS B 2 16 ? -3.427  -2.621  -4.450  1.00 0.00 ? 16 HIS B H    15 
ATOM 11501 H HA   . HIS B 2 16 ? -5.513  -4.574  -4.252  1.00 0.00 ? 16 HIS B HA   15 
ATOM 11502 H HB2  . HIS B 2 16 ? -5.703  -4.384  -6.587  1.00 0.00 ? 16 HIS B HB2  15 
ATOM 11503 H HB3  . HIS B 2 16 ? -5.009  -2.831  -6.133  1.00 0.00 ? 16 HIS B HB3  15 
ATOM 11504 H HD1  . HIS B 2 16 ? -4.535  -5.411  -8.526  1.00 0.00 ? 16 HIS B HD1  15 
ATOM 11505 H HD2  . HIS B 2 16 ? -1.936  -3.108  -6.224  1.00 0.00 ? 16 HIS B HD2  15 
ATOM 11506 H HE1  . HIS B 2 16 ? -2.273  -5.535  -9.660  1.00 0.00 ? 16 HIS B HE1  15 
ATOM 11507 N N    . LEU B 2 17 ? -2.509  -5.690  -4.899  1.00 0.00 ? 17 LEU B N    15 
ATOM 11508 C CA   . LEU B 2 17 ? -1.703  -6.940  -4.961  1.00 0.00 ? 17 LEU B CA   15 
ATOM 11509 C C    . LEU B 2 17 ? -1.833  -7.697  -3.638  1.00 0.00 ? 17 LEU B C    15 
ATOM 11510 O O    . LEU B 2 17 ? -1.548  -8.876  -3.554  1.00 0.00 ? 17 LEU B O    15 
ATOM 11511 C CB   . LEU B 2 17 ? -0.237  -6.583  -5.206  1.00 0.00 ? 17 LEU B CB   15 
ATOM 11512 C CG   . LEU B 2 17 ? 0.602   -7.860  -5.274  1.00 0.00 ? 17 LEU B CG   15 
ATOM 11513 C CD1  . LEU B 2 17 ? 0.315   -8.592  -6.585  1.00 0.00 ? 17 LEU B CD1  15 
ATOM 11514 C CD2  . LEU B 2 17 ? 2.085   -7.495  -5.208  1.00 0.00 ? 17 LEU B CD2  15 
ATOM 11515 H H    . LEU B 2 17 ? -2.061  -4.819  -4.918  1.00 0.00 ? 17 LEU B H    15 
ATOM 11516 H HA   . LEU B 2 17 ? -2.064  -7.561  -5.768  1.00 0.00 ? 17 LEU B HA   15 
ATOM 11517 H HB2  . LEU B 2 17 ? -0.149  -6.045  -6.141  1.00 0.00 ? 17 LEU B HB2  15 
ATOM 11518 H HB3  . LEU B 2 17 ? 0.123   -5.961  -4.400  1.00 0.00 ? 17 LEU B HB3  15 
ATOM 11519 H HG   . LEU B 2 17 ? 0.348   -8.501  -4.441  1.00 0.00 ? 17 LEU B HG   15 
ATOM 11520 H HD11 . LEU B 2 17 ? 0.525   -7.936  -7.417  1.00 0.00 ? 17 LEU B HD11 15 
ATOM 11521 H HD12 . LEU B 2 17 ? 0.943   -9.468  -6.652  1.00 0.00 ? 17 LEU B HD12 15 
ATOM 11522 H HD13 . LEU B 2 17 ? -0.722  -8.890  -6.615  1.00 0.00 ? 17 LEU B HD13 15 
ATOM 11523 H HD21 . LEU B 2 17 ? 2.210   -6.453  -5.465  1.00 0.00 ? 17 LEU B HD21 15 
ATOM 11524 H HD22 . LEU B 2 17 ? 2.455   -7.665  -4.208  1.00 0.00 ? 17 LEU B HD22 15 
ATOM 11525 H HD23 . LEU B 2 17 ? 2.638   -8.107  -5.906  1.00 0.00 ? 17 LEU B HD23 15 
ATOM 11526 N N    . VAL B 2 18 ? -2.264  -7.028  -2.603  1.00 0.00 ? 18 VAL B N    15 
ATOM 11527 C CA   . VAL B 2 18 ? -2.414  -7.711  -1.285  1.00 0.00 ? 18 VAL B CA   15 
ATOM 11528 C C    . VAL B 2 18 ? -3.833  -8.267  -1.156  1.00 0.00 ? 18 VAL B C    15 
ATOM 11529 O O    . VAL B 2 18 ? -4.095  -9.147  -0.359  1.00 0.00 ? 18 VAL B O    15 
ATOM 11530 C CB   . VAL B 2 18 ? -2.160  -6.710  -0.156  1.00 0.00 ? 18 VAL B CB   15 
ATOM 11531 C CG1  . VAL B 2 18 ? -1.992  -7.463  1.164   1.00 0.00 ? 18 VAL B CG1  15 
ATOM 11532 C CG2  . VAL B 2 18 ? -0.887  -5.913  -0.452  1.00 0.00 ? 18 VAL B CG2  15 
ATOM 11533 H H    . VAL B 2 18 ? -2.491  -6.080  -2.690  1.00 0.00 ? 18 VAL B H    15 
ATOM 11534 H HA   . VAL B 2 18 ? -1.703  -8.521  -1.215  1.00 0.00 ? 18 VAL B HA   15 
ATOM 11535 H HB   . VAL B 2 18 ? -3.002  -6.035  -0.081  1.00 0.00 ? 18 VAL B HB   15 
ATOM 11536 H HG11 . VAL B 2 18 ? -1.634  -8.463  0.966   1.00 0.00 ? 18 VAL B HG11 15 
ATOM 11537 H HG12 . VAL B 2 18 ? -1.281  -6.942  1.789   1.00 0.00 ? 18 VAL B HG12 15 
ATOM 11538 H HG13 . VAL B 2 18 ? -2.945  -7.517  1.672   1.00 0.00 ? 18 VAL B HG13 15 
ATOM 11539 H HG21 . VAL B 2 18 ? -0.540  -6.147  -1.446  1.00 0.00 ? 18 VAL B HG21 15 
ATOM 11540 H HG22 . VAL B 2 18 ? -1.102  -4.857  -0.382  1.00 0.00 ? 18 VAL B HG22 15 
ATOM 11541 H HG23 . VAL B 2 18 ? -0.125  -6.173  0.267   1.00 0.00 ? 18 VAL B HG23 15 
ATOM 11542 N N    . CYS B 2 19 ? -4.755  -7.754  -1.923  1.00 0.00 ? 19 CYS B N    15 
ATOM 11543 C CA   . CYS B 2 19 ? -6.156  -8.250  -1.833  1.00 0.00 ? 19 CYS B CA   15 
ATOM 11544 C C    . CYS B 2 19 ? -6.541  -8.966  -3.129  1.00 0.00 ? 19 CYS B C    15 
ATOM 11545 O O    . CYS B 2 19 ? -6.311  -10.149 -3.285  1.00 0.00 ? 19 CYS B O    15 
ATOM 11546 C CB   . CYS B 2 19 ? -7.097  -7.066  -1.603  1.00 0.00 ? 19 CYS B CB   15 
ATOM 11547 S SG   . CYS B 2 19 ? -6.902  -6.464  0.092   1.00 0.00 ? 19 CYS B SG   15 
ATOM 11548 H H    . CYS B 2 19 ? -4.527  -7.040  -2.555  1.00 0.00 ? 19 CYS B H    15 
ATOM 11549 H HA   . CYS B 2 19 ? -6.241  -8.937  -1.004  1.00 0.00 ? 19 CYS B HA   15 
ATOM 11550 H HB2  . CYS B 2 19 ? -6.857  -6.274  -2.298  1.00 0.00 ? 19 CYS B HB2  15 
ATOM 11551 H HB3  . CYS B 2 19 ? -8.119  -7.382  -1.758  1.00 0.00 ? 19 CYS B HB3  15 
ATOM 11552 N N    . GLY B 2 20 ? -7.130  -8.265  -4.059  1.00 0.00 ? 20 GLY B N    15 
ATOM 11553 C CA   . GLY B 2 20 ? -7.530  -8.914  -5.340  1.00 0.00 ? 20 GLY B CA   15 
ATOM 11554 C C    . GLY B 2 20 ? -9.042  -9.142  -5.347  1.00 0.00 ? 20 GLY B C    15 
ATOM 11555 O O    . GLY B 2 20 ? -9.821  -8.209  -5.367  1.00 0.00 ? 20 GLY B O    15 
ATOM 11556 H H    . GLY B 2 20 ? -7.312  -7.313  -3.915  1.00 0.00 ? 20 GLY B H    15 
ATOM 11557 H HA2  . GLY B 2 20 ? -7.257  -8.278  -6.167  1.00 0.00 ? 20 GLY B HA2  15 
ATOM 11558 H HA3  . GLY B 2 20 ? -7.026  -9.864  -5.435  1.00 0.00 ? 20 GLY B HA3  15 
ATOM 11559 N N    . GLU B 2 21 ? -9.461  -10.377 -5.334  1.00 0.00 ? 21 GLU B N    15 
ATOM 11560 C CA   . GLU B 2 21 ? -10.922 -10.675 -5.340  1.00 0.00 ? 21 GLU B CA   15 
ATOM 11561 C C    . GLU B 2 21 ? -11.648 -9.719  -4.393  1.00 0.00 ? 21 GLU B C    15 
ATOM 11562 O O    . GLU B 2 21 ? -12.474 -8.928  -4.805  1.00 0.00 ? 21 GLU B O    15 
ATOM 11563 C CB   . GLU B 2 21 ? -11.150 -12.116 -4.874  1.00 0.00 ? 21 GLU B CB   15 
ATOM 11564 C CG   . GLU B 2 21 ? -10.589 -13.084 -5.917  1.00 0.00 ? 21 GLU B CG   15 
ATOM 11565 C CD   . GLU B 2 21 ? -11.741 -13.819 -6.605  1.00 0.00 ? 21 GLU B CD   15 
ATOM 11566 O OE1  . GLU B 2 21 ? -12.830 -13.818 -6.056  1.00 0.00 ? 21 GLU B OE1  15 
ATOM 11567 O OE2  . GLU B 2 21 ? -11.515 -14.370 -7.670  1.00 0.00 ? 21 GLU B OE2  15 
ATOM 11568 H H    . GLU B 2 21 ? -8.812  -11.109 -5.319  1.00 0.00 ? 21 GLU B H    15 
ATOM 11569 H HA   . GLU B 2 21 ? -11.309 -10.556 -6.340  1.00 0.00 ? 21 GLU B HA   15 
ATOM 11570 H HB2  . GLU B 2 21 ? -10.647 -12.271 -3.929  1.00 0.00 ? 21 GLU B HB2  15 
ATOM 11571 H HB3  . GLU B 2 21 ? -12.207 -12.291 -4.752  1.00 0.00 ? 21 GLU B HB3  15 
ATOM 11572 H HG2  . GLU B 2 21 ? -10.021 -12.533 -6.652  1.00 0.00 ? 21 GLU B HG2  15 
ATOM 11573 H HG3  . GLU B 2 21 ? -9.945  -13.803 -5.431  1.00 0.00 ? 21 GLU B HG3  15 
ATOM 11574 N N    . ARG B 2 22 ? -11.348 -9.783  -3.125  1.00 0.00 ? 22 ARG B N    15 
ATOM 11575 C CA   . ARG B 2 22 ? -12.021 -8.878  -2.152  1.00 0.00 ? 22 ARG B CA   15 
ATOM 11576 C C    . ARG B 2 22 ? -11.906 -7.431  -2.635  1.00 0.00 ? 22 ARG B C    15 
ATOM 11577 O O    . ARG B 2 22 ? -12.879 -6.818  -3.027  1.00 0.00 ? 22 ARG B O    15 
ATOM 11578 C CB   . ARG B 2 22 ? -11.355 -9.011  -0.784  1.00 0.00 ? 22 ARG B CB   15 
ATOM 11579 C CG   . ARG B 2 22 ? -11.864 -10.274 -0.087  1.00 0.00 ? 22 ARG B CG   15 
ATOM 11580 C CD   . ARG B 2 22 ? -13.209 -9.978  0.582   1.00 0.00 ? 22 ARG B CD   15 
ATOM 11581 N NE   . ARG B 2 22 ? -13.061 -10.078 2.062   1.00 0.00 ? 22 ARG B NE   15 
ATOM 11582 C CZ   . ARG B 2 22 ? -13.977 -9.581  2.848   1.00 0.00 ? 22 ARG B CZ   15 
ATOM 11583 N NH1  . ARG B 2 22 ? -15.024 -8.985  2.342   1.00 0.00 ? 22 ARG B NH1  15 
ATOM 11584 N NH2  . ARG B 2 22 ? -13.847 -9.677  4.143   1.00 0.00 ? 22 ARG B NH2  15 
ATOM 11585 H H    . ARG B 2 22 ? -10.679 -10.427 -2.813  1.00 0.00 ? 22 ARG B H    15 
ATOM 11586 H HA   . ARG B 2 22 ? -13.062 -9.148  -2.070  1.00 0.00 ? 22 ARG B HA   15 
ATOM 11587 H HB2  . ARG B 2 22 ? -10.283 -9.074  -0.910  1.00 0.00 ? 22 ARG B HB2  15 
ATOM 11588 H HB3  . ARG B 2 22 ? -11.596 -8.148  -0.184  1.00 0.00 ? 22 ARG B HB3  15 
ATOM 11589 H HG2  . ARG B 2 22 ? -11.988 -11.062 -0.814  1.00 0.00 ? 22 ARG B HG2  15 
ATOM 11590 H HG3  . ARG B 2 22 ? -11.151 -10.583 0.664   1.00 0.00 ? 22 ARG B HG3  15 
ATOM 11591 H HD2  . ARG B 2 22 ? -13.529 -8.980  0.319   1.00 0.00 ? 22 ARG B HD2  15 
ATOM 11592 H HD3  . ARG B 2 22 ? -13.943 -10.692 0.245   1.00 0.00 ? 22 ARG B HD3  15 
ATOM 11593 H HE   . ARG B 2 22 ? -12.276 -10.521 2.447   1.00 0.00 ? 22 ARG B HE   15 
ATOM 11594 H HH11 . ARG B 2 22 ? -15.127 -8.907  1.350   1.00 0.00 ? 22 ARG B HH11 15 
ATOM 11595 H HH12 . ARG B 2 22 ? -15.722 -8.603  2.948   1.00 0.00 ? 22 ARG B HH12 15 
ATOM 11596 H HH21 . ARG B 2 22 ? -13.046 -10.132 4.532   1.00 0.00 ? 22 ARG B HH21 15 
ATOM 11597 H HH22 . ARG B 2 22 ? -14.548 -9.297  4.746   1.00 0.00 ? 22 ARG B HH22 15 
ATOM 11598 N N    . GLY B 2 23 ? -10.725 -6.879  -2.609  1.00 0.00 ? 23 GLY B N    15 
ATOM 11599 C CA   . GLY B 2 23 ? -10.546 -5.472  -3.064  1.00 0.00 ? 23 GLY B CA   15 
ATOM 11600 C C    . GLY B 2 23 ? -9.922  -4.646  -1.939  1.00 0.00 ? 23 GLY B C    15 
ATOM 11601 O O    . GLY B 2 23 ? -9.536  -5.169  -0.912  1.00 0.00 ? 23 GLY B O    15 
ATOM 11602 H H    . GLY B 2 23 ? -9.953  -7.392  -2.289  1.00 0.00 ? 23 GLY B H    15 
ATOM 11603 H HA2  . GLY B 2 23 ? -9.900  -5.454  -3.931  1.00 0.00 ? 23 GLY B HA2  15 
ATOM 11604 H HA3  . GLY B 2 23 ? -11.506 -5.053  -3.323  1.00 0.00 ? 23 GLY B HA3  15 
ATOM 11605 N N    . PHE B 2 24 ? -9.817  -3.358  -2.121  1.00 0.00 ? 24 PHE B N    15 
ATOM 11606 C CA   . PHE B 2 24 ? -9.215  -2.503  -1.062  1.00 0.00 ? 24 PHE B CA   15 
ATOM 11607 C C    . PHE B 2 24 ? -9.649  -1.050  -1.265  1.00 0.00 ? 24 PHE B C    15 
ATOM 11608 O O    . PHE B 2 24 ? -10.167 -0.685  -2.302  1.00 0.00 ? 24 PHE B O    15 
ATOM 11609 C CB   . PHE B 2 24 ? -7.689  -2.594  -1.141  1.00 0.00 ? 24 PHE B CB   15 
ATOM 11610 C CG   . PHE B 2 24 ? -7.219  -1.997  -2.445  1.00 0.00 ? 24 PHE B CG   15 
ATOM 11611 C CD1  . PHE B 2 24 ? -7.285  -2.760  -3.614  1.00 0.00 ? 24 PHE B CD1  15 
ATOM 11612 C CD2  . PHE B 2 24 ? -6.719  -0.691  -2.486  1.00 0.00 ? 24 PHE B CD2  15 
ATOM 11613 C CE1  . PHE B 2 24 ? -6.853  -2.217  -4.829  1.00 0.00 ? 24 PHE B CE1  15 
ATOM 11614 C CE2  . PHE B 2 24 ? -6.285  -0.148  -3.700  1.00 0.00 ? 24 PHE B CE2  15 
ATOM 11615 C CZ   . PHE B 2 24 ? -6.351  -0.910  -4.872  1.00 0.00 ? 24 PHE B CZ   15 
ATOM 11616 H H    . PHE B 2 24 ? -10.132 -2.953  -2.958  1.00 0.00 ? 24 PHE B H    15 
ATOM 11617 H HA   . PHE B 2 24 ? -9.546  -2.844  -0.091  1.00 0.00 ? 24 PHE B HA   15 
ATOM 11618 H HB2  . PHE B 2 24 ? -7.250  -2.051  -0.317  1.00 0.00 ? 24 PHE B HB2  15 
ATOM 11619 H HB3  . PHE B 2 24 ? -7.389  -3.629  -1.095  1.00 0.00 ? 24 PHE B HB3  15 
ATOM 11620 H HD1  . PHE B 2 24 ? -7.671  -3.768  -3.575  1.00 0.00 ? 24 PHE B HD1  15 
ATOM 11621 H HD2  . PHE B 2 24 ? -6.668  -0.103  -1.582  1.00 0.00 ? 24 PHE B HD2  15 
ATOM 11622 H HE1  . PHE B 2 24 ? -6.904  -2.807  -5.732  1.00 0.00 ? 24 PHE B HE1  15 
ATOM 11623 H HE2  . PHE B 2 24 ? -5.898  0.860   -3.734  1.00 0.00 ? 24 PHE B HE2  15 
ATOM 11624 H HZ   . PHE B 2 24 ? -6.016  -0.491  -5.810  1.00 0.00 ? 24 PHE B HZ   15 
ATOM 11625 N N    . PHE B 2 25 ? -9.439  -0.215  -0.285  1.00 0.00 ? 25 PHE B N    15 
ATOM 11626 C CA   . PHE B 2 25 ? -9.835  1.214   -0.421  1.00 0.00 ? 25 PHE B CA   15 
ATOM 11627 C C    . PHE B 2 25 ? -8.662  2.105   -0.011  1.00 0.00 ? 25 PHE B C    15 
ATOM 11628 O O    . PHE B 2 25 ? -8.422  2.333   1.158   1.00 0.00 ? 25 PHE B O    15 
ATOM 11629 C CB   . PHE B 2 25 ? -11.037 1.501   0.483   1.00 0.00 ? 25 PHE B CB   15 
ATOM 11630 C CG   . PHE B 2 25 ? -10.817 0.867   1.835   1.00 0.00 ? 25 PHE B CG   15 
ATOM 11631 C CD1  . PHE B 2 25 ? -11.015 -0.508  2.005   1.00 0.00 ? 25 PHE B CD1  15 
ATOM 11632 C CD2  . PHE B 2 25 ? -10.417 1.656   2.920   1.00 0.00 ? 25 PHE B CD2  15 
ATOM 11633 C CE1  . PHE B 2 25 ? -10.811 -1.096  3.261   1.00 0.00 ? 25 PHE B CE1  15 
ATOM 11634 C CE2  . PHE B 2 25 ? -10.213 1.069   4.175   1.00 0.00 ? 25 PHE B CE2  15 
ATOM 11635 C CZ   . PHE B 2 25 ? -10.411 -0.306  4.345   1.00 0.00 ? 25 PHE B CZ   15 
ATOM 11636 H H    . PHE B 2 25 ? -9.017  -0.530  0.544   1.00 0.00 ? 25 PHE B H    15 
ATOM 11637 H HA   . PHE B 2 25 ? -10.100 1.416   -1.449  1.00 0.00 ? 25 PHE B HA   15 
ATOM 11638 H HB2  . PHE B 2 25 ? -11.150 2.569   0.598   1.00 0.00 ? 25 PHE B HB2  15 
ATOM 11639 H HB3  . PHE B 2 25 ? -11.929 1.092   0.034   1.00 0.00 ? 25 PHE B HB3  15 
ATOM 11640 H HD1  . PHE B 2 25 ? -11.323 -1.116  1.168   1.00 0.00 ? 25 PHE B HD1  15 
ATOM 11641 H HD2  . PHE B 2 25 ? -10.263 2.718   2.790   1.00 0.00 ? 25 PHE B HD2  15 
ATOM 11642 H HE1  . PHE B 2 25 ? -10.965 -2.157  3.392   1.00 0.00 ? 25 PHE B HE1  15 
ATOM 11643 H HE2  . PHE B 2 25 ? -9.904  1.678   5.013   1.00 0.00 ? 25 PHE B HE2  15 
ATOM 11644 H HZ   . PHE B 2 25 ? -10.256 -0.759  5.313   1.00 0.00 ? 25 PHE B HZ   15 
ATOM 11645 N N    . TYR B 2 26 ? -7.932  2.612   -0.964  1.00 0.00 ? 26 TYR B N    15 
ATOM 11646 C CA   . TYR B 2 26 ? -6.774  3.488   -0.630  1.00 0.00 ? 26 TYR B CA   15 
ATOM 11647 C C    . TYR B 2 26 ? -7.284  4.819   -0.074  1.00 0.00 ? 26 TYR B C    15 
ATOM 11648 O O    . TYR B 2 26 ? -8.454  5.135   -0.170  1.00 0.00 ? 26 TYR B O    15 
ATOM 11649 C CB   . TYR B 2 26 ? -5.949  3.743   -1.894  1.00 0.00 ? 26 TYR B CB   15 
ATOM 11650 C CG   . TYR B 2 26 ? -4.626  4.368   -1.522  1.00 0.00 ? 26 TYR B CG   15 
ATOM 11651 C CD1  . TYR B 2 26 ? -3.911  3.898   -0.413  1.00 0.00 ? 26 TYR B CD1  15 
ATOM 11652 C CD2  . TYR B 2 26 ? -4.110  5.419   -2.289  1.00 0.00 ? 26 TYR B CD2  15 
ATOM 11653 C CE1  . TYR B 2 26 ? -2.683  4.477   -0.073  1.00 0.00 ? 26 TYR B CE1  15 
ATOM 11654 C CE2  . TYR B 2 26 ? -2.882  6.000   -1.948  1.00 0.00 ? 26 TYR B CE2  15 
ATOM 11655 C CZ   . TYR B 2 26 ? -2.169  5.528   -0.840  1.00 0.00 ? 26 TYR B CZ   15 
ATOM 11656 O OH   . TYR B 2 26 ? -0.958  6.099   -0.506  1.00 0.00 ? 26 TYR B OH   15 
ATOM 11657 H H    . TYR B 2 26 ? -8.142  2.415   -1.902  1.00 0.00 ? 26 TYR B H    15 
ATOM 11658 H HA   . TYR B 2 26 ? -6.157  3.001   0.110   1.00 0.00 ? 26 TYR B HA   15 
ATOM 11659 H HB2  . TYR B 2 26 ? -5.774  2.808   -2.405  1.00 0.00 ? 26 TYR B HB2  15 
ATOM 11660 H HB3  . TYR B 2 26 ? -6.491  4.414   -2.546  1.00 0.00 ? 26 TYR B HB3  15 
ATOM 11661 H HD1  . TYR B 2 26 ? -4.306  3.087   0.180   1.00 0.00 ? 26 TYR B HD1  15 
ATOM 11662 H HD2  . TYR B 2 26 ? -4.660  5.783   -3.145  1.00 0.00 ? 26 TYR B HD2  15 
ATOM 11663 H HE1  . TYR B 2 26 ? -2.134  4.112   0.781   1.00 0.00 ? 26 TYR B HE1  15 
ATOM 11664 H HE2  . TYR B 2 26 ? -2.485  6.810   -2.542  1.00 0.00 ? 26 TYR B HE2  15 
ATOM 11665 H HH   . TYR B 2 26 ? -0.261  5.576   -0.908  1.00 0.00 ? 26 TYR B HH   15 
ATOM 11666 N N    . THR B 2 27 ? -6.415  5.604   0.502   1.00 0.00 ? 27 THR B N    15 
ATOM 11667 C CA   . THR B 2 27 ? -6.850  6.916   1.060   1.00 0.00 ? 27 THR B CA   15 
ATOM 11668 C C    . THR B 2 27 ? -5.919  8.018   0.549   1.00 0.00 ? 27 THR B C    15 
ATOM 11669 O O    . THR B 2 27 ? -5.285  8.704   1.328   1.00 0.00 ? 27 THR B O    15 
ATOM 11670 C CB   . THR B 2 27 ? -6.794  6.865   2.587   1.00 0.00 ? 27 THR B CB   15 
ATOM 11671 O OG1  . THR B 2 27 ? -7.386  8.042   3.120   1.00 0.00 ? 27 THR B OG1  15 
ATOM 11672 C CG2  . THR B 2 27 ? -5.338  6.771   3.044   1.00 0.00 ? 27 THR B CG2  15 
ATOM 11673 H H    . THR B 2 27 ? -5.476  5.331   0.565   1.00 0.00 ? 27 THR B H    15 
ATOM 11674 H HA   . THR B 2 27 ? -7.861  7.123   0.742   1.00 0.00 ? 27 THR B HA   15 
ATOM 11675 H HB   . THR B 2 27 ? -7.334  5.999   2.939   1.00 0.00 ? 27 THR B HB   15 
ATOM 11676 H HG1  . THR B 2 27 ? -6.949  8.245   3.950   1.00 0.00 ? 27 THR B HG1  15 
ATOM 11677 H HG21 . THR B 2 27 ? -4.736  6.363   2.247   1.00 0.00 ? 27 THR B HG21 15 
ATOM 11678 H HG22 . THR B 2 27 ? -4.978  7.757   3.302   1.00 0.00 ? 27 THR B HG22 15 
ATOM 11679 H HG23 . THR B 2 27 ? -5.275  6.128   3.910   1.00 0.00 ? 27 THR B HG23 15 
ATOM 11680 N N    . PRO B 2 28 ? -5.866  8.152   -0.751  1.00 0.00 ? 28 PRO B N    15 
ATOM 11681 C CA   . PRO B 2 28 ? -5.023  9.162   -1.435  1.00 0.00 ? 28 PRO B CA   15 
ATOM 11682 C C    . PRO B 2 28 ? -5.429  10.572  -0.997  1.00 0.00 ? 28 PRO B C    15 
ATOM 11683 O O    . PRO B 2 28 ? -6.306  11.184  -1.572  1.00 0.00 ? 28 PRO B O    15 
ATOM 11684 C CB   . PRO B 2 28 ? -5.282  8.979   -2.936  1.00 0.00 ? 28 PRO B CB   15 
ATOM 11685 C CG   . PRO B 2 28 ? -6.315  7.848   -3.096  1.00 0.00 ? 28 PRO B CG   15 
ATOM 11686 C CD   . PRO B 2 28 ? -6.641  7.315   -1.694  1.00 0.00 ? 28 PRO B CD   15 
ATOM 11687 H HA   . PRO B 2 28 ? -3.981  8.987   -1.219  1.00 0.00 ? 28 PRO B HA   15 
ATOM 11688 H HB2  . PRO B 2 28 ? -5.670  9.898   -3.355  1.00 0.00 ? 28 PRO B HB2  15 
ATOM 11689 H HB3  . PRO B 2 28 ? -4.366  8.705   -3.434  1.00 0.00 ? 28 PRO B HB3  15 
ATOM 11690 H HG2  . PRO B 2 28 ? -7.211  8.235   -3.560  1.00 0.00 ? 28 PRO B HG2  15 
ATOM 11691 H HG3  . PRO B 2 28 ? -5.902  7.055   -3.699  1.00 0.00 ? 28 PRO B HG3  15 
ATOM 11692 H HD2  . PRO B 2 28 ? -7.699  7.409   -1.498  1.00 0.00 ? 28 PRO B HD2  15 
ATOM 11693 H HD3  . PRO B 2 28 ? -6.333  6.285   -1.607  1.00 0.00 ? 28 PRO B HD3  15 
ATOM 11694 N N    . LYS B 2 29 ? -4.792  11.092  0.015   1.00 0.00 ? 29 LYS B N    15 
ATOM 11695 C CA   . LYS B 2 29 ? -5.136  12.463  0.490   1.00 0.00 ? 29 LYS B CA   15 
ATOM 11696 C C    . LYS B 2 29 ? -3.883  13.134  1.056   1.00 0.00 ? 29 LYS B C    15 
ATOM 11697 O O    . LYS B 2 29 ? -3.475  12.868  2.168   1.00 0.00 ? 29 LYS B O    15 
ATOM 11698 C CB   . LYS B 2 29 ? -6.206  12.373  1.579   1.00 0.00 ? 29 LYS B CB   15 
ATOM 11699 C CG   . LYS B 2 29 ? -7.041  13.655  1.580   1.00 0.00 ? 29 LYS B CG   15 
ATOM 11700 C CD   . LYS B 2 29 ? -7.233  14.137  3.019   1.00 0.00 ? 29 LYS B CD   15 
ATOM 11701 C CE   . LYS B 2 29 ? -8.635  14.727  3.175   1.00 0.00 ? 29 LYS B CE   15 
ATOM 11702 N NZ   . LYS B 2 29 ? -9.365  13.991  4.245   1.00 0.00 ? 29 LYS B NZ   15 
ATOM 11703 H H    . LYS B 2 29 ? -4.084  10.583  0.464   1.00 0.00 ? 29 LYS B H    15 
ATOM 11704 H HA   . LYS B 2 29 ? -5.513  13.045  -0.339  1.00 0.00 ? 29 LYS B HA   15 
ATOM 11705 H HB2  . LYS B 2 29 ? -6.844  11.524  1.387   1.00 0.00 ? 29 LYS B HB2  15 
ATOM 11706 H HB3  . LYS B 2 29 ? -5.730  12.256  2.542   1.00 0.00 ? 29 LYS B HB3  15 
ATOM 11707 H HG2  . LYS B 2 29 ? -6.531  14.417  1.008   1.00 0.00 ? 29 LYS B HG2  15 
ATOM 11708 H HG3  . LYS B 2 29 ? -8.006  13.454  1.138   1.00 0.00 ? 29 LYS B HG3  15 
ATOM 11709 H HD2  . LYS B 2 29 ? -7.114  13.306  3.697   1.00 0.00 ? 29 LYS B HD2  15 
ATOM 11710 H HD3  . LYS B 2 29 ? -6.500  14.897  3.245   1.00 0.00 ? 29 LYS B HD3  15 
ATOM 11711 H HE2  . LYS B 2 29 ? -8.560  15.770  3.443   1.00 0.00 ? 29 LYS B HE2  15 
ATOM 11712 H HE3  . LYS B 2 29 ? -9.172  14.634  2.242   1.00 0.00 ? 29 LYS B HE3  15 
ATOM 11713 H HZ1  . LYS B 2 29 ? -9.003  13.018  4.308   1.00 0.00 ? 29 LYS B HZ1  15 
ATOM 11714 H HZ2  . LYS B 2 29 ? -9.225  14.474  5.156   1.00 0.00 ? 29 LYS B HZ2  15 
ATOM 11715 H HZ3  . LYS B 2 29 ? -10.379 13.965  4.019   1.00 0.00 ? 29 LYS B HZ3  15 
ATOM 11716 N N    . THR B 2 30 ? -3.267  13.997  0.297   1.00 0.00 ? 30 THR B N    15 
ATOM 11717 C CA   . THR B 2 30 ? -2.038  14.681  0.791   1.00 0.00 ? 30 THR B CA   15 
ATOM 11718 C C    . THR B 2 30 ? -2.295  16.187  0.888   1.00 0.00 ? 30 THR B C    15 
ATOM 11719 O O    . THR B 2 30 ? -1.669  16.922  0.144   1.00 0.00 ? 30 THR B O    15 
ATOM 11720 C CB   . THR B 2 30 ? -0.886  14.419  -0.179  1.00 0.00 ? 30 THR B CB   15 
ATOM 11721 O OG1  . THR B 2 30 ? 0.209   15.265  0.150   1.00 0.00 ? 30 THR B OG1  15 
ATOM 11722 C CG2  . THR B 2 30 ? -1.345  14.708  -1.610  1.00 0.00 ? 30 THR B CG2  15 
ATOM 11723 O OXT  . THR B 2 30 ? -3.113  16.577  1.704   1.00 0.00 ? 30 THR B OXT  15 
ATOM 11724 H H    . THR B 2 30 ? -3.611  14.195  -0.599  1.00 0.00 ? 30 THR B H    15 
ATOM 11725 H HA   . THR B 2 30 ? -1.781  14.296  1.768   1.00 0.00 ? 30 THR B HA   15 
ATOM 11726 H HB   . THR B 2 30 ? -0.579  13.388  -0.106  1.00 0.00 ? 30 THR B HB   15 
ATOM 11727 H HG1  . THR B 2 30 ? 0.153   15.470  1.086   1.00 0.00 ? 30 THR B HG1  15 
ATOM 11728 H HG21 . THR B 2 30 ? -2.068  15.510  -1.600  1.00 0.00 ? 30 THR B HG21 15 
ATOM 11729 H HG22 . THR B 2 30 ? -0.495  14.998  -2.208  1.00 0.00 ? 30 THR B HG22 15 
ATOM 11730 H HG23 . THR B 2 30 ? -1.795  13.820  -2.029  1.00 0.00 ? 30 THR B HG23 15 
ATOM 11731 N N    . GLY A 1 1  ? -2.933  6.559   8.300   1.00 0.00 ? 1  GLY A N    16 
ATOM 11732 C CA   . GLY A 1 1  ? -2.796  6.239   6.851   1.00 0.00 ? 1  GLY A CA   16 
ATOM 11733 C C    . GLY A 1 1  ? -1.460  5.543   6.604   1.00 0.00 ? 1  GLY A C    16 
ATOM 11734 O O    . GLY A 1 1  ? -0.447  5.894   7.174   1.00 0.00 ? 1  GLY A O    16 
ATOM 11735 H H1   . GLY A 1 1  ? -1.990  6.702   8.714   1.00 0.00 ? 1  GLY A H1   16 
ATOM 11736 H H2   . GLY A 1 1  ? -3.497  7.426   8.412   1.00 0.00 ? 1  GLY A H2   16 
ATOM 11737 H H3   . GLY A 1 1  ? -3.409  5.773   8.786   1.00 0.00 ? 1  GLY A H3   16 
ATOM 11738 H HA2  . GLY A 1 1  ? -3.603  5.583   6.549   1.00 0.00 ? 1  GLY A HA2  16 
ATOM 11739 H HA3  . GLY A 1 1  ? -2.834  7.148   6.273   1.00 0.00 ? 1  GLY A HA3  16 
ATOM 11740 N N    . ILE A 1 2  ? -1.459  4.554   5.758   1.00 0.00 ? 2  ILE A N    16 
ATOM 11741 C CA   . ILE A 1 2  ? -0.200  3.822   5.460   1.00 0.00 ? 2  ILE A CA   16 
ATOM 11742 C C    . ILE A 1 2  ? 0.799   4.786   4.800   1.00 0.00 ? 2  ILE A C    16 
ATOM 11743 O O    . ILE A 1 2  ? 1.987   4.720   5.038   1.00 0.00 ? 2  ILE A O    16 
ATOM 11744 C CB   . ILE A 1 2  ? -0.544  2.638   4.530   1.00 0.00 ? 2  ILE A CB   16 
ATOM 11745 C CG1  . ILE A 1 2  ? -0.071  1.327   5.167   1.00 0.00 ? 2  ILE A CG1  16 
ATOM 11746 C CG2  . ILE A 1 2  ? 0.108   2.798   3.156   1.00 0.00 ? 2  ILE A CG2  16 
ATOM 11747 C CD1  . ILE A 1 2  ? -1.059  0.206   4.824   1.00 0.00 ? 2  ILE A CD1  16 
ATOM 11748 H H    . ILE A 1 2  ? -2.291  4.294   5.312   1.00 0.00 ? 2  ILE A H    16 
ATOM 11749 H HA   . ILE A 1 2  ? 0.221   3.445   6.380   1.00 0.00 ? 2  ILE A HA   16 
ATOM 11750 H HB   . ILE A 1 2  ? -1.610  2.606   4.403   1.00 0.00 ? 2  ILE A HB   16 
ATOM 11751 H HG12 . ILE A 1 2  ? 0.907   1.075   4.784   1.00 0.00 ? 2  ILE A HG12 16 
ATOM 11752 H HG13 . ILE A 1 2  ? -0.022  1.444   6.239   1.00 0.00 ? 2  ILE A HG13 16 
ATOM 11753 H HG21 . ILE A 1 2  ? -0.225  3.724   2.707   1.00 0.00 ? 2  ILE A HG21 16 
ATOM 11754 H HG22 . ILE A 1 2  ? 1.183   2.819   3.269   1.00 0.00 ? 2  ILE A HG22 16 
ATOM 11755 H HG23 . ILE A 1 2  ? -0.173  1.969   2.526   1.00 0.00 ? 2  ILE A HG23 16 
ATOM 11756 H HD11 . ILE A 1 2  ? -1.352  0.283   3.786   1.00 0.00 ? 2  ILE A HD11 16 
ATOM 11757 H HD12 . ILE A 1 2  ? -0.592  -0.753  4.993   1.00 0.00 ? 2  ILE A HD12 16 
ATOM 11758 H HD13 . ILE A 1 2  ? -1.935  0.291   5.449   1.00 0.00 ? 2  ILE A HD13 16 
ATOM 11759 N N    . VAL A 1 3  ? 0.316   5.674   3.971   1.00 0.00 ? 3  VAL A N    16 
ATOM 11760 C CA   . VAL A 1 3  ? 1.223   6.641   3.284   1.00 0.00 ? 3  VAL A CA   16 
ATOM 11761 C C    . VAL A 1 3  ? 2.288   7.142   4.260   1.00 0.00 ? 3  VAL A C    16 
ATOM 11762 O O    . VAL A 1 3  ? 3.423   7.367   3.890   1.00 0.00 ? 3  VAL A O    16 
ATOM 11763 C CB   . VAL A 1 3  ? 0.405   7.827   2.776   1.00 0.00 ? 3  VAL A CB   16 
ATOM 11764 C CG1  . VAL A 1 3  ? 1.338   8.852   2.127   1.00 0.00 ? 3  VAL A CG1  16 
ATOM 11765 C CG2  . VAL A 1 3  ? -0.608  7.337   1.739   1.00 0.00 ? 3  VAL A CG2  16 
ATOM 11766 H H    . VAL A 1 3  ? -0.648  5.701   3.795   1.00 0.00 ? 3  VAL A H    16 
ATOM 11767 H HA   . VAL A 1 3  ? 1.702   6.152   2.448   1.00 0.00 ? 3  VAL A HA   16 
ATOM 11768 H HB   . VAL A 1 3  ? -0.116  8.287   3.603   1.00 0.00 ? 3  VAL A HB   16 
ATOM 11769 H HG11 . VAL A 1 3  ? 2.356   8.656   2.433   1.00 0.00 ? 3  VAL A HG11 16 
ATOM 11770 H HG12 . VAL A 1 3  ? 1.264   8.778   1.052   1.00 0.00 ? 3  VAL A HG12 16 
ATOM 11771 H HG13 . VAL A 1 3  ? 1.054   9.846   2.440   1.00 0.00 ? 3  VAL A HG13 16 
ATOM 11772 H HG21 . VAL A 1 3  ? -0.278  6.393   1.333   1.00 0.00 ? 3  VAL A HG21 16 
ATOM 11773 H HG22 . VAL A 1 3  ? -1.573  7.208   2.212   1.00 0.00 ? 3  VAL A HG22 16 
ATOM 11774 H HG23 . VAL A 1 3  ? -0.691  8.063   0.944   1.00 0.00 ? 3  VAL A HG23 16 
ATOM 11775 N N    . GLU A 1 4  ? 1.934   7.319   5.504   1.00 0.00 ? 4  GLU A N    16 
ATOM 11776 C CA   . GLU A 1 4  ? 2.933   7.803   6.499   1.00 0.00 ? 4  GLU A CA   16 
ATOM 11777 C C    . GLU A 1 4  ? 3.718   6.612   7.050   1.00 0.00 ? 4  GLU A C    16 
ATOM 11778 O O    . GLU A 1 4  ? 3.916   6.482   8.241   1.00 0.00 ? 4  GLU A O    16 
ATOM 11779 C CB   . GLU A 1 4  ? 2.211   8.516   7.646   1.00 0.00 ? 4  GLU A CB   16 
ATOM 11780 C CG   . GLU A 1 4  ? 1.483   9.748   7.106   1.00 0.00 ? 4  GLU A CG   16 
ATOM 11781 C CD   . GLU A 1 4  ? 2.261   11.009  7.485   1.00 0.00 ? 4  GLU A CD   16 
ATOM 11782 O OE1  . GLU A 1 4  ? 2.198   11.395  8.641   1.00 0.00 ? 4  GLU A OE1  16 
ATOM 11783 O OE2  . GLU A 1 4  ? 2.907   11.567  6.613   1.00 0.00 ? 4  GLU A OE2  16 
ATOM 11784 H H    . GLU A 1 4  ? 1.013   7.133   5.783   1.00 0.00 ? 4  GLU A H    16 
ATOM 11785 H HA   . GLU A 1 4  ? 3.614   8.493   6.020   1.00 0.00 ? 4  GLU A HA   16 
ATOM 11786 H HB2  . GLU A 1 4  ? 1.497   7.841   8.096   1.00 0.00 ? 4  GLU A HB2  16 
ATOM 11787 H HB3  . GLU A 1 4  ? 2.932   8.824   8.390   1.00 0.00 ? 4  GLU A HB3  16 
ATOM 11788 H HG2  . GLU A 1 4  ? 1.411   9.678   6.030   1.00 0.00 ? 4  GLU A HG2  16 
ATOM 11789 H HG3  . GLU A 1 4  ? 0.492   9.796   7.531   1.00 0.00 ? 4  GLU A HG3  16 
ATOM 11790 N N    . GLN A 1 5  ? 4.164   5.740   6.187   1.00 0.00 ? 5  GLN A N    16 
ATOM 11791 C CA   . GLN A 1 5  ? 4.935   4.553   6.649   1.00 0.00 ? 5  GLN A CA   16 
ATOM 11792 C C    . GLN A 1 5  ? 5.512   3.829   5.431   1.00 0.00 ? 5  GLN A C    16 
ATOM 11793 O O    . GLN A 1 5  ? 6.611   3.314   5.466   1.00 0.00 ? 5  GLN A O    16 
ATOM 11794 C CB   . GLN A 1 5  ? 4.005   3.610   7.412   1.00 0.00 ? 5  GLN A CB   16 
ATOM 11795 C CG   . GLN A 1 5  ? 4.054   3.937   8.906   1.00 0.00 ? 5  GLN A CG   16 
ATOM 11796 C CD   . GLN A 1 5  ? 2.691   4.461   9.359   1.00 0.00 ? 5  GLN A CD   16 
ATOM 11797 O OE1  . GLN A 1 5  ? 1.946   5.009   8.571   1.00 0.00 ? 5  GLN A OE1  16 
ATOM 11798 N NE2  . GLN A 1 5  ? 2.331   4.319   10.604  1.00 0.00 ? 5  GLN A NE2  16 
ATOM 11799 H H    . GLN A 1 5  ? 3.990   5.866   5.232   1.00 0.00 ? 5  GLN A H    16 
ATOM 11800 H HA   . GLN A 1 5  ? 5.740   4.873   7.295   1.00 0.00 ? 5  GLN A HA   16 
ATOM 11801 H HB2  . GLN A 1 5  ? 2.993   3.729   7.050   1.00 0.00 ? 5  GLN A HB2  16 
ATOM 11802 H HB3  . GLN A 1 5  ? 4.323   2.588   7.259   1.00 0.00 ? 5  GLN A HB3  16 
ATOM 11803 H HG2  . GLN A 1 5  ? 4.301   3.045   9.463   1.00 0.00 ? 5  GLN A HG2  16 
ATOM 11804 H HG3  . GLN A 1 5  ? 4.806   4.693   9.084   1.00 0.00 ? 5  GLN A HG3  16 
ATOM 11805 H HE21 . GLN A 1 5  ? 2.933   3.878   11.241  1.00 0.00 ? 5  GLN A HE21 16 
ATOM 11806 H HE22 . GLN A 1 5  ? 1.459   4.651   10.904  1.00 0.00 ? 5  GLN A HE22 16 
ATOM 11807 N N    . CYS A 1 6  ? 4.777   3.794   4.354   1.00 0.00 ? 6  CYS A N    16 
ATOM 11808 C CA   . CYS A 1 6  ? 5.275   3.112   3.128   1.00 0.00 ? 6  CYS A CA   16 
ATOM 11809 C C    . CYS A 1 6  ? 5.884   4.150   2.184   1.00 0.00 ? 6  CYS A C    16 
ATOM 11810 O O    . CYS A 1 6  ? 6.920   3.934   1.588   1.00 0.00 ? 6  CYS A O    16 
ATOM 11811 C CB   . CYS A 1 6  ? 4.113   2.411   2.427   1.00 0.00 ? 6  CYS A CB   16 
ATOM 11812 S SG   . CYS A 1 6  ? 3.236   1.363   3.613   1.00 0.00 ? 6  CYS A SG   16 
ATOM 11813 H H    . CYS A 1 6  ? 3.896   4.221   4.349   1.00 0.00 ? 6  CYS A H    16 
ATOM 11814 H HA   . CYS A 1 6  ? 6.024   2.386   3.396   1.00 0.00 ? 6  CYS A HA   16 
ATOM 11815 H HB2  . CYS A 1 6  ? 3.439   3.155   2.032   1.00 0.00 ? 6  CYS A HB2  16 
ATOM 11816 H HB3  . CYS A 1 6  ? 4.494   1.804   1.620   1.00 0.00 ? 6  CYS A HB3  16 
ATOM 11817 N N    . CYS A 1 7  ? 5.245   5.280   2.046   1.00 0.00 ? 7  CYS A N    16 
ATOM 11818 C CA   . CYS A 1 7  ? 5.783   6.335   1.143   1.00 0.00 ? 7  CYS A CA   16 
ATOM 11819 C C    . CYS A 1 7  ? 7.047   6.935   1.762   1.00 0.00 ? 7  CYS A C    16 
ATOM 11820 O O    . CYS A 1 7  ? 7.944   7.373   1.068   1.00 0.00 ? 7  CYS A O    16 
ATOM 11821 C CB   . CYS A 1 7  ? 4.732   7.432   0.956   1.00 0.00 ? 7  CYS A CB   16 
ATOM 11822 S SG   . CYS A 1 7  ? 5.467   8.832   0.079   1.00 0.00 ? 7  CYS A SG   16 
ATOM 11823 H H    . CYS A 1 7  ? 4.412   5.435   2.537   1.00 0.00 ? 7  CYS A H    16 
ATOM 11824 H HA   . CYS A 1 7  ? 6.023   5.901   0.183   1.00 0.00 ? 7  CYS A HA   16 
ATOM 11825 H HB2  . CYS A 1 7  ? 3.903   7.040   0.383   1.00 0.00 ? 7  CYS A HB2  16 
ATOM 11826 H HB3  . CYS A 1 7  ? 4.376   7.757   1.923   1.00 0.00 ? 7  CYS A HB3  16 
ATOM 11827 N N    . THR A 1 8  ? 7.128   6.952   3.066   1.00 0.00 ? 8  THR A N    16 
ATOM 11828 C CA   . THR A 1 8  ? 8.339   7.517   3.728   1.00 0.00 ? 8  THR A CA   16 
ATOM 11829 C C    . THR A 1 8  ? 9.368   6.403   3.929   1.00 0.00 ? 8  THR A C    16 
ATOM 11830 O O    . THR A 1 8  ? 10.560  6.633   3.907   1.00 0.00 ? 8  THR A O    16 
ATOM 11831 C CB   . THR A 1 8  ? 7.952   8.105   5.088   1.00 0.00 ? 8  THR A CB   16 
ATOM 11832 O OG1  . THR A 1 8  ? 7.728   7.049   6.012   1.00 0.00 ? 8  THR A OG1  16 
ATOM 11833 C CG2  . THR A 1 8  ? 6.677   8.938   4.942   1.00 0.00 ? 8  THR A CG2  16 
ATOM 11834 H H    . THR A 1 8  ? 6.397   6.591   3.608   1.00 0.00 ? 8  THR A H    16 
ATOM 11835 H HA   . THR A 1 8  ? 8.763   8.291   3.106   1.00 0.00 ? 8  THR A HA   16 
ATOM 11836 H HB   . THR A 1 8  ? 8.750   8.736   5.448   1.00 0.00 ? 8  THR A HB   16 
ATOM 11837 H HG1  . THR A 1 8  ? 7.988   7.356   6.883   1.00 0.00 ? 8  THR A HG1  16 
ATOM 11838 H HG21 . THR A 1 8  ? 6.761   9.578   4.076   1.00 0.00 ? 8  THR A HG21 16 
ATOM 11839 H HG22 . THR A 1 8  ? 5.829   8.281   4.825   1.00 0.00 ? 8  THR A HG22 16 
ATOM 11840 H HG23 . THR A 1 8  ? 6.542   9.546   5.825   1.00 0.00 ? 8  THR A HG23 16 
ATOM 11841 N N    . SER A 1 9  ? 8.913   5.194   4.120   1.00 0.00 ? 9  SER A N    16 
ATOM 11842 C CA   . SER A 1 9  ? 9.860   4.061   4.318   1.00 0.00 ? 9  SER A CA   16 
ATOM 11843 C C    . SER A 1 9  ? 9.397   2.867   3.473   1.00 0.00 ? 9  SER A C    16 
ATOM 11844 O O    . SER A 1 9  ? 8.918   3.031   2.369   1.00 0.00 ? 9  SER A O    16 
ATOM 11845 C CB   . SER A 1 9  ? 9.885   3.669   5.797   1.00 0.00 ? 9  SER A CB   16 
ATOM 11846 O OG   . SER A 1 9  ? 9.645   4.824   6.590   1.00 0.00 ? 9  SER A OG   16 
ATOM 11847 H H    . SER A 1 9  ? 7.947   5.030   4.130   1.00 0.00 ? 9  SER A H    16 
ATOM 11848 H HA   . SER A 1 9  ? 10.850  4.359   4.005   1.00 0.00 ? 9  SER A HA   16 
ATOM 11849 H HB2  . SER A 1 9  ? 9.116   2.940   5.990   1.00 0.00 ? 9  SER A HB2  16 
ATOM 11850 H HB3  . SER A 1 9  ? 10.851  3.246   6.039   1.00 0.00 ? 9  SER A HB3  16 
ATOM 11851 H HG   . SER A 1 9  ? 8.770   4.742   6.977   1.00 0.00 ? 9  SER A HG   16 
ATOM 11852 N N    . ILE A 1 10 ? 9.529   1.670   3.977   1.00 0.00 ? 10 ILE A N    16 
ATOM 11853 C CA   . ILE A 1 10 ? 9.089   0.483   3.190   1.00 0.00 ? 10 ILE A CA   16 
ATOM 11854 C C    . ILE A 1 10 ? 8.319   -0.476  4.102   1.00 0.00 ? 10 ILE A C    16 
ATOM 11855 O O    . ILE A 1 10 ? 8.896   -1.188  4.899   1.00 0.00 ? 10 ILE A O    16 
ATOM 11856 C CB   . ILE A 1 10 ? 10.314  -0.232  2.612   1.00 0.00 ? 10 ILE A CB   16 
ATOM 11857 C CG1  . ILE A 1 10 ? 10.946  0.645   1.529   1.00 0.00 ? 10 ILE A CG1  16 
ATOM 11858 C CG2  . ILE A 1 10 ? 9.885   -1.567  2.005   1.00 0.00 ? 10 ILE A CG2  16 
ATOM 11859 C CD1  . ILE A 1 10 ? 12.350  0.127   1.209   1.00 0.00 ? 10 ILE A CD1  16 
ATOM 11860 H H    . ILE A 1 10 ? 9.917   1.550   4.869   1.00 0.00 ? 10 ILE A H    16 
ATOM 11861 H HA   . ILE A 1 10 ? 8.449   0.805   2.383   1.00 0.00 ? 10 ILE A HA   16 
ATOM 11862 H HB   . ILE A 1 10 ? 11.031  -0.408  3.400   1.00 0.00 ? 10 ILE A HB   16 
ATOM 11863 H HG12 . ILE A 1 10 ? 10.336  0.609   0.636   1.00 0.00 ? 10 ILE A HG12 16 
ATOM 11864 H HG13 . ILE A 1 10 ? 11.011  1.663   1.880   1.00 0.00 ? 10 ILE A HG13 16 
ATOM 11865 H HG21 . ILE A 1 10 ? 8.935   -1.448  1.503   1.00 0.00 ? 10 ILE A HG21 16 
ATOM 11866 H HG22 . ILE A 1 10 ? 10.629  -1.892  1.291   1.00 0.00 ? 10 ILE A HG22 16 
ATOM 11867 H HG23 . ILE A 1 10 ? 9.789   -2.305  2.786   1.00 0.00 ? 10 ILE A HG23 16 
ATOM 11868 H HD11 . ILE A 1 10 ? 12.494  -0.837  1.673   1.00 0.00 ? 10 ILE A HD11 16 
ATOM 11869 H HD12 . ILE A 1 10 ? 12.464  0.031   0.139   1.00 0.00 ? 10 ILE A HD12 16 
ATOM 11870 H HD13 . ILE A 1 10 ? 13.084  0.823   1.587   1.00 0.00 ? 10 ILE A HD13 16 
ATOM 11871 N N    . CYS A 1 11 ? 7.018   -0.498  3.990   1.00 0.00 ? 11 CYS A N    16 
ATOM 11872 C CA   . CYS A 1 11 ? 6.211   -1.406  4.849   1.00 0.00 ? 11 CYS A CA   16 
ATOM 11873 C C    . CYS A 1 11 ? 6.327   -2.842  4.333   1.00 0.00 ? 11 CYS A C    16 
ATOM 11874 O O    . CYS A 1 11 ? 7.155   -3.148  3.497   1.00 0.00 ? 11 CYS A O    16 
ATOM 11875 C CB   . CYS A 1 11 ? 4.745   -0.967  4.820   1.00 0.00 ? 11 CYS A CB   16 
ATOM 11876 S SG   . CYS A 1 11 ? 4.653   0.835   4.954   1.00 0.00 ? 11 CYS A SG   16 
ATOM 11877 H H    . CYS A 1 11 ? 6.574   0.086   3.341   1.00 0.00 ? 11 CYS A H    16 
ATOM 11878 H HA   . CYS A 1 11 ? 6.578   -1.361  5.865   1.00 0.00 ? 11 CYS A HA   16 
ATOM 11879 H HB2  . CYS A 1 11 ? 4.292   -1.284  3.892   1.00 0.00 ? 11 CYS A HB2  16 
ATOM 11880 H HB3  . CYS A 1 11 ? 4.219   -1.418  5.650   1.00 0.00 ? 11 CYS A HB3  16 
ATOM 11881 N N    . SER A 1 12 ? 5.504   -3.725  4.827   1.00 0.00 ? 12 SER A N    16 
ATOM 11882 C CA   . SER A 1 12 ? 5.568   -5.142  4.372   1.00 0.00 ? 12 SER A CA   16 
ATOM 11883 C C    . SER A 1 12 ? 4.244   -5.528  3.709   1.00 0.00 ? 12 SER A C