data_1HMA
# 
_entry.id   1HMA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1HMA         pdb_00001hma 10.2210/pdb1hma/pdb 
WWPDB D_1000173907 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HMA 
_pdbx_database_status.recvd_initial_deposition_date   1994-05-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jones, D.N.M.'     1 
'Searles, M.A.'     2 
'Shaw, G.L.'        3 
'Churchill, M.E.A.' 4 
'Ner, S.S.'         5 
'Keeler, J.'        6 
'Travers, A.A.'     7 
'Neuhaus, D.'       8 
# 
_citation.id                        primary 
_citation.title                     
'The solution structure and dynamics of the DNA-binding domain of HMG-D from Drosophila melanogaster.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            2 
_citation.page_first                609 
_citation.page_last                 627 
_citation.year                      1994 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7922039 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(00)00063-0' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jones, D.N.'     1 ? 
primary 'Searles, M.A.'   2 ? 
primary 'Shaw, G.L.'      3 ? 
primary 'Churchill, M.E.' 4 ? 
primary 'Ner, S.S.'       5 ? 
primary 'Keeler, J.'      6 ? 
primary 'Travers, A.A.'   7 ? 
primary 'Neuhaus, D.'     8 ? 
# 
_cell.entry_id           1HMA 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HMA 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           HMG-D 
_entity.formula_weight             8370.515 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG 
_entity_poly.pdbx_seq_one_letter_code_can   SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ASP n 
1 3  LYS n 
1 4  PRO n 
1 5  LYS n 
1 6  ARG n 
1 7  PRO n 
1 8  LEU n 
1 9  SER n 
1 10 ALA n 
1 11 TYR n 
1 12 MET n 
1 13 LEU n 
1 14 TRP n 
1 15 LEU n 
1 16 ASN n 
1 17 SER n 
1 18 ALA n 
1 19 ARG n 
1 20 GLU n 
1 21 SER n 
1 22 ILE n 
1 23 LYS n 
1 24 ARG n 
1 25 GLU n 
1 26 ASN n 
1 27 PRO n 
1 28 GLY n 
1 29 ILE n 
1 30 LYS n 
1 31 VAL n 
1 32 THR n 
1 33 GLU n 
1 34 VAL n 
1 35 ALA n 
1 36 LYS n 
1 37 ARG n 
1 38 GLY n 
1 39 GLY n 
1 40 GLU n 
1 41 LEU n 
1 42 TRP n 
1 43 ARG n 
1 44 ALA n 
1 45 MET n 
1 46 LYS n 
1 47 ASP n 
1 48 LYS n 
1 49 SER n 
1 50 GLU n 
1 51 TRP n 
1 52 GLU n 
1 53 ALA n 
1 54 LYS n 
1 55 ALA n 
1 56 ALA n 
1 57 LYS n 
1 58 ALA n 
1 59 LYS n 
1 60 ASP n 
1 61 ASP n 
1 62 TYR n 
1 63 ASP n 
1 64 ARG n 
1 65 ALA n 
1 66 VAL n 
1 67 LYS n 
1 68 GLU n 
1 69 PHE n 
1 70 GLU n 
1 71 ALA n 
1 72 ASN n 
1 73 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'fruit fly' 
_entity_src_gen.gene_src_genus                     Drosophila 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HMGD_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q05783 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANGGSSAAN
GGGAKKRAKPAKKVAKKSKKEESDEDDDDESE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HMA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q05783 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  74 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       74 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1HMA 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1HMA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1HMA 
_struct.title                     
'THE SOLUTION STRUCTURE AND DYNAMICS OF THE DNA BINDING DOMAIN OF HMG-D FROM DROSOPHILA MELANOGASTER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HMA 
_struct_keywords.pdbx_keywords   DNA-BINDING 
_struct_keywords.text            DNA-BINDING 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 I   ALA A 10 ? ASN A 26 ? ALA A 11 ASN A 27 1 '~60 DEG BEND CENTRED @ ALA 19' 17 
HELX_P HELX_P2 II  THR A 32 ? MET A 45 ? THR A 33 MET A 46 1 ?                               14 
HELX_P HELX_P3 III LYS A 48 ? ASN A 72 ? LYS A 49 ASN A 73 1 ?                               25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HMA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HMA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1  ? -1.558  10.238  -18.538 1.00 0.00 ? 2  SER A N    1  
ATOM 2     C CA   . SER A 1 1  ? -1.602  8.753   -18.409 1.00 0.00 ? 2  SER A CA   1  
ATOM 3     C C    . SER A 1 1  ? -2.759  8.353   -17.493 1.00 0.00 ? 2  SER A C    1  
ATOM 4     O O    . SER A 1 1  ? -3.363  9.179   -16.839 1.00 0.00 ? 2  SER A O    1  
ATOM 5     C CB   . SER A 1 1  ? -0.286  8.255   -17.810 1.00 0.00 ? 2  SER A CB   1  
ATOM 6     O OG   . SER A 1 1  ? -0.460  6.924   -17.339 1.00 0.00 ? 2  SER A OG   1  
ATOM 7     H H    . SER A 1 1  ? -1.550  10.800  -17.736 1.00 0.00 ? 2  SER A H    1  
ATOM 8     H HA   . SER A 1 1  ? -1.744  8.311   -19.383 1.00 0.00 ? 2  SER A HA   1  
ATOM 9     H HB2  . SER A 1 1  ? 0.482   8.266   -18.566 1.00 0.00 ? 2  SER A HB2  1  
ATOM 10    H HB3  . SER A 1 1  ? 0.005   8.901   -16.993 1.00 0.00 ? 2  SER A HB3  1  
ATOM 11    H HG   . SER A 1 1  ? -0.486  6.340   -18.102 1.00 0.00 ? 2  SER A HG   1  
ATOM 12    N N    . ASP A 1 2  ? -3.071  7.087   -17.442 1.00 0.00 ? 3  ASP A N    1  
ATOM 13    C CA   . ASP A 1 2  ? -4.188  6.627   -16.570 1.00 0.00 ? 3  ASP A CA   1  
ATOM 14    C C    . ASP A 1 2  ? -3.623  6.143   -15.233 1.00 0.00 ? 3  ASP A C    1  
ATOM 15    O O    . ASP A 1 2  ? -2.507  6.457   -14.868 1.00 0.00 ? 3  ASP A O    1  
ATOM 16    C CB   . ASP A 1 2  ? -4.927  5.477   -17.258 1.00 0.00 ? 3  ASP A CB   1  
ATOM 17    C CG   . ASP A 1 2  ? -6.434  5.644   -17.059 1.00 0.00 ? 3  ASP A CG   1  
ATOM 18    O OD1  . ASP A 1 2  ? -7.003  6.516   -17.694 1.00 0.00 ? 3  ASP A OD1  1  
ATOM 19    O OD2  . ASP A 1 2  ? -6.994  4.896   -16.274 1.00 0.00 ? 3  ASP A OD2  1  
ATOM 20    H H    . ASP A 1 2  ? -2.569  6.438   -17.978 1.00 0.00 ? 3  ASP A H    1  
ATOM 21    H HA   . ASP A 1 2  ? -4.872  7.445   -16.399 1.00 0.00 ? 3  ASP A HA   1  
ATOM 22    H HB2  . ASP A 1 2  ? -4.699  5.484   -18.315 1.00 0.00 ? 3  ASP A HB2  1  
ATOM 23    H HB3  . ASP A 1 2  ? -4.610  4.538   -16.828 1.00 0.00 ? 3  ASP A HB3  1  
ATOM 24    N N    . LYS A 1 3  ? -4.384  5.378   -14.498 1.00 0.00 ? 4  LYS A N    1  
ATOM 25    C CA   . LYS A 1 3  ? -3.887  4.873   -13.187 1.00 0.00 ? 4  LYS A CA   1  
ATOM 26    C C    . LYS A 1 3  ? -2.632  4.018   -13.419 1.00 0.00 ? 4  LYS A C    1  
ATOM 27    O O    . LYS A 1 3  ? -2.660  3.091   -14.205 1.00 0.00 ? 4  LYS A O    1  
ATOM 28    C CB   . LYS A 1 3  ? -4.974  4.018   -12.529 1.00 0.00 ? 4  LYS A CB   1  
ATOM 29    C CG   . LYS A 1 3  ? -4.688  3.885   -11.032 1.00 0.00 ? 4  LYS A CG   1  
ATOM 30    C CD   . LYS A 1 3  ? -5.905  4.354   -10.232 1.00 0.00 ? 4  LYS A CD   1  
ATOM 31    C CE   . LYS A 1 3  ? -5.611  4.223   -8.735  1.00 0.00 ? 4  LYS A CE   1  
ATOM 32    N NZ   . LYS A 1 3  ? -6.609  3.308   -8.112  1.00 0.00 ? 4  LYS A NZ   1  
ATOM 33    H H    . LYS A 1 3  ? -5.280  5.133   -14.809 1.00 0.00 ? 4  LYS A H    1  
ATOM 34    H HA   . LYS A 1 3  ? -3.651  5.711   -12.548 1.00 0.00 ? 4  LYS A HA   1  
ATOM 35    H HB2  . LYS A 1 3  ? -5.937  4.488   -12.672 1.00 0.00 ? 4  LYS A HB2  1  
ATOM 36    H HB3  . LYS A 1 3  ? -4.981  3.037   -12.980 1.00 0.00 ? 4  LYS A HB3  1  
ATOM 37    H HG2  . LYS A 1 3  ? -4.478  2.852   -10.797 1.00 0.00 ? 4  LYS A HG2  1  
ATOM 38    H HG3  . LYS A 1 3  ? -3.836  4.492   -10.773 1.00 0.00 ? 4  LYS A HG3  1  
ATOM 39    H HD2  . LYS A 1 3  ? -6.116  5.386   -10.470 1.00 0.00 ? 4  LYS A HD2  1  
ATOM 40    H HD3  . LYS A 1 3  ? -6.759  3.743   -10.484 1.00 0.00 ? 4  LYS A HD3  1  
ATOM 41    H HE2  . LYS A 1 3  ? -4.619  3.821   -8.597  1.00 0.00 ? 4  LYS A HE2  1  
ATOM 42    H HE3  . LYS A 1 3  ? -5.674  5.196   -8.270  1.00 0.00 ? 4  LYS A HE3  1  
ATOM 43    H HZ1  . LYS A 1 3  ? -7.054  2.726   -8.850  1.00 0.00 ? 4  LYS A HZ1  1  
ATOM 44    H HZ2  . LYS A 1 3  ? -6.131  2.689   -7.427  1.00 0.00 ? 4  LYS A HZ2  1  
ATOM 45    H HZ3  . LYS A 1 3  ? -7.337  3.870   -7.625  1.00 0.00 ? 4  LYS A HZ3  1  
ATOM 46    N N    . PRO A 1 4  ? -1.565  4.354   -12.736 1.00 0.00 ? 5  PRO A N    1  
ATOM 47    C CA   . PRO A 1 4  ? -0.289  3.633   -12.856 1.00 0.00 ? 5  PRO A CA   1  
ATOM 48    C C    . PRO A 1 4  ? -0.330  2.297   -12.123 1.00 0.00 ? 5  PRO A C    1  
ATOM 49    O O    . PRO A 1 4  ? -1.196  2.041   -11.309 1.00 0.00 ? 5  PRO A O    1  
ATOM 50    C CB   . PRO A 1 4  ? 0.727   4.568   -12.229 1.00 0.00 ? 5  PRO A CB   1  
ATOM 51    C CG   . PRO A 1 4  ? -0.063  5.506   -11.310 1.00 0.00 ? 5  PRO A CG   1  
ATOM 52    C CD   . PRO A 1 4  ? -1.526  5.475   -11.782 1.00 0.00 ? 5  PRO A CD   1  
ATOM 53    H HA   . PRO A 1 4  ? -0.036  3.495   -13.875 1.00 0.00 ? 5  PRO A HA   1  
ATOM 54    H HB2  . PRO A 1 4  ? 1.448   3.998   -11.658 1.00 0.00 ? 5  PRO A HB2  1  
ATOM 55    H HB3  . PRO A 1 4  ? 1.223   5.136   -12.998 1.00 0.00 ? 5  PRO A HB3  1  
ATOM 56    H HG2  . PRO A 1 4  ? 0.008   5.160   -10.296 1.00 0.00 ? 5  PRO A HG2  1  
ATOM 57    H HG3  . PRO A 1 4  ? 0.322   6.502   -11.399 1.00 0.00 ? 5  PRO A HG3  1  
ATOM 58    H HD2  . PRO A 1 4  ? -2.187  5.289   -10.947 1.00 0.00 ? 5  PRO A HD2  1  
ATOM 59    H HD3  . PRO A 1 4  ? -1.788  6.397   -12.279 1.00 0.00 ? 5  PRO A HD3  1  
ATOM 60    N N    . LYS A 1 5  ? 0.611   1.444   -12.408 1.00 0.00 ? 6  LYS A N    1  
ATOM 61    C CA   . LYS A 1 5  ? 0.653   0.119   -11.739 1.00 0.00 ? 6  LYS A CA   1  
ATOM 62    C C    . LYS A 1 5  ? 0.989   0.311   -10.262 1.00 0.00 ? 6  LYS A C    1  
ATOM 63    O O    . LYS A 1 5  ? 2.139   0.325   -9.870  1.00 0.00 ? 6  LYS A O    1  
ATOM 64    C CB   . LYS A 1 5  ? 1.715   -0.737  -12.402 1.00 0.00 ? 6  LYS A CB   1  
ATOM 65    C CG   . LYS A 1 5  ? 1.687   -0.510  -13.915 1.00 0.00 ? 6  LYS A CG   1  
ATOM 66    C CD   . LYS A 1 5  ? 2.077   -1.803  -14.635 1.00 0.00 ? 6  LYS A CD   1  
ATOM 67    C CE   . LYS A 1 5  ? 1.004   -2.157  -15.667 1.00 0.00 ? 6  LYS A CE   1  
ATOM 68    N NZ   . LYS A 1 5  ? 0.899   -1.061  -16.672 1.00 0.00 ? 6  LYS A NZ   1  
ATOM 69    H H    . LYS A 1 5  ? 1.298   1.681   -13.065 1.00 0.00 ? 6  LYS A H    1  
ATOM 70    H HA   . LYS A 1 5  ? -0.300  -0.371  -11.833 1.00 0.00 ? 6  LYS A HA   1  
ATOM 71    H HB2  . LYS A 1 5  ? 2.685   -0.468  -12.014 1.00 0.00 ? 6  LYS A HB2  1  
ATOM 72    H HB3  . LYS A 1 5  ? 1.508   -1.770  -12.190 1.00 0.00 ? 6  LYS A HB3  1  
ATOM 73    H HG2  . LYS A 1 5  ? 0.691   -0.217  -14.215 1.00 0.00 ? 6  LYS A HG2  1  
ATOM 74    H HG3  . LYS A 1 5  ? 2.387   0.269   -14.176 1.00 0.00 ? 6  LYS A HG3  1  
ATOM 75    H HD2  . LYS A 1 5  ? 3.026   -1.665  -15.133 1.00 0.00 ? 6  LYS A HD2  1  
ATOM 76    H HD3  . LYS A 1 5  ? 2.161   -2.606  -13.917 1.00 0.00 ? 6  LYS A HD3  1  
ATOM 77    H HE2  . LYS A 1 5  ? 1.273   -3.077  -16.165 1.00 0.00 ? 6  LYS A HE2  1  
ATOM 78    H HE3  . LYS A 1 5  ? 0.054   -2.281  -15.170 1.00 0.00 ? 6  LYS A HE3  1  
ATOM 79    H HZ1  . LYS A 1 5  ? 1.467   -0.248  -16.362 1.00 0.00 ? 6  LYS A HZ1  1  
ATOM 80    H HZ2  . LYS A 1 5  ? 1.251   -1.401  -17.591 1.00 0.00 ? 6  LYS A HZ2  1  
ATOM 81    H HZ3  . LYS A 1 5  ? -0.095  -0.772  -16.767 1.00 0.00 ? 6  LYS A HZ3  1  
ATOM 82    N N    . ARG A 1 6  ? -0.010  0.467   -9.439  1.00 0.00 ? 7  ARG A N    1  
ATOM 83    C CA   . ARG A 1 6  ? 0.242   0.669   -7.985  1.00 0.00 ? 7  ARG A CA   1  
ATOM 84    C C    . ARG A 1 6  ? 1.159   -0.440  -7.454  1.00 0.00 ? 7  ARG A C    1  
ATOM 85    O O    . ARG A 1 6  ? 1.137   -1.551  -7.943  1.00 0.00 ? 7  ARG A O    1  
ATOM 86    C CB   . ARG A 1 6  ? -1.089  0.633   -7.229  1.00 0.00 ? 7  ARG A CB   1  
ATOM 87    C CG   . ARG A 1 6  ? -1.979  1.786   -7.699  1.00 0.00 ? 7  ARG A CG   1  
ATOM 88    C CD   . ARG A 1 6  ? -3.450  1.383   -7.564  1.00 0.00 ? 7  ARG A CD   1  
ATOM 89    N NE   . ARG A 1 6  ? -3.924  0.799   -8.849  1.00 0.00 ? 7  ARG A NE   1  
ATOM 90    C CZ   . ARG A 1 6  ? -4.873  -0.097  -8.851  1.00 0.00 ? 7  ARG A CZ   1  
ATOM 91    N NH1  . ARG A 1 6  ? -5.710  -0.165  -7.853  1.00 0.00 ? 7  ARG A NH1  1  
ATOM 92    N NH2  . ARG A 1 6  ? -4.984  -0.923  -9.854  1.00 0.00 ? 7  ARG A NH2  1  
ATOM 93    H H    . ARG A 1 6  ? -0.930  0.459   -9.779  1.00 0.00 ? 7  ARG A H    1  
ATOM 94    H HA   . ARG A 1 6  ? 0.713   1.629   -7.834  1.00 0.00 ? 7  ARG A HA   1  
ATOM 95    H HB2  . ARG A 1 6  ? -1.585  -0.307  -7.420  1.00 0.00 ? 7  ARG A HB2  1  
ATOM 96    H HB3  . ARG A 1 6  ? -0.903  0.735   -6.170  1.00 0.00 ? 7  ARG A HB3  1  
ATOM 97    H HG2  . ARG A 1 6  ? -1.786  2.659   -7.095  1.00 0.00 ? 7  ARG A HG2  1  
ATOM 98    H HG3  . ARG A 1 6  ? -1.764  2.008   -8.734  1.00 0.00 ? 7  ARG A HG3  1  
ATOM 99    H HD2  . ARG A 1 6  ? -3.552  0.650   -6.776  1.00 0.00 ? 7  ARG A HD2  1  
ATOM 100   H HD3  . ARG A 1 6  ? -4.040  2.254   -7.323  1.00 0.00 ? 7  ARG A HD3  1  
ATOM 101   H HE   . ARG A 1 6  ? -3.522  1.088   -9.695  1.00 0.00 ? 7  ARG A HE   1  
ATOM 102   H HH11 . ARG A 1 6  ? -5.626  0.470   -7.085  1.00 0.00 ? 7  ARG A HH11 1  
ATOM 103   H HH12 . ARG A 1 6  ? -6.437  -0.852  -7.856  1.00 0.00 ? 7  ARG A HH12 1  
ATOM 104   H HH21 . ARG A 1 6  ? -4.343  -0.870  -10.620 1.00 0.00 ? 7  ARG A HH21 1  
ATOM 105   H HH22 . ARG A 1 6  ? -5.710  -1.612  -9.857  1.00 0.00 ? 7  ARG A HH22 1  
ATOM 106   N N    . PRO A 1 7  ? 1.932   -0.096  -6.454  1.00 0.00 ? 8  PRO A N    1  
ATOM 107   C CA   . PRO A 1 7  ? 2.870   -1.032  -5.807  1.00 0.00 ? 8  PRO A CA   1  
ATOM 108   C C    . PRO A 1 7  ? 2.102   -2.035  -4.938  1.00 0.00 ? 8  PRO A C    1  
ATOM 109   O O    . PRO A 1 7  ? 1.129   -1.695  -4.295  1.00 0.00 ? 8  PRO A O    1  
ATOM 110   C CB   . PRO A 1 7  ? 3.761   -0.120  -4.954  1.00 0.00 ? 8  PRO A CB   1  
ATOM 111   C CG   . PRO A 1 7  ? 2.954   1.183   -4.726  1.00 0.00 ? 8  PRO A CG   1  
ATOM 112   C CD   . PRO A 1 7  ? 1.939   1.262   -5.877  1.00 0.00 ? 8  PRO A CD   1  
ATOM 113   H HA   . PRO A 1 7  ? 3.465   -1.544  -6.544  1.00 0.00 ? 8  PRO A HA   1  
ATOM 114   H HB2  . PRO A 1 7  ? 3.978   -0.598  -4.009  1.00 0.00 ? 8  PRO A HB2  1  
ATOM 115   H HB3  . PRO A 1 7  ? 4.675   0.104   -5.479  1.00 0.00 ? 8  PRO A HB3  1  
ATOM 116   H HG2  . PRO A 1 7  ? 2.440   1.138   -3.775  1.00 0.00 ? 8  PRO A HG2  1  
ATOM 117   H HG3  . PRO A 1 7  ? 3.606   2.045   -4.755  1.00 0.00 ? 8  PRO A HG3  1  
ATOM 118   H HD2  . PRO A 1 7  ? 0.959   1.523   -5.503  1.00 0.00 ? 8  PRO A HD2  1  
ATOM 119   H HD3  . PRO A 1 7  ? 2.266   1.970   -6.621  1.00 0.00 ? 8  PRO A HD3  1  
ATOM 120   N N    . LEU A 1 8  ? 2.524   -3.270  -4.925  1.00 0.00 ? 9  LEU A N    1  
ATOM 121   C CA   . LEU A 1 8  ? 1.811   -4.291  -4.108  1.00 0.00 ? 9  LEU A CA   1  
ATOM 122   C C    . LEU A 1 8  ? 2.786   -5.323  -3.569  1.00 0.00 ? 9  LEU A C    1  
ATOM 123   O O    . LEU A 1 8  ? 3.990   -5.177  -3.640  1.00 0.00 ? 9  LEU A O    1  
ATOM 124   C CB   . LEU A 1 8  ? 0.755   -4.987  -4.952  1.00 0.00 ? 9  LEU A CB   1  
ATOM 125   C CG   . LEU A 1 8  ? 1.434   -5.767  -6.059  1.00 0.00 ? 9  LEU A CG   1  
ATOM 126   C CD1  . LEU A 1 8  ? 0.453   -6.797  -6.607  1.00 0.00 ? 9  LEU A CD1  1  
ATOM 127   C CD2  . LEU A 1 8  ? 1.837   -4.786  -7.151  1.00 0.00 ? 9  LEU A CD2  1  
ATOM 128   H H    . LEU A 1 8  ? 3.305   -3.525  -5.456  1.00 0.00 ? 9  LEU A H    1  
ATOM 129   H HA   . LEU A 1 8  ? 1.326   -3.822  -3.288  1.00 0.00 ? 9  LEU A HA   1  
ATOM 130   H HB2  . LEU A 1 8  ? 0.181   -5.661  -4.332  1.00 0.00 ? 9  LEU A HB2  1  
ATOM 131   H HB3  . LEU A 1 8  ? 0.097   -4.249  -5.386  1.00 0.00 ? 9  LEU A HB3  1  
ATOM 132   H HG   . LEU A 1 8  ? 2.309   -6.265  -5.670  1.00 0.00 ? 9  LEU A HG   1  
ATOM 133   H HD11 . LEU A 1 8  ? -0.292  -7.004  -5.853  1.00 0.00 ? 9  LEU A HD11 1  
ATOM 134   H HD12 . LEU A 1 8  ? -0.025  -6.403  -7.492  1.00 0.00 ? 9  LEU A HD12 1  
ATOM 135   H HD13 . LEU A 1 8  ? 0.981   -7.704  -6.853  1.00 0.00 ? 9  LEU A HD13 1  
ATOM 136   H HD21 . LEU A 1 8  ? 1.608   -3.783  -6.818  1.00 0.00 ? 9  LEU A HD21 1  
ATOM 137   H HD22 . LEU A 1 8  ? 2.897   -4.872  -7.338  1.00 0.00 ? 9  LEU A HD22 1  
ATOM 138   H HD23 . LEU A 1 8  ? 1.289   -5.003  -8.054  1.00 0.00 ? 9  LEU A HD23 1  
ATOM 139   N N    . SER A 1 9  ? 2.251   -6.360  -3.010  1.00 0.00 ? 10 SER A N    1  
ATOM 140   C CA   . SER A 1 9  ? 3.101   -7.438  -2.418  1.00 0.00 ? 10 SER A CA   1  
ATOM 141   C C    . SER A 1 9  ? 3.679   -8.336  -3.517  1.00 0.00 ? 10 SER A C    1  
ATOM 142   O O    . SER A 1 9  ? 3.148   -8.434  -4.607  1.00 0.00 ? 10 SER A O    1  
ATOM 143   C CB   . SER A 1 9  ? 2.256   -8.286  -1.467  1.00 0.00 ? 10 SER A CB   1  
ATOM 144   O OG   . SER A 1 9  ? 1.047   -7.599  -1.172  1.00 0.00 ? 10 SER A OG   1  
ATOM 145   H H    . SER A 1 9  ? 1.273   -6.418  -2.967  1.00 0.00 ? 10 SER A H    1  
ATOM 146   H HA   . SER A 1 9  ? 3.913   -6.990  -1.866  1.00 0.00 ? 10 SER A HA   1  
ATOM 147   H HB2  . SER A 1 9  ? 2.023   -9.230  -1.931  1.00 0.00 ? 10 SER A HB2  1  
ATOM 148   H HB3  . SER A 1 9  ? 2.813   -8.464  -0.556  1.00 0.00 ? 10 SER A HB3  1  
ATOM 149   H HG   . SER A 1 9  ? 0.446   -8.221  -0.756  1.00 0.00 ? 10 SER A HG   1  
ATOM 150   N N    . ALA A 1 10 ? 4.769   -8.995  -3.223  1.00 0.00 ? 11 ALA A N    1  
ATOM 151   C CA   . ALA A 1 10 ? 5.402   -9.895  -4.228  1.00 0.00 ? 11 ALA A CA   1  
ATOM 152   C C    . ALA A 1 10 ? 4.471   -11.077 -4.512  1.00 0.00 ? 11 ALA A C    1  
ATOM 153   O O    . ALA A 1 10 ? 4.175   -11.391 -5.651  1.00 0.00 ? 11 ALA A O    1  
ATOM 154   C CB   . ALA A 1 10 ? 6.730   -10.419 -3.674  1.00 0.00 ? 11 ALA A CB   1  
ATOM 155   H H    . ALA A 1 10 ? 5.170   -8.896  -2.335  1.00 0.00 ? 11 ALA A H    1  
ATOM 156   H HA   . ALA A 1 10 ? 5.584   -9.349  -5.140  1.00 0.00 ? 11 ALA A HA   1  
ATOM 157   H HB1  . ALA A 1 10 ? 6.872   -10.047 -2.671  1.00 0.00 ? 11 ALA A HB1  1  
ATOM 158   H HB2  . ALA A 1 10 ? 6.713   -11.499 -3.660  1.00 0.00 ? 11 ALA A HB2  1  
ATOM 159   H HB3  . ALA A 1 10 ? 7.539   -10.080 -4.302  1.00 0.00 ? 11 ALA A HB3  1  
ATOM 160   N N    . TYR A 1 11 ? 4.002   -11.729 -3.483  1.00 0.00 ? 12 TYR A N    1  
ATOM 161   C CA   . TYR A 1 11 ? 3.089   -12.879 -3.678  1.00 0.00 ? 12 TYR A CA   1  
ATOM 162   C C    . TYR A 1 11 ? 1.937   -12.453 -4.585  1.00 0.00 ? 12 TYR A C    1  
ATOM 163   O O    . TYR A 1 11 ? 1.289   -13.268 -5.214  1.00 0.00 ? 12 TYR A O    1  
ATOM 164   C CB   . TYR A 1 11 ? 2.554   -13.298 -2.313  1.00 0.00 ? 12 TYR A CB   1  
ATOM 165   C CG   . TYR A 1 11 ? 1.433   -14.293 -2.485  1.00 0.00 ? 12 TYR A CG   1  
ATOM 166   C CD1  . TYR A 1 11 ? 1.667   -15.497 -3.157  1.00 0.00 ? 12 TYR A CD1  1  
ATOM 167   C CD2  . TYR A 1 11 ? 0.161   -14.013 -1.973  1.00 0.00 ? 12 TYR A CD2  1  
ATOM 168   C CE1  . TYR A 1 11 ? 0.631   -16.423 -3.317  1.00 0.00 ? 12 TYR A CE1  1  
ATOM 169   C CE2  . TYR A 1 11 ? -0.877  -14.939 -2.132  1.00 0.00 ? 12 TYR A CE2  1  
ATOM 170   C CZ   . TYR A 1 11 ? -0.641  -16.145 -2.805  1.00 0.00 ? 12 TYR A CZ   1  
ATOM 171   O OH   . TYR A 1 11 ? -1.662  -17.059 -2.963  1.00 0.00 ? 12 TYR A OH   1  
ATOM 172   H H    . TYR A 1 11 ? 4.245   -11.459 -2.573  1.00 0.00 ? 12 TYR A H    1  
ATOM 173   H HA   . TYR A 1 11 ? 3.623   -13.704 -4.127  1.00 0.00 ? 12 TYR A HA   1  
ATOM 174   H HB2  . TYR A 1 11 ? 3.353   -13.745 -1.741  1.00 0.00 ? 12 TYR A HB2  1  
ATOM 175   H HB3  . TYR A 1 11 ? 2.189   -12.425 -1.794  1.00 0.00 ? 12 TYR A HB3  1  
ATOM 176   H HD1  . TYR A 1 11 ? 2.647   -15.712 -3.552  1.00 0.00 ? 12 TYR A HD1  1  
ATOM 177   H HD2  . TYR A 1 11 ? -0.019  -13.083 -1.454  1.00 0.00 ? 12 TYR A HD2  1  
ATOM 178   H HE1  . TYR A 1 11 ? 0.814   -17.352 -3.835  1.00 0.00 ? 12 TYR A HE1  1  
ATOM 179   H HE2  . TYR A 1 11 ? -1.857  -14.723 -1.737  1.00 0.00 ? 12 TYR A HE2  1  
ATOM 180   H HH   . TYR A 1 11 ? -2.495  -16.585 -2.906  1.00 0.00 ? 12 TYR A HH   1  
ATOM 181   N N    . MET A 1 12 ? 1.678   -11.176 -4.660  1.00 0.00 ? 13 MET A N    1  
ATOM 182   C CA   . MET A 1 12 ? 0.577   -10.690 -5.526  1.00 0.00 ? 13 MET A CA   1  
ATOM 183   C C    . MET A 1 12 ? 1.048   -10.664 -6.979  1.00 0.00 ? 13 MET A C    1  
ATOM 184   O O    . MET A 1 12 ? 0.363   -11.130 -7.867  1.00 0.00 ? 13 MET A O    1  
ATOM 185   C CB   . MET A 1 12 ? 0.181   -9.278  -5.097  1.00 0.00 ? 13 MET A CB   1  
ATOM 186   C CG   . MET A 1 12 ? -0.533  -9.334  -3.746  1.00 0.00 ? 13 MET A CG   1  
ATOM 187   S SD   . MET A 1 12 ? -2.319  -9.193  -4.003  1.00 0.00 ? 13 MET A SD   1  
ATOM 188   C CE   . MET A 1 12 ? -2.555  -10.788 -4.825  1.00 0.00 ? 13 MET A CE   1  
ATOM 189   H H    . MET A 1 12 ? 2.213   -10.536 -4.150  1.00 0.00 ? 13 MET A H    1  
ATOM 190   H HA   . MET A 1 12 ? -0.275  -11.349 -5.434  1.00 0.00 ? 13 MET A HA   1  
ATOM 191   H HB2  . MET A 1 12 ? 1.067   -8.665  -5.013  1.00 0.00 ? 13 MET A HB2  1  
ATOM 192   H HB3  . MET A 1 12 ? -0.479  -8.856  -5.833  1.00 0.00 ? 13 MET A HB3  1  
ATOM 193   H HG2  . MET A 1 12 ? -0.312  -10.274 -3.261  1.00 0.00 ? 13 MET A HG2  1  
ATOM 194   H HG3  . MET A 1 12 ? -0.192  -8.519  -3.125  1.00 0.00 ? 13 MET A HG3  1  
ATOM 195   H HE1  . MET A 1 12 ? -1.881  -11.516 -4.395  1.00 0.00 ? 13 MET A HE1  1  
ATOM 196   H HE2  . MET A 1 12 ? -3.578  -11.112 -4.692  1.00 0.00 ? 13 MET A HE2  1  
ATOM 197   H HE3  . MET A 1 12 ? -2.347  -10.686 -5.877  1.00 0.00 ? 13 MET A HE3  1  
ATOM 198   N N    . LEU A 1 13 ? 2.213   -10.128 -7.236  1.00 0.00 ? 14 LEU A N    1  
ATOM 199   C CA   . LEU A 1 13 ? 2.701   -10.094 -8.644  1.00 0.00 ? 14 LEU A CA   1  
ATOM 200   C C    . LEU A 1 13 ? 2.545   -11.486 -9.243  1.00 0.00 ? 14 LEU A C    1  
ATOM 201   O O    . LEU A 1 13 ? 1.990   -11.658 -10.310 1.00 0.00 ? 14 LEU A O    1  
ATOM 202   C CB   . LEU A 1 13 ? 4.180   -9.695  -8.701  1.00 0.00 ? 14 LEU A CB   1  
ATOM 203   C CG   . LEU A 1 13 ? 4.505   -8.691  -7.594  1.00 0.00 ? 14 LEU A CG   1  
ATOM 204   C CD1  . LEU A 1 13 ? 5.861   -8.042  -7.882  1.00 0.00 ? 14 LEU A CD1  1  
ATOM 205   C CD2  . LEU A 1 13 ? 3.426   -7.610  -7.551  1.00 0.00 ? 14 LEU A CD2  1  
ATOM 206   H H    . LEU A 1 13 ? 2.759   -9.758  -6.509  1.00 0.00 ? 14 LEU A H    1  
ATOM 207   H HA   . LEU A 1 13 ? 2.112   -9.390  -9.214  1.00 0.00 ? 14 LEU A HA   1  
ATOM 208   H HB2  . LEU A 1 13 ? 4.793   -10.580 -8.580  1.00 0.00 ? 14 LEU A HB2  1  
ATOM 209   H HB3  . LEU A 1 13 ? 4.389   -9.247  -9.660  1.00 0.00 ? 14 LEU A HB3  1  
ATOM 210   H HG   . LEU A 1 13 ? 4.543   -9.205  -6.645  1.00 0.00 ? 14 LEU A HG   1  
ATOM 211   H HD11 . LEU A 1 13 ? 6.092   -8.145  -8.933  1.00 0.00 ? 14 LEU A HD11 1  
ATOM 212   H HD12 . LEU A 1 13 ? 5.824   -6.992  -7.622  1.00 0.00 ? 14 LEU A HD12 1  
ATOM 213   H HD13 . LEU A 1 13 ? 6.626   -8.532  -7.297  1.00 0.00 ? 14 LEU A HD13 1  
ATOM 214   H HD21 . LEU A 1 13 ? 2.804   -7.684  -8.431  1.00 0.00 ? 14 LEU A HD21 1  
ATOM 215   H HD22 . LEU A 1 13 ? 2.819   -7.747  -6.668  1.00 0.00 ? 14 LEU A HD22 1  
ATOM 216   H HD23 . LEU A 1 13 ? 3.893   -6.636  -7.519  1.00 0.00 ? 14 LEU A HD23 1  
ATOM 217   N N    . TRP A 1 14 ? 3.024   -12.486 -8.559  1.00 0.00 ? 15 TRP A N    1  
ATOM 218   C CA   . TRP A 1 14 ? 2.894   -13.868 -9.087  1.00 0.00 ? 15 TRP A CA   1  
ATOM 219   C C    . TRP A 1 14 ? 1.407   -14.207 -9.213  1.00 0.00 ? 15 TRP A C    1  
ATOM 220   O O    . TRP A 1 14 ? 0.979   -14.839 -10.158 1.00 0.00 ? 15 TRP A O    1  
ATOM 221   C CB   . TRP A 1 14 ? 3.572   -14.850 -8.131  1.00 0.00 ? 15 TRP A CB   1  
ATOM 222   C CG   . TRP A 1 14 ? 3.234   -16.246 -8.536  1.00 0.00 ? 15 TRP A CG   1  
ATOM 223   C CD1  . TRP A 1 14 ? 3.888   -16.962 -9.479  1.00 0.00 ? 15 TRP A CD1  1  
ATOM 224   C CD2  . TRP A 1 14 ? 2.171   -17.104 -8.032  1.00 0.00 ? 15 TRP A CD2  1  
ATOM 225   N NE1  . TRP A 1 14 ? 3.294   -18.207 -9.585  1.00 0.00 ? 15 TRP A NE1  1  
ATOM 226   C CE2  . TRP A 1 14 ? 2.233   -18.342 -8.713  1.00 0.00 ? 15 TRP A CE2  1  
ATOM 227   C CE3  . TRP A 1 14 ? 1.172   -16.931 -7.058  1.00 0.00 ? 15 TRP A CE3  1  
ATOM 228   C CZ2  . TRP A 1 14 ? 1.333   -19.373 -8.438  1.00 0.00 ? 15 TRP A CZ2  1  
ATOM 229   C CZ3  . TRP A 1 14 ? 0.265   -17.965 -6.778  1.00 0.00 ? 15 TRP A CZ3  1  
ATOM 230   C CH2  . TRP A 1 14 ? 0.346   -19.184 -7.467  1.00 0.00 ? 15 TRP A CH2  1  
ATOM 231   H H    . TRP A 1 14 ? 3.464   -12.325 -7.694  1.00 0.00 ? 15 TRP A H    1  
ATOM 232   H HA   . TRP A 1 14 ? 3.362   -13.929 -10.060 1.00 0.00 ? 15 TRP A HA   1  
ATOM 233   H HB2  . TRP A 1 14 ? 4.643   -14.711 -8.173  1.00 0.00 ? 15 TRP A HB2  1  
ATOM 234   H HB3  . TRP A 1 14 ? 3.224   -14.672 -7.124  1.00 0.00 ? 15 TRP A HB3  1  
ATOM 235   H HD1  . TRP A 1 14 ? 4.734   -16.618 -10.055 1.00 0.00 ? 15 TRP A HD1  1  
ATOM 236   H HE1  . TRP A 1 14 ? 3.578   -18.919 -10.197 1.00 0.00 ? 15 TRP A HE1  1  
ATOM 237   H HE3  . TRP A 1 14 ? 1.103   -15.996 -6.523  1.00 0.00 ? 15 TRP A HE3  1  
ATOM 238   H HZ2  . TRP A 1 14 ? 1.400   -20.309 -8.972  1.00 0.00 ? 15 TRP A HZ2  1  
ATOM 239   H HZ3  . TRP A 1 14 ? -0.498  -17.821 -6.028  1.00 0.00 ? 15 TRP A HZ3  1  
ATOM 240   H HH2  . TRP A 1 14 ? -0.354  -19.977 -7.248  1.00 0.00 ? 15 TRP A HH2  1  
ATOM 241   N N    . LEU A 1 15 ? 0.616   -13.780 -8.266  1.00 0.00 ? 16 LEU A N    1  
ATOM 242   C CA   . LEU A 1 15 ? -0.846  -14.060 -8.324  1.00 0.00 ? 16 LEU A CA   1  
ATOM 243   C C    . LEU A 1 15 ? -1.405  -13.584 -9.667  1.00 0.00 ? 16 LEU A C    1  
ATOM 244   O O    . LEU A 1 15 ? -2.270  -14.210 -10.248 1.00 0.00 ? 16 LEU A O    1  
ATOM 245   C CB   . LEU A 1 15 ? -1.547  -13.307 -7.192  1.00 0.00 ? 16 LEU A CB   1  
ATOM 246   C CG   . LEU A 1 15 ? -2.411  -14.276 -6.385  1.00 0.00 ? 16 LEU A CG   1  
ATOM 247   C CD1  . LEU A 1 15 ? -3.519  -14.840 -7.277  1.00 0.00 ? 16 LEU A CD1  1  
ATOM 248   C CD2  . LEU A 1 15 ? -1.541  -15.422 -5.863  1.00 0.00 ? 16 LEU A CD2  1  
ATOM 249   H H    . LEU A 1 15 ? 0.985   -13.267 -7.516  1.00 0.00 ? 16 LEU A H    1  
ATOM 250   H HA   . LEU A 1 15 ? -1.017  -15.121 -8.214  1.00 0.00 ? 16 LEU A HA   1  
ATOM 251   H HB2  . LEU A 1 15 ? -0.805  -12.861 -6.545  1.00 0.00 ? 16 LEU A HB2  1  
ATOM 252   H HB3  . LEU A 1 15 ? -2.173  -12.533 -7.609  1.00 0.00 ? 16 LEU A HB3  1  
ATOM 253   H HG   . LEU A 1 15 ? -2.853  -13.750 -5.550  1.00 0.00 ? 16 LEU A HG   1  
ATOM 254   H HD11 . LEU A 1 15 ? -3.952  -14.041 -7.861  1.00 0.00 ? 16 LEU A HD11 1  
ATOM 255   H HD12 . LEU A 1 15 ? -3.102  -15.584 -7.940  1.00 0.00 ? 16 LEU A HD12 1  
ATOM 256   H HD13 . LEU A 1 15 ? -4.282  -15.292 -6.662  1.00 0.00 ? 16 LEU A HD13 1  
ATOM 257   H HD21 . LEU A 1 15 ? -0.501  -15.134 -5.909  1.00 0.00 ? 16 LEU A HD21 1  
ATOM 258   H HD22 . LEU A 1 15 ? -1.810  -15.642 -4.841  1.00 0.00 ? 16 LEU A HD22 1  
ATOM 259   H HD23 . LEU A 1 15 ? -1.697  -16.300 -6.473  1.00 0.00 ? 16 LEU A HD23 1  
ATOM 260   N N    . ASN A 1 16 ? -0.920  -12.476 -10.163 1.00 0.00 ? 17 ASN A N    1  
ATOM 261   C CA   . ASN A 1 16 ? -1.424  -11.957 -11.462 1.00 0.00 ? 17 ASN A CA   1  
ATOM 262   C C    . ASN A 1 16 ? -0.868  -12.799 -12.611 1.00 0.00 ? 17 ASN A C    1  
ATOM 263   O O    . ASN A 1 16 ? -1.538  -13.045 -13.593 1.00 0.00 ? 17 ASN A O    1  
ATOM 264   C CB   . ASN A 1 16 ? -0.979  -10.514 -11.632 1.00 0.00 ? 17 ASN A CB   1  
ATOM 265   C CG   . ASN A 1 16 ? -1.155  -9.759  -10.312 1.00 0.00 ? 17 ASN A CG   1  
ATOM 266   O OD1  . ASN A 1 16 ? -2.171  -9.885  -9.658  1.00 0.00 ? 17 ASN A OD1  1  
ATOM 267   N ND2  . ASN A 1 16 ? -0.203  -8.970  -9.893  1.00 0.00 ? 17 ASN A ND2  1  
ATOM 268   H H    . ASN A 1 16 ? -0.226  -11.984 -9.679  1.00 0.00 ? 17 ASN A H    1  
ATOM 269   H HA   . ASN A 1 16 ? -2.498  -11.991 -11.480 1.00 0.00 ? 17 ASN A HA   1  
ATOM 270   H HB2  . ASN A 1 16 ? 0.058   -10.492 -11.927 1.00 0.00 ? 17 ASN A HB2  1  
ATOM 271   H HB3  . ASN A 1 16 ? -1.586  -10.054 -12.390 1.00 0.00 ? 17 ASN A HB3  1  
ATOM 272   H HD21 . ASN A 1 16 ? 0.615   -8.866  -10.423 1.00 0.00 ? 17 ASN A HD21 1  
ATOM 273   H HD22 . ASN A 1 16 ? -0.305  -8.483  -9.049  1.00 0.00 ? 17 ASN A HD22 1  
ATOM 274   N N    . SER A 1 17 ? 0.355   -13.242 -12.499 1.00 0.00 ? 18 SER A N    1  
ATOM 275   C CA   . SER A 1 17 ? 0.949   -14.065 -13.588 1.00 0.00 ? 18 SER A CA   1  
ATOM 276   C C    . SER A 1 17 ? 0.353   -15.474 -13.559 1.00 0.00 ? 18 SER A C    1  
ATOM 277   O O    . SER A 1 17 ? 0.584   -16.272 -14.446 1.00 0.00 ? 18 SER A O    1  
ATOM 278   C CB   . SER A 1 17 ? 2.457   -14.148 -13.393 1.00 0.00 ? 18 SER A CB   1  
ATOM 279   O OG   . SER A 1 17 ? 2.774   -15.312 -12.642 1.00 0.00 ? 18 SER A OG   1  
ATOM 280   H H    . SER A 1 17 ? 0.881   -13.031 -11.700 1.00 0.00 ? 18 SER A H    1  
ATOM 281   H HA   . SER A 1 17 ? 0.743   -13.606 -14.541 1.00 0.00 ? 18 SER A HA   1  
ATOM 282   H HB2  . SER A 1 17 ? 2.937   -14.201 -14.355 1.00 0.00 ? 18 SER A HB2  1  
ATOM 283   H HB3  . SER A 1 17 ? 2.798   -13.264 -12.873 1.00 0.00 ? 18 SER A HB3  1  
ATOM 284   H HG   . SER A 1 17 ? 3.487   -15.091 -12.040 1.00 0.00 ? 18 SER A HG   1  
ATOM 285   N N    . ALA A 1 18 ? -0.410  -15.790 -12.549 1.00 0.00 ? 19 ALA A N    1  
ATOM 286   C CA   . ALA A 1 18 ? -1.013  -17.151 -12.473 1.00 0.00 ? 19 ALA A CA   1  
ATOM 287   C C    . ALA A 1 18 ? -2.528  -17.042 -12.312 1.00 0.00 ? 19 ALA A C    1  
ATOM 288   O O    . ALA A 1 18 ? -3.214  -18.033 -12.193 1.00 0.00 ? 19 ALA A O    1  
ATOM 289   C CB   . ALA A 1 18 ? -0.438  -17.901 -11.270 1.00 0.00 ? 19 ALA A CB   1  
ATOM 290   H H    . ALA A 1 18 ? -0.585  -15.135 -11.841 1.00 0.00 ? 19 ALA A H    1  
ATOM 291   H HA   . ALA A 1 18 ? -0.786  -17.695 -13.378 1.00 0.00 ? 19 ALA A HA   1  
ATOM 292   H HB1  . ALA A 1 18 ? 0.152   -17.223 -10.671 1.00 0.00 ? 19 ALA A HB1  1  
ATOM 293   H HB2  . ALA A 1 18 ? -1.248  -18.297 -10.674 1.00 0.00 ? 19 ALA A HB2  1  
ATOM 294   H HB3  . ALA A 1 18 ? 0.186   -18.712 -11.615 1.00 0.00 ? 19 ALA A HB3  1  
ATOM 295   N N    . ARG A 1 19 ? -3.057  -15.851 -12.298 1.00 0.00 ? 20 ARG A N    1  
ATOM 296   C CA   . ARG A 1 19 ? -4.531  -15.699 -12.133 1.00 0.00 ? 20 ARG A CA   1  
ATOM 297   C C    . ARG A 1 19 ? -5.255  -16.378 -13.297 1.00 0.00 ? 20 ARG A C    1  
ATOM 298   O O    . ARG A 1 19 ? -6.293  -16.983 -13.122 1.00 0.00 ? 20 ARG A O    1  
ATOM 299   C CB   . ARG A 1 19 ? -4.896  -14.211 -12.095 1.00 0.00 ? 20 ARG A CB   1  
ATOM 300   C CG   . ARG A 1 19 ? -5.697  -13.913 -10.825 1.00 0.00 ? 20 ARG A CG   1  
ATOM 301   C CD   . ARG A 1 19 ? -5.910  -12.403 -10.696 1.00 0.00 ? 20 ARG A CD   1  
ATOM 302   N NE   . ARG A 1 19 ? -6.931  -12.132 -9.645  1.00 0.00 ? 20 ARG A NE   1  
ATOM 303   C CZ   . ARG A 1 19 ? -6.567  -11.653 -8.487  1.00 0.00 ? 20 ARG A CZ   1  
ATOM 304   N NH1  . ARG A 1 19 ? -6.095  -10.438 -8.401  1.00 0.00 ? 20 ARG A NH1  1  
ATOM 305   N NH2  . ARG A 1 19 ? -6.677  -12.388 -7.415  1.00 0.00 ? 20 ARG A NH2  1  
ATOM 306   H H    . ARG A 1 19 ? -2.487  -15.058 -12.389 1.00 0.00 ? 20 ARG A H    1  
ATOM 307   H HA   . ARG A 1 19 ? -4.835  -16.168 -11.210 1.00 0.00 ? 20 ARG A HA   1  
ATOM 308   H HB2  . ARG A 1 19 ? -3.991  -13.620 -12.098 1.00 0.00 ? 20 ARG A HB2  1  
ATOM 309   H HB3  . ARG A 1 19 ? -5.491  -13.964 -12.960 1.00 0.00 ? 20 ARG A HB3  1  
ATOM 310   H HG2  . ARG A 1 19 ? -6.655  -14.409 -10.881 1.00 0.00 ? 20 ARG A HG2  1  
ATOM 311   H HG3  . ARG A 1 19 ? -5.154  -14.273 -9.964  1.00 0.00 ? 20 ARG A HG3  1  
ATOM 312   H HD2  . ARG A 1 19 ? -4.978  -11.931 -10.423 1.00 0.00 ? 20 ARG A HD2  1  
ATOM 313   H HD3  . ARG A 1 19 ? -6.250  -12.006 -11.641 1.00 0.00 ? 20 ARG A HD3  1  
ATOM 314   H HE   . ARG A 1 19 ? -7.878  -12.314 -9.824  1.00 0.00 ? 20 ARG A HE   1  
ATOM 315   H HH11 . ARG A 1 19 ? -6.014  -9.874  -9.222  1.00 0.00 ? 20 ARG A HH11 1  
ATOM 316   H HH12 . ARG A 1 19 ? -5.815  -10.073 -7.513  1.00 0.00 ? 20 ARG A HH12 1  
ATOM 317   H HH21 . ARG A 1 19 ? -7.039  -13.317 -7.480  1.00 0.00 ? 20 ARG A HH21 1  
ATOM 318   H HH22 . ARG A 1 19 ? -6.398  -12.021 -6.527  1.00 0.00 ? 20 ARG A HH22 1  
ATOM 319   N N    . GLU A 1 20 ? -4.719  -16.289 -14.482 1.00 0.00 ? 21 GLU A N    1  
ATOM 320   C CA   . GLU A 1 20 ? -5.386  -16.939 -15.642 1.00 0.00 ? 21 GLU A CA   1  
ATOM 321   C C    . GLU A 1 20 ? -5.109  -18.440 -15.603 1.00 0.00 ? 21 GLU A C    1  
ATOM 322   O O    . GLU A 1 20 ? -5.997  -19.250 -15.774 1.00 0.00 ? 21 GLU A O    1  
ATOM 323   C CB   . GLU A 1 20 ? -4.846  -16.349 -16.947 1.00 0.00 ? 21 GLU A CB   1  
ATOM 324   C CG   . GLU A 1 20 ? -5.366  -14.920 -17.117 1.00 0.00 ? 21 GLU A CG   1  
ATOM 325   C CD   . GLU A 1 20 ? -5.451  -14.580 -18.607 1.00 0.00 ? 21 GLU A CD   1  
ATOM 326   O OE1  . GLU A 1 20 ? -5.823  -15.453 -19.373 1.00 0.00 ? 21 GLU A OE1  1  
ATOM 327   O OE2  . GLU A 1 20 ? -5.144  -13.452 -18.955 1.00 0.00 ? 21 GLU A OE2  1  
ATOM 328   H H    . GLU A 1 20 ? -3.879  -15.801 -14.608 1.00 0.00 ? 21 GLU A H    1  
ATOM 329   H HA   . GLU A 1 20 ? -6.449  -16.773 -15.581 1.00 0.00 ? 21 GLU A HA   1  
ATOM 330   H HB2  . GLU A 1 20 ? -3.766  -16.338 -16.918 1.00 0.00 ? 21 GLU A HB2  1  
ATOM 331   H HB3  . GLU A 1 20 ? -5.177  -16.952 -17.779 1.00 0.00 ? 21 GLU A HB3  1  
ATOM 332   H HG2  . GLU A 1 20 ? -6.348  -14.841 -16.671 1.00 0.00 ? 21 GLU A HG2  1  
ATOM 333   H HG3  . GLU A 1 20 ? -4.693  -14.232 -16.631 1.00 0.00 ? 21 GLU A HG3  1  
ATOM 334   N N    . SER A 1 21 ? -3.886  -18.816 -15.370 1.00 0.00 ? 22 SER A N    1  
ATOM 335   C CA   . SER A 1 21 ? -3.558  -20.266 -15.310 1.00 0.00 ? 22 SER A CA   1  
ATOM 336   C C    . SER A 1 21 ? -4.090  -20.844 -13.999 1.00 0.00 ? 22 SER A C    1  
ATOM 337   O O    . SER A 1 21 ? -4.054  -22.038 -13.775 1.00 0.00 ? 22 SER A O    1  
ATOM 338   C CB   . SER A 1 21 ? -2.042  -20.455 -15.376 1.00 0.00 ? 22 SER A CB   1  
ATOM 339   O OG   . SER A 1 21 ? -1.606  -20.292 -16.719 1.00 0.00 ? 22 SER A OG   1  
ATOM 340   H H    . SER A 1 21 ? -3.188  -18.146 -15.227 1.00 0.00 ? 22 SER A H    1  
ATOM 341   H HA   . SER A 1 21 ? -4.023  -20.775 -16.141 1.00 0.00 ? 22 SER A HA   1  
ATOM 342   H HB2  . SER A 1 21 ? -1.557  -19.720 -14.755 1.00 0.00 ? 22 SER A HB2  1  
ATOM 343   H HB3  . SER A 1 21 ? -1.788  -21.446 -15.022 1.00 0.00 ? 22 SER A HB3  1  
ATOM 344   H HG   . SER A 1 21 ? -1.648  -19.358 -16.934 1.00 0.00 ? 22 SER A HG   1  
ATOM 345   N N    . ILE A 1 22 ? -4.594  -20.008 -13.130 1.00 0.00 ? 23 ILE A N    1  
ATOM 346   C CA   . ILE A 1 22 ? -5.134  -20.514 -11.841 1.00 0.00 ? 23 ILE A CA   1  
ATOM 347   C C    . ILE A 1 22 ? -6.615  -20.841 -12.026 1.00 0.00 ? 23 ILE A C    1  
ATOM 348   O O    . ILE A 1 22 ? -7.087  -21.882 -11.615 1.00 0.00 ? 23 ILE A O    1  
ATOM 349   C CB   . ILE A 1 22 ? -4.950  -19.434 -10.758 1.00 0.00 ? 23 ILE A CB   1  
ATOM 350   C CG1  . ILE A 1 22 ? -3.579  -19.613 -10.102 1.00 0.00 ? 23 ILE A CG1  1  
ATOM 351   C CG2  . ILE A 1 22 ? -6.036  -19.550 -9.680  1.00 0.00 ? 23 ILE A CG2  1  
ATOM 352   C CD1  . ILE A 1 22 ? -3.342  -18.487 -9.094  1.00 0.00 ? 23 ILE A CD1  1  
ATOM 353   H H    . ILE A 1 22 ? -4.623  -19.048 -13.328 1.00 0.00 ? 23 ILE A H    1  
ATOM 354   H HA   . ILE A 1 22 ? -4.601  -21.408 -11.553 1.00 0.00 ? 23 ILE A HA   1  
ATOM 355   H HB   . ILE A 1 22 ? -5.005  -18.457 -11.214 1.00 0.00 ? 23 ILE A HB   1  
ATOM 356   H HG12 . ILE A 1 22 ? -3.548  -20.565 -9.592  1.00 0.00 ? 23 ILE A HG12 1  
ATOM 357   H HG13 . ILE A 1 22 ? -2.810  -19.585 -10.858 1.00 0.00 ? 23 ILE A HG13 1  
ATOM 358   H HG21 . ILE A 1 22 ? -7.014  -19.573 -10.147 1.00 0.00 ? 23 ILE A HG21 1  
ATOM 359   H HG22 . ILE A 1 22 ? -5.883  -20.455 -9.114  1.00 0.00 ? 23 ILE A HG22 1  
ATOM 360   H HG23 . ILE A 1 22 ? -5.973  -18.699 -9.019  1.00 0.00 ? 23 ILE A HG23 1  
ATOM 361   H HD11 . ILE A 1 22 ? -4.266  -17.955 -8.925  1.00 0.00 ? 23 ILE A HD11 1  
ATOM 362   H HD12 . ILE A 1 22 ? -2.993  -18.906 -8.162  1.00 0.00 ? 23 ILE A HD12 1  
ATOM 363   H HD13 . ILE A 1 22 ? -2.600  -17.805 -9.483  1.00 0.00 ? 23 ILE A HD13 1  
ATOM 364   N N    . LYS A 1 23 ? -7.354  -19.956 -12.635 1.00 0.00 ? 24 LYS A N    1  
ATOM 365   C CA   . LYS A 1 23 ? -8.796  -20.213 -12.835 1.00 0.00 ? 24 LYS A CA   1  
ATOM 366   C C    . LYS A 1 23 ? -8.985  -21.311 -13.886 1.00 0.00 ? 24 LYS A C    1  
ATOM 367   O O    . LYS A 1 23 ? -9.953  -22.044 -13.865 1.00 0.00 ? 24 LYS A O    1  
ATOM 368   C CB   . LYS A 1 23 ? -9.448  -18.922 -13.314 1.00 0.00 ? 24 LYS A CB   1  
ATOM 369   C CG   . LYS A 1 23 ? -9.756  -18.036 -12.107 1.00 0.00 ? 24 LYS A CG   1  
ATOM 370   C CD   . LYS A 1 23 ? -10.171 -16.644 -12.587 1.00 0.00 ? 24 LYS A CD   1  
ATOM 371   C CE   . LYS A 1 23 ? -11.678 -16.468 -12.397 1.00 0.00 ? 24 LYS A CE   1  
ATOM 372   N NZ   . LYS A 1 23 ? -12.314 -16.197 -13.718 1.00 0.00 ? 24 LYS A NZ   1  
ATOM 373   H H    . LYS A 1 23 ? -6.963  -19.115 -12.957 1.00 0.00 ? 24 LYS A H    1  
ATOM 374   H HA   . LYS A 1 23 ? -9.239  -20.518 -11.897 1.00 0.00 ? 24 LYS A HA   1  
ATOM 375   H HB2  . LYS A 1 23 ? -8.760  -18.407 -13.971 1.00 0.00 ? 24 LYS A HB2  1  
ATOM 376   H HB3  . LYS A 1 23 ? -10.362 -19.147 -13.841 1.00 0.00 ? 24 LYS A HB3  1  
ATOM 377   H HG2  . LYS A 1 23 ? -10.558 -18.476 -11.533 1.00 0.00 ? 24 LYS A HG2  1  
ATOM 378   H HG3  . LYS A 1 23 ? -8.873  -17.954 -11.491 1.00 0.00 ? 24 LYS A HG3  1  
ATOM 379   H HD2  . LYS A 1 23 ? -9.645  -15.895 -12.014 1.00 0.00 ? 24 LYS A HD2  1  
ATOM 380   H HD3  . LYS A 1 23 ? -9.927  -16.536 -13.633 1.00 0.00 ? 24 LYS A HD3  1  
ATOM 381   H HE2  . LYS A 1 23 ? -12.096 -17.370 -11.975 1.00 0.00 ? 24 LYS A HE2  1  
ATOM 382   H HE3  . LYS A 1 23 ? -11.863 -15.639 -11.732 1.00 0.00 ? 24 LYS A HE3  1  
ATOM 383   H HZ1  . LYS A 1 23 ? -11.694 -16.541 -14.478 1.00 0.00 ? 24 LYS A HZ1  1  
ATOM 384   H HZ2  . LYS A 1 23 ? -13.229 -16.685 -13.769 1.00 0.00 ? 24 LYS A HZ2  1  
ATOM 385   H HZ3  . LYS A 1 23 ? -12.463 -15.174 -13.826 1.00 0.00 ? 24 LYS A HZ3  1  
ATOM 386   N N    . ARG A 1 24 ? -8.065  -21.429 -14.808 1.00 0.00 ? 25 ARG A N    1  
ATOM 387   C CA   . ARG A 1 24 ? -8.196  -22.480 -15.860 1.00 0.00 ? 25 ARG A CA   1  
ATOM 388   C C    . ARG A 1 24 ? -8.088  -23.862 -15.218 1.00 0.00 ? 25 ARG A C    1  
ATOM 389   O O    . ARG A 1 24 ? -9.041  -24.616 -15.179 1.00 0.00 ? 25 ARG A O    1  
ATOM 390   C CB   . ARG A 1 24 ? -7.077  -22.314 -16.893 1.00 0.00 ? 25 ARG A CB   1  
ATOM 391   C CG   . ARG A 1 24 ? -7.348  -21.073 -17.748 1.00 0.00 ? 25 ARG A CG   1  
ATOM 392   C CD   . ARG A 1 24 ? -6.339  -21.005 -18.885 1.00 0.00 ? 25 ARG A CD   1  
ATOM 393   N NE   . ARG A 1 24 ? -6.030  -22.382 -19.366 1.00 0.00 ? 25 ARG A NE   1  
ATOM 394   C CZ   . ARG A 1 24 ? -6.943  -23.079 -19.987 1.00 0.00 ? 25 ARG A CZ   1  
ATOM 395   N NH1  . ARG A 1 24 ? -7.942  -22.478 -20.575 1.00 0.00 ? 25 ARG A NH1  1  
ATOM 396   N NH2  . ARG A 1 24 ? -6.854  -24.381 -20.023 1.00 0.00 ? 25 ARG A NH2  1  
ATOM 397   H H    . ARG A 1 24 ? -7.290  -20.829 -14.809 1.00 0.00 ? 25 ARG A H    1  
ATOM 398   H HA   . ARG A 1 24 ? -9.154  -22.383 -16.349 1.00 0.00 ? 25 ARG A HA   1  
ATOM 399   H HB2  . ARG A 1 24 ? -6.131  -22.201 -16.384 1.00 0.00 ? 25 ARG A HB2  1  
ATOM 400   H HB3  . ARG A 1 24 ? -7.043  -23.186 -17.530 1.00 0.00 ? 25 ARG A HB3  1  
ATOM 401   H HG2  . ARG A 1 24 ? -8.344  -21.125 -18.158 1.00 0.00 ? 25 ARG A HG2  1  
ATOM 402   H HG3  . ARG A 1 24 ? -7.254  -20.189 -17.140 1.00 0.00 ? 25 ARG A HG3  1  
ATOM 403   H HD2  . ARG A 1 24 ? -6.754  -20.424 -19.691 1.00 0.00 ? 25 ARG A HD2  1  
ATOM 404   H HD3  . ARG A 1 24 ? -5.437  -20.534 -18.530 1.00 0.00 ? 25 ARG A HD3  1  
ATOM 405   H HE   . ARG A 1 24 ? -5.140  -22.764 -19.214 1.00 0.00 ? 25 ARG A HE   1  
ATOM 406   H HH11 . ARG A 1 24 ? -8.011  -21.481 -20.549 1.00 0.00 ? 25 ARG A HH11 1  
ATOM 407   H HH12 . ARG A 1 24 ? -8.640  -23.014 -21.048 1.00 0.00 ? 25 ARG A HH12 1  
ATOM 408   H HH21 . ARG A 1 24 ? -6.088  -24.843 -19.576 1.00 0.00 ? 25 ARG A HH21 1  
ATOM 409   H HH22 . ARG A 1 24 ? -7.552  -24.917 -20.498 1.00 0.00 ? 25 ARG A HH22 1  
ATOM 410   N N    . GLU A 1 25 ? -6.935  -24.202 -14.715 1.00 0.00 ? 26 GLU A N    1  
ATOM 411   C CA   . GLU A 1 25 ? -6.763  -25.536 -14.076 1.00 0.00 ? 26 GLU A CA   1  
ATOM 412   C C    . GLU A 1 25 ? -7.759  -25.682 -12.924 1.00 0.00 ? 26 GLU A C    1  
ATOM 413   O O    . GLU A 1 25 ? -8.159  -26.774 -12.572 1.00 0.00 ? 26 GLU A O    1  
ATOM 414   C CB   . GLU A 1 25 ? -5.338  -25.663 -13.538 1.00 0.00 ? 26 GLU A CB   1  
ATOM 415   C CG   . GLU A 1 25 ? -4.491  -26.468 -14.526 1.00 0.00 ? 26 GLU A CG   1  
ATOM 416   C CD   . GLU A 1 25 ? -3.194  -26.909 -13.844 1.00 0.00 ? 26 GLU A CD   1  
ATOM 417   O OE1  . GLU A 1 25 ? -2.805  -26.269 -12.883 1.00 0.00 ? 26 GLU A OE1  1  
ATOM 418   O OE2  . GLU A 1 25 ? -2.613  -27.882 -14.298 1.00 0.00 ? 26 GLU A OE2  1  
ATOM 419   H H    . GLU A 1 25 ? -6.178  -23.580 -14.759 1.00 0.00 ? 26 GLU A H    1  
ATOM 420   H HA   . GLU A 1 25 ? -6.942  -26.311 -14.807 1.00 0.00 ? 26 GLU A HA   1  
ATOM 421   H HB2  . GLU A 1 25 ? -4.911  -24.678 -13.414 1.00 0.00 ? 26 GLU A HB2  1  
ATOM 422   H HB3  . GLU A 1 25 ? -5.357  -26.171 -12.586 1.00 0.00 ? 26 GLU A HB3  1  
ATOM 423   H HG2  . GLU A 1 25 ? -5.045  -27.337 -14.848 1.00 0.00 ? 26 GLU A HG2  1  
ATOM 424   H HG3  . GLU A 1 25 ? -4.255  -25.853 -15.381 1.00 0.00 ? 26 GLU A HG3  1  
ATOM 425   N N    . ASN A 1 26 ? -8.162  -24.591 -12.333 1.00 0.00 ? 27 ASN A N    1  
ATOM 426   C CA   . ASN A 1 26 ? -9.131  -24.670 -11.203 1.00 0.00 ? 27 ASN A CA   1  
ATOM 427   C C    . ASN A 1 26 ? -10.559 -24.582 -11.742 1.00 0.00 ? 27 ASN A C    1  
ATOM 428   O O    . ASN A 1 26 ? -10.798 -23.996 -12.779 1.00 0.00 ? 27 ASN A O    1  
ATOM 429   C CB   . ASN A 1 26 ? -8.883  -23.515 -10.234 1.00 0.00 ? 27 ASN A CB   1  
ATOM 430   C CG   . ASN A 1 26 ? -7.509  -23.679 -9.586  1.00 0.00 ? 27 ASN A CG   1  
ATOM 431   O OD1  . ASN A 1 26 ? -7.061  -24.785 -9.354  1.00 0.00 ? 27 ASN A OD1  1  
ATOM 432   N ND2  . ASN A 1 26 ? -6.816  -22.617 -9.283  1.00 0.00 ? 27 ASN A ND2  1  
ATOM 433   H H    . ASN A 1 26 ? -7.827  -23.719 -12.631 1.00 0.00 ? 27 ASN A H    1  
ATOM 434   H HA   . ASN A 1 26 ? -9.007  -25.609 -10.682 1.00 0.00 ? 27 ASN A HA   1  
ATOM 435   H HB2  . ASN A 1 26 ? -8.920  -22.580 -10.773 1.00 0.00 ? 27 ASN A HB2  1  
ATOM 436   H HB3  . ASN A 1 26 ? -9.644  -23.520 -9.467  1.00 0.00 ? 27 ASN A HB3  1  
ATOM 437   H HD21 . ASN A 1 26 ? -7.179  -21.727 -9.469  1.00 0.00 ? 27 ASN A HD21 1  
ATOM 438   H HD22 . ASN A 1 26 ? -5.932  -22.710 -8.869  1.00 0.00 ? 27 ASN A HD22 1  
ATOM 439   N N    . PRO A 1 27 ? -11.467 -25.170 -11.009 1.00 0.00 ? 28 PRO A N    1  
ATOM 440   C CA   . PRO A 1 27 ? -12.893 -25.187 -11.365 1.00 0.00 ? 28 PRO A CA   1  
ATOM 441   C C    . PRO A 1 27 ? -13.548 -23.848 -11.028 1.00 0.00 ? 28 PRO A C    1  
ATOM 442   O O    . PRO A 1 27 ? -14.323 -23.751 -10.097 1.00 0.00 ? 28 PRO A O    1  
ATOM 443   C CB   . PRO A 1 27 ? -13.470 -26.296 -10.503 1.00 0.00 ? 28 PRO A CB   1  
ATOM 444   C CG   . PRO A 1 27 ? -12.502 -26.476 -9.327  1.00 0.00 ? 28 PRO A CG   1  
ATOM 445   C CD   . PRO A 1 27 ? -11.155 -25.875 -9.756  1.00 0.00 ? 28 PRO A CD   1  
ATOM 446   H HA   . PRO A 1 27 ? -13.020 -25.434 -12.388 1.00 0.00 ? 28 PRO A HA   1  
ATOM 447   H HB2  . PRO A 1 27 ? -14.446 -26.008 -10.139 1.00 0.00 ? 28 PRO A HB2  1  
ATOM 448   H HB3  . PRO A 1 27 ? -13.531 -27.212 -11.066 1.00 0.00 ? 28 PRO A HB3  1  
ATOM 449   H HG2  . PRO A 1 27 ? -12.882 -25.958 -8.468  1.00 0.00 ? 28 PRO A HG2  1  
ATOM 450   H HG3  . PRO A 1 27 ? -12.382 -27.520 -9.118  1.00 0.00 ? 28 PRO A HG3  1  
ATOM 451   H HD2  . PRO A 1 27 ? -10.795 -25.183 -9.006  1.00 0.00 ? 28 PRO A HD2  1  
ATOM 452   H HD3  . PRO A 1 27 ? -10.431 -26.654 -9.936  1.00 0.00 ? 28 PRO A HD3  1  
ATOM 453   N N    . GLY A 1 28 ? -13.240 -22.813 -11.762 1.00 0.00 ? 29 GLY A N    1  
ATOM 454   C CA   . GLY A 1 28 ? -13.847 -21.488 -11.449 1.00 0.00 ? 29 GLY A CA   1  
ATOM 455   C C    . GLY A 1 28 ? -13.743 -21.271 -9.943  1.00 0.00 ? 29 GLY A C    1  
ATOM 456   O O    . GLY A 1 28 ? -14.563 -20.612 -9.335  1.00 0.00 ? 29 GLY A O    1  
ATOM 457   H H    . GLY A 1 28 ? -12.605 -22.904 -12.504 1.00 0.00 ? 29 GLY A H    1  
ATOM 458   H HA2  . GLY A 1 28 ? -13.311 -20.708 -11.972 1.00 0.00 ? 29 GLY A HA2  1  
ATOM 459   H HA3  . GLY A 1 28 ? -14.884 -21.483 -11.743 1.00 0.00 ? 29 GLY A HA3  1  
ATOM 460   N N    . ILE A 1 29 ? -12.737 -21.850 -9.344  1.00 0.00 ? 30 ILE A N    1  
ATOM 461   C CA   . ILE A 1 29 ? -12.539 -21.727 -7.879  1.00 0.00 ? 30 ILE A CA   1  
ATOM 462   C C    . ILE A 1 29 ? -12.940 -20.330 -7.395  1.00 0.00 ? 30 ILE A C    1  
ATOM 463   O O    . ILE A 1 29 ? -12.815 -19.356 -8.109  1.00 0.00 ? 30 ILE A O    1  
ATOM 464   C CB   . ILE A 1 29 ? -11.075 -21.989 -7.578  1.00 0.00 ? 30 ILE A CB   1  
ATOM 465   C CG1  . ILE A 1 29 ? -10.829 -21.939 -6.071  1.00 0.00 ? 30 ILE A CG1  1  
ATOM 466   C CG2  . ILE A 1 29 ? -10.253 -20.921 -8.269  1.00 0.00 ? 30 ILE A CG2  1  
ATOM 467   C CD1  . ILE A 1 29 ? -9.398  -22.395 -5.780  1.00 0.00 ? 30 ILE A CD1  1  
ATOM 468   H H    . ILE A 1 29 ? -12.102 -22.384 -9.868  1.00 0.00 ? 30 ILE A H    1  
ATOM 469   H HA   . ILE A 1 29 ? -13.131 -22.462 -7.383  1.00 0.00 ? 30 ILE A HA   1  
ATOM 470   H HB   . ILE A 1 29 ? -10.800 -22.959 -7.966  1.00 0.00 ? 30 ILE A HB   1  
ATOM 471   H HG12 . ILE A 1 29 ? -10.967 -20.929 -5.716  1.00 0.00 ? 30 ILE A HG12 1  
ATOM 472   H HG13 . ILE A 1 29 ? -11.523 -22.597 -5.570  1.00 0.00 ? 30 ILE A HG13 1  
ATOM 473   H HG21 . ILE A 1 29 ? -10.849 -20.031 -8.359  1.00 0.00 ? 30 ILE A HG21 1  
ATOM 474   H HG22 . ILE A 1 29 ? -9.368  -20.715 -7.690  1.00 0.00 ? 30 ILE A HG22 1  
ATOM 475   H HG23 . ILE A 1 29 ? -9.976  -21.268 -9.251  1.00 0.00 ? 30 ILE A HG23 1  
ATOM 476   H HD11 . ILE A 1 29 ? -9.117  -23.169 -6.482  1.00 0.00 ? 30 ILE A HD11 1  
ATOM 477   H HD12 . ILE A 1 29 ? -8.726  -21.557 -5.882  1.00 0.00 ? 30 ILE A HD12 1  
ATOM 478   H HD13 . ILE A 1 29 ? -9.341  -22.784 -4.774  1.00 0.00 ? 30 ILE A HD13 1  
ATOM 479   N N    . LYS A 1 30 ? -13.428 -20.228 -6.189  1.00 0.00 ? 31 LYS A N    1  
ATOM 480   C CA   . LYS A 1 30 ? -13.841 -18.903 -5.660  1.00 0.00 ? 31 LYS A CA   1  
ATOM 481   C C    . LYS A 1 30 ? -12.605 -18.044 -5.395  1.00 0.00 ? 31 LYS A C    1  
ATOM 482   O O    . LYS A 1 30 ? -11.496 -18.537 -5.324  1.00 0.00 ? 31 LYS A O    1  
ATOM 483   C CB   . LYS A 1 30 ? -14.614 -19.102 -4.361  1.00 0.00 ? 31 LYS A CB   1  
ATOM 484   C CG   . LYS A 1 30 ? -15.610 -20.251 -4.528  1.00 0.00 ? 31 LYS A CG   1  
ATOM 485   C CD   . LYS A 1 30 ? -15.198 -21.419 -3.633  1.00 0.00 ? 31 LYS A CD   1  
ATOM 486   C CE   . LYS A 1 30 ? -14.927 -22.652 -4.495  1.00 0.00 ? 31 LYS A CE   1  
ATOM 487   N NZ   . LYS A 1 30 ? -15.578 -23.841 -3.877  1.00 0.00 ? 31 LYS A NZ   1  
ATOM 488   H H    . LYS A 1 30 ? -13.528 -21.026 -5.629  1.00 0.00 ? 31 LYS A H    1  
ATOM 489   H HA   . LYS A 1 30 ? -14.474 -18.411 -6.377  1.00 0.00 ? 31 LYS A HA   1  
ATOM 490   H HB2  . LYS A 1 30 ? -13.923 -19.335 -3.570  1.00 0.00 ? 31 LYS A HB2  1  
ATOM 491   H HB3  . LYS A 1 30 ? -15.146 -18.201 -4.118  1.00 0.00 ? 31 LYS A HB3  1  
ATOM 492   H HG2  . LYS A 1 30 ? -16.598 -19.913 -4.248  1.00 0.00 ? 31 LYS A HG2  1  
ATOM 493   H HG3  . LYS A 1 30 ? -15.619 -20.573 -5.558  1.00 0.00 ? 31 LYS A HG3  1  
ATOM 494   H HD2  . LYS A 1 30 ? -14.302 -21.157 -3.088  1.00 0.00 ? 31 LYS A HD2  1  
ATOM 495   H HD3  . LYS A 1 30 ? -15.993 -21.638 -2.935  1.00 0.00 ? 31 LYS A HD3  1  
ATOM 496   H HE2  . LYS A 1 30 ? -15.330 -22.494 -5.486  1.00 0.00 ? 31 LYS A HE2  1  
ATOM 497   H HE3  . LYS A 1 30 ? -13.862 -22.819 -4.562  1.00 0.00 ? 31 LYS A HE3  1  
ATOM 498   H HZ1  . LYS A 1 30 ? -15.820 -23.629 -2.889  1.00 0.00 ? 31 LYS A HZ1  1  
ATOM 499   H HZ2  . LYS A 1 30 ? -16.443 -24.076 -4.405  1.00 0.00 ? 31 LYS A HZ2  1  
ATOM 500   H HZ3  . LYS A 1 30 ? -14.924 -24.649 -3.906  1.00 0.00 ? 31 LYS A HZ3  1  
ATOM 501   N N    . VAL A 1 31 ? -12.786 -16.761 -5.251  1.00 0.00 ? 32 VAL A N    1  
ATOM 502   C CA   . VAL A 1 31 ? -11.636 -15.866 -4.994  1.00 0.00 ? 32 VAL A CA   1  
ATOM 503   C C    . VAL A 1 31 ? -11.062 -16.160 -3.602  1.00 0.00 ? 32 VAL A C    1  
ATOM 504   O O    . VAL A 1 31 ? -9.906  -15.900 -3.330  1.00 0.00 ? 32 VAL A O    1  
ATOM 505   C CB   . VAL A 1 31 ? -12.097 -14.404 -5.102  1.00 0.00 ? 32 VAL A CB   1  
ATOM 506   C CG1  . VAL A 1 31 ? -13.552 -14.293 -4.689  1.00 0.00 ? 32 VAL A CG1  1  
ATOM 507   C CG2  . VAL A 1 31 ? -11.263 -13.522 -4.189  1.00 0.00 ? 32 VAL A CG2  1  
ATOM 508   H H    . VAL A 1 31 ? -13.679 -16.384 -5.312  1.00 0.00 ? 32 VAL A H    1  
ATOM 509   H HA   . VAL A 1 31 ? -10.888 -16.047 -5.733  1.00 0.00 ? 32 VAL A HA   1  
ATOM 510   H HB   . VAL A 1 31 ? -11.992 -14.073 -6.123  1.00 0.00 ? 32 VAL A HB   1  
ATOM 511   H HG11 . VAL A 1 31 ? -13.743 -15.000 -3.898  1.00 0.00 ? 32 VAL A HG11 1  
ATOM 512   H HG12 . VAL A 1 31 ? -13.757 -13.293 -4.342  1.00 0.00 ? 32 VAL A HG12 1  
ATOM 513   H HG13 . VAL A 1 31 ? -14.176 -14.523 -5.535  1.00 0.00 ? 32 VAL A HG13 1  
ATOM 514   H HG21 . VAL A 1 31 ? -10.268 -13.931 -4.110  1.00 0.00 ? 32 VAL A HG21 1  
ATOM 515   H HG22 . VAL A 1 31 ? -11.219 -12.524 -4.593  1.00 0.00 ? 32 VAL A HG22 1  
ATOM 516   H HG23 . VAL A 1 31 ? -11.722 -13.499 -3.214  1.00 0.00 ? 32 VAL A HG23 1  
ATOM 517   N N    . THR A 1 32 ? -11.857 -16.699 -2.719  1.00 0.00 ? 33 THR A N    1  
ATOM 518   C CA   . THR A 1 32 ? -11.352 -17.006 -1.352  1.00 0.00 ? 33 THR A CA   1  
ATOM 519   C C    . THR A 1 32 ? -10.479 -18.262 -1.398  1.00 0.00 ? 33 THR A C    1  
ATOM 520   O O    . THR A 1 32 ? -9.506  -18.381 -0.679  1.00 0.00 ? 33 THR A O    1  
ATOM 521   C CB   . THR A 1 32 ? -12.533 -17.238 -0.408  1.00 0.00 ? 33 THR A CB   1  
ATOM 522   O OG1  . THR A 1 32 ? -13.222 -18.419 -0.794  1.00 0.00 ? 33 THR A OG1  1  
ATOM 523   C CG2  . THR A 1 32 ? -13.484 -16.042 -0.478  1.00 0.00 ? 33 THR A CG2  1  
ATOM 524   H H    . THR A 1 32 ? -12.788 -16.902 -2.955  1.00 0.00 ? 33 THR A H    1  
ATOM 525   H HA   . THR A 1 32 ? -10.764 -16.174 -0.992  1.00 0.00 ? 33 THR A HA   1  
ATOM 526   H HB   . THR A 1 32 ? -12.172 -17.345 0.603   1.00 0.00 ? 33 THR A HB   1  
ATOM 527   H HG1  . THR A 1 32 ? -12.776 -19.167 -0.392  1.00 0.00 ? 33 THR A HG1  1  
ATOM 528   H HG21 . THR A 1 32 ? -12.997 -15.228 -0.997  1.00 0.00 ? 33 THR A HG21 1  
ATOM 529   H HG22 . THR A 1 32 ? -14.379 -16.324 -1.010  1.00 0.00 ? 33 THR A HG22 1  
ATOM 530   H HG23 . THR A 1 32 ? -13.741 -15.728 0.521   1.00 0.00 ? 33 THR A HG23 1  
ATOM 531   N N    . GLU A 1 33 ? -10.817 -19.200 -2.240  1.00 0.00 ? 34 GLU A N    1  
ATOM 532   C CA   . GLU A 1 33 ? -10.005 -20.446 -2.331  1.00 0.00 ? 34 GLU A CA   1  
ATOM 533   C C    . GLU A 1 33 ? -8.897  -20.261 -3.370  1.00 0.00 ? 34 GLU A C    1  
ATOM 534   O O    . GLU A 1 33 ? -8.028  -21.097 -3.520  1.00 0.00 ? 34 GLU A O    1  
ATOM 535   C CB   . GLU A 1 33 ? -10.905 -21.610 -2.750  1.00 0.00 ? 34 GLU A CB   1  
ATOM 536   C CG   . GLU A 1 33 ? -11.952 -21.864 -1.663  1.00 0.00 ? 34 GLU A CG   1  
ATOM 537   C CD   . GLU A 1 33 ? -12.862 -23.017 -2.090  1.00 0.00 ? 34 GLU A CD   1  
ATOM 538   O OE1  . GLU A 1 33 ? -12.436 -23.806 -2.919  1.00 0.00 ? 34 GLU A OE1  1  
ATOM 539   O OE2  . GLU A 1 33 ? -13.968 -23.093 -1.583  1.00 0.00 ? 34 GLU A OE2  1  
ATOM 540   H H    . GLU A 1 33 ? -11.606 -19.086 -2.811  1.00 0.00 ? 34 GLU A H    1  
ATOM 541   H HA   . GLU A 1 33 ? -9.565  -20.660 -1.369  1.00 0.00 ? 34 GLU A HA   1  
ATOM 542   H HB2  . GLU A 1 33 ? -11.400 -21.367 -3.678  1.00 0.00 ? 34 GLU A HB2  1  
ATOM 543   H HB3  . GLU A 1 33 ? -10.306 -22.498 -2.883  1.00 0.00 ? 34 GLU A HB3  1  
ATOM 544   H HG2  . GLU A 1 33 ? -11.456 -22.120 -0.738  1.00 0.00 ? 34 GLU A HG2  1  
ATOM 545   H HG3  . GLU A 1 33 ? -12.545 -20.974 -1.519  1.00 0.00 ? 34 GLU A HG3  1  
ATOM 546   N N    . VAL A 1 34 ? -8.920  -19.174 -4.090  1.00 0.00 ? 35 VAL A N    1  
ATOM 547   C CA   . VAL A 1 34 ? -7.867  -18.938 -5.118  1.00 0.00 ? 35 VAL A CA   1  
ATOM 548   C C    . VAL A 1 34 ? -6.560  -18.539 -4.427  1.00 0.00 ? 35 VAL A C    1  
ATOM 549   O O    . VAL A 1 34 ? -5.481  -18.809 -4.916  1.00 0.00 ? 35 VAL A O    1  
ATOM 550   C CB   . VAL A 1 34 ? -8.325  -17.823 -6.057  1.00 0.00 ? 35 VAL A CB   1  
ATOM 551   C CG1  . VAL A 1 34 ? -7.132  -17.276 -6.846  1.00 0.00 ? 35 VAL A CG1  1  
ATOM 552   C CG2  . VAL A 1 34 ? -9.365  -18.380 -7.031  1.00 0.00 ? 35 VAL A CG2  1  
ATOM 553   H H    . VAL A 1 34 ? -9.629  -18.511 -3.955  1.00 0.00 ? 35 VAL A H    1  
ATOM 554   H HA   . VAL A 1 34 ? -7.714  -19.839 -5.684  1.00 0.00 ? 35 VAL A HA   1  
ATOM 555   H HB   . VAL A 1 34 ? -8.765  -17.031 -5.477  1.00 0.00 ? 35 VAL A HB   1  
ATOM 556   H HG11 . VAL A 1 34 ? -6.525  -18.097 -7.197  1.00 0.00 ? 35 VAL A HG11 1  
ATOM 557   H HG12 . VAL A 1 34 ? -7.490  -16.706 -7.691  1.00 0.00 ? 35 VAL A HG12 1  
ATOM 558   H HG13 . VAL A 1 34 ? -6.540  -16.637 -6.206  1.00 0.00 ? 35 VAL A HG13 1  
ATOM 559   H HG21 . VAL A 1 34 ? -9.845  -19.242 -6.592  1.00 0.00 ? 35 VAL A HG21 1  
ATOM 560   H HG22 . VAL A 1 34 ? -10.107 -17.623 -7.239  1.00 0.00 ? 35 VAL A HG22 1  
ATOM 561   H HG23 . VAL A 1 34 ? -8.879  -18.668 -7.951  1.00 0.00 ? 35 VAL A HG23 1  
ATOM 562   N N    . ALA A 1 35 ? -6.650  -17.897 -3.297  1.00 0.00 ? 36 ALA A N    1  
ATOM 563   C CA   . ALA A 1 35 ? -5.415  -17.480 -2.577  1.00 0.00 ? 36 ALA A CA   1  
ATOM 564   C C    . ALA A 1 35 ? -4.844  -18.667 -1.798  1.00 0.00 ? 36 ALA A C    1  
ATOM 565   O O    . ALA A 1 35 ? -3.646  -18.823 -1.678  1.00 0.00 ? 36 ALA A O    1  
ATOM 566   C CB   . ALA A 1 35 ? -5.749  -16.345 -1.607  1.00 0.00 ? 36 ALA A CB   1  
ATOM 567   H H    . ALA A 1 35 ? -7.529  -17.688 -2.920  1.00 0.00 ? 36 ALA A H    1  
ATOM 568   H HA   . ALA A 1 35 ? -4.684  -17.135 -3.293  1.00 0.00 ? 36 ALA A HA   1  
ATOM 569   H HB1  . ALA A 1 35 ? -6.378  -15.622 -2.104  1.00 0.00 ? 36 ALA A HB1  1  
ATOM 570   H HB2  . ALA A 1 35 ? -6.270  -16.747 -0.750  1.00 0.00 ? 36 ALA A HB2  1  
ATOM 571   H HB3  . ALA A 1 35 ? -4.837  -15.867 -1.283  1.00 0.00 ? 36 ALA A HB3  1  
ATOM 572   N N    . LYS A 1 36 ? -5.691  -19.507 -1.266  1.00 0.00 ? 37 LYS A N    1  
ATOM 573   C CA   . LYS A 1 36 ? -5.193  -20.677 -0.499  1.00 0.00 ? 37 LYS A CA   1  
ATOM 574   C C    . LYS A 1 36 ? -4.336  -21.554 -1.414  1.00 0.00 ? 37 LYS A C    1  
ATOM 575   O O    . LYS A 1 36 ? -3.306  -22.065 -1.018  1.00 0.00 ? 37 LYS A O    1  
ATOM 576   C CB   . LYS A 1 36 ? -6.393  -21.458 0.030   1.00 0.00 ? 37 LYS A CB   1  
ATOM 577   C CG   . LYS A 1 36 ? -6.030  -22.931 0.254   1.00 0.00 ? 37 LYS A CG   1  
ATOM 578   C CD   . LYS A 1 36 ? -6.926  -23.520 1.345   1.00 0.00 ? 37 LYS A CD   1  
ATOM 579   C CE   . LYS A 1 36 ? -6.149  -24.575 2.134   1.00 0.00 ? 37 LYS A CE   1  
ATOM 580   N NZ   . LYS A 1 36 ? -6.609  -24.575 3.551   1.00 0.00 ? 37 LYS A NZ   1  
ATOM 581   H H    . LYS A 1 36 ? -6.655  -19.369 -1.373  1.00 0.00 ? 37 LYS A H    1  
ATOM 582   H HA   . LYS A 1 36 ? -4.605  -20.336 0.333   1.00 0.00 ? 37 LYS A HA   1  
ATOM 583   H HB2  . LYS A 1 36 ? -6.696  -21.019 0.966   1.00 0.00 ? 37 LYS A HB2  1  
ATOM 584   H HB3  . LYS A 1 36 ? -7.203  -21.386 -0.680  1.00 0.00 ? 37 LYS A HB3  1  
ATOM 585   H HG2  . LYS A 1 36 ? -6.172  -23.481 -0.666  1.00 0.00 ? 37 LYS A HG2  1  
ATOM 586   H HG3  . LYS A 1 36 ? -4.997  -23.005 0.561   1.00 0.00 ? 37 LYS A HG3  1  
ATOM 587   H HD2  . LYS A 1 36 ? -7.244  -22.731 2.012   1.00 0.00 ? 37 LYS A HD2  1  
ATOM 588   H HD3  . LYS A 1 36 ? -7.793  -23.978 0.892   1.00 0.00 ? 37 LYS A HD3  1  
ATOM 589   H HE2  . LYS A 1 36 ? -6.320  -25.548 1.699   1.00 0.00 ? 37 LYS A HE2  1  
ATOM 590   H HE3  . LYS A 1 36 ? -5.094  -24.346 2.099   1.00 0.00 ? 37 LYS A HE3  1  
ATOM 591   H HZ1  . LYS A 1 36 ? -6.744  -23.594 3.870   1.00 0.00 ? 37 LYS A HZ1  1  
ATOM 592   H HZ2  . LYS A 1 36 ? -7.510  -25.090 3.623   1.00 0.00 ? 37 LYS A HZ2  1  
ATOM 593   H HZ3  . LYS A 1 36 ? -5.898  -25.041 4.148   1.00 0.00 ? 37 LYS A HZ3  1  
ATOM 594   N N    . ARG A 1 37 ? -4.755  -21.730 -2.634  1.00 0.00 ? 38 ARG A N    1  
ATOM 595   C CA   . ARG A 1 37 ? -3.975  -22.569 -3.580  1.00 0.00 ? 38 ARG A CA   1  
ATOM 596   C C    . ARG A 1 37 ? -2.844  -21.735 -4.189  1.00 0.00 ? 38 ARG A C    1  
ATOM 597   O O    . ARG A 1 37 ? -1.766  -22.229 -4.444  1.00 0.00 ? 38 ARG A O    1  
ATOM 598   C CB   . ARG A 1 37 ? -4.907  -23.059 -4.689  1.00 0.00 ? 38 ARG A CB   1  
ATOM 599   C CG   . ARG A 1 37 ? -4.803  -24.582 -4.822  1.00 0.00 ? 38 ARG A CG   1  
ATOM 600   C CD   . ARG A 1 37 ? -4.943  -25.235 -3.444  1.00 0.00 ? 38 ARG A CD   1  
ATOM 601   N NE   . ARG A 1 37 ? -5.640  -26.546 -3.583  1.00 0.00 ? 38 ARG A NE   1  
ATOM 602   C CZ   . ARG A 1 37 ? -6.071  -27.173 -2.522  1.00 0.00 ? 38 ARG A CZ   1  
ATOM 603   N NH1  . ARG A 1 37 ? -5.220  -27.725 -1.700  1.00 0.00 ? 38 ARG A NH1  1  
ATOM 604   N NH2  . ARG A 1 37 ? -7.351  -27.250 -2.283  1.00 0.00 ? 38 ARG A NH2  1  
ATOM 605   H H    . ARG A 1 37 ? -5.588  -21.310 -2.929  1.00 0.00 ? 38 ARG A H    1  
ATOM 606   H HA   . ARG A 1 37 ? -3.559  -23.413 -3.056  1.00 0.00 ? 38 ARG A HA   1  
ATOM 607   H HB2  . ARG A 1 37 ? -5.923  -22.785 -4.442  1.00 0.00 ? 38 ARG A HB2  1  
ATOM 608   H HB3  . ARG A 1 37 ? -4.627  -22.598 -5.624  1.00 0.00 ? 38 ARG A HB3  1  
ATOM 609   H HG2  . ARG A 1 37 ? -5.590  -24.939 -5.470  1.00 0.00 ? 38 ARG A HG2  1  
ATOM 610   H HG3  . ARG A 1 37 ? -3.844  -24.841 -5.246  1.00 0.00 ? 38 ARG A HG3  1  
ATOM 611   H HD2  . ARG A 1 37 ? -3.962  -25.394 -3.020  1.00 0.00 ? 38 ARG A HD2  1  
ATOM 612   H HD3  . ARG A 1 37 ? -5.515  -24.590 -2.795  1.00 0.00 ? 38 ARG A HD3  1  
ATOM 613   H HE   . ARG A 1 37 ? -5.774  -26.938 -4.472  1.00 0.00 ? 38 ARG A HE   1  
ATOM 614   H HH11 . ARG A 1 37 ? -4.238  -27.666 -1.883  1.00 0.00 ? 38 ARG A HH11 1  
ATOM 615   H HH12 . ARG A 1 37 ? -5.550  -28.206 -0.888  1.00 0.00 ? 38 ARG A HH12 1  
ATOM 616   H HH21 . ARG A 1 37 ? -8.004  -26.827 -2.911  1.00 0.00 ? 38 ARG A HH21 1  
ATOM 617   H HH22 . ARG A 1 37 ? -7.680  -27.732 -1.469  1.00 0.00 ? 38 ARG A HH22 1  
ATOM 618   N N    . GLY A 1 38 ? -3.079  -20.474 -4.422  1.00 0.00 ? 39 GLY A N    1  
ATOM 619   C CA   . GLY A 1 38 ? -2.011  -19.617 -5.015  1.00 0.00 ? 39 GLY A CA   1  
ATOM 620   C C    . GLY A 1 38 ? -0.801  -19.572 -4.077  1.00 0.00 ? 39 GLY A C    1  
ATOM 621   O O    . GLY A 1 38 ? 0.306   -19.287 -4.491  1.00 0.00 ? 39 GLY A O    1  
ATOM 622   H H    . GLY A 1 38 ? -3.954  -20.090 -4.211  1.00 0.00 ? 39 GLY A H    1  
ATOM 623   H HA2  . GLY A 1 38 ? -1.712  -20.025 -5.970  1.00 0.00 ? 39 GLY A HA2  1  
ATOM 624   H HA3  . GLY A 1 38 ? -2.390  -18.616 -5.154  1.00 0.00 ? 39 GLY A HA3  1  
ATOM 625   N N    . GLY A 1 39 ? -1.000  -19.848 -2.818  1.00 0.00 ? 40 GLY A N    1  
ATOM 626   C CA   . GLY A 1 39 ? 0.141   -19.814 -1.857  1.00 0.00 ? 40 GLY A CA   1  
ATOM 627   C C    . GLY A 1 39 ? 0.995   -21.074 -2.016  1.00 0.00 ? 40 GLY A C    1  
ATOM 628   O O    . GLY A 1 39 ? 2.166   -21.084 -1.690  1.00 0.00 ? 40 GLY A O    1  
ATOM 629   H H    . GLY A 1 39 ? -1.901  -20.072 -2.501  1.00 0.00 ? 40 GLY A H    1  
ATOM 630   H HA2  . GLY A 1 39 ? 0.747   -18.941 -2.053  1.00 0.00 ? 40 GLY A HA2  1  
ATOM 631   H HA3  . GLY A 1 39 ? -0.241  -19.767 -0.848  1.00 0.00 ? 40 GLY A HA3  1  
ATOM 632   N N    . GLU A 1 40 ? 0.425   -22.141 -2.510  1.00 0.00 ? 41 GLU A N    1  
ATOM 633   C CA   . GLU A 1 40 ? 1.214   -23.393 -2.681  1.00 0.00 ? 41 GLU A CA   1  
ATOM 634   C C    . GLU A 1 40 ? 2.155   -23.248 -3.883  1.00 0.00 ? 41 GLU A C    1  
ATOM 635   O O    . GLU A 1 40 ? 3.338   -23.515 -3.795  1.00 0.00 ? 41 GLU A O    1  
ATOM 636   C CB   . GLU A 1 40 ? 0.263   -24.580 -2.877  1.00 0.00 ? 41 GLU A CB   1  
ATOM 637   C CG   . GLU A 1 40 ? -0.069  -24.780 -4.361  1.00 0.00 ? 41 GLU A CG   1  
ATOM 638   C CD   . GLU A 1 40 ? -0.928  -26.035 -4.527  1.00 0.00 ? 41 GLU A CD   1  
ATOM 639   O OE1  . GLU A 1 40 ? -0.361  -27.114 -4.578  1.00 0.00 ? 41 GLU A OE1  1  
ATOM 640   O OE2  . GLU A 1 40 ? -2.137  -25.895 -4.601  1.00 0.00 ? 41 GLU A OE2  1  
ATOM 641   H H    . GLU A 1 40 ? -0.521  -22.117 -2.766  1.00 0.00 ? 41 GLU A H    1  
ATOM 642   H HA   . GLU A 1 40 ? 1.803   -23.564 -1.793  1.00 0.00 ? 41 GLU A HA   1  
ATOM 643   H HB2  . GLU A 1 40 ? 0.734   -25.471 -2.493  1.00 0.00 ? 41 GLU A HB2  1  
ATOM 644   H HB3  . GLU A 1 40 ? -0.648  -24.397 -2.329  1.00 0.00 ? 41 GLU A HB3  1  
ATOM 645   H HG2  . GLU A 1 40 ? -0.610  -23.921 -4.729  1.00 0.00 ? 41 GLU A HG2  1  
ATOM 646   H HG3  . GLU A 1 40 ? 0.846   -24.896 -4.922  1.00 0.00 ? 41 GLU A HG3  1  
ATOM 647   N N    . LEU A 1 41 ? 1.638   -22.822 -5.003  1.00 0.00 ? 42 LEU A N    1  
ATOM 648   C CA   . LEU A 1 41 ? 2.499   -22.655 -6.206  1.00 0.00 ? 42 LEU A CA   1  
ATOM 649   C C    . LEU A 1 41 ? 3.492   -21.517 -5.962  1.00 0.00 ? 42 LEU A C    1  
ATOM 650   O O    . LEU A 1 41 ? 4.637   -21.579 -6.363  1.00 0.00 ? 42 LEU A O    1  
ATOM 651   C CB   . LEU A 1 41 ? 1.620   -22.316 -7.411  1.00 0.00 ? 42 LEU A CB   1  
ATOM 652   C CG   . LEU A 1 41 ? 1.093   -23.607 -8.040  1.00 0.00 ? 42 LEU A CG   1  
ATOM 653   C CD1  . LEU A 1 41 ? 0.009   -23.269 -9.065  1.00 0.00 ? 42 LEU A CD1  1  
ATOM 654   C CD2  . LEU A 1 41 ? 2.241   -24.341 -8.736  1.00 0.00 ? 42 LEU A CD2  1  
ATOM 655   H H    . LEU A 1 41 ? 0.685   -22.608 -5.053  1.00 0.00 ? 42 LEU A H    1  
ATOM 656   H HA   . LEU A 1 41 ? 3.038   -23.570 -6.398  1.00 0.00 ? 42 LEU A HA   1  
ATOM 657   H HB2  . LEU A 1 41 ? 0.789   -21.706 -7.087  1.00 0.00 ? 42 LEU A HB2  1  
ATOM 658   H HB3  . LEU A 1 41 ? 2.202   -21.775 -8.138  1.00 0.00 ? 42 LEU A HB3  1  
ATOM 659   H HG   . LEU A 1 41 ? 0.674   -24.237 -7.268  1.00 0.00 ? 42 LEU A HG   1  
ATOM 660   H HD11 . LEU A 1 41 ? 0.311   -22.403 -9.635  1.00 0.00 ? 42 LEU A HD11 1  
ATOM 661   H HD12 . LEU A 1 41 ? -0.131  -24.108 -9.730  1.00 0.00 ? 42 LEU A HD12 1  
ATOM 662   H HD13 . LEU A 1 41 ? -0.917  -23.057 -8.552  1.00 0.00 ? 42 LEU A HD13 1  
ATOM 663   H HD21 . LEU A 1 41 ? 3.069   -24.449 -8.051  1.00 0.00 ? 42 LEU A HD21 1  
ATOM 664   H HD22 . LEU A 1 41 ? 1.905   -25.318 -9.051  1.00 0.00 ? 42 LEU A HD22 1  
ATOM 665   H HD23 . LEU A 1 41 ? 2.560   -23.776 -9.600  1.00 0.00 ? 42 LEU A HD23 1  
ATOM 666   N N    . TRP A 1 42 ? 3.059   -20.477 -5.305  1.00 0.00 ? 43 TRP A N    1  
ATOM 667   C CA   . TRP A 1 42 ? 3.969   -19.331 -5.027  1.00 0.00 ? 43 TRP A CA   1  
ATOM 668   C C    . TRP A 1 42 ? 5.251   -19.842 -4.363  1.00 0.00 ? 43 TRP A C    1  
ATOM 669   O O    . TRP A 1 42 ? 6.346   -19.500 -4.762  1.00 0.00 ? 43 TRP A O    1  
ATOM 670   C CB   . TRP A 1 42 ? 3.263   -18.347 -4.088  1.00 0.00 ? 43 TRP A CB   1  
ATOM 671   C CG   . TRP A 1 42 ? 4.262   -17.404 -3.494  1.00 0.00 ? 43 TRP A CG   1  
ATOM 672   C CD1  . TRP A 1 42 ? 4.802   -17.520 -2.261  1.00 0.00 ? 43 TRP A CD1  1  
ATOM 673   C CD2  . TRP A 1 42 ? 4.853   -16.215 -4.089  1.00 0.00 ? 43 TRP A CD2  1  
ATOM 674   N NE1  . TRP A 1 42 ? 5.682   -16.473 -2.057  1.00 0.00 ? 43 TRP A NE1  1  
ATOM 675   C CE2  . TRP A 1 42 ? 5.749   -15.640 -3.157  1.00 0.00 ? 43 TRP A CE2  1  
ATOM 676   C CE3  . TRP A 1 42 ? 4.697   -15.585 -5.335  1.00 0.00 ? 43 TRP A CE3  1  
ATOM 677   C CZ2  . TRP A 1 42 ? 6.464   -14.479 -3.452  1.00 0.00 ? 43 TRP A CZ2  1  
ATOM 678   C CZ3  . TRP A 1 42 ? 5.414   -14.418 -5.635  1.00 0.00 ? 43 TRP A CZ3  1  
ATOM 679   C CH2  . TRP A 1 42 ? 6.297   -13.866 -4.697  1.00 0.00 ? 43 TRP A CH2  1  
ATOM 680   H H    . TRP A 1 42 ? 2.130   -20.451 -4.991  1.00 0.00 ? 43 TRP A H    1  
ATOM 681   H HA   . TRP A 1 42 ? 4.216   -18.830 -5.953  1.00 0.00 ? 43 TRP A HA   1  
ATOM 682   H HB2  . TRP A 1 42 ? 2.527   -17.785 -4.645  1.00 0.00 ? 43 TRP A HB2  1  
ATOM 683   H HB3  . TRP A 1 42 ? 2.772   -18.894 -3.297  1.00 0.00 ? 43 TRP A HB3  1  
ATOM 684   H HD1  . TRP A 1 42 ? 4.580   -18.303 -1.550  1.00 0.00 ? 43 TRP A HD1  1  
ATOM 685   H HE1  . TRP A 1 42 ? 6.204   -16.322 -1.240  1.00 0.00 ? 43 TRP A HE1  1  
ATOM 686   H HE3  . TRP A 1 42 ? 4.021   -16.002 -6.066  1.00 0.00 ? 43 TRP A HE3  1  
ATOM 687   H HZ2  . TRP A 1 42 ? 7.142   -14.057 -2.724  1.00 0.00 ? 43 TRP A HZ2  1  
ATOM 688   H HZ3  . TRP A 1 42 ? 5.285   -13.944 -6.596  1.00 0.00 ? 43 TRP A HZ3  1  
ATOM 689   H HH2  . TRP A 1 42 ? 6.846   -12.966 -4.934  1.00 0.00 ? 43 TRP A HH2  1  
ATOM 690   N N    . ARG A 1 43 ? 5.122   -20.648 -3.343  1.00 0.00 ? 44 ARG A N    1  
ATOM 691   C CA   . ARG A 1 43 ? 6.332   -21.164 -2.647  1.00 0.00 ? 44 ARG A CA   1  
ATOM 692   C C    . ARG A 1 43 ? 6.771   -22.491 -3.271  1.00 0.00 ? 44 ARG A C    1  
ATOM 693   O O    . ARG A 1 43 ? 7.759   -23.074 -2.870  1.00 0.00 ? 44 ARG A O    1  
ATOM 694   C CB   . ARG A 1 43 ? 6.012   -21.382 -1.167  1.00 0.00 ? 44 ARG A CB   1  
ATOM 695   C CG   . ARG A 1 43 ? 7.313   -21.607 -0.395  1.00 0.00 ? 44 ARG A CG   1  
ATOM 696   C CD   . ARG A 1 43 ? 7.093   -21.281 1.083   1.00 0.00 ? 44 ARG A CD   1  
ATOM 697   N NE   . ARG A 1 43 ? 7.082   -22.544 1.872   1.00 0.00 ? 44 ARG A NE   1  
ATOM 698   C CZ   . ARG A 1 43 ? 8.202   -23.161 2.131   1.00 0.00 ? 44 ARG A CZ   1  
ATOM 699   N NH1  . ARG A 1 43 ? 8.997   -22.708 3.061   1.00 0.00 ? 44 ARG A NH1  1  
ATOM 700   N NH2  . ARG A 1 43 ? 8.529   -24.230 1.459   1.00 0.00 ? 44 ARG A NH2  1  
ATOM 701   H H    . ARG A 1 43 ? 4.231   -20.903 -3.030  1.00 0.00 ? 44 ARG A H    1  
ATOM 702   H HA   . ARG A 1 43 ? 7.127   -20.442 -2.737  1.00 0.00 ? 44 ARG A HA   1  
ATOM 703   H HB2  . ARG A 1 43 ? 5.506   -20.511 -0.777  1.00 0.00 ? 44 ARG A HB2  1  
ATOM 704   H HB3  . ARG A 1 43 ? 5.376   -22.247 -1.059  1.00 0.00 ? 44 ARG A HB3  1  
ATOM 705   H HG2  . ARG A 1 43 ? 7.617   -22.638 -0.496  1.00 0.00 ? 44 ARG A HG2  1  
ATOM 706   H HG3  . ARG A 1 43 ? 8.084   -20.964 -0.793  1.00 0.00 ? 44 ARG A HG3  1  
ATOM 707   H HD2  . ARG A 1 43 ? 7.893   -20.644 1.434   1.00 0.00 ? 44 ARG A HD2  1  
ATOM 708   H HD3  . ARG A 1 43 ? 6.149   -20.772 1.204   1.00 0.00 ? 44 ARG A HD3  1  
ATOM 709   H HE   . ARG A 1 43 ? 6.235   -22.912 2.196   1.00 0.00 ? 44 ARG A HE   1  
ATOM 710   H HH11 . ARG A 1 43 ? 8.748   -21.888 3.576   1.00 0.00 ? 44 ARG A HH11 1  
ATOM 711   H HH12 . ARG A 1 43 ? 9.855   -23.182 3.259   1.00 0.00 ? 44 ARG A HH12 1  
ATOM 712   H HH21 . ARG A 1 43 ? 7.921   -24.578 0.745   1.00 0.00 ? 44 ARG A HH21 1  
ATOM 713   H HH22 . ARG A 1 43 ? 9.387   -24.703 1.658   1.00 0.00 ? 44 ARG A HH22 1  
ATOM 714   N N    . ALA A 1 44 ? 6.049   -22.978 -4.242  1.00 0.00 ? 45 ALA A N    1  
ATOM 715   C CA   . ALA A 1 44 ? 6.436   -24.271 -4.877  1.00 0.00 ? 45 ALA A CA   1  
ATOM 716   C C    . ALA A 1 44 ? 7.035   -24.011 -6.260  1.00 0.00 ? 45 ALA A C    1  
ATOM 717   O O    . ALA A 1 44 ? 7.486   -24.918 -6.931  1.00 0.00 ? 45 ALA A O    1  
ATOM 718   C CB   . ALA A 1 44 ? 5.199   -25.160 -5.017  1.00 0.00 ? 45 ALA A CB   1  
ATOM 719   H H    . ALA A 1 44 ? 5.252   -22.498 -4.552  1.00 0.00 ? 45 ALA A H    1  
ATOM 720   H HA   . ALA A 1 44 ? 7.166   -24.769 -4.257  1.00 0.00 ? 45 ALA A HA   1  
ATOM 721   H HB1  . ALA A 1 44 ? 4.415   -24.609 -5.518  1.00 0.00 ? 45 ALA A HB1  1  
ATOM 722   H HB2  . ALA A 1 44 ? 5.450   -26.036 -5.597  1.00 0.00 ? 45 ALA A HB2  1  
ATOM 723   H HB3  . ALA A 1 44 ? 4.858   -25.460 -4.038  1.00 0.00 ? 45 ALA A HB3  1  
ATOM 724   N N    . MET A 1 45 ? 7.042   -22.782 -6.697  1.00 0.00 ? 46 MET A N    1  
ATOM 725   C CA   . MET A 1 45 ? 7.602   -22.468 -8.028  1.00 0.00 ? 46 MET A CA   1  
ATOM 726   C C    . MET A 1 45 ? 9.126   -22.312 -7.917  1.00 0.00 ? 46 MET A C    1  
ATOM 727   O O    . MET A 1 45 ? 9.833   -23.260 -7.642  1.00 0.00 ? 46 MET A O    1  
ATOM 728   C CB   . MET A 1 45 ? 6.955   -21.179 -8.523  1.00 0.00 ? 46 MET A CB   1  
ATOM 729   C CG   . MET A 1 45 ? 6.992   -20.144 -7.403  1.00 0.00 ? 46 MET A CG   1  
ATOM 730   S SD   . MET A 1 45 ? 7.405   -18.520 -8.087  1.00 0.00 ? 46 MET A SD   1  
ATOM 731   C CE   . MET A 1 45 ? 6.173   -17.567 -7.166  1.00 0.00 ? 46 MET A CE   1  
ATOM 732   H H    . MET A 1 45 ? 6.674   -22.062 -6.153  1.00 0.00 ? 46 MET A H    1  
ATOM 733   H HA   . MET A 1 45 ? 7.372   -23.266 -8.708  1.00 0.00 ? 46 MET A HA   1  
ATOM 734   H HB2  . MET A 1 45 ? 7.490   -20.808 -9.384  1.00 0.00 ? 46 MET A HB2  1  
ATOM 735   H HB3  . MET A 1 45 ? 5.930   -21.378 -8.786  1.00 0.00 ? 46 MET A HB3  1  
ATOM 736   H HG2  . MET A 1 45 ? 6.027   -20.101 -6.925  1.00 0.00 ? 46 MET A HG2  1  
ATOM 737   H HG3  . MET A 1 45 ? 7.739   -20.435 -6.682  1.00 0.00 ? 46 MET A HG3  1  
ATOM 738   H HE1  . MET A 1 45 ? 6.245   -17.807 -6.114  1.00 0.00 ? 46 MET A HE1  1  
ATOM 739   H HE2  . MET A 1 45 ? 6.353   -16.511 -7.314  1.00 0.00 ? 46 MET A HE2  1  
ATOM 740   H HE3  . MET A 1 45 ? 5.185   -17.815 -7.522  1.00 0.00 ? 46 MET A HE3  1  
ATOM 741   N N    . LYS A 1 46 ? 9.640   -21.131 -8.130  1.00 0.00 ? 47 LYS A N    1  
ATOM 742   C CA   . LYS A 1 46 ? 11.104  -20.926 -8.040  1.00 0.00 ? 47 LYS A CA   1  
ATOM 743   C C    . LYS A 1 46 ? 11.436  -20.175 -6.749  1.00 0.00 ? 47 LYS A C    1  
ATOM 744   O O    . LYS A 1 46 ? 11.865  -20.756 -5.772  1.00 0.00 ? 47 LYS A O    1  
ATOM 745   C CB   . LYS A 1 46 ? 11.545  -20.097 -9.241  1.00 0.00 ? 47 LYS A CB   1  
ATOM 746   C CG   . LYS A 1 46 ? 12.199  -21.007 -10.284 1.00 0.00 ? 47 LYS A CG   1  
ATOM 747   C CD   . LYS A 1 46 ? 13.564  -20.439 -10.675 1.00 0.00 ? 47 LYS A CD   1  
ATOM 748   C CE   . LYS A 1 46 ? 13.611  -20.219 -12.188 1.00 0.00 ? 47 LYS A CE   1  
ATOM 749   N NZ   . LYS A 1 46 ? 14.594  -21.157 -12.796 1.00 0.00 ? 47 LYS A NZ   1  
ATOM 750   H H    . LYS A 1 46 ? 9.068   -20.379 -8.356  1.00 0.00 ? 47 LYS A H    1  
ATOM 751   H HA   . LYS A 1 46 ? 11.606  -21.879 -8.052  1.00 0.00 ? 47 LYS A HA   1  
ATOM 752   H HB2  . LYS A 1 46 ? 10.673  -19.620 -9.670  1.00 0.00 ? 47 LYS A HB2  1  
ATOM 753   H HB3  . LYS A 1 46 ? 12.251  -19.345 -8.924  1.00 0.00 ? 47 LYS A HB3  1  
ATOM 754   H HG2  . LYS A 1 46 ? 12.326  -21.997 -9.868  1.00 0.00 ? 47 LYS A HG2  1  
ATOM 755   H HG3  . LYS A 1 46 ? 11.570  -21.063 -11.158 1.00 0.00 ? 47 LYS A HG3  1  
ATOM 756   H HD2  . LYS A 1 46 ? 13.720  -19.497 -10.169 1.00 0.00 ? 47 LYS A HD2  1  
ATOM 757   H HD3  . LYS A 1 46 ? 14.340  -21.134 -10.391 1.00 0.00 ? 47 LYS A HD3  1  
ATOM 758   H HE2  . LYS A 1 46 ? 12.633  -20.401 -12.609 1.00 0.00 ? 47 LYS A HE2  1  
ATOM 759   H HE3  . LYS A 1 46 ? 13.908  -19.201 -12.396 1.00 0.00 ? 47 LYS A HE3  1  
ATOM 760   H HZ1  . LYS A 1 46 ? 14.661  -22.016 -12.212 1.00 0.00 ? 47 LYS A HZ1  1  
ATOM 761   H HZ2  . LYS A 1 46 ? 14.283  -21.413 -13.755 1.00 0.00 ? 47 LYS A HZ2  1  
ATOM 762   H HZ3  . LYS A 1 46 ? 15.526  -20.699 -12.848 1.00 0.00 ? 47 LYS A HZ3  1  
ATOM 763   N N    . ASP A 1 47 ? 11.237  -18.885 -6.739  1.00 0.00 ? 48 ASP A N    1  
ATOM 764   C CA   . ASP A 1 47 ? 11.537  -18.093 -5.513  1.00 0.00 ? 48 ASP A CA   1  
ATOM 765   C C    . ASP A 1 47 ? 10.694  -16.817 -5.515  1.00 0.00 ? 48 ASP A C    1  
ATOM 766   O O    . ASP A 1 47 ? 9.797   -16.656 -6.319  1.00 0.00 ? 48 ASP A O    1  
ATOM 767   C CB   . ASP A 1 47 ? 13.022  -17.728 -5.491  1.00 0.00 ? 48 ASP A CB   1  
ATOM 768   C CG   . ASP A 1 47 ? 13.827  -18.908 -4.945  1.00 0.00 ? 48 ASP A CG   1  
ATOM 769   O OD1  . ASP A 1 47 ? 13.312  -19.602 -4.084  1.00 0.00 ? 48 ASP A OD1  1  
ATOM 770   O OD2  . ASP A 1 47 ? 14.944  -19.099 -5.397  1.00 0.00 ? 48 ASP A OD2  1  
ATOM 771   H H    . ASP A 1 47 ? 10.889  -18.437 -7.538  1.00 0.00 ? 48 ASP A H    1  
ATOM 772   H HA   . ASP A 1 47 ? 11.299  -18.680 -4.639  1.00 0.00 ? 48 ASP A HA   1  
ATOM 773   H HB2  . ASP A 1 47 ? 13.352  -17.500 -6.495  1.00 0.00 ? 48 ASP A HB2  1  
ATOM 774   H HB3  . ASP A 1 47 ? 13.174  -16.867 -4.857  1.00 0.00 ? 48 ASP A HB3  1  
ATOM 775   N N    . LYS A 1 48 ? 10.969  -15.910 -4.618  1.00 0.00 ? 49 LYS A N    1  
ATOM 776   C CA   . LYS A 1 48 ? 10.177  -14.649 -4.570  1.00 0.00 ? 49 LYS A CA   1  
ATOM 777   C C    . LYS A 1 48 ? 11.046  -13.477 -5.028  1.00 0.00 ? 49 LYS A C    1  
ATOM 778   O O    . LYS A 1 48 ? 10.550  -12.463 -5.475  1.00 0.00 ? 49 LYS A O    1  
ATOM 779   C CB   . LYS A 1 48 ? 9.702   -14.400 -3.137  1.00 0.00 ? 49 LYS A CB   1  
ATOM 780   C CG   . LYS A 1 48 ? 8.989   -15.646 -2.610  1.00 0.00 ? 49 LYS A CG   1  
ATOM 781   C CD   . LYS A 1 48 ? 9.999   -16.550 -1.905  1.00 0.00 ? 49 LYS A CD   1  
ATOM 782   C CE   . LYS A 1 48 ? 9.857   -16.390 -0.390  1.00 0.00 ? 49 LYS A CE   1  
ATOM 783   N NZ   . LYS A 1 48 ? 8.514   -16.873 0.037   1.00 0.00 ? 49 LYS A NZ   1  
ATOM 784   H H    . LYS A 1 48 ? 11.693  -16.060 -3.975  1.00 0.00 ? 49 LYS A H    1  
ATOM 785   H HA   . LYS A 1 48 ? 9.320   -14.738 -5.221  1.00 0.00 ? 49 LYS A HA   1  
ATOM 786   H HB2  . LYS A 1 48 ? 10.554  -14.179 -2.509  1.00 0.00 ? 49 LYS A HB2  1  
ATOM 787   H HB3  . LYS A 1 48 ? 9.020   -13.563 -3.125  1.00 0.00 ? 49 LYS A HB3  1  
ATOM 788   H HG2  . LYS A 1 48 ? 8.219   -15.352 -1.913  1.00 0.00 ? 49 LYS A HG2  1  
ATOM 789   H HG3  . LYS A 1 48 ? 8.544   -16.181 -3.436  1.00 0.00 ? 49 LYS A HG3  1  
ATOM 790   H HD2  . LYS A 1 48 ? 9.813   -17.579 -2.179  1.00 0.00 ? 49 LYS A HD2  1  
ATOM 791   H HD3  . LYS A 1 48 ? 11.000  -16.274 -2.203  1.00 0.00 ? 49 LYS A HD3  1  
ATOM 792   H HE2  . LYS A 1 48 ? 10.623  -16.968 0.106   1.00 0.00 ? 49 LYS A HE2  1  
ATOM 793   H HE3  . LYS A 1 48 ? 9.966   -15.348 -0.127  1.00 0.00 ? 49 LYS A HE3  1  
ATOM 794   H HZ1  . LYS A 1 48 ? 8.068   -17.394 -0.746  1.00 0.00 ? 49 LYS A HZ1  1  
ATOM 795   H HZ2  . LYS A 1 48 ? 8.617   -17.502 0.858   1.00 0.00 ? 49 LYS A HZ2  1  
ATOM 796   H HZ3  . LYS A 1 48 ? 7.919   -16.061 0.298   1.00 0.00 ? 49 LYS A HZ3  1  
ATOM 797   N N    . SER A 1 49 ? 12.340  -13.602 -4.921  1.00 0.00 ? 50 SER A N    1  
ATOM 798   C CA   . SER A 1 49 ? 13.230  -12.488 -5.352  1.00 0.00 ? 50 SER A CA   1  
ATOM 799   C C    . SER A 1 49 ? 12.776  -11.979 -6.721  1.00 0.00 ? 50 SER A C    1  
ATOM 800   O O    . SER A 1 49 ? 12.981  -10.832 -7.067  1.00 0.00 ? 50 SER A O    1  
ATOM 801   C CB   . SER A 1 49 ? 14.671  -12.990 -5.450  1.00 0.00 ? 50 SER A CB   1  
ATOM 802   O OG   . SER A 1 49 ? 15.495  -12.219 -4.584  1.00 0.00 ? 50 SER A OG   1  
ATOM 803   H H    . SER A 1 49 ? 12.726  -14.427 -4.557  1.00 0.00 ? 50 SER A H    1  
ATOM 804   H HA   . SER A 1 49 ? 13.176  -11.684 -4.633  1.00 0.00 ? 50 SER A HA   1  
ATOM 805   H HB2  . SER A 1 49 ? 14.716  -14.024 -5.154  1.00 0.00 ? 50 SER A HB2  1  
ATOM 806   H HB3  . SER A 1 49 ? 15.015  -12.895 -6.471  1.00 0.00 ? 50 SER A HB3  1  
ATOM 807   H HG   . SER A 1 49 ? 16.381  -12.590 -4.610  1.00 0.00 ? 50 SER A HG   1  
ATOM 808   N N    . GLU A 1 50 ? 12.154  -12.824 -7.497  1.00 0.00 ? 51 GLU A N    1  
ATOM 809   C CA   . GLU A 1 50 ? 11.680  -12.404 -8.838  1.00 0.00 ? 51 GLU A CA   1  
ATOM 810   C C    . GLU A 1 50 ? 10.647  -11.292 -8.694  1.00 0.00 ? 51 GLU A C    1  
ATOM 811   O O    . GLU A 1 50 ? 10.865  -10.166 -9.097  1.00 0.00 ? 51 GLU A O    1  
ATOM 812   C CB   . GLU A 1 50 ? 11.047  -13.590 -9.527  1.00 0.00 ? 51 GLU A CB   1  
ATOM 813   C CG   . GLU A 1 50 ? 11.867  -14.851 -9.250  1.00 0.00 ? 51 GLU A CG   1  
ATOM 814   C CD   . GLU A 1 50 ? 12.006  -15.661 -10.542 1.00 0.00 ? 51 GLU A CD   1  
ATOM 815   O OE1  . GLU A 1 50 ? 12.558  -15.130 -11.492 1.00 0.00 ? 51 GLU A OE1  1  
ATOM 816   O OE2  . GLU A 1 50 ? 11.558  -16.795 -10.558 1.00 0.00 ? 51 GLU A OE2  1  
ATOM 817   H H    . GLU A 1 50 ? 11.989  -13.740 -7.194  1.00 0.00 ? 51 GLU A H    1  
ATOM 818   H HA   . GLU A 1 50 ? 12.501  -12.062 -9.438  1.00 0.00 ? 51 GLU A HA   1  
ATOM 819   H HB2  . GLU A 1 50 ? 10.040  -13.721 -9.160  1.00 0.00 ? 51 GLU A HB2  1  
ATOM 820   H HB3  . GLU A 1 50 ? 11.035  -13.396 -10.580 1.00 0.00 ? 51 GLU A HB3  1  
ATOM 821   H HG2  . GLU A 1 50 ? 12.847  -14.572 -8.890  1.00 0.00 ? 51 GLU A HG2  1  
ATOM 822   H HG3  . GLU A 1 50 ? 11.366  -15.451 -8.504  1.00 0.00 ? 51 GLU A HG3  1  
ATOM 823   N N    . TRP A 1 51 ? 9.520   -11.602 -8.121  1.00 0.00 ? 52 TRP A N    1  
ATOM 824   C CA   . TRP A 1 51 ? 8.463   -10.576 -7.945  1.00 0.00 ? 52 TRP A CA   1  
ATOM 825   C C    . TRP A 1 51 ? 8.917   -9.547  -6.926  1.00 0.00 ? 52 TRP A C    1  
ATOM 826   O O    . TRP A 1 51 ? 8.989   -8.381  -7.218  1.00 0.00 ? 52 TRP A O    1  
ATOM 827   C CB   . TRP A 1 51 ? 7.201   -11.243 -7.432  1.00 0.00 ? 52 TRP A CB   1  
ATOM 828   C CG   . TRP A 1 51 ? 6.898   -12.415 -8.269  1.00 0.00 ? 52 TRP A CG   1  
ATOM 829   C CD1  . TRP A 1 51 ? 7.181   -13.668 -7.927  1.00 0.00 ? 52 TRP A CD1  1  
ATOM 830   C CD2  . TRP A 1 51 ? 6.261   -12.464 -9.567  1.00 0.00 ? 52 TRP A CD2  1  
ATOM 831   N NE1  . TRP A 1 51 ? 6.752   -14.514 -8.931  1.00 0.00 ? 52 TRP A NE1  1  
ATOM 832   C CE2  . TRP A 1 51 ? 6.173   -13.813 -9.972  1.00 0.00 ? 52 TRP A CE2  1  
ATOM 833   C CE3  . TRP A 1 51 ? 5.753   -11.478 -10.419 1.00 0.00 ? 52 TRP A CE3  1  
ATOM 834   C CZ2  . TRP A 1 51 ? 5.594   -14.170 -11.190 1.00 0.00 ? 52 TRP A CZ2  1  
ATOM 835   C CZ3  . TRP A 1 51 ? 5.171   -11.824 -11.638 1.00 0.00 ? 52 TRP A CZ3  1  
ATOM 836   C CH2  . TRP A 1 51 ? 5.087   -13.170 -12.028 1.00 0.00 ? 52 TRP A CH2  1  
ATOM 837   H H    . TRP A 1 51 ? 9.369   -12.516 -7.804  1.00 0.00 ? 52 TRP A H    1  
ATOM 838   H HA   . TRP A 1 51 ? 8.261   -10.092 -8.889  1.00 0.00 ? 52 TRP A HA   1  
ATOM 839   H HB2  . TRP A 1 51 ? 7.347   -11.559 -6.411  1.00 0.00 ? 52 TRP A HB2  1  
ATOM 840   H HB3  . TRP A 1 51 ? 6.383   -10.561 -7.479  1.00 0.00 ? 52 TRP A HB3  1  
ATOM 841   H HD1  . TRP A 1 51 ? 7.663   -13.952 -7.012  1.00 0.00 ? 52 TRP A HD1  1  
ATOM 842   H HE1  . TRP A 1 51 ? 6.837   -15.484 -8.923  1.00 0.00 ? 52 TRP A HE1  1  
ATOM 843   H HE3  . TRP A 1 51 ? 5.817   -10.440 -10.135 1.00 0.00 ? 52 TRP A HE3  1  
ATOM 844   H HZ2  . TRP A 1 51 ? 5.535   -15.208 -11.482 1.00 0.00 ? 52 TRP A HZ2  1  
ATOM 845   H HZ3  . TRP A 1 51 ? 4.777   -11.048 -12.268 1.00 0.00 ? 52 TRP A HZ3  1  
ATOM 846   H HH2  . TRP A 1 51 ? 4.638   -13.432 -12.974 1.00 0.00 ? 52 TRP A HH2  1  
ATOM 847   N N    . GLU A 1 52 ? 9.203   -9.981  -5.728  1.00 0.00 ? 53 GLU A N    1  
ATOM 848   C CA   . GLU A 1 52 ? 9.641   -9.030  -4.657  1.00 0.00 ? 53 GLU A CA   1  
ATOM 849   C C    . GLU A 1 52 ? 10.458  -7.885  -5.261  1.00 0.00 ? 53 GLU A C    1  
ATOM 850   O O    . GLU A 1 52 ? 10.060  -6.738  -5.206  1.00 0.00 ? 53 GLU A O    1  
ATOM 851   C CB   . GLU A 1 52 ? 10.494  -9.774  -3.629  1.00 0.00 ? 53 GLU A CB   1  
ATOM 852   C CG   . GLU A 1 52 ? 9.581   -10.466 -2.615  1.00 0.00 ? 53 GLU A CG   1  
ATOM 853   C CD   . GLU A 1 52 ? 10.423  -11.018 -1.463  1.00 0.00 ? 53 GLU A CD   1  
ATOM 854   O OE1  . GLU A 1 52 ? 11.365  -10.348 -1.071  1.00 0.00 ? 53 GLU A OE1  1  
ATOM 855   O OE2  . GLU A 1 52 ? 10.112  -12.098 -0.992  1.00 0.00 ? 53 GLU A OE2  1  
ATOM 856   H H    . GLU A 1 52 ? 9.114   -10.942 -5.528  1.00 0.00 ? 53 GLU A H    1  
ATOM 857   H HA   . GLU A 1 52 ? 8.770   -8.620  -4.170  1.00 0.00 ? 53 GLU A HA   1  
ATOM 858   H HB2  . GLU A 1 52 ? 11.102  -10.513 -4.131  1.00 0.00 ? 53 GLU A HB2  1  
ATOM 859   H HB3  . GLU A 1 52 ? 11.132  -9.072  -3.114  1.00 0.00 ? 53 GLU A HB3  1  
ATOM 860   H HG2  . GLU A 1 52 ? 8.865   -9.754  -2.231  1.00 0.00 ? 53 GLU A HG2  1  
ATOM 861   H HG3  . GLU A 1 52 ? 9.059   -11.279 -3.096  1.00 0.00 ? 53 GLU A HG3  1  
ATOM 862   N N    . ALA A 1 53 ? 11.588  -8.177  -5.845  1.00 0.00 ? 54 ALA A N    1  
ATOM 863   C CA   . ALA A 1 53 ? 12.400  -7.086  -6.451  1.00 0.00 ? 54 ALA A CA   1  
ATOM 864   C C    . ALA A 1 53 ? 11.549  -6.349  -7.484  1.00 0.00 ? 54 ALA A C    1  
ATOM 865   O O    . ALA A 1 53 ? 11.569  -5.138  -7.578  1.00 0.00 ? 54 ALA A O    1  
ATOM 866   C CB   . ALA A 1 53 ? 13.633  -7.683  -7.133  1.00 0.00 ? 54 ALA A CB   1  
ATOM 867   H H    . ALA A 1 53 ? 11.897  -9.108  -5.891  1.00 0.00 ? 54 ALA A H    1  
ATOM 868   H HA   . ALA A 1 53 ? 12.710  -6.395  -5.681  1.00 0.00 ? 54 ALA A HA   1  
ATOM 869   H HB1  . ALA A 1 53 ? 14.208  -8.244  -6.412  1.00 0.00 ? 54 ALA A HB1  1  
ATOM 870   H HB2  . ALA A 1 53 ? 13.318  -8.339  -7.933  1.00 0.00 ? 54 ALA A HB2  1  
ATOM 871   H HB3  . ALA A 1 53 ? 14.241  -6.888  -7.539  1.00 0.00 ? 54 ALA A HB3  1  
ATOM 872   N N    . LYS A 1 54 ? 10.799  -7.079  -8.259  1.00 0.00 ? 55 LYS A N    1  
ATOM 873   C CA   . LYS A 1 54 ? 9.935   -6.443  -9.293  1.00 0.00 ? 55 LYS A CA   1  
ATOM 874   C C    . LYS A 1 54 ? 9.041   -5.378  -8.654  1.00 0.00 ? 55 LYS A C    1  
ATOM 875   O O    . LYS A 1 54 ? 8.779   -4.344  -9.237  1.00 0.00 ? 55 LYS A O    1  
ATOM 876   C CB   . LYS A 1 54 ? 9.052   -7.512  -9.936  1.00 0.00 ? 55 LYS A CB   1  
ATOM 877   C CG   . LYS A 1 54 ? 8.240   -6.890  -11.072 1.00 0.00 ? 55 LYS A CG   1  
ATOM 878   C CD   . LYS A 1 54 ? 7.127   -7.851  -11.497 1.00 0.00 ? 55 LYS A CD   1  
ATOM 879   C CE   . LYS A 1 54 ? 6.986   -7.827  -13.020 1.00 0.00 ? 55 LYS A CE   1  
ATOM 880   N NZ   . LYS A 1 54 ? 5.542   -7.874  -13.384 1.00 0.00 ? 55 LYS A NZ   1  
ATOM 881   H H    . LYS A 1 54 ? 10.805  -8.053  -8.161  1.00 0.00 ? 55 LYS A H    1  
ATOM 882   H HA   . LYS A 1 54 ? 10.554  -5.988  -10.048 1.00 0.00 ? 55 LYS A HA   1  
ATOM 883   H HB2  . LYS A 1 54 ? 9.673   -8.306  -10.326 1.00 0.00 ? 55 LYS A HB2  1  
ATOM 884   H HB3  . LYS A 1 54 ? 8.379   -7.914  -9.192  1.00 0.00 ? 55 LYS A HB3  1  
ATOM 885   H HG2  . LYS A 1 54 ? 7.804   -5.961  -10.734 1.00 0.00 ? 55 LYS A HG2  1  
ATOM 886   H HG3  . LYS A 1 54 ? 8.888   -6.697  -11.914 1.00 0.00 ? 55 LYS A HG3  1  
ATOM 887   H HD2  . LYS A 1 54 ? 7.372   -8.852  -11.171 1.00 0.00 ? 55 LYS A HD2  1  
ATOM 888   H HD3  . LYS A 1 54 ? 6.195   -7.543  -11.047 1.00 0.00 ? 55 LYS A HD3  1  
ATOM 889   H HE2  . LYS A 1 54 ? 7.426   -6.921  -13.409 1.00 0.00 ? 55 LYS A HE2  1  
ATOM 890   H HE3  . LYS A 1 54 ? 7.493   -8.683  -13.441 1.00 0.00 ? 55 LYS A HE3  1  
ATOM 891   H HZ1  . LYS A 1 54 ? 5.004   -8.318  -12.610 1.00 0.00 ? 55 LYS A HZ1  1  
ATOM 892   H HZ2  . LYS A 1 54 ? 5.191   -6.909  -13.541 1.00 0.00 ? 55 LYS A HZ2  1  
ATOM 893   H HZ3  . LYS A 1 54 ? 5.421   -8.430  -14.254 1.00 0.00 ? 55 LYS A HZ3  1  
ATOM 894   N N    . ALA A 1 55 ? 8.566   -5.618  -7.462  1.00 0.00 ? 56 ALA A N    1  
ATOM 895   C CA   . ALA A 1 55 ? 7.688   -4.620  -6.799  1.00 0.00 ? 56 ALA A CA   1  
ATOM 896   C C    . ALA A 1 55 ? 8.455   -3.311  -6.646  1.00 0.00 ? 56 ALA A C    1  
ATOM 897   O O    . ALA A 1 55 ? 7.937   -2.243  -6.899  1.00 0.00 ? 56 ALA A O    1  
ATOM 898   C CB   . ALA A 1 55 ? 7.272   -5.134  -5.419  1.00 0.00 ? 56 ALA A CB   1  
ATOM 899   H H    . ALA A 1 55 ? 8.786   -6.452  -7.007  1.00 0.00 ? 56 ALA A H    1  
ATOM 900   H HA   . ALA A 1 55 ? 6.808   -4.458  -7.406  1.00 0.00 ? 56 ALA A HA   1  
ATOM 901   H HB1  . ALA A 1 55 ? 7.094   -6.198  -5.471  1.00 0.00 ? 56 ALA A HB1  1  
ATOM 902   H HB2  . ALA A 1 55 ? 8.059   -4.933  -4.708  1.00 0.00 ? 56 ALA A HB2  1  
ATOM 903   H HB3  . ALA A 1 55 ? 6.367   -4.633  -5.107  1.00 0.00 ? 56 ALA A HB3  1  
ATOM 904   N N    . ALA A 1 56 ? 9.692   -3.388  -6.241  1.00 0.00 ? 57 ALA A N    1  
ATOM 905   C CA   . ALA A 1 56 ? 10.501  -2.152  -6.081  1.00 0.00 ? 57 ALA A CA   1  
ATOM 906   C C    . ALA A 1 56 ? 10.437  -1.347  -7.378  1.00 0.00 ? 57 ALA A C    1  
ATOM 907   O O    . ALA A 1 56 ? 10.134  -0.172  -7.379  1.00 0.00 ? 57 ALA A O    1  
ATOM 908   C CB   . ALA A 1 56 ? 11.955  -2.528  -5.792  1.00 0.00 ? 57 ALA A CB   1  
ATOM 909   H H    . ALA A 1 56 ? 10.090  -4.264  -6.049  1.00 0.00 ? 57 ALA A H    1  
ATOM 910   H HA   . ALA A 1 56 ? 10.109  -1.563  -5.266  1.00 0.00 ? 57 ALA A HA   1  
ATOM 911   H HB1  . ALA A 1 56 ? 12.002  -3.555  -5.455  1.00 0.00 ? 57 ALA A HB1  1  
ATOM 912   H HB2  . ALA A 1 56 ? 12.541  -2.419  -6.694  1.00 0.00 ? 57 ALA A HB2  1  
ATOM 913   H HB3  . ALA A 1 56 ? 12.350  -1.878  -5.025  1.00 0.00 ? 57 ALA A HB3  1  
ATOM 914   N N    . LYS A 1 57 ? 10.722  -1.977  -8.485  1.00 0.00 ? 58 LYS A N    1  
ATOM 915   C CA   . LYS A 1 57 ? 10.679  -1.257  -9.787  1.00 0.00 ? 58 LYS A CA   1  
ATOM 916   C C    . LYS A 1 57 ? 9.367   -0.482  -9.899  1.00 0.00 ? 58 LYS A C    1  
ATOM 917   O O    . LYS A 1 57 ? 9.365   0.720   -10.065 1.00 0.00 ? 58 LYS A O    1  
ATOM 918   C CB   . LYS A 1 57 ? 10.779  -2.263  -10.934 1.00 0.00 ? 58 LYS A CB   1  
ATOM 919   C CG   . LYS A 1 57 ? 11.866  -1.815  -11.911 1.00 0.00 ? 58 LYS A CG   1  
ATOM 920   C CD   . LYS A 1 57 ? 12.070  -2.891  -12.978 1.00 0.00 ? 58 LYS A CD   1  
ATOM 921   C CE   . LYS A 1 57 ? 13.491  -2.794  -13.535 1.00 0.00 ? 58 LYS A CE   1  
ATOM 922   N NZ   . LYS A 1 57 ? 13.501  -1.885  -14.716 1.00 0.00 ? 58 LYS A NZ   1  
ATOM 923   H H    . LYS A 1 57 ? 10.964  -2.927  -8.459  1.00 0.00 ? 58 LYS A H    1  
ATOM 924   H HA   . LYS A 1 57 ? 11.507  -0.562  -9.842  1.00 0.00 ? 58 LYS A HA   1  
ATOM 925   H HB2  . LYS A 1 57 ? 11.030  -3.237  -10.537 1.00 0.00 ? 58 LYS A HB2  1  
ATOM 926   H HB3  . LYS A 1 57 ? 9.834   -2.317  -11.450 1.00 0.00 ? 58 LYS A HB3  1  
ATOM 927   H HG2  . LYS A 1 57 ? 11.567  -0.890  -12.382 1.00 0.00 ? 58 LYS A HG2  1  
ATOM 928   H HG3  . LYS A 1 57 ? 12.792  -1.663  -11.376 1.00 0.00 ? 58 LYS A HG3  1  
ATOM 929   H HD2  . LYS A 1 57 ? 11.919  -3.867  -12.539 1.00 0.00 ? 58 LYS A HD2  1  
ATOM 930   H HD3  . LYS A 1 57 ? 11.362  -2.743  -13.779 1.00 0.00 ? 58 LYS A HD3  1  
ATOM 931   H HE2  . LYS A 1 57 ? 14.150  -2.402  -12.774 1.00 0.00 ? 58 LYS A HE2  1  
ATOM 932   H HE3  . LYS A 1 57 ? 13.829  -3.776  -13.832 1.00 0.00 ? 58 LYS A HE3  1  
ATOM 933   H HZ1  . LYS A 1 57 ? 12.785  -1.142  -14.586 1.00 0.00 ? 58 LYS A HZ1  1  
ATOM 934   H HZ2  . LYS A 1 57 ? 14.439  -1.449  -14.811 1.00 0.00 ? 58 LYS A HZ2  1  
ATOM 935   H HZ3  . LYS A 1 57 ? 13.285  -2.430  -15.574 1.00 0.00 ? 58 LYS A HZ3  1  
ATOM 936   N N    . ALA A 1 58 ? 8.247   -1.148  -9.803  1.00 0.00 ? 59 ALA A N    1  
ATOM 937   C CA   . ALA A 1 58 ? 6.960   -0.409  -9.903  1.00 0.00 ? 59 ALA A CA   1  
ATOM 938   C C    . ALA A 1 58 ? 7.001   0.758   -8.931  1.00 0.00 ? 59 ALA A C    1  
ATOM 939   O O    . ALA A 1 58 ? 6.484   1.814   -9.203  1.00 0.00 ? 59 ALA A O    1  
ATOM 940   C CB   . ALA A 1 58 ? 5.786   -1.322  -9.537  1.00 0.00 ? 59 ALA A CB   1  
ATOM 941   H H    . ALA A 1 58 ? 8.253   -2.120  -9.662  1.00 0.00 ? 59 ALA A H    1  
ATOM 942   H HA   . ALA A 1 58 ? 6.834   -0.035  -10.909 1.00 0.00 ? 59 ALA A HA   1  
ATOM 943   H HB1  . ALA A 1 58 ? 6.133   -2.109  -8.885  1.00 0.00 ? 59 ALA A HB1  1  
ATOM 944   H HB2  . ALA A 1 58 ? 5.024   -0.742  -9.027  1.00 0.00 ? 59 ALA A HB2  1  
ATOM 945   H HB3  . ALA A 1 58 ? 5.371   -1.754  -10.434 1.00 0.00 ? 59 ALA A HB3  1  
ATOM 946   N N    . LYS A 1 59 ? 7.621   0.573   -7.803  1.00 0.00 ? 60 LYS A N    1  
ATOM 947   C CA   . LYS A 1 59 ? 7.708   1.661   -6.805  1.00 0.00 ? 60 LYS A CA   1  
ATOM 948   C C    . LYS A 1 59 ? 8.287   2.903   -7.455  1.00 0.00 ? 60 LYS A C    1  
ATOM 949   O O    . LYS A 1 59 ? 7.678   3.944   -7.471  1.00 0.00 ? 60 LYS A O    1  
ATOM 950   C CB   . LYS A 1 59 ? 8.635   1.211   -5.689  1.00 0.00 ? 60 LYS A CB   1  
ATOM 951   C CG   . LYS A 1 59 ? 8.038   1.589   -4.332  1.00 0.00 ? 60 LYS A CG   1  
ATOM 952   C CD   . LYS A 1 59 ? 8.112   0.388   -3.388  1.00 0.00 ? 60 LYS A CD   1  
ATOM 953   C CE   . LYS A 1 59 ? 8.029   0.873   -1.939  1.00 0.00 ? 60 LYS A CE   1  
ATOM 954   N NZ   . LYS A 1 59 ? 8.700   -0.113  -1.046  1.00 0.00 ? 60 LYS A NZ   1  
ATOM 955   H H    . LYS A 1 59 ? 8.043   -0.287  -7.610  1.00 0.00 ? 60 LYS A H    1  
ATOM 956   H HA   . LYS A 1 59 ? 6.730   1.878   -6.409  1.00 0.00 ? 60 LYS A HA   1  
ATOM 957   H HB2  . LYS A 1 59 ? 8.769   0.145   -5.749  1.00 0.00 ? 60 LYS A HB2  1  
ATOM 958   H HB3  . LYS A 1 59 ? 9.588   1.691   -5.811  1.00 0.00 ? 60 LYS A HB3  1  
ATOM 959   H HG2  . LYS A 1 59 ? 8.595   2.414   -3.911  1.00 0.00 ? 60 LYS A HG2  1  
ATOM 960   H HG3  . LYS A 1 59 ? 7.006   1.879   -4.462  1.00 0.00 ? 60 LYS A HG3  1  
ATOM 961   H HD2  . LYS A 1 59 ? 7.289   -0.280  -3.593  1.00 0.00 ? 60 LYS A HD2  1  
ATOM 962   H HD3  . LYS A 1 59 ? 9.045   -0.133  -3.539  1.00 0.00 ? 60 LYS A HD3  1  
ATOM 963   H HE2  . LYS A 1 59 ? 8.520   1.830   -1.852  1.00 0.00 ? 60 LYS A HE2  1  
ATOM 964   H HE3  . LYS A 1 59 ? 6.992   0.973   -1.652  1.00 0.00 ? 60 LYS A HE3  1  
ATOM 965   H HZ1  . LYS A 1 59 ? 8.956   -0.959  -1.592  1.00 0.00 ? 60 LYS A HZ1  1  
ATOM 966   H HZ2  . LYS A 1 59 ? 9.561   0.311   -0.646  1.00 0.00 ? 60 LYS A HZ2  1  
ATOM 967   H HZ3  . LYS A 1 59 ? 8.053   -0.379  -0.275  1.00 0.00 ? 60 LYS A HZ3  1  
ATOM 968   N N    . ASP A 1 60 ? 9.468   2.804   -7.973  1.00 0.00 ? 61 ASP A N    1  
ATOM 969   C CA   . ASP A 1 60 ? 10.099  3.995   -8.611  1.00 0.00 ? 61 ASP A CA   1  
ATOM 970   C C    . ASP A 1 60 ? 9.212   4.522   -9.746  1.00 0.00 ? 61 ASP A C    1  
ATOM 971   O O    . ASP A 1 60 ? 8.915   5.698   -9.815  1.00 0.00 ? 61 ASP A O    1  
ATOM 972   C CB   . ASP A 1 60 ? 11.471  3.600   -9.165  1.00 0.00 ? 61 ASP A CB   1  
ATOM 973   C CG   . ASP A 1 60 ? 11.991  4.702   -10.090 1.00 0.00 ? 61 ASP A CG   1  
ATOM 974   O OD1  . ASP A 1 60 ? 11.506  5.816   -9.984  1.00 0.00 ? 61 ASP A OD1  1  
ATOM 975   O OD2  . ASP A 1 60 ? 12.865  4.412   -10.889 1.00 0.00 ? 61 ASP A OD2  1  
ATOM 976   H H    . ASP A 1 60 ? 9.950   1.946   -7.929  1.00 0.00 ? 61 ASP A H    1  
ATOM 977   H HA   . ASP A 1 60 ? 10.215  4.771   -7.869  1.00 0.00 ? 61 ASP A HA   1  
ATOM 978   H HB2  . ASP A 1 60 ? 12.162  3.464   -8.345  1.00 0.00 ? 61 ASP A HB2  1  
ATOM 979   H HB3  . ASP A 1 60 ? 11.384  2.676   -9.719  1.00 0.00 ? 61 ASP A HB3  1  
ATOM 980   N N    . ASP A 1 61 ? 8.791   3.670   -10.636 1.00 0.00 ? 62 ASP A N    1  
ATOM 981   C CA   . ASP A 1 61 ? 7.930   4.129   -11.766 1.00 0.00 ? 62 ASP A CA   1  
ATOM 982   C C    . ASP A 1 61 ? 6.529   4.465   -11.246 1.00 0.00 ? 62 ASP A C    1  
ATOM 983   O O    . ASP A 1 61 ? 5.677   4.932   -11.974 1.00 0.00 ? 62 ASP A O    1  
ATOM 984   C CB   . ASP A 1 61 ? 7.816   3.001   -12.786 1.00 0.00 ? 62 ASP A CB   1  
ATOM 985   C CG   . ASP A 1 61 ? 9.196   2.696   -13.374 1.00 0.00 ? 62 ASP A CG   1  
ATOM 986   O OD1  . ASP A 1 61 ? 10.012  3.601   -13.420 1.00 0.00 ? 62 ASP A OD1  1  
ATOM 987   O OD2  . ASP A 1 61 ? 9.411   1.562   -13.770 1.00 0.00 ? 62 ASP A OD2  1  
ATOM 988   H H    . ASP A 1 61 ? 9.041   2.724   -10.567 1.00 0.00 ? 62 ASP A H    1  
ATOM 989   H HA   . ASP A 1 61 ? 8.368   4.999   -12.232 1.00 0.00 ? 62 ASP A HA   1  
ATOM 990   H HB2  . ASP A 1 61 ? 7.428   2.119   -12.294 1.00 0.00 ? 62 ASP A HB2  1  
ATOM 991   H HB3  . ASP A 1 61 ? 7.144   3.296   -13.577 1.00 0.00 ? 62 ASP A HB3  1  
ATOM 992   N N    . TYR A 1 62 ? 6.283   4.197   -9.998  1.00 0.00 ? 63 TYR A N    1  
ATOM 993   C CA   . TYR A 1 62 ? 4.939   4.453   -9.417  1.00 0.00 ? 63 TYR A CA   1  
ATOM 994   C C    . TYR A 1 62 ? 4.893   5.805   -8.693  1.00 0.00 ? 63 TYR A C    1  
ATOM 995   O O    . TYR A 1 62 ? 3.941   6.540   -8.812  1.00 0.00 ? 63 TYR A O    1  
ATOM 996   C CB   . TYR A 1 62 ? 4.654   3.326   -8.440  1.00 0.00 ? 63 TYR A CB   1  
ATOM 997   C CG   . TYR A 1 62 ? 3.494   3.677   -7.572  1.00 0.00 ? 63 TYR A CG   1  
ATOM 998   C CD1  . TYR A 1 62 ? 2.218   3.783   -8.122  1.00 0.00 ? 63 TYR A CD1  1  
ATOM 999   C CD2  . TYR A 1 62 ? 3.698   3.876   -6.211  1.00 0.00 ? 63 TYR A CD2  1  
ATOM 1000  C CE1  . TYR A 1 62 ? 1.134   4.087   -7.304  1.00 0.00 ? 63 TYR A CE1  1  
ATOM 1001  C CE2  . TYR A 1 62 ? 2.617   4.184   -5.384  1.00 0.00 ? 63 TYR A CE2  1  
ATOM 1002  C CZ   . TYR A 1 62 ? 1.328   4.286   -5.928  1.00 0.00 ? 63 TYR A CZ   1  
ATOM 1003  O OH   . TYR A 1 62 ? 0.255   4.586   -5.113  1.00 0.00 ? 63 TYR A OH   1  
ATOM 1004  H H    . TYR A 1 62 ? 6.977   3.793   -9.443  1.00 0.00 ? 63 TYR A H    1  
ATOM 1005  H HA   . TYR A 1 62 ? 4.194   4.440   -10.196 1.00 0.00 ? 63 TYR A HA   1  
ATOM 1006  H HB2  . TYR A 1 62 ? 4.428   2.426   -8.990  1.00 0.00 ? 63 TYR A HB2  1  
ATOM 1007  H HB3  . TYR A 1 62 ? 5.524   3.160   -7.824  1.00 0.00 ? 63 TYR A HB3  1  
ATOM 1008  H HD1  . TYR A 1 62 ? 2.072   3.627   -9.179  1.00 0.00 ? 63 TYR A HD1  1  
ATOM 1009  H HD2  . TYR A 1 62 ? 4.699   3.806   -5.804  1.00 0.00 ? 63 TYR A HD2  1  
ATOM 1010  H HE1  . TYR A 1 62 ? 0.150   4.170   -7.734  1.00 0.00 ? 63 TYR A HE1  1  
ATOM 1011  H HE2  . TYR A 1 62 ? 2.773   4.325   -4.328  1.00 0.00 ? 63 TYR A HE2  1  
ATOM 1012  H HH   . TYR A 1 62 ? 0.491   4.348   -4.213  1.00 0.00 ? 63 TYR A HH   1  
ATOM 1013  N N    . ASP A 1 63 ? 5.899   6.141   -7.943  1.00 0.00 ? 64 ASP A N    1  
ATOM 1014  C CA   . ASP A 1 63 ? 5.882   7.441   -7.227  1.00 0.00 ? 64 ASP A CA   1  
ATOM 1015  C C    . ASP A 1 63 ? 6.047   8.561   -8.240  1.00 0.00 ? 64 ASP A C    1  
ATOM 1016  O O    . ASP A 1 63 ? 5.499   9.637   -8.103  1.00 0.00 ? 64 ASP A O    1  
ATOM 1017  C CB   . ASP A 1 63 ? 7.037   7.481   -6.252  1.00 0.00 ? 64 ASP A CB   1  
ATOM 1018  C CG   . ASP A 1 63 ? 6.808   8.586   -5.220  1.00 0.00 ? 64 ASP A CG   1  
ATOM 1019  O OD1  . ASP A 1 63 ? 6.172   8.310   -4.216  1.00 0.00 ? 64 ASP A OD1  1  
ATOM 1020  O OD2  . ASP A 1 63 ? 7.273   9.690   -5.451  1.00 0.00 ? 64 ASP A OD2  1  
ATOM 1021  H H    . ASP A 1 63 ? 6.662   5.546   -7.847  1.00 0.00 ? 64 ASP A H    1  
ATOM 1022  H HA   . ASP A 1 63 ? 4.964   7.551   -6.690  1.00 0.00 ? 64 ASP A HA   1  
ATOM 1023  H HB2  . ASP A 1 63 ? 7.096   6.534   -5.762  1.00 0.00 ? 64 ASP A HB2  1  
ATOM 1024  H HB3  . ASP A 1 63 ? 7.950   7.672   -6.787  1.00 0.00 ? 64 ASP A HB3  1  
ATOM 1025  N N    . ARG A 1 64 ? 6.827   8.309   -9.246  1.00 0.00 ? 65 ARG A N    1  
ATOM 1026  C CA   . ARG A 1 64 ? 7.077   9.345   -10.281 1.00 0.00 ? 65 ARG A CA   1  
ATOM 1027  C C    . ARG A 1 64 ? 5.901   9.439   -11.262 1.00 0.00 ? 65 ARG A C    1  
ATOM 1028  O O    . ARG A 1 64 ? 5.540   10.511  -11.706 1.00 0.00 ? 65 ARG A O    1  
ATOM 1029  C CB   . ARG A 1 64 ? 8.349   8.990   -11.053 1.00 0.00 ? 65 ARG A CB   1  
ATOM 1030  C CG   . ARG A 1 64 ? 8.772   10.172  -11.928 1.00 0.00 ? 65 ARG A CG   1  
ATOM 1031  C CD   . ARG A 1 64 ? 10.124  9.864   -12.576 1.00 0.00 ? 65 ARG A CD   1  
ATOM 1032  N NE   . ARG A 1 64 ? 10.395  10.849  -13.663 1.00 0.00 ? 65 ARG A NE   1  
ATOM 1033  C CZ   . ARG A 1 64 ? 10.205  12.122  -13.452 1.00 0.00 ? 65 ARG A CZ   1  
ATOM 1034  N NH1  . ARG A 1 64 ? 8.993   12.605  -13.421 1.00 0.00 ? 65 ARG A NH1  1  
ATOM 1035  N NH2  . ARG A 1 64 ? 11.228  12.914  -13.275 1.00 0.00 ? 65 ARG A NH2  1  
ATOM 1036  H H    . ARG A 1 64 ? 7.267   7.433   -9.307  1.00 0.00 ? 65 ARG A H    1  
ATOM 1037  H HA   . ARG A 1 64 ? 7.211   10.291  -9.795  1.00 0.00 ? 65 ARG A HA   1  
ATOM 1038  H HB2  . ARG A 1 64 ? 9.141   8.758   -10.355 1.00 0.00 ? 65 ARG A HB2  1  
ATOM 1039  H HB3  . ARG A 1 64 ? 8.160   8.131   -11.680 1.00 0.00 ? 65 ARG A HB3  1  
ATOM 1040  H HG2  . ARG A 1 64 ? 8.029   10.335  -12.696 1.00 0.00 ? 65 ARG A HG2  1  
ATOM 1041  H HG3  . ARG A 1 64 ? 8.859   11.059  -11.318 1.00 0.00 ? 65 ARG A HG3  1  
ATOM 1042  H HD2  . ARG A 1 64 ? 10.902  9.929   -11.831 1.00 0.00 ? 65 ARG A HD2  1  
ATOM 1043  H HD3  . ARG A 1 64 ? 10.104  8.867   -12.991 1.00 0.00 ? 65 ARG A HD3  1  
ATOM 1044  H HE   . ARG A 1 64 ? 10.717  10.539  -14.535 1.00 0.00 ? 65 ARG A HE   1  
ATOM 1045  H HH11 . ARG A 1 64 ? 8.210   11.998  -13.558 1.00 0.00 ? 65 ARG A HH11 1  
ATOM 1046  H HH12 . ARG A 1 64 ? 8.848   13.581  -13.260 1.00 0.00 ? 65 ARG A HH12 1  
ATOM 1047  H HH21 . ARG A 1 64 ? 12.157  12.543  -13.300 1.00 0.00 ? 65 ARG A HH21 1  
ATOM 1048  H HH22 . ARG A 1 64 ? 11.083  13.889  -13.114 1.00 0.00 ? 65 ARG A HH22 1  
ATOM 1049  N N    . ALA A 1 65 ? 5.318   8.331   -11.626 1.00 0.00 ? 66 ALA A N    1  
ATOM 1050  C CA   . ALA A 1 65 ? 4.187   8.369   -12.604 1.00 0.00 ? 66 ALA A CA   1  
ATOM 1051  C C    . ALA A 1 65 ? 2.885   8.784   -11.923 1.00 0.00 ? 66 ALA A C    1  
ATOM 1052  O O    . ALA A 1 65 ? 2.143   9.579   -12.457 1.00 0.00 ? 66 ALA A O    1  
ATOM 1053  C CB   . ALA A 1 65 ? 4.013   6.988   -13.236 1.00 0.00 ? 66 ALA A CB   1  
ATOM 1054  H H    . ALA A 1 65 ? 5.635   7.475   -11.275 1.00 0.00 ? 66 ALA A H    1  
ATOM 1055  H HA   . ALA A 1 65 ? 4.407   9.088   -13.380 1.00 0.00 ? 66 ALA A HA   1  
ATOM 1056  H HB1  . ALA A 1 65 ? 4.978   6.605   -13.536 1.00 0.00 ? 66 ALA A HB1  1  
ATOM 1057  H HB2  . ALA A 1 65 ? 3.568   6.316   -12.517 1.00 0.00 ? 66 ALA A HB2  1  
ATOM 1058  H HB3  . ALA A 1 65 ? 3.372   7.066   -14.103 1.00 0.00 ? 66 ALA A HB3  1  
ATOM 1059  N N    . VAL A 1 66 ? 2.584   8.260   -10.768 1.00 0.00 ? 67 VAL A N    1  
ATOM 1060  C CA   . VAL A 1 66 ? 1.314   8.652   -10.106 1.00 0.00 ? 67 VAL A CA   1  
ATOM 1061  C C    . VAL A 1 66 ? 1.168   10.162  -10.167 1.00 0.00 ? 67 VAL A C    1  
ATOM 1062  O O    . VAL A 1 66 ? 0.106   10.675  -10.386 1.00 0.00 ? 67 VAL A O    1  
ATOM 1063  C CB   . VAL A 1 66 ? 1.301   8.227   -8.660  1.00 0.00 ? 67 VAL A CB   1  
ATOM 1064  C CG1  . VAL A 1 66 ? 1.403   6.709   -8.555  1.00 0.00 ? 67 VAL A CG1  1  
ATOM 1065  C CG2  . VAL A 1 66 ? 2.460   8.892   -7.972  1.00 0.00 ? 67 VAL A CG2  1  
ATOM 1066  H H    . VAL A 1 66 ? 3.179   7.618   -10.349 1.00 0.00 ? 67 VAL A H    1  
ATOM 1067  H HA   . VAL A 1 66 ? 0.500   8.193   -10.610 1.00 0.00 ? 67 VAL A HA   1  
ATOM 1068  H HB   . VAL A 1 66 ? 0.389   8.558   -8.213  1.00 0.00 ? 67 VAL A HB   1  
ATOM 1069  H HG11 . VAL A 1 66 ? 1.729   6.305   -9.502  1.00 0.00 ? 67 VAL A HG11 1  
ATOM 1070  H HG12 . VAL A 1 66 ? 2.114   6.448   -7.786  1.00 0.00 ? 67 VAL A HG12 1  
ATOM 1071  H HG13 . VAL A 1 66 ? 0.435   6.303   -8.304  1.00 0.00 ? 67 VAL A HG13 1  
ATOM 1072  H HG21 . VAL A 1 66 ? 3.283   8.953   -8.663  1.00 0.00 ? 67 VAL A HG21 1  
ATOM 1073  H HG22 . VAL A 1 66 ? 2.158   9.884   -7.677  1.00 0.00 ? 67 VAL A HG22 1  
ATOM 1074  H HG23 . VAL A 1 66 ? 2.746   8.319   -7.106  1.00 0.00 ? 67 VAL A HG23 1  
ATOM 1075  N N    . LYS A 1 67 ? 2.235   10.880  -9.976  1.00 0.00 ? 68 LYS A N    1  
ATOM 1076  C CA   . LYS A 1 67 ? 2.144   12.366  -10.042 1.00 0.00 ? 68 LYS A CA   1  
ATOM 1077  C C    . LYS A 1 67 ? 1.421   12.740  -11.338 1.00 0.00 ? 68 LYS A C    1  
ATOM 1078  O O    . LYS A 1 67 ? 0.452   13.471  -11.335 1.00 0.00 ? 68 LYS A O    1  
ATOM 1079  C CB   . LYS A 1 67 ? 3.550   12.973  -10.043 1.00 0.00 ? 68 LYS A CB   1  
ATOM 1080  C CG   . LYS A 1 67 ? 3.448   14.499  -10.056 1.00 0.00 ? 68 LYS A CG   1  
ATOM 1081  C CD   . LYS A 1 67 ? 4.848   15.105  -10.177 1.00 0.00 ? 68 LYS A CD   1  
ATOM 1082  C CE   . LYS A 1 67 ? 5.418   15.361  -8.781  1.00 0.00 ? 68 LYS A CE   1  
ATOM 1083  N NZ   . LYS A 1 67 ? 5.559   16.828  -8.565  1.00 0.00 ? 68 LYS A NZ   1  
ATOM 1084  H H    . LYS A 1 67 ? 3.089   10.441  -9.794  1.00 0.00 ? 68 LYS A H    1  
ATOM 1085  H HA   . LYS A 1 67 ? 1.586   12.736  -9.193  1.00 0.00 ? 68 LYS A HA   1  
ATOM 1086  H HB2  . LYS A 1 67 ? 4.080   12.654  -9.157  1.00 0.00 ? 68 LYS A HB2  1  
ATOM 1087  H HB3  . LYS A 1 67 ? 4.085   12.643  -10.921 1.00 0.00 ? 68 LYS A HB3  1  
ATOM 1088  H HG2  . LYS A 1 67 ? 2.845   14.812  -10.897 1.00 0.00 ? 68 LYS A HG2  1  
ATOM 1089  H HG3  . LYS A 1 67 ? 2.989   14.838  -9.139  1.00 0.00 ? 68 LYS A HG3  1  
ATOM 1090  H HD2  . LYS A 1 67 ? 5.491   14.419  -10.710 1.00 0.00 ? 68 LYS A HD2  1  
ATOM 1091  H HD3  . LYS A 1 67 ? 4.790   16.038  -10.717 1.00 0.00 ? 68 LYS A HD3  1  
ATOM 1092  H HE2  . LYS A 1 67 ? 4.751   14.950  -8.039  1.00 0.00 ? 68 LYS A HE2  1  
ATOM 1093  H HE3  . LYS A 1 67 ? 6.387   14.890  -8.696  1.00 0.00 ? 68 LYS A HE3  1  
ATOM 1094  H HZ1  . LYS A 1 67 ? 5.334   17.331  -9.448  1.00 0.00 ? 68 LYS A HZ1  1  
ATOM 1095  H HZ2  . LYS A 1 67 ? 4.907   17.133  -7.816  1.00 0.00 ? 68 LYS A HZ2  1  
ATOM 1096  H HZ3  . LYS A 1 67 ? 6.535   17.045  -8.280  1.00 0.00 ? 68 LYS A HZ3  1  
ATOM 1097  N N    . GLU A 1 68 ? 1.878   12.213  -12.443 1.00 0.00 ? 69 GLU A N    1  
ATOM 1098  C CA   . GLU A 1 68 ? 1.218   12.494  -13.749 1.00 0.00 ? 69 GLU A CA   1  
ATOM 1099  C C    . GLU A 1 68 ? -0.248  12.057  -13.649 1.00 0.00 ? 69 GLU A C    1  
ATOM 1100  O O    . GLU A 1 68 ? -1.157  12.718  -14.111 1.00 0.00 ? 69 GLU A O    1  
ATOM 1101  C CB   . GLU A 1 68 ? 1.930   11.681  -14.835 1.00 0.00 ? 69 GLU A CB   1  
ATOM 1102  C CG   . GLU A 1 68 ? 2.736   12.623  -15.731 1.00 0.00 ? 69 GLU A CG   1  
ATOM 1103  C CD   . GLU A 1 68 ? 3.331   11.837  -16.900 1.00 0.00 ? 69 GLU A CD   1  
ATOM 1104  O OE1  . GLU A 1 68 ? 2.569   11.203  -17.611 1.00 0.00 ? 69 GLU A OE1  1  
ATOM 1105  O OE2  . GLU A 1 68 ? 4.539   11.882  -17.064 1.00 0.00 ? 69 GLU A OE2  1  
ATOM 1106  H H    . GLU A 1 68 ? 2.651   11.611  -12.410 1.00 0.00 ? 69 GLU A H    1  
ATOM 1107  H HA   . GLU A 1 68 ? 1.277   13.548  -13.977 1.00 0.00 ? 69 GLU A HA   1  
ATOM 1108  H HB2  . GLU A 1 68 ? 2.601   10.960  -14.367 1.00 0.00 ? 69 GLU A HB2  1  
ATOM 1109  H HB3  . GLU A 1 68 ? 1.197   11.157  -15.431 1.00 0.00 ? 69 GLU A HB3  1  
ATOM 1110  H HG2  . GLU A 1 68 ? 2.086   13.400  -16.111 1.00 0.00 ? 69 GLU A HG2  1  
ATOM 1111  H HG3  . GLU A 1 68 ? 3.533   13.070  -15.156 1.00 0.00 ? 69 GLU A HG3  1  
ATOM 1112  N N    . PHE A 1 69 ? -0.453  10.941  -13.020 1.00 0.00 ? 70 PHE A N    1  
ATOM 1113  C CA   . PHE A 1 69 ? -1.811  10.371  -12.807 1.00 0.00 ? 70 PHE A CA   1  
ATOM 1114  C C    . PHE A 1 69 ? -2.636  11.273  -11.891 1.00 0.00 ? 70 PHE A C    1  
ATOM 1115  O O    . PHE A 1 69 ? -3.851  11.262  -11.911 1.00 0.00 ? 70 PHE A O    1  
ATOM 1116  C CB   . PHE A 1 69 ? -1.609  9.061   -12.094 1.00 0.00 ? 70 PHE A CB   1  
ATOM 1117  C CG   . PHE A 1 69 ? -2.854  8.703   -11.376 1.00 0.00 ? 70 PHE A CG   1  
ATOM 1118  C CD1  . PHE A 1 69 ? -3.878  8.102   -12.073 1.00 0.00 ? 70 PHE A CD1  1  
ATOM 1119  C CD2  . PHE A 1 69 ? -2.976  9.007   -10.027 1.00 0.00 ? 70 PHE A CD2  1  
ATOM 1120  C CE1  . PHE A 1 69 ? -5.065  7.780   -11.421 1.00 0.00 ? 70 PHE A CE1  1  
ATOM 1121  C CE2  . PHE A 1 69 ? -4.162  8.691   -9.356  1.00 0.00 ? 70 PHE A CE2  1  
ATOM 1122  C CZ   . PHE A 1 69 ? -5.212  8.073   -10.056 1.00 0.00 ? 70 PHE A CZ   1  
ATOM 1123  H H    . PHE A 1 69 ? 0.317   10.461  -12.659 1.00 0.00 ? 70 PHE A H    1  
ATOM 1124  H HA   . PHE A 1 69 ? -2.327  10.182  -13.733 1.00 0.00 ? 70 PHE A HA   1  
ATOM 1125  H HB2  . PHE A 1 69 ? -1.378  8.296   -12.813 1.00 0.00 ? 70 PHE A HB2  1  
ATOM 1126  H HB3  . PHE A 1 69 ? -0.812  9.173   -11.383 1.00 0.00 ? 70 PHE A HB3  1  
ATOM 1127  H HD1  . PHE A 1 69 ? -3.746  7.890   -13.123 1.00 0.00 ? 70 PHE A HD1  1  
ATOM 1128  H HD2  . PHE A 1 69 ? -2.150  9.494   -9.510  1.00 0.00 ? 70 PHE A HD2  1  
ATOM 1129  H HE1  . PHE A 1 69 ? -5.862  7.312   -11.967 1.00 0.00 ? 70 PHE A HE1  1  
ATOM 1130  H HE2  . PHE A 1 69 ? -4.270  8.923   -8.309  1.00 0.00 ? 70 PHE A HE2  1  
ATOM 1131  H HZ   . PHE A 1 69 ? -6.131  7.827   -9.544  1.00 0.00 ? 70 PHE A HZ   1  
ATOM 1132  N N    . GLU A 1 70 ? -1.979  12.011  -11.060 1.00 0.00 ? 71 GLU A N    1  
ATOM 1133  C CA   . GLU A 1 70 ? -2.707  12.871  -10.100 1.00 0.00 ? 71 GLU A CA   1  
ATOM 1134  C C    . GLU A 1 70 ? -2.784  14.279  -10.672 1.00 0.00 ? 71 GLU A C    1  
ATOM 1135  O O    . GLU A 1 70 ? -3.482  15.140  -10.172 1.00 0.00 ? 71 GLU A O    1  
ATOM 1136  C CB   . GLU A 1 70 ? -1.948  12.895  -8.771  1.00 0.00 ? 71 GLU A CB   1  
ATOM 1137  C CG   . GLU A 1 70 ? -1.861  11.474  -8.207  1.00 0.00 ? 71 GLU A CG   1  
ATOM 1138  C CD   . GLU A 1 70 ? -1.775  11.533  -6.681  1.00 0.00 ? 71 GLU A CD   1  
ATOM 1139  O OE1  . GLU A 1 70 ? -0.673  11.662  -6.175  1.00 0.00 ? 71 GLU A OE1  1  
ATOM 1140  O OE2  . GLU A 1 70 ? -2.812  11.447  -6.045  1.00 0.00 ? 71 GLU A OE2  1  
ATOM 1141  H H    . GLU A 1 70 ? -1.006  11.987  -11.057 1.00 0.00 ? 71 GLU A H    1  
ATOM 1142  H HA   . GLU A 1 70 ? -3.694  12.465  -9.944  1.00 0.00 ? 71 GLU A HA   1  
ATOM 1143  H HB2  . GLU A 1 70 ? -0.952  13.281  -8.933  1.00 0.00 ? 71 GLU A HB2  1  
ATOM 1144  H HB3  . GLU A 1 70 ? -2.471  13.526  -8.070  1.00 0.00 ? 71 GLU A HB3  1  
ATOM 1145  H HG2  . GLU A 1 70 ? -2.742  10.919  -8.497  1.00 0.00 ? 71 GLU A HG2  1  
ATOM 1146  H HG3  . GLU A 1 70 ? -0.981  10.980  -8.597  1.00 0.00 ? 71 GLU A HG3  1  
ATOM 1147  N N    . ALA A 1 71 ? -2.044  14.510  -11.715 1.00 0.00 ? 72 ALA A N    1  
ATOM 1148  C CA   . ALA A 1 71 ? -2.012  15.841  -12.353 1.00 0.00 ? 72 ALA A CA   1  
ATOM 1149  C C    . ALA A 1 71 ? -3.124  15.947  -13.400 1.00 0.00 ? 72 ALA A C    1  
ATOM 1150  O O    . ALA A 1 71 ? -2.986  16.628  -14.397 1.00 0.00 ? 72 ALA A O    1  
ATOM 1151  C CB   . ALA A 1 71 ? -0.651  15.982  -13.020 1.00 0.00 ? 72 ALA A CB   1  
ATOM 1152  H H    . ALA A 1 71 ? -1.485  13.796  -12.078 1.00 0.00 ? 72 ALA A H    1  
ATOM 1153  H HA   . ALA A 1 71 ? -2.132  16.610  -11.606 1.00 0.00 ? 72 ALA A HA   1  
ATOM 1154  H HB1  . ALA A 1 71 ? -0.073  15.083  -12.822 1.00 0.00 ? 72 ALA A HB1  1  
ATOM 1155  H HB2  . ALA A 1 71 ? -0.779  16.102  -14.085 1.00 0.00 ? 72 ALA A HB2  1  
ATOM 1156  H HB3  . ALA A 1 71 ? -0.136  16.841  -12.617 1.00 0.00 ? 72 ALA A HB3  1  
ATOM 1157  N N    . ASN A 1 72 ? -4.224  15.278  -13.184 1.00 0.00 ? 73 ASN A N    1  
ATOM 1158  C CA   . ASN A 1 72 ? -5.340  15.343  -14.169 1.00 0.00 ? 73 ASN A CA   1  
ATOM 1159  C C    . ASN A 1 72 ? -6.541  16.051  -13.534 1.00 0.00 ? 73 ASN A C    1  
ATOM 1160  O O    . ASN A 1 72 ? -7.664  15.901  -13.974 1.00 0.00 ? 73 ASN A O    1  
ATOM 1161  C CB   . ASN A 1 72 ? -5.738  13.922  -14.583 1.00 0.00 ? 73 ASN A CB   1  
ATOM 1162  C CG   . ASN A 1 72 ? -6.505  13.250  -13.451 1.00 0.00 ? 73 ASN A CG   1  
ATOM 1163  O OD1  . ASN A 1 72 ? -6.182  13.422  -12.291 1.00 0.00 ? 73 ASN A OD1  1  
ATOM 1164  N ND2  . ASN A 1 72 ? -7.513  12.484  -13.744 1.00 0.00 ? 73 ASN A ND2  1  
ATOM 1165  H H    . ASN A 1 72 ? -4.317  14.733  -12.374 1.00 0.00 ? 73 ASN A H    1  
ATOM 1166  H HA   . ASN A 1 72 ? -5.018  15.894  -15.040 1.00 0.00 ? 73 ASN A HA   1  
ATOM 1167  H HB2  . ASN A 1 72 ? -6.369  13.964  -15.457 1.00 0.00 ? 73 ASN A HB2  1  
ATOM 1168  H HB3  . ASN A 1 72 ? -4.852  13.348  -14.803 1.00 0.00 ? 73 ASN A HB3  1  
ATOM 1169  H HD21 . ASN A 1 72 ? -7.771  12.346  -14.679 1.00 0.00 ? 73 ASN A HD21 1  
ATOM 1170  H HD22 . ASN A 1 72 ? -8.014  12.046  -13.033 1.00 0.00 ? 73 ASN A HD22 1  
ATOM 1171  N N    . GLY A 1 73 ? -6.314  16.820  -12.504 1.00 0.00 ? 74 GLY A N    1  
ATOM 1172  C CA   . GLY A 1 73 ? -7.443  17.535  -11.843 1.00 0.00 ? 74 GLY A CA   1  
ATOM 1173  C C    . GLY A 1 73 ? -8.341  18.168  -12.907 1.00 0.00 ? 74 GLY A C    1  
ATOM 1174  O O    . GLY A 1 73 ? -9.492  18.434  -12.600 1.00 0.00 ? 74 GLY A O    1  
ATOM 1175  O OXT  . GLY A 1 73 ? -7.863  18.379  -14.009 1.00 0.00 ? 74 GLY A OXT  1  
ATOM 1176  H H    . GLY A 1 73 ? -5.400  16.927  -12.165 1.00 0.00 ? 74 GLY A H    1  
ATOM 1177  H HA2  . GLY A 1 73 ? -8.017  16.833  -11.255 1.00 0.00 ? 74 GLY A HA2  1  
ATOM 1178  H HA3  . GLY A 1 73 ? -7.052  18.309  -11.200 1.00 0.00 ? 74 GLY A HA3  1  
ATOM 1179  N N    . SER A 1 1  ? -2.915  7.355   -20.405 1.00 0.00 ? 2  SER A N    2  
ATOM 1180  C CA   . SER A 1 1  ? -2.442  7.482   -18.997 1.00 0.00 ? 2  SER A CA   2  
ATOM 1181  C C    . SER A 1 1  ? -3.610  7.236   -18.041 1.00 0.00 ? 2  SER A C    2  
ATOM 1182  O O    . SER A 1 1  ? -4.708  7.710   -18.254 1.00 0.00 ? 2  SER A O    2  
ATOM 1183  C CB   . SER A 1 1  ? -1.888  8.887   -18.769 1.00 0.00 ? 2  SER A CB   2  
ATOM 1184  O OG   . SER A 1 1  ? -0.854  8.831   -17.795 1.00 0.00 ? 2  SER A OG   2  
ATOM 1185  H H    . SER A 1 1  ? -3.606  7.961   -20.747 1.00 0.00 ? 2  SER A H    2  
ATOM 1186  H HA   . SER A 1 1  ? -1.665  6.754   -18.811 1.00 0.00 ? 2  SER A HA   2  
ATOM 1187  H HB2  . SER A 1 1  ? -1.487  9.273   -19.690 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1188  H HB3  . SER A 1 1  ? -2.685  9.535   -18.426 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1189  H HG   . SER A 1 1  ? -0.014  8.910   -18.251 1.00 0.00 ? 2  SER A HG   2  
ATOM 1190  N N    . ASP A 1 2  ? -3.383  6.500   -16.987 1.00 0.00 ? 3  ASP A N    2  
ATOM 1191  C CA   . ASP A 1 2  ? -4.484  6.228   -16.021 1.00 0.00 ? 3  ASP A CA   2  
ATOM 1192  C C    . ASP A 1 2  ? -3.900  5.694   -14.711 1.00 0.00 ? 3  ASP A C    2  
ATOM 1193  O O    . ASP A 1 2  ? -2.741  5.896   -14.408 1.00 0.00 ? 3  ASP A O    2  
ATOM 1194  C CB   . ASP A 1 2  ? -5.438  5.192   -16.614 1.00 0.00 ? 3  ASP A CB   2  
ATOM 1195  C CG   . ASP A 1 2  ? -6.861  5.475   -16.127 1.00 0.00 ? 3  ASP A CG   2  
ATOM 1196  O OD1  . ASP A 1 2  ? -7.243  6.633   -16.119 1.00 0.00 ? 3  ASP A OD1  2  
ATOM 1197  O OD2  . ASP A 1 2  ? -7.544  4.528   -15.772 1.00 0.00 ? 3  ASP A OD2  2  
ATOM 1198  H H    . ASP A 1 2  ? -2.490  6.128   -16.832 1.00 0.00 ? 3  ASP A H    2  
ATOM 1199  H HA   . ASP A 1 2  ? -5.025  7.143   -15.826 1.00 0.00 ? 3  ASP A HA   2  
ATOM 1200  H HB2  . ASP A 1 2  ? -5.407  5.249   -17.693 1.00 0.00 ? 3  ASP A HB2  2  
ATOM 1201  H HB3  . ASP A 1 2  ? -5.141  4.204   -16.295 1.00 0.00 ? 3  ASP A HB3  2  
ATOM 1202  N N    . LYS A 1 3  ? -4.696  5.016   -13.930 1.00 0.00 ? 4  LYS A N    2  
ATOM 1203  C CA   . LYS A 1 3  ? -4.188  4.472   -12.640 1.00 0.00 ? 4  LYS A CA   2  
ATOM 1204  C C    . LYS A 1 3  ? -2.946  3.606   -12.903 1.00 0.00 ? 4  LYS A C    2  
ATOM 1205  O O    . LYS A 1 3  ? -2.986  2.707   -13.720 1.00 0.00 ? 4  LYS A O    2  
ATOM 1206  C CB   . LYS A 1 3  ? -5.276  3.616   -11.987 1.00 0.00 ? 4  LYS A CB   2  
ATOM 1207  C CG   . LYS A 1 3  ? -4.736  3.010   -10.693 1.00 0.00 ? 4  LYS A CG   2  
ATOM 1208  C CD   . LYS A 1 3  ? -5.653  3.388   -9.528  1.00 0.00 ? 4  LYS A CD   2  
ATOM 1209  C CE   . LYS A 1 3  ? -7.036  2.772   -9.749  1.00 0.00 ? 4  LYS A CE   2  
ATOM 1210  N NZ   . LYS A 1 3  ? -7.635  2.406   -8.433  1.00 0.00 ? 4  LYS A NZ   2  
ATOM 1211  H H    . LYS A 1 3  ? -5.628  4.866   -14.191 1.00 0.00 ? 4  LYS A H    2  
ATOM 1212  H HA   . LYS A 1 3  ? -3.934  5.290   -11.985 1.00 0.00 ? 4  LYS A HA   2  
ATOM 1213  H HB2  . LYS A 1 3  ? -6.135  4.235   -11.765 1.00 0.00 ? 4  LYS A HB2  2  
ATOM 1214  H HB3  . LYS A 1 3  ? -5.566  2.824   -12.660 1.00 0.00 ? 4  LYS A HB3  2  
ATOM 1215  H HG2  . LYS A 1 3  ? -4.697  1.934   -10.788 1.00 0.00 ? 4  LYS A HG2  2  
ATOM 1216  H HG3  . LYS A 1 3  ? -3.744  3.392   -10.504 1.00 0.00 ? 4  LYS A HG3  2  
ATOM 1217  H HD2  . LYS A 1 3  ? -5.235  3.013   -8.605  1.00 0.00 ? 4  LYS A HD2  2  
ATOM 1218  H HD3  . LYS A 1 3  ? -5.743  4.463   -9.474  1.00 0.00 ? 4  LYS A HD3  2  
ATOM 1219  H HE2  . LYS A 1 3  ? -7.673  3.489   -10.247 1.00 0.00 ? 4  LYS A HE2  2  
ATOM 1220  H HE3  . LYS A 1 3  ? -6.943  1.887   -10.361 1.00 0.00 ? 4  LYS A HE3  2  
ATOM 1221  H HZ1  . LYS A 1 3  ? -6.985  2.676   -7.669  1.00 0.00 ? 4  LYS A HZ1  2  
ATOM 1222  H HZ2  . LYS A 1 3  ? -8.537  2.908   -8.311  1.00 0.00 ? 4  LYS A HZ2  2  
ATOM 1223  H HZ3  . LYS A 1 3  ? -7.801  1.379   -8.403  1.00 0.00 ? 4  LYS A HZ3  2  
ATOM 1224  N N    . PRO A 1 4  ? -1.876  3.903   -12.203 1.00 0.00 ? 5  PRO A N    2  
ATOM 1225  C CA   . PRO A 1 4  ? -0.607  3.171   -12.339 1.00 0.00 ? 5  PRO A CA   2  
ATOM 1226  C C    . PRO A 1 4  ? -0.652  1.825   -11.622 1.00 0.00 ? 5  PRO A C    2  
ATOM 1227  O O    . PRO A 1 4  ? -1.494  1.577   -10.782 1.00 0.00 ? 5  PRO A O    2  
ATOM 1228  C CB   . PRO A 1 4  ? 0.419   4.079   -11.694 1.00 0.00 ? 5  PRO A CB   2  
ATOM 1229  C CG   . PRO A 1 4  ? -0.360  5.004   -10.751 1.00 0.00 ? 5  PRO A CG   2  
ATOM 1230  C CD   . PRO A 1 4  ? -1.827  4.992   -11.215 1.00 0.00 ? 5  PRO A CD   2  
ATOM 1231  H HA   . PRO A 1 4  ? -0.354  3.047   -13.361 1.00 0.00 ? 5  PRO A HA   2  
ATOM 1232  H HB2  . PRO A 1 4  ? 1.133   3.486   -11.136 1.00 0.00 ? 5  PRO A HB2  2  
ATOM 1233  H HB3  . PRO A 1 4  ? 0.921   4.659   -12.448 1.00 0.00 ? 5  PRO A HB3  2  
ATOM 1234  H HG2  . PRO A 1 4  ? -0.285  4.634   -9.744  1.00 0.00 ? 5  PRO A HG2  2  
ATOM 1235  H HG3  . PRO A 1 4  ? 0.033   5.998   -10.819 1.00 0.00 ? 5  PRO A HG3  2  
ATOM 1236  H HD2  . PRO A 1 4  ? -2.485  4.783   -10.383 1.00 0.00 ? 5  PRO A HD2  2  
ATOM 1237  H HD3  . PRO A 1 4  ? -2.085  5.931   -11.680 1.00 0.00 ? 5  PRO A HD3  2  
ATOM 1238  N N    . LYS A 1 5  ? 0.266   0.961   -11.947 1.00 0.00 ? 6  LYS A N    2  
ATOM 1239  C CA   . LYS A 1 5  ? 0.310   -0.372  -11.291 1.00 0.00 ? 6  LYS A CA   2  
ATOM 1240  C C    . LYS A 1 5  ? 0.800   -0.205  -9.854  1.00 0.00 ? 6  LYS A C    2  
ATOM 1241  O O    . LYS A 1 5  ? 1.975   -0.324  -9.565  1.00 0.00 ? 6  LYS A O    2  
ATOM 1242  C CB   . LYS A 1 5  ? 1.261   -1.276  -12.062 1.00 0.00 ? 6  LYS A CB   2  
ATOM 1243  C CG   . LYS A 1 5  ? 2.602   -0.565  -12.255 1.00 0.00 ? 6  LYS A CG   2  
ATOM 1244  C CD   . LYS A 1 5  ? 3.731   -1.449  -11.719 1.00 0.00 ? 6  LYS A CD   2  
ATOM 1245  C CE   . LYS A 1 5  ? 3.994   -2.593  -12.701 1.00 0.00 ? 6  LYS A CE   2  
ATOM 1246  N NZ   . LYS A 1 5  ? 3.029   -3.699  -12.446 1.00 0.00 ? 6  LYS A NZ   2  
ATOM 1247  H H    . LYS A 1 5  ? 0.935   1.196   -12.621 1.00 0.00 ? 6  LYS A H    2  
ATOM 1248  H HA   . LYS A 1 5  ? -0.673  -0.810  -11.289 1.00 0.00 ? 6  LYS A HA   2  
ATOM 1249  H HB2  . LYS A 1 5  ? 1.407   -2.192  -11.513 1.00 0.00 ? 6  LYS A HB2  2  
ATOM 1250  H HB3  . LYS A 1 5  ? 0.830   -1.493  -13.024 1.00 0.00 ? 6  LYS A HB3  2  
ATOM 1251  H HG2  . LYS A 1 5  ? 2.760   -0.376  -13.307 1.00 0.00 ? 6  LYS A HG2  2  
ATOM 1252  H HG3  . LYS A 1 5  ? 2.595   0.372   -11.718 1.00 0.00 ? 6  LYS A HG3  2  
ATOM 1253  H HD2  . LYS A 1 5  ? 4.627   -0.855  -11.607 1.00 0.00 ? 6  LYS A HD2  2  
ATOM 1254  H HD3  . LYS A 1 5  ? 3.445   -1.856  -10.761 1.00 0.00 ? 6  LYS A HD3  2  
ATOM 1255  H HE2  . LYS A 1 5  ? 3.874   -2.235  -13.712 1.00 0.00 ? 6  LYS A HE2  2  
ATOM 1256  H HE3  . LYS A 1 5  ? 5.002   -2.957  -12.566 1.00 0.00 ? 6  LYS A HE3  2  
ATOM 1257  H HZ1  . LYS A 1 5  ? 2.659   -3.623  -11.478 1.00 0.00 ? 6  LYS A HZ1  2  
ATOM 1258  H HZ2  . LYS A 1 5  ? 2.241   -3.634  -13.125 1.00 0.00 ? 6  LYS A HZ2  2  
ATOM 1259  H HZ3  . LYS A 1 5  ? 3.510   -4.613  -12.560 1.00 0.00 ? 6  LYS A HZ3  2  
ATOM 1260  N N    . ARG A 1 6  ? -0.094  0.088   -8.954  1.00 0.00 ? 7  ARG A N    2  
ATOM 1261  C CA   . ARG A 1 6  ? 0.303   0.287   -7.532  1.00 0.00 ? 7  ARG A CA   2  
ATOM 1262  C C    . ARG A 1 6  ? 1.237   -0.839  -7.074  1.00 0.00 ? 7  ARG A C    2  
ATOM 1263  O O    . ARG A 1 6  ? 1.178   -1.942  -7.582  1.00 0.00 ? 7  ARG A O    2  
ATOM 1264  C CB   . ARG A 1 6  ? -0.948  0.298   -6.653  1.00 0.00 ? 7  ARG A CB   2  
ATOM 1265  C CG   . ARG A 1 6  ? -1.805  1.516   -7.000  1.00 0.00 ? 7  ARG A CG   2  
ATOM 1266  C CD   . ARG A 1 6  ? -3.258  1.251   -6.602  1.00 0.00 ? 7  ARG A CD   2  
ATOM 1267  N NE   . ARG A 1 6  ? -3.682  -0.077  -7.127  1.00 0.00 ? 7  ARG A NE   2  
ATOM 1268  C CZ   . ARG A 1 6  ? -4.593  -0.766  -6.497  1.00 0.00 ? 7  ARG A CZ   2  
ATOM 1269  N NH1  . ARG A 1 6  ? -5.804  -0.296  -6.384  1.00 0.00 ? 7  ARG A NH1  2  
ATOM 1270  N NH2  . ARG A 1 6  ? -4.292  -1.927  -5.981  1.00 0.00 ? 7  ARG A NH2  2  
ATOM 1271  H H    . ARG A 1 6  ? -1.033  0.188   -9.218  1.00 0.00 ? 7  ARG A H    2  
ATOM 1272  H HA   . ARG A 1 6  ? 0.813   1.235   -7.436  1.00 0.00 ? 7  ARG A HA   2  
ATOM 1273  H HB2  . ARG A 1 6  ? -1.517  -0.605  -6.825  1.00 0.00 ? 7  ARG A HB2  2  
ATOM 1274  H HB3  . ARG A 1 6  ? -0.657  0.349   -5.614  1.00 0.00 ? 7  ARG A HB3  2  
ATOM 1275  H HG2  . ARG A 1 6  ? -1.436  2.379   -6.465  1.00 0.00 ? 7  ARG A HG2  2  
ATOM 1276  H HG3  . ARG A 1 6  ? -1.754  1.702   -8.062  1.00 0.00 ? 7  ARG A HG3  2  
ATOM 1277  H HD2  . ARG A 1 6  ? -3.343  1.256   -5.525  1.00 0.00 ? 7  ARG A HD2  2  
ATOM 1278  H HD3  . ARG A 1 6  ? -3.890  2.021   -7.017  1.00 0.00 ? 7  ARG A HD3  2  
ATOM 1279  H HE   . ARG A 1 6  ? -3.280  -0.431  -7.948  1.00 0.00 ? 7  ARG A HE   2  
ATOM 1280  H HH11 . ARG A 1 6  ? -6.034  0.593   -6.782  1.00 0.00 ? 7  ARG A HH11 2  
ATOM 1281  H HH12 . ARG A 1 6  ? -6.503  -0.822  -5.900  1.00 0.00 ? 7  ARG A HH12 2  
ATOM 1282  H HH21 . ARG A 1 6  ? -3.363  -2.287  -6.068  1.00 0.00 ? 7  ARG A HH21 2  
ATOM 1283  H HH22 . ARG A 1 6  ? -4.990  -2.455  -5.498  1.00 0.00 ? 7  ARG A HH22 2  
ATOM 1284  N N    . PRO A 1 7  ? 2.067   -0.518  -6.111  1.00 0.00 ? 8  PRO A N    2  
ATOM 1285  C CA   . PRO A 1 7  ? 3.031   -1.468  -5.528  1.00 0.00 ? 8  PRO A CA   2  
ATOM 1286  C C    . PRO A 1 7  ? 2.306   -2.484  -4.647  1.00 0.00 ? 8  PRO A C    2  
ATOM 1287  O O    . PRO A 1 7  ? 1.372   -2.158  -3.942  1.00 0.00 ? 8  PRO A O    2  
ATOM 1288  C CB   . PRO A 1 7  ? 3.955   -0.577  -4.691  1.00 0.00 ? 8  PRO A CB   2  
ATOM 1289  C CG   . PRO A 1 7  ? 3.154   0.712   -4.392  1.00 0.00 ? 8  PRO A CG   2  
ATOM 1290  C CD   . PRO A 1 7  ? 2.113   0.830   -5.516  1.00 0.00 ? 8  PRO A CD   2  
ATOM 1291  H HA   . PRO A 1 7  ? 3.595   -1.963  -6.300  1.00 0.00 ? 8  PRO A HA   2  
ATOM 1292  H HB2  . PRO A 1 7  ? 4.218   -1.079  -3.769  1.00 0.00 ? 8  PRO A HB2  2  
ATOM 1293  H HB3  . PRO A 1 7  ? 4.845   -0.332  -5.250  1.00 0.00 ? 8  PRO A HB3  2  
ATOM 1294  H HG2  . PRO A 1 7  ? 2.660   0.627   -3.434  1.00 0.00 ? 8  PRO A HG2  2  
ATOM 1295  H HG3  . PRO A 1 7  ? 3.802   1.577   -4.402  1.00 0.00 ? 8  PRO A HG3  2  
ATOM 1296  H HD2  . PRO A 1 7  ? 1.148   1.107   -5.118  1.00 0.00 ? 8  PRO A HD2  2  
ATOM 1297  H HD3  . PRO A 1 7  ? 2.439   1.540   -6.257  1.00 0.00 ? 8  PRO A HD3  2  
ATOM 1298  N N    . LEU A 1 8  ? 2.725   -3.716  -4.690  1.00 0.00 ? 9  LEU A N    2  
ATOM 1299  C CA   . LEU A 1 8  ? 2.060   -4.756  -3.869  1.00 0.00 ? 9  LEU A CA   2  
ATOM 1300  C C    . LEU A 1 8  ? 3.071   -5.846  -3.493  1.00 0.00 ? 9  LEU A C    2  
ATOM 1301  O O    . LEU A 1 8  ? 4.076   -6.032  -4.150  1.00 0.00 ? 9  LEU A O    2  
ATOM 1302  C CB   . LEU A 1 8  ? 0.891   -5.330  -4.666  1.00 0.00 ? 9  LEU A CB   2  
ATOM 1303  C CG   . LEU A 1 8  ? 1.380   -5.778  -6.033  1.00 0.00 ? 9  LEU A CG   2  
ATOM 1304  C CD1  . LEU A 1 8  ? 2.223   -7.022  -5.843  1.00 0.00 ? 9  LEU A CD1  2  
ATOM 1305  C CD2  . LEU A 1 8  ? 0.180   -6.099  -6.924  1.00 0.00 ? 9  LEU A CD2  2  
ATOM 1306  H H    . LEU A 1 8  ? 3.471   -3.957  -5.269  1.00 0.00 ? 9  LEU A H    2  
ATOM 1307  H HA   . LEU A 1 8  ? 1.682   -4.317  -2.973  1.00 0.00 ? 9  LEU A HA   2  
ATOM 1308  H HB2  . LEU A 1 8  ? 0.473   -6.172  -4.136  1.00 0.00 ? 9  LEU A HB2  2  
ATOM 1309  H HB3  . LEU A 1 8  ? 0.139   -4.569  -4.788  1.00 0.00 ? 9  LEU A HB3  2  
ATOM 1310  H HG   . LEU A 1 8  ? 1.977   -4.997  -6.484  1.00 0.00 ? 9  LEU A HG   2  
ATOM 1311  H HD11 . LEU A 1 8  ? 2.040   -7.405  -4.852  1.00 0.00 ? 9  LEU A HD11 2  
ATOM 1312  H HD12 . LEU A 1 8  ? 1.953   -7.765  -6.579  1.00 0.00 ? 9  LEU A HD12 2  
ATOM 1313  H HD13 . LEU A 1 8  ? 3.265   -6.767  -5.942  1.00 0.00 ? 9  LEU A HD13 2  
ATOM 1314  H HD21 . LEU A 1 8  ? -0.535  -5.292  -6.863  1.00 0.00 ? 9  LEU A HD21 2  
ATOM 1315  H HD22 . LEU A 1 8  ? 0.509   -6.215  -7.946  1.00 0.00 ? 9  LEU A HD22 2  
ATOM 1316  H HD23 . LEU A 1 8  ? -0.281  -7.015  -6.586  1.00 0.00 ? 9  LEU A HD23 2  
ATOM 1317  N N    . SER A 1 9  ? 2.813   -6.555  -2.428  1.00 0.00 ? 10 SER A N    2  
ATOM 1318  C CA   . SER A 1 9  ? 3.753   -7.627  -1.977  1.00 0.00 ? 10 SER A CA   2  
ATOM 1319  C C    . SER A 1 9  ? 4.215   -8.480  -3.164  1.00 0.00 ? 10 SER A C    2  
ATOM 1320  O O    . SER A 1 9  ? 3.530   -8.612  -4.158  1.00 0.00 ? 10 SER A O    2  
ATOM 1321  C CB   . SER A 1 9  ? 3.044   -8.524  -0.962  1.00 0.00 ? 10 SER A CB   2  
ATOM 1322  O OG   . SER A 1 9  ? 2.690   -7.754  0.181   1.00 0.00 ? 10 SER A OG   2  
ATOM 1323  H H    . SER A 1 9  ? 2.001   -6.372  -1.912  1.00 0.00 ? 10 SER A H    2  
ATOM 1324  H HA   . SER A 1 9  ? 4.615   -7.175  -1.510  1.00 0.00 ? 10 SER A HA   2  
ATOM 1325  H HB2  . SER A 1 9  ? 2.150   -8.934  -1.403  1.00 0.00 ? 10 SER A HB2  2  
ATOM 1326  H HB3  . SER A 1 9  ? 3.703   -9.332  -0.675  1.00 0.00 ? 10 SER A HB3  2  
ATOM 1327  H HG   . SER A 1 9  ? 2.357   -8.354  0.850   1.00 0.00 ? 10 SER A HG   2  
ATOM 1328  N N    . ALA A 1 10 ? 5.374   -9.070  -3.060  1.00 0.00 ? 11 ALA A N    2  
ATOM 1329  C CA   . ALA A 1 10 ? 5.882   -9.923  -4.172  1.00 0.00 ? 11 ALA A CA   2  
ATOM 1330  C C    . ALA A 1 10 ? 4.901   -11.074 -4.409  1.00 0.00 ? 11 ALA A C    2  
ATOM 1331  O O    . ALA A 1 10 ? 4.556   -11.391 -5.531  1.00 0.00 ? 11 ALA A O    2  
ATOM 1332  C CB   . ALA A 1 10 ? 7.253   -10.489 -3.797  1.00 0.00 ? 11 ALA A CB   2  
ATOM 1333  H H    . ALA A 1 10 ? 5.909   -8.957  -2.246  1.00 0.00 ? 11 ALA A H    2  
ATOM 1334  H HA   . ALA A 1 10 ? 5.968   -9.331  -5.071  1.00 0.00 ? 11 ALA A HA   2  
ATOM 1335  H HB1  . ALA A 1 10 ? 7.666   -9.919  -2.978  1.00 0.00 ? 11 ALA A HB1  2  
ATOM 1336  H HB2  . ALA A 1 10 ? 7.147   -11.523 -3.498  1.00 0.00 ? 11 ALA A HB2  2  
ATOM 1337  H HB3  . ALA A 1 10 ? 7.914   -10.426 -4.648  1.00 0.00 ? 11 ALA A HB3  2  
ATOM 1338  N N    . TYR A 1 11 ? 4.440   -11.693 -3.355  1.00 0.00 ? 12 TYR A N    2  
ATOM 1339  C CA   . TYR A 1 11 ? 3.475   -12.809 -3.507  1.00 0.00 ? 12 TYR A CA   2  
ATOM 1340  C C    . TYR A 1 11 ? 2.247   -12.301 -4.259  1.00 0.00 ? 12 TYR A C    2  
ATOM 1341  O O    . TYR A 1 11 ? 1.521   -13.055 -4.875  1.00 0.00 ? 12 TYR A O    2  
ATOM 1342  C CB   . TYR A 1 11 ? 3.068   -13.283 -2.116  1.00 0.00 ? 12 TYR A CB   2  
ATOM 1343  C CG   . TYR A 1 11 ? 1.876   -14.200 -2.221  1.00 0.00 ? 12 TYR A CG   2  
ATOM 1344  C CD1  . TYR A 1 11 ? 1.963   -15.366 -2.988  1.00 0.00 ? 12 TYR A CD1  2  
ATOM 1345  C CD2  . TYR A 1 11 ? 0.685   -13.887 -1.555  1.00 0.00 ? 12 TYR A CD2  2  
ATOM 1346  C CE1  . TYR A 1 11 ? 0.861   -16.222 -3.090  1.00 0.00 ? 12 TYR A CE1  2  
ATOM 1347  C CE2  . TYR A 1 11 ? -0.418  -14.743 -1.655  1.00 0.00 ? 12 TYR A CE2  2  
ATOM 1348  C CZ   . TYR A 1 11 ? -0.330  -15.911 -2.423  1.00 0.00 ? 12 TYR A CZ   2  
ATOM 1349  O OH   . TYR A 1 11 ? -1.418  -16.755 -2.521  1.00 0.00 ? 12 TYR A OH   2  
ATOM 1350  H H    . TYR A 1 11 ? 4.719   -11.417 -2.458  1.00 0.00 ? 12 TYR A H    2  
ATOM 1351  H HA   . TYR A 1 11 ? 3.931   -13.622 -4.052  1.00 0.00 ? 12 TYR A HA   2  
ATOM 1352  H HB2  . TYR A 1 11 ? 3.894   -13.811 -1.664  1.00 0.00 ? 12 TYR A HB2  2  
ATOM 1353  H HB3  . TYR A 1 11 ? 2.818   -12.425 -1.510  1.00 0.00 ? 12 TYR A HB3  2  
ATOM 1354  H HD1  . TYR A 1 11 ? 2.879   -15.606 -3.501  1.00 0.00 ? 12 TYR A HD1  2  
ATOM 1355  H HD2  . TYR A 1 11 ? 0.617   -12.985 -0.965  1.00 0.00 ? 12 TYR A HD2  2  
ATOM 1356  H HE1  . TYR A 1 11 ? 0.931   -17.122 -3.684  1.00 0.00 ? 12 TYR A HE1  2  
ATOM 1357  H HE2  . TYR A 1 11 ? -1.336  -14.502 -1.141  1.00 0.00 ? 12 TYR A HE2  2  
ATOM 1358  H HH   . TYR A 1 11 ? -2.056  -16.495 -1.852  1.00 0.00 ? 12 TYR A HH   2  
ATOM 1359  N N    . MET A 1 12 ? 2.012   -11.019 -4.207  1.00 0.00 ? 13 MET A N    2  
ATOM 1360  C CA   . MET A 1 12 ? 0.836   -10.445 -4.910  1.00 0.00 ? 13 MET A CA   2  
ATOM 1361  C C    . MET A 1 12 ? 1.144   -10.313 -6.406  1.00 0.00 ? 13 MET A C    2  
ATOM 1362  O O    . MET A 1 12 ? 0.284   -10.519 -7.236  1.00 0.00 ? 13 MET A O    2  
ATOM 1363  C CB   . MET A 1 12 ? 0.512   -9.072  -4.319  1.00 0.00 ? 13 MET A CB   2  
ATOM 1364  C CG   . MET A 1 12 ? -0.707  -9.184  -3.400  1.00 0.00 ? 13 MET A CG   2  
ATOM 1365  S SD   . MET A 1 12 ? -2.216  -8.914  -4.360  1.00 0.00 ? 13 MET A SD   2  
ATOM 1366  C CE   . MET A 1 12 ? -2.616  -10.656 -4.644  1.00 0.00 ? 13 MET A CE   2  
ATOM 1367  H H    . MET A 1 12 ? 2.613   -10.434 -3.701  1.00 0.00 ? 13 MET A H    2  
ATOM 1368  H HA   . MET A 1 12 ? -0.015  -11.101 -4.777  1.00 0.00 ? 13 MET A HA   2  
ATOM 1369  H HB2  . MET A 1 12 ? 1.359   -8.717  -3.751  1.00 0.00 ? 13 MET A HB2  2  
ATOM 1370  H HB3  . MET A 1 12 ? 0.295   -8.377  -5.117  1.00 0.00 ? 13 MET A HB3  2  
ATOM 1371  H HG2  . MET A 1 12 ? -0.732  -10.168 -2.957  1.00 0.00 ? 13 MET A HG2  2  
ATOM 1372  H HG3  . MET A 1 12 ? -0.638  -8.440  -2.619  1.00 0.00 ? 13 MET A HG3  2  
ATOM 1373  H HE1  . MET A 1 12 ? -2.097  -11.267 -3.917  1.00 0.00 ? 13 MET A HE1  2  
ATOM 1374  H HE2  . MET A 1 12 ? -3.683  -10.801 -4.546  1.00 0.00 ? 13 MET A HE2  2  
ATOM 1375  H HE3  . MET A 1 12 ? -2.308  -10.940 -5.637  1.00 0.00 ? 13 MET A HE3  2  
ATOM 1376  N N    . LEU A 1 13 ? 2.362   -9.987  -6.770  1.00 0.00 ? 14 LEU A N    2  
ATOM 1377  C CA   . LEU A 1 13 ? 2.679   -9.873  -8.227  1.00 0.00 ? 14 LEU A CA   2  
ATOM 1378  C C    . LEU A 1 13 ? 2.465   -11.240 -8.872  1.00 0.00 ? 14 LEU A C    2  
ATOM 1379  O O    . LEU A 1 13 ? 1.730   -11.381 -9.829  1.00 0.00 ? 14 LEU A O    2  
ATOM 1380  C CB   . LEU A 1 13 ? 4.135   -9.440  -8.447  1.00 0.00 ? 14 LEU A CB   2  
ATOM 1381  C CG   . LEU A 1 13 ? 4.443   -8.196  -7.604  1.00 0.00 ? 14 LEU A CG   2  
ATOM 1382  C CD1  . LEU A 1 13 ? 5.953   -7.929  -7.599  1.00 0.00 ? 14 LEU A CD1  2  
ATOM 1383  C CD2  . LEU A 1 13 ? 3.723   -6.988  -8.209  1.00 0.00 ? 14 LEU A CD2  2  
ATOM 1384  H H    . LEU A 1 13 ? 3.058   -9.829  -6.095  1.00 0.00 ? 14 LEU A H    2  
ATOM 1385  H HA   . LEU A 1 13 ? 2.012   -9.156  -8.683  1.00 0.00 ? 14 LEU A HA   2  
ATOM 1386  H HB2  . LEU A 1 13 ? 4.807   -10.252 -8.179  1.00 0.00 ? 14 LEU A HB2  2  
ATOM 1387  H HB3  . LEU A 1 13 ? 4.274   -9.201  -9.490  1.00 0.00 ? 14 LEU A HB3  2  
ATOM 1388  H HG   . LEU A 1 13 ? 4.102   -8.352  -6.591  1.00 0.00 ? 14 LEU A HG   2  
ATOM 1389  H HD11 . LEU A 1 13 ? 6.379   -8.257  -8.536  1.00 0.00 ? 14 LEU A HD11 2  
ATOM 1390  H HD12 . LEU A 1 13 ? 6.134   -6.867  -7.474  1.00 0.00 ? 14 LEU A HD12 2  
ATOM 1391  H HD13 . LEU A 1 13 ? 6.412   -8.471  -6.786  1.00 0.00 ? 14 LEU A HD13 2  
ATOM 1392  H HD21 . LEU A 1 13 ? 2.660   -7.178  -8.235  1.00 0.00 ? 14 LEU A HD21 2  
ATOM 1393  H HD22 . LEU A 1 13 ? 3.918   -6.114  -7.604  1.00 0.00 ? 14 LEU A HD22 2  
ATOM 1394  H HD23 . LEU A 1 13 ? 4.083   -6.819  -9.213  1.00 0.00 ? 14 LEU A HD23 2  
ATOM 1395  N N    . TRP A 1 14 ? 3.092   -12.253 -8.343  1.00 0.00 ? 15 TRP A N    2  
ATOM 1396  C CA   . TRP A 1 14 ? 2.915   -13.616 -8.912  1.00 0.00 ? 15 TRP A CA   2  
ATOM 1397  C C    . TRP A 1 14 ? 1.427   -13.959 -8.897  1.00 0.00 ? 15 TRP A C    2  
ATOM 1398  O O    . TRP A 1 14 ? 0.912   -14.592 -9.797  1.00 0.00 ? 15 TRP A O    2  
ATOM 1399  C CB   . TRP A 1 14 ? 3.681   -14.620 -8.052  1.00 0.00 ? 15 TRP A CB   2  
ATOM 1400  C CG   . TRP A 1 14 ? 3.344   -16.010 -8.480  1.00 0.00 ? 15 TRP A CG   2  
ATOM 1401  C CD1  . TRP A 1 14 ? 3.991   -16.703 -9.443  1.00 0.00 ? 15 TRP A CD1  2  
ATOM 1402  C CD2  . TRP A 1 14 ? 2.298   -16.887 -7.974  1.00 0.00 ? 15 TRP A CD2  2  
ATOM 1403  N NE1  . TRP A 1 14 ? 3.403   -17.952 -9.566  1.00 0.00 ? 15 TRP A NE1  2  
ATOM 1404  C CE2  . TRP A 1 14 ? 2.354   -18.112 -8.681  1.00 0.00 ? 15 TRP A CE2  2  
ATOM 1405  C CE3  . TRP A 1 14 ? 1.315   -16.737 -6.982  1.00 0.00 ? 15 TRP A CE3  2  
ATOM 1406  C CZ2  . TRP A 1 14 ? 1.463   -19.154 -8.410  1.00 0.00 ? 15 TRP A CZ2  2  
ATOM 1407  C CZ3  . TRP A 1 14 ? 0.418   -17.780 -6.705  1.00 0.00 ? 15 TRP A CZ3  2  
ATOM 1408  C CH2  . TRP A 1 14 ? 0.491   -18.987 -7.418  1.00 0.00 ? 15 TRP A CH2  2  
ATOM 1409  H H    . TRP A 1 14 ? 3.673   -12.119 -7.563  1.00 0.00 ? 15 TRP A H    2  
ATOM 1410  H HA   . TRP A 1 14 ? 3.287   -13.641 -9.926  1.00 0.00 ? 15 TRP A HA   2  
ATOM 1411  H HB2  . TRP A 1 14 ? 4.739   -14.457 -8.170  1.00 0.00 ? 15 TRP A HB2  2  
ATOM 1412  H HB3  . TRP A 1 14 ? 3.410   -14.487 -7.016  1.00 0.00 ? 15 TRP A HB3  2  
ATOM 1413  H HD1  . TRP A 1 14 ? 4.829   -16.340 -10.022 1.00 0.00 ? 15 TRP A HD1  2  
ATOM 1414  H HE1  . TRP A 1 14 ? 3.682   -18.648 -10.197 1.00 0.00 ? 15 TRP A HE1  2  
ATOM 1415  H HE3  . TRP A 1 14 ? 1.249   -15.813 -6.427  1.00 0.00 ? 15 TRP A HE3  2  
ATOM 1416  H HZ2  . TRP A 1 14 ? 1.525   -20.080 -8.962  1.00 0.00 ? 15 TRP A HZ2  2  
ATOM 1417  H HZ3  . TRP A 1 14 ? -0.331  -17.653 -5.936  1.00 0.00 ? 15 TRP A HZ3  2  
ATOM 1418  H HH2  . TRP A 1 14 ? -0.202  -19.787 -7.202  1.00 0.00 ? 15 TRP A HH2  2  
ATOM 1419  N N    . LEU A 1 15 ? 0.736   -13.536 -7.876  1.00 0.00 ? 16 LEU A N    2  
ATOM 1420  C CA   . LEU A 1 15 ? -0.720  -13.820 -7.784  1.00 0.00 ? 16 LEU A CA   2  
ATOM 1421  C C    . LEU A 1 15 ? -1.425  -13.299 -9.038  1.00 0.00 ? 16 LEU A C    2  
ATOM 1422  O O    . LEU A 1 15 ? -2.145  -14.019 -9.701  1.00 0.00 ? 16 LEU A O    2  
ATOM 1423  C CB   . LEU A 1 15 ? -1.287  -13.108 -6.556  1.00 0.00 ? 16 LEU A CB   2  
ATOM 1424  C CG   . LEU A 1 15 ? -2.144  -14.079 -5.746  1.00 0.00 ? 16 LEU A CG   2  
ATOM 1425  C CD1  . LEU A 1 15 ? -3.274  -14.617 -6.624  1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1426  C CD2  . LEU A 1 15 ? -1.279  -15.244 -5.262  1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1427  H H    . LEU A 1 15 ? 1.178   -13.026 -7.165  1.00 0.00 ? 16 LEU A H    2  
ATOM 1428  H HA   . LEU A 1 15 ? -0.879  -14.884 -7.691  1.00 0.00 ? 16 LEU A HA   2  
ATOM 1429  H HB2  . LEU A 1 15 ? -0.473  -12.748 -5.943  1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1430  H HB3  . LEU A 1 15 ? -1.894  -12.274 -6.874  1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1431  H HG   . LEU A 1 15 ? -2.562  -13.560 -4.895  1.00 0.00 ? 16 LEU A HG   2  
ATOM 1432  H HD11 . LEU A 1 15 ? -2.854  -15.130 -7.477  1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1433  H HD12 . LEU A 1 15 ? -3.879  -15.304 -6.053  1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1434  H HD13 . LEU A 1 15 ? -3.887  -13.795 -6.965  1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1435  H HD21 . LEU A 1 15 ? -0.260  -14.909 -5.133  1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1436  H HD22 . LEU A 1 15 ? -1.660  -15.608 -4.319  1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1437  H HD23 . LEU A 1 15 ? -1.306  -16.041 -5.991  1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1438  N N    . ASN A 1 16 ? -1.228  -12.049 -9.366  1.00 0.00 ? 17 ASN A N    2  
ATOM 1439  C CA   . ASN A 1 16 ? -1.890  -11.480 -10.572 1.00 0.00 ? 17 ASN A CA   2  
ATOM 1440  C C    . ASN A 1 16 ? -1.261  -12.076 -11.831 1.00 0.00 ? 17 ASN A C    2  
ATOM 1441  O O    . ASN A 1 16 ? -1.808  -11.987 -12.912 1.00 0.00 ? 17 ASN A O    2  
ATOM 1442  C CB   . ASN A 1 16 ? -1.730  -9.962  -10.577 1.00 0.00 ? 17 ASN A CB   2  
ATOM 1443  C CG   . ASN A 1 16 ? -0.263  -9.585  -10.800 1.00 0.00 ? 17 ASN A CG   2  
ATOM 1444  O OD1  . ASN A 1 16 ? 0.394   -10.128 -11.666 1.00 0.00 ? 17 ASN A OD1  2  
ATOM 1445  N ND2  . ASN A 1 16 ? 0.283   -8.665  -10.050 1.00 0.00 ? 17 ASN A ND2  2  
ATOM 1446  H H    . ASN A 1 16 ? -0.646  -11.485 -8.816  1.00 0.00 ? 17 ASN A H    2  
ATOM 1447  H HA   . ASN A 1 16 ? -2.940  -11.721 -10.548 1.00 0.00 ? 17 ASN A HA   2  
ATOM 1448  H HB2  . ASN A 1 16 ? -2.335  -9.549  -11.368 1.00 0.00 ? 17 ASN A HB2  2  
ATOM 1449  H HB3  . ASN A 1 16 ? -2.061  -9.569  -9.630  1.00 0.00 ? 17 ASN A HB3  2  
ATOM 1450  H HD21 . ASN A 1 16 ? -0.245  -8.223  -9.351  1.00 0.00 ? 17 ASN A HD21 2  
ATOM 1451  H HD22 . ASN A 1 16 ? 1.220   -8.411  -10.188 1.00 0.00 ? 17 ASN A HD22 2  
ATOM 1452  N N    . SER A 1 17 ? -0.118  -12.689 -11.696 1.00 0.00 ? 18 SER A N    2  
ATOM 1453  C CA   . SER A 1 17 ? 0.543   -13.299 -12.881 1.00 0.00 ? 18 SER A CA   2  
ATOM 1454  C C    . SER A 1 17 ? 0.217   -14.792 -12.931 1.00 0.00 ? 18 SER A C    2  
ATOM 1455  O O    . SER A 1 17 ? 0.703   -15.517 -13.777 1.00 0.00 ? 18 SER A O    2  
ATOM 1456  C CB   . SER A 1 17 ? 2.050   -13.109 -12.774 1.00 0.00 ? 18 SER A CB   2  
ATOM 1457  O OG   . SER A 1 17 ? 2.643   -14.291 -12.250 1.00 0.00 ? 18 SER A OG   2  
ATOM 1458  H H    . SER A 1 17 ? 0.302   -12.753 -10.814 1.00 0.00 ? 18 SER A H    2  
ATOM 1459  H HA   . SER A 1 17 ? 0.190   -12.821 -13.780 1.00 0.00 ? 18 SER A HA   2  
ATOM 1460  H HB2  . SER A 1 17 ? 2.453   -12.913 -13.751 1.00 0.00 ? 18 SER A HB2  2  
ATOM 1461  H HB3  . SER A 1 17 ? 2.259   -12.270 -12.125 1.00 0.00 ? 18 SER A HB3  2  
ATOM 1462  H HG   . SER A 1 17 ? 2.560   -14.983 -12.909 1.00 0.00 ? 18 SER A HG   2  
ATOM 1463  N N    . ALA A 1 18 ? -0.605  -15.258 -12.029 1.00 0.00 ? 19 ALA A N    2  
ATOM 1464  C CA   . ALA A 1 18 ? -0.964  -16.701 -12.023 1.00 0.00 ? 19 ALA A CA   2  
ATOM 1465  C C    . ALA A 1 18 ? -2.485  -16.848 -12.048 1.00 0.00 ? 19 ALA A C    2  
ATOM 1466  O O    . ALA A 1 18 ? -3.007  -17.941 -12.049 1.00 0.00 ? 19 ALA A O    2  
ATOM 1467  C CB   . ALA A 1 18 ? -0.415  -17.359 -10.754 1.00 0.00 ? 19 ALA A CB   2  
ATOM 1468  H H    . ALA A 1 18 ? -0.986  -14.657 -11.356 1.00 0.00 ? 19 ALA A H    2  
ATOM 1469  H HA   . ALA A 1 18 ? -0.540  -17.184 -12.891 1.00 0.00 ? 19 ALA A HA   2  
ATOM 1470  H HB1  . ALA A 1 18 ? -0.330  -16.618 -9.972  1.00 0.00 ? 19 ALA A HB1  2  
ATOM 1471  H HB2  . ALA A 1 18 ? -1.090  -18.142 -10.434 1.00 0.00 ? 19 ALA A HB2  2  
ATOM 1472  H HB3  . ALA A 1 18 ? 0.557   -17.782 -10.957 1.00 0.00 ? 19 ALA A HB3  2  
ATOM 1473  N N    . ARG A 1 19 ? -3.201  -15.757 -12.061 1.00 0.00 ? 20 ARG A N    2  
ATOM 1474  C CA   . ARG A 1 19 ? -4.689  -15.843 -12.078 1.00 0.00 ? 20 ARG A CA   2  
ATOM 1475  C C    . ARG A 1 19 ? -5.150  -16.521 -13.367 1.00 0.00 ? 20 ARG A C    2  
ATOM 1476  O O    . ARG A 1 19 ? -6.265  -16.997 -13.463 1.00 0.00 ? 20 ARG A O    2  
ATOM 1477  C CB   . ARG A 1 19 ? -5.283  -14.434 -12.000 1.00 0.00 ? 20 ARG A CB   2  
ATOM 1478  C CG   . ARG A 1 19 ? -6.074  -14.284 -10.699 1.00 0.00 ? 20 ARG A CG   2  
ATOM 1479  C CD   . ARG A 1 19 ? -6.969  -13.045 -10.782 1.00 0.00 ? 20 ARG A CD   2  
ATOM 1480  N NE   . ARG A 1 19 ? -8.288  -13.424 -11.365 1.00 0.00 ? 20 ARG A NE   2  
ATOM 1481  C CZ   . ARG A 1 19 ? -8.339  -14.060 -12.503 1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1482  N NH1  . ARG A 1 19 ? -8.164  -13.411 -13.621 1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1483  N NH2  . ARG A 1 19 ? -8.566  -15.343 -12.520 1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1484  H H    . ARG A 1 19 ? -2.762  -14.881 -12.055 1.00 0.00 ? 20 ARG A H    2  
ATOM 1485  H HA   . ARG A 1 19 ? -5.022  -16.424 -11.233 1.00 0.00 ? 20 ARG A HA   2  
ATOM 1486  H HB2  . ARG A 1 19 ? -4.485  -13.707 -12.024 1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1487  H HB3  . ARG A 1 19 ? -5.943  -14.275 -12.840 1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1488  H HG2  . ARG A 1 19 ? -6.684  -15.161 -10.545 1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1489  H HG3  . ARG A 1 19 ? -5.388  -14.173 -9.872  1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1490  H HD2  . ARG A 1 19 ? -7.117  -12.641 -9.791  1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1491  H HD3  . ARG A 1 19 ? -6.499  -12.303 -11.407 1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1492  H HE   . ARG A 1 19 ? -9.116  -13.193 -10.894 1.00 0.00 ? 20 ARG A HE   2  
ATOM 1493  H HH11 . ARG A 1 19 ? -7.991  -12.426 -13.607 1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1494  H HH12 . ARG A 1 19 ? -8.203  -13.899 -14.493 1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1495  H HH21 . ARG A 1 19 ? -8.701  -15.840 -11.663 1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1496  H HH22 . ARG A 1 19 ? -8.607  -15.832 -13.392 1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1497  N N    . GLU A 1 20 ? -4.306  -16.575 -14.358 1.00 0.00 ? 21 GLU A N    2  
ATOM 1498  C CA   . GLU A 1 20 ? -4.705  -17.230 -15.634 1.00 0.00 ? 21 GLU A CA   2  
ATOM 1499  C C    . GLU A 1 20 ? -4.563  -18.739 -15.481 1.00 0.00 ? 21 GLU A C    2  
ATOM 1500  O O    . GLU A 1 20 ? -5.531  -19.474 -15.520 1.00 0.00 ? 21 GLU A O    2  
ATOM 1501  C CB   . GLU A 1 20 ? -3.803  -16.737 -16.766 1.00 0.00 ? 21 GLU A CB   2  
ATOM 1502  C CG   . GLU A 1 20 ? -4.388  -15.458 -17.369 1.00 0.00 ? 21 GLU A CG   2  
ATOM 1503  C CD   . GLU A 1 20 ? -4.227  -15.493 -18.890 1.00 0.00 ? 21 GLU A CD   2  
ATOM 1504  O OE1  . GLU A 1 20 ? -4.284  -16.575 -19.448 1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1505  O OE2  . GLU A 1 20 ? -4.049  -14.434 -19.470 1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1506  H H    . GLU A 1 20 ? -3.412  -16.189 -14.264 1.00 0.00 ? 21 GLU A H    2  
ATOM 1507  H HA   . GLU A 1 20 ? -5.731  -16.989 -15.853 1.00 0.00 ? 21 GLU A HA   2  
ATOM 1508  H HB2  . GLU A 1 20 ? -2.816  -16.533 -16.375 1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1509  H HB3  . GLU A 1 20 ? -3.738  -17.497 -17.532 1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1510  H HG2  . GLU A 1 20 ? -5.436  -15.389 -17.117 1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1511  H HG3  . GLU A 1 20 ? -3.864  -14.602 -16.972 1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1512  N N    . SER A 1 21 ? -3.365  -19.207 -15.292 1.00 0.00 ? 22 SER A N    2  
ATOM 1513  C CA   . SER A 1 21 ? -3.162  -20.668 -15.117 1.00 0.00 ? 22 SER A CA   2  
ATOM 1514  C C    . SER A 1 21 ? -3.880  -21.111 -13.842 1.00 0.00 ? 22 SER A C    2  
ATOM 1515  O O    . SER A 1 21 ? -4.073  -22.285 -13.600 1.00 0.00 ? 22 SER A O    2  
ATOM 1516  C CB   . SER A 1 21 ? -1.668  -20.968 -14.995 1.00 0.00 ? 22 SER A CB   2  
ATOM 1517  O OG   . SER A 1 21 ? -1.290  -20.929 -13.625 1.00 0.00 ? 22 SER A OG   2  
ATOM 1518  H H    . SER A 1 21 ? -2.603  -18.594 -15.252 1.00 0.00 ? 22 SER A H    2  
ATOM 1519  H HA   . SER A 1 21 ? -3.574  -21.196 -15.965 1.00 0.00 ? 22 SER A HA   2  
ATOM 1520  H HB2  . SER A 1 21 ? -1.461  -21.948 -15.391 1.00 0.00 ? 22 SER A HB2  2  
ATOM 1521  H HB3  . SER A 1 21 ? -1.107  -20.230 -15.554 1.00 0.00 ? 22 SER A HB3  2  
ATOM 1522  H HG   . SER A 1 21 ? -0.949  -21.795 -13.387 1.00 0.00 ? 22 SER A HG   2  
ATOM 1523  N N    . ILE A 1 22 ? -4.282  -20.173 -13.025 1.00 0.00 ? 23 ILE A N    2  
ATOM 1524  C CA   . ILE A 1 22 ? -4.992  -20.531 -11.769 1.00 0.00 ? 23 ILE A CA   2  
ATOM 1525  C C    . ILE A 1 22 ? -6.468  -20.763 -12.083 1.00 0.00 ? 23 ILE A C    2  
ATOM 1526  O O    . ILE A 1 22 ? -7.045  -21.761 -11.696 1.00 0.00 ? 23 ILE A O    2  
ATOM 1527  C CB   . ILE A 1 22 ? -4.845  -19.381 -10.760 1.00 0.00 ? 23 ILE A CB   2  
ATOM 1528  C CG1  . ILE A 1 22 ? -3.507  -19.521 -10.029 1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1529  C CG2  . ILE A 1 22 ? -5.985  -19.423 -9.736  1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1530  C CD1  . ILE A 1 22 ? -3.309  -18.331 -9.088  1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1531  H H    . ILE A 1 22 ? -4.121  -19.230 -13.241 1.00 0.00 ? 23 ILE A H    2  
ATOM 1532  H HA   . ILE A 1 22 ? -4.562  -21.432 -11.355 1.00 0.00 ? 23 ILE A HA   2  
ATOM 1533  H HB   . ILE A 1 22 ? -4.872  -18.438 -11.284 1.00 0.00 ? 23 ILE A HB   2  
ATOM 1534  H HG12 . ILE A 1 22 ? -3.506  -20.436 -9.456  1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1535  H HG13 . ILE A 1 22 ? -2.704  -19.547 -10.749 1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1536  H HG21 . ILE A 1 22 ? -6.938  -19.421 -10.252 1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1537  H HG22 . ILE A 1 22 ? -5.900  -20.318 -9.140  1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1538  H HG23 . ILE A 1 22 ? -5.922  -18.555 -9.094  1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1539  H HD11 . ILE A 1 22 ? -4.262  -17.865 -8.890  1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1540  H HD12 . ILE A 1 22 ? -2.876  -18.675 -8.160  1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1541  H HD13 . ILE A 1 22 ? -2.646  -17.614 -9.549  1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1542  N N    . LYS A 1 23 ? -7.088  -19.845 -12.770 1.00 0.00 ? 24 LYS A N    2  
ATOM 1543  C CA   . LYS A 1 23 ? -8.521  -20.010 -13.091 1.00 0.00 ? 24 LYS A CA   2  
ATOM 1544  C C    . LYS A 1 23 ? -8.704  -21.153 -14.101 1.00 0.00 ? 24 LYS A C    2  
ATOM 1545  O O    . LYS A 1 23 ? -9.807  -21.587 -14.369 1.00 0.00 ? 24 LYS A O    2  
ATOM 1546  C CB   . LYS A 1 23 ? -9.038  -18.685 -13.660 1.00 0.00 ? 24 LYS A CB   2  
ATOM 1547  C CG   . LYS A 1 23 ? -8.873  -18.664 -15.179 1.00 0.00 ? 24 LYS A CG   2  
ATOM 1548  C CD   . LYS A 1 23 ? -9.446  -17.362 -15.745 1.00 0.00 ? 24 LYS A CD   2  
ATOM 1549  C CE   . LYS A 1 23 ? -9.566  -17.476 -17.266 1.00 0.00 ? 24 LYS A CE   2  
ATOM 1550  N NZ   . LYS A 1 23 ? -10.687 -16.619 -17.743 1.00 0.00 ? 24 LYS A NZ   2  
ATOM 1551  H H    . LYS A 1 23 ? -6.613  -19.038 -13.069 1.00 0.00 ? 24 LYS A H    2  
ATOM 1552  H HA   . LYS A 1 23 ? -9.059  -20.240 -12.188 1.00 0.00 ? 24 LYS A HA   2  
ATOM 1553  H HB2  . LYS A 1 23 ? -10.080 -18.563 -13.406 1.00 0.00 ? 24 LYS A HB2  2  
ATOM 1554  H HB3  . LYS A 1 23 ? -8.462  -17.878 -13.232 1.00 0.00 ? 24 LYS A HB3  2  
ATOM 1555  H HG2  . LYS A 1 23 ? -7.824  -18.737 -15.423 1.00 0.00 ? 24 LYS A HG2  2  
ATOM 1556  H HG3  . LYS A 1 23 ? -9.402  -19.503 -15.603 1.00 0.00 ? 24 LYS A HG3  2  
ATOM 1557  H HD2  . LYS A 1 23 ? -10.423 -17.183 -15.318 1.00 0.00 ? 24 LYS A HD2  2  
ATOM 1558  H HD3  . LYS A 1 23 ? -8.789  -16.542 -15.498 1.00 0.00 ? 24 LYS A HD3  2  
ATOM 1559  H HE2  . LYS A 1 23 ? -8.643  -17.152 -17.725 1.00 0.00 ? 24 LYS A HE2  2  
ATOM 1560  H HE3  . LYS A 1 23 ? -9.759  -18.505 -17.535 1.00 0.00 ? 24 LYS A HE3  2  
ATOM 1561  H HZ1  . LYS A 1 23 ? -11.009 -16.004 -16.968 1.00 0.00 ? 24 LYS A HZ1  2  
ATOM 1562  H HZ2  . LYS A 1 23 ? -10.361 -16.030 -18.536 1.00 0.00 ? 24 LYS A HZ2  2  
ATOM 1563  H HZ3  . LYS A 1 23 ? -11.475 -17.222 -18.058 1.00 0.00 ? 24 LYS A HZ3  2  
ATOM 1564  N N    . ARG A 1 24 ? -7.629  -21.637 -14.670 1.00 0.00 ? 25 ARG A N    2  
ATOM 1565  C CA   . ARG A 1 24 ? -7.748  -22.739 -15.663 1.00 0.00 ? 25 ARG A CA   2  
ATOM 1566  C C    . ARG A 1 24 ? -7.539  -24.091 -14.973 1.00 0.00 ? 25 ARG A C    2  
ATOM 1567  O O    . ARG A 1 24 ? -8.226  -25.053 -15.251 1.00 0.00 ? 25 ARG A O    2  
ATOM 1568  C CB   . ARG A 1 24 ? -6.700  -22.546 -16.771 1.00 0.00 ? 25 ARG A CB   2  
ATOM 1569  C CG   . ARG A 1 24 ? -5.328  -23.051 -16.305 1.00 0.00 ? 25 ARG A CG   2  
ATOM 1570  C CD   . ARG A 1 24 ? -4.366  -23.065 -17.485 1.00 0.00 ? 25 ARG A CD   2  
ATOM 1571  N NE   . ARG A 1 24 ? -5.086  -23.508 -18.712 1.00 0.00 ? 25 ARG A NE   2  
ATOM 1572  C CZ   . ARG A 1 24 ? -4.960  -24.737 -19.134 1.00 0.00 ? 25 ARG A CZ   2  
ATOM 1573  N NH1  . ARG A 1 24 ? -3.915  -25.082 -19.836 1.00 0.00 ? 25 ARG A NH1  2  
ATOM 1574  N NH2  . ARG A 1 24 ? -5.877  -25.623 -18.851 1.00 0.00 ? 25 ARG A NH2  2  
ATOM 1575  H H    . ARG A 1 24 ? -6.750  -21.271 -14.449 1.00 0.00 ? 25 ARG A H    2  
ATOM 1576  H HA   . ARG A 1 24 ? -8.734  -22.713 -16.099 1.00 0.00 ? 25 ARG A HA   2  
ATOM 1577  H HB2  . ARG A 1 24 ? -7.003  -23.094 -17.650 1.00 0.00 ? 25 ARG A HB2  2  
ATOM 1578  H HB3  . ARG A 1 24 ? -6.626  -21.496 -17.012 1.00 0.00 ? 25 ARG A HB3  2  
ATOM 1579  H HG2  . ARG A 1 24 ? -4.942  -22.399 -15.541 1.00 0.00 ? 25 ARG A HG2  2  
ATOM 1580  H HG3  . ARG A 1 24 ? -5.418  -24.052 -15.917 1.00 0.00 ? 25 ARG A HG3  2  
ATOM 1581  H HD2  . ARG A 1 24 ? -3.971  -22.073 -17.633 1.00 0.00 ? 25 ARG A HD2  2  
ATOM 1582  H HD3  . ARG A 1 24 ? -3.560  -23.748 -17.273 1.00 0.00 ? 25 ARG A HD3  2  
ATOM 1583  H HE   . ARG A 1 24 ? -5.657  -22.879 -19.200 1.00 0.00 ? 25 ARG A HE   2  
ATOM 1584  H HH11 . ARG A 1 24 ? -3.211  -24.405 -20.052 1.00 0.00 ? 25 ARG A HH11 2  
ATOM 1585  H HH12 . ARG A 1 24 ? -3.818  -26.025 -20.159 1.00 0.00 ? 25 ARG A HH12 2  
ATOM 1586  H HH21 . ARG A 1 24 ? -6.677  -25.360 -18.312 1.00 0.00 ? 25 ARG A HH21 2  
ATOM 1587  H HH22 . ARG A 1 24 ? -5.780  -26.564 -19.175 1.00 0.00 ? 25 ARG A HH22 2  
ATOM 1588  N N    . GLU A 1 25 ? -6.589  -24.175 -14.084 1.00 0.00 ? 26 GLU A N    2  
ATOM 1589  C CA   . GLU A 1 25 ? -6.331  -25.466 -13.388 1.00 0.00 ? 26 GLU A CA   2  
ATOM 1590  C C    . GLU A 1 25 ? -7.370  -25.679 -12.287 1.00 0.00 ? 26 GLU A C    2  
ATOM 1591  O O    . GLU A 1 25 ? -7.512  -26.763 -11.756 1.00 0.00 ? 26 GLU A O    2  
ATOM 1592  C CB   . GLU A 1 25 ? -4.930  -25.441 -12.771 1.00 0.00 ? 26 GLU A CB   2  
ATOM 1593  C CG   . GLU A 1 25 ? -4.924  -24.527 -11.544 1.00 0.00 ? 26 GLU A CG   2  
ATOM 1594  C CD   . GLU A 1 25 ? -3.484  -24.310 -11.078 1.00 0.00 ? 26 GLU A CD   2  
ATOM 1595  O OE1  . GLU A 1 25 ? -2.963  -25.180 -10.401 1.00 0.00 ? 26 GLU A OE1  2  
ATOM 1596  O OE2  . GLU A 1 25 ? -2.926  -23.277 -11.408 1.00 0.00 ? 26 GLU A OE2  2  
ATOM 1597  H H    . GLU A 1 25 ? -6.039  -23.391 -13.878 1.00 0.00 ? 26 GLU A H    2  
ATOM 1598  H HA   . GLU A 1 25 ? -6.392  -26.275 -14.100 1.00 0.00 ? 26 GLU A HA   2  
ATOM 1599  H HB2  . GLU A 1 25 ? -4.650  -26.443 -12.475 1.00 0.00 ? 26 GLU A HB2  2  
ATOM 1600  H HB3  . GLU A 1 25 ? -4.223  -25.070 -13.497 1.00 0.00 ? 26 GLU A HB3  2  
ATOM 1601  H HG2  . GLU A 1 25 ? -5.369  -23.576 -11.800 1.00 0.00 ? 26 GLU A HG2  2  
ATOM 1602  H HG3  . GLU A 1 25 ? -5.491  -24.987 -10.749 1.00 0.00 ? 26 GLU A HG3  2  
ATOM 1603  N N    . ASN A 1 26 ? -8.095  -24.656 -11.936 1.00 0.00 ? 27 ASN A N    2  
ATOM 1604  C CA   . ASN A 1 26 ? -9.118  -24.807 -10.865 1.00 0.00 ? 27 ASN A CA   2  
ATOM 1605  C C    . ASN A 1 26 ? -10.509 -24.950 -11.489 1.00 0.00 ? 27 ASN A C    2  
ATOM 1606  O O    . ASN A 1 26 ? -10.782 -24.391 -12.533 1.00 0.00 ? 27 ASN A O    2  
ATOM 1607  C CB   . ASN A 1 26 ? -9.090  -23.576 -9.956  1.00 0.00 ? 27 ASN A CB   2  
ATOM 1608  C CG   . ASN A 1 26 ? -7.707  -23.445 -9.315  1.00 0.00 ? 27 ASN A CG   2  
ATOM 1609  O OD1  . ASN A 1 26 ? -7.061  -24.434 -9.035  1.00 0.00 ? 27 ASN A OD1  2  
ATOM 1610  N ND2  . ASN A 1 26 ? -7.225  -22.258 -9.068  1.00 0.00 ? 27 ASN A ND2  2  
ATOM 1611  H H    . ASN A 1 26 ? -7.964  -23.788 -12.373 1.00 0.00 ? 27 ASN A H    2  
ATOM 1612  H HA   . ASN A 1 26 ? -8.899  -25.689 -10.282 1.00 0.00 ? 27 ASN A HA   2  
ATOM 1613  H HB2  . ASN A 1 26 ? -9.301  -22.692 -10.543 1.00 0.00 ? 27 ASN A HB2  2  
ATOM 1614  H HB3  . ASN A 1 26 ? -9.834  -23.682 -9.183  1.00 0.00 ? 27 ASN A HB3  2  
ATOM 1615  H HD21 . ASN A 1 26 ? -7.748  -21.461 -9.294  1.00 0.00 ? 27 ASN A HD21 2  
ATOM 1616  H HD22 . ASN A 1 26 ? -6.339  -22.165 -8.659  1.00 0.00 ? 27 ASN A HD22 2  
ATOM 1617  N N    . PRO A 1 27 ? -11.347 -25.699 -10.819 1.00 0.00 ? 28 PRO A N    2  
ATOM 1618  C CA   . PRO A 1 27 ? -12.727 -25.949 -11.261 1.00 0.00 ? 28 PRO A CA   2  
ATOM 1619  C C    . PRO A 1 27 ? -13.611 -24.748 -10.941 1.00 0.00 ? 28 PRO A C    2  
ATOM 1620  O O    . PRO A 1 27 ? -14.451 -24.807 -10.066 1.00 0.00 ? 28 PRO A O    2  
ATOM 1621  C CB   . PRO A 1 27 ? -13.158 -27.158 -10.448 1.00 0.00 ? 28 PRO A CB   2  
ATOM 1622  C CG   . PRO A 1 27 ? -12.244 -27.195 -9.218  1.00 0.00 ? 28 PRO A CG   2  
ATOM 1623  C CD   . PRO A 1 27 ? -10.995 -26.369 -9.557  1.00 0.00 ? 28 PRO A CD   2  
ATOM 1624  H HA   . PRO A 1 27 ? -12.754 -26.189 -12.293 1.00 0.00 ? 28 PRO A HA   2  
ATOM 1625  H HB2  . PRO A 1 27 ? -14.189 -27.043 -10.140 1.00 0.00 ? 28 PRO A HB2  2  
ATOM 1626  H HB3  . PRO A 1 27 ? -13.031 -28.059 -11.024 1.00 0.00 ? 28 PRO A HB3  2  
ATOM 1627  H HG2  . PRO A 1 27 ? -12.756 -26.766 -8.379  1.00 0.00 ? 28 PRO A HG2  2  
ATOM 1628  H HG3  . PRO A 1 27 ? -11.963 -28.208 -9.012  1.00 0.00 ? 28 PRO A HG3  2  
ATOM 1629  H HD2  . PRO A 1 27 ? -10.802 -25.642 -8.780  1.00 0.00 ? 28 PRO A HD2  2  
ATOM 1630  H HD3  . PRO A 1 27 ? -10.140 -27.012 -9.700  1.00 0.00 ? 28 PRO A HD3  2  
ATOM 1631  N N    . GLY A 1 28 ? -13.421 -23.649 -11.619 1.00 0.00 ? 29 GLY A N    2  
ATOM 1632  C CA   . GLY A 1 28 ? -14.248 -22.454 -11.309 1.00 0.00 ? 29 GLY A CA   2  
ATOM 1633  C C    . GLY A 1 28 ? -14.238 -22.264 -9.793  1.00 0.00 ? 29 GLY A C    2  
ATOM 1634  O O    . GLY A 1 28 ? -15.151 -21.713 -9.213  1.00 0.00 ? 29 GLY A O    2  
ATOM 1635  H H    . GLY A 1 28 ? -12.727 -23.607 -12.311 1.00 0.00 ? 29 GLY A H    2  
ATOM 1636  H HA2  . GLY A 1 28 ? -13.830 -21.583 -11.794 1.00 0.00 ? 29 GLY A HA2  2  
ATOM 1637  H HA3  . GLY A 1 28 ? -15.261 -22.611 -11.645 1.00 0.00 ? 29 GLY A HA3  2  
ATOM 1638  N N    . ILE A 1 29 ? -13.201 -22.741 -9.155  1.00 0.00 ? 30 ILE A N    2  
ATOM 1639  C CA   . ILE A 1 29 ? -13.098 -22.627 -7.680  1.00 0.00 ? 30 ILE A CA   2  
ATOM 1640  C C    . ILE A 1 29 ? -13.598 -21.258 -7.220  1.00 0.00 ? 30 ILE A C    2  
ATOM 1641  O O    . ILE A 1 29 ? -13.595 -20.299 -7.967  1.00 0.00 ? 30 ILE A O    2  
ATOM 1642  C CB   . ILE A 1 29 ? -11.641 -22.812 -7.281  1.00 0.00 ? 30 ILE A CB   2  
ATOM 1643  C CG1  . ILE A 1 29 ? -11.512 -22.802 -5.756  1.00 0.00 ? 30 ILE A CG1  2  
ATOM 1644  C CG2  . ILE A 1 29 ? -10.837 -21.672 -7.871  1.00 0.00 ? 30 ILE A CG2  2  
ATOM 1645  C CD1  . ILE A 1 29 ? -10.037 -22.946 -5.369  1.00 0.00 ? 30 ILE A CD1  2  
ATOM 1646  H H    . ILE A 1 29 ? -12.486 -23.190 -9.651  1.00 0.00 ? 30 ILE A H    2  
ATOM 1647  H HA   . ILE A 1 29 ? -13.680 -23.393 -7.224  1.00 0.00 ? 30 ILE A HA   2  
ATOM 1648  H HB   . ILE A 1 29 ? -11.279 -23.750 -7.676  1.00 0.00 ? 30 ILE A HB   2  
ATOM 1649  H HG12 . ILE A 1 29 ? -11.896 -21.870 -5.368  1.00 0.00 ? 30 ILE A HG12 2  
ATOM 1650  H HG13 . ILE A 1 29 ? -12.073 -23.624 -5.340  1.00 0.00 ? 30 ILE A HG13 2  
ATOM 1651  H HG21 . ILE A 1 29 ? -11.412 -20.766 -7.798  1.00 0.00 ? 30 ILE A HG21 2  
ATOM 1652  H HG22 . ILE A 1 29 ? -9.912  -21.564 -7.328  1.00 0.00 ? 30 ILE A HG22 2  
ATOM 1653  H HG23 . ILE A 1 29 ? -10.632 -21.884 -8.906  1.00 0.00 ? 30 ILE A HG23 2  
ATOM 1654  H HD11 . ILE A 1 29 ? -9.541  -23.589 -6.080  1.00 0.00 ? 30 ILE A HD11 2  
ATOM 1655  H HD12 . ILE A 1 29 ? -9.567  -21.973 -5.375  1.00 0.00 ? 30 ILE A HD12 2  
ATOM 1656  H HD13 . ILE A 1 29 ? -9.965  -23.375 -4.381  1.00 0.00 ? 30 ILE A HD13 2  
ATOM 1657  N N    . LYS A 1 30 ? -14.026 -21.162 -5.994  1.00 0.00 ? 31 LYS A N    2  
ATOM 1658  C CA   . LYS A 1 30 ? -14.526 -19.862 -5.477  1.00 0.00 ? 31 LYS A CA   2  
ATOM 1659  C C    . LYS A 1 30 ? -13.411 -18.816 -5.560  1.00 0.00 ? 31 LYS A C    2  
ATOM 1660  O O    . LYS A 1 30 ? -12.249 -19.144 -5.698  1.00 0.00 ? 31 LYS A O    2  
ATOM 1661  C CB   . LYS A 1 30 ? -14.964 -20.031 -4.026  1.00 0.00 ? 31 LYS A CB   2  
ATOM 1662  C CG   . LYS A 1 30 ? -15.799 -21.305 -3.886  1.00 0.00 ? 31 LYS A CG   2  
ATOM 1663  C CD   . LYS A 1 30 ? -16.871 -21.340 -4.978  1.00 0.00 ? 31 LYS A CD   2  
ATOM 1664  C CE   . LYS A 1 30 ? -17.731 -22.594 -4.810  1.00 0.00 ? 31 LYS A CE   2  
ATOM 1665  N NZ   . LYS A 1 30 ? -18.080 -23.138 -6.152  1.00 0.00 ? 31 LYS A NZ   2  
ATOM 1666  H H    . LYS A 1 30 ? -14.019 -21.947 -5.411  1.00 0.00 ? 31 LYS A H    2  
ATOM 1667  H HA   . LYS A 1 30 ? -15.366 -19.539 -6.066  1.00 0.00 ? 31 LYS A HA   2  
ATOM 1668  H HB2  . LYS A 1 30 ? -14.092 -20.101 -3.400  1.00 0.00 ? 31 LYS A HB2  2  
ATOM 1669  H HB3  . LYS A 1 30 ? -15.554 -19.182 -3.730  1.00 0.00 ? 31 LYS A HB3  2  
ATOM 1670  H HG2  . LYS A 1 30 ? -15.159 -22.169 -3.981  1.00 0.00 ? 31 LYS A HG2  2  
ATOM 1671  H HG3  . LYS A 1 30 ? -16.276 -21.318 -2.917  1.00 0.00 ? 31 LYS A HG3  2  
ATOM 1672  H HD2  . LYS A 1 30 ? -17.495 -20.462 -4.898  1.00 0.00 ? 31 LYS A HD2  2  
ATOM 1673  H HD3  . LYS A 1 30 ? -16.397 -21.358 -5.948  1.00 0.00 ? 31 LYS A HD3  2  
ATOM 1674  H HE2  . LYS A 1 30 ? -17.180 -23.336 -4.252  1.00 0.00 ? 31 LYS A HE2  2  
ATOM 1675  H HE3  . LYS A 1 30 ? -18.636 -22.341 -4.277  1.00 0.00 ? 31 LYS A HE3  2  
ATOM 1676  H HZ1  . LYS A 1 30 ? -18.572 -22.407 -6.705  1.00 0.00 ? 31 LYS A HZ1  2  
ATOM 1677  H HZ2  . LYS A 1 30 ? -17.211 -23.422 -6.648  1.00 0.00 ? 31 LYS A HZ2  2  
ATOM 1678  H HZ3  . LYS A 1 30 ? -18.698 -23.966 -6.042  1.00 0.00 ? 31 LYS A HZ3  2  
ATOM 1679  N N    . VAL A 1 31 ? -13.756 -17.560 -5.480  1.00 0.00 ? 32 VAL A N    2  
ATOM 1680  C CA   . VAL A 1 31 ? -12.730 -16.496 -5.557  1.00 0.00 ? 32 VAL A CA   2  
ATOM 1681  C C    . VAL A 1 31 ? -11.923 -16.464 -4.253  1.00 0.00 ? 32 VAL A C    2  
ATOM 1682  O O    . VAL A 1 31 ? -10.771 -16.080 -4.236  1.00 0.00 ? 32 VAL A O    2  
ATOM 1683  C CB   . VAL A 1 31 ? -13.423 -15.152 -5.797  1.00 0.00 ? 32 VAL A CB   2  
ATOM 1684  C CG1  . VAL A 1 31 ? -14.738 -15.127 -5.043  1.00 0.00 ? 32 VAL A CG1  2  
ATOM 1685  C CG2  . VAL A 1 31 ? -12.548 -14.019 -5.291  1.00 0.00 ? 32 VAL A CG2  2  
ATOM 1686  H H    . VAL A 1 31 ? -14.690 -17.316 -5.372  1.00 0.00 ? 32 VAL A H    2  
ATOM 1687  H HA   . VAL A 1 31 ? -12.080 -16.699 -6.376  1.00 0.00 ? 32 VAL A HA   2  
ATOM 1688  H HB   . VAL A 1 31 ? -13.609 -15.027 -6.853  1.00 0.00 ? 32 VAL A HB   2  
ATOM 1689  H HG11 . VAL A 1 31 ? -14.689 -15.841 -4.239  1.00 0.00 ? 32 VAL A HG11 2  
ATOM 1690  H HG12 . VAL A 1 31 ? -14.910 -14.139 -4.646  1.00 0.00 ? 32 VAL A HG12 2  
ATOM 1691  H HG13 . VAL A 1 31 ? -15.537 -15.395 -5.714  1.00 0.00 ? 32 VAL A HG13 2  
ATOM 1692  H HG21 . VAL A 1 31 ? -11.551 -14.135 -5.683  1.00 0.00 ? 32 VAL A HG21 2  
ATOM 1693  H HG22 . VAL A 1 31 ? -12.960 -13.078 -5.611  1.00 0.00 ? 32 VAL A HG22 2  
ATOM 1694  H HG23 . VAL A 1 31 ? -12.521 -14.059 -4.214  1.00 0.00 ? 32 VAL A HG23 2  
ATOM 1695  N N    . THR A 1 32 ? -12.519 -16.860 -3.163  1.00 0.00 ? 33 THR A N    2  
ATOM 1696  C CA   . THR A 1 32 ? -11.784 -16.845 -1.867  1.00 0.00 ? 33 THR A CA   2  
ATOM 1697  C C    . THR A 1 32 ? -10.799 -18.016 -1.819  1.00 0.00 ? 33 THR A C    2  
ATOM 1698  O O    . THR A 1 32 ? -9.729  -17.916 -1.255  1.00 0.00 ? 33 THR A O    2  
ATOM 1699  C CB   . THR A 1 32 ? -12.783 -16.968 -0.714  1.00 0.00 ? 33 THR A CB   2  
ATOM 1700  O OG1  . THR A 1 32 ? -13.968 -17.597 -1.184  1.00 0.00 ? 33 THR A OG1  2  
ATOM 1701  C CG2  . THR A 1 32 ? -13.119 -15.575 -0.180  1.00 0.00 ? 33 THR A CG2  2  
ATOM 1702  H H    . THR A 1 32 ? -13.450 -17.163 -3.195  1.00 0.00 ? 33 THR A H    2  
ATOM 1703  H HA   . THR A 1 32 ? -11.241 -15.917 -1.774  1.00 0.00 ? 33 THR A HA   2  
ATOM 1704  H HB   . THR A 1 32 ? -12.349 -17.559 0.078   1.00 0.00 ? 33 THR A HB   2  
ATOM 1705  H HG1  . THR A 1 32 ? -13.718 -18.416 -1.619  1.00 0.00 ? 33 THR A HG1  2  
ATOM 1706  H HG21 . THR A 1 32 ? -12.205 -15.034 0.012   1.00 0.00 ? 33 THR A HG21 2  
ATOM 1707  H HG22 . THR A 1 32 ? -13.706 -15.040 -0.912  1.00 0.00 ? 33 THR A HG22 2  
ATOM 1708  H HG23 . THR A 1 32 ? -13.682 -15.667 0.738   1.00 0.00 ? 33 THR A HG23 2  
ATOM 1709  N N    . GLU A 1 33 ? -11.153 -19.127 -2.405  1.00 0.00 ? 34 GLU A N    2  
ATOM 1710  C CA   . GLU A 1 33 ? -10.234 -20.300 -2.389  1.00 0.00 ? 34 GLU A CA   2  
ATOM 1711  C C    . GLU A 1 33 ? -9.173  -20.136 -3.479  1.00 0.00 ? 34 GLU A C    2  
ATOM 1712  O O    . GLU A 1 33 ? -8.201  -20.863 -3.528  1.00 0.00 ? 34 GLU A O    2  
ATOM 1713  C CB   . GLU A 1 33 ? -11.035 -21.582 -2.644  1.00 0.00 ? 34 GLU A CB   2  
ATOM 1714  C CG   . GLU A 1 33 ? -11.949 -21.862 -1.450  1.00 0.00 ? 34 GLU A CG   2  
ATOM 1715  C CD   . GLU A 1 33 ? -11.142 -22.520 -0.330  1.00 0.00 ? 34 GLU A CD   2  
ATOM 1716  O OE1  . GLU A 1 33 ? -10.986 -23.730 -0.370  1.00 0.00 ? 34 GLU A OE1  2  
ATOM 1717  O OE2  . GLU A 1 33 ? -10.692 -21.803 0.549   1.00 0.00 ? 34 GLU A OE2  2  
ATOM 1718  H H    . GLU A 1 33 ? -12.021 -19.190 -2.855  1.00 0.00 ? 34 GLU A H    2  
ATOM 1719  H HA   . GLU A 1 33 ? -9.752  -20.365 -1.425  1.00 0.00 ? 34 GLU A HA   2  
ATOM 1720  H HB2  . GLU A 1 33 ? -11.632 -21.460 -3.536  1.00 0.00 ? 34 GLU A HB2  2  
ATOM 1721  H HB3  . GLU A 1 33 ? -10.355 -22.410 -2.776  1.00 0.00 ? 34 GLU A HB3  2  
ATOM 1722  H HG2  . GLU A 1 33 ? -12.372 -20.934 -1.093  1.00 0.00 ? 34 GLU A HG2  2  
ATOM 1723  H HG3  . GLU A 1 33 ? -12.746 -22.526 -1.754  1.00 0.00 ? 34 GLU A HG3  2  
ATOM 1724  N N    . VAL A 1 34 ? -9.350  -19.185 -4.357  1.00 0.00 ? 35 VAL A N    2  
ATOM 1725  C CA   . VAL A 1 34 ? -8.352  -18.976 -5.443  1.00 0.00 ? 35 VAL A CA   2  
ATOM 1726  C C    . VAL A 1 34 ? -7.090  -18.332 -4.864  1.00 0.00 ? 35 VAL A C    2  
ATOM 1727  O O    . VAL A 1 34 ? -5.993  -18.563 -5.334  1.00 0.00 ? 35 VAL A O    2  
ATOM 1728  C CB   . VAL A 1 34 ? -8.952  -18.066 -6.513  1.00 0.00 ? 35 VAL A CB   2  
ATOM 1729  C CG1  . VAL A 1 34 ? -7.844  -17.546 -7.434  1.00 0.00 ? 35 VAL A CG1  2  
ATOM 1730  C CG2  . VAL A 1 34 ? -9.970  -18.854 -7.337  1.00 0.00 ? 35 VAL A CG2  2  
ATOM 1731  H H    . VAL A 1 34 ? -10.141 -18.609 -4.302  1.00 0.00 ? 35 VAL A H    2  
ATOM 1732  H HA   . VAL A 1 34 ? -8.099  -19.923 -5.883  1.00 0.00 ? 35 VAL A HA   2  
ATOM 1733  H HB   . VAL A 1 34 ? -9.440  -17.235 -6.033  1.00 0.00 ? 35 VAL A HB   2  
ATOM 1734  H HG11 . VAL A 1 34 ? -7.118  -18.328 -7.601  1.00 0.00 ? 35 VAL A HG11 2  
ATOM 1735  H HG12 . VAL A 1 34 ? -8.274  -17.247 -8.379  1.00 0.00 ? 35 VAL A HG12 2  
ATOM 1736  H HG13 . VAL A 1 34 ? -7.361  -16.697 -6.974  1.00 0.00 ? 35 VAL A HG13 2  
ATOM 1737  H HG21 . VAL A 1 34 ? -10.447 -19.593 -6.709  1.00 0.00 ? 35 VAL A HG21 2  
ATOM 1738  H HG22 . VAL A 1 34 ? -10.717 -18.180 -7.730  1.00 0.00 ? 35 VAL A HG22 2  
ATOM 1739  H HG23 . VAL A 1 34 ? -9.467  -19.350 -8.154  1.00 0.00 ? 35 VAL A HG23 2  
ATOM 1740  N N    . ALA A 1 35 ? -7.235  -17.527 -3.849  1.00 0.00 ? 36 ALA A N    2  
ATOM 1741  C CA   . ALA A 1 35 ? -6.043  -16.871 -3.245  1.00 0.00 ? 36 ALA A CA   2  
ATOM 1742  C C    . ALA A 1 35 ? -5.336  -17.856 -2.311  1.00 0.00 ? 36 ALA A C    2  
ATOM 1743  O O    . ALA A 1 35 ? -4.127  -17.856 -2.192  1.00 0.00 ? 36 ALA A O    2  
ATOM 1744  C CB   . ALA A 1 35 ? -6.488  -15.641 -2.449  1.00 0.00 ? 36 ALA A CB   2  
ATOM 1745  H H    . ALA A 1 35 ? -8.128  -17.353 -3.485  1.00 0.00 ? 36 ALA A H    2  
ATOM 1746  H HA   . ALA A 1 35 ? -5.367  -16.565 -4.028  1.00 0.00 ? 36 ALA A HA   2  
ATOM 1747  H HB1  . ALA A 1 35 ? -7.480  -15.348 -2.763  1.00 0.00 ? 36 ALA A HB1  2  
ATOM 1748  H HB2  . ALA A 1 35 ? -6.500  -15.879 -1.396  1.00 0.00 ? 36 ALA A HB2  2  
ATOM 1749  H HB3  . ALA A 1 35 ? -5.799  -14.829 -2.627  1.00 0.00 ? 36 ALA A HB3  2  
ATOM 1750  N N    . LYS A 1 36 ? -6.082  -18.695 -1.646  1.00 0.00 ? 37 LYS A N    2  
ATOM 1751  C CA   . LYS A 1 36 ? -5.466  -19.677 -0.718  1.00 0.00 ? 37 LYS A CA   2  
ATOM 1752  C C    . LYS A 1 36 ? -4.683  -20.726 -1.513  1.00 0.00 ? 37 LYS A C    2  
ATOM 1753  O O    . LYS A 1 36 ? -3.544  -21.025 -1.215  1.00 0.00 ? 37 LYS A O    2  
ATOM 1754  C CB   . LYS A 1 36 ? -6.579  -20.336 0.085   1.00 0.00 ? 37 LYS A CB   2  
ATOM 1755  C CG   . LYS A 1 36 ? -6.130  -21.698 0.623   1.00 0.00 ? 37 LYS A CG   2  
ATOM 1756  C CD   . LYS A 1 36 ? -6.557  -21.823 2.086   1.00 0.00 ? 37 LYS A CD   2  
ATOM 1757  C CE   . LYS A 1 36 ? -5.548  -22.686 2.845   1.00 0.00 ? 37 LYS A CE   2  
ATOM 1758  N NZ   . LYS A 1 36 ? -6.085  -24.068 2.989   1.00 0.00 ? 37 LYS A NZ   2  
ATOM 1759  H H    . LYS A 1 36 ? -7.057  -18.677 -1.752  1.00 0.00 ? 37 LYS A H    2  
ATOM 1760  H HA   . LYS A 1 36 ? -4.807  -19.167 -0.042  1.00 0.00 ? 37 LYS A HA   2  
ATOM 1761  H HB2  . LYS A 1 36 ? -6.828  -19.692 0.911   1.00 0.00 ? 37 LYS A HB2  2  
ATOM 1762  H HB3  . LYS A 1 36 ? -7.446  -20.463 -0.546  1.00 0.00 ? 37 LYS A HB3  2  
ATOM 1763  H HG2  . LYS A 1 36 ? -6.590  -22.484 0.042   1.00 0.00 ? 37 LYS A HG2  2  
ATOM 1764  H HG3  . LYS A 1 36 ? -5.056  -21.777 0.554   1.00 0.00 ? 37 LYS A HG3  2  
ATOM 1765  H HD2  . LYS A 1 36 ? -6.599  -20.841 2.532   1.00 0.00 ? 37 LYS A HD2  2  
ATOM 1766  H HD3  . LYS A 1 36 ? -7.531  -22.284 2.137   1.00 0.00 ? 37 LYS A HD3  2  
ATOM 1767  H HE2  . LYS A 1 36 ? -4.617  -22.715 2.299   1.00 0.00 ? 37 LYS A HE2  2  
ATOM 1768  H HE3  . LYS A 1 36 ? -5.377  -22.263 3.824   1.00 0.00 ? 37 LYS A HE3  2  
ATOM 1769  H HZ1  . LYS A 1 36 ? -7.029  -24.030 3.422   1.00 0.00 ? 37 LYS A HZ1  2  
ATOM 1770  H HZ2  . LYS A 1 36 ? -6.151  -24.515 2.051   1.00 0.00 ? 37 LYS A HZ2  2  
ATOM 1771  H HZ3  . LYS A 1 36 ? -5.451  -24.626 3.594   1.00 0.00 ? 37 LYS A HZ3  2  
ATOM 1772  N N    . ARG A 1 37 ? -5.289  -21.288 -2.519  1.00 0.00 ? 38 ARG A N    2  
ATOM 1773  C CA   . ARG A 1 37 ? -4.587  -22.319 -3.331  1.00 0.00 ? 38 ARG A CA   2  
ATOM 1774  C C    . ARG A 1 37 ? -3.460  -21.665 -4.134  1.00 0.00 ? 38 ARG A C    2  
ATOM 1775  O O    . ARG A 1 37 ? -2.507  -22.310 -4.519  1.00 0.00 ? 38 ARG A O    2  
ATOM 1776  C CB   . ARG A 1 37 ? -5.585  -22.972 -4.290  1.00 0.00 ? 38 ARG A CB   2  
ATOM 1777  C CG   . ARG A 1 37 ? -5.803  -24.431 -3.886  1.00 0.00 ? 38 ARG A CG   2  
ATOM 1778  C CD   . ARG A 1 37 ? -6.311  -24.495 -2.445  1.00 0.00 ? 38 ARG A CD   2  
ATOM 1779  N NE   . ARG A 1 37 ? -5.424  -25.387 -1.647  1.00 0.00 ? 38 ARG A NE   2  
ATOM 1780  C CZ   . ARG A 1 37 ? -5.108  -26.568 -2.103  1.00 0.00 ? 38 ARG A CZ   2  
ATOM 1781  N NH1  . ARG A 1 37 ? -6.026  -27.329 -2.634  1.00 0.00 ? 38 ARG A NH1  2  
ATOM 1782  N NH2  . ARG A 1 37 ? -3.875  -26.989 -2.030  1.00 0.00 ? 38 ARG A NH2  2  
ATOM 1783  H H    . ARG A 1 37 ? -6.207  -21.032 -2.738  1.00 0.00 ? 38 ARG A H    2  
ATOM 1784  H HA   . ARG A 1 37 ? -4.172  -23.072 -2.679  1.00 0.00 ? 38 ARG A HA   2  
ATOM 1785  H HB2  . ARG A 1 37 ? -6.525  -22.439 -4.245  1.00 0.00 ? 38 ARG A HB2  2  
ATOM 1786  H HB3  . ARG A 1 37 ? -5.196  -22.932 -5.297  1.00 0.00 ? 38 ARG A HB3  2  
ATOM 1787  H HG2  . ARG A 1 37 ? -6.531  -24.882 -4.546  1.00 0.00 ? 38 ARG A HG2  2  
ATOM 1788  H HG3  . ARG A 1 37 ? -4.870  -24.968 -3.961  1.00 0.00 ? 38 ARG A HG3  2  
ATOM 1789  H HD2  . ARG A 1 37 ? -6.306  -23.504 -2.017  1.00 0.00 ? 38 ARG A HD2  2  
ATOM 1790  H HD3  . ARG A 1 37 ? -7.317  -24.886 -2.435  1.00 0.00 ? 38 ARG A HD3  2  
ATOM 1791  H HE   . ARG A 1 37 ? -5.077  -25.086 -0.782  1.00 0.00 ? 38 ARG A HE   2  
ATOM 1792  H HH11 . ARG A 1 37 ? -6.970  -27.006 -2.694  1.00 0.00 ? 38 ARG A HH11 2  
ATOM 1793  H HH12 . ARG A 1 37 ? -5.785  -28.235 -2.983  1.00 0.00 ? 38 ARG A HH12 2  
ATOM 1794  H HH21 . ARG A 1 37 ? -3.171  -26.404 -1.626  1.00 0.00 ? 38 ARG A HH21 2  
ATOM 1795  H HH22 . ARG A 1 37 ? -3.633  -27.894 -2.377  1.00 0.00 ? 38 ARG A HH22 2  
ATOM 1796  N N    . GLY A 1 38 ? -3.561  -20.389 -4.390  1.00 0.00 ? 39 GLY A N    2  
ATOM 1797  C CA   . GLY A 1 38 ? -2.493  -19.699 -5.168  1.00 0.00 ? 39 GLY A CA   2  
ATOM 1798  C C    . GLY A 1 38 ? -1.202  -19.667 -4.350  1.00 0.00 ? 39 GLY A C    2  
ATOM 1799  O O    . GLY A 1 38 ? -0.120  -19.527 -4.884  1.00 0.00 ? 39 GLY A O    2  
ATOM 1800  H H    . GLY A 1 38 ? -4.339  -19.885 -4.071  1.00 0.00 ? 39 GLY A H    2  
ATOM 1801  H HA2  . GLY A 1 38 ? -2.323  -20.232 -6.092  1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1802  H HA3  . GLY A 1 38 ? -2.803  -18.689 -5.387  1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1803  N N    . GLY A 1 39 ? -1.306  -19.793 -3.054  1.00 0.00 ? 40 GLY A N    2  
ATOM 1804  C CA   . GLY A 1 39 ? -0.083  -19.769 -2.202  1.00 0.00 ? 40 GLY A CA   2  
ATOM 1805  C C    . GLY A 1 39 ? 0.655   -21.105 -2.325  1.00 0.00 ? 40 GLY A C    2  
ATOM 1806  O O    . GLY A 1 39 ? 1.807   -21.224 -1.958  1.00 0.00 ? 40 GLY A O    2  
ATOM 1807  H H    . GLY A 1 39 ? -2.188  -19.905 -2.643  1.00 0.00 ? 40 GLY A H    2  
ATOM 1808  H HA2  . GLY A 1 39 ? 0.565   -18.966 -2.526  1.00 0.00 ? 40 GLY A HA2  2  
ATOM 1809  H HA3  . GLY A 1 39 ? -0.364  -19.613 -1.172  1.00 0.00 ? 40 GLY A HA3  2  
ATOM 1810  N N    . GLU A 1 40 ? 0.002   -22.112 -2.838  1.00 0.00 ? 41 GLU A N    2  
ATOM 1811  C CA   . GLU A 1 40 ? 0.672   -23.435 -2.981  1.00 0.00 ? 41 GLU A CA   2  
ATOM 1812  C C    . GLU A 1 40 ? 1.684   -23.375 -4.129  1.00 0.00 ? 41 GLU A C    2  
ATOM 1813  O O    . GLU A 1 40 ? 2.746   -23.961 -4.066  1.00 0.00 ? 41 GLU A O    2  
ATOM 1814  C CB   . GLU A 1 40 ? -0.379  -24.513 -3.259  1.00 0.00 ? 41 GLU A CB   2  
ATOM 1815  C CG   . GLU A 1 40 ? -0.753  -24.524 -4.744  1.00 0.00 ? 41 GLU A CG   2  
ATOM 1816  C CD   . GLU A 1 40 ? -2.051  -25.309 -4.941  1.00 0.00 ? 41 GLU A CD   2  
ATOM 1817  O OE1  . GLU A 1 40 ? -2.590  -25.783 -3.953  1.00 0.00 ? 41 GLU A OE1  2  
ATOM 1818  O OE2  . GLU A 1 40 ? -2.484  -25.424 -6.076  1.00 0.00 ? 41 GLU A OE2  2  
ATOM 1819  H H    . GLU A 1 40 ? -0.927  -21.998 -3.129  1.00 0.00 ? 41 GLU A H    2  
ATOM 1820  H HA   . GLU A 1 40 ? 1.185   -23.677 -2.064  1.00 0.00 ? 41 GLU A HA   2  
ATOM 1821  H HB2  . GLU A 1 40 ? 0.023   -25.474 -2.980  1.00 0.00 ? 41 GLU A HB2  2  
ATOM 1822  H HB3  . GLU A 1 40 ? -1.260  -24.310 -2.668  1.00 0.00 ? 41 GLU A HB3  2  
ATOM 1823  H HG2  . GLU A 1 40 ? -0.888  -23.509 -5.088  1.00 0.00 ? 41 GLU A HG2  2  
ATOM 1824  H HG3  . GLU A 1 40 ? 0.038   -24.992 -5.310  1.00 0.00 ? 41 GLU A HG3  2  
ATOM 1825  N N    . LEU A 1 41 ? 1.356   -22.674 -5.179  1.00 0.00 ? 42 LEU A N    2  
ATOM 1826  C CA   . LEU A 1 41 ? 2.288   -22.577 -6.333  1.00 0.00 ? 42 LEU A CA   2  
ATOM 1827  C C    . LEU A 1 41 ? 3.328   -21.485 -6.066  1.00 0.00 ? 42 LEU A C    2  
ATOM 1828  O O    . LEU A 1 41 ? 4.427   -21.521 -6.583  1.00 0.00 ? 42 LEU A O    2  
ATOM 1829  C CB   . LEU A 1 41 ? 1.491   -22.223 -7.589  1.00 0.00 ? 42 LEU A CB   2  
ATOM 1830  C CG   . LEU A 1 41 ? 0.923   -23.500 -8.210  1.00 0.00 ? 42 LEU A CG   2  
ATOM 1831  C CD1  . LEU A 1 41 ? 0.201   -23.153 -9.512  1.00 0.00 ? 42 LEU A CD1  2  
ATOM 1832  C CD2  . LEU A 1 41 ? 2.068   -24.474 -8.504  1.00 0.00 ? 42 LEU A CD2  2  
ATOM 1833  H H    . LEU A 1 41 ? 0.494   -22.215 -5.211  1.00 0.00 ? 42 LEU A H    2  
ATOM 1834  H HA   . LEU A 1 41 ? 2.786   -23.523 -6.476  1.00 0.00 ? 42 LEU A HA   2  
ATOM 1835  H HB2  . LEU A 1 41 ? 0.680   -21.560 -7.323  1.00 0.00 ? 42 LEU A HB2  2  
ATOM 1836  H HB3  . LEU A 1 41 ? 2.137   -21.734 -8.299  1.00 0.00 ? 42 LEU A HB3  2  
ATOM 1837  H HG   . LEU A 1 41 ? 0.227   -23.955 -7.522  1.00 0.00 ? 42 LEU A HG   2  
ATOM 1838  H HD11 . LEU A 1 41 ? 0.401   -22.123 -9.771  1.00 0.00 ? 42 LEU A HD11 2  
ATOM 1839  H HD12 . LEU A 1 41 ? 0.554   -23.799 -10.303 1.00 0.00 ? 42 LEU A HD12 2  
ATOM 1840  H HD13 . LEU A 1 41 ? -0.863  -23.292 -9.382  1.00 0.00 ? 42 LEU A HD13 2  
ATOM 1841  H HD21 . LEU A 1 41 ? 3.012   -23.980 -8.332  1.00 0.00 ? 42 LEU A HD21 2  
ATOM 1842  H HD22 . LEU A 1 41 ? 1.986   -25.332 -7.853  1.00 0.00 ? 42 LEU A HD22 2  
ATOM 1843  H HD23 . LEU A 1 41 ? 2.011   -24.796 -9.533  1.00 0.00 ? 42 LEU A HD23 2  
ATOM 1844  N N    . TRP A 1 42 ? 2.990   -20.512 -5.264  1.00 0.00 ? 43 TRP A N    2  
ATOM 1845  C CA   . TRP A 1 42 ? 3.959   -19.419 -4.969  1.00 0.00 ? 43 TRP A CA   2  
ATOM 1846  C C    . TRP A 1 42 ? 5.227   -20.015 -4.350  1.00 0.00 ? 43 TRP A C    2  
ATOM 1847  O O    . TRP A 1 42 ? 6.328   -19.750 -4.791  1.00 0.00 ? 43 TRP A O    2  
ATOM 1848  C CB   . TRP A 1 42 ? 3.321   -18.428 -3.990  1.00 0.00 ? 43 TRP A CB   2  
ATOM 1849  C CG   . TRP A 1 42 ? 4.372   -17.533 -3.414  1.00 0.00 ? 43 TRP A CG   2  
ATOM 1850  C CD1  . TRP A 1 42 ? 4.920   -17.673 -2.187  1.00 0.00 ? 43 TRP A CD1  2  
ATOM 1851  C CD2  . TRP A 1 42 ? 5.007   -16.369 -4.016  1.00 0.00 ? 43 TRP A CD2  2  
ATOM 1852  N NE1  . TRP A 1 42 ? 5.853   -16.668 -1.996  1.00 0.00 ? 43 TRP A NE1  2  
ATOM 1853  C CE2  . TRP A 1 42 ? 5.941   -15.837 -3.096  1.00 0.00 ? 43 TRP A CE2  2  
ATOM 1854  C CE3  . TRP A 1 42 ? 4.862   -15.728 -5.259  1.00 0.00 ? 43 TRP A CE3  2  
ATOM 1855  C CZ2  . TRP A 1 42 ? 6.706   -14.709 -3.400  1.00 0.00 ? 43 TRP A CZ2  2  
ATOM 1856  C CZ3  . TRP A 1 42 ? 5.630   -14.594 -5.567  1.00 0.00 ? 43 TRP A CZ3  2  
ATOM 1857  C CH2  . TRP A 1 42 ? 6.549   -14.085 -4.640  1.00 0.00 ? 43 TRP A CH2  2  
ATOM 1858  H H    . TRP A 1 42 ? 2.098   -20.499 -4.859  1.00 0.00 ? 43 TRP A H    2  
ATOM 1859  H HA   . TRP A 1 42 ? 4.214   -18.906 -5.885  1.00 0.00 ? 43 TRP A HA   2  
ATOM 1860  H HB2  . TRP A 1 42 ? 2.589   -17.829 -4.513  1.00 0.00 ? 43 TRP A HB2  2  
ATOM 1861  H HB3  . TRP A 1 42 ? 2.836   -18.972 -3.193  1.00 0.00 ? 43 TRP A HB3  2  
ATOM 1862  H HD1  . TRP A 1 42 ? 4.671   -18.444 -1.475  1.00 0.00 ? 43 TRP A HD1  2  
ATOM 1863  H HE1  . TRP A 1 42 ? 6.393   -16.543 -1.187  1.00 0.00 ? 43 TRP A HE1  2  
ATOM 1864  H HE3  . TRP A 1 42 ? 4.156   -16.111 -5.982  1.00 0.00 ? 43 TRP A HE3  2  
ATOM 1865  H HZ2  . TRP A 1 42 ? 7.413   -14.320 -2.681  1.00 0.00 ? 43 TRP A HZ2  2  
ATOM 1866  H HZ3  . TRP A 1 42 ? 5.509   -14.110 -6.524  1.00 0.00 ? 43 TRP A HZ3  2  
ATOM 1867  H HH2  . TRP A 1 42 ? 7.136   -13.212 -4.884  1.00 0.00 ? 43 TRP A HH2  2  
ATOM 1868  N N    . ARG A 1 43 ? 5.083   -20.812 -3.327  1.00 0.00 ? 44 ARG A N    2  
ATOM 1869  C CA   . ARG A 1 43 ? 6.280   -21.416 -2.679  1.00 0.00 ? 44 ARG A CA   2  
ATOM 1870  C C    . ARG A 1 43 ? 6.691   -22.685 -3.430  1.00 0.00 ? 44 ARG A C    2  
ATOM 1871  O O    . ARG A 1 43 ? 7.534   -23.436 -2.981  1.00 0.00 ? 44 ARG A O    2  
ATOM 1872  C CB   . ARG A 1 43 ? 5.950   -21.773 -1.227  1.00 0.00 ? 44 ARG A CB   2  
ATOM 1873  C CG   . ARG A 1 43 ? 6.842   -20.964 -0.282  1.00 0.00 ? 44 ARG A CG   2  
ATOM 1874  C CD   . ARG A 1 43 ? 6.579   -21.395 1.164   1.00 0.00 ? 44 ARG A CD   2  
ATOM 1875  N NE   . ARG A 1 43 ? 6.153   -20.214 1.967   1.00 0.00 ? 44 ARG A NE   2  
ATOM 1876  C CZ   . ARG A 1 43 ? 6.662   -20.012 3.152   1.00 0.00 ? 44 ARG A CZ   2  
ATOM 1877  N NH1  . ARG A 1 43 ? 7.158   -21.012 3.829   1.00 0.00 ? 44 ARG A NH1  2  
ATOM 1878  N NH2  . ARG A 1 43 ? 6.675   -18.810 3.660   1.00 0.00 ? 44 ARG A NH2  2  
ATOM 1879  H H    . ARG A 1 43 ? 4.189   -21.008 -2.982  1.00 0.00 ? 44 ARG A H    2  
ATOM 1880  H HA   . ARG A 1 43 ? 7.092   -20.706 -2.697  1.00 0.00 ? 44 ARG A HA   2  
ATOM 1881  H HB2  . ARG A 1 43 ? 4.912   -21.544 -1.028  1.00 0.00 ? 44 ARG A HB2  2  
ATOM 1882  H HB3  . ARG A 1 43 ? 6.122   -22.827 -1.068  1.00 0.00 ? 44 ARG A HB3  2  
ATOM 1883  H HG2  . ARG A 1 43 ? 7.880   -21.141 -0.527  1.00 0.00 ? 44 ARG A HG2  2  
ATOM 1884  H HG3  . ARG A 1 43 ? 6.621   -19.913 -0.388  1.00 0.00 ? 44 ARG A HG3  2  
ATOM 1885  H HD2  . ARG A 1 43 ? 5.798   -22.140 1.180   1.00 0.00 ? 44 ARG A HD2  2  
ATOM 1886  H HD3  . ARG A 1 43 ? 7.482   -21.811 1.586   1.00 0.00 ? 44 ARG A HD3  2  
ATOM 1887  H HE   . ARG A 1 43 ? 5.491   -19.588 1.606   1.00 0.00 ? 44 ARG A HE   2  
ATOM 1888  H HH11 . ARG A 1 43 ? 7.151   -21.932 3.440   1.00 0.00 ? 44 ARG A HH11 2  
ATOM 1889  H HH12 . ARG A 1 43 ? 7.546   -20.856 4.738   1.00 0.00 ? 44 ARG A HH12 2  
ATOM 1890  H HH21 . ARG A 1 43 ? 6.296   -18.044 3.140   1.00 0.00 ? 44 ARG A HH21 2  
ATOM 1891  H HH22 . ARG A 1 43 ? 7.064   -18.655 4.568   1.00 0.00 ? 44 ARG A HH22 2  
ATOM 1892  N N    . ALA A 1 44 ? 6.098   -22.940 -4.565  1.00 0.00 ? 45 ALA A N    2  
ATOM 1893  C CA   . ALA A 1 44 ? 6.455   -24.169 -5.328  1.00 0.00 ? 45 ALA A CA   2  
ATOM 1894  C C    . ALA A 1 44 ? 6.891   -23.800 -6.749  1.00 0.00 ? 45 ALA A C    2  
ATOM 1895  O O    . ALA A 1 44 ? 7.182   -24.660 -7.556  1.00 0.00 ? 45 ALA A O    2  
ATOM 1896  C CB   . ALA A 1 44 ? 5.233   -25.084 -5.396  1.00 0.00 ? 45 ALA A CB   2  
ATOM 1897  H H    . ALA A 1 44 ? 5.414   -22.331 -4.910  1.00 0.00 ? 45 ALA A H    2  
ATOM 1898  H HA   . ALA A 1 44 ? 7.260   -24.683 -4.825  1.00 0.00 ? 45 ALA A HA   2  
ATOM 1899  H HB1  . ALA A 1 44 ? 4.336   -24.484 -5.347  1.00 0.00 ? 45 ALA A HB1  2  
ATOM 1900  H HB2  . ALA A 1 44 ? 5.248   -25.637 -6.324  1.00 0.00 ? 45 ALA A HB2  2  
ATOM 1901  H HB3  . ALA A 1 44 ? 5.251   -25.773 -4.564  1.00 0.00 ? 45 ALA A HB3  2  
ATOM 1902  N N    . MET A 1 45 ? 6.933   -22.535 -7.069  1.00 0.00 ? 46 MET A N    2  
ATOM 1903  C CA   . MET A 1 45 ? 7.342   -22.131 -8.432  1.00 0.00 ? 46 MET A CA   2  
ATOM 1904  C C    . MET A 1 45 ? 8.874   -22.111 -8.519  1.00 0.00 ? 46 MET A C    2  
ATOM 1905  O O    . MET A 1 45 ? 9.518   -23.138 -8.444  1.00 0.00 ? 46 MET A O    2  
ATOM 1906  C CB   . MET A 1 45 ? 6.760   -20.749 -8.715  1.00 0.00 ? 46 MET A CB   2  
ATOM 1907  C CG   . MET A 1 45 ? 7.036   -19.839 -7.525  1.00 0.00 ? 46 MET A CG   2  
ATOM 1908  S SD   . MET A 1 45 ? 7.486   -18.188 -8.115  1.00 0.00 ? 46 MET A SD   2  
ATOM 1909  C CE   . MET A 1 45 ? 6.280   -17.264 -7.133  1.00 0.00 ? 46 MET A CE   2  
ATOM 1910  H H    . MET A 1 45 ? 6.694   -21.850 -6.419  1.00 0.00 ? 46 MET A H    2  
ATOM 1911  H HA   . MET A 1 45 ? 6.952   -22.833 -9.143  1.00 0.00 ? 46 MET A HA   2  
ATOM 1912  H HB2  . MET A 1 45 ? 7.212   -20.338 -9.604  1.00 0.00 ? 46 MET A HB2  2  
ATOM 1913  H HB3  . MET A 1 45 ? 5.696   -20.836 -8.853  1.00 0.00 ? 46 MET A HB3  2  
ATOM 1914  H HG2  . MET A 1 45 ? 6.154   -19.776 -6.909  1.00 0.00 ? 46 MET A HG2  2  
ATOM 1915  H HG3  . MET A 1 45 ? 7.850   -20.251 -6.948  1.00 0.00 ? 46 MET A HG3  2  
ATOM 1916  H HE1  . MET A 1 45 ? 6.236   -17.673 -6.136  1.00 0.00 ? 46 MET A HE1  2  
ATOM 1917  H HE2  . MET A 1 45 ? 6.579   -16.226 -7.081  1.00 0.00 ? 46 MET A HE2  2  
ATOM 1918  H HE3  . MET A 1 45 ? 5.306   -17.341 -7.595  1.00 0.00 ? 46 MET A HE3  2  
ATOM 1919  N N    . LYS A 1 46 ? 9.466   -20.960 -8.684  1.00 0.00 ? 47 LYS A N    2  
ATOM 1920  C CA   . LYS A 1 46 ? 10.943  -20.886 -8.780  1.00 0.00 ? 47 LYS A CA   2  
ATOM 1921  C C    . LYS A 1 46 ? 11.506  -20.235 -7.515  1.00 0.00 ? 47 LYS A C    2  
ATOM 1922  O O    . LYS A 1 46 ? 11.940  -20.904 -6.599  1.00 0.00 ? 47 LYS A O    2  
ATOM 1923  C CB   . LYS A 1 46 ? 11.296  -20.033 -9.989  1.00 0.00 ? 47 LYS A CB   2  
ATOM 1924  C CG   . LYS A 1 46 ? 11.790  -20.932 -11.124 1.00 0.00 ? 47 LYS A CG   2  
ATOM 1925  C CD   . LYS A 1 46 ? 10.591  -21.455 -11.917 1.00 0.00 ? 47 LYS A CD   2  
ATOM 1926  C CE   . LYS A 1 46 ? 11.082  -22.383 -13.029 1.00 0.00 ? 47 LYS A CE   2  
ATOM 1927  N NZ   . LYS A 1 46 ? 11.974  -23.425 -12.448 1.00 0.00 ? 47 LYS A NZ   2  
ATOM 1928  H H    . LYS A 1 46 ? 8.945   -20.144 -8.752  1.00 0.00 ? 47 LYS A H    2  
ATOM 1929  H HA   . LYS A 1 46 ? 11.351  -21.875 -8.899  1.00 0.00 ? 47 LYS A HA   2  
ATOM 1930  H HB2  . LYS A 1 46 ? 10.410  -19.499 -10.306 1.00 0.00 ? 47 LYS A HB2  2  
ATOM 1931  H HB3  . LYS A 1 46 ? 12.070  -19.329 -9.723  1.00 0.00 ? 47 LYS A HB3  2  
ATOM 1932  H HG2  . LYS A 1 46 ? 12.437  -20.364 -11.778 1.00 0.00 ? 47 LYS A HG2  2  
ATOM 1933  H HG3  . LYS A 1 46 ? 12.336  -21.766 -10.711 1.00 0.00 ? 47 LYS A HG3  2  
ATOM 1934  H HD2  . LYS A 1 46 ? 9.933   -21.999 -11.255 1.00 0.00 ? 47 LYS A HD2  2  
ATOM 1935  H HD3  . LYS A 1 46 ? 10.058  -20.623 -12.353 1.00 0.00 ? 47 LYS A HD3  2  
ATOM 1936  H HE2  . LYS A 1 46 ? 10.234  -22.858 -13.501 1.00 0.00 ? 47 LYS A HE2  2  
ATOM 1937  H HE3  . LYS A 1 46 ? 11.628  -21.810 -13.762 1.00 0.00 ? 47 LYS A HE3  2  
ATOM 1938  H HZ1  . LYS A 1 46 ? 11.852  -23.451 -11.416 1.00 0.00 ? 47 LYS A HZ1  2  
ATOM 1939  H HZ2  . LYS A 1 46 ? 11.729  -24.354 -12.846 1.00 0.00 ? 47 LYS A HZ2  2  
ATOM 1940  H HZ3  . LYS A 1 46 ? 12.965  -23.200 -12.675 1.00 0.00 ? 47 LYS A HZ3  2  
ATOM 1941  N N    . ASP A 1 47 ? 11.498  -18.931 -7.464  1.00 0.00 ? 48 ASP A N    2  
ATOM 1942  C CA   . ASP A 1 47 ? 12.029  -18.225 -6.265  1.00 0.00 ? 48 ASP A CA   2  
ATOM 1943  C C    . ASP A 1 47 ? 11.112  -17.049 -5.921  1.00 0.00 ? 48 ASP A C    2  
ATOM 1944  O O    . ASP A 1 47 ? 10.045  -16.895 -6.482  1.00 0.00 ? 48 ASP A O    2  
ATOM 1945  C CB   . ASP A 1 47 ? 13.436  -17.703 -6.566  1.00 0.00 ? 48 ASP A CB   2  
ATOM 1946  C CG   . ASP A 1 47 ? 14.414  -18.875 -6.639  1.00 0.00 ? 48 ASP A CG   2  
ATOM 1947  O OD1  . ASP A 1 47 ? 14.150  -19.796 -7.397  1.00 0.00 ? 48 ASP A OD1  2  
ATOM 1948  O OD2  . ASP A 1 47 ? 15.411  -18.834 -5.938  1.00 0.00 ? 48 ASP A OD2  2  
ATOM 1949  H H    . ASP A 1 47 ? 11.141  -18.415 -8.216  1.00 0.00 ? 48 ASP A H    2  
ATOM 1950  H HA   . ASP A 1 47 ? 12.068  -18.908 -5.430  1.00 0.00 ? 48 ASP A HA   2  
ATOM 1951  H HB2  . ASP A 1 47 ? 13.429  -17.180 -7.512  1.00 0.00 ? 48 ASP A HB2  2  
ATOM 1952  H HB3  . ASP A 1 47 ? 13.744  -17.027 -5.783  1.00 0.00 ? 48 ASP A HB3  2  
ATOM 1953  N N    . LYS A 1 48 ? 11.521  -16.215 -5.006  1.00 0.00 ? 49 LYS A N    2  
ATOM 1954  C CA   . LYS A 1 48 ? 10.674  -15.048 -4.630  1.00 0.00 ? 49 LYS A CA   2  
ATOM 1955  C C    . LYS A 1 48 ? 11.413  -13.755 -4.970  1.00 0.00 ? 49 LYS A C    2  
ATOM 1956  O O    . LYS A 1 48 ? 10.814  -12.710 -5.132  1.00 0.00 ? 49 LYS A O    2  
ATOM 1957  C CB   . LYS A 1 48 ? 10.387  -15.090 -3.129  1.00 0.00 ? 49 LYS A CB   2  
ATOM 1958  C CG   . LYS A 1 48 ? 9.684   -16.403 -2.780  1.00 0.00 ? 49 LYS A CG   2  
ATOM 1959  C CD   . LYS A 1 48 ? 9.527   -16.509 -1.262  1.00 0.00 ? 49 LYS A CD   2  
ATOM 1960  C CE   . LYS A 1 48 ? 10.509  -17.547 -0.715  1.00 0.00 ? 49 LYS A CE   2  
ATOM 1961  N NZ   . LYS A 1 48 ? 9.878   -18.897 -0.743  1.00 0.00 ? 49 LYS A NZ   2  
ATOM 1962  H H    . LYS A 1 48 ? 12.386  -16.354 -4.567  1.00 0.00 ? 49 LYS A H    2  
ATOM 1963  H HA   . LYS A 1 48 ? 9.742   -15.087 -5.177  1.00 0.00 ? 49 LYS A HA   2  
ATOM 1964  H HB2  . LYS A 1 48 ? 11.317  -15.022 -2.582  1.00 0.00 ? 49 LYS A HB2  2  
ATOM 1965  H HB3  . LYS A 1 48 ? 9.750   -14.260 -2.861  1.00 0.00 ? 49 LYS A HB3  2  
ATOM 1966  H HG2  . LYS A 1 48 ? 8.709   -16.422 -3.247  1.00 0.00 ? 49 LYS A HG2  2  
ATOM 1967  H HG3  . LYS A 1 48 ? 10.272  -17.233 -3.139  1.00 0.00 ? 49 LYS A HG3  2  
ATOM 1968  H HD2  . LYS A 1 48 ? 9.729   -15.547 -0.812  1.00 0.00 ? 49 LYS A HD2  2  
ATOM 1969  H HD3  . LYS A 1 48 ? 8.518   -16.812 -1.025  1.00 0.00 ? 49 LYS A HD3  2  
ATOM 1970  H HE2  . LYS A 1 48 ? 11.402  -17.554 -1.323  1.00 0.00 ? 49 LYS A HE2  2  
ATOM 1971  H HE3  . LYS A 1 48 ? 10.770  -17.293 0.303   1.00 0.00 ? 49 LYS A HE3  2  
ATOM 1972  H HZ1  . LYS A 1 48 ? 9.057   -18.884 -1.381  1.00 0.00 ? 49 LYS A HZ1  2  
ATOM 1973  H HZ2  . LYS A 1 48 ? 10.568  -19.596 -1.085  1.00 0.00 ? 49 LYS A HZ2  2  
ATOM 1974  H HZ3  . LYS A 1 48 ? 9.567   -19.154 0.217   1.00 0.00 ? 49 LYS A HZ3  2  
ATOM 1975  N N    . SER A 1 49 ? 12.712  -13.816 -5.079  1.00 0.00 ? 50 SER A N    2  
ATOM 1976  C CA   . SER A 1 49 ? 13.491  -12.589 -5.409  1.00 0.00 ? 50 SER A CA   2  
ATOM 1977  C C    . SER A 1 49 ? 13.033  -12.039 -6.762  1.00 0.00 ? 50 SER A C    2  
ATOM 1978  O O    . SER A 1 49 ? 13.325  -10.913 -7.116  1.00 0.00 ? 50 SER A O    2  
ATOM 1979  C CB   . SER A 1 49 ? 14.979  -12.935 -5.475  1.00 0.00 ? 50 SER A CB   2  
ATOM 1980  O OG   . SER A 1 49 ? 15.628  -12.433 -4.315  1.00 0.00 ? 50 SER A OG   2  
ATOM 1981  H H    . SER A 1 49 ? 13.175  -14.668 -4.943  1.00 0.00 ? 50 SER A H    2  
ATOM 1982  H HA   . SER A 1 49 ? 13.328  -11.844 -4.645  1.00 0.00 ? 50 SER A HA   2  
ATOM 1983  H HB2  . SER A 1 49 ? 15.100  -14.005 -5.514  1.00 0.00 ? 50 SER A HB2  2  
ATOM 1984  H HB3  . SER A 1 49 ? 15.411  -12.492 -6.362  1.00 0.00 ? 50 SER A HB3  2  
ATOM 1985  H HG   . SER A 1 49 ? 15.160  -11.645 -4.030  1.00 0.00 ? 50 SER A HG   2  
ATOM 1986  N N    . GLU A 1 50 ? 12.308  -12.821 -7.517  1.00 0.00 ? 51 GLU A N    2  
ATOM 1987  C CA   . GLU A 1 50 ? 11.825  -12.345 -8.837  1.00 0.00 ? 51 GLU A CA   2  
ATOM 1988  C C    . GLU A 1 50 ? 10.849  -11.192 -8.634  1.00 0.00 ? 51 GLU A C    2  
ATOM 1989  O O    . GLU A 1 50 ? 11.126  -10.060 -8.979  1.00 0.00 ? 51 GLU A O    2  
ATOM 1990  C CB   . GLU A 1 50 ? 11.129  -13.484 -9.547  1.00 0.00 ? 51 GLU A CB   2  
ATOM 1991  C CG   . GLU A 1 50 ? 11.871  -14.794 -9.280  1.00 0.00 ? 51 GLU A CG   2  
ATOM 1992  C CD   . GLU A 1 50 ? 11.996  -15.588 -10.582 1.00 0.00 ? 51 GLU A CD   2  
ATOM 1993  O OE1  . GLU A 1 50 ? 10.970  -15.985 -11.110 1.00 0.00 ? 51 GLU A OE1  2  
ATOM 1994  O OE2  . GLU A 1 50 ? 13.114  -15.784 -11.029 1.00 0.00 ? 51 GLU A OE2  2  
ATOM 1995  H H    . GLU A 1 50 ? 12.071  -13.720 -7.214  1.00 0.00 ? 51 GLU A H    2  
ATOM 1996  H HA   . GLU A 1 50 ? 12.650  -12.019 -9.441  1.00 0.00 ? 51 GLU A HA   2  
ATOM 1997  H HB2  . GLU A 1 50 ? 10.114  -13.560 -9.190  1.00 0.00 ? 51 GLU A HB2  2  
ATOM 1998  H HB3  . GLU A 1 50 ? 11.137  -13.275 -10.598 1.00 0.00 ? 51 GLU A HB3  2  
ATOM 1999  H HG2  . GLU A 1 50 ? 12.858  -14.576 -8.895  1.00 0.00 ? 51 GLU A HG2  2  
ATOM 2000  H HG3  . GLU A 1 50 ? 11.324  -15.379 -8.556  1.00 0.00 ? 51 GLU A HG3  2  
ATOM 2001  N N    . TRP A 1 51 ? 9.709   -11.468 -8.068  1.00 0.00 ? 52 TRP A N    2  
ATOM 2002  C CA   . TRP A 1 51 ? 8.716   -10.390 -7.833  1.00 0.00 ? 52 TRP A CA   2  
ATOM 2003  C C    . TRP A 1 51 ? 9.270   -9.416  -6.815  1.00 0.00 ? 52 TRP A C    2  
ATOM 2004  O O    . TRP A 1 51 ? 9.211   -8.228  -6.998  1.00 0.00 ? 52 TRP A O    2  
ATOM 2005  C CB   . TRP A 1 51 ? 7.439   -10.990 -7.278  1.00 0.00 ? 52 TRP A CB   2  
ATOM 2006  C CG   . TRP A 1 51 ? 7.042   -12.138 -8.106  1.00 0.00 ? 52 TRP A CG   2  
ATOM 2007  C CD1  . TRP A 1 51 ? 7.324   -13.401 -7.811  1.00 0.00 ? 52 TRP A CD1  2  
ATOM 2008  C CD2  . TRP A 1 51 ? 6.294   -12.148 -9.342  1.00 0.00 ? 52 TRP A CD2  2  
ATOM 2009  N NE1  . TRP A 1 51 ? 6.800   -14.218 -8.793  1.00 0.00 ? 52 TRP A NE1  2  
ATOM 2010  C CE2  . TRP A 1 51 ? 6.146   -13.484 -9.765  1.00 0.00 ? 52 TRP A CE2  2  
ATOM 2011  C CE3  . TRP A 1 51 ? 5.736   -11.133 -10.123 1.00 0.00 ? 52 TRP A CE3  2  
ATOM 2012  C CZ2  . TRP A 1 51 ? 5.459   -13.804 -10.936 1.00 0.00 ? 52 TRP A CZ2  2  
ATOM 2013  C CZ3  . TRP A 1 51 ? 5.045   -11.442 -11.296 1.00 0.00 ? 52 TRP A CZ3  2  
ATOM 2014  C CH2  . TRP A 1 51 ? 4.902   -12.777 -11.705 1.00 0.00 ? 52 TRP A CH2  2  
ATOM 2015  H H    . TRP A 1 51 ? 9.508   -12.385 -7.790  1.00 0.00 ? 52 TRP A H    2  
ATOM 2016  H HA   . TRP A 1 51 ? 8.506   -9.874  -8.758  1.00 0.00 ? 52 TRP A HA   2  
ATOM 2017  H HB2  . TRP A 1 51 ? 7.604   -11.318 -6.264  1.00 0.00 ? 52 TRP A HB2  2  
ATOM 2018  H HB3  . TRP A 1 51 ? 6.660   -10.265 -7.293  1.00 0.00 ? 52 TRP A HB3  2  
ATOM 2019  H HD1  . TRP A 1 51 ? 7.871   -13.712 -6.947  1.00 0.00 ? 52 TRP A HD1  2  
ATOM 2020  H HE1  . TRP A 1 51 ? 6.867   -15.187 -8.812  1.00 0.00 ? 52 TRP A HE1  2  
ATOM 2021  H HE3  . TRP A 1 51 ? 5.848   -10.104 -9.824  1.00 0.00 ? 52 TRP A HE3  2  
ATOM 2022  H HZ2  . TRP A 1 51 ? 5.355   -14.835 -11.243 1.00 0.00 ? 52 TRP A HZ2  2  
ATOM 2023  H HZ3  . TRP A 1 51 ? 4.612   -10.647 -11.876 1.00 0.00 ? 52 TRP A HZ3  2  
ATOM 2024  H HH2  . TRP A 1 51 ? 4.368   -13.011 -12.612 1.00 0.00 ? 52 TRP A HH2  2  
ATOM 2025  N N    . GLU A 1 52 ? 9.792   -9.919  -5.733  1.00 0.00 ? 53 GLU A N    2  
ATOM 2026  C CA   . GLU A 1 52 ? 10.344  -9.016  -4.679  1.00 0.00 ? 53 GLU A CA   2  
ATOM 2027  C C    . GLU A 1 52 ? 11.079  -7.843  -5.331  1.00 0.00 ? 53 GLU A C    2  
ATOM 2028  O O    . GLU A 1 52 ? 10.631  -6.714  -5.274  1.00 0.00 ? 53 GLU A O    2  
ATOM 2029  C CB   . GLU A 1 52 ? 11.314  -9.795  -3.790  1.00 0.00 ? 53 GLU A CB   2  
ATOM 2030  C CG   . GLU A 1 52 ? 10.527  -10.581 -2.740  1.00 0.00 ? 53 GLU A CG   2  
ATOM 2031  C CD   . GLU A 1 52 ? 11.495  -11.406 -1.890  1.00 0.00 ? 53 GLU A CD   2  
ATOM 2032  O OE1  . GLU A 1 52 ? 12.086  -10.841 -0.982  1.00 0.00 ? 53 GLU A OE1  2  
ATOM 2033  O OE2  . GLU A 1 52 ? 11.631  -12.588 -2.159  1.00 0.00 ? 53 GLU A OE2  2  
ATOM 2034  H H    . GLU A 1 52 ? 9.808   -10.896 -5.608  1.00 0.00 ? 53 GLU A H    2  
ATOM 2035  H HA   . GLU A 1 52 ? 9.533   -8.632  -4.080  1.00 0.00 ? 53 GLU A HA   2  
ATOM 2036  H HB2  . GLU A 1 52 ? 11.888  -10.480 -4.399  1.00 0.00 ? 53 GLU A HB2  2  
ATOM 2037  H HB3  . GLU A 1 52 ? 11.983  -9.107  -3.296  1.00 0.00 ? 53 GLU A HB3  2  
ATOM 2038  H HG2  . GLU A 1 52 ? 9.986   -9.893  -2.106  1.00 0.00 ? 53 GLU A HG2  2  
ATOM 2039  H HG3  . GLU A 1 52 ? 9.829   -11.243 -3.232  1.00 0.00 ? 53 GLU A HG3  2  
ATOM 2040  N N    . ALA A 1 53 ? 12.197  -8.091  -5.954  1.00 0.00 ? 54 ALA A N    2  
ATOM 2041  C CA   . ALA A 1 53 ? 12.938  -6.975  -6.606  1.00 0.00 ? 54 ALA A CA   2  
ATOM 2042  C C    . ALA A 1 53 ? 12.025  -6.298  -7.629  1.00 0.00 ? 54 ALA A C    2  
ATOM 2043  O O    . ALA A 1 53 ? 12.142  -5.121  -7.902  1.00 0.00 ? 54 ALA A O    2  
ATOM 2044  C CB   . ALA A 1 53 ? 14.178  -7.525  -7.313  1.00 0.00 ? 54 ALA A CB   2  
ATOM 2045  H H    . ALA A 1 53 ? 12.546  -9.008  -5.997  1.00 0.00 ? 54 ALA A H    2  
ATOM 2046  H HA   . ALA A 1 53 ? 13.238  -6.255  -5.857  1.00 0.00 ? 54 ALA A HA   2  
ATOM 2047  H HB1  . ALA A 1 53 ? 14.027  -8.568  -7.546  1.00 0.00 ? 54 ALA A HB1  2  
ATOM 2048  H HB2  . ALA A 1 53 ? 14.345  -6.972  -8.226  1.00 0.00 ? 54 ALA A HB2  2  
ATOM 2049  H HB3  . ALA A 1 53 ? 15.037  -7.422  -6.666  1.00 0.00 ? 54 ALA A HB3  2  
ATOM 2050  N N    . LYS A 1 54 ? 11.118  -7.042  -8.199  1.00 0.00 ? 55 LYS A N    2  
ATOM 2051  C CA   . LYS A 1 54 ? 10.189  -6.465  -9.211  1.00 0.00 ? 55 LYS A CA   2  
ATOM 2052  C C    . LYS A 1 54 ? 9.324   -5.373  -8.579  1.00 0.00 ? 55 LYS A C    2  
ATOM 2053  O O    . LYS A 1 54 ? 8.967   -4.405  -9.219  1.00 0.00 ? 55 LYS A O    2  
ATOM 2054  C CB   . LYS A 1 54 ? 9.277   -7.569  -9.737  1.00 0.00 ? 55 LYS A CB   2  
ATOM 2055  C CG   . LYS A 1 54 ? 8.619   -7.113  -11.042 1.00 0.00 ? 55 LYS A CG   2  
ATOM 2056  C CD   . LYS A 1 54 ? 7.629   -8.178  -11.517 1.00 0.00 ? 55 LYS A CD   2  
ATOM 2057  C CE   . LYS A 1 54 ? 6.881   -7.670  -12.752 1.00 0.00 ? 55 LYS A CE   2  
ATOM 2058  N NZ   . LYS A 1 54 ? 6.299   -8.826  -13.492 1.00 0.00 ? 55 LYS A NZ   2  
ATOM 2059  H H    . LYS A 1 54 ? 11.049  -7.991  -7.962  1.00 0.00 ? 55 LYS A H    2  
ATOM 2060  H HA   . LYS A 1 54 ? 10.757  -6.048  -10.027 1.00 0.00 ? 55 LYS A HA   2  
ATOM 2061  H HB2  . LYS A 1 54 ? 9.857   -8.463  -9.916  1.00 0.00 ? 55 LYS A HB2  2  
ATOM 2062  H HB3  . LYS A 1 54 ? 8.512   -7.776  -9.002  1.00 0.00 ? 55 LYS A HB3  2  
ATOM 2063  H HG2  . LYS A 1 54 ? 8.096   -6.182  -10.874 1.00 0.00 ? 55 LYS A HG2  2  
ATOM 2064  H HG3  . LYS A 1 54 ? 9.378   -6.968  -11.796 1.00 0.00 ? 55 LYS A HG3  2  
ATOM 2065  H HD2  . LYS A 1 54 ? 8.166   -9.082  -11.767 1.00 0.00 ? 55 LYS A HD2  2  
ATOM 2066  H HD3  . LYS A 1 54 ? 6.920   -8.386  -10.731 1.00 0.00 ? 55 LYS A HD3  2  
ATOM 2067  H HE2  . LYS A 1 54 ? 6.088   -7.002  -12.446 1.00 0.00 ? 55 LYS A HE2  2  
ATOM 2068  H HE3  . LYS A 1 54 ? 7.568   -7.139  -13.396 1.00 0.00 ? 55 LYS A HE3  2  
ATOM 2069  H HZ1  . LYS A 1 54 ? 6.873   -9.674  -13.317 1.00 0.00 ? 55 LYS A HZ1  2  
ATOM 2070  H HZ2  . LYS A 1 54 ? 5.326   -8.991  -13.165 1.00 0.00 ? 55 LYS A HZ2  2  
ATOM 2071  H HZ3  . LYS A 1 54 ? 6.293   -8.619  -14.511 1.00 0.00 ? 55 LYS A HZ3  2  
ATOM 2072  N N    . ALA A 1 55 ? 8.970   -5.527  -7.335  1.00 0.00 ? 56 ALA A N    2  
ATOM 2073  C CA   . ALA A 1 55 ? 8.115   -4.505  -6.679  1.00 0.00 ? 56 ALA A CA   2  
ATOM 2074  C C    . ALA A 1 55 ? 8.890   -3.193  -6.561  1.00 0.00 ? 56 ALA A C    2  
ATOM 2075  O O    . ALA A 1 55 ? 8.316   -2.128  -6.445  1.00 0.00 ? 56 ALA A O    2  
ATOM 2076  C CB   . ALA A 1 55 ? 7.715   -4.994  -5.286  1.00 0.00 ? 56 ALA A CB   2  
ATOM 2077  H H    . ALA A 1 55 ? 9.259   -6.315  -6.836  1.00 0.00 ? 56 ALA A H    2  
ATOM 2078  H HA   . ALA A 1 55 ? 7.224   -4.352  -7.275  1.00 0.00 ? 56 ALA A HA   2  
ATOM 2079  H HB1  . ALA A 1 55 ? 7.645   -6.072  -5.289  1.00 0.00 ? 56 ALA A HB1  2  
ATOM 2080  H HB2  . ALA A 1 55 ? 8.459   -4.684  -4.568  1.00 0.00 ? 56 ALA A HB2  2  
ATOM 2081  H HB3  . ALA A 1 55 ? 6.758   -4.572  -5.017  1.00 0.00 ? 56 ALA A HB3  2  
ATOM 2082  N N    . ALA A 1 56 ? 10.193  -3.259  -6.589  1.00 0.00 ? 57 ALA A N    2  
ATOM 2083  C CA   . ALA A 1 56 ? 11.006  -2.016  -6.476  1.00 0.00 ? 57 ALA A CA   2  
ATOM 2084  C C    . ALA A 1 56 ? 10.824  -1.170  -7.736  1.00 0.00 ? 57 ALA A C    2  
ATOM 2085  O O    . ALA A 1 56 ? 10.474  -0.008  -7.672  1.00 0.00 ? 57 ALA A O    2  
ATOM 2086  C CB   . ALA A 1 56 ? 12.483  -2.381  -6.323  1.00 0.00 ? 57 ALA A CB   2  
ATOM 2087  H H    . ALA A 1 56 ? 10.638  -4.128  -6.683  1.00 0.00 ? 57 ALA A H    2  
ATOM 2088  H HA   . ALA A 1 56 ? 10.684  -1.451  -5.615  1.00 0.00 ? 57 ALA A HA   2  
ATOM 2089  H HB1  . ALA A 1 56 ? 12.573  -3.433  -6.097  1.00 0.00 ? 57 ALA A HB1  2  
ATOM 2090  H HB2  . ALA A 1 56 ? 13.004  -2.164  -7.245  1.00 0.00 ? 57 ALA A HB2  2  
ATOM 2091  H HB3  . ALA A 1 56 ? 12.916  -1.801  -5.522  1.00 0.00 ? 57 ALA A HB3  2  
ATOM 2092  N N    . LYS A 1 57 ? 11.062  -1.740  -8.885  1.00 0.00 ? 58 LYS A N    2  
ATOM 2093  C CA   . LYS A 1 57 ? 10.902  -0.963  -10.143 1.00 0.00 ? 58 LYS A CA   2  
ATOM 2094  C C    . LYS A 1 57 ? 9.522   -0.308  -10.156 1.00 0.00 ? 58 LYS A C    2  
ATOM 2095  O O    . LYS A 1 57 ? 9.386   0.853   -10.482 1.00 0.00 ? 58 LYS A O    2  
ATOM 2096  C CB   . LYS A 1 57 ? 11.047  -1.894  -11.348 1.00 0.00 ? 58 LYS A CB   2  
ATOM 2097  C CG   . LYS A 1 57 ? 12.429  -2.551  -11.318 1.00 0.00 ? 58 LYS A CG   2  
ATOM 2098  C CD   . LYS A 1 57 ? 13.479  -1.551  -11.805 1.00 0.00 ? 58 LYS A CD   2  
ATOM 2099  C CE   . LYS A 1 57 ? 14.465  -1.253  -10.674 1.00 0.00 ? 58 LYS A CE   2  
ATOM 2100  N NZ   . LYS A 1 57 ? 15.803  -0.933  -11.248 1.00 0.00 ? 58 LYS A NZ   2  
ATOM 2101  H H    . LYS A 1 57 ? 11.346  -2.678  -8.918  1.00 0.00 ? 58 LYS A H    2  
ATOM 2102  H HA   . LYS A 1 57 ? 11.660  -0.194  -10.188 1.00 0.00 ? 58 LYS A HA   2  
ATOM 2103  H HB2  . LYS A 1 57 ? 10.283  -2.657  -11.308 1.00 0.00 ? 58 LYS A HB2  2  
ATOM 2104  H HB3  . LYS A 1 57 ? 10.940  -1.324  -12.259 1.00 0.00 ? 58 LYS A HB3  2  
ATOM 2105  H HG2  . LYS A 1 57 ? 12.661  -2.853  -10.308 1.00 0.00 ? 58 LYS A HG2  2  
ATOM 2106  H HG3  . LYS A 1 57 ? 12.432  -3.415  -11.964 1.00 0.00 ? 58 LYS A HG3  2  
ATOM 2107  H HD2  . LYS A 1 57 ? 14.011  -1.969  -12.648 1.00 0.00 ? 58 LYS A HD2  2  
ATOM 2108  H HD3  . LYS A 1 57 ? 12.992  -0.635  -12.105 1.00 0.00 ? 58 LYS A HD3  2  
ATOM 2109  H HE2  . LYS A 1 57 ? 14.110  -0.410  -10.100 1.00 0.00 ? 58 LYS A HE2  2  
ATOM 2110  H HE3  . LYS A 1 57 ? 14.547  -2.117  -10.031 1.00 0.00 ? 58 LYS A HE3  2  
ATOM 2111  H HZ1  . LYS A 1 57 ? 15.875  -1.340  -12.205 1.00 0.00 ? 58 LYS A HZ1  2  
ATOM 2112  H HZ2  . LYS A 1 57 ? 15.921  0.098   -11.300 1.00 0.00 ? 58 LYS A HZ2  2  
ATOM 2113  H HZ3  . LYS A 1 57 ? 16.545  -1.335  -10.644 1.00 0.00 ? 58 LYS A HZ3  2  
ATOM 2114  N N    . ALA A 1 58 ? 8.495   -1.027  -9.790  1.00 0.00 ? 59 ALA A N    2  
ATOM 2115  C CA   . ALA A 1 58 ? 7.146   -0.404  -9.773  1.00 0.00 ? 59 ALA A CA   2  
ATOM 2116  C C    . ALA A 1 58 ? 7.158   0.719   -8.751  1.00 0.00 ? 59 ALA A C    2  
ATOM 2117  O O    . ALA A 1 58 ? 6.519   1.728   -8.921  1.00 0.00 ? 59 ALA A O    2  
ATOM 2118  C CB   . ALA A 1 58 ? 6.083   -1.431  -9.369  1.00 0.00 ? 59 ALA A CB   2  
ATOM 2119  H H    . ALA A 1 58 ? 8.614   -1.962  -9.513  1.00 0.00 ? 59 ALA A H    2  
ATOM 2120  H HA   . ALA A 1 58 ? 6.917   0.000   -10.750 1.00 0.00 ? 59 ALA A HA   2  
ATOM 2121  H HB1  . ALA A 1 58 ? 6.548   -2.227  -8.807  1.00 0.00 ? 59 ALA A HB1  2  
ATOM 2122  H HB2  . ALA A 1 58 ? 5.330   -0.947  -8.752  1.00 0.00 ? 59 ALA A HB2  2  
ATOM 2123  H HB3  . ALA A 1 58 ? 5.617   -1.837  -10.254 1.00 0.00 ? 59 ALA A HB3  2  
ATOM 2124  N N    . LYS A 1 59 ? 7.890   0.544   -7.689  1.00 0.00 ? 60 LYS A N    2  
ATOM 2125  C CA   . LYS A 1 59 ? 7.961   1.584   -6.642  1.00 0.00 ? 60 LYS A CA   2  
ATOM 2126  C C    . LYS A 1 59 ? 8.415   2.898   -7.254  1.00 0.00 ? 60 LYS A C    2  
ATOM 2127  O O    . LYS A 1 59 ? 7.772   3.909   -7.111  1.00 0.00 ? 60 LYS A O    2  
ATOM 2128  C CB   . LYS A 1 59 ? 8.979   1.139   -5.608  1.00 0.00 ? 60 LYS A CB   2  
ATOM 2129  C CG   . LYS A 1 59 ? 8.391   1.285   -4.205  1.00 0.00 ? 60 LYS A CG   2  
ATOM 2130  C CD   . LYS A 1 59 ? 7.520   0.068   -3.892  1.00 0.00 ? 60 LYS A CD   2  
ATOM 2131  C CE   . LYS A 1 59 ? 7.568   -0.224  -2.392  1.00 0.00 ? 60 LYS A CE   2  
ATOM 2132  N NZ   . LYS A 1 59 ? 6.307   -0.902  -1.980  1.00 0.00 ? 60 LYS A NZ   2  
ATOM 2133  H H    . LYS A 1 59 ? 8.406   -0.279  -7.577  1.00 0.00 ? 60 LYS A H    2  
ATOM 2134  H HA   . LYS A 1 59 ? 6.995   1.710   -6.181  1.00 0.00 ? 60 LYS A HA   2  
ATOM 2135  H HB2  . LYS A 1 59 ? 9.241   0.110   -5.793  1.00 0.00 ? 60 LYS A HB2  2  
ATOM 2136  H HB3  . LYS A 1 59 ? 9.858   1.745   -5.699  1.00 0.00 ? 60 LYS A HB3  2  
ATOM 2137  H HG2  . LYS A 1 59 ? 9.193   1.351   -3.483  1.00 0.00 ? 60 LYS A HG2  2  
ATOM 2138  H HG3  . LYS A 1 59 ? 7.789   2.179   -4.157  1.00 0.00 ? 60 LYS A HG3  2  
ATOM 2139  H HD2  . LYS A 1 59 ? 6.501   0.270   -4.189  1.00 0.00 ? 60 LYS A HD2  2  
ATOM 2140  H HD3  . LYS A 1 59 ? 7.890   -0.789  -4.435  1.00 0.00 ? 60 LYS A HD3  2  
ATOM 2141  H HE2  . LYS A 1 59 ? 8.410   -0.865  -2.176  1.00 0.00 ? 60 LYS A HE2  2  
ATOM 2142  H HE3  . LYS A 1 59 ? 7.672   0.704   -1.848  1.00 0.00 ? 60 LYS A HE3  2  
ATOM 2143  H HZ1  . LYS A 1 59 ? 6.133   -1.715  -2.607  1.00 0.00 ? 60 LYS A HZ1  2  
ATOM 2144  H HZ2  . LYS A 1 59 ? 6.394   -1.232  -0.998  1.00 0.00 ? 60 LYS A HZ2  2  
ATOM 2145  H HZ3  . LYS A 1 59 ? 5.514   -0.233  -2.050  1.00 0.00 ? 60 LYS A HZ3  2  
ATOM 2146  N N    . ASP A 1 60 ? 9.529   2.895   -7.916  1.00 0.00 ? 61 ASP A N    2  
ATOM 2147  C CA   . ASP A 1 60 ? 10.024  4.164   -8.520  1.00 0.00 ? 61 ASP A CA   2  
ATOM 2148  C C    . ASP A 1 60 ? 9.032   4.664   -9.573  1.00 0.00 ? 61 ASP A C    2  
ATOM 2149  O O    . ASP A 1 60 ? 8.637   5.813   -9.567  1.00 0.00 ? 61 ASP A O    2  
ATOM 2150  C CB   . ASP A 1 60 ? 11.391  3.926   -9.169  1.00 0.00 ? 61 ASP A CB   2  
ATOM 2151  C CG   . ASP A 1 60 ? 12.490  4.045   -8.111  1.00 0.00 ? 61 ASP A CG   2  
ATOM 2152  O OD1  . ASP A 1 60 ? 12.655  5.130   -7.578  1.00 0.00 ? 61 ASP A OD1  2  
ATOM 2153  O OD2  . ASP A 1 60 ? 13.147  3.051   -7.853  1.00 0.00 ? 61 ASP A OD2  2  
ATOM 2154  H H    . ASP A 1 60 ? 10.046  2.061   -8.004  1.00 0.00 ? 61 ASP A H    2  
ATOM 2155  H HA   . ASP A 1 60 ? 10.115  4.910   -7.745  1.00 0.00 ? 61 ASP A HA   2  
ATOM 2156  H HB2  . ASP A 1 60 ? 11.415  2.934   -9.603  1.00 0.00 ? 61 ASP A HB2  2  
ATOM 2157  H HB3  . ASP A 1 60 ? 11.556  4.661   -9.942  1.00 0.00 ? 61 ASP A HB3  2  
ATOM 2158  N N    . ASP A 1 61 ? 8.624   3.818   -10.474 1.00 0.00 ? 62 ASP A N    2  
ATOM 2159  C CA   . ASP A 1 61 ? 7.658   4.253   -11.522 1.00 0.00 ? 62 ASP A CA   2  
ATOM 2160  C C    . ASP A 1 61 ? 6.283   4.470   -10.892 1.00 0.00 ? 62 ASP A C    2  
ATOM 2161  O O    . ASP A 1 61 ? 5.354   4.915   -11.536 1.00 0.00 ? 62 ASP A O    2  
ATOM 2162  C CB   . ASP A 1 61 ? 7.548   3.159   -12.578 1.00 0.00 ? 62 ASP A CB   2  
ATOM 2163  C CG   . ASP A 1 61 ? 8.749   3.239   -13.521 1.00 0.00 ? 62 ASP A CG   2  
ATOM 2164  O OD1  . ASP A 1 61 ? 9.650   4.011   -13.237 1.00 0.00 ? 62 ASP A OD1  2  
ATOM 2165  O OD2  . ASP A 1 61 ? 8.748   2.526   -14.512 1.00 0.00 ? 62 ASP A OD2  2  
ATOM 2166  H H    . ASP A 1 61 ? 8.951   2.893   -10.463 1.00 0.00 ? 62 ASP A H    2  
ATOM 2167  H HA   . ASP A 1 61 ? 8.001   5.168   -11.980 1.00 0.00 ? 62 ASP A HA   2  
ATOM 2168  H HB2  . ASP A 1 61 ? 7.530   2.194   -12.089 1.00 0.00 ? 62 ASP A HB2  2  
ATOM 2169  H HB3  . ASP A 1 61 ? 6.638   3.295   -13.142 1.00 0.00 ? 62 ASP A HB3  2  
ATOM 2170  N N    . TYR A 1 62 ? 6.142   4.127   -9.646  1.00 0.00 ? 63 TYR A N    2  
ATOM 2171  C CA   . TYR A 1 62 ? 4.829   4.273   -8.967  1.00 0.00 ? 63 TYR A CA   2  
ATOM 2172  C C    . TYR A 1 62 ? 4.735   5.615   -8.231  1.00 0.00 ? 63 TYR A C    2  
ATOM 2173  O O    . TYR A 1 62 ? 3.756   6.314   -8.338  1.00 0.00 ? 63 TYR A O    2  
ATOM 2174  C CB   . TYR A 1 62 ? 4.691   3.130   -7.977  1.00 0.00 ? 63 TYR A CB   2  
ATOM 2175  C CG   . TYR A 1 62 ? 3.548   3.388   -7.055  1.00 0.00 ? 63 TYR A CG   2  
ATOM 2176  C CD1  . TYR A 1 62 ? 2.253   3.465   -7.563  1.00 0.00 ? 63 TYR A CD1  2  
ATOM 2177  C CD2  . TYR A 1 62 ? 3.783   3.513   -5.691  1.00 0.00 ? 63 TYR A CD2  2  
ATOM 2178  C CE1  . TYR A 1 62 ? 1.181   3.678   -6.701  1.00 0.00 ? 63 TYR A CE1  2  
ATOM 2179  C CE2  . TYR A 1 62 ? 2.714   3.718   -4.818  1.00 0.00 ? 63 TYR A CE2  2  
ATOM 2180  C CZ   . TYR A 1 62 ? 1.407   3.804   -5.321  1.00 0.00 ? 63 TYR A CZ   2  
ATOM 2181  O OH   . TYR A 1 62 ? 0.347   4.006   -4.462  1.00 0.00 ? 63 TYR A OH   2  
ATOM 2182  H H    . TYR A 1 62 ? 6.899   3.745   -9.158  1.00 0.00 ? 63 TYR A H    2  
ATOM 2183  H HA   . TYR A 1 62 ? 4.036   4.208   -9.694  1.00 0.00 ? 63 TYR A HA   2  
ATOM 2184  H HB2  . TYR A 1 62 ? 4.513   2.212   -8.516  1.00 0.00 ? 63 TYR A HB2  2  
ATOM 2185  H HB3  . TYR A 1 62 ? 5.601   3.039   -7.404  1.00 0.00 ? 63 TYR A HB3  2  
ATOM 2186  H HD1  . TYR A 1 62 ? 2.085   3.368   -8.624  1.00 0.00 ? 63 TYR A HD1  2  
ATOM 2187  H HD2  . TYR A 1 62 ? 4.797   3.461   -5.315  1.00 0.00 ? 63 TYR A HD2  2  
ATOM 2188  H HE1  . TYR A 1 62 ? 0.181   3.742   -7.099  1.00 0.00 ? 63 TYR A HE1  2  
ATOM 2189  H HE2  . TYR A 1 62 ? 2.894   3.805   -3.758  1.00 0.00 ? 63 TYR A HE2  2  
ATOM 2190  H HH   . TYR A 1 62 ? 0.653   3.834   -3.567  1.00 0.00 ? 63 TYR A HH   2  
ATOM 2191  N N    . ASP A 1 63 ? 5.728   5.979   -7.478  1.00 0.00 ? 64 ASP A N    2  
ATOM 2192  C CA   . ASP A 1 63 ? 5.661   7.270   -6.748  1.00 0.00 ? 64 ASP A CA   2  
ATOM 2193  C C    . ASP A 1 63 ? 5.770   8.412   -7.744  1.00 0.00 ? 64 ASP A C    2  
ATOM 2194  O O    . ASP A 1 63 ? 5.281   9.502   -7.527  1.00 0.00 ? 64 ASP A O    2  
ATOM 2195  C CB   . ASP A 1 63 ? 6.810   7.343   -5.770  1.00 0.00 ? 64 ASP A CB   2  
ATOM 2196  C CG   . ASP A 1 63 ? 6.409   8.194   -4.565  1.00 0.00 ? 64 ASP A CG   2  
ATOM 2197  O OD1  . ASP A 1 63 ? 5.688   7.689   -3.722  1.00 0.00 ? 64 ASP A OD1  2  
ATOM 2198  O OD2  . ASP A 1 63 ? 6.830   9.339   -4.506  1.00 0.00 ? 64 ASP A OD2  2  
ATOM 2199  H H    . ASP A 1 63 ? 6.515   5.410   -7.388  1.00 0.00 ? 64 ASP A H    2  
ATOM 2200  H HA   . ASP A 1 63 ? 4.741   7.332   -6.206  1.00 0.00 ? 64 ASP A HA   2  
ATOM 2201  H HB2  . ASP A 1 63 ? 7.036   6.351   -5.452  1.00 0.00 ? 64 ASP A HB2  2  
ATOM 2202  H HB3  . ASP A 1 63 ? 7.668   7.779   -6.253  1.00 0.00 ? 64 ASP A HB3  2  
ATOM 2203  N N    . ARG A 1 64 ? 6.432   8.162   -8.834  1.00 0.00 ? 65 ARG A N    2  
ATOM 2204  C CA   . ARG A 1 64 ? 6.609   9.222   -9.859  1.00 0.00 ? 65 ARG A CA   2  
ATOM 2205  C C    . ARG A 1 64 ? 5.412   9.257   -10.819 1.00 0.00 ? 65 ARG A C    2  
ATOM 2206  O O    . ARG A 1 64 ? 4.977   10.310  -11.241 1.00 0.00 ? 65 ARG A O    2  
ATOM 2207  C CB   . ARG A 1 64 ? 7.889   8.949   -10.652 1.00 0.00 ? 65 ARG A CB   2  
ATOM 2208  C CG   . ARG A 1 64 ? 9.068   8.808   -9.687  1.00 0.00 ? 65 ARG A CG   2  
ATOM 2209  C CD   . ARG A 1 64 ? 10.374  8.750   -10.480 1.00 0.00 ? 65 ARG A CD   2  
ATOM 2210  N NE   . ARG A 1 64 ? 11.131  10.019  -10.287 1.00 0.00 ? 65 ARG A NE   2  
ATOM 2211  C CZ   . ARG A 1 64 ? 12.093  10.339  -11.110 1.00 0.00 ? 65 ARG A CZ   2  
ATOM 2212  N NH1  . ARG A 1 64 ? 13.017  9.466   -11.405 1.00 0.00 ? 65 ARG A NH1  2  
ATOM 2213  N NH2  . ARG A 1 64 ? 12.131  11.531  -11.638 1.00 0.00 ? 65 ARG A NH2  2  
ATOM 2214  H H    . ARG A 1 64 ? 6.827   7.276   -8.967  1.00 0.00 ? 65 ARG A H    2  
ATOM 2215  H HA   . ARG A 1 64 ? 6.695   10.167  -9.363  1.00 0.00 ? 65 ARG A HA   2  
ATOM 2216  H HB2  . ARG A 1 64 ? 7.773   8.035   -11.218 1.00 0.00 ? 65 ARG A HB2  2  
ATOM 2217  H HB3  . ARG A 1 64 ? 8.075   9.770   -11.328 1.00 0.00 ? 65 ARG A HB3  2  
ATOM 2218  H HG2  . ARG A 1 64 ? 9.088   9.656   -9.018  1.00 0.00 ? 65 ARG A HG2  2  
ATOM 2219  H HG3  . ARG A 1 64 ? 8.957   7.900   -9.114  1.00 0.00 ? 65 ARG A HG3  2  
ATOM 2220  H HD2  . ARG A 1 64 ? 10.971  7.920   -10.131 1.00 0.00 ? 65 ARG A HD2  2  
ATOM 2221  H HD3  . ARG A 1 64 ? 10.154  8.618   -11.529 1.00 0.00 ? 65 ARG A HD3  2  
ATOM 2222  H HE   . ARG A 1 64 ? 10.907  10.614  -9.541  1.00 0.00 ? 65 ARG A HE   2  
ATOM 2223  H HH11 . ARG A 1 64 ? 12.990  8.551   -11.000 1.00 0.00 ? 65 ARG A HH11 2  
ATOM 2224  H HH12 . ARG A 1 64 ? 13.752  9.712   -12.036 1.00 0.00 ? 65 ARG A HH12 2  
ATOM 2225  H HH21 . ARG A 1 64 ? 11.423  12.201  -11.412 1.00 0.00 ? 65 ARG A HH21 2  
ATOM 2226  H HH22 . ARG A 1 64 ? 12.867  11.776  -12.269 1.00 0.00 ? 65 ARG A HH22 2  
ATOM 2227  N N    . ALA A 1 65 ? 4.887   8.120   -11.182 1.00 0.00 ? 66 ALA A N    2  
ATOM 2228  C CA   . ALA A 1 65 ? 3.733   8.098   -12.131 1.00 0.00 ? 66 ALA A CA   2  
ATOM 2229  C C    . ALA A 1 65 ? 2.436   8.445   -11.408 1.00 0.00 ? 66 ALA A C    2  
ATOM 2230  O O    . ALA A 1 65 ? 1.587   9.117   -11.954 1.00 0.00 ? 66 ALA A O    2  
ATOM 2231  C CB   . ALA A 1 65 ? 3.612   6.706   -12.757 1.00 0.00 ? 66 ALA A CB   2  
ATOM 2232  H H    . ALA A 1 65 ? 5.260   7.282   -10.844 1.00 0.00 ? 66 ALA A H    2  
ATOM 2233  H HA   . ALA A 1 65 ? 3.897   8.826   -12.912 1.00 0.00 ? 66 ALA A HA   2  
ATOM 2234  H HB1  . ALA A 1 65 ? 3.452   5.974   -11.979 1.00 0.00 ? 66 ALA A HB1  2  
ATOM 2235  H HB2  . ALA A 1 65 ? 2.776   6.692   -13.441 1.00 0.00 ? 66 ALA A HB2  2  
ATOM 2236  H HB3  . ALA A 1 65 ? 4.520   6.471   -13.292 1.00 0.00 ? 66 ALA A HB3  2  
ATOM 2237  N N    . VAL A 1 66 ? 2.261   8.009   -10.194 1.00 0.00 ? 67 VAL A N    2  
ATOM 2238  C CA   . VAL A 1 66 ? 1.006   8.349   -9.486  1.00 0.00 ? 67 VAL A CA   2  
ATOM 2239  C C    . VAL A 1 66 ? 0.882   9.862   -9.416  1.00 0.00 ? 67 VAL A C    2  
ATOM 2240  O O    . VAL A 1 66 ? -0.143  10.408  -9.710  1.00 0.00 ? 67 VAL A O    2  
ATOM 2241  C CB   . VAL A 1 66 ? 0.998   7.780   -8.085  1.00 0.00 ? 67 VAL A CB   2  
ATOM 2242  C CG1  . VAL A 1 66 ? 1.208   6.272   -8.133  1.00 0.00 ? 67 VAL A CG1  2  
ATOM 2243  C CG2  . VAL A 1 66 ? 2.092   8.445   -7.294  1.00 0.00 ? 67 VAL A CG2  2  
ATOM 2244  H H    . VAL A 1 66 ? 2.944   7.474   -9.759  1.00 0.00 ? 67 VAL A H    2  
ATOM 2245  H HA   . VAL A 1 66 ? 0.181   7.948   -10.020 1.00 0.00 ? 67 VAL A HA   2  
ATOM 2246  H HB   . VAL A 1 66 ? 0.053   7.995   -7.629  1.00 0.00 ? 67 VAL A HB   2  
ATOM 2247  H HG11 . VAL A 1 66 ? 1.565   5.993   -9.113  1.00 0.00 ? 67 VAL A HG11 2  
ATOM 2248  H HG12 . VAL A 1 66 ? 1.931   5.983   -7.387  1.00 0.00 ? 67 VAL A HG12 2  
ATOM 2249  H HG13 . VAL A 1 66 ? 0.268   5.777   -7.937  1.00 0.00 ? 67 VAL A HG13 2  
ATOM 2250  H HG21 . VAL A 1 66 ? 2.985   8.476   -7.892  1.00 0.00 ? 67 VAL A HG21 2  
ATOM 2251  H HG22 . VAL A 1 66 ? 1.780   9.450   -7.059  1.00 0.00 ? 67 VAL A HG22 2  
ATOM 2252  H HG23 . VAL A 1 66 ? 2.272   7.892   -6.388  1.00 0.00 ? 67 VAL A HG23 2  
ATOM 2253  N N    . LYS A 1 67 ? 1.926   10.543  -9.039  1.00 0.00 ? 68 LYS A N    2  
ATOM 2254  C CA   . LYS A 1 67 ? 1.855   12.034  -8.967  1.00 0.00 ? 68 LYS A CA   2  
ATOM 2255  C C    . LYS A 1 67 ? 1.158   12.564  -10.224 1.00 0.00 ? 68 LYS A C    2  
ATOM 2256  O O    . LYS A 1 67 ? 0.446   13.547  -10.185 1.00 0.00 ? 68 LYS A O    2  
ATOM 2257  C CB   . LYS A 1 67 ? 3.269   12.613  -8.881  1.00 0.00 ? 68 LYS A CB   2  
ATOM 2258  C CG   . LYS A 1 67 ? 3.375   13.518  -7.652  1.00 0.00 ? 68 LYS A CG   2  
ATOM 2259  C CD   . LYS A 1 67 ? 3.151   14.972  -8.066  1.00 0.00 ? 68 LYS A CD   2  
ATOM 2260  C CE   . LYS A 1 67 ? 2.942   15.833  -6.818  1.00 0.00 ? 68 LYS A CE   2  
ATOM 2261  N NZ   . LYS A 1 67 ? 3.672   17.123  -6.976  1.00 0.00 ? 68 LYS A NZ   2  
ATOM 2262  H H    . LYS A 1 67 ? 2.753   10.076  -8.811  1.00 0.00 ? 68 LYS A H    2  
ATOM 2263  H HA   . LYS A 1 67 ? 1.291   12.326  -8.093  1.00 0.00 ? 68 LYS A HA   2  
ATOM 2264  H HB2  . LYS A 1 67 ? 3.984   11.807  -8.799  1.00 0.00 ? 68 LYS A HB2  2  
ATOM 2265  H HB3  . LYS A 1 67 ? 3.477   13.191  -9.769  1.00 0.00 ? 68 LYS A HB3  2  
ATOM 2266  H HG2  . LYS A 1 67 ? 2.626   13.229  -6.928  1.00 0.00 ? 68 LYS A HG2  2  
ATOM 2267  H HG3  . LYS A 1 67 ? 4.357   13.416  -7.214  1.00 0.00 ? 68 LYS A HG3  2  
ATOM 2268  H HD2  . LYS A 1 67 ? 4.014   15.329  -8.609  1.00 0.00 ? 68 LYS A HD2  2  
ATOM 2269  H HD3  . LYS A 1 67 ? 2.277   15.038  -8.696  1.00 0.00 ? 68 LYS A HD3  2  
ATOM 2270  H HE2  . LYS A 1 67 ? 1.888   16.029  -6.688  1.00 0.00 ? 68 LYS A HE2  2  
ATOM 2271  H HE3  . LYS A 1 67 ? 3.320   15.309  -5.952  1.00 0.00 ? 68 LYS A HE3  2  
ATOM 2272  H HZ1  . LYS A 1 67 ? 3.942   17.249  -7.972  1.00 0.00 ? 68 LYS A HZ1  2  
ATOM 2273  H HZ2  . LYS A 1 67 ? 3.058   17.908  -6.684  1.00 0.00 ? 68 LYS A HZ2  2  
ATOM 2274  H HZ3  . LYS A 1 67 ? 4.528   17.110  -6.383  1.00 0.00 ? 68 LYS A HZ3  2  
ATOM 2275  N N    . GLU A 1 68 ? 1.342   11.902  -11.331 1.00 0.00 ? 69 GLU A N    2  
ATOM 2276  C CA   . GLU A 1 68 ? 0.684   12.326  -12.589 1.00 0.00 ? 69 GLU A CA   2  
ATOM 2277  C C    . GLU A 1 68 ? -0.784  11.909  -12.475 1.00 0.00 ? 69 GLU A C    2  
ATOM 2278  O O    . GLU A 1 68 ? -1.705  12.649  -12.761 1.00 0.00 ? 69 GLU A O    2  
ATOM 2279  C CB   . GLU A 1 68 ? 1.404   11.584  -13.734 1.00 0.00 ? 69 GLU A CB   2  
ATOM 2280  C CG   . GLU A 1 68 ? 0.418   10.802  -14.601 1.00 0.00 ? 69 GLU A CG   2  
ATOM 2281  C CD   . GLU A 1 68 ? -0.493  11.773  -15.354 1.00 0.00 ? 69 GLU A CD   2  
ATOM 2282  O OE1  . GLU A 1 68 ? -0.332  12.969  -15.173 1.00 0.00 ? 69 GLU A OE1  2  
ATOM 2283  O OE2  . GLU A 1 68 ? -1.338  11.304  -16.101 1.00 0.00 ? 69 GLU A OE2  2  
ATOM 2284  H H    . GLU A 1 68 ? 1.901   11.099  -11.337 1.00 0.00 ? 69 GLU A H    2  
ATOM 2285  H HA   . GLU A 1 68 ? 0.767   13.394  -12.719 1.00 0.00 ? 69 GLU A HA   2  
ATOM 2286  H HB2  . GLU A 1 68 ? 1.936   12.295  -14.346 1.00 0.00 ? 69 GLU A HB2  2  
ATOM 2287  H HB3  . GLU A 1 68 ? 2.111   10.883  -13.297 1.00 0.00 ? 69 GLU A HB3  2  
ATOM 2288  H HG2  . GLU A 1 68 ? 0.968   10.197  -15.306 1.00 0.00 ? 69 GLU A HG2  2  
ATOM 2289  H HG3  . GLU A 1 68 ? -0.175  10.166  -13.966 1.00 0.00 ? 69 GLU A HG3  2  
ATOM 2290  N N    . PHE A 1 69 ? -0.959  10.711  -12.026 1.00 0.00 ? 70 PHE A N    2  
ATOM 2291  C CA   . PHE A 1 69 ? -2.303  10.110  -11.810 1.00 0.00 ? 70 PHE A CA   2  
ATOM 2292  C C    . PHE A 1 69 ? -3.117  10.925  -10.804 1.00 0.00 ? 70 PHE A C    2  
ATOM 2293  O O    . PHE A 1 69 ? -4.333  10.911  -10.812 1.00 0.00 ? 70 PHE A O    2  
ATOM 2294  C CB   . PHE A 1 69 ? -2.048  8.758   -11.206 1.00 0.00 ? 70 PHE A CB   2  
ATOM 2295  C CG   . PHE A 1 69 ? -3.273  8.287   -10.526 1.00 0.00 ? 70 PHE A CG   2  
ATOM 2296  C CD1  . PHE A 1 69 ? -4.275  7.702   -11.269 1.00 0.00 ? 70 PHE A CD1  2  
ATOM 2297  C CD2  . PHE A 1 69 ? -3.397  8.466   -9.157  1.00 0.00 ? 70 PHE A CD2  2  
ATOM 2298  C CE1  . PHE A 1 69 ? -5.440  7.271   -10.642 1.00 0.00 ? 70 PHE A CE1  2  
ATOM 2299  C CE2  . PHE A 1 69 ? -4.561  8.039   -8.510  1.00 0.00 ? 70 PHE A CE2  2  
ATOM 2300  C CZ   . PHE A 1 69 ? -5.589  7.438   -9.255  1.00 0.00 ? 70 PHE A CZ   2  
ATOM 2301  H H    . PHE A 1 69 ? -0.164  10.181  -11.804 1.00 0.00 ? 70 PHE A H    2  
ATOM 2302  H HA   . PHE A 1 69 ? -2.842  9.977   -12.731 1.00 0.00 ? 70 PHE A HA   2  
ATOM 2303  H HB2  . PHE A 1 69 ? -1.777  8.068   -11.982 1.00 0.00 ? 70 PHE A HB2  2  
ATOM 2304  H HB3  . PHE A 1 69 ? -1.258  8.851   -10.481 1.00 0.00 ? 70 PHE A HB3  2  
ATOM 2305  H HD1  . PHE A 1 69 ? -4.142  7.585   -12.335 1.00 0.00 ? 70 PHE A HD1  2  
ATOM 2306  H HD2  . PHE A 1 69 ? -2.586  8.945   -8.606  1.00 0.00 ? 70 PHE A HD2  2  
ATOM 2307  H HE1  . PHE A 1 69 ? -6.222  6.818   -11.225 1.00 0.00 ? 70 PHE A HE1  2  
ATOM 2308  H HE2  . PHE A 1 69 ? -4.667  8.170   -7.445  1.00 0.00 ? 70 PHE A HE2  2  
ATOM 2309  H HZ   . PHE A 1 69 ? -6.491  7.105   -8.764  1.00 0.00 ? 70 PHE A HZ   2  
ATOM 2310  N N    . GLU A 1 70 ? -2.456  11.592  -9.915  1.00 0.00 ? 71 GLU A N    2  
ATOM 2311  C CA   . GLU A 1 70 ? -3.174  12.362  -8.878  1.00 0.00 ? 71 GLU A CA   2  
ATOM 2312  C C    . GLU A 1 70 ? -3.258  13.809  -9.340  1.00 0.00 ? 71 GLU A C    2  
ATOM 2313  O O    . GLU A 1 70 ? -4.118  14.570  -8.941  1.00 0.00 ? 71 GLU A O    2  
ATOM 2314  C CB   . GLU A 1 70 ? -2.394  12.285  -7.562  1.00 0.00 ? 71 GLU A CB   2  
ATOM 2315  C CG   . GLU A 1 70 ? -2.198  10.817  -7.163  1.00 0.00 ? 71 GLU A CG   2  
ATOM 2316  C CD   . GLU A 1 70 ? -1.887  10.732  -5.667  1.00 0.00 ? 71 GLU A CD   2  
ATOM 2317  O OE1  . GLU A 1 70 ? -1.876  11.768  -5.025  1.00 0.00 ? 71 GLU A OE1  2  
ATOM 2318  O OE2  . GLU A 1 70 ? -1.666  9.631   -5.190  1.00 0.00 ? 71 GLU A OE2  2  
ATOM 2319  H H    . GLU A 1 70 ? -1.486  11.577  -9.922  1.00 0.00 ? 71 GLU A H    2  
ATOM 2320  H HA   . GLU A 1 70 ? -4.159  11.940  -8.743  1.00 0.00 ? 71 GLU A HA   2  
ATOM 2321  H HB2  . GLU A 1 70 ? -1.430  12.756  -7.688  1.00 0.00 ? 71 GLU A HB2  2  
ATOM 2322  H HB3  . GLU A 1 70 ? -2.946  12.795  -6.787  1.00 0.00 ? 71 GLU A HB3  2  
ATOM 2323  H HG2  . GLU A 1 70 ? -3.100  10.262  -7.376  1.00 0.00 ? 71 GLU A HG2  2  
ATOM 2324  H HG3  . GLU A 1 70 ? -1.375  10.394  -7.723  1.00 0.00 ? 71 GLU A HG3  2  
ATOM 2325  N N    . ALA A 1 71 ? -2.345  14.176  -10.188 1.00 0.00 ? 72 ALA A N    2  
ATOM 2326  C CA   . ALA A 1 71 ? -2.297  15.555  -10.724 1.00 0.00 ? 72 ALA A CA   2  
ATOM 2327  C C    . ALA A 1 71 ? -3.581  15.861  -11.496 1.00 0.00 ? 72 ALA A C    2  
ATOM 2328  O O    . ALA A 1 71 ? -3.918  17.004  -11.731 1.00 0.00 ? 72 ALA A O    2  
ATOM 2329  C CB   . ALA A 1 71 ? -1.097  15.632  -11.662 1.00 0.00 ? 72 ALA A CB   2  
ATOM 2330  H H    . ALA A 1 71 ? -1.672  13.528  -10.479 1.00 0.00 ? 72 ALA A H    2  
ATOM 2331  H HA   . ALA A 1 71 ? -2.173  16.260  -9.917  1.00 0.00 ? 72 ALA A HA   2  
ATOM 2332  H HB1  . ALA A 1 71 ? -0.611  14.661  -11.687 1.00 0.00 ? 72 ALA A HB1  2  
ATOM 2333  H HB2  . ALA A 1 71 ? -1.430  15.894  -12.655 1.00 0.00 ? 72 ALA A HB2  2  
ATOM 2334  H HB3  . ALA A 1 71 ? -0.402  16.376  -11.302 1.00 0.00 ? 72 ALA A HB3  2  
ATOM 2335  N N    . ASN A 1 72 ? -4.302  14.849  -11.893 1.00 0.00 ? 73 ASN A N    2  
ATOM 2336  C CA   . ASN A 1 72 ? -5.563  15.087  -12.649 1.00 0.00 ? 73 ASN A CA   2  
ATOM 2337  C C    . ASN A 1 72 ? -6.759  14.683  -11.787 1.00 0.00 ? 73 ASN A C    2  
ATOM 2338  O O    . ASN A 1 72 ? -7.134  13.528  -11.729 1.00 0.00 ? 73 ASN A O    2  
ATOM 2339  C CB   . ASN A 1 72 ? -5.552  14.256  -13.934 1.00 0.00 ? 73 ASN A CB   2  
ATOM 2340  C CG   . ASN A 1 72 ? -4.819  15.019  -15.031 1.00 0.00 ? 73 ASN A CG   2  
ATOM 2341  O OD1  . ASN A 1 72 ? -4.135  15.987  -14.766 1.00 0.00 ? 73 ASN A OD1  2  
ATOM 2342  N ND2  . ASN A 1 72 ? -4.937  14.618  -16.263 1.00 0.00 ? 73 ASN A ND2  2  
ATOM 2343  H H    . ASN A 1 72 ? -4.015  13.933  -11.694 1.00 0.00 ? 73 ASN A H    2  
ATOM 2344  H HA   . ASN A 1 72 ? -5.639  16.135  -12.899 1.00 0.00 ? 73 ASN A HA   2  
ATOM 2345  H HB2  . ASN A 1 72 ? -5.049  13.319  -13.756 1.00 0.00 ? 73 ASN A HB2  2  
ATOM 2346  H HB3  . ASN A 1 72 ? -6.565  14.068  -14.253 1.00 0.00 ? 73 ASN A HB3  2  
ATOM 2347  H HD21 . ASN A 1 72 ? -5.492  13.839  -16.475 1.00 0.00 ? 73 ASN A HD21 2  
ATOM 2348  H HD22 . ASN A 1 72 ? -4.475  15.095  -16.974 1.00 0.00 ? 73 ASN A HD22 2  
ATOM 2349  N N    . GLY A 1 73 ? -7.361  15.625  -11.115 1.00 0.00 ? 74 GLY A N    2  
ATOM 2350  C CA   . GLY A 1 73 ? -8.533  15.296  -10.255 1.00 0.00 ? 74 GLY A CA   2  
ATOM 2351  C C    . GLY A 1 73 ? -8.045  14.801  -8.893  1.00 0.00 ? 74 GLY A C    2  
ATOM 2352  O O    . GLY A 1 73 ? -6.889  15.038  -8.580  1.00 0.00 ? 74 GLY A O    2  
ATOM 2353  O OXT  . GLY A 1 73 ? -8.832  14.192  -8.189  1.00 0.00 ? 74 GLY A OXT  2  
ATOM 2354  H H    . GLY A 1 73 ? -7.042  16.549  -11.174 1.00 0.00 ? 74 GLY A H    2  
ATOM 2355  H HA2  . GLY A 1 73 ? -9.140  16.180  -10.121 1.00 0.00 ? 74 GLY A HA2  2  
ATOM 2356  H HA3  . GLY A 1 73 ? -9.121  14.522  -10.725 1.00 0.00 ? 74 GLY A HA3  2  
ATOM 2357  N N    . SER A 1 1  ? -4.552  14.629  -13.490 1.00 0.00 ? 2  SER A N    3  
ATOM 2358  C CA   . SER A 1 1  ? -3.788  13.456  -12.979 1.00 0.00 ? 2  SER A CA   3  
ATOM 2359  C C    . SER A 1 1  ? -4.512  12.861  -11.770 1.00 0.00 ? 2  SER A C    3  
ATOM 2360  O O    . SER A 1 1  ? -5.515  13.378  -11.319 1.00 0.00 ? 2  SER A O    3  
ATOM 2361  C CB   . SER A 1 1  ? -2.388  13.906  -12.563 1.00 0.00 ? 2  SER A CB   3  
ATOM 2362  O OG   . SER A 1 1  ? -2.492  15.054  -11.733 1.00 0.00 ? 2  SER A OG   3  
ATOM 2363  H H    . SER A 1 1  ? -4.123  15.508  -13.538 1.00 0.00 ? 2  SER A H    3  
ATOM 2364  H HA   . SER A 1 1  ? -3.711  12.709  -13.757 1.00 0.00 ? 2  SER A HA   3  
ATOM 2365  H HB2  . SER A 1 1  ? -1.901  13.116  -12.017 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2366  H HB3  . SER A 1 1  ? -1.809  14.139  -13.448 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2367  H HG   . SER A 1 1  ? -1.695  15.576  -11.846 1.00 0.00 ? 2  SER A HG   3  
ATOM 2368  N N    . ASP A 1 2  ? -4.013  11.777  -11.242 1.00 0.00 ? 3  ASP A N    3  
ATOM 2369  C CA   . ASP A 1 2  ? -4.672  11.149  -10.062 1.00 0.00 ? 3  ASP A CA   3  
ATOM 2370  C C    . ASP A 1 2  ? -3.608  10.537  -9.146  1.00 0.00 ? 3  ASP A C    3  
ATOM 2371  O O    . ASP A 1 2  ? -2.505  11.034  -9.041  1.00 0.00 ? 3  ASP A O    3  
ATOM 2372  C CB   . ASP A 1 2  ? -5.628  10.053  -10.536 1.00 0.00 ? 3  ASP A CB   3  
ATOM 2373  C CG   . ASP A 1 2  ? -6.870  10.037  -9.641  1.00 0.00 ? 3  ASP A CG   3  
ATOM 2374  O OD1  . ASP A 1 2  ? -6.716  10.222  -8.446  1.00 0.00 ? 3  ASP A OD1  3  
ATOM 2375  O OD2  . ASP A 1 2  ? -7.952  9.838   -10.168 1.00 0.00 ? 3  ASP A OD2  3  
ATOM 2376  H H    . ASP A 1 2  ? -3.203  11.375  -11.621 1.00 0.00 ? 3  ASP A H    3  
ATOM 2377  H HA   . ASP A 1 2  ? -5.225  11.900  -9.518  1.00 0.00 ? 3  ASP A HA   3  
ATOM 2378  H HB2  . ASP A 1 2  ? -5.921  10.248  -11.557 1.00 0.00 ? 3  ASP A HB2  3  
ATOM 2379  H HB3  . ASP A 1 2  ? -5.133  9.095   -10.479 1.00 0.00 ? 3  ASP A HB3  3  
ATOM 2380  N N    . LYS A 1 3  ? -3.932  9.461   -8.483  1.00 0.00 ? 4  LYS A N    3  
ATOM 2381  C CA   . LYS A 1 3  ? -2.947  8.815   -7.574  1.00 0.00 ? 4  LYS A CA   3  
ATOM 2382  C C    . LYS A 1 3  ? -2.123  7.788   -8.367  1.00 0.00 ? 4  LYS A C    3  
ATOM 2383  O O    . LYS A 1 3  ? -2.631  7.156   -9.271  1.00 0.00 ? 4  LYS A O    3  
ATOM 2384  C CB   . LYS A 1 3  ? -3.705  8.115   -6.447  1.00 0.00 ? 4  LYS A CB   3  
ATOM 2385  C CG   . LYS A 1 3  ? -2.953  8.300   -5.127  1.00 0.00 ? 4  LYS A CG   3  
ATOM 2386  C CD   . LYS A 1 3  ? -3.927  8.772   -4.047  1.00 0.00 ? 4  LYS A CD   3  
ATOM 2387  C CE   . LYS A 1 3  ? -5.114  7.809   -3.972  1.00 0.00 ? 4  LYS A CE   3  
ATOM 2388  N NZ   . LYS A 1 3  ? -5.886  8.066   -2.722  1.00 0.00 ? 4  LYS A NZ   3  
ATOM 2389  H H    . LYS A 1 3  ? -4.827  9.075   -8.579  1.00 0.00 ? 4  LYS A H    3  
ATOM 2390  H HA   . LYS A 1 3  ? -2.292  9.566   -7.159  1.00 0.00 ? 4  LYS A HA   3  
ATOM 2391  H HB2  . LYS A 1 3  ? -4.694  8.543   -6.361  1.00 0.00 ? 4  LYS A HB2  3  
ATOM 2392  H HB3  . LYS A 1 3  ? -3.787  7.064   -6.670  1.00 0.00 ? 4  LYS A HB3  3  
ATOM 2393  H HG2  . LYS A 1 3  ? -2.510  7.360   -4.830  1.00 0.00 ? 4  LYS A HG2  3  
ATOM 2394  H HG3  . LYS A 1 3  ? -2.178  9.040   -5.257  1.00 0.00 ? 4  LYS A HG3  3  
ATOM 2395  H HD2  . LYS A 1 3  ? -3.421  8.798   -3.092  1.00 0.00 ? 4  LYS A HD2  3  
ATOM 2396  H HD3  . LYS A 1 3  ? -4.284  9.761   -4.292  1.00 0.00 ? 4  LYS A HD3  3  
ATOM 2397  H HE2  . LYS A 1 3  ? -5.754  7.961   -4.827  1.00 0.00 ? 4  LYS A HE2  3  
ATOM 2398  H HE3  . LYS A 1 3  ? -4.752  6.793   -3.967  1.00 0.00 ? 4  LYS A HE3  3  
ATOM 2399  H HZ1  . LYS A 1 3  ? -5.235  8.084   -1.910  1.00 0.00 ? 4  LYS A HZ1  3  
ATOM 2400  H HZ2  . LYS A 1 3  ? -6.374  8.981   -2.797  1.00 0.00 ? 4  LYS A HZ2  3  
ATOM 2401  H HZ3  . LYS A 1 3  ? -6.588  7.312   -2.588  1.00 0.00 ? 4  LYS A HZ3  3  
ATOM 2402  N N    . PRO A 1 4  ? -0.871  7.662   -8.007  1.00 0.00 ? 5  PRO A N    3  
ATOM 2403  C CA   . PRO A 1 4  ? 0.061   6.730   -8.665  1.00 0.00 ? 5  PRO A CA   3  
ATOM 2404  C C    . PRO A 1 4  ? -0.172  5.288   -8.224  1.00 0.00 ? 5  PRO A C    3  
ATOM 2405  O O    . PRO A 1 4  ? -0.831  5.021   -7.239  1.00 0.00 ? 5  PRO A O    3  
ATOM 2406  C CB   . PRO A 1 4  ? 1.432   7.211   -8.231  1.00 0.00 ? 5  PRO A CB   3  
ATOM 2407  C CG   . PRO A 1 4  ? 1.215   8.013   -6.940  1.00 0.00 ? 5  PRO A CG   3  
ATOM 2408  C CD   . PRO A 1 4  ? -0.265  8.430   -6.910  1.00 0.00 ? 5  PRO A CD   3  
ATOM 2409  H HA   . PRO A 1 4  ? -0.009  6.818   -9.719  1.00 0.00 ? 5  PRO A HA   3  
ATOM 2410  H HB2  . PRO A 1 4  ? 2.077   6.362   -8.044  1.00 0.00 ? 5  PRO A HB2  3  
ATOM 2411  H HB3  . PRO A 1 4  ? 1.855   7.845   -8.990  1.00 0.00 ? 5  PRO A HB3  3  
ATOM 2412  H HG2  . PRO A 1 4  ? 1.444   7.394   -6.092  1.00 0.00 ? 5  PRO A HG2  3  
ATOM 2413  H HG3  . PRO A 1 4  ? 1.837   8.885   -6.952  1.00 0.00 ? 5  PRO A HG3  3  
ATOM 2414  H HD2  . PRO A 1 4  ? -0.712  8.161   -5.963  1.00 0.00 ? 5  PRO A HD2  3  
ATOM 2415  H HD3  . PRO A 1 4  ? -0.367  9.488   -7.095  1.00 0.00 ? 5  PRO A HD3  3  
ATOM 2416  N N    . LYS A 1 5  ? 0.379   4.358   -8.951  1.00 0.00 ? 6  LYS A N    3  
ATOM 2417  C CA   . LYS A 1 5  ? 0.216   2.925   -8.589  1.00 0.00 ? 6  LYS A CA   3  
ATOM 2418  C C    . LYS A 1 5  ? 1.016   2.634   -7.320  1.00 0.00 ? 6  LYS A C    3  
ATOM 2419  O O    . LYS A 1 5  ? 2.219   2.795   -7.282  1.00 0.00 ? 6  LYS A O    3  
ATOM 2420  C CB   . LYS A 1 5  ? 0.721   2.049   -9.725  1.00 0.00 ? 6  LYS A CB   3  
ATOM 2421  C CG   . LYS A 1 5  ? 0.178   2.566   -11.059 1.00 0.00 ? 6  LYS A CG   3  
ATOM 2422  C CD   . LYS A 1 5  ? -1.351  2.565   -11.023 1.00 0.00 ? 6  LYS A CD   3  
ATOM 2423  C CE   . LYS A 1 5  ? -1.868  3.994   -11.194 1.00 0.00 ? 6  LYS A CE   3  
ATOM 2424  N NZ   . LYS A 1 5  ? -2.953  4.014   -12.216 1.00 0.00 ? 6  LYS A NZ   3  
ATOM 2425  H H    . LYS A 1 5  ? 0.911   4.609   -9.735  1.00 0.00 ? 6  LYS A H    3  
ATOM 2426  H HA   . LYS A 1 5  ? -0.823  2.705   -8.417  1.00 0.00 ? 6  LYS A HA   3  
ATOM 2427  H HB2  . LYS A 1 5  ? 1.799   2.065   -9.739  1.00 0.00 ? 6  LYS A HB2  3  
ATOM 2428  H HB3  . LYS A 1 5  ? 0.371   1.046   -9.563  1.00 0.00 ? 6  LYS A HB3  3  
ATOM 2429  H HG2  . LYS A 1 5  ? 0.535   3.572   -11.229 1.00 0.00 ? 6  LYS A HG2  3  
ATOM 2430  H HG3  . LYS A 1 5  ? 0.517   1.925   -11.859 1.00 0.00 ? 6  LYS A HG3  3  
ATOM 2431  H HD2  . LYS A 1 5  ? -1.730  1.946   -11.824 1.00 0.00 ? 6  LYS A HD2  3  
ATOM 2432  H HD3  . LYS A 1 5  ? -1.688  2.174   -10.074 1.00 0.00 ? 6  LYS A HD3  3  
ATOM 2433  H HE2  . LYS A 1 5  ? -2.254  4.353   -10.251 1.00 0.00 ? 6  LYS A HE2  3  
ATOM 2434  H HE3  . LYS A 1 5  ? -1.058  4.632   -11.517 1.00 0.00 ? 6  LYS A HE3  3  
ATOM 2435  H HZ1  . LYS A 1 5  ? -2.667  3.444   -13.037 1.00 0.00 ? 6  LYS A HZ1  3  
ATOM 2436  H HZ2  . LYS A 1 5  ? -3.822  3.616   -11.806 1.00 0.00 ? 6  LYS A HZ2  3  
ATOM 2437  H HZ3  . LYS A 1 5  ? -3.128  4.994   -12.516 1.00 0.00 ? 6  LYS A HZ3  3  
ATOM 2438  N N    . ARG A 1 6  ? 0.354   2.222   -6.274  1.00 0.00 ? 7  ARG A N    3  
ATOM 2439  C CA   . ARG A 1 6  ? 1.072   1.939   -5.000  1.00 0.00 ? 7  ARG A CA   3  
ATOM 2440  C C    . ARG A 1 6  ? 1.930   0.674   -5.135  1.00 0.00 ? 7  ARG A C    3  
ATOM 2441  O O    . ARG A 1 6  ? 1.632   -0.199  -5.927  1.00 0.00 ? 7  ARG A O    3  
ATOM 2442  C CB   . ARG A 1 6  ? 0.051   1.741   -3.878  1.00 0.00 ? 7  ARG A CB   3  
ATOM 2443  C CG   . ARG A 1 6  ? -0.747  3.032   -3.684  1.00 0.00 ? 7  ARG A CG   3  
ATOM 2444  C CD   . ARG A 1 6  ? -0.259  3.752   -2.427  1.00 0.00 ? 7  ARG A CD   3  
ATOM 2445  N NE   . ARG A 1 6  ? -1.421  4.346   -1.711  1.00 0.00 ? 7  ARG A NE   3  
ATOM 2446  C CZ   . ARG A 1 6  ? -2.337  3.571   -1.198  1.00 0.00 ? 7  ARG A CZ   3  
ATOM 2447  N NH1  . ARG A 1 6  ? -3.368  3.214   -1.913  1.00 0.00 ? 7  ARG A NH1  3  
ATOM 2448  N NH2  . ARG A 1 6  ? -2.221  3.151   0.033   1.00 0.00 ? 7  ARG A NH2  3  
ATOM 2449  H H    . ARG A 1 6  ? -0.617  2.111   -6.323  1.00 0.00 ? 7  ARG A H    3  
ATOM 2450  H HA   . ARG A 1 6  ? 1.708   2.776   -4.756  1.00 0.00 ? 7  ARG A HA   3  
ATOM 2451  H HB2  . ARG A 1 6  ? -0.620  0.936   -4.139  1.00 0.00 ? 7  ARG A HB2  3  
ATOM 2452  H HB3  . ARG A 1 6  ? 0.567   1.497   -2.961  1.00 0.00 ? 7  ARG A HB3  3  
ATOM 2453  H HG2  . ARG A 1 6  ? -0.609  3.672   -4.543  1.00 0.00 ? 7  ARG A HG2  3  
ATOM 2454  H HG3  . ARG A 1 6  ? -1.795  2.795   -3.577  1.00 0.00 ? 7  ARG A HG3  3  
ATOM 2455  H HD2  . ARG A 1 6  ? 0.242   3.046   -1.778  1.00 0.00 ? 7  ARG A HD2  3  
ATOM 2456  H HD3  . ARG A 1 6  ? 0.432   4.534   -2.705  1.00 0.00 ? 7  ARG A HD3  3  
ATOM 2457  H HE   . ARG A 1 6  ? -1.499  5.320   -1.626  1.00 0.00 ? 7  ARG A HE   3  
ATOM 2458  H HH11 . ARG A 1 6  ? -3.457  3.534   -2.856  1.00 0.00 ? 7  ARG A HH11 3  
ATOM 2459  H HH12 . ARG A 1 6  ? -4.070  2.620   -1.519  1.00 0.00 ? 7  ARG A HH12 3  
ATOM 2460  H HH21 . ARG A 1 6  ? -1.430  3.423   0.581   1.00 0.00 ? 7  ARG A HH21 3  
ATOM 2461  H HH22 . ARG A 1 6  ? -2.923  2.557   0.427   1.00 0.00 ? 7  ARG A HH22 3  
ATOM 2462  N N    . PRO A 1 7  ? 2.969   0.620   -4.337  1.00 0.00 ? 8  PRO A N    3  
ATOM 2463  C CA   . PRO A 1 7  ? 3.906   -0.518  -4.308  1.00 0.00 ? 8  PRO A CA   3  
ATOM 2464  C C    . PRO A 1 7  ? 3.253   -1.722  -3.622  1.00 0.00 ? 8  PRO A C    3  
ATOM 2465  O O    . PRO A 1 7  ? 2.504   -1.579  -2.678  1.00 0.00 ? 8  PRO A O    3  
ATOM 2466  C CB   . PRO A 1 7  ? 5.091   0.013   -3.486  1.00 0.00 ? 8  PRO A CB   3  
ATOM 2467  C CG   . PRO A 1 7  ? 4.537   1.183   -2.638  1.00 0.00 ? 8  PRO A CG   3  
ATOM 2468  C CD   . PRO A 1 7  ? 3.299   1.698   -3.387  1.00 0.00 ? 8  PRO A CD   3  
ATOM 2469  H HA   . PRO A 1 7  ? 4.231   -0.772  -5.303  1.00 0.00 ? 8  PRO A HA   3  
ATOM 2470  H HB2  . PRO A 1 7  ? 5.477   -0.767  -2.844  1.00 0.00 ? 8  PRO A HB2  3  
ATOM 2471  H HB3  . PRO A 1 7  ? 5.866   0.376   -4.142  1.00 0.00 ? 8  PRO A HB3  3  
ATOM 2472  H HG2  . PRO A 1 7  ? 4.257   0.827   -1.655  1.00 0.00 ? 8  PRO A HG2  3  
ATOM 2473  H HG3  . PRO A 1 7  ? 5.267   1.976   -2.552  1.00 0.00 ? 8  PRO A HG3  3  
ATOM 2474  H HD2  . PRO A 1 7  ? 2.481   1.867   -2.702  1.00 0.00 ? 8  PRO A HD2  3  
ATOM 2475  H HD3  . PRO A 1 7  ? 3.535   2.597   -3.929  1.00 0.00 ? 8  PRO A HD3  3  
ATOM 2476  N N    . LEU A 1 8  ? 3.530   -2.908  -4.092  1.00 0.00 ? 9  LEU A N    3  
ATOM 2477  C CA   . LEU A 1 8  ? 2.921   -4.116  -3.464  1.00 0.00 ? 9  LEU A CA   3  
ATOM 2478  C C    . LEU A 1 8  ? 3.993   -5.170  -3.200  1.00 0.00 ? 9  LEU A C    3  
ATOM 2479  O O    . LEU A 1 8  ? 5.160   -4.983  -3.482  1.00 0.00 ? 9  LEU A O    3  
ATOM 2480  C CB   . LEU A 1 8  ? 1.791   -4.663  -4.360  1.00 0.00 ? 9  LEU A CB   3  
ATOM 2481  C CG   . LEU A 1 8  ? 2.253   -5.885  -5.150  1.00 0.00 ? 9  LEU A CG   3  
ATOM 2482  C CD1  . LEU A 1 8  ? 1.137   -6.323  -6.095  1.00 0.00 ? 9  LEU A CD1  3  
ATOM 2483  C CD2  . LEU A 1 8  ? 3.495   -5.511  -5.948  1.00 0.00 ? 9  LEU A CD2  3  
ATOM 2484  H H    . LEU A 1 8  ? 4.137   -3.001  -4.855  1.00 0.00 ? 9  LEU A H    3  
ATOM 2485  H HA   . LEU A 1 8  ? 2.499   -3.844  -2.522  1.00 0.00 ? 9  LEU A HA   3  
ATOM 2486  H HB2  . LEU A 1 8  ? 0.952   -4.942  -3.740  1.00 0.00 ? 9  LEU A HB2  3  
ATOM 2487  H HB3  . LEU A 1 8  ? 1.480   -3.892  -5.049  1.00 0.00 ? 9  LEU A HB3  3  
ATOM 2488  H HG   . LEU A 1 8  ? 2.486   -6.690  -4.470  1.00 0.00 ? 9  LEU A HG   3  
ATOM 2489  H HD11 . LEU A 1 8  ? 0.719   -5.455  -6.584  1.00 0.00 ? 9  LEU A HD11 3  
ATOM 2490  H HD12 . LEU A 1 8  ? 1.534   -6.999  -6.836  1.00 0.00 ? 9  LEU A HD12 3  
ATOM 2491  H HD13 . LEU A 1 8  ? 0.366   -6.823  -5.528  1.00 0.00 ? 9  LEU A HD13 3  
ATOM 2492  H HD21 . LEU A 1 8  ? 4.007   -4.707  -5.443  1.00 0.00 ? 9  LEU A HD21 3  
ATOM 2493  H HD22 . LEU A 1 8  ? 4.148   -6.366  -6.022  1.00 0.00 ? 9  LEU A HD22 3  
ATOM 2494  H HD23 . LEU A 1 8  ? 3.203   -5.187  -6.936  1.00 0.00 ? 9  LEU A HD23 3  
ATOM 2495  N N    . SER A 1 9  ? 3.591   -6.263  -2.637  1.00 0.00 ? 10 SER A N    3  
ATOM 2496  C CA   . SER A 1 9  ? 4.559   -7.350  -2.309  1.00 0.00 ? 10 SER A CA   3  
ATOM 2497  C C    . SER A 1 9  ? 4.810   -8.240  -3.528  1.00 0.00 ? 10 SER A C    3  
ATOM 2498  O O    . SER A 1 9  ? 4.002   -8.330  -4.436  1.00 0.00 ? 10 SER A O    3  
ATOM 2499  C CB   . SER A 1 9  ? 3.995   -8.200  -1.172  1.00 0.00 ? 10 SER A CB   3  
ATOM 2500  O OG   . SER A 1 9  ? 5.064   -8.648  -0.348  1.00 0.00 ? 10 SER A OG   3  
ATOM 2501  H H    . SER A 1 9  ? 2.644   -6.359  -2.414  1.00 0.00 ? 10 SER A H    3  
ATOM 2502  H HA   . SER A 1 9  ? 5.493   -6.912  -1.992  1.00 0.00 ? 10 SER A HA   3  
ATOM 2503  H HB2  . SER A 1 9  ? 3.315   -7.611  -0.581  1.00 0.00 ? 10 SER A HB2  3  
ATOM 2504  H HB3  . SER A 1 9  ? 3.466   -9.049  -1.588  1.00 0.00 ? 10 SER A HB3  3  
ATOM 2505  H HG   . SER A 1 9  ? 5.099   -8.083  0.427   1.00 0.00 ? 10 SER A HG   3  
ATOM 2506  N N    . ALA A 1 10 ? 5.934   -8.903  -3.544  1.00 0.00 ? 11 ALA A N    3  
ATOM 2507  C CA   . ALA A 1 10 ? 6.266   -9.798  -4.686  1.00 0.00 ? 11 ALA A CA   3  
ATOM 2508  C C    . ALA A 1 10 ? 5.264   -10.951 -4.739  1.00 0.00 ? 11 ALA A C    3  
ATOM 2509  O O    . ALA A 1 10 ? 4.730   -11.274 -5.781  1.00 0.00 ? 11 ALA A O    3  
ATOM 2510  C CB   . ALA A 1 10 ? 7.678   -10.358 -4.502  1.00 0.00 ? 11 ALA A CB   3  
ATOM 2511  H H    . ALA A 1 10 ? 6.563   -8.813  -2.797  1.00 0.00 ? 11 ALA A H    3  
ATOM 2512  H HA   . ALA A 1 10 ? 6.219   -9.237  -5.608  1.00 0.00 ? 11 ALA A HA   3  
ATOM 2513  H HB1  . ALA A 1 10 ? 8.179   -9.817  -3.714  1.00 0.00 ? 11 ALA A HB1  3  
ATOM 2514  H HB2  . ALA A 1 10 ? 7.618   -11.404 -4.239  1.00 0.00 ? 11 ALA A HB2  3  
ATOM 2515  H HB3  . ALA A 1 10 ? 8.230   -10.250 -5.423  1.00 0.00 ? 11 ALA A HB3  3  
ATOM 2516  N N    . TYR A 1 11 ? 4.996   -11.573 -3.621  1.00 0.00 ? 12 TYR A N    3  
ATOM 2517  C CA   . TYR A 1 11 ? 4.026   -12.692 -3.614  1.00 0.00 ? 12 TYR A CA   3  
ATOM 2518  C C    . TYR A 1 11 ? 2.738   -12.230 -4.290  1.00 0.00 ? 12 TYR A C    3  
ATOM 2519  O O    . TYR A 1 11 ? 1.968   -13.022 -4.798  1.00 0.00 ? 12 TYR A O    3  
ATOM 2520  C CB   . TYR A 1 11 ? 3.751   -13.083 -2.166  1.00 0.00 ? 12 TYR A CB   3  
ATOM 2521  C CG   . TYR A 1 11 ? 2.517   -13.951 -2.095  1.00 0.00 ? 12 TYR A CG   3  
ATOM 2522  C CD1  . TYR A 1 11 ? 2.286   -14.917 -3.081  1.00 0.00 ? 12 TYR A CD1  3  
ATOM 2523  C CD2  . TYR A 1 11 ? 1.609   -13.795 -1.041  1.00 0.00 ? 12 TYR A CD2  3  
ATOM 2524  C CE1  . TYR A 1 11 ? 1.148   -15.727 -3.014  1.00 0.00 ? 12 TYR A CE1  3  
ATOM 2525  C CE2  . TYR A 1 11 ? 0.469   -14.605 -0.975  1.00 0.00 ? 12 TYR A CE2  3  
ATOM 2526  C CZ   . TYR A 1 11 ? 0.238   -15.570 -1.962  1.00 0.00 ? 12 TYR A CZ   3  
ATOM 2527  O OH   . TYR A 1 11 ? -0.884  -16.370 -1.896  1.00 0.00 ? 12 TYR A OH   3  
ATOM 2528  H H    . TYR A 1 11 ? 5.426   -11.299 -2.785  1.00 0.00 ? 12 TYR A H    3  
ATOM 2529  H HA   . TYR A 1 11 ? 4.437   -13.535 -4.148  1.00 0.00 ? 12 TYR A HA   3  
ATOM 2530  H HB2  . TYR A 1 11 ? 4.599   -13.630 -1.780  1.00 0.00 ? 12 TYR A HB2  3  
ATOM 2531  H HB3  . TYR A 1 11 ? 3.604   -12.191 -1.580  1.00 0.00 ? 12 TYR A HB3  3  
ATOM 2532  H HD1  . TYR A 1 11 ? 2.986   -15.037 -3.893  1.00 0.00 ? 12 TYR A HD1  3  
ATOM 2533  H HD2  . TYR A 1 11 ? 1.787   -13.048 -0.281  1.00 0.00 ? 12 TYR A HD2  3  
ATOM 2534  H HE1  . TYR A 1 11 ? 0.971   -16.472 -3.774  1.00 0.00 ? 12 TYR A HE1  3  
ATOM 2535  H HE2  . TYR A 1 11 ? -0.233  -14.483 -0.165  1.00 0.00 ? 12 TYR A HE2  3  
ATOM 2536  H HH   . TYR A 1 11 ? -0.947  -16.718 -1.003  1.00 0.00 ? 12 TYR A HH   3  
ATOM 2537  N N    . MET A 1 12 ? 2.502   -10.948 -4.304  1.00 0.00 ? 13 MET A N    3  
ATOM 2538  C CA   . MET A 1 12 ? 1.276   -10.421 -4.949  1.00 0.00 ? 13 MET A CA   3  
ATOM 2539  C C    . MET A 1 12 ? 1.475   -10.397 -6.465  1.00 0.00 ? 13 MET A C    3  
ATOM 2540  O O    . MET A 1 12 ? 0.604   -10.787 -7.217  1.00 0.00 ? 13 MET A O    3  
ATOM 2541  C CB   . MET A 1 12 ? 1.022   -9.003  -4.446  1.00 0.00 ? 13 MET A CB   3  
ATOM 2542  C CG   . MET A 1 12 ? 1.322   -8.930  -2.948  1.00 0.00 ? 13 MET A CG   3  
ATOM 2543  S SD   . MET A 1 12 ? -0.141  -8.327  -2.069  1.00 0.00 ? 13 MET A SD   3  
ATOM 2544  C CE   . MET A 1 12 ? -1.176  -9.791  -2.319  1.00 0.00 ? 13 MET A CE   3  
ATOM 2545  H H    . MET A 1 12 ? 3.137   -10.327 -3.892  1.00 0.00 ? 13 MET A H    3  
ATOM 2546  H HA   . MET A 1 12 ? 0.434   -11.051 -4.701  1.00 0.00 ? 13 MET A HA   3  
ATOM 2547  H HB2  . MET A 1 12 ? 1.660   -8.312  -4.977  1.00 0.00 ? 13 MET A HB2  3  
ATOM 2548  H HB3  . MET A 1 12 ? -0.008  -8.743  -4.614  1.00 0.00 ? 13 MET A HB3  3  
ATOM 2549  H HG2  . MET A 1 12 ? 1.582   -9.913  -2.586  1.00 0.00 ? 13 MET A HG2  3  
ATOM 2550  H HG3  . MET A 1 12 ? 2.148   -8.254  -2.781  1.00 0.00 ? 13 MET A HG3  3  
ATOM 2551  H HE1  . MET A 1 12 ? -1.015  -10.181 -3.315  1.00 0.00 ? 13 MET A HE1  3  
ATOM 2552  H HE2  . MET A 1 12 ? -0.916  -10.546 -1.595  1.00 0.00 ? 13 MET A HE2  3  
ATOM 2553  H HE3  . MET A 1 12 ? -2.216  -9.520  -2.196  1.00 0.00 ? 13 MET A HE3  3  
ATOM 2554  N N    . LEU A 1 13 ? 2.615   -9.946  -6.926  1.00 0.00 ? 14 LEU A N    3  
ATOM 2555  C CA   . LEU A 1 13 ? 2.842   -9.913  -8.402  1.00 0.00 ? 14 LEU A CA   3  
ATOM 2556  C C    . LEU A 1 13 ? 2.542   -11.300 -8.970  1.00 0.00 ? 14 LEU A C    3  
ATOM 2557  O O    . LEU A 1 13 ? 1.752   -11.452 -9.879  1.00 0.00 ? 14 LEU A O    3  
ATOM 2558  C CB   . LEU A 1 13 ? 4.294   -9.533  -8.731  1.00 0.00 ? 14 LEU A CB   3  
ATOM 2559  C CG   . LEU A 1 13 ? 4.695   -8.277  -7.944  1.00 0.00 ? 14 LEU A CG   3  
ATOM 2560  C CD1  . LEU A 1 13 ? 6.181   -7.964  -8.155  1.00 0.00 ? 14 LEU A CD1  3  
ATOM 2561  C CD2  . LEU A 1 13 ? 3.863   -7.099  -8.446  1.00 0.00 ? 14 LEU A CD2  3  
ATOM 2562  H H    . LEU A 1 13 ? 3.310   -9.638  -6.305  1.00 0.00 ? 14 LEU A H    3  
ATOM 2563  H HA   . LEU A 1 13 ? 2.174   -9.190  -8.847  1.00 0.00 ? 14 LEU A HA   3  
ATOM 2564  H HB2  . LEU A 1 13 ? 4.958   -10.359 -8.492  1.00 0.00 ? 14 LEU A HB2  3  
ATOM 2565  H HB3  . LEU A 1 13 ? 4.363   -9.320  -9.786  1.00 0.00 ? 14 LEU A HB3  3  
ATOM 2566  H HG   . LEU A 1 13 ? 4.508   -8.428  -6.893  1.00 0.00 ? 14 LEU A HG   3  
ATOM 2567  H HD11 . LEU A 1 13 ? 6.457   -8.190  -9.175  1.00 0.00 ? 14 LEU A HD11 3  
ATOM 2568  H HD12 . LEU A 1 13 ? 6.361   -6.912  -7.957  1.00 0.00 ? 14 LEU A HD12 3  
ATOM 2569  H HD13 . LEU A 1 13 ? 6.774   -8.562  -7.480  1.00 0.00 ? 14 LEU A HD13 3  
ATOM 2570  H HD21 . LEU A 1 13 ? 3.890   -7.074  -9.525  1.00 0.00 ? 14 LEU A HD21 3  
ATOM 2571  H HD22 . LEU A 1 13 ? 2.842   -7.215  -8.116  1.00 0.00 ? 14 LEU A HD22 3  
ATOM 2572  H HD23 . LEU A 1 13 ? 4.270   -6.179  -8.055  1.00 0.00 ? 14 LEU A HD23 3  
ATOM 2573  N N    . TRP A 1 14 ? 3.158   -12.313 -8.426  1.00 0.00 ? 15 TRP A N    3  
ATOM 2574  C CA   . TRP A 1 14 ? 2.899   -13.695 -8.918  1.00 0.00 ? 15 TRP A CA   3  
ATOM 2575  C C    . TRP A 1 14 ? 1.410   -14.002 -8.756  1.00 0.00 ? 15 TRP A C    3  
ATOM 2576  O O    . TRP A 1 14 ? 0.790   -14.612 -9.604  1.00 0.00 ? 15 TRP A O    3  
ATOM 2577  C CB   . TRP A 1 14 ? 3.718   -14.686 -8.089  1.00 0.00 ? 15 TRP A CB   3  
ATOM 2578  C CG   . TRP A 1 14 ? 3.327   -16.085 -8.442  1.00 0.00 ? 15 TRP A CG   3  
ATOM 2579  C CD1  . TRP A 1 14 ? 3.875   -16.817 -9.440  1.00 0.00 ? 15 TRP A CD1  3  
ATOM 2580  C CD2  . TRP A 1 14 ? 2.322   -16.935 -7.815  1.00 0.00 ? 15 TRP A CD2  3  
ATOM 2581  N NE1  . TRP A 1 14 ? 3.273   -18.061 -9.464  1.00 0.00 ? 15 TRP A NE1  3  
ATOM 2582  C CE2  . TRP A 1 14 ? 2.310   -18.183 -8.483  1.00 0.00 ? 15 TRP A CE2  3  
ATOM 2583  C CE3  . TRP A 1 14 ? 1.431   -16.747 -6.745  1.00 0.00 ? 15 TRP A CE3  3  
ATOM 2584  C CZ2  . TRP A 1 14 ? 1.444   -19.207 -8.100  1.00 0.00 ? 15 TRP A CZ2  3  
ATOM 2585  C CZ3  . TRP A 1 14 ? 0.557   -17.777 -6.358  1.00 0.00 ? 15 TRP A CZ3  3  
ATOM 2586  C CH2  . TRP A 1 14 ? 0.563   -19.005 -7.034  1.00 0.00 ? 15 TRP A CH2  3  
ATOM 2587  H H    . TRP A 1 14 ? 3.782   -12.166 -7.684  1.00 0.00 ? 15 TRP A H    3  
ATOM 2588  H HA   . TRP A 1 14 ? 3.177   -13.771 -9.959  1.00 0.00 ? 15 TRP A HA   3  
ATOM 2589  H HB2  . TRP A 1 14 ? 4.769   -14.543 -8.294  1.00 0.00 ? 15 TRP A HB2  3  
ATOM 2590  H HB3  . TRP A 1 14 ? 3.530   -14.515 -7.039  1.00 0.00 ? 15 TRP A HB3  3  
ATOM 2591  H HD1  . TRP A 1 14 ? 4.655   -16.484 -10.107 1.00 0.00 ? 15 TRP A HD1  3  
ATOM 2592  H HE1  . TRP A 1 14 ? 3.489   -18.781 -10.092 1.00 0.00 ? 15 TRP A HE1  3  
ATOM 2593  H HE3  . TRP A 1 14 ? 1.417   -15.804 -6.218  1.00 0.00 ? 15 TRP A HE3  3  
ATOM 2594  H HZ2  . TRP A 1 14 ? 1.456   -20.153 -8.624  1.00 0.00 ? 15 TRP A HZ2  3  
ATOM 2595  H HZ3  . TRP A 1 14 ? -0.124  -17.622 -5.534  1.00 0.00 ? 15 TRP A HZ3  3  
ATOM 2596  H HH2  . TRP A 1 14 ? -0.111  -19.792 -6.732  1.00 0.00 ? 15 TRP A HH2  3  
ATOM 2597  N N    . LEU A 1 15 ? 0.836   -13.573 -7.666  1.00 0.00 ? 16 LEU A N    3  
ATOM 2598  C CA   . LEU A 1 15 ? -0.613  -13.821 -7.428  1.00 0.00 ? 16 LEU A CA   3  
ATOM 2599  C C    . LEU A 1 15 ? -1.422  -13.309 -8.623  1.00 0.00 ? 16 LEU A C    3  
ATOM 2600  O O    . LEU A 1 15 ? -2.422  -13.884 -9.001  1.00 0.00 ? 16 LEU A O    3  
ATOM 2601  C CB   . LEU A 1 15 ? -1.047  -13.070 -6.167  1.00 0.00 ? 16 LEU A CB   3  
ATOM 2602  C CG   . LEU A 1 15 ? -1.890  -13.986 -5.282  1.00 0.00 ? 16 LEU A CG   3  
ATOM 2603  C CD1  . LEU A 1 15 ? -3.195  -14.336 -6.000  1.00 0.00 ? 16 LEU A CD1  3  
ATOM 2604  C CD2  . LEU A 1 15 ? -1.110  -15.269 -4.987  1.00 0.00 ? 16 LEU A CD2  3  
ATOM 2605  H H    . LEU A 1 15 ? 1.361   -13.080 -7.000  1.00 0.00 ? 16 LEU A H    3  
ATOM 2606  H HA   . LEU A 1 15 ? -0.785  -14.878 -7.298  1.00 0.00 ? 16 LEU A HA   3  
ATOM 2607  H HB2  . LEU A 1 15 ? -0.170  -12.749 -5.622  1.00 0.00 ? 16 LEU A HB2  3  
ATOM 2608  H HB3  . LEU A 1 15 ? -1.631  -12.206 -6.447  1.00 0.00 ? 16 LEU A HB3  3  
ATOM 2609  H HG   . LEU A 1 15 ? -2.113  -13.477 -4.356  1.00 0.00 ? 16 LEU A HG   3  
ATOM 2610  H HD11 . LEU A 1 15 ? -3.146  -13.991 -7.023  1.00 0.00 ? 16 LEU A HD11 3  
ATOM 2611  H HD12 . LEU A 1 15 ? -3.336  -15.406 -5.989  1.00 0.00 ? 16 LEU A HD12 3  
ATOM 2612  H HD13 . LEU A 1 15 ? -4.022  -13.858 -5.498  1.00 0.00 ? 16 LEU A HD13 3  
ATOM 2613  H HD21 . LEU A 1 15 ? -0.051  -15.058 -4.992  1.00 0.00 ? 16 LEU A HD21 3  
ATOM 2614  H HD22 . LEU A 1 15 ? -1.396  -15.648 -4.016  1.00 0.00 ? 16 LEU A HD22 3  
ATOM 2615  H HD23 . LEU A 1 15 ? -1.333  -16.009 -5.742  1.00 0.00 ? 16 LEU A HD23 3  
ATOM 2616  N N    . ASN A 1 16 ? -0.999  -12.224 -9.213  1.00 0.00 ? 17 ASN A N    3  
ATOM 2617  C CA   . ASN A 1 16 ? -1.740  -11.664 -10.372 1.00 0.00 ? 17 ASN A CA   3  
ATOM 2618  C C    . ASN A 1 16 ? -1.338  -12.392 -11.656 1.00 0.00 ? 17 ASN A C    3  
ATOM 2619  O O    . ASN A 1 16 ? -2.088  -12.446 -12.610 1.00 0.00 ? 17 ASN A O    3  
ATOM 2620  C CB   . ASN A 1 16 ? -1.409  -10.189 -10.502 1.00 0.00 ? 17 ASN A CB   3  
ATOM 2621  C CG   . ASN A 1 16 ? -1.314  -9.556  -9.112  1.00 0.00 ? 17 ASN A CG   3  
ATOM 2622  O OD1  . ASN A 1 16 ? -2.205  -9.710  -8.301  1.00 0.00 ? 17 ASN A OD1  3  
ATOM 2623  N ND2  . ASN A 1 16 ? -0.264  -8.844  -8.801  1.00 0.00 ? 17 ASN A ND2  3  
ATOM 2624  H H    . ASN A 1 16 ? -0.195  -11.771 -8.889  1.00 0.00 ? 17 ASN A H    3  
ATOM 2625  H HA   . ASN A 1 16 ? -2.797  -11.770 -10.214 1.00 0.00 ? 17 ASN A HA   3  
ATOM 2626  H HB2  . ASN A 1 16 ? -0.467  -10.079 -11.015 1.00 0.00 ? 17 ASN A HB2  3  
ATOM 2627  H HB3  . ASN A 1 16 ? -2.190  -9.707  -11.062 1.00 0.00 ? 17 ASN A HB3  3  
ATOM 2628  H HD21 . ASN A 1 16 ? 0.454   -8.718  -9.455  1.00 0.00 ? 17 ASN A HD21 3  
ATOM 2629  H HD22 . ASN A 1 16 ? -0.195  -8.435  -7.913  1.00 0.00 ? 17 ASN A HD22 3  
ATOM 2630  N N    . SER A 1 17 ? -0.158  -12.944 -11.694 1.00 0.00 ? 18 SER A N    3  
ATOM 2631  C CA   . SER A 1 17 ? 0.290   -13.657 -12.922 1.00 0.00 ? 18 SER A CA   3  
ATOM 2632  C C    . SER A 1 17 ? -0.161  -15.117 -12.871 1.00 0.00 ? 18 SER A C    3  
ATOM 2633  O O    . SER A 1 17 ? -0.004  -15.857 -13.823 1.00 0.00 ? 18 SER A O    3  
ATOM 2634  C CB   . SER A 1 17 ? 1.810   -13.594 -13.015 1.00 0.00 ? 18 SER A CB   3  
ATOM 2635  O OG   . SER A 1 17 ? 2.366   -14.848 -12.640 1.00 0.00 ? 18 SER A OG   3  
ATOM 2636  H H    . SER A 1 17 ? 0.436   -12.886 -10.917 1.00 0.00 ? 18 SER A H    3  
ATOM 2637  H HA   . SER A 1 17 ? -0.134  -13.180 -13.790 1.00 0.00 ? 18 SER A HA   3  
ATOM 2638  H HB2  . SER A 1 17 ? 2.094   -13.368 -14.027 1.00 0.00 ? 18 SER A HB2  3  
ATOM 2639  H HB3  . SER A 1 17 ? 2.176   -12.815 -12.359 1.00 0.00 ? 18 SER A HB3  3  
ATOM 2640  H HG   . SER A 1 17 ? 3.231   -14.686 -12.258 1.00 0.00 ? 18 SER A HG   3  
ATOM 2641  N N    . ALA A 1 18 ? -0.714  -15.542 -11.770 1.00 0.00 ? 19 ALA A N    3  
ATOM 2642  C CA   . ALA A 1 18 ? -1.166  -16.958 -11.667 1.00 0.00 ? 19 ALA A CA   3  
ATOM 2643  C C    . ALA A 1 18 ? -2.691  -17.020 -11.680 1.00 0.00 ? 19 ALA A C    3  
ATOM 2644  O O    . ALA A 1 18 ? -3.270  -18.039 -11.985 1.00 0.00 ? 19 ALA A O    3  
ATOM 2645  C CB   . ALA A 1 18 ? -0.655  -17.562 -10.360 1.00 0.00 ? 19 ALA A CB   3  
ATOM 2646  H H    . ALA A 1 18 ? -0.829  -14.934 -11.011 1.00 0.00 ? 19 ALA A H    3  
ATOM 2647  H HA   . ALA A 1 18 ? -0.773  -17.521 -12.500 1.00 0.00 ? 19 ALA A HA   3  
ATOM 2648  H HB1  . ALA A 1 18 ? 0.277   -17.092 -10.084 1.00 0.00 ? 19 ALA A HB1  3  
ATOM 2649  H HB2  . ALA A 1 18 ? -1.385  -17.397 -9.581  1.00 0.00 ? 19 ALA A HB2  3  
ATOM 2650  H HB3  . ALA A 1 18 ? -0.502  -18.622 -10.490 1.00 0.00 ? 19 ALA A HB3  3  
ATOM 2651  N N    . ARG A 1 19 ? -3.350  -15.946 -11.342 1.00 0.00 ? 20 ARG A N    3  
ATOM 2652  C CA   . ARG A 1 19 ? -4.841  -15.964 -11.326 1.00 0.00 ? 20 ARG A CA   3  
ATOM 2653  C C    . ARG A 1 19 ? -5.374  -16.343 -12.707 1.00 0.00 ? 20 ARG A C    3  
ATOM 2654  O O    . ARG A 1 19 ? -6.455  -16.884 -12.836 1.00 0.00 ? 20 ARG A O    3  
ATOM 2655  C CB   . ARG A 1 19 ? -5.368  -14.581 -10.932 1.00 0.00 ? 20 ARG A CB   3  
ATOM 2656  C CG   . ARG A 1 19 ? -5.638  -14.553 -9.426  1.00 0.00 ? 20 ARG A CG   3  
ATOM 2657  C CD   . ARG A 1 19 ? -6.012  -13.132 -8.996  1.00 0.00 ? 20 ARG A CD   3  
ATOM 2658  N NE   . ARG A 1 19 ? -7.366  -12.795 -9.519  1.00 0.00 ? 20 ARG A NE   3  
ATOM 2659  C CZ   . ARG A 1 19 ? -8.428  -13.061 -8.808  1.00 0.00 ? 20 ARG A CZ   3  
ATOM 2660  N NH1  . ARG A 1 19 ? -8.489  -12.688 -7.558  1.00 0.00 ? 20 ARG A NH1  3  
ATOM 2661  N NH2  . ARG A 1 19 ? -9.431  -13.695 -9.348  1.00 0.00 ? 20 ARG A NH2  3  
ATOM 2662  H H    . ARG A 1 19 ? -2.865  -15.133 -11.089 1.00 0.00 ? 20 ARG A H    3  
ATOM 2663  H HA   . ARG A 1 19 ? -5.179  -16.694 -10.607 1.00 0.00 ? 20 ARG A HA   3  
ATOM 2664  H HB2  . ARG A 1 19 ? -4.633  -13.830 -11.181 1.00 0.00 ? 20 ARG A HB2  3  
ATOM 2665  H HB3  . ARG A 1 19 ? -6.286  -14.379 -11.463 1.00 0.00 ? 20 ARG A HB3  3  
ATOM 2666  H HG2  . ARG A 1 19 ? -6.452  -15.224 -9.194  1.00 0.00 ? 20 ARG A HG2  3  
ATOM 2667  H HG3  . ARG A 1 19 ? -4.752  -14.865 -8.895  1.00 0.00 ? 20 ARG A HG3  3  
ATOM 2668  H HD2  . ARG A 1 19 ? -6.017  -13.073 -7.918  1.00 0.00 ? 20 ARG A HD2  3  
ATOM 2669  H HD3  . ARG A 1 19 ? -5.289  -12.434 -9.391  1.00 0.00 ? 20 ARG A HD3  3  
ATOM 2670  H HE   . ARG A 1 19 ? -7.460  -12.374 -10.399 1.00 0.00 ? 20 ARG A HE   3  
ATOM 2671  H HH11 . ARG A 1 19 ? -7.721  -12.197 -7.145  1.00 0.00 ? 20 ARG A HH11 3  
ATOM 2672  H HH12 . ARG A 1 19 ? -9.303  -12.893 -7.015  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 2673  H HH21 . ARG A 1 19 ? -9.385  -13.976 -10.307 1.00 0.00 ? 20 ARG A HH21 3  
ATOM 2674  H HH22 . ARG A 1 19 ? -10.244 -13.901 -8.805  1.00 0.00 ? 20 ARG A HH22 3  
ATOM 2675  N N    . GLU A 1 20 ? -4.630  -16.072 -13.743 1.00 0.00 ? 21 GLU A N    3  
ATOM 2676  C CA   . GLU A 1 20 ? -5.108  -16.429 -15.107 1.00 0.00 ? 21 GLU A CA   3  
ATOM 2677  C C    . GLU A 1 20 ? -4.874  -17.917 -15.347 1.00 0.00 ? 21 GLU A C    3  
ATOM 2678  O O    . GLU A 1 20 ? -5.785  -18.657 -15.661 1.00 0.00 ? 21 GLU A O    3  
ATOM 2679  C CB   . GLU A 1 20 ? -4.344  -15.611 -16.151 1.00 0.00 ? 21 GLU A CB   3  
ATOM 2680  C CG   . GLU A 1 20 ? -4.978  -14.226 -16.283 1.00 0.00 ? 21 GLU A CG   3  
ATOM 2681  C CD   . GLU A 1 20 ? -3.907  -13.154 -16.072 1.00 0.00 ? 21 GLU A CD   3  
ATOM 2682  O OE1  . GLU A 1 20 ? -2.799  -13.353 -16.541 1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2683  O OE2  . GLU A 1 20 ? -4.214  -12.152 -15.447 1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2684  H H    . GLU A 1 20 ? -3.761  -15.639 -13.624 1.00 0.00 ? 21 GLU A H    3  
ATOM 2685  H HA   . GLU A 1 20 ? -6.162  -16.222 -15.181 1.00 0.00 ? 21 GLU A HA   3  
ATOM 2686  H HB2  . GLU A 1 20 ? -3.314  -15.508 -15.841 1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2687  H HB3  . GLU A 1 20 ? -4.384  -16.116 -17.105 1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2688  H HG2  . GLU A 1 20 ? -5.407  -14.119 -17.269 1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2689  H HG3  . GLU A 1 20 ? -5.751  -14.111 -15.538 1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2690  N N    . SER A 1 21 ? -3.664  -18.367 -15.186 1.00 0.00 ? 22 SER A N    3  
ATOM 2691  C CA   . SER A 1 21 ? -3.383  -19.812 -15.390 1.00 0.00 ? 22 SER A CA   3  
ATOM 2692  C C    . SER A 1 21 ? -3.976  -20.604 -14.222 1.00 0.00 ? 22 SER A C    3  
ATOM 2693  O O    . SER A 1 21 ? -3.942  -21.817 -14.200 1.00 0.00 ? 22 SER A O    3  
ATOM 2694  C CB   . SER A 1 21 ? -1.872  -20.041 -15.450 1.00 0.00 ? 22 SER A CB   3  
ATOM 2695  O OG   . SER A 1 21 ? -1.303  -19.755 -14.180 1.00 0.00 ? 22 SER A OG   3  
ATOM 2696  H H    . SER A 1 21 ? -2.947  -17.756 -14.921 1.00 0.00 ? 22 SER A H    3  
ATOM 2697  H HA   . SER A 1 21 ? -3.837  -20.140 -16.313 1.00 0.00 ? 22 SER A HA   3  
ATOM 2698  H HB2  . SER A 1 21 ? -1.671  -21.069 -15.704 1.00 0.00 ? 22 SER A HB2  3  
ATOM 2699  H HB3  . SER A 1 21 ? -1.441  -19.396 -16.204 1.00 0.00 ? 22 SER A HB3  3  
ATOM 2700  H HG   . SER A 1 21 ? -0.569  -20.358 -14.041 1.00 0.00 ? 22 SER A HG   3  
ATOM 2701  N N    . ILE A 1 22 ? -4.529  -19.921 -13.254 1.00 0.00 ? 23 ILE A N    3  
ATOM 2702  C CA   . ILE A 1 22 ? -5.134  -20.626 -12.096 1.00 0.00 ? 23 ILE A CA   3  
ATOM 2703  C C    . ILE A 1 22 ? -6.614  -20.859 -12.392 1.00 0.00 ? 23 ILE A C    3  
ATOM 2704  O O    . ILE A 1 22 ? -7.132  -21.942 -12.204 1.00 0.00 ? 23 ILE A O    3  
ATOM 2705  C CB   . ILE A 1 22 ? -4.978  -19.758 -10.836 1.00 0.00 ? 23 ILE A CB   3  
ATOM 2706  C CG1  . ILE A 1 22 ? -3.621  -20.040 -10.190 1.00 0.00 ? 23 ILE A CG1  3  
ATOM 2707  C CG2  . ILE A 1 22 ? -6.086  -20.071 -9.824  1.00 0.00 ? 23 ILE A CG2  3  
ATOM 2708  C CD1  . ILE A 1 22 ? -3.499  -19.233 -8.897  1.00 0.00 ? 23 ILE A CD1  3  
ATOM 2709  H H    . ILE A 1 22 ? -4.555  -18.943 -13.293 1.00 0.00 ? 23 ILE A H    3  
ATOM 2710  H HA   . ILE A 1 22 ? -4.638  -21.575 -11.948 1.00 0.00 ? 23 ILE A HA   3  
ATOM 2711  H HB   . ILE A 1 22 ? -5.035  -18.716 -11.112 1.00 0.00 ? 23 ILE A HB   3  
ATOM 2712  H HG12 . ILE A 1 22 ? -3.542  -21.094 -9.967  1.00 0.00 ? 23 ILE A HG12 3  
ATOM 2713  H HG13 . ILE A 1 22 ? -2.831  -19.755 -10.868 1.00 0.00 ? 23 ILE A HG13 3  
ATOM 2714  H HG21 . ILE A 1 22 ? -7.054  -19.962 -10.299 1.00 0.00 ? 23 ILE A HG21 3  
ATOM 2715  H HG22 . ILE A 1 22 ? -5.971  -21.084 -9.468  1.00 0.00 ? 23 ILE A HG22 3  
ATOM 2716  H HG23 . ILE A 1 22 ? -6.011  -19.386 -8.992  1.00 0.00 ? 23 ILE A HG23 3  
ATOM 2717  H HD11 . ILE A 1 22 ? -4.450  -18.779 -8.664  1.00 0.00 ? 23 ILE A HD11 3  
ATOM 2718  H HD12 . ILE A 1 22 ? -3.206  -19.889 -8.090  1.00 0.00 ? 23 ILE A HD12 3  
ATOM 2719  H HD13 . ILE A 1 22 ? -2.755  -18.463 -9.022  1.00 0.00 ? 23 ILE A HD13 3  
ATOM 2720  N N    . LYS A 1 23 ? -7.301  -19.847 -12.842 1.00 0.00 ? 24 LYS A N    3  
ATOM 2721  C CA   . LYS A 1 23 ? -8.740  -20.010 -13.133 1.00 0.00 ? 24 LYS A CA   3  
ATOM 2722  C C    . LYS A 1 23 ? -8.926  -20.856 -14.396 1.00 0.00 ? 24 LYS A C    3  
ATOM 2723  O O    . LYS A 1 23 ? -10.003 -21.352 -14.666 1.00 0.00 ? 24 LYS A O    3  
ATOM 2724  C CB   . LYS A 1 23 ? -9.339  -18.626 -13.348 1.00 0.00 ? 24 LYS A CB   3  
ATOM 2725  C CG   . LYS A 1 23 ? -9.676  -18.012 -11.993 1.00 0.00 ? 24 LYS A CG   3  
ATOM 2726  C CD   . LYS A 1 23 ? -11.015 -18.565 -11.499 1.00 0.00 ? 24 LYS A CD   3  
ATOM 2727  C CE   . LYS A 1 23 ? -12.054 -17.444 -11.477 1.00 0.00 ? 24 LYS A CE   3  
ATOM 2728  N NZ   . LYS A 1 23 ? -13.268 -17.873 -12.228 1.00 0.00 ? 24 LYS A NZ   3  
ATOM 2729  H H    . LYS A 1 23 ? -6.874  -18.972 -12.981 1.00 0.00 ? 24 LYS A H    3  
ATOM 2730  H HA   . LYS A 1 23 ? -9.223  -20.486 -12.293 1.00 0.00 ? 24 LYS A HA   3  
ATOM 2731  H HB2  . LYS A 1 23 ? -8.614  -18.004 -13.854 1.00 0.00 ? 24 LYS A HB2  3  
ATOM 2732  H HB3  . LYS A 1 23 ? -10.236 -18.704 -13.944 1.00 0.00 ? 24 LYS A HB3  3  
ATOM 2733  H HG2  . LYS A 1 23 ? -8.895  -18.262 -11.286 1.00 0.00 ? 24 LYS A HG2  3  
ATOM 2734  H HG3  . LYS A 1 23 ? -9.743  -16.939 -12.089 1.00 0.00 ? 24 LYS A HG3  3  
ATOM 2735  H HD2  . LYS A 1 23 ? -11.346 -19.351 -12.163 1.00 0.00 ? 24 LYS A HD2  3  
ATOM 2736  H HD3  . LYS A 1 23 ? -10.894 -18.962 -10.502 1.00 0.00 ? 24 LYS A HD3  3  
ATOM 2737  H HE2  . LYS A 1 23 ? -12.323 -17.223 -10.455 1.00 0.00 ? 24 LYS A HE2  3  
ATOM 2738  H HE3  . LYS A 1 23 ? -11.639 -16.559 -11.938 1.00 0.00 ? 24 LYS A HE3  3  
ATOM 2739  H HZ1  . LYS A 1 23 ? -13.498 -18.856 -11.981 1.00 0.00 ? 24 LYS A HZ1  3  
ATOM 2740  H HZ2  . LYS A 1 23 ? -14.067 -17.255 -11.977 1.00 0.00 ? 24 LYS A HZ2  3  
ATOM 2741  H HZ3  . LYS A 1 23 ? -13.087 -17.808 -13.249 1.00 0.00 ? 24 LYS A HZ3  3  
ATOM 2742  N N    . ARG A 1 24 ? -7.890  -21.021 -15.175 1.00 0.00 ? 25 ARG A N    3  
ATOM 2743  C CA   . ARG A 1 24 ? -8.019  -21.829 -16.420 1.00 0.00 ? 25 ARG A CA   3  
ATOM 2744  C C    . ARG A 1 24 ? -7.781  -23.311 -16.104 1.00 0.00 ? 25 ARG A C    3  
ATOM 2745  O O    . ARG A 1 24 ? -8.340  -24.185 -16.735 1.00 0.00 ? 25 ARG A O    3  
ATOM 2746  C CB   . ARG A 1 24 ? -7.007  -21.324 -17.461 1.00 0.00 ? 25 ARG A CB   3  
ATOM 2747  C CG   . ARG A 1 24 ? -5.636  -21.978 -17.252 1.00 0.00 ? 25 ARG A CG   3  
ATOM 2748  C CD   . ARG A 1 24 ? -5.420  -23.076 -18.284 1.00 0.00 ? 25 ARG A CD   3  
ATOM 2749  N NE   . ARG A 1 24 ? -6.675  -23.858 -18.470 1.00 0.00 ? 25 ARG A NE   3  
ATOM 2750  C CZ   . ARG A 1 24 ? -6.621  -25.157 -18.584 1.00 0.00 ? 25 ARG A CZ   3  
ATOM 2751  N NH1  . ARG A 1 24 ? -5.966  -25.862 -17.702 1.00 0.00 ? 25 ARG A NH1  3  
ATOM 2752  N NH2  . ARG A 1 24 ? -7.220  -25.750 -19.579 1.00 0.00 ? 25 ARG A NH2  3  
ATOM 2753  H H    . ARG A 1 24 ? -7.032  -20.611 -14.946 1.00 0.00 ? 25 ARG A H    3  
ATOM 2754  H HA   . ARG A 1 24 ? -9.017  -21.709 -16.811 1.00 0.00 ? 25 ARG A HA   3  
ATOM 2755  H HB2  . ARG A 1 24 ? -7.366  -21.557 -18.452 1.00 0.00 ? 25 ARG A HB2  3  
ATOM 2756  H HB3  . ARG A 1 24 ? -6.903  -20.253 -17.364 1.00 0.00 ? 25 ARG A HB3  3  
ATOM 2757  H HG2  . ARG A 1 24 ? -4.867  -21.235 -17.372 1.00 0.00 ? 25 ARG A HG2  3  
ATOM 2758  H HG3  . ARG A 1 24 ? -5.577  -22.400 -16.265 1.00 0.00 ? 25 ARG A HG3  3  
ATOM 2759  H HD2  . ARG A 1 24 ? -5.130  -22.629 -19.221 1.00 0.00 ? 25 ARG A HD2  3  
ATOM 2760  H HD3  . ARG A 1 24 ? -4.636  -23.730 -17.938 1.00 0.00 ? 25 ARG A HD3  3  
ATOM 2761  H HE   . ARG A 1 24 ? -7.538  -23.398 -18.509 1.00 0.00 ? 25 ARG A HE   3  
ATOM 2762  H HH11 . ARG A 1 24 ? -5.505  -25.407 -16.940 1.00 0.00 ? 25 ARG A HH11 3  
ATOM 2763  H HH12 . ARG A 1 24 ? -5.924  -26.857 -17.790 1.00 0.00 ? 25 ARG A HH12 3  
ATOM 2764  H HH21 . ARG A 1 24 ? -7.721  -25.209 -20.254 1.00 0.00 ? 25 ARG A HH21 3  
ATOM 2765  H HH22 . ARG A 1 24 ? -7.179  -26.745 -19.666 1.00 0.00 ? 25 ARG A HH22 3  
ATOM 2766  N N    . GLU A 1 25 ? -6.963  -23.602 -15.131 1.00 0.00 ? 26 GLU A N    3  
ATOM 2767  C CA   . GLU A 1 25 ? -6.700  -25.024 -14.780 1.00 0.00 ? 26 GLU A CA   3  
ATOM 2768  C C    . GLU A 1 25 ? -7.626  -25.446 -13.636 1.00 0.00 ? 26 GLU A C    3  
ATOM 2769  O O    . GLU A 1 25 ? -7.553  -26.553 -13.142 1.00 0.00 ? 26 GLU A O    3  
ATOM 2770  C CB   . GLU A 1 25 ? -5.239  -25.185 -14.351 1.00 0.00 ? 26 GLU A CB   3  
ATOM 2771  C CG   . GLU A 1 25 ? -5.051  -24.636 -12.935 1.00 0.00 ? 26 GLU A CG   3  
ATOM 2772  C CD   . GLU A 1 25 ? -3.625  -24.928 -12.463 1.00 0.00 ? 26 GLU A CD   3  
ATOM 2773  O OE1  . GLU A 1 25 ? -2.782  -25.177 -13.308 1.00 0.00 ? 26 GLU A OE1  3  
ATOM 2774  O OE2  . GLU A 1 25 ? -3.401  -24.898 -11.264 1.00 0.00 ? 26 GLU A OE2  3  
ATOM 2775  H H    . GLU A 1 25 ? -6.524  -22.887 -14.629 1.00 0.00 ? 26 GLU A H    3  
ATOM 2776  H HA   . GLU A 1 25 ? -6.891  -25.643 -15.642 1.00 0.00 ? 26 GLU A HA   3  
ATOM 2777  H HB2  . GLU A 1 25 ? -4.974  -26.232 -14.370 1.00 0.00 ? 26 GLU A HB2  3  
ATOM 2778  H HB3  . GLU A 1 25 ? -4.603  -24.640 -15.033 1.00 0.00 ? 26 GLU A HB3  3  
ATOM 2779  H HG2  . GLU A 1 25 ? -5.219  -23.569 -12.938 1.00 0.00 ? 26 GLU A HG2  3  
ATOM 2780  H HG3  . GLU A 1 25 ? -5.754  -25.110 -12.268 1.00 0.00 ? 26 GLU A HG3  3  
ATOM 2781  N N    . ASN A 1 26 ? -8.498  -24.572 -13.215 1.00 0.00 ? 27 ASN A N    3  
ATOM 2782  C CA   . ASN A 1 26 ? -9.428  -24.922 -12.107 1.00 0.00 ? 27 ASN A CA   3  
ATOM 2783  C C    . ASN A 1 26 ? -10.869 -24.818 -12.606 1.00 0.00 ? 27 ASN A C    3  
ATOM 2784  O O    . ASN A 1 26 ? -11.162 -24.052 -13.503 1.00 0.00 ? 27 ASN A O    3  
ATOM 2785  C CB   . ASN A 1 26 ? -9.222  -23.955 -10.940 1.00 0.00 ? 27 ASN A CB   3  
ATOM 2786  C CG   . ASN A 1 26 ? -7.773  -24.044 -10.455 1.00 0.00 ? 27 ASN A CG   3  
ATOM 2787  O OD1  . ASN A 1 26 ? -7.146  -25.079 -10.566 1.00 0.00 ? 27 ASN A OD1  3  
ATOM 2788  N ND2  . ASN A 1 26 ? -7.212  -22.995 -9.917  1.00 0.00 ? 27 ASN A ND2  3  
ATOM 2789  H H    . ASN A 1 26 ? -8.542  -23.684 -13.628 1.00 0.00 ? 27 ASN A H    3  
ATOM 2790  H HA   . ASN A 1 26 ? -9.238  -25.932 -11.776 1.00 0.00 ? 27 ASN A HA   3  
ATOM 2791  H HB2  . ASN A 1 26 ? -9.433  -22.947 -11.266 1.00 0.00 ? 27 ASN A HB2  3  
ATOM 2792  H HB3  . ASN A 1 26 ? -9.886  -24.219 -10.132 1.00 0.00 ? 27 ASN A HB3  3  
ATOM 2793  H HD21 . ASN A 1 26 ? -7.719  -22.162 -9.825  1.00 0.00 ? 27 ASN A HD21 3  
ATOM 2794  H HD22 . ASN A 1 26 ? -6.286  -23.042 -9.605  1.00 0.00 ? 27 ASN A HD22 3  
ATOM 2795  N N    . PRO A 1 27 ? -11.724 -25.603 -12.007 1.00 0.00 ? 28 PRO A N    3  
ATOM 2796  C CA   . PRO A 1 27 ? -13.150 -25.641 -12.357 1.00 0.00 ? 28 PRO A CA   3  
ATOM 2797  C C    . PRO A 1 27 ? -13.881 -24.434 -11.777 1.00 0.00 ? 28 PRO A C    3  
ATOM 2798  O O    . PRO A 1 27 ? -14.622 -24.555 -10.822 1.00 0.00 ? 28 PRO A O    3  
ATOM 2799  C CB   . PRO A 1 27 ? -13.648 -26.926 -11.716 1.00 0.00 ? 28 PRO A CB   3  
ATOM 2800  C CG   . PRO A 1 27 ? -12.654 -27.261 -10.597 1.00 0.00 ? 28 PRO A CG   3  
ATOM 2801  C CD   . PRO A 1 27 ? -11.348 -26.522 -10.921 1.00 0.00 ? 28 PRO A CD   3  
ATOM 2802  H HA   . PRO A 1 27 ? -13.275 -25.703 -13.408 1.00 0.00 ? 28 PRO A HA   3  
ATOM 2803  H HB2  . PRO A 1 27 ? -14.634 -26.771 -11.302 1.00 0.00 ? 28 PRO A HB2  3  
ATOM 2804  H HB3  . PRO A 1 27 ? -13.661 -27.722 -12.442 1.00 0.00 ? 28 PRO A HB3  3  
ATOM 2805  H HG2  . PRO A 1 27 ? -13.048 -26.926 -9.657  1.00 0.00 ? 28 PRO A HG2  3  
ATOM 2806  H HG3  . PRO A 1 27 ? -12.477 -28.317 -10.579 1.00 0.00 ? 28 PRO A HG3  3  
ATOM 2807  H HD2  . PRO A 1 27 ? -11.001 -25.972 -10.055 1.00 0.00 ? 28 PRO A HD2  3  
ATOM 2808  H HD3  . PRO A 1 27 ? -10.593 -27.213 -11.261 1.00 0.00 ? 28 PRO A HD3  3  
ATOM 2809  N N    . GLY A 1 28 ? -13.672 -23.267 -12.331 1.00 0.00 ? 29 GLY A N    3  
ATOM 2810  C CA   . GLY A 1 28 ? -14.353 -22.062 -11.780 1.00 0.00 ? 29 GLY A CA   3  
ATOM 2811  C C    . GLY A 1 28 ? -14.237 -22.112 -10.258 1.00 0.00 ? 29 GLY A C    3  
ATOM 2812  O O    . GLY A 1 28 ? -15.102 -21.657 -9.537  1.00 0.00 ? 29 GLY A O    3  
ATOM 2813  H H    . GLY A 1 28 ? -13.064 -23.185 -13.094 1.00 0.00 ? 29 GLY A H    3  
ATOM 2814  H HA2  . GLY A 1 28 ? -13.873 -21.168 -12.157 1.00 0.00 ? 29 GLY A HA2  3  
ATOM 2815  H HA3  . GLY A 1 28 ? -15.394 -22.065 -12.062 1.00 0.00 ? 29 GLY A HA3  3  
ATOM 2816  N N    . ILE A 1 29 ? -13.167 -22.693 -9.780  1.00 0.00 ? 30 ILE A N    3  
ATOM 2817  C CA   . ILE A 1 29 ? -12.950 -22.824 -8.318  1.00 0.00 ? 30 ILE A CA   3  
ATOM 2818  C C    . ILE A 1 29 ? -13.472 -21.586 -7.584  1.00 0.00 ? 30 ILE A C    3  
ATOM 2819  O O    . ILE A 1 29 ? -13.468 -20.491 -8.111  1.00 0.00 ? 30 ILE A O    3  
ATOM 2820  C CB   . ILE A 1 29 ? -11.460 -22.991 -8.077  1.00 0.00 ? 30 ILE A CB   3  
ATOM 2821  C CG1  . ILE A 1 29 ? -11.186 -23.199 -6.586  1.00 0.00 ? 30 ILE A CG1  3  
ATOM 2822  C CG2  . ILE A 1 29 ? -10.760 -21.739 -8.559  1.00 0.00 ? 30 ILE A CG2  3  
ATOM 2823  C CD1  . ILE A 1 29 ? -9.733  -23.641 -6.397  1.00 0.00 ? 30 ILE A CD1  3  
ATOM 2824  H H    . ILE A 1 29 ? -12.499 -23.061 -10.397 1.00 0.00 ? 30 ILE A H    3  
ATOM 2825  H HA   . ILE A 1 29 ? -13.457 -23.693 -7.965  1.00 0.00 ? 30 ILE A HA   3  
ATOM 2826  H HB   . ILE A 1 29 ? -11.102 -23.841 -8.640  1.00 0.00 ? 30 ILE A HB   3  
ATOM 2827  H HG12 . ILE A 1 29 ? -11.355 -22.273 -6.056  1.00 0.00 ? 30 ILE A HG12 3  
ATOM 2828  H HG13 . ILE A 1 29 ? -11.845 -23.962 -6.201  1.00 0.00 ? 30 ILE A HG13 3  
ATOM 2829  H HG21 . ILE A 1 29 ? -11.433 -20.905 -8.453  1.00 0.00 ? 30 ILE A HG21 3  
ATOM 2830  H HG22 . ILE A 1 29 ? -9.873  -21.569 -7.970  1.00 0.00 ? 30 ILE A HG22 3  
ATOM 2831  H HG23 . ILE A 1 29 ? -10.496 -21.859 -9.596  1.00 0.00 ? 30 ILE A HG23 3  
ATOM 2832  H HD11 . ILE A 1 29 ? -9.465  -24.336 -7.180  1.00 0.00 ? 30 ILE A HD11 3  
ATOM 2833  H HD12 . ILE A 1 29 ? -9.087  -22.776 -6.446  1.00 0.00 ? 30 ILE A HD12 3  
ATOM 2834  H HD13 . ILE A 1 29 ? -9.624  -24.120 -5.437  1.00 0.00 ? 30 ILE A HD13 3  
ATOM 2835  N N    . LYS A 1 30 ? -13.929 -21.753 -6.372  1.00 0.00 ? 31 LYS A N    3  
ATOM 2836  C CA   . LYS A 1 30 ? -14.459 -20.594 -5.604  1.00 0.00 ? 31 LYS A CA   3  
ATOM 2837  C C    . LYS A 1 30 ? -13.364 -19.542 -5.424  1.00 0.00 ? 31 LYS A C    3  
ATOM 2838  O O    . LYS A 1 30 ? -12.188 -19.847 -5.441  1.00 0.00 ? 31 LYS A O    3  
ATOM 2839  C CB   . LYS A 1 30 ? -14.932 -21.076 -4.236  1.00 0.00 ? 31 LYS A CB   3  
ATOM 2840  C CG   . LYS A 1 30 ? -15.816 -22.314 -4.403  1.00 0.00 ? 31 LYS A CG   3  
ATOM 2841  C CD   . LYS A 1 30 ? -16.874 -22.046 -5.475  1.00 0.00 ? 31 LYS A CD   3  
ATOM 2842  C CE   . LYS A 1 30 ? -17.760 -20.879 -5.037  1.00 0.00 ? 31 LYS A CE   3  
ATOM 2843  N NZ   . LYS A 1 30 ? -18.710 -20.536 -6.133  1.00 0.00 ? 31 LYS A NZ   3  
ATOM 2844  H H    . LYS A 1 30 ? -13.928 -22.643 -5.966  1.00 0.00 ? 31 LYS A H    3  
ATOM 2845  H HA   . LYS A 1 30 ? -15.289 -20.161 -6.134  1.00 0.00 ? 31 LYS A HA   3  
ATOM 2846  H HB2  . LYS A 1 30 ? -14.075 -21.322 -3.634  1.00 0.00 ? 31 LYS A HB2  3  
ATOM 2847  H HB3  . LYS A 1 30 ? -15.497 -20.296 -3.758  1.00 0.00 ? 31 LYS A HB3  3  
ATOM 2848  H HG2  . LYS A 1 30 ? -15.205 -23.154 -4.699  1.00 0.00 ? 31 LYS A HG2  3  
ATOM 2849  H HG3  . LYS A 1 30 ? -16.304 -22.537 -3.466  1.00 0.00 ? 31 LYS A HG3  3  
ATOM 2850  H HD2  . LYS A 1 30 ? -16.389 -21.801 -6.408  1.00 0.00 ? 31 LYS A HD2  3  
ATOM 2851  H HD3  . LYS A 1 30 ? -17.484 -22.928 -5.607  1.00 0.00 ? 31 LYS A HD3  3  
ATOM 2852  H HE2  . LYS A 1 30 ? -18.315 -21.159 -4.154  1.00 0.00 ? 31 LYS A HE2  3  
ATOM 2853  H HE3  . LYS A 1 30 ? -17.142 -20.021 -4.815  1.00 0.00 ? 31 LYS A HE3  3  
ATOM 2854  H HZ1  . LYS A 1 30 ? -18.422 -21.021 -7.006  1.00 0.00 ? 31 LYS A HZ1  3  
ATOM 2855  H HZ2  . LYS A 1 30 ? -19.668 -20.840 -5.870  1.00 0.00 ? 31 LYS A HZ2  3  
ATOM 2856  H HZ3  . LYS A 1 30 ? -18.702 -19.507 -6.288  1.00 0.00 ? 31 LYS A HZ3  3  
ATOM 2857  N N    . VAL A 1 31 ? -13.740 -18.304 -5.248  1.00 0.00 ? 32 VAL A N    3  
ATOM 2858  C CA   . VAL A 1 31 ? -12.732 -17.238 -5.064  1.00 0.00 ? 32 VAL A CA   3  
ATOM 2859  C C    . VAL A 1 31 ? -12.040 -17.433 -3.708  1.00 0.00 ? 32 VAL A C    3  
ATOM 2860  O O    . VAL A 1 31 ? -10.911 -17.026 -3.514  1.00 0.00 ? 32 VAL A O    3  
ATOM 2861  C CB   . VAL A 1 31 ? -13.420 -15.867 -5.142  1.00 0.00 ? 32 VAL A CB   3  
ATOM 2862  C CG1  . VAL A 1 31 ? -14.833 -15.976 -4.603  1.00 0.00 ? 32 VAL A CG1  3  
ATOM 2863  C CG2  . VAL A 1 31 ? -12.658 -14.851 -4.309  1.00 0.00 ? 32 VAL A CG2  3  
ATOM 2864  H H    . VAL A 1 31 ? -14.684 -18.077 -5.236  1.00 0.00 ? 32 VAL A H    3  
ATOM 2865  H HA   . VAL A 1 31 ? -12.010 -17.306 -5.846  1.00 0.00 ? 32 VAL A HA   3  
ATOM 2866  H HB   . VAL A 1 31 ? -13.454 -15.544 -6.170  1.00 0.00 ? 32 VAL A HB   3  
ATOM 2867  H HG11 . VAL A 1 31 ? -14.875 -16.791 -3.900  1.00 0.00 ? 32 VAL A HG11 3  
ATOM 2868  H HG12 . VAL A 1 31 ? -15.108 -15.056 -4.113  1.00 0.00 ? 32 VAL A HG12 3  
ATOM 2869  H HG13 . VAL A 1 31 ? -15.508 -16.171 -5.421  1.00 0.00 ? 32 VAL A HG13 3  
ATOM 2870  H HG21 . VAL A 1 31 ? -11.648 -14.772 -4.676  1.00 0.00 ? 32 VAL A HG21 3  
ATOM 2871  H HG22 . VAL A 1 31 ? -13.146 -13.893 -4.376  1.00 0.00 ? 32 VAL A HG22 3  
ATOM 2872  H HG23 . VAL A 1 31 ? -12.648 -15.182 -3.284  1.00 0.00 ? 32 VAL A HG23 3  
ATOM 2873  N N    . THR A 1 32 ? -12.703 -18.060 -2.774  1.00 0.00 ? 33 THR A N    3  
ATOM 2874  C CA   . THR A 1 32 ? -12.077 -18.284 -1.440  1.00 0.00 ? 33 THR A CA   3  
ATOM 2875  C C    . THR A 1 32 ? -11.001 -19.367 -1.563  1.00 0.00 ? 33 THR A C    3  
ATOM 2876  O O    . THR A 1 32 ? -10.046 -19.397 -0.812  1.00 0.00 ? 33 THR A O    3  
ATOM 2877  C CB   . THR A 1 32 ? -13.145 -18.740 -0.442  1.00 0.00 ? 33 THR A CB   3  
ATOM 2878  O OG1  . THR A 1 32 ? -14.097 -19.556 -1.110  1.00 0.00 ? 33 THR A OG1  3  
ATOM 2879  C CG2  . THR A 1 32 ? -13.849 -17.520 0.155   1.00 0.00 ? 33 THR A CG2  3  
ATOM 2880  H H    . THR A 1 32 ? -13.611 -18.385 -2.951  1.00 0.00 ? 33 THR A H    3  
ATOM 2881  H HA   . THR A 1 32 ? -11.627 -17.367 -1.093  1.00 0.00 ? 33 THR A HA   3  
ATOM 2882  H HB   . THR A 1 32 ? -12.680 -19.304 0.351   1.00 0.00 ? 33 THR A HB   3  
ATOM 2883  H HG1  . THR A 1 32 ? -13.637 -20.324 -1.458  1.00 0.00 ? 33 THR A HG1  3  
ATOM 2884  H HG21 . THR A 1 32 ? -13.776 -16.690 -0.533  1.00 0.00 ? 33 THR A HG21 3  
ATOM 2885  H HG22 . THR A 1 32 ? -14.889 -17.753 0.326   1.00 0.00 ? 33 THR A HG22 3  
ATOM 2886  H HG23 . THR A 1 32 ? -13.381 -17.255 1.091   1.00 0.00 ? 33 THR A HG23 3  
ATOM 2887  N N    . GLU A 1 33 ? -11.148 -20.256 -2.508  1.00 0.00 ? 34 GLU A N    3  
ATOM 2888  C CA   . GLU A 1 33 ? -10.136 -21.336 -2.685  1.00 0.00 ? 34 GLU A CA   3  
ATOM 2889  C C    . GLU A 1 33 ? -9.112  -20.906 -3.737  1.00 0.00 ? 34 GLU A C    3  
ATOM 2890  O O    . GLU A 1 33 ? -8.068  -21.510 -3.885  1.00 0.00 ? 34 GLU A O    3  
ATOM 2891  C CB   . GLU A 1 33 ? -10.832 -22.616 -3.153  1.00 0.00 ? 34 GLU A CB   3  
ATOM 2892  C CG   . GLU A 1 33 ? -11.778 -23.114 -2.059  1.00 0.00 ? 34 GLU A CG   3  
ATOM 2893  C CD   . GLU A 1 33 ? -11.698 -24.640 -1.971  1.00 0.00 ? 34 GLU A CD   3  
ATOM 2894  O OE1  . GLU A 1 33 ? -11.562 -25.266 -3.010  1.00 0.00 ? 34 GLU A OE1  3  
ATOM 2895  O OE2  . GLU A 1 33 ? -11.772 -25.155 -0.868  1.00 0.00 ? 34 GLU A OE2  3  
ATOM 2896  H H    . GLU A 1 33 ? -11.926 -20.213 -3.105  1.00 0.00 ? 34 GLU A H    3  
ATOM 2897  H HA   . GLU A 1 33 ? -9.634  -21.520 -1.746  1.00 0.00 ? 34 GLU A HA   3  
ATOM 2898  H HB2  . GLU A 1 33 ? -11.396 -22.410 -4.052  1.00 0.00 ? 34 GLU A HB2  3  
ATOM 2899  H HB3  . GLU A 1 33 ? -10.091 -23.374 -3.357  1.00 0.00 ? 34 GLU A HB3  3  
ATOM 2900  H HG2  . GLU A 1 33 ? -11.492 -22.683 -1.111  1.00 0.00 ? 34 GLU A HG2  3  
ATOM 2901  H HG3  . GLU A 1 33 ? -12.790 -22.822 -2.297  1.00 0.00 ? 34 GLU A HG3  3  
ATOM 2902  N N    . VAL A 1 34 ? -9.405  -19.870 -4.472  1.00 0.00 ? 35 VAL A N    3  
ATOM 2903  C CA   . VAL A 1 34 ? -8.454  -19.407 -5.518  1.00 0.00 ? 35 VAL A CA   3  
ATOM 2904  C C    . VAL A 1 34 ? -7.289  -18.662 -4.862  1.00 0.00 ? 35 VAL A C    3  
ATOM 2905  O O    . VAL A 1 34 ? -6.180  -18.668 -5.355  1.00 0.00 ? 35 VAL A O    3  
ATOM 2906  C CB   . VAL A 1 34 ? -9.183  -18.473 -6.479  1.00 0.00 ? 35 VAL A CB   3  
ATOM 2907  C CG1  . VAL A 1 34 ? -8.170  -17.740 -7.360  1.00 0.00 ? 35 VAL A CG1  3  
ATOM 2908  C CG2  . VAL A 1 34 ? -10.121 -19.294 -7.363  1.00 0.00 ? 35 VAL A CG2  3  
ATOM 2909  H H    . VAL A 1 34 ? -10.253 -19.399 -4.339  1.00 0.00 ? 35 VAL A H    3  
ATOM 2910  H HA   . VAL A 1 34 ? -8.080  -20.255 -6.062  1.00 0.00 ? 35 VAL A HA   3  
ATOM 2911  H HB   . VAL A 1 34 ? -9.755  -17.760 -5.912  1.00 0.00 ? 35 VAL A HB   3  
ATOM 2912  H HG11 . VAL A 1 34 ? -7.568  -18.462 -7.892  1.00 0.00 ? 35 VAL A HG11 3  
ATOM 2913  H HG12 . VAL A 1 34 ? -8.696  -17.117 -8.070  1.00 0.00 ? 35 VAL A HG12 3  
ATOM 2914  H HG13 . VAL A 1 34 ? -7.534  -17.125 -6.742  1.00 0.00 ? 35 VAL A HG13 3  
ATOM 2915  H HG21 . VAL A 1 34 ? -10.438 -20.178 -6.830  1.00 0.00 ? 35 VAL A HG21 3  
ATOM 2916  H HG22 . VAL A 1 34 ? -10.986 -18.700 -7.621  1.00 0.00 ? 35 VAL A HG22 3  
ATOM 2917  H HG23 . VAL A 1 34 ? -9.603  -19.584 -8.266  1.00 0.00 ? 35 VAL A HG23 3  
ATOM 2918  N N    . ALA A 1 35 ? -7.534  -18.018 -3.753  1.00 0.00 ? 36 ALA A N    3  
ATOM 2919  C CA   . ALA A 1 35 ? -6.442  -17.272 -3.070  1.00 0.00 ? 36 ALA A CA   3  
ATOM 2920  C C    . ALA A 1 35 ? -5.665  -18.222 -2.155  1.00 0.00 ? 36 ALA A C    3  
ATOM 2921  O O    . ALA A 1 35 ? -4.486  -18.044 -1.919  1.00 0.00 ? 36 ALA A O    3  
ATOM 2922  C CB   . ALA A 1 35 ? -7.043  -16.139 -2.235  1.00 0.00 ? 36 ALA A CB   3  
ATOM 2923  H H    . ALA A 1 35 ? -8.436  -18.024 -3.374  1.00 0.00 ? 36 ALA A H    3  
ATOM 2924  H HA   . ALA A 1 35 ? -5.775  -16.859 -3.809  1.00 0.00 ? 36 ALA A HA   3  
ATOM 2925  H HB1  . ALA A 1 35 ? -7.963  -16.475 -1.781  1.00 0.00 ? 36 ALA A HB1  3  
ATOM 2926  H HB2  . ALA A 1 35 ? -6.345  -15.853 -1.461  1.00 0.00 ? 36 ALA A HB2  3  
ATOM 2927  H HB3  . ALA A 1 35 ? -7.242  -15.290 -2.870  1.00 0.00 ? 36 ALA A HB3  3  
ATOM 2928  N N    . LYS A 1 36 ? -6.315  -19.226 -1.634  1.00 0.00 ? 37 LYS A N    3  
ATOM 2929  C CA   . LYS A 1 36 ? -5.618  -20.181 -0.735  1.00 0.00 ? 37 LYS A CA   3  
ATOM 2930  C C    . LYS A 1 36 ? -4.526  -20.923 -1.517  1.00 0.00 ? 37 LYS A C    3  
ATOM 2931  O O    . LYS A 1 36 ? -3.422  -21.101 -1.040  1.00 0.00 ? 37 LYS A O    3  
ATOM 2932  C CB   . LYS A 1 36 ? -6.658  -21.146 -0.165  1.00 0.00 ? 37 LYS A CB   3  
ATOM 2933  C CG   . LYS A 1 36 ? -6.069  -22.543 0.056   1.00 0.00 ? 37 LYS A CG   3  
ATOM 2934  C CD   . LYS A 1 36 ? -7.204  -23.512 0.371   1.00 0.00 ? 37 LYS A CD   3  
ATOM 2935  C CE   . LYS A 1 36 ? -7.940  -23.861 -0.922  1.00 0.00 ? 37 LYS A CE   3  
ATOM 2936  N NZ   . LYS A 1 36 ? -8.191  -25.329 -0.973  1.00 0.00 ? 37 LYS A NZ   3  
ATOM 2937  H H    . LYS A 1 36 ? -7.266  -19.354 -1.832  1.00 0.00 ? 37 LYS A H    3  
ATOM 2938  H HA   . LYS A 1 36 ? -5.170  -19.640 0.076   1.00 0.00 ? 37 LYS A HA   3  
ATOM 2939  H HB2  . LYS A 1 36 ? -7.002  -20.756 0.778   1.00 0.00 ? 37 LYS A HB2  3  
ATOM 2940  H HB3  . LYS A 1 36 ? -7.491  -21.213 -0.848  1.00 0.00 ? 37 LYS A HB3  3  
ATOM 2941  H HG2  . LYS A 1 36 ? -5.557  -22.869 -0.837  1.00 0.00 ? 37 LYS A HG2  3  
ATOM 2942  H HG3  . LYS A 1 36 ? -5.377  -22.519 0.884   1.00 0.00 ? 37 LYS A HG3  3  
ATOM 2943  H HD2  . LYS A 1 36 ? -6.801  -24.410 0.814   1.00 0.00 ? 37 LYS A HD2  3  
ATOM 2944  H HD3  . LYS A 1 36 ? -7.892  -23.045 1.058   1.00 0.00 ? 37 LYS A HD3  3  
ATOM 2945  H HE2  . LYS A 1 36 ? -8.881  -23.332 -0.953  1.00 0.00 ? 37 LYS A HE2  3  
ATOM 2946  H HE3  . LYS A 1 36 ? -7.335  -23.568 -1.768  1.00 0.00 ? 37 LYS A HE3  3  
ATOM 2947  H HZ1  . LYS A 1 36 ? -8.616  -25.640 -0.076  1.00 0.00 ? 37 LYS A HZ1  3  
ATOM 2948  H HZ2  . LYS A 1 36 ? -8.840  -25.543 -1.758  1.00 0.00 ? 37 LYS A HZ2  3  
ATOM 2949  H HZ3  . LYS A 1 36 ? -7.292  -25.830 -1.119  1.00 0.00 ? 37 LYS A HZ3  3  
ATOM 2950  N N    . ARG A 1 37 ? -4.826  -21.352 -2.711  1.00 0.00 ? 38 ARG A N    3  
ATOM 2951  C CA   . ARG A 1 37 ? -3.806  -22.078 -3.520  1.00 0.00 ? 38 ARG A CA   3  
ATOM 2952  C C    . ARG A 1 37 ? -2.714  -21.101 -3.960  1.00 0.00 ? 38 ARG A C    3  
ATOM 2953  O O    . ARG A 1 37 ? -1.641  -21.496 -4.369  1.00 0.00 ? 38 ARG A O    3  
ATOM 2954  C CB   . ARG A 1 37 ? -4.473  -22.683 -4.757  1.00 0.00 ? 38 ARG A CB   3  
ATOM 2955  C CG   . ARG A 1 37 ? -4.322  -24.207 -4.728  1.00 0.00 ? 38 ARG A CG   3  
ATOM 2956  C CD   . ARG A 1 37 ? -2.836  -24.574 -4.713  1.00 0.00 ? 38 ARG A CD   3  
ATOM 2957  N NE   . ARG A 1 37 ? -2.448  -25.140 -6.038  1.00 0.00 ? 38 ARG A NE   3  
ATOM 2958  C CZ   . ARG A 1 37 ? -2.069  -26.387 -6.131  1.00 0.00 ? 38 ARG A CZ   3  
ATOM 2959  N NH1  . ARG A 1 37 ? -2.931  -27.348 -5.945  1.00 0.00 ? 38 ARG A NH1  3  
ATOM 2960  N NH2  . ARG A 1 37 ? -0.827  -26.673 -6.416  1.00 0.00 ? 38 ARG A NH2  3  
ATOM 2961  H H    . ARG A 1 37 ? -5.721  -21.195 -3.075  1.00 0.00 ? 38 ARG A H    3  
ATOM 2962  H HA   . ARG A 1 37 ? -3.367  -22.865 -2.925  1.00 0.00 ? 38 ARG A HA   3  
ATOM 2963  H HB2  . ARG A 1 37 ? -5.522  -22.423 -4.761  1.00 0.00 ? 38 ARG A HB2  3  
ATOM 2964  H HB3  . ARG A 1 37 ? -4.001  -22.294 -5.647  1.00 0.00 ? 38 ARG A HB3  3  
ATOM 2965  H HG2  . ARG A 1 37 ? -4.799  -24.598 -3.841  1.00 0.00 ? 38 ARG A HG2  3  
ATOM 2966  H HG3  . ARG A 1 37 ? -4.787  -24.633 -5.604  1.00 0.00 ? 38 ARG A HG3  3  
ATOM 2967  H HD2  . ARG A 1 37 ? -2.250  -23.688 -4.515  1.00 0.00 ? 38 ARG A HD2  3  
ATOM 2968  H HD3  . ARG A 1 37 ? -2.654  -25.307 -3.941  1.00 0.00 ? 38 ARG A HD3  3  
ATOM 2969  H HE   . ARG A 1 37 ? -2.476  -24.575 -6.838  1.00 0.00 ? 38 ARG A HE   3  
ATOM 2970  H HH11 . ARG A 1 37 ? -3.883  -27.131 -5.731  1.00 0.00 ? 38 ARG A HH11 3  
ATOM 2971  H HH12 . ARG A 1 37 ? -2.639  -28.303 -6.017  1.00 0.00 ? 38 ARG A HH12 3  
ATOM 2972  H HH21 . ARG A 1 37 ? -0.165  -25.938 -6.564  1.00 0.00 ? 38 ARG A HH21 3  
ATOM 2973  H HH22 . ARG A 1 37 ? -0.538  -27.629 -6.488  1.00 0.00 ? 38 ARG A HH22 3  
ATOM 2974  N N    . GLY A 1 38 ? -2.981  -19.826 -3.882  1.00 0.00 ? 39 GLY A N    3  
ATOM 2975  C CA   . GLY A 1 38 ? -1.961  -18.823 -4.300  1.00 0.00 ? 39 GLY A CA   3  
ATOM 2976  C C    . GLY A 1 38 ? -0.803  -18.809 -3.298  1.00 0.00 ? 39 GLY A C    3  
ATOM 2977  O O    . GLY A 1 38 ? 0.347   -18.690 -3.668  1.00 0.00 ? 39 GLY A O    3  
ATOM 2978  H H    . GLY A 1 38 ? -3.855  -19.528 -3.552  1.00 0.00 ? 39 GLY A H    3  
ATOM 2979  H HA2  . GLY A 1 38 ? -1.587  -19.080 -5.279  1.00 0.00 ? 39 GLY A HA2  3  
ATOM 2980  H HA3  . GLY A 1 38 ? -2.413  -17.842 -4.334  1.00 0.00 ? 39 GLY A HA3  3  
ATOM 2981  N N    . GLY A 1 39 ? -1.097  -18.923 -2.030  1.00 0.00 ? 40 GLY A N    3  
ATOM 2982  C CA   . GLY A 1 39 ? -0.009  -18.910 -1.009  1.00 0.00 ? 40 GLY A CA   3  
ATOM 2983  C C    . GLY A 1 39 ? 0.735   -20.249 -1.017  1.00 0.00 ? 40 GLY A C    3  
ATOM 2984  O O    . GLY A 1 39 ? 1.727   -20.422 -0.336  1.00 0.00 ? 40 GLY A O    3  
ATOM 2985  H H    . GLY A 1 39 ? -2.032  -19.014 -1.750  1.00 0.00 ? 40 GLY A H    3  
ATOM 2986  H HA2  . GLY A 1 39 ? 0.684   -18.112 -1.235  1.00 0.00 ? 40 GLY A HA2  3  
ATOM 2987  H HA3  . GLY A 1 39 ? -0.437  -18.747 -0.031  1.00 0.00 ? 40 GLY A HA3  3  
ATOM 2988  N N    . GLU A 1 40 ? 0.263   -21.200 -1.776  1.00 0.00 ? 41 GLU A N    3  
ATOM 2989  C CA   . GLU A 1 40 ? 0.936   -22.525 -1.820  1.00 0.00 ? 41 GLU A CA   3  
ATOM 2990  C C    . GLU A 1 40 ? 1.950   -22.567 -2.965  1.00 0.00 ? 41 GLU A C    3  
ATOM 2991  O O    . GLU A 1 40 ? 3.135   -22.729 -2.750  1.00 0.00 ? 41 GLU A O    3  
ATOM 2992  C CB   . GLU A 1 40 ? -0.110  -23.606 -2.031  1.00 0.00 ? 41 GLU A CB   3  
ATOM 2993  C CG   . GLU A 1 40 ? -1.337  -23.303 -1.170  1.00 0.00 ? 41 GLU A CG   3  
ATOM 2994  C CD   . GLU A 1 40 ? -2.096  -24.600 -0.889  1.00 0.00 ? 41 GLU A CD   3  
ATOM 2995  O OE1  . GLU A 1 40 ? -2.054  -25.482 -1.730  1.00 0.00 ? 41 GLU A OE1  3  
ATOM 2996  O OE2  . GLU A 1 40 ? -2.705  -24.690 0.165   1.00 0.00 ? 41 GLU A OE2  3  
ATOM 2997  H H    . GLU A 1 40 ? -0.539  -21.047 -2.313  1.00 0.00 ? 41 GLU A H    3  
ATOM 2998  H HA   . GLU A 1 40 ? 1.439   -22.710 -0.891  1.00 0.00 ? 41 GLU A HA   3  
ATOM 2999  H HB2  . GLU A 1 40 ? -0.392  -23.635 -3.072  1.00 0.00 ? 41 GLU A HB2  3  
ATOM 3000  H HB3  . GLU A 1 40 ? 0.308   -24.552 -1.738  1.00 0.00 ? 41 GLU A HB3  3  
ATOM 3001  H HG2  . GLU A 1 40 ? -1.022  -22.860 -0.236  1.00 0.00 ? 41 GLU A HG2  3  
ATOM 3002  H HG3  . GLU A 1 40 ? -1.985  -22.616 -1.694  1.00 0.00 ? 41 GLU A HG3  3  
ATOM 3003  N N    . LEU A 1 41 ? 1.496   -22.429 -4.180  1.00 0.00 ? 42 LEU A N    3  
ATOM 3004  C CA   . LEU A 1 41 ? 2.433   -22.468 -5.337  1.00 0.00 ? 42 LEU A CA   3  
ATOM 3005  C C    . LEU A 1 41 ? 3.463   -21.343 -5.209  1.00 0.00 ? 42 LEU A C    3  
ATOM 3006  O O    . LEU A 1 41 ? 4.580   -21.457 -5.671  1.00 0.00 ? 42 LEU A O    3  
ATOM 3007  C CB   . LEU A 1 41 ? 1.639   -22.281 -6.631  1.00 0.00 ? 42 LEU A CB   3  
ATOM 3008  C CG   . LEU A 1 41 ? 1.122   -23.635 -7.122  1.00 0.00 ? 42 LEU A CG   3  
ATOM 3009  C CD1  . LEU A 1 41 ? 0.360   -23.439 -8.434  1.00 0.00 ? 42 LEU A CD1  3  
ATOM 3010  C CD2  . LEU A 1 41 ? 2.305   -24.581 -7.354  1.00 0.00 ? 42 LEU A CD2  3  
ATOM 3011  H H    . LEU A 1 41 ? 0.538   -22.303 -4.334  1.00 0.00 ? 42 LEU A H    3  
ATOM 3012  H HA   . LEU A 1 41 ? 2.939   -23.420 -5.360  1.00 0.00 ? 42 LEU A HA   3  
ATOM 3013  H HB2  . LEU A 1 41 ? 0.803   -21.623 -6.447  1.00 0.00 ? 42 LEU A HB2  3  
ATOM 3014  H HB3  . LEU A 1 41 ? 2.277   -21.848 -7.383  1.00 0.00 ? 42 LEU A HB3  3  
ATOM 3015  H HG   . LEU A 1 41 ? 0.461   -24.058 -6.380  1.00 0.00 ? 42 LEU A HG   3  
ATOM 3016  H HD11 . LEU A 1 41 ? 0.551   -22.447 -8.815  1.00 0.00 ? 42 LEU A HD11 3  
ATOM 3017  H HD12 . LEU A 1 41 ? 0.689   -24.172 -9.155  1.00 0.00 ? 42 LEU A HD12 3  
ATOM 3018  H HD13 . LEU A 1 41 ? -0.699  -23.560 -8.255  1.00 0.00 ? 42 LEU A HD13 3  
ATOM 3019  H HD21 . LEU A 1 41 ? 3.096   -24.050 -7.865  1.00 0.00 ? 42 LEU A HD21 3  
ATOM 3020  H HD22 . LEU A 1 41 ? 2.668   -24.943 -6.405  1.00 0.00 ? 42 LEU A HD22 3  
ATOM 3021  H HD23 . LEU A 1 41 ? 1.983   -25.417 -7.958  1.00 0.00 ? 42 LEU A HD23 3  
ATOM 3022  N N    . TRP A 1 42 ? 3.093   -20.254 -4.591  1.00 0.00 ? 43 TRP A N    3  
ATOM 3023  C CA   . TRP A 1 42 ? 4.050   -19.120 -4.440  1.00 0.00 ? 43 TRP A CA   3  
ATOM 3024  C C    . TRP A 1 42 ? 5.311   -19.596 -3.713  1.00 0.00 ? 43 TRP A C    3  
ATOM 3025  O O    . TRP A 1 42 ? 6.401   -19.556 -4.249  1.00 0.00 ? 43 TRP A O    3  
ATOM 3026  C CB   . TRP A 1 42 ? 3.382   -17.996 -3.635  1.00 0.00 ? 43 TRP A CB   3  
ATOM 3027  C CG   . TRP A 1 42 ? 4.420   -17.026 -3.156  1.00 0.00 ? 43 TRP A CG   3  
ATOM 3028  C CD1  . TRP A 1 42 ? 4.890   -16.961 -1.890  1.00 0.00 ? 43 TRP A CD1  3  
ATOM 3029  C CD2  . TRP A 1 42 ? 5.118   -15.989 -3.906  1.00 0.00 ? 43 TRP A CD2  3  
ATOM 3030  N NE1  . TRP A 1 42 ? 5.834   -15.952 -1.814  1.00 0.00 ? 43 TRP A NE1  3  
ATOM 3031  C CE2  . TRP A 1 42 ? 6.009   -15.323 -3.031  1.00 0.00 ? 43 TRP A CE2  3  
ATOM 3032  C CE3  . TRP A 1 42 ? 5.066   -15.566 -5.247  1.00 0.00 ? 43 TRP A CE3  3  
ATOM 3033  C CZ2  . TRP A 1 42 ? 6.821   -14.275 -3.470  1.00 0.00 ? 43 TRP A CZ2  3  
ATOM 3034  C CZ3  . TRP A 1 42 ? 5.881   -14.511 -5.692  1.00 0.00 ? 43 TRP A CZ3  3  
ATOM 3035  C CH2  . TRP A 1 42 ? 6.757   -13.868 -4.805  1.00 0.00 ? 43 TRP A CH2  3  
ATOM 3036  H H    . TRP A 1 42 ? 2.186   -20.181 -4.230  1.00 0.00 ? 43 TRP A H    3  
ATOM 3037  H HA   . TRP A 1 42 ? 4.319   -18.746 -5.417  1.00 0.00 ? 43 TRP A HA   3  
ATOM 3038  H HB2  . TRP A 1 42 ? 2.670   -17.479 -4.260  1.00 0.00 ? 43 TRP A HB2  3  
ATOM 3039  H HB3  . TRP A 1 42 ? 2.870   -18.422 -2.785  1.00 0.00 ? 43 TRP A HB3  3  
ATOM 3040  H HD1  . TRP A 1 42 ? 4.580   -17.594 -1.072  1.00 0.00 ? 43 TRP A HD1  3  
ATOM 3041  H HE1  . TRP A 1 42 ? 6.329   -15.700 -1.005  1.00 0.00 ? 43 TRP A HE1  3  
ATOM 3042  H HE3  . TRP A 1 42 ? 4.395   -16.054 -5.937  1.00 0.00 ? 43 TRP A HE3  3  
ATOM 3043  H HZ2  . TRP A 1 42 ? 7.493   -13.784 -2.783  1.00 0.00 ? 43 TRP A HZ2  3  
ATOM 3044  H HZ3  . TRP A 1 42 ? 5.832   -14.195 -6.723  1.00 0.00 ? 43 TRP A HZ3  3  
ATOM 3045  H HH2  . TRP A 1 42 ? 7.380   -13.059 -5.154  1.00 0.00 ? 43 TRP A HH2  3  
ATOM 3046  N N    . ARG A 1 43 ? 5.174   -20.032 -2.491  1.00 0.00 ? 44 ARG A N    3  
ATOM 3047  C CA   . ARG A 1 43 ? 6.366   -20.494 -1.725  1.00 0.00 ? 44 ARG A CA   3  
ATOM 3048  C C    . ARG A 1 43 ? 6.782   -21.893 -2.186  1.00 0.00 ? 44 ARG A C    3  
ATOM 3049  O O    . ARG A 1 43 ? 7.672   -22.498 -1.623  1.00 0.00 ? 44 ARG A O    3  
ATOM 3050  C CB   . ARG A 1 43 ? 6.020   -20.540 -0.235  1.00 0.00 ? 44 ARG A CB   3  
ATOM 3051  C CG   . ARG A 1 43 ? 6.488   -19.250 0.442   1.00 0.00 ? 44 ARG A CG   3  
ATOM 3052  C CD   . ARG A 1 43 ? 6.511   -19.449 1.960   1.00 0.00 ? 44 ARG A CD   3  
ATOM 3053  N NE   . ARG A 1 43 ? 7.780   -20.121 2.355   1.00 0.00 ? 44 ARG A NE   3  
ATOM 3054  C CZ   . ARG A 1 43 ? 7.745   -21.283 2.951   1.00 0.00 ? 44 ARG A CZ   3  
ATOM 3055  N NH1  . ARG A 1 43 ? 7.611   -21.347 4.249   1.00 0.00 ? 44 ARG A NH1  3  
ATOM 3056  N NH2  . ARG A 1 43 ? 7.842   -22.379 2.251   1.00 0.00 ? 44 ARG A NH2  3  
ATOM 3057  H H    . ARG A 1 43 ? 4.288   -20.045 -2.073  1.00 0.00 ? 44 ARG A H    3  
ATOM 3058  H HA   . ARG A 1 43 ? 7.181   -19.806 -1.880  1.00 0.00 ? 44 ARG A HA   3  
ATOM 3059  H HB2  . ARG A 1 43 ? 4.950   -20.641 -0.116  1.00 0.00 ? 44 ARG A HB2  3  
ATOM 3060  H HB3  . ARG A 1 43 ? 6.514   -21.384 0.224   1.00 0.00 ? 44 ARG A HB3  3  
ATOM 3061  H HG2  . ARG A 1 43 ? 7.481   -19.002 0.095   1.00 0.00 ? 44 ARG A HG2  3  
ATOM 3062  H HG3  . ARG A 1 43 ? 5.808   -18.448 0.197   1.00 0.00 ? 44 ARG A HG3  3  
ATOM 3063  H HD2  . ARG A 1 43 ? 6.444   -18.489 2.450   1.00 0.00 ? 44 ARG A HD2  3  
ATOM 3064  H HD3  . ARG A 1 43 ? 5.672   -20.062 2.255   1.00 0.00 ? 44 ARG A HD3  3  
ATOM 3065  H HE   . ARG A 1 43 ? 8.641   -19.693 2.167   1.00 0.00 ? 44 ARG A HE   3  
ATOM 3066  H HH11 . ARG A 1 43 ? 7.534   -20.506 4.785   1.00 0.00 ? 44 ARG A HH11 3  
ATOM 3067  H HH12 . ARG A 1 43 ? 7.583   -22.236 4.705   1.00 0.00 ? 44 ARG A HH12 3  
ATOM 3068  H HH21 . ARG A 1 43 ? 7.943   -22.330 1.257   1.00 0.00 ? 44 ARG A HH21 3  
ATOM 3069  H HH22 . ARG A 1 43 ? 7.815   -23.269 2.707   1.00 0.00 ? 44 ARG A HH22 3  
ATOM 3070  N N    . ALA A 1 44 ? 6.142   -22.424 -3.194  1.00 0.00 ? 45 ALA A N    3  
ATOM 3071  C CA   . ALA A 1 44 ? 6.509   -23.790 -3.659  1.00 0.00 ? 45 ALA A CA   3  
ATOM 3072  C C    . ALA A 1 44 ? 6.823   -23.781 -5.158  1.00 0.00 ? 45 ALA A C    3  
ATOM 3073  O O    . ALA A 1 44 ? 7.062   -24.815 -5.751  1.00 0.00 ? 45 ALA A O    3  
ATOM 3074  C CB   . ALA A 1 44 ? 5.337   -24.730 -3.400  1.00 0.00 ? 45 ALA A CB   3  
ATOM 3075  H H    . ALA A 1 44 ? 5.416   -21.934 -3.632  1.00 0.00 ? 45 ALA A H    3  
ATOM 3076  H HA   . ALA A 1 44 ? 7.373   -24.137 -3.113  1.00 0.00 ? 45 ALA A HA   3  
ATOM 3077  H HB1  . ALA A 1 44 ? 4.413   -24.187 -3.530  1.00 0.00 ? 45 ALA A HB1  3  
ATOM 3078  H HB2  . ALA A 1 44 ? 5.373   -25.552 -4.099  1.00 0.00 ? 45 ALA A HB2  3  
ATOM 3079  H HB3  . ALA A 1 44 ? 5.395   -25.110 -2.391  1.00 0.00 ? 45 ALA A HB3  3  
ATOM 3080  N N    . MET A 1 45 ? 6.820   -22.636 -5.785  1.00 0.00 ? 46 MET A N    3  
ATOM 3081  C CA   . MET A 1 45 ? 7.109   -22.589 -7.235  1.00 0.00 ? 46 MET A CA   3  
ATOM 3082  C C    . MET A 1 45 ? 8.627   -22.579 -7.454  1.00 0.00 ? 46 MET A C    3  
ATOM 3083  O O    . MET A 1 45 ? 9.308   -23.540 -7.153  1.00 0.00 ? 46 MET A O    3  
ATOM 3084  C CB   . MET A 1 45 ? 6.461   -21.335 -7.812  1.00 0.00 ? 46 MET A CB   3  
ATOM 3085  C CG   . MET A 1 45 ? 6.816   -20.139 -6.937  1.00 0.00 ? 46 MET A CG   3  
ATOM 3086  S SD   . MET A 1 45 ? 7.190   -18.708 -7.983  1.00 0.00 ? 46 MET A SD   3  
ATOM 3087  C CE   . MET A 1 45 ? 6.333   -17.461 -6.990  1.00 0.00 ? 46 MET A CE   3  
ATOM 3088  H H    . MET A 1 45 ? 6.620   -21.808 -5.311  1.00 0.00 ? 46 MET A H    3  
ATOM 3089  H HA   . MET A 1 45 ? 6.686   -23.454 -7.707  1.00 0.00 ? 46 MET A HA   3  
ATOM 3090  H HB2  . MET A 1 45 ? 6.816   -21.170 -8.819  1.00 0.00 ? 46 MET A HB2  3  
ATOM 3091  H HB3  . MET A 1 45 ? 5.391   -21.461 -7.819  1.00 0.00 ? 46 MET A HB3  3  
ATOM 3092  H HG2  . MET A 1 45 ? 5.986   -19.909 -6.288  1.00 0.00 ? 46 MET A HG2  3  
ATOM 3093  H HG3  . MET A 1 45 ? 7.682   -20.386 -6.340  1.00 0.00 ? 46 MET A HG3  3  
ATOM 3094  H HE1  . MET A 1 45 ? 6.445   -17.698 -5.942  1.00 0.00 ? 46 MET A HE1  3  
ATOM 3095  H HE2  . MET A 1 45 ? 6.759   -16.485 -7.191  1.00 0.00 ? 46 MET A HE2  3  
ATOM 3096  H HE3  . MET A 1 45 ? 5.284   -17.454 -7.246  1.00 0.00 ? 46 MET A HE3  3  
ATOM 3097  N N    . LYS A 1 46 ? 9.167   -21.512 -7.978  1.00 0.00 ? 47 LYS A N    3  
ATOM 3098  C CA   . LYS A 1 46 ? 10.630  -21.452 -8.219  1.00 0.00 ? 47 LYS A CA   3  
ATOM 3099  C C    . LYS A 1 46 ? 11.294  -20.603 -7.130  1.00 0.00 ? 47 LYS A C    3  
ATOM 3100  O O    . LYS A 1 46 ? 11.683  -21.101 -6.093  1.00 0.00 ? 47 LYS A O    3  
ATOM 3101  C CB   . LYS A 1 46 ? 10.866  -20.807 -9.580  1.00 0.00 ? 47 LYS A CB   3  
ATOM 3102  C CG   . LYS A 1 46 ? 11.121  -21.891 -10.628 1.00 0.00 ? 47 LYS A CG   3  
ATOM 3103  C CD   . LYS A 1 46 ? 12.607  -21.908 -10.997 1.00 0.00 ? 47 LYS A CD   3  
ATOM 3104  C CE   . LYS A 1 46 ? 12.830  -22.861 -12.172 1.00 0.00 ? 47 LYS A CE   3  
ATOM 3105  N NZ   . LYS A 1 46 ? 13.143  -24.223 -11.656 1.00 0.00 ? 47 LYS A NZ   3  
ATOM 3106  H H    . LYS A 1 46 ? 8.614   -20.751 -8.221  1.00 0.00 ? 47 LYS A H    3  
ATOM 3107  H HA   . LYS A 1 46 ? 11.041  -22.447 -8.212  1.00 0.00 ? 47 LYS A HA   3  
ATOM 3108  H HB2  . LYS A 1 46 ? 9.987   -20.239 -9.852  1.00 0.00 ? 47 LYS A HB2  3  
ATOM 3109  H HB3  . LYS A 1 46 ? 11.720  -20.149 -9.525  1.00 0.00 ? 47 LYS A HB3  3  
ATOM 3110  H HG2  . LYS A 1 46 ? 10.837  -22.853 -10.227 1.00 0.00 ? 47 LYS A HG2  3  
ATOM 3111  H HG3  . LYS A 1 46 ? 10.537  -21.682 -11.511 1.00 0.00 ? 47 LYS A HG3  3  
ATOM 3112  H HD2  . LYS A 1 46 ? 12.920  -20.911 -11.274 1.00 0.00 ? 47 LYS A HD2  3  
ATOM 3113  H HD3  . LYS A 1 46 ? 13.185  -22.244 -10.149 1.00 0.00 ? 47 LYS A HD3  3  
ATOM 3114  H HE2  . LYS A 1 46 ? 11.936  -22.901 -12.776 1.00 0.00 ? 47 LYS A HE2  3  
ATOM 3115  H HE3  . LYS A 1 46 ? 13.654  -22.505 -12.775 1.00 0.00 ? 47 LYS A HE3  3  
ATOM 3116  H HZ1  . LYS A 1 46 ? 13.502  -24.151 -10.683 1.00 0.00 ? 47 LYS A HZ1  3  
ATOM 3117  H HZ2  . LYS A 1 46 ? 12.280  -24.803 -11.666 1.00 0.00 ? 47 LYS A HZ2  3  
ATOM 3118  H HZ3  . LYS A 1 46 ? 13.866  -24.665 -12.257 1.00 0.00 ? 47 LYS A HZ3  3  
ATOM 3119  N N    . ASP A 1 47 ? 11.420  -19.324 -7.363  1.00 0.00 ? 48 ASP A N    3  
ATOM 3120  C CA   . ASP A 1 47 ? 12.054  -18.435 -6.349  1.00 0.00 ? 48 ASP A CA   3  
ATOM 3121  C C    . ASP A 1 47 ? 11.240  -17.145 -6.230  1.00 0.00 ? 48 ASP A C    3  
ATOM 3122  O O    . ASP A 1 47 ? 10.490  -16.788 -7.119  1.00 0.00 ? 48 ASP A O    3  
ATOM 3123  C CB   . ASP A 1 47 ? 13.482  -18.102 -6.783  1.00 0.00 ? 48 ASP A CB   3  
ATOM 3124  C CG   . ASP A 1 47 ? 14.192  -19.381 -7.230  1.00 0.00 ? 48 ASP A CG   3  
ATOM 3125  O OD1  . ASP A 1 47 ? 13.902  -20.423 -6.666  1.00 0.00 ? 48 ASP A OD1  3  
ATOM 3126  O OD2  . ASP A 1 47 ? 15.011  -19.297 -8.130  1.00 0.00 ? 48 ASP A OD2  3  
ATOM 3127  H H    . ASP A 1 47 ? 11.097  -18.946 -8.207  1.00 0.00 ? 48 ASP A H    3  
ATOM 3128  H HA   . ASP A 1 47 ? 12.075  -18.938 -5.393  1.00 0.00 ? 48 ASP A HA   3  
ATOM 3129  H HB2  . ASP A 1 47 ? 13.454  -17.399 -7.604  1.00 0.00 ? 48 ASP A HB2  3  
ATOM 3130  H HB3  . ASP A 1 47 ? 14.019  -17.665 -5.955  1.00 0.00 ? 48 ASP A HB3  3  
ATOM 3131  N N    . LYS A 1 48 ? 11.378  -16.441 -5.140  1.00 0.00 ? 49 LYS A N    3  
ATOM 3132  C CA   . LYS A 1 48 ? 10.606  -15.177 -4.967  1.00 0.00 ? 49 LYS A CA   3  
ATOM 3133  C C    . LYS A 1 48 ? 11.502  -13.979 -5.280  1.00 0.00 ? 49 LYS A C    3  
ATOM 3134  O O    . LYS A 1 48 ? 11.210  -12.860 -4.909  1.00 0.00 ? 49 LYS A O    3  
ATOM 3135  C CB   . LYS A 1 48 ? 10.112  -15.079 -3.524  1.00 0.00 ? 49 LYS A CB   3  
ATOM 3136  C CG   . LYS A 1 48 ? 9.365   -16.362 -3.157  1.00 0.00 ? 49 LYS A CG   3  
ATOM 3137  C CD   . LYS A 1 48 ? 9.538   -16.645 -1.664  1.00 0.00 ? 49 LYS A CD   3  
ATOM 3138  C CE   . LYS A 1 48 ? 10.899  -17.296 -1.420  1.00 0.00 ? 49 LYS A CE   3  
ATOM 3139  N NZ   . LYS A 1 48 ? 11.040  -17.617 0.028   1.00 0.00 ? 49 LYS A NZ   3  
ATOM 3140  H H    . LYS A 1 48 ? 11.984  -16.746 -4.434  1.00 0.00 ? 49 LYS A H    3  
ATOM 3141  H HA   . LYS A 1 48 ? 9.760   -15.178 -5.637  1.00 0.00 ? 49 LYS A HA   3  
ATOM 3142  H HB2  . LYS A 1 48 ? 10.957  -14.950 -2.862  1.00 0.00 ? 49 LYS A HB2  3  
ATOM 3143  H HB3  . LYS A 1 48 ? 9.445   -14.236 -3.427  1.00 0.00 ? 49 LYS A HB3  3  
ATOM 3144  H HG2  . LYS A 1 48 ? 8.316   -16.243 -3.383  1.00 0.00 ? 49 LYS A HG2  3  
ATOM 3145  H HG3  . LYS A 1 48 ? 9.765   -17.187 -3.727  1.00 0.00 ? 49 LYS A HG3  3  
ATOM 3146  H HD2  . LYS A 1 48 ? 9.476   -15.718 -1.113  1.00 0.00 ? 49 LYS A HD2  3  
ATOM 3147  H HD3  . LYS A 1 48 ? 8.757   -17.314 -1.332  1.00 0.00 ? 49 LYS A HD3  3  
ATOM 3148  H HE2  . LYS A 1 48 ? 10.974  -18.203 -1.999  1.00 0.00 ? 49 LYS A HE2  3  
ATOM 3149  H HE3  . LYS A 1 48 ? 11.682  -16.613 -1.716  1.00 0.00 ? 49 LYS A HE3  3  
ATOM 3150  H HZ1  . LYS A 1 48 ? 10.284  -17.144 0.563   1.00 0.00 ? 49 LYS A HZ1  3  
ATOM 3151  H HZ2  . LYS A 1 48 ? 10.971  -18.646 0.164   1.00 0.00 ? 49 LYS A HZ2  3  
ATOM 3152  H HZ3  . LYS A 1 48 ? 11.965  -17.287 0.369   1.00 0.00 ? 49 LYS A HZ3  3  
ATOM 3153  N N    . SER A 1 49 ? 12.589  -14.202 -5.964  1.00 0.00 ? 50 SER A N    3  
ATOM 3154  C CA   . SER A 1 49 ? 13.500  -13.074 -6.301  1.00 0.00 ? 50 SER A CA   3  
ATOM 3155  C C    . SER A 1 49 ? 13.042  -12.426 -7.608  1.00 0.00 ? 50 SER A C    3  
ATOM 3156  O O    . SER A 1 49 ? 13.366  -11.290 -7.897  1.00 0.00 ? 50 SER A O    3  
ATOM 3157  C CB   . SER A 1 49 ? 14.923  -13.605 -6.464  1.00 0.00 ? 50 SER A CB   3  
ATOM 3158  O OG   . SER A 1 49 ? 15.299  -14.310 -5.287  1.00 0.00 ? 50 SER A OG   3  
ATOM 3159  H H    . SER A 1 49 ? 12.807  -15.110 -6.255  1.00 0.00 ? 50 SER A H    3  
ATOM 3160  H HA   . SER A 1 49 ? 13.476  -12.344 -5.507  1.00 0.00 ? 50 SER A HA   3  
ATOM 3161  H HB2  . SER A 1 49 ? 14.967  -14.274 -7.307  1.00 0.00 ? 50 SER A HB2  3  
ATOM 3162  H HB3  . SER A 1 49 ? 15.598  -12.776 -6.630  1.00 0.00 ? 50 SER A HB3  3  
ATOM 3163  H HG   . SER A 1 49 ? 14.509  -14.713 -4.919  1.00 0.00 ? 50 SER A HG   3  
ATOM 3164  N N    . GLU A 1 50 ? 12.283  -13.137 -8.397  1.00 0.00 ? 51 GLU A N    3  
ATOM 3165  C CA   . GLU A 1 50 ? 11.799  -12.565 -9.680  1.00 0.00 ? 51 GLU A CA   3  
ATOM 3166  C C    . GLU A 1 50 ? 10.906  -11.367 -9.385  1.00 0.00 ? 51 GLU A C    3  
ATOM 3167  O O    . GLU A 1 50 ? 11.250  -10.228 -9.643  1.00 0.00 ? 51 GLU A O    3  
ATOM 3168  C CB   . GLU A 1 50 ? 11.009  -13.624 -10.428 1.00 0.00 ? 51 GLU A CB   3  
ATOM 3169  C CG   . GLU A 1 50 ? 10.116  -12.977 -11.495 1.00 0.00 ? 51 GLU A CG   3  
ATOM 3170  C CD   . GLU A 1 50 ? 10.908  -11.908 -12.252 1.00 0.00 ? 51 GLU A CD   3  
ATOM 3171  O OE1  . GLU A 1 50 ? 12.064  -12.157 -12.554 1.00 0.00 ? 51 GLU A OE1  3  
ATOM 3172  O OE2  . GLU A 1 50 ? 10.346  -10.858 -12.517 1.00 0.00 ? 51 GLU A OE2  3  
ATOM 3173  H H    . GLU A 1 50 ? 12.026  -14.047 -8.140  1.00 0.00 ? 51 GLU A H    3  
ATOM 3174  H HA   . GLU A 1 50 ? 12.634  -12.274 -10.285 1.00 0.00 ? 51 GLU A HA   3  
ATOM 3175  H HB2  . GLU A 1 50 ? 11.712  -14.281 -10.904 1.00 0.00 ? 51 GLU A HB2  3  
ATOM 3176  H HB3  . GLU A 1 50 ? 10.396  -14.178 -9.729  1.00 0.00 ? 51 GLU A HB3  3  
ATOM 3177  H HG2  . GLU A 1 50 ? 9.780   -13.734 -12.188 1.00 0.00 ? 51 GLU A HG2  3  
ATOM 3178  H HG3  . GLU A 1 50 ? 9.261   -12.519 -11.019 1.00 0.00 ? 51 GLU A HG3  3  
ATOM 3179  N N    . TRP A 1 51 ? 9.758   -11.627 -8.835  1.00 0.00 ? 52 TRP A N    3  
ATOM 3180  C CA   . TRP A 1 51 ? 8.819   -10.532 -8.501  1.00 0.00 ? 52 TRP A CA   3  
ATOM 3181  C C    . TRP A 1 51 ? 9.490   -9.562  -7.551  1.00 0.00 ? 52 TRP A C    3  
ATOM 3182  O O    . TRP A 1 51 ? 9.426   -8.373  -7.730  1.00 0.00 ? 52 TRP A O    3  
ATOM 3183  C CB   . TRP A 1 51 ? 7.607   -11.125 -7.812  1.00 0.00 ? 52 TRP A CB   3  
ATOM 3184  C CG   . TRP A 1 51 ? 7.128   -12.271 -8.597  1.00 0.00 ? 52 TRP A CG   3  
ATOM 3185  C CD1  . TRP A 1 51 ? 7.415   -13.540 -8.323  1.00 0.00 ? 52 TRP A CD1  3  
ATOM 3186  C CD2  . TRP A 1 51 ? 6.289   -12.271 -9.771  1.00 0.00 ? 52 TRP A CD2  3  
ATOM 3187  N NE1  . TRP A 1 51 ? 6.788   -14.349 -9.250  1.00 0.00 ? 52 TRP A NE1  3  
ATOM 3188  C CE2  . TRP A 1 51 ? 6.076   -13.605 -10.170 1.00 0.00 ? 52 TRP A CE2  3  
ATOM 3189  C CE3  . TRP A 1 51 ? 5.696   -11.247 -10.513 1.00 0.00 ? 52 TRP A CE3  3  
ATOM 3190  C CZ2  . TRP A 1 51 ? 5.287   -13.914 -11.279 1.00 0.00 ? 52 TRP A CZ2  3  
ATOM 3191  C CZ3  . TRP A 1 51 ? 4.906   -11.544 -11.623 1.00 0.00 ? 52 TRP A CZ3  3  
ATOM 3192  C CH2  . TRP A 1 51 ? 4.696   -12.877 -12.008 1.00 0.00 ? 52 TRP A CH2  3  
ATOM 3193  H H    . TRP A 1 51 ? 9.516   -12.554 -8.633  1.00 0.00 ? 52 TRP A H    3  
ATOM 3194  H HA   . TRP A 1 51 ? 8.513   -10.018 -9.399  1.00 0.00 ? 52 TRP A HA   3  
ATOM 3195  H HB2  . TRP A 1 51 ? 7.878   -11.455 -6.820  1.00 0.00 ? 52 TRP A HB2  3  
ATOM 3196  H HB3  . TRP A 1 51 ? 6.831   -10.399 -7.745  1.00 0.00 ? 52 TRP A HB3  3  
ATOM 3197  H HD1  . TRP A 1 51 ? 8.031   -13.859 -7.509  1.00 0.00 ? 52 TRP A HD1  3  
ATOM 3198  H HE1  . TRP A 1 51 ? 6.830   -15.320 -9.267  1.00 0.00 ? 52 TRP A HE1  3  
ATOM 3199  H HE3  . TRP A 1 51 ? 5.863   -10.220 -10.234 1.00 0.00 ? 52 TRP A HE3  3  
ATOM 3200  H HZ2  . TRP A 1 51 ? 5.130   -14.943 -11.568 1.00 0.00 ? 52 TRP A HZ2  3  
ATOM 3201  H HZ3  . TRP A 1 51 ? 4.449   -10.741 -12.171 1.00 0.00 ? 52 TRP A HZ3  3  
ATOM 3202  H HH2  . TRP A 1 51 ? 4.084   -13.101 -12.870 1.00 0.00 ? 52 TRP A HH2  3  
ATOM 3203  N N    . GLU A 1 52 ? 10.115  -10.072 -6.528  1.00 0.00 ? 53 GLU A N    3  
ATOM 3204  C CA   . GLU A 1 52 ? 10.785  -9.177  -5.537  1.00 0.00 ? 53 GLU A CA   3  
ATOM 3205  C C    . GLU A 1 52 ? 11.429  -7.988  -6.251  1.00 0.00 ? 53 GLU A C    3  
ATOM 3206  O O    . GLU A 1 52 ? 11.029  -6.855  -6.065  1.00 0.00 ? 53 GLU A O    3  
ATOM 3207  C CB   . GLU A 1 52 ? 11.856  -9.963  -4.780  1.00 0.00 ? 53 GLU A CB   3  
ATOM 3208  C CG   . GLU A 1 52 ? 11.242  -10.575 -3.521  1.00 0.00 ? 53 GLU A CG   3  
ATOM 3209  C CD   . GLU A 1 52 ? 11.063  -9.488  -2.458  1.00 0.00 ? 53 GLU A CD   3  
ATOM 3210  O OE1  . GLU A 1 52 ? 10.396  -8.509  -2.748  1.00 0.00 ? 53 GLU A OE1  3  
ATOM 3211  O OE2  . GLU A 1 52 ? 11.596  -9.654  -1.374  1.00 0.00 ? 53 GLU A OE2  3  
ATOM 3212  H H    . GLU A 1 52 ? 10.130  -11.050 -6.403  1.00 0.00 ? 53 GLU A H    3  
ATOM 3213  H HA   . GLU A 1 52 ? 10.048  -8.810  -4.839  1.00 0.00 ? 53 GLU A HA   3  
ATOM 3214  H HB2  . GLU A 1 52 ? 12.241  -10.750 -5.414  1.00 0.00 ? 53 GLU A HB2  3  
ATOM 3215  H HB3  . GLU A 1 52 ? 12.660  -9.299  -4.500  1.00 0.00 ? 53 GLU A HB3  3  
ATOM 3216  H HG2  . GLU A 1 52 ? 10.281  -11.007 -3.763  1.00 0.00 ? 53 GLU A HG2  3  
ATOM 3217  H HG3  . GLU A 1 52 ? 11.896  -11.346 -3.140  1.00 0.00 ? 53 GLU A HG3  3  
ATOM 3218  N N    . ALA A 1 53 ? 12.418  -8.223  -7.069  1.00 0.00 ? 54 ALA A N    3  
ATOM 3219  C CA   . ALA A 1 53 ? 13.062  -7.085  -7.782  1.00 0.00 ? 54 ALA A CA   3  
ATOM 3220  C C    . ALA A 1 53 ? 11.996  -6.319  -8.568  1.00 0.00 ? 54 ALA A C    3  
ATOM 3221  O O    . ALA A 1 53 ? 12.045  -5.111  -8.692  1.00 0.00 ? 54 ALA A O    3  
ATOM 3222  C CB   . ALA A 1 53 ? 14.125  -7.619  -8.745  1.00 0.00 ? 54 ALA A CB   3  
ATOM 3223  H H    . ALA A 1 53 ? 12.731  -9.142  -7.214  1.00 0.00 ? 54 ALA A H    3  
ATOM 3224  H HA   . ALA A 1 53 ? 13.524  -6.425  -7.064  1.00 0.00 ? 54 ALA A HA   3  
ATOM 3225  H HB1  . ALA A 1 53 ? 13.694  -8.392  -9.363  1.00 0.00 ? 54 ALA A HB1  3  
ATOM 3226  H HB2  . ALA A 1 53 ? 14.480  -6.813  -9.370  1.00 0.00 ? 54 ALA A HB2  3  
ATOM 3227  H HB3  . ALA A 1 53 ? 14.949  -8.027  -8.180  1.00 0.00 ? 54 ALA A HB3  3  
ATOM 3228  N N    . LYS A 1 54 ? 11.035  -7.020  -9.102  1.00 0.00 ? 55 LYS A N    3  
ATOM 3229  C CA   . LYS A 1 54 ? 9.957   -6.354  -9.889  1.00 0.00 ? 55 LYS A CA   3  
ATOM 3230  C C    . LYS A 1 54 ? 9.238   -5.303  -9.040  1.00 0.00 ? 55 LYS A C    3  
ATOM 3231  O O    . LYS A 1 54 ? 8.933   -4.222  -9.505  1.00 0.00 ? 55 LYS A O    3  
ATOM 3232  C CB   . LYS A 1 54 ? 8.942   -7.403  -10.341 1.00 0.00 ? 55 LYS A CB   3  
ATOM 3233  C CG   . LYS A 1 54 ? 8.700   -7.268  -11.847 1.00 0.00 ? 55 LYS A CG   3  
ATOM 3234  C CD   . LYS A 1 54 ? 7.709   -6.131  -12.109 1.00 0.00 ? 55 LYS A CD   3  
ATOM 3235  C CE   . LYS A 1 54 ? 7.787   -5.719  -13.579 1.00 0.00 ? 55 LYS A CE   3  
ATOM 3236  N NZ   . LYS A 1 54 ? 6.728   -4.712  -13.870 1.00 0.00 ? 55 LYS A NZ   3  
ATOM 3237  H H    . LYS A 1 54 ? 11.027  -7.994  -8.991  1.00 0.00 ? 55 LYS A H    3  
ATOM 3238  H HA   . LYS A 1 54 ? 10.388  -5.879  -10.755 1.00 0.00 ? 55 LYS A HA   3  
ATOM 3239  H HB2  . LYS A 1 54 ? 9.324   -8.390  -10.122 1.00 0.00 ? 55 LYS A HB2  3  
ATOM 3240  H HB3  . LYS A 1 54 ? 8.012   -7.252  -9.813  1.00 0.00 ? 55 LYS A HB3  3  
ATOM 3241  H HG2  . LYS A 1 54 ? 9.635   -7.054  -12.342 1.00 0.00 ? 55 LYS A HG2  3  
ATOM 3242  H HG3  . LYS A 1 54 ? 8.293   -8.192  -12.230 1.00 0.00 ? 55 LYS A HG3  3  
ATOM 3243  H HD2  . LYS A 1 54 ? 6.708   -6.467  -11.879 1.00 0.00 ? 55 LYS A HD2  3  
ATOM 3244  H HD3  . LYS A 1 54 ? 7.958   -5.286  -11.485 1.00 0.00 ? 55 LYS A HD3  3  
ATOM 3245  H HE2  . LYS A 1 54 ? 8.757   -5.288  -13.781 1.00 0.00 ? 55 LYS A HE2  3  
ATOM 3246  H HE3  . LYS A 1 54 ? 7.642   -6.586  -14.205 1.00 0.00 ? 55 LYS A HE3  3  
ATOM 3247  H HZ1  . LYS A 1 54 ? 6.600   -4.093  -13.045 1.00 0.00 ? 55 LYS A HZ1  3  
ATOM 3248  H HZ2  . LYS A 1 54 ? 7.010   -4.141  -14.693 1.00 0.00 ? 55 LYS A HZ2  3  
ATOM 3249  H HZ3  . LYS A 1 54 ? 5.833   -5.200  -14.077 1.00 0.00 ? 55 LYS A HZ3  3  
ATOM 3250  N N    . ALA A 1 55 ? 8.951   -5.608  -7.805  1.00 0.00 ? 56 ALA A N    3  
ATOM 3251  C CA   . ALA A 1 55 ? 8.242   -4.627  -6.944  1.00 0.00 ? 56 ALA A CA   3  
ATOM 3252  C C    . ALA A 1 55 ? 9.111   -3.379  -6.787  1.00 0.00 ? 56 ALA A C    3  
ATOM 3253  O O    . ALA A 1 55 ? 8.618   -2.276  -6.654  1.00 0.00 ? 56 ALA A O    3  
ATOM 3254  C CB   . ALA A 1 55 ? 7.982   -5.247  -5.569  1.00 0.00 ? 56 ALA A CB   3  
ATOM 3255  H H    . ALA A 1 55 ? 9.199   -6.479  -7.448  1.00 0.00 ? 56 ALA A H    3  
ATOM 3256  H HA   . ALA A 1 55 ? 7.299   -4.364  -7.406  1.00 0.00 ? 56 ALA A HA   3  
ATOM 3257  H HB1  . ALA A 1 55 ? 8.725   -6.005  -5.369  1.00 0.00 ? 56 ALA A HB1  3  
ATOM 3258  H HB2  . ALA A 1 55 ? 8.036   -4.480  -4.811  1.00 0.00 ? 56 ALA A HB2  3  
ATOM 3259  H HB3  . ALA A 1 55 ? 6.999   -5.697  -5.557  1.00 0.00 ? 56 ALA A HB3  3  
ATOM 3260  N N    . ALA A 1 56 ? 10.404  -3.550  -6.805  1.00 0.00 ? 57 ALA A N    3  
ATOM 3261  C CA   . ALA A 1 56 ? 11.317  -2.383  -6.663  1.00 0.00 ? 57 ALA A CA   3  
ATOM 3262  C C    . ALA A 1 56 ? 10.953  -1.329  -7.706  1.00 0.00 ? 57 ALA A C    3  
ATOM 3263  O O    . ALA A 1 56 ? 10.846  -0.156  -7.408  1.00 0.00 ? 57 ALA A O    3  
ATOM 3264  C CB   . ALA A 1 56 ? 12.760  -2.838  -6.888  1.00 0.00 ? 57 ALA A CB   3  
ATOM 3265  H H    . ALA A 1 56 ? 10.777  -4.450  -6.917  1.00 0.00 ? 57 ALA A H    3  
ATOM 3266  H HA   . ALA A 1 56 ? 11.219  -1.964  -5.674  1.00 0.00 ? 57 ALA A HA   3  
ATOM 3267  H HB1  . ALA A 1 56 ? 12.998  -3.637  -6.201  1.00 0.00 ? 57 ALA A HB1  3  
ATOM 3268  H HB2  . ALA A 1 56 ? 12.870  -3.191  -7.903  1.00 0.00 ? 57 ALA A HB2  3  
ATOM 3269  H HB3  . ALA A 1 56 ? 13.430  -2.007  -6.721  1.00 0.00 ? 57 ALA A HB3  3  
ATOM 3270  N N    . LYS A 1 57 ? 10.768  -1.736  -8.930  1.00 0.00 ? 58 LYS A N    3  
ATOM 3271  C CA   . LYS A 1 57 ? 10.412  -0.756  -9.993  1.00 0.00 ? 58 LYS A CA   3  
ATOM 3272  C C    . LYS A 1 57 ? 9.273   0.136   -9.503  1.00 0.00 ? 58 LYS A C    3  
ATOM 3273  O O    . LYS A 1 57 ? 9.416   1.337   -9.430  1.00 0.00 ? 58 LYS A O    3  
ATOM 3274  C CB   . LYS A 1 57 ? 9.978   -1.498  -11.258 1.00 0.00 ? 58 LYS A CB   3  
ATOM 3275  C CG   . LYS A 1 57 ? 10.266  -0.627  -12.483 1.00 0.00 ? 58 LYS A CG   3  
ATOM 3276  C CD   . LYS A 1 57 ? 8.954   -0.045  -13.014 1.00 0.00 ? 58 LYS A CD   3  
ATOM 3277  C CE   . LYS A 1 57 ? 9.256   1.137   -13.938 1.00 0.00 ? 58 LYS A CE   3  
ATOM 3278  N NZ   . LYS A 1 57 ? 10.114  0.679   -15.067 1.00 0.00 ? 58 LYS A NZ   3  
ATOM 3279  H H    . LYS A 1 57 ? 10.863  -2.687  -9.150  1.00 0.00 ? 58 LYS A H    3  
ATOM 3280  H HA   . LYS A 1 57 ? 11.275  -0.139  -10.214 1.00 0.00 ? 58 LYS A HA   3  
ATOM 3281  H HB2  . LYS A 1 57 ? 10.525  -2.425  -11.336 1.00 0.00 ? 58 LYS A HB2  3  
ATOM 3282  H HB3  . LYS A 1 57 ? 8.920   -1.706  -11.207 1.00 0.00 ? 58 LYS A HB3  3  
ATOM 3283  H HG2  . LYS A 1 57 ? 10.932  0.177   -12.205 1.00 0.00 ? 58 LYS A HG2  3  
ATOM 3284  H HG3  . LYS A 1 57 ? 10.728  -1.229  -13.251 1.00 0.00 ? 58 LYS A HG3  3  
ATOM 3285  H HD2  . LYS A 1 57 ? 8.419   -0.806  -13.564 1.00 0.00 ? 58 LYS A HD2  3  
ATOM 3286  H HD3  . LYS A 1 57 ? 8.350   0.293   -12.186 1.00 0.00 ? 58 LYS A HD3  3  
ATOM 3287  H HE2  . LYS A 1 57 ? 8.330   1.534   -14.327 1.00 0.00 ? 58 LYS A HE2  3  
ATOM 3288  H HE3  . LYS A 1 57 ? 9.772   1.904   -13.382 1.00 0.00 ? 58 LYS A HE3  3  
ATOM 3289  H HZ1  . LYS A 1 57 ? 10.840  0.027   -14.710 1.00 0.00 ? 58 LYS A HZ1  3  
ATOM 3290  H HZ2  . LYS A 1 57 ? 9.524   0.192   -15.773 1.00 0.00 ? 58 LYS A HZ2  3  
ATOM 3291  H HZ3  . LYS A 1 57 ? 10.575  1.501   -15.507 1.00 0.00 ? 58 LYS A HZ3  3  
ATOM 3292  N N    . ALA A 1 58 ? 8.144   -0.427  -9.159  1.00 0.00 ? 59 ALA A N    3  
ATOM 3293  C CA   . ALA A 1 58 ? 7.025   0.432   -8.674  1.00 0.00 ? 59 ALA A CA   3  
ATOM 3294  C C    . ALA A 1 58 ? 7.533   1.302   -7.534  1.00 0.00 ? 59 ALA A C    3  
ATOM 3295  O O    . ALA A 1 58 ? 7.086   2.404   -7.348  1.00 0.00 ? 59 ALA A O    3  
ATOM 3296  C CB   . ALA A 1 58 ? 5.869   -0.431  -8.154  1.00 0.00 ? 59 ALA A CB   3  
ATOM 3297  H H    . ALA A 1 58 ? 8.035   -1.401  -9.214  1.00 0.00 ? 59 ALA A H    3  
ATOM 3298  H HA   . ALA A 1 58 ? 6.675   1.062   -9.481  1.00 0.00 ? 59 ALA A HA   3  
ATOM 3299  H HB1  . ALA A 1 58 ? 6.258   -1.363  -7.774  1.00 0.00 ? 59 ALA A HB1  3  
ATOM 3300  H HB2  . ALA A 1 58 ? 5.356   0.098   -7.356  1.00 0.00 ? 59 ALA A HB2  3  
ATOM 3301  H HB3  . ALA A 1 58 ? 5.177   -0.630  -8.957  1.00 0.00 ? 59 ALA A HB3  3  
ATOM 3302  N N    . LYS A 1 59 ? 8.460   0.806   -6.767  1.00 0.00 ? 60 LYS A N    3  
ATOM 3303  C CA   . LYS A 1 59 ? 8.998   1.583   -5.626  1.00 0.00 ? 60 LYS A CA   3  
ATOM 3304  C C    . LYS A 1 59 ? 9.633   2.875   -6.112  1.00 0.00 ? 60 LYS A C    3  
ATOM 3305  O O    . LYS A 1 59 ? 9.415   3.929   -5.560  1.00 0.00 ? 60 LYS A O    3  
ATOM 3306  C CB   . LYS A 1 59 ? 10.063  0.734   -4.957  1.00 0.00 ? 60 LYS A CB   3  
ATOM 3307  C CG   . LYS A 1 59 ? 9.776   0.618   -3.458  1.00 0.00 ? 60 LYS A CG   3  
ATOM 3308  C CD   . LYS A 1 59 ? 10.402  -0.670  -2.917  1.00 0.00 ? 60 LYS A CD   3  
ATOM 3309  C CE   . LYS A 1 59 ? 9.456   -1.305  -1.897  1.00 0.00 ? 60 LYS A CE   3  
ATOM 3310  N NZ   . LYS A 1 59 ? 9.161   -2.710  -2.300  1.00 0.00 ? 60 LYS A NZ   3  
ATOM 3311  H H    . LYS A 1 59 ? 8.809   -0.092  -6.935  1.00 0.00 ? 60 LYS A H    3  
ATOM 3312  H HA   . LYS A 1 59 ? 8.210   1.805   -4.927  1.00 0.00 ? 60 LYS A HA   3  
ATOM 3313  H HB2  . LYS A 1 59 ? 10.064  -0.244  -5.408  1.00 0.00 ? 60 LYS A HB2  3  
ATOM 3314  H HB3  . LYS A 1 59 ? 11.019  1.189   -5.109  1.00 0.00 ? 60 LYS A HB3  3  
ATOM 3315  H HG2  . LYS A 1 59 ? 10.201  1.469   -2.944  1.00 0.00 ? 60 LYS A HG2  3  
ATOM 3316  H HG3  . LYS A 1 59 ? 8.709   0.594   -3.296  1.00 0.00 ? 60 LYS A HG3  3  
ATOM 3317  H HD2  . LYS A 1 59 ? 10.568  -1.359  -3.733  1.00 0.00 ? 60 LYS A HD2  3  
ATOM 3318  H HD3  . LYS A 1 59 ? 11.342  -0.441  -2.439  1.00 0.00 ? 60 LYS A HD3  3  
ATOM 3319  H HE2  . LYS A 1 59 ? 9.922   -1.302  -0.922  1.00 0.00 ? 60 LYS A HE2  3  
ATOM 3320  H HE3  . LYS A 1 59 ? 8.535   -0.741  -1.857  1.00 0.00 ? 60 LYS A HE3  3  
ATOM 3321  H HZ1  . LYS A 1 59 ? 10.034  -3.164  -2.636  1.00 0.00 ? 60 LYS A HZ1  3  
ATOM 3322  H HZ2  . LYS A 1 59 ? 8.789   -3.234  -1.482  1.00 0.00 ? 60 LYS A HZ2  3  
ATOM 3323  H HZ3  . LYS A 1 59 ? 8.458   -2.711  -3.065  1.00 0.00 ? 60 LYS A HZ3  3  
ATOM 3324  N N    . ASP A 1 60 ? 10.441  2.799   -7.117  1.00 0.00 ? 61 ASP A N    3  
ATOM 3325  C CA   . ASP A 1 60 ? 11.112  4.030   -7.620  1.00 0.00 ? 61 ASP A CA   3  
ATOM 3326  C C    . ASP A 1 60 ? 10.101  4.921   -8.351  1.00 0.00 ? 61 ASP A C    3  
ATOM 3327  O O    . ASP A 1 60 ? 10.110  6.127   -8.210  1.00 0.00 ? 61 ASP A O    3  
ATOM 3328  C CB   . ASP A 1 60 ? 12.240  3.633   -8.574  1.00 0.00 ? 61 ASP A CB   3  
ATOM 3329  C CG   . ASP A 1 60 ? 12.819  4.886   -9.234  1.00 0.00 ? 61 ASP A CG   3  
ATOM 3330  O OD1  . ASP A 1 60 ? 12.913  5.898   -8.559  1.00 0.00 ? 61 ASP A OD1  3  
ATOM 3331  O OD2  . ASP A 1 60 ? 13.161  4.812   -10.403 1.00 0.00 ? 61 ASP A OD2  3  
ATOM 3332  H H    . ASP A 1 60 ? 10.623  1.926   -7.530  1.00 0.00 ? 61 ASP A H    3  
ATOM 3333  H HA   . ASP A 1 60 ? 11.517  4.577   -6.783  1.00 0.00 ? 61 ASP A HA   3  
ATOM 3334  H HB2  . ASP A 1 60 ? 13.017  3.127   -8.019  1.00 0.00 ? 61 ASP A HB2  3  
ATOM 3335  H HB3  . ASP A 1 60 ? 11.853  2.971   -9.337  1.00 0.00 ? 61 ASP A HB3  3  
ATOM 3336  N N    . ASP A 1 61 ? 9.233   4.338   -9.124  1.00 0.00 ? 62 ASP A N    3  
ATOM 3337  C CA   . ASP A 1 61 ? 8.221   5.146   -9.861  1.00 0.00 ? 62 ASP A CA   3  
ATOM 3338  C C    . ASP A 1 61 ? 7.085   5.529   -8.913  1.00 0.00 ? 62 ASP A C    3  
ATOM 3339  O O    . ASP A 1 61 ? 6.212   6.304   -9.250  1.00 0.00 ? 62 ASP A O    3  
ATOM 3340  C CB   . ASP A 1 61 ? 7.653   4.307   -11.006 1.00 0.00 ? 62 ASP A CB   3  
ATOM 3341  C CG   . ASP A 1 61 ? 8.764   3.989   -12.009 1.00 0.00 ? 62 ASP A CG   3  
ATOM 3342  O OD1  . ASP A 1 61 ? 9.899   3.853   -11.582 1.00 0.00 ? 62 ASP A OD1  3  
ATOM 3343  O OD2  . ASP A 1 61 ? 8.462   3.887   -13.186 1.00 0.00 ? 62 ASP A OD2  3  
ATOM 3344  H H    . ASP A 1 61 ? 9.242   3.369   -9.221  1.00 0.00 ? 62 ASP A H    3  
ATOM 3345  H HA   . ASP A 1 61 ? 8.684   6.037   -10.257 1.00 0.00 ? 62 ASP A HA   3  
ATOM 3346  H HB2  . ASP A 1 61 ? 7.251   3.385   -10.607 1.00 0.00 ? 62 ASP A HB2  3  
ATOM 3347  H HB3  . ASP A 1 61 ? 6.869   4.858   -11.503 1.00 0.00 ? 62 ASP A HB3  3  
ATOM 3348  N N    . TYR A 1 62 ? 7.078   4.969   -7.738  1.00 0.00 ? 63 TYR A N    3  
ATOM 3349  C CA   . TYR A 1 62 ? 5.995   5.265   -6.767  1.00 0.00 ? 63 TYR A CA   3  
ATOM 3350  C C    . TYR A 1 62 ? 6.435   6.345   -5.778  1.00 0.00 ? 63 TYR A C    3  
ATOM 3351  O O    . TYR A 1 62 ? 5.699   7.257   -5.479  1.00 0.00 ? 63 TYR A O    3  
ATOM 3352  C CB   . TYR A 1 62 ? 5.684   3.981   -6.021  1.00 0.00 ? 63 TYR A CB   3  
ATOM 3353  C CG   . TYR A 1 62 ? 4.812   4.267   -4.847  1.00 0.00 ? 63 TYR A CG   3  
ATOM 3354  C CD1  . TYR A 1 62 ? 3.501   4.702   -5.037  1.00 0.00 ? 63 TYR A CD1  3  
ATOM 3355  C CD2  . TYR A 1 62 ? 5.316   4.077   -3.566  1.00 0.00 ? 63 TYR A CD2  3  
ATOM 3356  C CE1  . TYR A 1 62 ? 2.684   4.944   -3.934  1.00 0.00 ? 63 TYR A CE1  3  
ATOM 3357  C CE2  . TYR A 1 62 ? 4.505   4.318   -2.456  1.00 0.00 ? 63 TYR A CE2  3  
ATOM 3358  C CZ   . TYR A 1 62 ? 3.183   4.751   -2.637  1.00 0.00 ? 63 TYR A CZ   3  
ATOM 3359  O OH   . TYR A 1 62 ? 2.377   4.990   -1.542  1.00 0.00 ? 63 TYR A OH   3  
ATOM 3360  H H    . TYR A 1 62 ? 7.782   4.332   -7.496  1.00 0.00 ? 63 TYR A H    3  
ATOM 3361  H HA   . TYR A 1 62 ? 5.113   5.596   -7.291  1.00 0.00 ? 63 TYR A HA   3  
ATOM 3362  H HB2  . TYR A 1 62 ? 5.181   3.293   -6.684  1.00 0.00 ? 63 TYR A HB2  3  
ATOM 3363  H HB3  . TYR A 1 62 ? 6.607   3.537   -5.679  1.00 0.00 ? 63 TYR A HB3  3  
ATOM 3364  H HD1  . TYR A 1 62 ? 3.119   4.847   -6.037  1.00 0.00 ? 63 TYR A HD1  3  
ATOM 3365  H HD2  . TYR A 1 62 ? 6.342   3.752   -3.435  1.00 0.00 ? 63 TYR A HD2  3  
ATOM 3366  H HE1  . TYR A 1 62 ? 1.670   5.281   -4.085  1.00 0.00 ? 63 TYR A HE1  3  
ATOM 3367  H HE2  . TYR A 1 62 ? 4.894   4.157   -1.463  1.00 0.00 ? 63 TYR A HE2  3  
ATOM 3368  H HH   . TYR A 1 62 ? 1.810   5.737   -1.750  1.00 0.00 ? 63 TYR A HH   3  
ATOM 3369  N N    . ASP A 1 63 ? 7.627   6.254   -5.267  1.00 0.00 ? 64 ASP A N    3  
ATOM 3370  C CA   . ASP A 1 63 ? 8.097   7.282   -4.306  1.00 0.00 ? 64 ASP A CA   3  
ATOM 3371  C C    . ASP A 1 63 ? 8.373   8.566   -5.068  1.00 0.00 ? 64 ASP A C    3  
ATOM 3372  O O    . ASP A 1 63 ? 8.163   9.661   -4.585  1.00 0.00 ? 64 ASP A O    3  
ATOM 3373  C CB   . ASP A 1 63 ? 9.376   6.804   -3.655  1.00 0.00 ? 64 ASP A CB   3  
ATOM 3374  C CG   . ASP A 1 63 ? 9.645   7.612   -2.383  1.00 0.00 ? 64 ASP A CG   3  
ATOM 3375  O OD1  . ASP A 1 63 ? 8.935   7.406   -1.413  1.00 0.00 ? 64 ASP A OD1  3  
ATOM 3376  O OD2  . ASP A 1 63 ? 10.556  8.423   -2.403  1.00 0.00 ? 64 ASP A OD2  3  
ATOM 3377  H H    . ASP A 1 63 ? 8.212   5.515   -5.516  1.00 0.00 ? 64 ASP A H    3  
ATOM 3378  H HA   . ASP A 1 63 ? 7.356   7.444   -3.550  1.00 0.00 ? 64 ASP A HA   3  
ATOM 3379  H HB2  . ASP A 1 63 ? 9.262   5.770   -3.410  1.00 0.00 ? 64 ASP A HB2  3  
ATOM 3380  H HB3  . ASP A 1 63 ? 10.195  6.928   -4.340  1.00 0.00 ? 64 ASP A HB3  3  
ATOM 3381  N N    . ARG A 1 64 ? 8.864   8.423   -6.261  1.00 0.00 ? 65 ARG A N    3  
ATOM 3382  C CA   . ARG A 1 64 ? 9.190   9.612   -7.086  1.00 0.00 ? 65 ARG A CA   3  
ATOM 3383  C C    . ARG A 1 64 ? 7.919   10.234  -7.679  1.00 0.00 ? 65 ARG A C    3  
ATOM 3384  O O    . ARG A 1 64 ? 7.804   11.438  -7.786  1.00 0.00 ? 65 ARG A O    3  
ATOM 3385  C CB   . ARG A 1 64 ? 10.117  9.184   -8.220  1.00 0.00 ? 65 ARG A CB   3  
ATOM 3386  C CG   . ARG A 1 64 ? 10.717  10.420  -8.891  1.00 0.00 ? 65 ARG A CG   3  
ATOM 3387  C CD   . ARG A 1 64 ? 11.707  9.974   -9.966  1.00 0.00 ? 65 ARG A CD   3  
ATOM 3388  N NE   . ARG A 1 64 ? 13.061  9.827   -9.362  1.00 0.00 ? 65 ARG A NE   3  
ATOM 3389  C CZ   . ARG A 1 64 ? 14.125  10.028  -10.089 1.00 0.00 ? 65 ARG A CZ   3  
ATOM 3390  N NH1  . ARG A 1 64 ? 14.568  9.084   -10.873 1.00 0.00 ? 65 ARG A NH1  3  
ATOM 3391  N NH2  . ARG A 1 64 ? 14.749  11.172  -10.028 1.00 0.00 ? 65 ARG A NH2  3  
ATOM 3392  H H    . ARG A 1 64 ? 9.037   7.522   -6.609  1.00 0.00 ? 65 ARG A H    3  
ATOM 3393  H HA   . ARG A 1 64 ? 9.690   10.335  -6.472  1.00 0.00 ? 65 ARG A HA   3  
ATOM 3394  H HB2  . ARG A 1 64 ? 10.911  8.570   -7.822  1.00 0.00 ? 65 ARG A HB2  3  
ATOM 3395  H HB3  . ARG A 1 64 ? 9.555   8.619   -8.948  1.00 0.00 ? 65 ARG A HB3  3  
ATOM 3396  H HG2  . ARG A 1 64 ? 9.927   11.003  -9.343  1.00 0.00 ? 65 ARG A HG2  3  
ATOM 3397  H HG3  . ARG A 1 64 ? 11.232  11.019  -8.154  1.00 0.00 ? 65 ARG A HG3  3  
ATOM 3398  H HD2  . ARG A 1 64 ? 11.388  9.024   -10.370 1.00 0.00 ? 65 ARG A HD2  3  
ATOM 3399  H HD3  . ARG A 1 64 ? 11.739  10.711  -10.754 1.00 0.00 ? 65 ARG A HD3  3  
ATOM 3400  H HE   . ARG A 1 64 ? 13.152  9.578   -8.419  1.00 0.00 ? 65 ARG A HE   3  
ATOM 3401  H HH11 . ARG A 1 64 ? 14.091  8.206   -10.918 1.00 0.00 ? 65 ARG A HH11 3  
ATOM 3402  H HH12 . ARG A 1 64 ? 15.384  9.237   -11.430 1.00 0.00 ? 65 ARG A HH12 3  
ATOM 3403  H HH21 . ARG A 1 64 ? 14.411  11.895  -9.425  1.00 0.00 ? 65 ARG A HH21 3  
ATOM 3404  H HH22 . ARG A 1 64 ? 15.566  11.327  -10.584 1.00 0.00 ? 65 ARG A HH22 3  
ATOM 3405  N N    . ALA A 1 65 ? 6.977   9.429   -8.085  1.00 0.00 ? 66 ALA A N    3  
ATOM 3406  C CA   . ALA A 1 65 ? 5.731   9.988   -8.693  1.00 0.00 ? 66 ALA A CA   3  
ATOM 3407  C C    . ALA A 1 65 ? 4.791   10.511  -7.614  1.00 0.00 ? 66 ALA A C    3  
ATOM 3408  O O    . ALA A 1 65 ? 4.210   11.563  -7.760  1.00 0.00 ? 66 ALA A O    3  
ATOM 3409  C CB   . ALA A 1 65 ? 5.023   8.900   -9.504  1.00 0.00 ? 66 ALA A CB   3  
ATOM 3410  H H    . ALA A 1 65 ? 7.092   8.460   -8.006  1.00 0.00 ? 66 ALA A H    3  
ATOM 3411  H HA   . ALA A 1 65 ? 5.989   10.809  -9.346  1.00 0.00 ? 66 ALA A HA   3  
ATOM 3412  H HB1  . ALA A 1 65 ? 5.758   8.294   -10.013 1.00 0.00 ? 66 ALA A HB1  3  
ATOM 3413  H HB2  . ALA A 1 65 ? 4.442   8.277   -8.839  1.00 0.00 ? 66 ALA A HB2  3  
ATOM 3414  H HB3  . ALA A 1 65 ? 4.370   9.360   -10.230 1.00 0.00 ? 66 ALA A HB3  3  
ATOM 3415  N N    . VAL A 1 66 ? 4.624   9.802   -6.535  1.00 0.00 ? 67 VAL A N    3  
ATOM 3416  C CA   . VAL A 1 66 ? 3.710   10.305  -5.482  1.00 0.00 ? 67 VAL A CA   3  
ATOM 3417  C C    . VAL A 1 66 ? 4.135   11.712  -5.098  1.00 0.00 ? 67 VAL A C    3  
ATOM 3418  O O    . VAL A 1 66 ? 3.327   12.592  -4.999  1.00 0.00 ? 67 VAL A O    3  
ATOM 3419  C CB   . VAL A 1 66 ? 3.747   9.418   -4.263  1.00 0.00 ? 67 VAL A CB   3  
ATOM 3420  C CG1  . VAL A 1 66 ? 3.391   7.991   -4.655  1.00 0.00 ? 67 VAL A CG1  3  
ATOM 3421  C CG2  . VAL A 1 66 ? 5.131   9.479   -3.673  1.00 0.00 ? 67 VAL A CG2  3  
ATOM 3422  H H    . VAL A 1 66 ? 5.089   8.957   -6.421  1.00 0.00 ? 67 VAL A H    3  
ATOM 3423  H HA   . VAL A 1 66 ? 2.718   10.325  -5.860  1.00 0.00 ? 67 VAL A HA   3  
ATOM 3424  H HB   . VAL A 1 66 ? 3.039   9.781   -3.546  1.00 0.00 ? 67 VAL A HB   3  
ATOM 3425  H HG11 . VAL A 1 66 ? 3.475   7.885   -5.726  1.00 0.00 ? 67 VAL A HG11 3  
ATOM 3426  H HG12 . VAL A 1 66 ? 4.063   7.302   -4.167  1.00 0.00 ? 67 VAL A HG12 3  
ATOM 3427  H HG13 . VAL A 1 66 ? 2.376   7.781   -4.352  1.00 0.00 ? 67 VAL A HG13 3  
ATOM 3428  H HG21 . VAL A 1 66 ? 5.850   9.429   -4.470  1.00 0.00 ? 67 VAL A HG21 3  
ATOM 3429  H HG22 . VAL A 1 66 ? 5.235   10.413  -3.145  1.00 0.00 ? 67 VAL A HG22 3  
ATOM 3430  H HG23 . VAL A 1 66 ? 5.273   8.655   -2.994  1.00 0.00 ? 67 VAL A HG23 3  
ATOM 3431  N N    . LYS A 1 67 ? 5.402   11.928  -4.893  1.00 0.00 ? 68 LYS A N    3  
ATOM 3432  C CA   . LYS A 1 67 ? 5.875   13.299  -4.529  1.00 0.00 ? 68 LYS A CA   3  
ATOM 3433  C C    . LYS A 1 67 ? 5.154   14.318  -5.415  1.00 0.00 ? 68 LYS A C    3  
ATOM 3434  O O    . LYS A 1 67 ? 4.717   15.357  -4.963  1.00 0.00 ? 68 LYS A O    3  
ATOM 3435  C CB   . LYS A 1 67 ? 7.385   13.398  -4.762  1.00 0.00 ? 68 LYS A CB   3  
ATOM 3436  C CG   . LYS A 1 67 ? 8.128   12.680  -3.632  1.00 0.00 ? 68 LYS A CG   3  
ATOM 3437  C CD   . LYS A 1 67 ? 9.153   13.630  -3.010  1.00 0.00 ? 68 LYS A CD   3  
ATOM 3438  C CE   . LYS A 1 67 ? 9.554   13.114  -1.626  1.00 0.00 ? 68 LYS A CE   3  
ATOM 3439  N NZ   . LYS A 1 67 ? 8.340   12.993  -0.768  1.00 0.00 ? 68 LYS A NZ   3  
ATOM 3440  H H    . LYS A 1 67 ? 6.039   11.195  -4.985  1.00 0.00 ? 68 LYS A H    3  
ATOM 3441  H HA   . LYS A 1 67 ? 5.653   13.497  -3.490  1.00 0.00 ? 68 LYS A HA   3  
ATOM 3442  H HB2  . LYS A 1 67 ? 7.633   12.936  -5.707  1.00 0.00 ? 68 LYS A HB2  3  
ATOM 3443  H HB3  . LYS A 1 67 ? 7.679   14.437  -4.780  1.00 0.00 ? 68 LYS A HB3  3  
ATOM 3444  H HG2  . LYS A 1 67 ? 7.419   12.368  -2.878  1.00 0.00 ? 68 LYS A HG2  3  
ATOM 3445  H HG3  . LYS A 1 67 ? 8.636   11.814  -4.030  1.00 0.00 ? 68 LYS A HG3  3  
ATOM 3446  H HD2  . LYS A 1 67 ? 10.027  13.680  -3.644  1.00 0.00 ? 68 LYS A HD2  3  
ATOM 3447  H HD3  . LYS A 1 67 ? 8.721   14.614  -2.915  1.00 0.00 ? 68 LYS A HD3  3  
ATOM 3448  H HE2  . LYS A 1 67 ? 10.022  12.147  -1.725  1.00 0.00 ? 68 LYS A HE2  3  
ATOM 3449  H HE3  . LYS A 1 67 ? 10.248  13.806  -1.172  1.00 0.00 ? 68 LYS A HE3  3  
ATOM 3450  H HZ1  . LYS A 1 67 ? 7.662   13.739  -1.022  1.00 0.00 ? 68 LYS A HZ1  3  
ATOM 3451  H HZ2  . LYS A 1 67 ? 7.904   12.061  -0.914  1.00 0.00 ? 68 LYS A HZ2  3  
ATOM 3452  H HZ3  . LYS A 1 67 ? 8.610   13.093  0.231   1.00 0.00 ? 68 LYS A HZ3  3  
ATOM 3453  N N    . GLU A 1 68 ? 5.000   14.000  -6.671  1.00 0.00 ? 69 GLU A N    3  
ATOM 3454  C CA   . GLU A 1 68 ? 4.284   14.903  -7.607  1.00 0.00 ? 69 GLU A CA   3  
ATOM 3455  C C    . GLU A 1 68 ? 2.819   14.934  -7.160  1.00 0.00 ? 69 GLU A C    3  
ATOM 3456  O O    . GLU A 1 68 ? 2.220   15.965  -6.931  1.00 0.00 ? 69 GLU A O    3  
ATOM 3457  C CB   . GLU A 1 68 ? 4.436   14.291  -9.016  1.00 0.00 ? 69 GLU A CB   3  
ATOM 3458  C CG   . GLU A 1 68 ? 3.078   13.944  -9.623  1.00 0.00 ? 69 GLU A CG   3  
ATOM 3459  C CD   . GLU A 1 68 ? 3.238   13.704  -11.126 1.00 0.00 ? 69 GLU A CD   3  
ATOM 3460  O OE1  . GLU A 1 68 ? 4.264   14.093  -11.660 1.00 0.00 ? 69 GLU A OE1  3  
ATOM 3461  O OE2  . GLU A 1 68 ? 2.334   13.135  -11.716 1.00 0.00 ? 69 GLU A OE2  3  
ATOM 3462  H H    . GLU A 1 68 ? 5.339   13.143  -7.001  1.00 0.00 ? 69 GLU A H    3  
ATOM 3463  H HA   . GLU A 1 68 ? 4.710   15.894  -7.576  1.00 0.00 ? 69 GLU A HA   3  
ATOM 3464  H HB2  . GLU A 1 68 ? 4.948   14.989  -9.659  1.00 0.00 ? 69 GLU A HB2  3  
ATOM 3465  H HB3  . GLU A 1 68 ? 5.022   13.378  -8.935  1.00 0.00 ? 69 GLU A HB3  3  
ATOM 3466  H HG2  . GLU A 1 68 ? 2.702   13.048  -9.149  1.00 0.00 ? 69 GLU A HG2  3  
ATOM 3467  H HG3  . GLU A 1 68 ? 2.388   14.757  -9.458  1.00 0.00 ? 69 GLU A HG3  3  
ATOM 3468  N N    . PHE A 1 69 ? 2.282   13.767  -7.024  1.00 0.00 ? 70 PHE A N    3  
ATOM 3469  C CA   . PHE A 1 69 ? 0.880   13.561  -6.568  1.00 0.00 ? 70 PHE A CA   3  
ATOM 3470  C C    . PHE A 1 69 ? 0.615   14.279  -5.241  1.00 0.00 ? 70 PHE A C    3  
ATOM 3471  O O    . PHE A 1 69 ? -0.509  14.602  -4.910  1.00 0.00 ? 70 PHE A O    3  
ATOM 3472  C CB   . PHE A 1 69 ? 0.757   12.087  -6.322  1.00 0.00 ? 70 PHE A CB   3  
ATOM 3473  C CG   . PHE A 1 69 ? -0.400  11.831  -5.440  1.00 0.00 ? 70 PHE A CG   3  
ATOM 3474  C CD1  . PHE A 1 69 ? -1.660  11.756  -5.989  1.00 0.00 ? 70 PHE A CD1  3  
ATOM 3475  C CD2  . PHE A 1 69 ? -0.194  11.689  -4.077  1.00 0.00 ? 70 PHE A CD2  3  
ATOM 3476  C CE1  . PHE A 1 69 ? -2.761  11.533  -5.169  1.00 0.00 ? 70 PHE A CE1  3  
ATOM 3477  C CE2  . PHE A 1 69 ? -1.288  11.463  -3.236  1.00 0.00 ? 70 PHE A CE2  3  
ATOM 3478  C CZ   . PHE A 1 69 ? -2.579  11.382  -3.784  1.00 0.00 ? 70 PHE A CZ   3  
ATOM 3479  H H    . PHE A 1 69 ? 2.834   12.980  -7.215  1.00 0.00 ? 70 PHE A H    3  
ATOM 3480  H HA   . PHE A 1 69 ? 0.159   13.845  -7.314  1.00 0.00 ? 70 PHE A HA   3  
ATOM 3481  H HB2  . PHE A 1 69 ? 0.614   11.581  -7.259  1.00 0.00 ? 70 PHE A HB2  3  
ATOM 3482  H HB3  . PHE A 1 69 ? 1.652   11.746  -5.835  1.00 0.00 ? 70 PHE A HB3  3  
ATOM 3483  H HD1  . PHE A 1 69 ? -1.776  11.879  -7.056  1.00 0.00 ? 70 PHE A HD1  3  
ATOM 3484  H HD2  . PHE A 1 69 ? 0.818   11.764  -3.679  1.00 0.00 ? 70 PHE A HD2  3  
ATOM 3485  H HE1  . PHE A 1 69 ? -3.745  11.479  -5.599  1.00 0.00 ? 70 PHE A HE1  3  
ATOM 3486  H HE2  . PHE A 1 69 ? -1.139  11.349  -2.175  1.00 0.00 ? 70 PHE A HE2  3  
ATOM 3487  H HZ   . PHE A 1 69 ? -3.430  11.207  -3.143  1.00 0.00 ? 70 PHE A HZ   3  
ATOM 3488  N N    . GLU A 1 70 ? 1.629   14.481  -4.466  1.00 0.00 ? 71 GLU A N    3  
ATOM 3489  C CA   . GLU A 1 70 ? 1.436   15.120  -3.144  1.00 0.00 ? 71 GLU A CA   3  
ATOM 3490  C C    . GLU A 1 70 ? 1.746   16.604  -3.278  1.00 0.00 ? 71 GLU A C    3  
ATOM 3491  O O    . GLU A 1 70 ? 1.372   17.418  -2.457  1.00 0.00 ? 71 GLU A O    3  
ATOM 3492  C CB   . GLU A 1 70 ? 2.390   14.484  -2.129  1.00 0.00 ? 71 GLU A CB   3  
ATOM 3493  C CG   . GLU A 1 70 ? 2.116   12.979  -2.038  1.00 0.00 ? 71 GLU A CG   3  
ATOM 3494  C CD   . GLU A 1 70 ? 2.637   12.448  -0.701  1.00 0.00 ? 71 GLU A CD   3  
ATOM 3495  O OE1  . GLU A 1 70 ? 2.007   12.720  0.308   1.00 0.00 ? 71 GLU A OE1  3  
ATOM 3496  O OE2  . GLU A 1 70 ? 3.656   11.779  -0.709  1.00 0.00 ? 71 GLU A OE2  3  
ATOM 3497  H H    . GLU A 1 70 ? 2.518   14.201  -4.747  1.00 0.00 ? 71 GLU A H    3  
ATOM 3498  H HA   . GLU A 1 70 ? 0.416   14.970  -2.825  1.00 0.00 ? 71 GLU A HA   3  
ATOM 3499  H HB2  . GLU A 1 70 ? 3.411   14.645  -2.445  1.00 0.00 ? 71 GLU A HB2  3  
ATOM 3500  H HB3  . GLU A 1 70 ? 2.238   14.935  -1.160  1.00 0.00 ? 71 GLU A HB3  3  
ATOM 3501  H HG2  . GLU A 1 70 ? 1.053   12.802  -2.107  1.00 0.00 ? 71 GLU A HG2  3  
ATOM 3502  H HG3  . GLU A 1 70 ? 2.620   12.466  -2.847  1.00 0.00 ? 71 GLU A HG3  3  
ATOM 3503  N N    . ALA A 1 71 ? 2.447   16.939  -4.317  1.00 0.00 ? 72 ALA A N    3  
ATOM 3504  C CA   . ALA A 1 71 ? 2.833   18.344  -4.567  1.00 0.00 ? 72 ALA A CA   3  
ATOM 3505  C C    . ALA A 1 71 ? 1.689   19.077  -5.277  1.00 0.00 ? 72 ALA A C    3  
ATOM 3506  O O    . ALA A 1 71 ? 1.894   19.765  -6.257  1.00 0.00 ? 72 ALA A O    3  
ATOM 3507  C CB   . ALA A 1 71 ? 4.065   18.318  -5.461  1.00 0.00 ? 72 ALA A CB   3  
ATOM 3508  H H    . ALA A 1 71 ? 2.737   16.249  -4.945  1.00 0.00 ? 72 ALA A H    3  
ATOM 3509  H HA   . ALA A 1 71 ? 3.066   18.836  -3.636  1.00 0.00 ? 72 ALA A HA   3  
ATOM 3510  H HB1  . ALA A 1 71 ? 4.289   17.285  -5.710  1.00 0.00 ? 72 ALA A HB1  3  
ATOM 3511  H HB2  . ALA A 1 71 ? 3.871   18.874  -6.364  1.00 0.00 ? 72 ALA A HB2  3  
ATOM 3512  H HB3  . ALA A 1 71 ? 4.903   18.755  -4.937  1.00 0.00 ? 72 ALA A HB3  3  
ATOM 3513  N N    . ASN A 1 72 ? 0.484   18.932  -4.794  1.00 0.00 ? 73 ASN A N    3  
ATOM 3514  C CA   . ASN A 1 72 ? -0.670  19.616  -5.446  1.00 0.00 ? 73 ASN A CA   3  
ATOM 3515  C C    . ASN A 1 72 ? -1.717  19.972  -4.389  1.00 0.00 ? 73 ASN A C    3  
ATOM 3516  O O    . ASN A 1 72 ? -2.055  21.123  -4.197  1.00 0.00 ? 73 ASN A O    3  
ATOM 3517  C CB   . ASN A 1 72 ? -1.292  18.680  -6.482  1.00 0.00 ? 73 ASN A CB   3  
ATOM 3518  C CG   . ASN A 1 72 ? -1.835  19.492  -7.650  1.00 0.00 ? 73 ASN A CG   3  
ATOM 3519  O OD1  . ASN A 1 72 ? -1.974  20.695  -7.561  1.00 0.00 ? 73 ASN A OD1  3  
ATOM 3520  N ND2  . ASN A 1 72 ? -2.148  18.876  -8.752  1.00 0.00 ? 73 ASN A ND2  3  
ATOM 3521  H H    . ASN A 1 72 ? 0.336   18.370  -4.005  1.00 0.00 ? 73 ASN A H    3  
ATOM 3522  H HA   . ASN A 1 72 ? -0.326  20.517  -5.934  1.00 0.00 ? 73 ASN A HA   3  
ATOM 3523  H HB2  . ASN A 1 72 ? -0.545  17.992  -6.846  1.00 0.00 ? 73 ASN A HB2  3  
ATOM 3524  H HB3  . ASN A 1 72 ? -2.101  18.127  -6.031  1.00 0.00 ? 73 ASN A HB3  3  
ATOM 3525  H HD21 . ASN A 1 72 ? -2.034  17.906  -8.819  1.00 0.00 ? 73 ASN A HD21 3  
ATOM 3526  H HD22 . ASN A 1 72 ? -2.495  19.380  -9.508  1.00 0.00 ? 73 ASN A HD22 3  
ATOM 3527  N N    . GLY A 1 73 ? -2.237  18.989  -3.704  1.00 0.00 ? 74 GLY A N    3  
ATOM 3528  C CA   . GLY A 1 73 ? -3.266  19.270  -2.662  1.00 0.00 ? 74 GLY A CA   3  
ATOM 3529  C C    . GLY A 1 73 ? -2.835  18.643  -1.335  1.00 0.00 ? 74 GLY A C    3  
ATOM 3530  O O    . GLY A 1 73 ? -2.400  19.383  -0.467  1.00 0.00 ? 74 GLY A O    3  
ATOM 3531  O OXT  . GLY A 1 73 ? -2.946  17.435  -1.209  1.00 0.00 ? 74 GLY A OXT  3  
ATOM 3532  H H    . GLY A 1 73 ? -1.952  18.068  -3.876  1.00 0.00 ? 74 GLY A H    3  
ATOM 3533  H HA2  . GLY A 1 73 ? -3.373  20.338  -2.541  1.00 0.00 ? 74 GLY A HA2  3  
ATOM 3534  H HA3  . GLY A 1 73 ? -4.210  18.845  -2.965  1.00 0.00 ? 74 GLY A HA3  3  
ATOM 3535  N N    . SER A 1 1  ? -3.753  6.081   -16.904 1.00 0.00 ? 2  SER A N    4  
ATOM 3536  C CA   . SER A 1 1  ? -4.684  6.334   -15.767 1.00 0.00 ? 2  SER A CA   4  
ATOM 3537  C C    . SER A 1 1  ? -4.072  7.367   -14.821 1.00 0.00 ? 2  SER A C    4  
ATOM 3538  O O    . SER A 1 1  ? -2.873  7.563   -14.791 1.00 0.00 ? 2  SER A O    4  
ATOM 3539  C CB   . SER A 1 1  ? -4.931  5.031   -15.007 1.00 0.00 ? 2  SER A CB   4  
ATOM 3540  O OG   . SER A 1 1  ? -6.247  5.046   -14.470 1.00 0.00 ? 2  SER A OG   4  
ATOM 3541  H H    . SER A 1 1  ? -3.545  5.161   -17.170 1.00 0.00 ? 2  SER A H    4  
ATOM 3542  H HA   . SER A 1 1  ? -5.623  6.709   -16.148 1.00 0.00 ? 2  SER A HA   4  
ATOM 3543  H HB2  . SER A 1 1  ? -4.830  4.194   -15.677 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3544  H HB3  . SER A 1 1  ? -4.207  4.940   -14.207 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3545  H HG   . SER A 1 1  ? -6.489  5.960   -14.304 1.00 0.00 ? 2  SER A HG   4  
ATOM 3546  N N    . ASP A 1 2  ? -4.887  8.029   -14.049 1.00 0.00 ? 3  ASP A N    4  
ATOM 3547  C CA   . ASP A 1 2  ? -4.355  9.054   -13.106 1.00 0.00 ? 3  ASP A CA   4  
ATOM 3548  C C    . ASP A 1 2  ? -3.753  8.364   -11.881 1.00 0.00 ? 3  ASP A C    4  
ATOM 3549  O O    . ASP A 1 2  ? -2.794  8.835   -11.303 1.00 0.00 ? 3  ASP A O    4  
ATOM 3550  C CB   . ASP A 1 2  ? -5.492  9.976   -12.664 1.00 0.00 ? 3  ASP A CB   4  
ATOM 3551  C CG   . ASP A 1 2  ? -5.319  11.349  -13.316 1.00 0.00 ? 3  ASP A CG   4  
ATOM 3552  O OD1  . ASP A 1 2  ? -4.430  12.073  -12.899 1.00 0.00 ? 3  ASP A OD1  4  
ATOM 3553  O OD2  . ASP A 1 2  ? -6.078  11.652  -14.222 1.00 0.00 ? 3  ASP A OD2  4  
ATOM 3554  H H    . ASP A 1 2  ? -5.850  7.856   -14.091 1.00 0.00 ? 3  ASP A H    4  
ATOM 3555  H HA   . ASP A 1 2  ? -3.592  9.636   -13.602 1.00 0.00 ? 3  ASP A HA   4  
ATOM 3556  H HB2  . ASP A 1 2  ? -6.439  9.551   -12.965 1.00 0.00 ? 3  ASP A HB2  4  
ATOM 3557  H HB3  . ASP A 1 2  ? -5.471  10.085  -11.590 1.00 0.00 ? 3  ASP A HB3  4  
ATOM 3558  N N    . LYS A 1 3  ? -4.305  7.253   -11.477 1.00 0.00 ? 4  LYS A N    4  
ATOM 3559  C CA   . LYS A 1 3  ? -3.756  6.542   -10.287 1.00 0.00 ? 4  LYS A CA   4  
ATOM 3560  C C    . LYS A 1 3  ? -2.546  5.699   -10.716 1.00 0.00 ? 4  LYS A C    4  
ATOM 3561  O O    . LYS A 1 3  ? -2.590  5.038   -11.734 1.00 0.00 ? 4  LYS A O    4  
ATOM 3562  C CB   . LYS A 1 3  ? -4.835  5.631   -9.693  1.00 0.00 ? 4  LYS A CB   4  
ATOM 3563  C CG   . LYS A 1 3  ? -4.229  4.791   -8.567  1.00 0.00 ? 4  LYS A CG   4  
ATOM 3564  C CD   . LYS A 1 3  ? -5.278  3.807   -8.042  1.00 0.00 ? 4  LYS A CD   4  
ATOM 3565  C CE   . LYS A 1 3  ? -5.734  4.246   -6.650  1.00 0.00 ? 4  LYS A CE   4  
ATOM 3566  N NZ   . LYS A 1 3  ? -6.331  3.083   -5.933  1.00 0.00 ? 4  LYS A NZ   4  
ATOM 3567  H H    . LYS A 1 3  ? -5.079  6.887   -11.953 1.00 0.00 ? 4  LYS A H    4  
ATOM 3568  H HA   . LYS A 1 3  ? -3.453  7.269   -9.549  1.00 0.00 ? 4  LYS A HA   4  
ATOM 3569  H HB2  . LYS A 1 3  ? -5.640  6.236   -9.300  1.00 0.00 ? 4  LYS A HB2  4  
ATOM 3570  H HB3  . LYS A 1 3  ? -5.217  4.976   -10.461 1.00 0.00 ? 4  LYS A HB3  4  
ATOM 3571  H HG2  . LYS A 1 3  ? -3.378  4.243   -8.945  1.00 0.00 ? 4  LYS A HG2  4  
ATOM 3572  H HG3  . LYS A 1 3  ? -3.913  5.439   -7.764  1.00 0.00 ? 4  LYS A HG3  4  
ATOM 3573  H HD2  . LYS A 1 3  ? -6.126  3.793   -8.712  1.00 0.00 ? 4  LYS A HD2  4  
ATOM 3574  H HD3  . LYS A 1 3  ? -4.848  2.820   -7.983  1.00 0.00 ? 4  LYS A HD3  4  
ATOM 3575  H HE2  . LYS A 1 3  ? -4.885  4.614   -6.093  1.00 0.00 ? 4  LYS A HE2  4  
ATOM 3576  H HE3  . LYS A 1 3  ? -6.472  5.030   -6.742  1.00 0.00 ? 4  LYS A HE3  4  
ATOM 3577  H HZ1  . LYS A 1 3  ? -7.138  2.717   -6.478  1.00 0.00 ? 4  LYS A HZ1  4  
ATOM 3578  H HZ2  . LYS A 1 3  ? -5.616  2.337   -5.826  1.00 0.00 ? 4  LYS A HZ2  4  
ATOM 3579  H HZ3  . LYS A 1 3  ? -6.656  3.386   -4.993  1.00 0.00 ? 4  LYS A HZ3  4  
ATOM 3580  N N    . PRO A 1 4  ? -1.499  5.753   -9.929  1.00 0.00 ? 5  PRO A N    4  
ATOM 3581  C CA   . PRO A 1 4  ? -0.259  5.011   -10.203 1.00 0.00 ? 5  PRO A CA   4  
ATOM 3582  C C    . PRO A 1 4  ? -0.392  3.538   -9.829  1.00 0.00 ? 5  PRO A C    4  
ATOM 3583  O O    . PRO A 1 4  ? -1.296  3.139   -9.122  1.00 0.00 ? 5  PRO A O    4  
ATOM 3584  C CB   . PRO A 1 4  ? 0.779   5.692   -9.336  1.00 0.00 ? 5  PRO A CB   4  
ATOM 3585  C CG   . PRO A 1 4  ? 0.003   6.397   -8.214  1.00 0.00 ? 5  PRO A CG   4  
ATOM 3586  C CD   . PRO A 1 4  ? -1.450  6.554   -8.697  1.00 0.00 ? 5  PRO A CD   4  
ATOM 3587  H HA   . PRO A 1 4  ? 0.025   5.120   -11.219 1.00 0.00 ? 5  PRO A HA   4  
ATOM 3588  H HB2  . PRO A 1 4  ? 1.456   4.956   -8.926  1.00 0.00 ? 5  PRO A HB2  4  
ATOM 3589  H HB3  . PRO A 1 4  ? 1.322   6.418   -9.916  1.00 0.00 ? 5  PRO A HB3  4  
ATOM 3590  H HG2  . PRO A 1 4  ? 0.035   5.795   -7.326  1.00 0.00 ? 5  PRO A HG2  4  
ATOM 3591  H HG3  . PRO A 1 4  ? 0.430   7.362   -8.033  1.00 0.00 ? 5  PRO A HG3  4  
ATOM 3592  H HD2  . PRO A 1 4  ? -2.137  6.163   -7.959  1.00 0.00 ? 5  PRO A HD2  4  
ATOM 3593  H HD3  . PRO A 1 4  ? -1.668  7.588   -8.913  1.00 0.00 ? 5  PRO A HD3  4  
ATOM 3594  N N    . LYS A 1 5  ? 0.513   2.730   -10.298 1.00 0.00 ? 6  LYS A N    4  
ATOM 3595  C CA   . LYS A 1 5  ? 0.461   1.277   -9.975  1.00 0.00 ? 6  LYS A CA   4  
ATOM 3596  C C    . LYS A 1 5  ? 0.648   1.093   -8.466  1.00 0.00 ? 6  LYS A C    4  
ATOM 3597  O O    . LYS A 1 5  ? 1.715   1.322   -7.932  1.00 0.00 ? 6  LYS A O    4  
ATOM 3598  C CB   . LYS A 1 5  ? 1.564   0.550   -10.746 1.00 0.00 ? 6  LYS A CB   4  
ATOM 3599  C CG   . LYS A 1 5  ? 1.999   -0.720  -10.004 1.00 0.00 ? 6  LYS A CG   4  
ATOM 3600  C CD   . LYS A 1 5  ? 2.250   -1.841  -11.013 1.00 0.00 ? 6  LYS A CD   4  
ATOM 3601  C CE   . LYS A 1 5  ? 3.259   -1.367  -12.059 1.00 0.00 ? 6  LYS A CE   4  
ATOM 3602  N NZ   . LYS A 1 5  ? 2.600   -1.307  -13.393 1.00 0.00 ? 6  LYS A NZ   4  
ATOM 3603  H H    . LYS A 1 5  ? 1.232   3.084   -10.862 1.00 0.00 ? 6  LYS A H    4  
ATOM 3604  H HA   . LYS A 1 5  ? -0.493  0.878   -10.275 1.00 0.00 ? 6  LYS A HA   4  
ATOM 3605  H HB2  . LYS A 1 5  ? 1.180   0.280   -11.716 1.00 0.00 ? 6  LYS A HB2  4  
ATOM 3606  H HB3  . LYS A 1 5  ? 2.412   1.207   -10.865 1.00 0.00 ? 6  LYS A HB3  4  
ATOM 3607  H HG2  . LYS A 1 5  ? 2.907   -0.521  -9.453  1.00 0.00 ? 6  LYS A HG2  4  
ATOM 3608  H HG3  . LYS A 1 5  ? 1.221   -1.022  -9.320  1.00 0.00 ? 6  LYS A HG3  4  
ATOM 3609  H HD2  . LYS A 1 5  ? 2.643   -2.707  -10.500 1.00 0.00 ? 6  LYS A HD2  4  
ATOM 3610  H HD3  . LYS A 1 5  ? 1.323   -2.101  -11.502 1.00 0.00 ? 6  LYS A HD3  4  
ATOM 3611  H HE2  . LYS A 1 5  ? 3.620   -0.384  -11.791 1.00 0.00 ? 6  LYS A HE2  4  
ATOM 3612  H HE3  . LYS A 1 5  ? 4.090   -2.056  -12.098 1.00 0.00 ? 6  LYS A HE3  4  
ATOM 3613  H HZ1  . LYS A 1 5  ? 1.758   -0.699  -13.337 1.00 0.00 ? 6  LYS A HZ1  4  
ATOM 3614  H HZ2  . LYS A 1 5  ? 3.265   -0.916  -14.092 1.00 0.00 ? 6  LYS A HZ2  4  
ATOM 3615  H HZ3  . LYS A 1 5  ? 2.313   -2.263  -13.683 1.00 0.00 ? 6  LYS A HZ3  4  
ATOM 3616  N N    . ARG A 1 6  ? -0.380  0.688   -7.776  1.00 0.00 ? 7  ARG A N    4  
ATOM 3617  C CA   . ARG A 1 6  ? -0.253  0.499   -6.306  1.00 0.00 ? 7  ARG A CA   4  
ATOM 3618  C C    . ARG A 1 6  ? 0.767   -0.613  -6.013  1.00 0.00 ? 7  ARG A C    4  
ATOM 3619  O O    . ARG A 1 6  ? 0.799   -1.617  -6.698  1.00 0.00 ? 7  ARG A O    4  
ATOM 3620  C CB   . ARG A 1 6  ? -1.611  0.106   -5.721  1.00 0.00 ? 7  ARG A CB   4  
ATOM 3621  C CG   . ARG A 1 6  ? -1.973  -1.311  -6.170  1.00 0.00 ? 7  ARG A CG   4  
ATOM 3622  C CD   . ARG A 1 6  ? -3.458  -1.365  -6.532  1.00 0.00 ? 7  ARG A CD   4  
ATOM 3623  N NE   . ARG A 1 6  ? -3.622  -1.130  -7.994  1.00 0.00 ? 7  ARG A NE   4  
ATOM 3624  C CZ   . ARG A 1 6  ? -4.533  -1.783  -8.663  1.00 0.00 ? 7  ARG A CZ   4  
ATOM 3625  N NH1  . ARG A 1 6  ? -4.645  -3.075  -8.521  1.00 0.00 ? 7  ARG A NH1  4  
ATOM 3626  N NH2  . ARG A 1 6  ? -5.331  -1.142  -9.471  1.00 0.00 ? 7  ARG A NH2  4  
ATOM 3627  H H    . ARG A 1 6  ? -1.235  0.514   -8.222  1.00 0.00 ? 7  ARG A H    4  
ATOM 3628  H HA   . ARG A 1 6  ? 0.075   1.424   -5.858  1.00 0.00 ? 7  ARG A HA   4  
ATOM 3629  H HB2  . ARG A 1 6  ? -1.560  0.141   -4.642  1.00 0.00 ? 7  ARG A HB2  4  
ATOM 3630  H HB3  . ARG A 1 6  ? -2.365  0.795   -6.068  1.00 0.00 ? 7  ARG A HB3  4  
ATOM 3631  H HG2  . ARG A 1 6  ? -1.380  -1.577  -7.034  1.00 0.00 ? 7  ARG A HG2  4  
ATOM 3632  H HG3  . ARG A 1 6  ? -1.775  -2.006  -5.368  1.00 0.00 ? 7  ARG A HG3  4  
ATOM 3633  H HD2  . ARG A 1 6  ? -3.857  -2.336  -6.276  1.00 0.00 ? 7  ARG A HD2  4  
ATOM 3634  H HD3  . ARG A 1 6  ? -3.990  -0.601  -5.984  1.00 0.00 ? 7  ARG A HD3  4  
ATOM 3635  H HE   . ARG A 1 6  ? -3.045  -0.486  -8.455  1.00 0.00 ? 7  ARG A HE   4  
ATOM 3636  H HH11 . ARG A 1 6  ? -4.033  -3.566  -7.901  1.00 0.00 ? 7  ARG A HH11 4  
ATOM 3637  H HH12 . ARG A 1 6  ? -5.343  -3.575  -9.034  1.00 0.00 ? 7  ARG A HH12 4  
ATOM 3638  H HH21 . ARG A 1 6  ? -5.245  -0.151  -9.580  1.00 0.00 ? 7  ARG A HH21 4  
ATOM 3639  H HH22 . ARG A 1 6  ? -6.030  -1.642  -9.984  1.00 0.00 ? 7  ARG A HH22 4  
ATOM 3640  N N    . PRO A 1 7  ? 1.563   -0.400  -4.994  1.00 0.00 ? 8  PRO A N    4  
ATOM 3641  C CA   . PRO A 1 7  ? 2.592   -1.365  -4.565  1.00 0.00 ? 8  PRO A CA   4  
ATOM 3642  C C    . PRO A 1 7  ? 1.932   -2.580  -3.907  1.00 0.00 ? 8  PRO A C    4  
ATOM 3643  O O    . PRO A 1 7  ? 0.908   -2.467  -3.262  1.00 0.00 ? 8  PRO A O    4  
ATOM 3644  C CB   . PRO A 1 7  ? 3.437   -0.567  -3.561  1.00 0.00 ? 8  PRO A CB   4  
ATOM 3645  C CG   . PRO A 1 7  ? 2.539   0.592   -3.066  1.00 0.00 ? 8  PRO A CG   4  
ATOM 3646  C CD   . PRO A 1 7  ? 1.506   0.824   -4.178  1.00 0.00 ? 8  PRO A CD   4  
ATOM 3647  H HA   . PRO A 1 7  ? 3.202   -1.669  -5.401  1.00 0.00 ? 8  PRO A HA   4  
ATOM 3648  H HB2  . PRO A 1 7  ? 3.723   -1.201  -2.732  1.00 0.00 ? 8  PRO A HB2  4  
ATOM 3649  H HB3  . PRO A 1 7  ? 4.315   -0.168  -4.045  1.00 0.00 ? 8  PRO A HB3  4  
ATOM 3650  H HG2  . PRO A 1 7  ? 2.045   0.311   -2.148  1.00 0.00 ? 8  PRO A HG2  4  
ATOM 3651  H HG3  . PRO A 1 7  ? 3.122   1.493   -2.917  1.00 0.00 ? 8  PRO A HG3  4  
ATOM 3652  H HD2  . PRO A 1 7  ? 0.520   0.958   -3.760  1.00 0.00 ? 8  PRO A HD2  4  
ATOM 3653  H HD3  . PRO A 1 7  ? 1.785   1.670   -4.778  1.00 0.00 ? 8  PRO A HD3  4  
ATOM 3654  N N    . LEU A 1 8  ? 2.501   -3.743  -4.071  1.00 0.00 ? 9  LEU A N    4  
ATOM 3655  C CA   . LEU A 1 8  ? 1.891   -4.958  -3.460  1.00 0.00 ? 9  LEU A CA   4  
ATOM 3656  C C    . LEU A 1 8  ? 2.967   -5.999  -3.155  1.00 0.00 ? 9  LEU A C    4  
ATOM 3657  O O    . LEU A 1 8  ? 4.147   -5.783  -3.346  1.00 0.00 ? 9  LEU A O    4  
ATOM 3658  C CB   . LEU A 1 8  ? 0.809   -5.521  -4.401  1.00 0.00 ? 9  LEU A CB   4  
ATOM 3659  C CG   . LEU A 1 8  ? 1.345   -6.697  -5.216  1.00 0.00 ? 9  LEU A CG   4  
ATOM 3660  C CD1  . LEU A 1 8  ? 0.299   -7.123  -6.242  1.00 0.00 ? 9  LEU A CD1  4  
ATOM 3661  C CD2  . LEU A 1 8  ? 2.621   -6.266  -5.928  1.00 0.00 ? 9  LEU A CD2  4  
ATOM 3662  H H    . LEU A 1 8  ? 3.324   -3.817  -4.599  1.00 0.00 ? 9  LEU A H    4  
ATOM 3663  H HA   . LEU A 1 8  ? 1.428   -4.693  -2.535  1.00 0.00 ? 9  LEU A HA   4  
ATOM 3664  H HB2  . LEU A 1 8  ? -0.033  -5.854  -3.814  1.00 0.00 ? 9  LEU A HB2  4  
ATOM 3665  H HB3  . LEU A 1 8  ? 0.486   -4.741  -5.074  1.00 0.00 ? 9  LEU A HB3  4  
ATOM 3666  H HG   . LEU A 1 8  ? 1.561   -7.522  -4.557  1.00 0.00 ? 9  LEU A HG   4  
ATOM 3667  H HD11 . LEU A 1 8  ? -0.619  -7.372  -5.731  1.00 0.00 ? 9  LEU A HD11 4  
ATOM 3668  H HD12 . LEU A 1 8  ? 0.118   -6.312  -6.931  1.00 0.00 ? 9  LEU A HD12 4  
ATOM 3669  H HD13 . LEU A 1 8  ? 0.655   -7.987  -6.784  1.00 0.00 ? 9  LEU A HD13 4  
ATOM 3670  H HD21 . LEU A 1 8  ? 3.060   -5.437  -5.398  1.00 0.00 ? 9  LEU A HD21 4  
ATOM 3671  H HD22 . LEU A 1 8  ? 3.316   -7.090  -5.947  1.00 0.00 ? 9  LEU A HD22 4  
ATOM 3672  H HD23 . LEU A 1 8  ? 2.386   -5.967  -6.939  1.00 0.00 ? 9  LEU A HD23 4  
ATOM 3673  N N    . SER A 1 9  ? 2.545   -7.118  -2.658  1.00 0.00 ? 10 SER A N    4  
ATOM 3674  C CA   . SER A 1 9  ? 3.503   -8.203  -2.296  1.00 0.00 ? 10 SER A CA   4  
ATOM 3675  C C    . SER A 1 9  ? 3.943   -8.986  -3.540  1.00 0.00 ? 10 SER A C    4  
ATOM 3676  O O    . SER A 1 9  ? 3.247   -9.053  -4.539  1.00 0.00 ? 10 SER A O    4  
ATOM 3677  C CB   . SER A 1 9  ? 2.830   -9.160  -1.312  1.00 0.00 ? 10 SER A CB   4  
ATOM 3678  O OG   . SER A 1 9  ? 3.793   -9.628  -0.377  1.00 0.00 ? 10 SER A OG   4  
ATOM 3679  H H    . SER A 1 9  ? 1.586   -7.235  -2.507  1.00 0.00 ? 10 SER A H    4  
ATOM 3680  H HA   . SER A 1 9  ? 4.372   -7.769  -1.825  1.00 0.00 ? 10 SER A HA   4  
ATOM 3681  H HB2  . SER A 1 9  ? 2.045   -8.644  -0.785  1.00 0.00 ? 10 SER A HB2  4  
ATOM 3682  H HB3  . SER A 1 9  ? 2.407   -9.995  -1.857  1.00 0.00 ? 10 SER A HB3  4  
ATOM 3683  H HG   . SER A 1 9  ? 4.618   -9.770  -0.846  1.00 0.00 ? 10 SER A HG   4  
ATOM 3684  N N    . ALA A 1 10 ? 5.102   -9.585  -3.472  1.00 0.00 ? 11 ALA A N    4  
ATOM 3685  C CA   . ALA A 1 10 ? 5.613   -10.375 -4.627  1.00 0.00 ? 11 ALA A CA   4  
ATOM 3686  C C    . ALA A 1 10 ? 4.689   -11.566 -4.880  1.00 0.00 ? 11 ALA A C    4  
ATOM 3687  O O    . ALA A 1 10 ? 4.348   -11.869 -6.007  1.00 0.00 ? 11 ALA A O    4  
ATOM 3688  C CB   . ALA A 1 10 ? 7.022   -10.883 -4.307  1.00 0.00 ? 11 ALA A CB   4  
ATOM 3689  H H    . ALA A 1 10 ? 5.636   -9.518  -2.654  1.00 0.00 ? 11 ALA A H    4  
ATOM 3690  H HA   . ALA A 1 10 ? 5.646   -9.749  -5.506  1.00 0.00 ? 11 ALA A HA   4  
ATOM 3691  H HB1  . ALA A 1 10 ? 7.449   -10.284 -3.517  1.00 0.00 ? 11 ALA A HB1  4  
ATOM 3692  H HB2  . ALA A 1 10 ? 6.970   -11.916 -3.990  1.00 0.00 ? 11 ALA A HB2  4  
ATOM 3693  H HB3  . ALA A 1 10 ? 7.639   -10.807 -5.190  1.00 0.00 ? 11 ALA A HB3  4  
ATOM 3694  N N    . TYR A 1 11 ? 4.275   -12.244 -3.844  1.00 0.00 ? 12 TYR A N    4  
ATOM 3695  C CA   . TYR A 1 11 ? 3.372   -13.403 -4.030  1.00 0.00 ? 12 TYR A CA   4  
ATOM 3696  C C    . TYR A 1 11 ? 2.176   -12.968 -4.871  1.00 0.00 ? 12 TYR A C    4  
ATOM 3697  O O    . TYR A 1 11 ? 1.564   -13.758 -5.561  1.00 0.00 ? 12 TYR A O    4  
ATOM 3698  C CB   . TYR A 1 11 ? 2.899   -13.872 -2.661  1.00 0.00 ? 12 TYR A CB   4  
ATOM 3699  C CG   . TYR A 1 11 ? 1.738   -14.826 -2.823  1.00 0.00 ? 12 TYR A CG   4  
ATOM 3700  C CD1  . TYR A 1 11 ? 1.850   -15.917 -3.692  1.00 0.00 ? 12 TYR A CD1  4  
ATOM 3701  C CD2  . TYR A 1 11 ? 0.554   -14.621 -2.107  1.00 0.00 ? 12 TYR A CD2  4  
ATOM 3702  C CE1  . TYR A 1 11 ? 0.780   -16.803 -3.846  1.00 0.00 ? 12 TYR A CE1  4  
ATOM 3703  C CE2  . TYR A 1 11 ? -0.518  -15.507 -2.261  1.00 0.00 ? 12 TYR A CE2  4  
ATOM 3704  C CZ   . TYR A 1 11 ? -0.405  -16.599 -3.131  1.00 0.00 ? 12 TYR A CZ   4  
ATOM 3705  O OH   . TYR A 1 11 ? -1.462  -17.474 -3.281  1.00 0.00 ? 12 TYR A OH   4  
ATOM 3706  H H    . TYR A 1 11 ? 4.550   -11.987 -2.940  1.00 0.00 ? 12 TYR A H    4  
ATOM 3707  H HA   . TYR A 1 11 ? 3.899   -14.203 -4.529  1.00 0.00 ? 12 TYR A HA   4  
ATOM 3708  H HB2  . TYR A 1 11 ? 3.711   -14.371 -2.155  1.00 0.00 ? 12 TYR A HB2  4  
ATOM 3709  H HB3  . TYR A 1 11 ? 2.588   -13.016 -2.083  1.00 0.00 ? 12 TYR A HB3  4  
ATOM 3710  H HD1  . TYR A 1 11 ? 2.762   -16.074 -4.244  1.00 0.00 ? 12 TYR A HD1  4  
ATOM 3711  H HD2  . TYR A 1 11 ? 0.468   -13.779 -1.437  1.00 0.00 ? 12 TYR A HD2  4  
ATOM 3712  H HE1  . TYR A 1 11 ? 0.870   -17.646 -4.518  1.00 0.00 ? 12 TYR A HE1  4  
ATOM 3713  H HE2  . TYR A 1 11 ? -1.434  -15.349 -1.709  1.00 0.00 ? 12 TYR A HE2  4  
ATOM 3714  H HH   . TYR A 1 11 ? -1.274  -18.258 -2.757  1.00 0.00 ? 12 TYR A HH   4  
ATOM 3715  N N    . MET A 1 12 ? 1.842   -11.708 -4.820  1.00 0.00 ? 13 MET A N    4  
ATOM 3716  C CA   . MET A 1 12 ? 0.691   -11.213 -5.614  1.00 0.00 ? 13 MET A CA   4  
ATOM 3717  C C    . MET A 1 12 ? 1.112   -11.079 -7.079  1.00 0.00 ? 13 MET A C    4  
ATOM 3718  O O    . MET A 1 12 ? 0.392   -11.471 -7.974  1.00 0.00 ? 13 MET A O    4  
ATOM 3719  C CB   . MET A 1 12 ? 0.258   -9.852  -5.077  1.00 0.00 ? 13 MET A CB   4  
ATOM 3720  C CG   . MET A 1 12 ? -0.615  -10.039 -3.835  1.00 0.00 ? 13 MET A CG   4  
ATOM 3721  S SD   . MET A 1 12 ? -2.350  -9.771  -4.273  1.00 0.00 ? 13 MET A SD   4  
ATOM 3722  C CE   . MET A 1 12 ? -2.698  -11.448 -4.860  1.00 0.00 ? 13 MET A CE   4  
ATOM 3723  H H    . MET A 1 12 ? 2.351   -11.087 -4.260  1.00 0.00 ? 13 MET A H    4  
ATOM 3724  H HA   . MET A 1 12 ? -0.129  -11.912 -5.536  1.00 0.00 ? 13 MET A HA   4  
ATOM 3725  H HB2  . MET A 1 12 ? 1.132   -9.277  -4.819  1.00 0.00 ? 13 MET A HB2  4  
ATOM 3726  H HB3  . MET A 1 12 ? -0.305  -9.333  -5.834  1.00 0.00 ? 13 MET A HB3  4  
ATOM 3727  H HG2  . MET A 1 12 ? -0.490  -11.041 -3.452  1.00 0.00 ? 13 MET A HG2  4  
ATOM 3728  H HG3  . MET A 1 12 ? -0.322  -9.326  -3.078  1.00 0.00 ? 13 MET A HG3  4  
ATOM 3729  H HE1  . MET A 1 12 ? -1.997  -11.708 -5.640  1.00 0.00 ? 13 MET A HE1  4  
ATOM 3730  H HE2  . MET A 1 12 ? -2.598  -12.145 -4.044  1.00 0.00 ? 13 MET A HE2  4  
ATOM 3731  H HE3  . MET A 1 12 ? -3.707  -11.491 -5.245  1.00 0.00 ? 13 MET A HE3  4  
ATOM 3732  N N    . LEU A 1 13 ? 2.273   -10.531 -7.340  1.00 0.00 ? 14 LEU A N    4  
ATOM 3733  C CA   . LEU A 1 13 ? 2.707   -10.393 -8.765  1.00 0.00 ? 14 LEU A CA   4  
ATOM 3734  C C    . LEU A 1 13 ? 2.577   -11.753 -9.442  1.00 0.00 ? 14 LEU A C    4  
ATOM 3735  O O    . LEU A 1 13 ? 1.966   -11.891 -10.483 1.00 0.00 ? 14 LEU A O    4  
ATOM 3736  C CB   . LEU A 1 13 ? 4.167   -9.927  -8.861  1.00 0.00 ? 14 LEU A CB   4  
ATOM 3737  C CG   . LEU A 1 13 ? 4.406   -8.769  -7.889  1.00 0.00 ? 14 LEU A CG   4  
ATOM 3738  C CD1  . LEU A 1 13 ? 5.836   -8.247  -8.040  1.00 0.00 ? 14 LEU A CD1  4  
ATOM 3739  C CD2  . LEU A 1 13 ? 3.423   -7.647  -8.216  1.00 0.00 ? 14 LEU A CD2  4  
ATOM 3740  H H    . LEU A 1 13 ? 2.849   -10.218 -6.607  1.00 0.00 ? 14 LEU A H    4  
ATOM 3741  H HA   . LEU A 1 13 ? 2.067   -9.679  -9.265  1.00 0.00 ? 14 LEU A HA   4  
ATOM 3742  H HB2  . LEU A 1 13 ? 4.838   -10.752 -8.635  1.00 0.00 ? 14 LEU A HB2  4  
ATOM 3743  H HB3  . LEU A 1 13 ? 4.354   -9.584  -9.865  1.00 0.00 ? 14 LEU A HB3  4  
ATOM 3744  H HG   . LEU A 1 13 ? 4.251   -9.104  -6.875  1.00 0.00 ? 14 LEU A HG   4  
ATOM 3745  H HD11 . LEU A 1 13 ? 6.179   -8.423  -9.049  1.00 0.00 ? 14 LEU A HD11 4  
ATOM 3746  H HD12 . LEU A 1 13 ? 5.859   -7.183  -7.831  1.00 0.00 ? 14 LEU A HD12 4  
ATOM 3747  H HD13 . LEU A 1 13 ? 6.481   -8.763  -7.345  1.00 0.00 ? 14 LEU A HD13 4  
ATOM 3748  H HD21 . LEU A 1 13 ? 3.231   -7.636  -9.279  1.00 0.00 ? 14 LEU A HD21 4  
ATOM 3749  H HD22 . LEU A 1 13 ? 2.496   -7.814  -7.687  1.00 0.00 ? 14 LEU A HD22 4  
ATOM 3750  H HD23 . LEU A 1 13 ? 3.844   -6.699  -7.916  1.00 0.00 ? 14 LEU A HD23 4  
ATOM 3751  N N    . TRP A 1 14 ? 3.147   -12.763 -8.848  1.00 0.00 ? 15 TRP A N    4  
ATOM 3752  C CA   . TRP A 1 14 ? 3.060   -14.124 -9.436  1.00 0.00 ? 15 TRP A CA   4  
ATOM 3753  C C    . TRP A 1 14 ? 1.595   -14.563 -9.450  1.00 0.00 ? 15 TRP A C    4  
ATOM 3754  O O    . TRP A 1 14 ? 1.143   -15.234 -10.355 1.00 0.00 ? 15 TRP A O    4  
ATOM 3755  C CB   . TRP A 1 14 ? 3.886   -15.087 -8.583  1.00 0.00 ? 15 TRP A CB   4  
ATOM 3756  C CG   . TRP A 1 14 ? 3.669   -16.486 -9.050  1.00 0.00 ? 15 TRP A CG   4  
ATOM 3757  C CD1  . TRP A 1 14 ? 4.415   -17.118 -9.983  1.00 0.00 ? 15 TRP A CD1  4  
ATOM 3758  C CD2  . TRP A 1 14 ? 2.657   -17.435 -8.619  1.00 0.00 ? 15 TRP A CD2  4  
ATOM 3759  N NE1  . TRP A 1 14 ? 3.928   -18.402 -10.148 1.00 0.00 ? 15 TRP A NE1  4  
ATOM 3760  C CE2  . TRP A 1 14 ? 2.842   -18.643 -9.331  1.00 0.00 ? 15 TRP A CE2  4  
ATOM 3761  C CE3  . TRP A 1 14 ? 1.605   -17.366 -7.689  1.00 0.00 ? 15 TRP A CE3  4  
ATOM 3762  C CZ2  . TRP A 1 14 ? 2.015   -19.745 -9.126  1.00 0.00 ? 15 TRP A CZ2  4  
ATOM 3763  C CZ3  . TRP A 1 14 ? 0.769   -18.472 -7.481  1.00 0.00 ? 15 TRP A CZ3  4  
ATOM 3764  C CH2  . TRP A 1 14 ? 0.972   -19.660 -8.199  1.00 0.00 ? 15 TRP A CH2  4  
ATOM 3765  H H    . TRP A 1 14 ? 3.629   -12.624 -8.005  1.00 0.00 ? 15 TRP A H    4  
ATOM 3766  H HA   . TRP A 1 14 ? 3.445   -14.110 -10.445 1.00 0.00 ? 15 TRP A HA   4  
ATOM 3767  H HB2  . TRP A 1 14 ? 4.933   -14.836 -8.671  1.00 0.00 ? 15 TRP A HB2  4  
ATOM 3768  H HB3  . TRP A 1 14 ? 3.582   -15.003 -7.549  1.00 0.00 ? 15 TRP A HB3  4  
ATOM 3769  H HD1  . TRP A 1 14 ? 5.257   -16.692 -10.511 1.00 0.00 ? 15 TRP A HD1  4  
ATOM 3770  H HE1  . TRP A 1 14 ? 4.293   -19.071 -10.764 1.00 0.00 ? 15 TRP A HE1  4  
ATOM 3771  H HE3  . TRP A 1 14 ? 1.441   -16.455 -7.132  1.00 0.00 ? 15 TRP A HE3  4  
ATOM 3772  H HZ2  . TRP A 1 14 ? 2.178   -20.656 -9.680  1.00 0.00 ? 15 TRP A HZ2  4  
ATOM 3773  H HZ3  . TRP A 1 14 ? -0.038  -18.407 -6.765  1.00 0.00 ? 15 TRP A HZ3  4  
ATOM 3774  H HH2  . TRP A 1 14 ? 0.325   -20.509 -8.035  1.00 0.00 ? 15 TRP A HH2  4  
ATOM 3775  N N    . LEU A 1 15 ? 0.848   -14.174 -8.452  1.00 0.00 ? 16 LEU A N    4  
ATOM 3776  C CA   . LEU A 1 15 ? -0.592  -14.549 -8.398  1.00 0.00 ? 16 LEU A CA   4  
ATOM 3777  C C    . LEU A 1 15 ? -1.306  -13.990 -9.631  1.00 0.00 ? 16 LEU A C    4  
ATOM 3778  O O    . LEU A 1 15 ? -2.277  -14.548 -10.103 1.00 0.00 ? 16 LEU A O    4  
ATOM 3779  C CB   . LEU A 1 15 ? -1.218  -13.954 -7.133  1.00 0.00 ? 16 LEU A CB   4  
ATOM 3780  C CG   . LEU A 1 15 ? -2.044  -15.020 -6.411  1.00 0.00 ? 16 LEU A CG   4  
ATOM 3781  C CD1  . LEU A 1 15 ? -3.266  -15.386 -7.254  1.00 0.00 ? 16 LEU A CD1  4  
ATOM 3782  C CD2  . LEU A 1 15 ? -1.183  -16.266 -6.194  1.00 0.00 ? 16 LEU A CD2  4  
ATOM 3783  H H    . LEU A 1 15 ? 1.235   -13.630 -7.737  1.00 0.00 ? 16 LEU A H    4  
ATOM 3784  H HA   . LEU A 1 15 ? -0.686  -15.624 -8.380  1.00 0.00 ? 16 LEU A HA   4  
ATOM 3785  H HB2  . LEU A 1 15 ? -0.434  -13.602 -6.478  1.00 0.00 ? 16 LEU A HB2  4  
ATOM 3786  H HB3  . LEU A 1 15 ? -1.858  -13.127 -7.403  1.00 0.00 ? 16 LEU A HB3  4  
ATOM 3787  H HG   . LEU A 1 15 ? -2.369  -14.634 -5.455  1.00 0.00 ? 16 LEU A HG   4  
ATOM 3788  H HD11 . LEU A 1 15 ? -2.981  -15.455 -8.294  1.00 0.00 ? 16 LEU A HD11 4  
ATOM 3789  H HD12 . LEU A 1 15 ? -3.659  -16.337 -6.925  1.00 0.00 ? 16 LEU A HD12 4  
ATOM 3790  H HD13 . LEU A 1 15 ? -4.025  -14.626 -7.139  1.00 0.00 ? 16 LEU A HD13 4  
ATOM 3791  H HD21 . LEU A 1 15 ? -0.143  -15.978 -6.137  1.00 0.00 ? 16 LEU A HD21 4  
ATOM 3792  H HD22 . LEU A 1 15 ? -1.474  -16.750 -5.274  1.00 0.00 ? 16 LEU A HD22 4  
ATOM 3793  H HD23 . LEU A 1 15 ? -1.323  -16.948 -7.020  1.00 0.00 ? 16 LEU A HD23 4  
ATOM 3794  N N    . ASN A 1 16 ? -0.833  -12.892 -10.157 1.00 0.00 ? 17 ASN A N    4  
ATOM 3795  C CA   . ASN A 1 16 ? -1.481  -12.297 -11.356 1.00 0.00 ? 17 ASN A CA   4  
ATOM 3796  C C    . ASN A 1 16 ? -0.969  -12.995 -12.616 1.00 0.00 ? 17 ASN A C    4  
ATOM 3797  O O    . ASN A 1 16 ? -1.673  -13.120 -13.599 1.00 0.00 ? 17 ASN A O    4  
ATOM 3798  C CB   . ASN A 1 16 ? -1.147  -10.818 -11.426 1.00 0.00 ? 17 ASN A CB   4  
ATOM 3799  C CG   . ASN A 1 16 ? -1.216  -10.206 -10.026 1.00 0.00 ? 17 ASN A CG   4  
ATOM 3800  O OD1  . ASN A 1 16 ? -2.152  -10.446 -9.291  1.00 0.00 ? 17 ASN A OD1  4  
ATOM 3801  N ND2  . ASN A 1 16 ? -0.255  -9.420  -9.624  1.00 0.00 ? 17 ASN A ND2  4  
ATOM 3802  H H    . ASN A 1 16 ? -0.049  -12.456 -9.764  1.00 0.00 ? 17 ASN A H    4  
ATOM 3803  H HA   . ASN A 1 16 ? -2.548  -12.410 -11.289 1.00 0.00 ? 17 ASN A HA   4  
ATOM 3804  H HB2  . ASN A 1 16 ? -0.155  -10.693 -11.828 1.00 0.00 ? 17 ASN A HB2  4  
ATOM 3805  H HB3  . ASN A 1 16 ? -1.865  -10.333 -12.064 1.00 0.00 ? 17 ASN A HB3  4  
ATOM 3806  H HD21 . ASN A 1 16 ? 0.500   -9.225  -10.217 1.00 0.00 ? 17 ASN A HD21 4  
ATOM 3807  H HD22 . ASN A 1 16 ? -0.290  -9.022  -8.728  1.00 0.00 ? 17 ASN A HD22 4  
ATOM 3808  N N    . SER A 1 17 ? 0.253   -13.451 -12.596 1.00 0.00 ? 18 SER A N    4  
ATOM 3809  C CA   . SER A 1 17 ? 0.813   -14.139 -13.793 1.00 0.00 ? 18 SER A CA   4  
ATOM 3810  C C    . SER A 1 17 ? 0.319   -15.587 -13.837 1.00 0.00 ? 18 SER A C    4  
ATOM 3811  O O    . SER A 1 17 ? 0.596   -16.319 -14.768 1.00 0.00 ? 18 SER A O    4  
ATOM 3812  C CB   . SER A 1 17 ? 2.332   -14.120 -13.721 1.00 0.00 ? 18 SER A CB   4  
ATOM 3813  O OG   . SER A 1 17 ? 2.775   -15.103 -12.795 1.00 0.00 ? 18 SER A OG   4  
ATOM 3814  H H    . SER A 1 17 ? 0.804   -13.339 -11.792 1.00 0.00 ? 18 SER A H    4  
ATOM 3815  H HA   . SER A 1 17 ? 0.497   -13.624 -14.684 1.00 0.00 ? 18 SER A HA   4  
ATOM 3816  H HB2  . SER A 1 17 ? 2.737   -14.337 -14.693 1.00 0.00 ? 18 SER A HB2  4  
ATOM 3817  H HB3  . SER A 1 17 ? 2.662   -13.139 -13.407 1.00 0.00 ? 18 SER A HB3  4  
ATOM 3818  H HG   . SER A 1 17 ? 2.528   -15.965 -13.139 1.00 0.00 ? 18 SER A HG   4  
ATOM 3819  N N    . ALA A 1 18 ? -0.413  -16.007 -12.843 1.00 0.00 ? 19 ALA A N    4  
ATOM 3820  C CA   . ALA A 1 18 ? -0.927  -17.405 -12.835 1.00 0.00 ? 19 ALA A CA   4  
ATOM 3821  C C    . ALA A 1 18 ? -2.445  -17.387 -12.663 1.00 0.00 ? 19 ALA A C    4  
ATOM 3822  O O    . ALA A 1 18 ? -3.093  -18.411 -12.707 1.00 0.00 ? 19 ALA A O    4  
ATOM 3823  C CB   . ALA A 1 18 ? -0.300  -18.177 -11.675 1.00 0.00 ? 19 ALA A CB   4  
ATOM 3824  H H    . ALA A 1 18 ? -0.630  -15.402 -12.103 1.00 0.00 ? 19 ALA A H    4  
ATOM 3825  H HA   . ALA A 1 18 ? -0.674  -17.888 -13.769 1.00 0.00 ? 19 ALA A HA   4  
ATOM 3826  H HB1  . ALA A 1 18 ? 0.503   -17.596 -11.247 1.00 0.00 ? 19 ALA A HB1  4  
ATOM 3827  H HB2  . ALA A 1 18 ? -1.052  -18.364 -10.922 1.00 0.00 ? 19 ALA A HB2  4  
ATOM 3828  H HB3  . ALA A 1 18 ? 0.089   -19.117 -12.037 1.00 0.00 ? 19 ALA A HB3  4  
ATOM 3829  N N    . ARG A 1 19 ? -3.016  -16.231 -12.462 1.00 0.00 ? 20 ARG A N    4  
ATOM 3830  C CA   . ARG A 1 19 ? -4.492  -16.150 -12.281 1.00 0.00 ? 20 ARG A CA   4  
ATOM 3831  C C    . ARG A 1 19 ? -5.194  -16.704 -13.520 1.00 0.00 ? 20 ARG A C    4  
ATOM 3832  O O    . ARG A 1 19 ? -6.367  -17.020 -13.489 1.00 0.00 ? 20 ARG A O    4  
ATOM 3833  C CB   . ARG A 1 19 ? -4.896  -14.690 -12.069 1.00 0.00 ? 20 ARG A CB   4  
ATOM 3834  C CG   . ARG A 1 19 ? -5.978  -14.611 -10.991 1.00 0.00 ? 20 ARG A CG   4  
ATOM 3835  C CD   . ARG A 1 19 ? -7.204  -13.891 -11.555 1.00 0.00 ? 20 ARG A CD   4  
ATOM 3836  N NE   . ARG A 1 19 ? -8.438  -14.621 -11.150 1.00 0.00 ? 20 ARG A NE   4  
ATOM 3837  C CZ   . ARG A 1 19 ? -9.413  -14.770 -12.004 1.00 0.00 ? 20 ARG A CZ   4  
ATOM 3838  N NH1  . ARG A 1 19 ? -9.889  -13.735 -12.638 1.00 0.00 ? 20 ARG A NH1  4  
ATOM 3839  N NH2  . ARG A 1 19 ? -9.911  -15.956 -12.225 1.00 0.00 ? 20 ARG A NH2  4  
ATOM 3840  H H    . ARG A 1 19 ? -2.474  -15.416 -12.426 1.00 0.00 ? 20 ARG A H    4  
ATOM 3841  H HA   . ARG A 1 19 ? -4.780  -16.733 -11.419 1.00 0.00 ? 20 ARG A HA   4  
ATOM 3842  H HB2  . ARG A 1 19 ? -4.034  -14.120 -11.759 1.00 0.00 ? 20 ARG A HB2  4  
ATOM 3843  H HB3  . ARG A 1 19 ? -5.281  -14.286 -12.994 1.00 0.00 ? 20 ARG A HB3  4  
ATOM 3844  H HG2  . ARG A 1 19 ? -6.253  -15.609 -10.683 1.00 0.00 ? 20 ARG A HG2  4  
ATOM 3845  H HG3  . ARG A 1 19 ? -5.600  -14.062 -10.141 1.00 0.00 ? 20 ARG A HG3  4  
ATOM 3846  H HD2  . ARG A 1 19 ? -7.239  -12.883 -11.170 1.00 0.00 ? 20 ARG A HD2  4  
ATOM 3847  H HD3  . ARG A 1 19 ? -7.140  -13.863 -12.633 1.00 0.00 ? 20 ARG A HD3  4  
ATOM 3848  H HE   . ARG A 1 19 ? -8.519  -14.983 -10.244 1.00 0.00 ? 20 ARG A HE   4  
ATOM 3849  H HH11 . ARG A 1 19 ? -9.506  -12.826 -12.469 1.00 0.00 ? 20 ARG A HH11 4  
ATOM 3850  H HH12 . ARG A 1 19 ? -10.635 -13.848 -13.292 1.00 0.00 ? 20 ARG A HH12 4  
ATOM 3851  H HH21 . ARG A 1 19 ? -9.545  -16.752 -11.740 1.00 0.00 ? 20 ARG A HH21 4  
ATOM 3852  H HH22 . ARG A 1 19 ? -10.657 -16.071 -12.881 1.00 0.00 ? 20 ARG A HH22 4  
ATOM 3853  N N    . GLU A 1 20 ? -4.489  -16.828 -14.609 1.00 0.00 ? 21 GLU A N    4  
ATOM 3854  C CA   . GLU A 1 20 ? -5.124  -17.367 -15.842 1.00 0.00 ? 21 GLU A CA   4  
ATOM 3855  C C    . GLU A 1 20 ? -5.190  -18.889 -15.748 1.00 0.00 ? 21 GLU A C    4  
ATOM 3856  O O    . GLU A 1 20 ? -6.254  -19.473 -15.704 1.00 0.00 ? 21 GLU A O    4  
ATOM 3857  C CB   . GLU A 1 20 ? -4.296  -16.963 -17.066 1.00 0.00 ? 21 GLU A CB   4  
ATOM 3858  C CG   . GLU A 1 20 ? -5.168  -17.040 -18.319 1.00 0.00 ? 21 GLU A CG   4  
ATOM 3859  C CD   . GLU A 1 20 ? -4.909  -15.814 -19.196 1.00 0.00 ? 21 GLU A CD   4  
ATOM 3860  O OE1  . GLU A 1 20 ? -4.661  -14.756 -18.641 1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3861  O OE2  . GLU A 1 20 ? -4.964  -15.953 -20.407 1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3862  H H    . GLU A 1 20 ? -3.545  -16.570 -14.615 1.00 0.00 ? 21 GLU A H    4  
ATOM 3863  H HA   . GLU A 1 20 ? -6.120  -16.972 -15.934 1.00 0.00 ? 21 GLU A HA   4  
ATOM 3864  H HB2  . GLU A 1 20 ? -3.936  -15.951 -16.938 1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3865  H HB3  . GLU A 1 20 ? -3.456  -17.634 -17.171 1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3866  H HG2  . GLU A 1 20 ? -4.925  -17.937 -18.872 1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3867  H HG3  . GLU A 1 20 ? -6.208  -17.063 -18.034 1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3868  N N    . SER A 1 21 ? -4.061  -19.534 -15.706 1.00 0.00 ? 22 SER A N    4  
ATOM 3869  C CA   . SER A 1 21 ? -4.058  -21.019 -15.603 1.00 0.00 ? 22 SER A CA   4  
ATOM 3870  C C    . SER A 1 21 ? -4.639  -21.429 -14.251 1.00 0.00 ? 22 SER A C    4  
ATOM 3871  O O    . SER A 1 21 ? -4.932  -22.585 -14.014 1.00 0.00 ? 22 SER A O    4  
ATOM 3872  C CB   . SER A 1 21 ? -2.624  -21.537 -15.727 1.00 0.00 ? 22 SER A CB   4  
ATOM 3873  O OG   . SER A 1 21 ? -1.745  -20.653 -15.043 1.00 0.00 ? 22 SER A OG   4  
ATOM 3874  H H    . SER A 1 21 ? -3.217  -19.041 -15.736 1.00 0.00 ? 22 SER A H    4  
ATOM 3875  H HA   . SER A 1 21 ? -4.665  -21.435 -16.395 1.00 0.00 ? 22 SER A HA   4  
ATOM 3876  H HB2  . SER A 1 21 ? -2.555  -22.517 -15.286 1.00 0.00 ? 22 SER A HB2  4  
ATOM 3877  H HB3  . SER A 1 21 ? -2.353  -21.595 -16.772 1.00 0.00 ? 22 SER A HB3  4  
ATOM 3878  H HG   . SER A 1 21 ? -1.477  -21.078 -14.224 1.00 0.00 ? 22 SER A HG   4  
ATOM 3879  N N    . ILE A 1 22 ? -4.820  -20.490 -13.364 1.00 0.00 ? 23 ILE A N    4  
ATOM 3880  C CA   . ILE A 1 22 ? -5.392  -20.825 -12.034 1.00 0.00 ? 23 ILE A CA   4  
ATOM 3881  C C    . ILE A 1 22 ? -6.916  -20.774 -12.133 1.00 0.00 ? 23 ILE A C    4  
ATOM 3882  O O    . ILE A 1 22 ? -7.613  -21.620 -11.609 1.00 0.00 ? 23 ILE A O    4  
ATOM 3883  C CB   . ILE A 1 22 ? -4.887  -19.809 -10.995 1.00 0.00 ? 23 ILE A CB   4  
ATOM 3884  C CG1  . ILE A 1 22 ? -3.578  -20.321 -10.394 1.00 0.00 ? 23 ILE A CG1  4  
ATOM 3885  C CG2  . ILE A 1 22 ? -5.916  -19.622 -9.870  1.00 0.00 ? 23 ILE A CG2  4  
ATOM 3886  C CD1  . ILE A 1 22 ? -2.953  -19.234 -9.520  1.00 0.00 ? 23 ILE A CD1  4  
ATOM 3887  H H    . ILE A 1 22 ? -4.585  -19.561 -13.576 1.00 0.00 ? 23 ILE A H    4  
ATOM 3888  H HA   . ILE A 1 22 ? -5.082  -21.819 -11.747 1.00 0.00 ? 23 ILE A HA   4  
ATOM 3889  H HB   . ILE A 1 22 ? -4.714  -18.859 -11.478 1.00 0.00 ? 23 ILE A HB   4  
ATOM 3890  H HG12 . ILE A 1 22 ? -3.778  -21.197 -9.793  1.00 0.00 ? 23 ILE A HG12 4  
ATOM 3891  H HG13 . ILE A 1 22 ? -2.895  -20.579 -11.190 1.00 0.00 ? 23 ILE A HG13 4  
ATOM 3892  H HG21 . ILE A 1 22 ? -6.873  -19.350 -10.297 1.00 0.00 ? 23 ILE A HG21 4  
ATOM 3893  H HG22 . ILE A 1 22 ? -6.017  -20.545 -9.318  1.00 0.00 ? 23 ILE A HG22 4  
ATOM 3894  H HG23 . ILE A 1 22 ? -5.582  -18.840 -9.205  1.00 0.00 ? 23 ILE A HG23 4  
ATOM 3895  H HD11 . ILE A 1 22 ? -3.248  -18.263 -9.888  1.00 0.00 ? 23 ILE A HD11 4  
ATOM 3896  H HD12 . ILE A 1 22 ? -3.292  -19.352 -8.502  1.00 0.00 ? 23 ILE A HD12 4  
ATOM 3897  H HD13 . ILE A 1 22 ? -1.878  -19.321 -9.554  1.00 0.00 ? 23 ILE A HD13 4  
ATOM 3898  N N    . LYS A 1 23 ? -7.437  -19.777 -12.791 1.00 0.00 ? 24 LYS A N    4  
ATOM 3899  C CA   . LYS A 1 23 ? -8.906  -19.656 -12.913 1.00 0.00 ? 24 LYS A CA   4  
ATOM 3900  C C    . LYS A 1 23 ? -9.470  -20.824 -13.736 1.00 0.00 ? 24 LYS A C    4  
ATOM 3901  O O    . LYS A 1 23 ? -10.583 -21.264 -13.521 1.00 0.00 ? 24 LYS A O    4  
ATOM 3902  C CB   . LYS A 1 23 ? -9.218  -18.320 -13.586 1.00 0.00 ? 24 LYS A CB   4  
ATOM 3903  C CG   . LYS A 1 23 ? -9.210  -18.486 -15.104 1.00 0.00 ? 24 LYS A CG   4  
ATOM 3904  C CD   . LYS A 1 23 ? -9.151  -17.110 -15.771 1.00 0.00 ? 24 LYS A CD   4  
ATOM 3905  C CE   . LYS A 1 23 ? -10.505 -16.790 -16.408 1.00 0.00 ? 24 LYS A CE   4  
ATOM 3906  N NZ   . LYS A 1 23 ? -10.347 -16.681 -17.885 1.00 0.00 ? 24 LYS A NZ   4  
ATOM 3907  H H    . LYS A 1 23 ? -6.861  -19.096 -13.199 1.00 0.00 ? 24 LYS A H    4  
ATOM 3908  H HA   . LYS A 1 23 ? -9.343  -19.668 -11.931 1.00 0.00 ? 24 LYS A HA   4  
ATOM 3909  H HB2  . LYS A 1 23 ? -10.186 -17.967 -13.263 1.00 0.00 ? 24 LYS A HB2  4  
ATOM 3910  H HB3  . LYS A 1 23 ? -8.458  -17.605 -13.306 1.00 0.00 ? 24 LYS A HB3  4  
ATOM 3911  H HG2  . LYS A 1 23 ? -8.349  -19.067 -15.391 1.00 0.00 ? 24 LYS A HG2  4  
ATOM 3912  H HG3  . LYS A 1 23 ? -10.109 -18.998 -15.410 1.00 0.00 ? 24 LYS A HG3  4  
ATOM 3913  H HD2  . LYS A 1 23 ? -8.915  -16.362 -15.028 1.00 0.00 ? 24 LYS A HD2  4  
ATOM 3914  H HD3  . LYS A 1 23 ? -8.387  -17.113 -16.534 1.00 0.00 ? 24 LYS A HD3  4  
ATOM 3915  H HE2  . LYS A 1 23 ? -11.206 -17.580 -16.179 1.00 0.00 ? 24 LYS A HE2  4  
ATOM 3916  H HE3  . LYS A 1 23 ? -10.875 -15.855 -16.014 1.00 0.00 ? 24 LYS A HE3  4  
ATOM 3917  H HZ1  . LYS A 1 23 ? -9.824  -17.509 -18.239 1.00 0.00 ? 24 LYS A HZ1  4  
ATOM 3918  H HZ2  . LYS A 1 23 ? -11.284 -16.644 -18.332 1.00 0.00 ? 24 LYS A HZ2  4  
ATOM 3919  H HZ3  . LYS A 1 23 ? -9.822  -15.815 -18.115 1.00 0.00 ? 24 LYS A HZ3  4  
ATOM 3920  N N    . ARG A 1 24 ? -8.721  -21.318 -14.686 1.00 0.00 ? 25 ARG A N    4  
ATOM 3921  C CA   . ARG A 1 24 ? -9.230  -22.441 -15.523 1.00 0.00 ? 25 ARG A CA   4  
ATOM 3922  C C    . ARG A 1 24 ? -9.068  -23.768 -14.775 1.00 0.00 ? 25 ARG A C    4  
ATOM 3923  O O    . ARG A 1 24 ? -10.037 -24.406 -14.411 1.00 0.00 ? 25 ARG A O    4  
ATOM 3924  C CB   . ARG A 1 24 ? -8.444  -22.493 -16.835 1.00 0.00 ? 25 ARG A CB   4  
ATOM 3925  C CG   . ARG A 1 24 ? -9.222  -21.743 -17.920 1.00 0.00 ? 25 ARG A CG   4  
ATOM 3926  C CD   . ARG A 1 24 ? -8.284  -21.350 -19.049 1.00 0.00 ? 25 ARG A CD   4  
ATOM 3927  N NE   . ARG A 1 24 ? -7.018  -20.806 -18.483 1.00 0.00 ? 25 ARG A NE   4  
ATOM 3928  C CZ   . ARG A 1 24 ? -5.922  -20.835 -19.192 1.00 0.00 ? 25 ARG A CZ   4  
ATOM 3929  N NH1  . ARG A 1 24 ? -5.701  -19.916 -20.090 1.00 0.00 ? 25 ARG A NH1  4  
ATOM 3930  N NH2  . ARG A 1 24 ? -5.047  -21.785 -19.003 1.00 0.00 ? 25 ARG A NH2  4  
ATOM 3931  H H    . ARG A 1 24 ? -7.829  -20.945 -14.857 1.00 0.00 ? 25 ARG A H    4  
ATOM 3932  H HA   . ARG A 1 24 ? -10.274 -22.277 -15.739 1.00 0.00 ? 25 ARG A HA   4  
ATOM 3933  H HB2  . ARG A 1 24 ? -7.478  -22.028 -16.697 1.00 0.00 ? 25 ARG A HB2  4  
ATOM 3934  H HB3  . ARG A 1 24 ? -8.310  -23.521 -17.136 1.00 0.00 ? 25 ARG A HB3  4  
ATOM 3935  H HG2  . ARG A 1 24 ? -9.997  -22.381 -18.311 1.00 0.00 ? 25 ARG A HG2  4  
ATOM 3936  H HG3  . ARG A 1 24 ? -9.663  -20.854 -17.500 1.00 0.00 ? 25 ARG A HG3  4  
ATOM 3937  H HD2  . ARG A 1 24 ? -8.069  -22.219 -19.651 1.00 0.00 ? 25 ARG A HD2  4  
ATOM 3938  H HD3  . ARG A 1 24 ? -8.760  -20.599 -19.656 1.00 0.00 ? 25 ARG A HD3  4  
ATOM 3939  H HE   . ARG A 1 24 ? -7.008  -20.424 -17.581 1.00 0.00 ? 25 ARG A HE   4  
ATOM 3940  H HH11 . ARG A 1 24 ? -6.371  -19.189 -20.236 1.00 0.00 ? 25 ARG A HH11 4  
ATOM 3941  H HH12 . ARG A 1 24 ? -4.862  -19.939 -20.633 1.00 0.00 ? 25 ARG A HH12 4  
ATOM 3942  H HH21 . ARG A 1 24 ? -5.216  -22.491 -18.315 1.00 0.00 ? 25 ARG A HH21 4  
ATOM 3943  H HH22 . ARG A 1 24 ? -4.208  -21.806 -19.546 1.00 0.00 ? 25 ARG A HH22 4  
ATOM 3944  N N    . GLU A 1 25 ? -7.854  -24.191 -14.548 1.00 0.00 ? 26 GLU A N    4  
ATOM 3945  C CA   . GLU A 1 25 ? -7.633  -25.480 -13.830 1.00 0.00 ? 26 GLU A CA   4  
ATOM 3946  C C    . GLU A 1 25 ? -8.575  -25.576 -12.625 1.00 0.00 ? 26 GLU A C    4  
ATOM 3947  O O    . GLU A 1 25 ? -8.911  -26.653 -12.176 1.00 0.00 ? 26 GLU A O    4  
ATOM 3948  C CB   . GLU A 1 25 ? -6.184  -25.551 -13.343 1.00 0.00 ? 26 GLU A CB   4  
ATOM 3949  C CG   . GLU A 1 25 ? -5.291  -26.089 -14.462 1.00 0.00 ? 26 GLU A CG   4  
ATOM 3950  C CD   . GLU A 1 25 ? -3.941  -26.507 -13.880 1.00 0.00 ? 26 GLU A CD   4  
ATOM 3951  O OE1  . GLU A 1 25 ? -3.846  -26.605 -12.667 1.00 0.00 ? 26 GLU A OE1  4  
ATOM 3952  O OE2  . GLU A 1 25 ? -3.024  -26.722 -14.655 1.00 0.00 ? 26 GLU A OE2  4  
ATOM 3953  H H    . GLU A 1 25 ? -7.086  -23.664 -14.855 1.00 0.00 ? 26 GLU A H    4  
ATOM 3954  H HA   . GLU A 1 25 ? -7.825  -26.304 -14.501 1.00 0.00 ? 26 GLU A HA   4  
ATOM 3955  H HB2  . GLU A 1 25 ? -5.852  -24.562 -13.059 1.00 0.00 ? 26 GLU A HB2  4  
ATOM 3956  H HB3  . GLU A 1 25 ? -6.122  -26.210 -12.489 1.00 0.00 ? 26 GLU A HB3  4  
ATOM 3957  H HG2  . GLU A 1 25 ? -5.766  -26.942 -14.924 1.00 0.00 ? 26 GLU A HG2  4  
ATOM 3958  H HG3  . GLU A 1 25 ? -5.138  -25.318 -15.203 1.00 0.00 ? 26 GLU A HG3  4  
ATOM 3959  N N    . ASN A 1 26 ? -8.994  -24.462 -12.092 1.00 0.00 ? 27 ASN A N    4  
ATOM 3960  C CA   . ASN A 1 26 ? -9.904  -24.499 -10.910 1.00 0.00 ? 27 ASN A CA   4  
ATOM 3961  C C    . ASN A 1 26 ? -11.360 -24.381 -11.366 1.00 0.00 ? 27 ASN A C    4  
ATOM 3962  O O    . ASN A 1 26 ? -11.647 -23.784 -12.384 1.00 0.00 ? 27 ASN A O    4  
ATOM 3963  C CB   . ASN A 1 26 ? -9.566  -23.339 -9.973  1.00 0.00 ? 27 ASN A CB   4  
ATOM 3964  C CG   . ASN A 1 26 ? -8.103  -23.447 -9.541  1.00 0.00 ? 27 ASN A CG   4  
ATOM 3965  O OD1  . ASN A 1 26 ? -7.567  -24.532 -9.438  1.00 0.00 ? 27 ASN A OD1  4  
ATOM 3966  N ND2  . ASN A 1 26 ? -7.431  -22.360 -9.280  1.00 0.00 ? 27 ASN A ND2  4  
ATOM 3967  H H    . ASN A 1 26 ? -8.707  -23.602 -12.463 1.00 0.00 ? 27 ASN A H    4  
ATOM 3968  H HA   . ASN A 1 26 ? -9.774  -25.433 -10.383 1.00 0.00 ? 27 ASN A HA   4  
ATOM 3969  H HB2  . ASN A 1 26 ? -9.723  -22.402 -10.490 1.00 0.00 ? 27 ASN A HB2  4  
ATOM 3970  H HB3  . ASN A 1 26 ? -10.203 -23.382 -9.103  1.00 0.00 ? 27 ASN A HB3  4  
ATOM 3971  H HD21 . ASN A 1 26 ? -7.863  -21.485 -9.362  1.00 0.00 ? 27 ASN A HD21 4  
ATOM 3972  H HD22 . ASN A 1 26 ? -6.493  -22.419 -9.004  1.00 0.00 ? 27 ASN A HD22 4  
ATOM 3973  N N    . PRO A 1 27 ? -12.236 -24.958 -10.582 1.00 0.00 ? 28 PRO A N    4  
ATOM 3974  C CA   . PRO A 1 27 ? -13.681 -24.948 -10.852 1.00 0.00 ? 28 PRO A CA   4  
ATOM 3975  C C    . PRO A 1 27 ? -14.290 -23.596 -10.493 1.00 0.00 ? 28 PRO A C    4  
ATOM 3976  O O    . PRO A 1 27 ? -14.980 -23.469 -9.500  1.00 0.00 ? 28 PRO A O    4  
ATOM 3977  C CB   . PRO A 1 27 ? -14.229 -26.037 -9.947  1.00 0.00 ? 28 PRO A CB   4  
ATOM 3978  C CG   . PRO A 1 27 ? -13.196 -26.229 -8.830  1.00 0.00 ? 28 PRO A CG   4  
ATOM 3979  C CD   . PRO A 1 27 ? -11.863 -25.673 -9.350  1.00 0.00 ? 28 PRO A CD   4  
ATOM 3980  H HA   . PRO A 1 27 ? -13.873 -25.203 -11.864 1.00 0.00 ? 28 PRO A HA   4  
ATOM 3981  H HB2  . PRO A 1 27 ? -15.173 -25.723 -9.525  1.00 0.00 ? 28 PRO A HB2  4  
ATOM 3982  H HB3  . PRO A 1 27 ? -14.346 -26.957 -10.495 1.00 0.00 ? 28 PRO A HB3  4  
ATOM 3983  H HG2  . PRO A 1 27 ? -13.508 -25.688 -7.957  1.00 0.00 ? 28 PRO A HG2  4  
ATOM 3984  H HG3  . PRO A 1 27 ? -13.093 -27.274 -8.613  1.00 0.00 ? 28 PRO A HG3  4  
ATOM 3985  H HD2  . PRO A 1 27 ? -11.429 -24.994 -8.629  1.00 0.00 ? 28 PRO A HD2  4  
ATOM 3986  H HD3  . PRO A 1 27 ? -11.179 -26.476 -9.578  1.00 0.00 ? 28 PRO A HD3  4  
ATOM 3987  N N    . GLY A 1 28 ? -14.039 -22.581 -11.277 1.00 0.00 ? 29 GLY A N    4  
ATOM 3988  C CA   . GLY A 1 28 ? -14.603 -21.242 -10.947 1.00 0.00 ? 29 GLY A CA   4  
ATOM 3989  C C    . GLY A 1 28 ? -14.398 -20.994 -9.455  1.00 0.00 ? 29 GLY A C    4  
ATOM 3990  O O    . GLY A 1 28 ? -15.158 -20.295 -8.814  1.00 0.00 ? 29 GLY A O    4  
ATOM 3991  H H    . GLY A 1 28 ? -13.475 -22.698 -12.069 1.00 0.00 ? 29 GLY A H    4  
ATOM 3992  H HA2  . GLY A 1 28 ? -14.093 -20.481 -11.521 1.00 0.00 ? 29 GLY A HA2  4  
ATOM 3993  H HA3  . GLY A 1 28 ? -15.658 -21.224 -11.172 1.00 0.00 ? 29 GLY A HA3  4  
ATOM 3994  N N    . ILE A 1 29 ? -13.373 -21.589 -8.901  1.00 0.00 ? 30 ILE A N    4  
ATOM 3995  C CA   . ILE A 1 29 ? -13.089 -21.433 -7.454  1.00 0.00 ? 30 ILE A CA   4  
ATOM 3996  C C    . ILE A 1 29 ? -13.382 -20.001 -7.001  1.00 0.00 ? 30 ILE A C    4  
ATOM 3997  O O    . ILE A 1 29 ? -13.258 -19.060 -7.759  1.00 0.00 ? 30 ILE A O    4  
ATOM 3998  C CB   . ILE A 1 29 ? -11.626 -21.763 -7.218  1.00 0.00 ? 30 ILE A CB   4  
ATOM 3999  C CG1  . ILE A 1 29 ? -11.301 -21.674 -5.725  1.00 0.00 ? 30 ILE A CG1  4  
ATOM 4000  C CG2  . ILE A 1 29 ? -10.784 -20.766 -7.984  1.00 0.00 ? 30 ILE A CG2  4  
ATOM 4001  C CD1  . ILE A 1 29 ? -9.879  -22.185 -5.489  1.00 0.00 ? 30 ILE A CD1  4  
ATOM 4002  H H    . ILE A 1 29 ? -12.787 -22.154 -9.445  1.00 0.00 ? 30 ILE A H    4  
ATOM 4003  H HA   . ILE A 1 29 ? -13.693 -22.116 -6.904  1.00 0.00 ? 30 ILE A HA   4  
ATOM 4004  H HB   . ILE A 1 29 ? -11.422 -22.760 -7.581  1.00 0.00 ? 30 ILE A HB   4  
ATOM 4005  H HG12 . ILE A 1 29 ? -11.376 -20.646 -5.401  1.00 0.00 ? 30 ILE A HG12 4  
ATOM 4006  H HG13 . ILE A 1 29 ? -11.997 -22.281 -5.166  1.00 0.00 ? 30 ILE A HG13 4  
ATOM 4007  H HG21 . ILE A 1 29 ? -11.331 -19.841 -8.064  1.00 0.00 ? 30 ILE A HG21 4  
ATOM 4008  H HG22 . ILE A 1 29 ? -9.857  -20.597 -7.461  1.00 0.00 ? 30 ILE A HG22 4  
ATOM 4009  H HG23 . ILE A 1 29 ? -10.585 -21.153 -8.969  1.00 0.00 ? 30 ILE A HG23 4  
ATOM 4010  H HD11 . ILE A 1 29 ? -9.626  -22.908 -6.251  1.00 0.00 ? 30 ILE A HD11 4  
ATOM 4011  H HD12 . ILE A 1 29 ? -9.188  -21.356 -5.535  1.00 0.00 ? 30 ILE A HD12 4  
ATOM 4012  H HD13 . ILE A 1 29 ? -9.820  -22.650 -4.517  1.00 0.00 ? 30 ILE A HD13 4  
ATOM 4013  N N    . LYS A 1 30 ? -13.769 -19.832 -5.767  1.00 0.00 ? 31 LYS A N    4  
ATOM 4014  C CA   . LYS A 1 30 ? -14.068 -18.462 -5.261  1.00 0.00 ? 31 LYS A CA   4  
ATOM 4015  C C    . LYS A 1 30 ? -12.771 -17.656 -5.179  1.00 0.00 ? 31 LYS A C    4  
ATOM 4016  O O    . LYS A 1 30 ? -11.688 -18.207 -5.136  1.00 0.00 ? 31 LYS A O    4  
ATOM 4017  C CB   . LYS A 1 30 ? -14.697 -18.559 -3.870  1.00 0.00 ? 31 LYS A CB   4  
ATOM 4018  C CG   . LYS A 1 30 ? -16.191 -18.238 -3.959  1.00 0.00 ? 31 LYS A CG   4  
ATOM 4019  C CD   . LYS A 1 30 ? -17.004 -19.466 -3.545  1.00 0.00 ? 31 LYS A CD   4  
ATOM 4020  C CE   . LYS A 1 30 ? -18.122 -19.706 -4.562  1.00 0.00 ? 31 LYS A CE   4  
ATOM 4021  N NZ   . LYS A 1 30 ? -19.355 -18.993 -4.122  1.00 0.00 ? 31 LYS A NZ   4  
ATOM 4022  H H    . LYS A 1 30 ? -13.861 -20.604 -5.171  1.00 0.00 ? 31 LYS A H    4  
ATOM 4023  H HA   . LYS A 1 30 ? -14.756 -17.973 -5.933  1.00 0.00 ? 31 LYS A HA   4  
ATOM 4024  H HB2  . LYS A 1 30 ? -14.566 -19.560 -3.487  1.00 0.00 ? 31 LYS A HB2  4  
ATOM 4025  H HB3  . LYS A 1 30 ? -14.218 -17.855 -3.207  1.00 0.00 ? 31 LYS A HB3  4  
ATOM 4026  H HG2  . LYS A 1 30 ? -16.421 -17.414 -3.299  1.00 0.00 ? 31 LYS A HG2  4  
ATOM 4027  H HG3  . LYS A 1 30 ? -16.441 -17.969 -4.974  1.00 0.00 ? 31 LYS A HG3  4  
ATOM 4028  H HD2  . LYS A 1 30 ? -16.358 -20.331 -3.508  1.00 0.00 ? 31 LYS A HD2  4  
ATOM 4029  H HD3  . LYS A 1 30 ? -17.437 -19.300 -2.570  1.00 0.00 ? 31 LYS A HD3  4  
ATOM 4030  H HE2  . LYS A 1 30 ? -17.816 -19.334 -5.528  1.00 0.00 ? 31 LYS A HE2  4  
ATOM 4031  H HE3  . LYS A 1 30 ? -18.324 -20.765 -4.631  1.00 0.00 ? 31 LYS A HE3  4  
ATOM 4032  H HZ1  . LYS A 1 30 ? -19.095 -18.069 -3.719  1.00 0.00 ? 31 LYS A HZ1  4  
ATOM 4033  H HZ2  . LYS A 1 30 ? -19.983 -18.853 -4.937  1.00 0.00 ? 31 LYS A HZ2  4  
ATOM 4034  H HZ3  . LYS A 1 30 ? -19.846 -19.560 -3.402  1.00 0.00 ? 31 LYS A HZ3  4  
ATOM 4035  N N    . VAL A 1 31 ? -12.869 -16.356 -5.157  1.00 0.00 ? 32 VAL A N    4  
ATOM 4036  C CA   . VAL A 1 31 ? -11.651 -15.516 -5.076  1.00 0.00 ? 32 VAL A CA   4  
ATOM 4037  C C    . VAL A 1 31 ? -10.937 -15.792 -3.747  1.00 0.00 ? 32 VAL A C    4  
ATOM 4038  O O    . VAL A 1 31 ? -9.730  -15.703 -3.648  1.00 0.00 ? 32 VAL A O    4  
ATOM 4039  C CB   . VAL A 1 31 ? -12.045 -14.035 -5.191  1.00 0.00 ? 32 VAL A CB   4  
ATOM 4040  C CG1  . VAL A 1 31 ? -13.437 -13.832 -4.623  1.00 0.00 ? 32 VAL A CG1  4  
ATOM 4041  C CG2  . VAL A 1 31 ? -11.071 -13.169 -4.410  1.00 0.00 ? 32 VAL A CG2  4  
ATOM 4042  H H    . VAL A 1 31 ? -13.741 -15.931 -5.192  1.00 0.00 ? 32 VAL A H    4  
ATOM 4043  H HA   . VAL A 1 31 ? -11.004 -15.767 -5.887  1.00 0.00 ? 32 VAL A HA   4  
ATOM 4044  H HB   . VAL A 1 31 ? -12.038 -13.745 -6.230  1.00 0.00 ? 32 VAL A HB   4  
ATOM 4045  H HG11 . VAL A 1 31 ? -13.629 -14.601 -3.893  1.00 0.00 ? 32 VAL A HG11 4  
ATOM 4046  H HG12 . VAL A 1 31 ? -13.502 -12.861 -4.159  1.00 0.00 ? 32 VAL A HG12 4  
ATOM 4047  H HG13 . VAL A 1 31 ? -14.157 -13.906 -5.421  1.00 0.00 ? 32 VAL A HG13 4  
ATOM 4048  H HG21 . VAL A 1 31 ? -10.093 -13.622 -4.434  1.00 0.00 ? 32 VAL A HG21 4  
ATOM 4049  H HG22 . VAL A 1 31 ? -11.030 -12.186 -4.848  1.00 0.00 ? 32 VAL A HG22 4  
ATOM 4050  H HG23 . VAL A 1 31 ? -11.412 -13.098 -3.390  1.00 0.00 ? 32 VAL A HG23 4  
ATOM 4051  N N    . THR A 1 32 ? -11.677 -16.121 -2.725  1.00 0.00 ? 33 THR A N    4  
ATOM 4052  C CA   . THR A 1 32 ? -11.046 -16.397 -1.404  1.00 0.00 ? 33 THR A CA   4  
ATOM 4053  C C    . THR A 1 32 ? -10.322 -17.744 -1.448  1.00 0.00 ? 33 THR A C    4  
ATOM 4054  O O    . THR A 1 32 ? -9.397  -17.986 -0.698  1.00 0.00 ? 33 THR A O    4  
ATOM 4055  C CB   . THR A 1 32 ? -12.129 -16.433 -0.323  1.00 0.00 ? 33 THR A CB   4  
ATOM 4056  O OG1  . THR A 1 32 ? -13.085 -17.434 -0.645  1.00 0.00 ? 33 THR A OG1  4  
ATOM 4057  C CG2  . THR A 1 32 ? -12.819 -15.070 -0.250  1.00 0.00 ? 33 THR A CG2  4  
ATOM 4058  H H    . THR A 1 32 ? -12.651 -16.184 -2.826  1.00 0.00 ? 33 THR A H    4  
ATOM 4059  H HA   . THR A 1 32 ? -10.337 -15.616 -1.176  1.00 0.00 ? 33 THR A HA   4  
ATOM 4060  H HB   . THR A 1 32 ? -11.680 -16.656 0.632   1.00 0.00 ? 33 THR A HB   4  
ATOM 4061  H HG1  . THR A 1 32 ? -13.464 -17.218 -1.500  1.00 0.00 ? 33 THR A HG1  4  
ATOM 4062  H HG21 . THR A 1 32 ? -12.180 -14.319 -0.693  1.00 0.00 ? 33 THR A HG21 4  
ATOM 4063  H HG22 . THR A 1 32 ? -13.754 -15.110 -0.788  1.00 0.00 ? 33 THR A HG22 4  
ATOM 4064  H HG23 . THR A 1 32 ? -13.009 -14.816 0.783   1.00 0.00 ? 33 THR A HG23 4  
ATOM 4065  N N    . GLU A 1 33 ? -10.731 -18.625 -2.320  1.00 0.00 ? 34 GLU A N    4  
ATOM 4066  C CA   . GLU A 1 33 ? -10.059 -19.953 -2.405  1.00 0.00 ? 34 GLU A CA   4  
ATOM 4067  C C    . GLU A 1 33 ? -9.035  -19.934 -3.542  1.00 0.00 ? 34 GLU A C    4  
ATOM 4068  O O    . GLU A 1 33 ? -8.252  -20.850 -3.700  1.00 0.00 ? 34 GLU A O    4  
ATOM 4069  C CB   . GLU A 1 33 ? -11.104 -21.036 -2.676  1.00 0.00 ? 34 GLU A CB   4  
ATOM 4070  C CG   . GLU A 1 33 ? -11.917 -21.297 -1.406  1.00 0.00 ? 34 GLU A CG   4  
ATOM 4071  C CD   . GLU A 1 33 ? -13.094 -22.216 -1.734  1.00 0.00 ? 34 GLU A CD   4  
ATOM 4072  O OE1  . GLU A 1 33 ? -13.381 -22.382 -2.909  1.00 0.00 ? 34 GLU A OE1  4  
ATOM 4073  O OE2  . GLU A 1 33 ? -13.689 -22.740 -0.807  1.00 0.00 ? 34 GLU A OE2  4  
ATOM 4074  H H    . GLU A 1 33 ? -11.477 -18.413 -2.918  1.00 0.00 ? 34 GLU A H    4  
ATOM 4075  H HA   . GLU A 1 33 ? -9.557  -20.161 -1.472  1.00 0.00 ? 34 GLU A HA   4  
ATOM 4076  H HB2  . GLU A 1 33 ? -11.766 -20.709 -3.467  1.00 0.00 ? 34 GLU A HB2  4  
ATOM 4077  H HB3  . GLU A 1 33 ? -10.609 -21.948 -2.977  1.00 0.00 ? 34 GLU A HB3  4  
ATOM 4078  H HG2  . GLU A 1 33 ? -11.285 -21.768 -0.666  1.00 0.00 ? 34 GLU A HG2  4  
ATOM 4079  H HG3  . GLU A 1 33 ? -12.290 -20.361 -1.019  1.00 0.00 ? 34 GLU A HG3  4  
ATOM 4080  N N    . VAL A 1 34 ? -9.036  -18.898 -4.338  1.00 0.00 ? 35 VAL A N    4  
ATOM 4081  C CA   . VAL A 1 34 ? -8.065  -18.820 -5.464  1.00 0.00 ? 35 VAL A CA   4  
ATOM 4082  C C    . VAL A 1 34 ? -6.670  -18.507 -4.919  1.00 0.00 ? 35 VAL A C    4  
ATOM 4083  O O    . VAL A 1 34 ? -5.677  -19.018 -5.396  1.00 0.00 ? 35 VAL A O    4  
ATOM 4084  C CB   . VAL A 1 34 ? -8.500  -17.717 -6.428  1.00 0.00 ? 35 VAL A CB   4  
ATOM 4085  C CG1  . VAL A 1 34 ? -7.357  -17.389 -7.390  1.00 0.00 ? 35 VAL A CG1  4  
ATOM 4086  C CG2  . VAL A 1 34 ? -9.718  -18.186 -7.228  1.00 0.00 ? 35 VAL A CG2  4  
ATOM 4087  H H    . VAL A 1 34 ? -9.676  -18.171 -4.194  1.00 0.00 ? 35 VAL A H    4  
ATOM 4088  H HA   . VAL A 1 34 ? -8.044  -19.759 -5.985  1.00 0.00 ? 35 VAL A HA   4  
ATOM 4089  H HB   . VAL A 1 34 ? -8.758  -16.839 -5.863  1.00 0.00 ? 35 VAL A HB   4  
ATOM 4090  H HG11 . VAL A 1 34 ? -6.547  -18.086 -7.236  1.00 0.00 ? 35 VAL A HG11 4  
ATOM 4091  H HG12 . VAL A 1 34 ? -7.709  -17.466 -8.408  1.00 0.00 ? 35 VAL A HG12 4  
ATOM 4092  H HG13 . VAL A 1 34 ? -7.006  -16.385 -7.204  1.00 0.00 ? 35 VAL A HG13 4  
ATOM 4093  H HG21 . VAL A 1 34 ? -10.304 -18.865 -6.628  1.00 0.00 ? 35 VAL A HG21 4  
ATOM 4094  H HG22 . VAL A 1 34 ? -10.321 -17.332 -7.500  1.00 0.00 ? 35 VAL A HG22 4  
ATOM 4095  H HG23 . VAL A 1 34 ? -9.386  -18.692 -8.123  1.00 0.00 ? 35 VAL A HG23 4  
ATOM 4096  N N    . ALA A 1 35 ? -6.589  -17.668 -3.925  1.00 0.00 ? 36 ALA A N    4  
ATOM 4097  C CA   . ALA A 1 35 ? -5.259  -17.318 -3.349  1.00 0.00 ? 36 ALA A CA   4  
ATOM 4098  C C    . ALA A 1 35 ? -4.716  -18.511 -2.561  1.00 0.00 ? 36 ALA A C    4  
ATOM 4099  O O    . ALA A 1 35 ? -3.521  -18.702 -2.450  1.00 0.00 ? 36 ALA A O    4  
ATOM 4100  C CB   . ALA A 1 35 ? -5.409  -16.118 -2.410  1.00 0.00 ? 36 ALA A CB   4  
ATOM 4101  H H    . ALA A 1 35 ? -7.404  -17.267 -3.558  1.00 0.00 ? 36 ALA A H    4  
ATOM 4102  H HA   . ALA A 1 35 ? -4.575  -17.070 -4.147  1.00 0.00 ? 36 ALA A HA   4  
ATOM 4103  H HB1  . ALA A 1 35 ? -6.432  -16.050 -2.073  1.00 0.00 ? 36 ALA A HB1  4  
ATOM 4104  H HB2  . ALA A 1 35 ? -4.757  -16.246 -1.558  1.00 0.00 ? 36 ALA A HB2  4  
ATOM 4105  H HB3  . ALA A 1 35 ? -5.141  -15.214 -2.935  1.00 0.00 ? 36 ALA A HB3  4  
ATOM 4106  N N    . LYS A 1 36 ? -5.585  -19.312 -2.010  1.00 0.00 ? 37 LYS A N    4  
ATOM 4107  C CA   . LYS A 1 36 ? -5.127  -20.489 -1.226  1.00 0.00 ? 37 LYS A CA   4  
ATOM 4108  C C    . LYS A 1 36 ? -4.509  -21.525 -2.171  1.00 0.00 ? 37 LYS A C    4  
ATOM 4109  O O    . LYS A 1 36 ? -3.349  -21.869 -2.061  1.00 0.00 ? 37 LYS A O    4  
ATOM 4110  C CB   . LYS A 1 36 ? -6.331  -21.075 -0.481  1.00 0.00 ? 37 LYS A CB   4  
ATOM 4111  C CG   . LYS A 1 36 ? -6.198  -22.595 -0.320  1.00 0.00 ? 37 LYS A CG   4  
ATOM 4112  C CD   . LYS A 1 36 ? -4.859  -22.922 0.344   1.00 0.00 ? 37 LYS A CD   4  
ATOM 4113  C CE   . LYS A 1 36 ? -5.099  -23.343 1.794   1.00 0.00 ? 37 LYS A CE   4  
ATOM 4114  N NZ   . LYS A 1 36 ? -5.153  -22.132 2.661   1.00 0.00 ? 37 LYS A NZ   4  
ATOM 4115  H H    . LYS A 1 36 ? -6.545  -19.138 -2.109  1.00 0.00 ? 37 LYS A H    4  
ATOM 4116  H HA   . LYS A 1 36 ? -4.394  -20.175 -0.508  1.00 0.00 ? 37 LYS A HA   4  
ATOM 4117  H HB2  . LYS A 1 36 ? -6.380  -20.618 0.494   1.00 0.00 ? 37 LYS A HB2  4  
ATOM 4118  H HB3  . LYS A 1 36 ? -7.231  -20.847 -1.030  1.00 0.00 ? 37 LYS A HB3  4  
ATOM 4119  H HG2  . LYS A 1 36 ? -7.005  -22.964 0.295   1.00 0.00 ? 37 LYS A HG2  4  
ATOM 4120  H HG3  . LYS A 1 36 ? -6.239  -23.065 -1.291  1.00 0.00 ? 37 LYS A HG3  4  
ATOM 4121  H HD2  . LYS A 1 36 ? -4.380  -23.731 -0.192  1.00 0.00 ? 37 LYS A HD2  4  
ATOM 4122  H HD3  . LYS A 1 36 ? -4.224  -22.050 0.324   1.00 0.00 ? 37 LYS A HD3  4  
ATOM 4123  H HE2  . LYS A 1 36 ? -6.034  -23.878 1.864   1.00 0.00 ? 37 LYS A HE2  4  
ATOM 4124  H HE3  . LYS A 1 36 ? -4.292  -23.984 2.121   1.00 0.00 ? 37 LYS A HE3  4  
ATOM 4125  H HZ1  . LYS A 1 36 ? -5.343  -21.293 2.075   1.00 0.00 ? 37 LYS A HZ1  4  
ATOM 4126  H HZ2  . LYS A 1 36 ? -5.910  -22.243 3.365   1.00 0.00 ? 37 LYS A HZ2  4  
ATOM 4127  H HZ3  . LYS A 1 36 ? -4.243  -22.015 3.152   1.00 0.00 ? 37 LYS A HZ3  4  
ATOM 4128  N N    . ARG A 1 37 ? -5.279  -22.022 -3.093  1.00 0.00 ? 38 ARG A N    4  
ATOM 4129  C CA   . ARG A 1 37 ? -4.748  -23.035 -4.046  1.00 0.00 ? 38 ARG A CA   4  
ATOM 4130  C C    . ARG A 1 37 ? -3.689  -22.393 -4.945  1.00 0.00 ? 38 ARG A C    4  
ATOM 4131  O O    . ARG A 1 37 ? -2.909  -23.071 -5.584  1.00 0.00 ? 38 ARG A O    4  
ATOM 4132  C CB   . ARG A 1 37 ? -5.896  -23.564 -4.908  1.00 0.00 ? 38 ARG A CB   4  
ATOM 4133  C CG   . ARG A 1 37 ? -6.113  -25.051 -4.617  1.00 0.00 ? 38 ARG A CG   4  
ATOM 4134  C CD   . ARG A 1 37 ? -6.605  -25.225 -3.176  1.00 0.00 ? 38 ARG A CD   4  
ATOM 4135  N NE   . ARG A 1 37 ? -7.561  -26.368 -3.111  1.00 0.00 ? 38 ARG A NE   4  
ATOM 4136  C CZ   . ARG A 1 37 ? -7.463  -27.248 -2.152  1.00 0.00 ? 38 ARG A CZ   4  
ATOM 4137  N NH1  . ARG A 1 37 ? -6.874  -26.930 -1.032  1.00 0.00 ? 38 ARG A NH1  4  
ATOM 4138  N NH2  . ARG A 1 37 ? -7.953  -28.448 -2.314  1.00 0.00 ? 38 ARG A NH2  4  
ATOM 4139  H H    . ARG A 1 37 ? -6.210  -21.728 -3.158  1.00 0.00 ? 38 ARG A H    4  
ATOM 4140  H HA   . ARG A 1 37 ? -4.306  -23.852 -3.496  1.00 0.00 ? 38 ARG A HA   4  
ATOM 4141  H HB2  . ARG A 1 37 ? -6.799  -23.015 -4.679  1.00 0.00 ? 38 ARG A HB2  4  
ATOM 4142  H HB3  . ARG A 1 37 ? -5.650  -23.437 -5.952  1.00 0.00 ? 38 ARG A HB3  4  
ATOM 4143  H HG2  . ARG A 1 37 ? -6.851  -25.447 -5.299  1.00 0.00 ? 38 ARG A HG2  4  
ATOM 4144  H HG3  . ARG A 1 37 ? -5.183  -25.583 -4.744  1.00 0.00 ? 38 ARG A HG3  4  
ATOM 4145  H HD2  . ARG A 1 37 ? -5.762  -25.425 -2.530  1.00 0.00 ? 38 ARG A HD2  4  
ATOM 4146  H HD3  . ARG A 1 37 ? -7.100  -24.322 -2.852  1.00 0.00 ? 38 ARG A HD3  4  
ATOM 4147  H HE   . ARG A 1 37 ? -8.264  -26.458 -3.789  1.00 0.00 ? 38 ARG A HE   4  
ATOM 4148  H HH11 . ARG A 1 37 ? -6.499  -26.011 -0.907  1.00 0.00 ? 38 ARG A HH11 4  
ATOM 4149  H HH12 . ARG A 1 37 ? -6.798  -27.604 -0.297  1.00 0.00 ? 38 ARG A HH12 4  
ATOM 4150  H HH21 . ARG A 1 37 ? -8.403  -28.692 -3.172  1.00 0.00 ? 38 ARG A HH21 4  
ATOM 4151  H HH22 . ARG A 1 37 ? -7.876  -29.123 -1.579  1.00 0.00 ? 38 ARG A HH22 4  
ATOM 4152  N N    . GLY A 1 38 ? -3.653  -21.090 -5.000  1.00 0.00 ? 39 GLY A N    4  
ATOM 4153  C CA   . GLY A 1 38 ? -2.642  -20.411 -5.858  1.00 0.00 ? 39 GLY A CA   4  
ATOM 4154  C C    . GLY A 1 38 ? -1.291  -20.395 -5.142  1.00 0.00 ? 39 GLY A C    4  
ATOM 4155  O O    . GLY A 1 38 ? -0.248  -20.405 -5.763  1.00 0.00 ? 39 GLY A O    4  
ATOM 4156  H H    . GLY A 1 38 ? -4.291  -20.560 -4.477  1.00 0.00 ? 39 GLY A H    4  
ATOM 4157  H HA2  . GLY A 1 38 ? -2.549  -20.944 -6.794  1.00 0.00 ? 39 GLY A HA2  4  
ATOM 4158  H HA3  . GLY A 1 38 ? -2.956  -19.397 -6.052  1.00 0.00 ? 39 GLY A HA3  4  
ATOM 4159  N N    . GLY A 1 39 ? -1.302  -20.370 -3.837  1.00 0.00 ? 40 GLY A N    4  
ATOM 4160  C CA   . GLY A 1 39 ? -0.017  -20.354 -3.082  1.00 0.00 ? 40 GLY A CA   4  
ATOM 4161  C C    . GLY A 1 39 ? 0.671   -21.713 -3.212  1.00 0.00 ? 40 GLY A C    4  
ATOM 4162  O O    . GLY A 1 39 ? 1.876   -21.821 -3.095  1.00 0.00 ? 40 GLY A O    4  
ATOM 4163  H H    . GLY A 1 39 ? -2.155  -20.362 -3.354  1.00 0.00 ? 40 GLY A H    4  
ATOM 4164  H HA2  . GLY A 1 39 ? 0.625   -19.582 -3.484  1.00 0.00 ? 40 GLY A HA2  4  
ATOM 4165  H HA3  . GLY A 1 39 ? -0.214  -20.153 -2.040  1.00 0.00 ? 40 GLY A HA3  4  
ATOM 4166  N N    . GLU A 1 40 ? -0.081  -22.752 -3.454  1.00 0.00 ? 41 GLU A N    4  
ATOM 4167  C CA   . GLU A 1 40 ? 0.537   -24.100 -3.592  1.00 0.00 ? 41 GLU A CA   4  
ATOM 4168  C C    . GLU A 1 40 ? 1.720   -24.025 -4.562  1.00 0.00 ? 41 GLU A C    4  
ATOM 4169  O O    . GLU A 1 40 ? 2.779   -24.563 -4.308  1.00 0.00 ? 41 GLU A O    4  
ATOM 4170  C CB   . GLU A 1 40 ? -0.502  -25.091 -4.116  1.00 0.00 ? 41 GLU A CB   4  
ATOM 4171  C CG   . GLU A 1 40 ? -0.697  -24.903 -5.625  1.00 0.00 ? 41 GLU A CG   4  
ATOM 4172  C CD   . GLU A 1 40 ? -1.788  -25.854 -6.120  1.00 0.00 ? 41 GLU A CD   4  
ATOM 4173  O OE1  . GLU A 1 40 ? -1.964  -26.893 -5.506  1.00 0.00 ? 41 GLU A OE1  4  
ATOM 4174  O OE2  . GLU A 1 40 ? -2.428  -25.528 -7.107  1.00 0.00 ? 41 GLU A OE2  4  
ATOM 4175  H H    . GLU A 1 40 ? -1.051  -22.644 -3.547  1.00 0.00 ? 41 GLU A H    4  
ATOM 4176  H HA   . GLU A 1 40 ? 0.885   -24.435 -2.630  1.00 0.00 ? 41 GLU A HA   4  
ATOM 4177  H HB2  . GLU A 1 40 ? -0.160  -26.094 -3.917  1.00 0.00 ? 41 GLU A HB2  4  
ATOM 4178  H HB3  . GLU A 1 40 ? -1.439  -24.924 -3.610  1.00 0.00 ? 41 GLU A HB3  4  
ATOM 4179  H HG2  . GLU A 1 40 ? -0.988  -23.882 -5.826  1.00 0.00 ? 41 GLU A HG2  4  
ATOM 4180  H HG3  . GLU A 1 40 ? 0.228   -25.121 -6.137  1.00 0.00 ? 41 GLU A HG3  4  
ATOM 4181  N N    . LEU A 1 41 ? 1.546   -23.361 -5.671  1.00 0.00 ? 42 LEU A N    4  
ATOM 4182  C CA   . LEU A 1 41 ? 2.654   -23.249 -6.655  1.00 0.00 ? 42 LEU A CA   4  
ATOM 4183  C C    . LEU A 1 41 ? 3.653   -22.190 -6.183  1.00 0.00 ? 42 LEU A C    4  
ATOM 4184  O O    . LEU A 1 41 ? 4.845   -22.307 -6.392  1.00 0.00 ? 42 LEU A O    4  
ATOM 4185  C CB   . LEU A 1 41 ? 2.082   -22.849 -8.014  1.00 0.00 ? 42 LEU A CB   4  
ATOM 4186  C CG   . LEU A 1 41 ? 1.661   -24.106 -8.776  1.00 0.00 ? 42 LEU A CG   4  
ATOM 4187  C CD1  . LEU A 1 41 ? 1.060   -23.712 -10.126 1.00 0.00 ? 42 LEU A CD1  4  
ATOM 4188  C CD2  . LEU A 1 41 ? 2.885   -24.995 -9.001  1.00 0.00 ? 42 LEU A CD2  4  
ATOM 4189  H H    . LEU A 1 41 ? 0.683   -22.935 -5.857  1.00 0.00 ? 42 LEU A H    4  
ATOM 4190  H HA   . LEU A 1 41 ? 3.154   -24.202 -6.743  1.00 0.00 ? 42 LEU A HA   4  
ATOM 4191  H HB2  . LEU A 1 41 ? 1.222   -22.209 -7.869  1.00 0.00 ? 42 LEU A HB2  4  
ATOM 4192  H HB3  . LEU A 1 41 ? 2.832   -22.320 -8.581  1.00 0.00 ? 42 LEU A HB3  4  
ATOM 4193  H HG   . LEU A 1 41 ? 0.924   -24.645 -8.198  1.00 0.00 ? 42 LEU A HG   4  
ATOM 4194  H HD11 . LEU A 1 41 ? 1.241   -22.663 -10.309 1.00 0.00 ? 42 LEU A HD11 4  
ATOM 4195  H HD12 . LEU A 1 41 ? 1.518   -24.298 -10.908 1.00 0.00 ? 42 LEU A HD12 4  
ATOM 4196  H HD13 . LEU A 1 41 ? -0.004  -23.897 -10.113 1.00 0.00 ? 42 LEU A HD13 4  
ATOM 4197  H HD21 . LEU A 1 41 ? 3.746   -24.552 -8.521  1.00 0.00 ? 42 LEU A HD21 4  
ATOM 4198  H HD22 . LEU A 1 41 ? 2.702   -25.973 -8.581  1.00 0.00 ? 42 LEU A HD22 4  
ATOM 4199  H HD23 . LEU A 1 41 ? 3.073   -25.088 -10.060 1.00 0.00 ? 42 LEU A HD23 4  
ATOM 4200  N N    . TRP A 1 42 ? 3.178   -21.155 -5.544  1.00 0.00 ? 43 TRP A N    4  
ATOM 4201  C CA   . TRP A 1 42 ? 4.098   -20.091 -5.057  1.00 0.00 ? 43 TRP A CA   4  
ATOM 4202  C C    . TRP A 1 42 ? 5.084   -20.688 -4.050  1.00 0.00 ? 43 TRP A C    4  
ATOM 4203  O O    . TRP A 1 42 ? 6.083   -20.086 -3.712  1.00 0.00 ? 43 TRP A O    4  
ATOM 4204  C CB   . TRP A 1 42 ? 3.289   -18.989 -4.373  1.00 0.00 ? 43 TRP A CB   4  
ATOM 4205  C CG   . TRP A 1 42 ? 4.224   -18.010 -3.743  1.00 0.00 ? 43 TRP A CG   4  
ATOM 4206  C CD1  . TRP A 1 42 ? 4.587   -18.008 -2.439  1.00 0.00 ? 43 TRP A CD1  4  
ATOM 4207  C CD2  . TRP A 1 42 ? 4.924   -16.894 -4.365  1.00 0.00 ? 43 TRP A CD2  4  
ATOM 4208  N NE1  . TRP A 1 42 ? 5.462   -16.959 -2.221  1.00 0.00 ? 43 TRP A NE1  4  
ATOM 4209  C CE2  . TRP A 1 42 ? 5.701   -16.243 -3.378  1.00 0.00 ? 43 TRP A CE2  4  
ATOM 4210  C CE3  . TRP A 1 42 ? 4.958   -16.390 -5.676  1.00 0.00 ? 43 TRP A CE3  4  
ATOM 4211  C CZ2  . TRP A 1 42 ? 6.484   -15.128 -3.683  1.00 0.00 ? 43 TRP A CZ2  4  
ATOM 4212  C CZ3  . TRP A 1 42 ? 5.744   -15.270 -5.987  1.00 0.00 ? 43 TRP A CZ3  4  
ATOM 4213  C CH2  . TRP A 1 42 ? 6.507   -14.641 -4.992  1.00 0.00 ? 43 TRP A CH2  4  
ATOM 4214  H H    . TRP A 1 42 ? 2.213   -21.080 -5.385  1.00 0.00 ? 43 TRP A H    4  
ATOM 4215  H HA   . TRP A 1 42 ? 4.642   -19.672 -5.891  1.00 0.00 ? 43 TRP A HA   4  
ATOM 4216  H HB2  . TRP A 1 42 ? 2.678   -18.484 -5.106  1.00 0.00 ? 43 TRP A HB2  4  
ATOM 4217  H HB3  . TRP A 1 42 ? 2.656   -19.425 -3.614  1.00 0.00 ? 43 TRP A HB3  4  
ATOM 4218  H HD1  . TRP A 1 42 ? 4.247   -18.711 -1.692  1.00 0.00 ? 43 TRP A HD1  4  
ATOM 4219  H HE1  . TRP A 1 42 ? 5.871   -16.735 -1.359  1.00 0.00 ? 43 TRP A HE1  4  
ATOM 4220  H HE3  . TRP A 1 42 ? 4.374   -16.867 -6.449  1.00 0.00 ? 43 TRP A HE3  4  
ATOM 4221  H HZ2  . TRP A 1 42 ? 7.069   -14.645 -2.913  1.00 0.00 ? 43 TRP A HZ2  4  
ATOM 4222  H HZ3  . TRP A 1 42 ? 5.764   -14.894 -6.997  1.00 0.00 ? 43 TRP A HZ3  4  
ATOM 4223  H HH2  . TRP A 1 42 ? 7.110   -13.780 -5.238  1.00 0.00 ? 43 TRP A HH2  4  
ATOM 4224  N N    . ARG A 1 43 ? 4.807   -21.868 -3.564  1.00 0.00 ? 44 ARG A N    4  
ATOM 4225  C CA   . ARG A 1 43 ? 5.725   -22.501 -2.575  1.00 0.00 ? 44 ARG A CA   4  
ATOM 4226  C C    . ARG A 1 43 ? 7.100   -22.706 -3.213  1.00 0.00 ? 44 ARG A C    4  
ATOM 4227  O O    . ARG A 1 43 ? 8.093   -22.179 -2.753  1.00 0.00 ? 44 ARG A O    4  
ATOM 4228  C CB   . ARG A 1 43 ? 5.155   -23.854 -2.145  1.00 0.00 ? 44 ARG A CB   4  
ATOM 4229  C CG   . ARG A 1 43 ? 5.088   -23.922 -0.617  1.00 0.00 ? 44 ARG A CG   4  
ATOM 4230  C CD   . ARG A 1 43 ? 5.436   -25.338 -0.154  1.00 0.00 ? 44 ARG A CD   4  
ATOM 4231  N NE   . ARG A 1 43 ? 4.185   -26.084 0.155   1.00 0.00 ? 44 ARG A NE   4  
ATOM 4232  C CZ   . ARG A 1 43 ? 4.250   -27.267 0.706   1.00 0.00 ? 44 ARG A CZ   4  
ATOM 4233  N NH1  . ARG A 1 43 ? 5.191   -27.531 1.571   1.00 0.00 ? 44 ARG A NH1  4  
ATOM 4234  N NH2  . ARG A 1 43 ? 3.376   -28.183 0.393   1.00 0.00 ? 44 ARG A NH2  4  
ATOM 4235  H H    . ARG A 1 43 ? 3.995   -22.336 -3.848  1.00 0.00 ? 44 ARG A H    4  
ATOM 4236  H HA   . ARG A 1 43 ? 5.819   -21.859 -1.712  1.00 0.00 ? 44 ARG A HA   4  
ATOM 4237  H HB2  . ARG A 1 43 ? 4.162   -23.971 -2.555  1.00 0.00 ? 44 ARG A HB2  4  
ATOM 4238  H HB3  . ARG A 1 43 ? 5.792   -24.646 -2.511  1.00 0.00 ? 44 ARG A HB3  4  
ATOM 4239  H HG2  . ARG A 1 43 ? 5.792   -23.220 -0.193  1.00 0.00 ? 44 ARG A HG2  4  
ATOM 4240  H HG3  . ARG A 1 43 ? 4.090   -23.673 -0.288  1.00 0.00 ? 44 ARG A HG3  4  
ATOM 4241  H HD2  . ARG A 1 43 ? 5.976   -25.849 -0.936  1.00 0.00 ? 44 ARG A HD2  4  
ATOM 4242  H HD3  . ARG A 1 43 ? 6.052   -25.285 0.733   1.00 0.00 ? 44 ARG A HD3  4  
ATOM 4243  H HE   . ARG A 1 43 ? 3.314   -25.688 -0.053  1.00 0.00 ? 44 ARG A HE   4  
ATOM 4244  H HH11 . ARG A 1 43 ? 5.861   -26.829 1.812   1.00 0.00 ? 44 ARG A HH11 4  
ATOM 4245  H HH12 . ARG A 1 43 ? 5.242   -28.435 1.993   1.00 0.00 ? 44 ARG A HH12 4  
ATOM 4246  H HH21 . ARG A 1 43 ? 2.655   -27.982 -0.270  1.00 0.00 ? 44 ARG A HH21 4  
ATOM 4247  H HH22 . ARG A 1 43 ? 3.428   -29.088 0.815   1.00 0.00 ? 44 ARG A HH22 4  
ATOM 4248  N N    . ALA A 1 44 ? 7.167   -23.466 -4.272  1.00 0.00 ? 45 ALA A N    4  
ATOM 4249  C CA   . ALA A 1 44 ? 8.480   -23.699 -4.938  1.00 0.00 ? 45 ALA A CA   4  
ATOM 4250  C C    . ALA A 1 44 ? 9.111   -22.351 -5.281  1.00 0.00 ? 45 ALA A C    4  
ATOM 4251  O O    . ALA A 1 44 ? 10.317  -22.203 -5.285  1.00 0.00 ? 45 ALA A O    4  
ATOM 4252  C CB   . ALA A 1 44 ? 8.271   -24.505 -6.222  1.00 0.00 ? 45 ALA A CB   4  
ATOM 4253  H H    . ALA A 1 44 ? 6.354   -23.881 -4.630  1.00 0.00 ? 45 ALA A H    4  
ATOM 4254  H HA   . ALA A 1 44 ? 9.133   -24.242 -4.271  1.00 0.00 ? 45 ALA A HA   4  
ATOM 4255  H HB1  . ALA A 1 44 ? 7.223   -24.509 -6.478  1.00 0.00 ? 45 ALA A HB1  4  
ATOM 4256  H HB2  . ALA A 1 44 ? 8.836   -24.055 -7.026  1.00 0.00 ? 45 ALA A HB2  4  
ATOM 4257  H HB3  . ALA A 1 44 ? 8.609   -25.519 -6.070  1.00 0.00 ? 45 ALA A HB3  4  
ATOM 4258  N N    . MET A 1 45 ? 8.294   -21.374 -5.581  1.00 0.00 ? 46 MET A N    4  
ATOM 4259  C CA   . MET A 1 45 ? 8.811   -20.016 -5.939  1.00 0.00 ? 46 MET A CA   4  
ATOM 4260  C C    . MET A 1 45 ? 10.116  -19.691 -5.197  1.00 0.00 ? 46 MET A C    4  
ATOM 4261  O O    . MET A 1 45 ? 10.971  -19.031 -5.742  1.00 0.00 ? 46 MET A O    4  
ATOM 4262  C CB   . MET A 1 45 ? 7.769   -18.973 -5.555  1.00 0.00 ? 46 MET A CB   4  
ATOM 4263  C CG   . MET A 1 45 ? 8.170   -17.608 -6.122  1.00 0.00 ? 46 MET A CG   4  
ATOM 4264  S SD   . MET A 1 45 ? 8.421   -17.736 -7.911  1.00 0.00 ? 46 MET A SD   4  
ATOM 4265  C CE   . MET A 1 45 ? 6.762   -17.225 -8.417  1.00 0.00 ? 46 MET A CE   4  
ATOM 4266  H H    . MET A 1 45 ? 7.321   -21.539 -5.584  1.00 0.00 ? 46 MET A H    4  
ATOM 4267  H HA   . MET A 1 45 ? 8.984   -19.972 -7.001  1.00 0.00 ? 46 MET A HA   4  
ATOM 4268  H HB2  . MET A 1 45 ? 6.806   -19.263 -5.948  1.00 0.00 ? 46 MET A HB2  4  
ATOM 4269  H HB3  . MET A 1 45 ? 7.717   -18.913 -4.477  1.00 0.00 ? 46 MET A HB3  4  
ATOM 4270  H HG2  . MET A 1 45 ? 7.389   -16.895 -5.921  1.00 0.00 ? 46 MET A HG2  4  
ATOM 4271  H HG3  . MET A 1 45 ? 9.086   -17.278 -5.654  1.00 0.00 ? 46 MET A HG3  4  
ATOM 4272  H HE1  . MET A 1 45 ? 6.026   -17.840 -7.925  1.00 0.00 ? 46 MET A HE1  4  
ATOM 4273  H HE2  . MET A 1 45 ? 6.606   -16.190 -8.143  1.00 0.00 ? 46 MET A HE2  4  
ATOM 4274  H HE3  . MET A 1 45 ? 6.666   -17.338 -9.487  1.00 0.00 ? 46 MET A HE3  4  
ATOM 4275  N N    . LYS A 1 46 ? 10.268  -20.167 -3.978  1.00 0.00 ? 47 LYS A N    4  
ATOM 4276  C CA   . LYS A 1 46 ? 11.502  -19.935 -3.170  1.00 0.00 ? 47 LYS A CA   4  
ATOM 4277  C C    . LYS A 1 46 ? 12.287  -18.694 -3.629  1.00 0.00 ? 47 LYS A C    4  
ATOM 4278  O O    . LYS A 1 46 ? 12.233  -17.658 -2.999  1.00 0.00 ? 47 LYS A O    4  
ATOM 4279  C CB   . LYS A 1 46 ? 12.331  -21.194 -3.295  1.00 0.00 ? 47 LYS A CB   4  
ATOM 4280  C CG   . LYS A 1 46 ? 13.129  -21.428 -2.009  1.00 0.00 ? 47 LYS A CG   4  
ATOM 4281  C CD   . LYS A 1 46 ? 13.902  -22.745 -2.115  1.00 0.00 ? 47 LYS A CD   4  
ATOM 4282  C CE   . LYS A 1 46 ? 15.340  -22.462 -2.550  1.00 0.00 ? 47 LYS A CE   4  
ATOM 4283  N NZ   . LYS A 1 46 ? 15.928  -23.691 -3.153  1.00 0.00 ? 47 LYS A NZ   4  
ATOM 4284  H H    . LYS A 1 46 ? 9.569   -20.715 -3.588  1.00 0.00 ? 47 LYS A H    4  
ATOM 4285  H HA   . LYS A 1 46 ? 11.222  -19.807 -2.135  1.00 0.00 ? 47 LYS A HA   4  
ATOM 4286  H HB2  . LYS A 1 46 ? 11.644  -22.017 -3.457  1.00 0.00 ? 47 LYS A HB2  4  
ATOM 4287  H HB3  . LYS A 1 46 ? 13.001  -21.110 -4.135  1.00 0.00 ? 47 LYS A HB3  4  
ATOM 4288  H HG2  . LYS A 1 46 ? 13.824  -20.614 -1.865  1.00 0.00 ? 47 LYS A HG2  4  
ATOM 4289  H HG3  . LYS A 1 46 ? 12.453  -21.477 -1.170  1.00 0.00 ? 47 LYS A HG3  4  
ATOM 4290  H HD2  . LYS A 1 46 ? 13.907  -23.237 -1.152  1.00 0.00 ? 47 LYS A HD2  4  
ATOM 4291  H HD3  . LYS A 1 46 ? 13.428  -23.385 -2.843  1.00 0.00 ? 47 LYS A HD3  4  
ATOM 4292  H HE2  . LYS A 1 46 ? 15.345  -21.666 -3.280  1.00 0.00 ? 47 LYS A HE2  4  
ATOM 4293  H HE3  . LYS A 1 46 ? 15.925  -22.166 -1.691  1.00 0.00 ? 47 LYS A HE3  4  
ATOM 4294  H HZ1  . LYS A 1 46 ? 15.684  -24.515 -2.565  1.00 0.00 ? 47 LYS A HZ1  4  
ATOM 4295  H HZ2  . LYS A 1 46 ? 15.547  -23.824 -4.111  1.00 0.00 ? 47 LYS A HZ2  4  
ATOM 4296  H HZ3  . LYS A 1 46 ? 16.961  -23.593 -3.203  1.00 0.00 ? 47 LYS A HZ3  4  
ATOM 4297  N N    . ASP A 1 47 ? 13.009  -18.777 -4.714  1.00 0.00 ? 48 ASP A N    4  
ATOM 4298  C CA   . ASP A 1 47 ? 13.770  -17.584 -5.182  1.00 0.00 ? 48 ASP A CA   4  
ATOM 4299  C C    . ASP A 1 47 ? 12.798  -16.620 -5.870  1.00 0.00 ? 48 ASP A C    4  
ATOM 4300  O O    . ASP A 1 47 ? 12.681  -16.592 -7.080  1.00 0.00 ? 48 ASP A O    4  
ATOM 4301  C CB   . ASP A 1 47 ? 14.851  -18.022 -6.173  1.00 0.00 ? 48 ASP A CB   4  
ATOM 4302  C CG   . ASP A 1 47 ? 16.170  -18.240 -5.430  1.00 0.00 ? 48 ASP A CG   4  
ATOM 4303  O OD1  . ASP A 1 47 ? 16.126  -18.743 -4.320  1.00 0.00 ? 48 ASP A OD1  4  
ATOM 4304  O OD2  . ASP A 1 47 ? 17.202  -17.901 -5.986  1.00 0.00 ? 48 ASP A OD2  4  
ATOM 4305  H H    . ASP A 1 47 ? 13.043  -19.614 -5.221  1.00 0.00 ? 48 ASP A H    4  
ATOM 4306  H HA   . ASP A 1 47 ? 14.229  -17.093 -4.336  1.00 0.00 ? 48 ASP A HA   4  
ATOM 4307  H HB2  . ASP A 1 47 ? 14.549  -18.945 -6.650  1.00 0.00 ? 48 ASP A HB2  4  
ATOM 4308  H HB3  . ASP A 1 47 ? 14.984  -17.257 -6.922  1.00 0.00 ? 48 ASP A HB3  4  
ATOM 4309  N N    . LYS A 1 48 ? 12.089  -15.838 -5.099  1.00 0.00 ? 49 LYS A N    4  
ATOM 4310  C CA   . LYS A 1 48 ? 11.107  -14.881 -5.689  1.00 0.00 ? 49 LYS A CA   4  
ATOM 4311  C C    . LYS A 1 48 ? 11.799  -13.553 -5.998  1.00 0.00 ? 49 LYS A C    4  
ATOM 4312  O O    . LYS A 1 48 ? 11.157  -12.566 -6.299  1.00 0.00 ? 49 LYS A O    4  
ATOM 4313  C CB   . LYS A 1 48 ? 9.957   -14.632 -4.699  1.00 0.00 ? 49 LYS A CB   4  
ATOM 4314  C CG   . LYS A 1 48 ? 9.832   -15.808 -3.722  1.00 0.00 ? 49 LYS A CG   4  
ATOM 4315  C CD   . LYS A 1 48 ? 10.461  -15.424 -2.379  1.00 0.00 ? 49 LYS A CD   4  
ATOM 4316  C CE   . LYS A 1 48 ? 10.260  -16.562 -1.376  1.00 0.00 ? 49 LYS A CE   4  
ATOM 4317  N NZ   . LYS A 1 48 ? 11.162  -16.356 -0.207  1.00 0.00 ? 49 LYS A NZ   4  
ATOM 4318  H H    . LYS A 1 48 ? 12.195  -15.887 -4.127  1.00 0.00 ? 49 LYS A H    4  
ATOM 4319  H HA   . LYS A 1 48 ? 10.704  -15.293 -6.603  1.00 0.00 ? 49 LYS A HA   4  
ATOM 4320  H HB2  . LYS A 1 48 ? 10.154  -13.725 -4.146  1.00 0.00 ? 49 LYS A HB2  4  
ATOM 4321  H HB3  . LYS A 1 48 ? 9.033   -14.523 -5.246  1.00 0.00 ? 49 LYS A HB3  4  
ATOM 4322  H HG2  . LYS A 1 48 ? 8.787   -16.041 -3.575  1.00 0.00 ? 49 LYS A HG2  4  
ATOM 4323  H HG3  . LYS A 1 48 ? 10.340  -16.671 -4.125  1.00 0.00 ? 49 LYS A HG3  4  
ATOM 4324  H HD2  . LYS A 1 48 ? 11.517  -15.245 -2.514  1.00 0.00 ? 49 LYS A HD2  4  
ATOM 4325  H HD3  . LYS A 1 48 ? 9.989   -14.529 -2.004  1.00 0.00 ? 49 LYS A HD3  4  
ATOM 4326  H HE2  . LYS A 1 48 ? 9.234   -16.570 -1.041  1.00 0.00 ? 49 LYS A HE2  4  
ATOM 4327  H HE3  . LYS A 1 48 ? 10.491  -17.506 -1.847  1.00 0.00 ? 49 LYS A HE3  4  
ATOM 4328  H HZ1  . LYS A 1 48 ? 12.022  -15.858 -0.516  1.00 0.00 ? 49 LYS A HZ1  4  
ATOM 4329  H HZ2  . LYS A 1 48 ? 10.674  -15.787 0.512   1.00 0.00 ? 49 LYS A HZ2  4  
ATOM 4330  H HZ3  . LYS A 1 48 ? 11.422  -17.279 0.198   1.00 0.00 ? 49 LYS A HZ3  4  
ATOM 4331  N N    . SER A 1 49 ? 13.103  -13.515 -5.934  1.00 0.00 ? 50 SER A N    4  
ATOM 4332  C CA   . SER A 1 49 ? 13.822  -12.244 -6.233  1.00 0.00 ? 50 SER A CA   4  
ATOM 4333  C C    . SER A 1 49 ? 13.267  -11.644 -7.528  1.00 0.00 ? 50 SER A C    4  
ATOM 4334  O O    . SER A 1 49 ? 13.357  -10.456 -7.763  1.00 0.00 ? 50 SER A O    4  
ATOM 4335  C CB   . SER A 1 49 ? 15.318  -12.522 -6.396  1.00 0.00 ? 50 SER A CB   4  
ATOM 4336  O OG   . SER A 1 49 ? 15.504  -13.871 -6.803  1.00 0.00 ? 50 SER A OG   4  
ATOM 4337  H H    . SER A 1 49 ? 13.608  -14.321 -5.694  1.00 0.00 ? 50 SER A H    4  
ATOM 4338  H HA   . SER A 1 49 ? 13.673  -11.546 -5.421  1.00 0.00 ? 50 SER A HA   4  
ATOM 4339  H HB2  . SER A 1 49 ? 15.728  -11.867 -7.146  1.00 0.00 ? 50 SER A HB2  4  
ATOM 4340  H HB3  . SER A 1 49 ? 15.821  -12.346 -5.454  1.00 0.00 ? 50 SER A HB3  4  
ATOM 4341  H HG   . SER A 1 49 ? 15.626  -13.880 -7.755  1.00 0.00 ? 50 SER A HG   4  
ATOM 4342  N N    . GLU A 1 50 ? 12.686  -12.461 -8.365  1.00 0.00 ? 51 GLU A N    4  
ATOM 4343  C CA   . GLU A 1 50 ? 12.115  -11.946 -9.636  1.00 0.00 ? 51 GLU A CA   4  
ATOM 4344  C C    . GLU A 1 50 ? 11.049  -10.904 -9.322  1.00 0.00 ? 51 GLU A C    4  
ATOM 4345  O O    . GLU A 1 50 ? 11.199  -9.726  -9.594  1.00 0.00 ? 51 GLU A O    4  
ATOM 4346  C CB   . GLU A 1 50 ? 11.489  -13.100 -10.396 1.00 0.00 ? 51 GLU A CB   4  
ATOM 4347  C CG   . GLU A 1 50 ? 10.545  -12.571 -11.481 1.00 0.00 ? 51 GLU A CG   4  
ATOM 4348  C CD   . GLU A 1 50 ? 9.996   -13.743 -12.295 1.00 0.00 ? 51 GLU A CD   4  
ATOM 4349  O OE1  . GLU A 1 50 ? 10.336  -14.870 -11.976 1.00 0.00 ? 51 GLU A OE1  4  
ATOM 4350  O OE2  . GLU A 1 50 ? 9.244   -13.493 -13.222 1.00 0.00 ? 51 GLU A OE2  4  
ATOM 4351  H H    . GLU A 1 50 ? 12.617  -13.412 -8.153  1.00 0.00 ? 51 GLU A H    4  
ATOM 4352  H HA   . GLU A 1 50 ? 12.893  -11.523 -10.240 1.00 0.00 ? 51 GLU A HA   4  
ATOM 4353  H HB2  . GLU A 1 50 ? 12.282  -13.658 -10.856 1.00 0.00 ? 51 GLU A HB2  4  
ATOM 4354  H HB3  . GLU A 1 50 ? 10.939  -13.730 -9.711  1.00 0.00 ? 51 GLU A HB3  4  
ATOM 4355  H HG2  . GLU A 1 50 ? 9.727   -12.038 -11.017 1.00 0.00 ? 51 GLU A HG2  4  
ATOM 4356  H HG3  . GLU A 1 50 ? 11.086  -11.903 -12.135 1.00 0.00 ? 51 GLU A HG3  4  
ATOM 4357  N N    . TRP A 1 51 ? 9.969   -11.340 -8.745  1.00 0.00 ? 52 TRP A N    4  
ATOM 4358  C CA   . TRP A 1 51 ? 8.876   -10.403 -8.401  1.00 0.00 ? 52 TRP A CA   4  
ATOM 4359  C C    . TRP A 1 51 ? 9.356   -9.430  -7.342  1.00 0.00 ? 52 TRP A C    4  
ATOM 4360  O O    . TRP A 1 51 ? 9.389   -8.248  -7.562  1.00 0.00 ? 52 TRP A O    4  
ATOM 4361  C CB   . TRP A 1 51 ? 7.703   -11.185 -7.837  1.00 0.00 ? 52 TRP A CB   4  
ATOM 4362  C CG   . TRP A 1 51 ? 7.367   -12.299 -8.740  1.00 0.00 ? 52 TRP A CG   4  
ATOM 4363  C CD1  . TRP A 1 51 ? 7.758   -13.556 -8.551  1.00 0.00 ? 52 TRP A CD1  4  
ATOM 4364  C CD2  . TRP A 1 51 ? 6.575   -12.282 -9.950  1.00 0.00 ? 52 TRP A CD2  4  
ATOM 4365  N NE1  . TRP A 1 51 ? 7.251   -14.341 -9.568  1.00 0.00 ? 52 TRP A NE1  4  
ATOM 4366  C CE2  . TRP A 1 51 ? 6.509   -13.594 -10.462 1.00 0.00 ? 52 TRP A CE2  4  
ATOM 4367  C CE3  . TRP A 1 51 ? 5.912   -11.264 -10.640 1.00 0.00 ? 52 TRP A CE3  4  
ATOM 4368  C CZ2  . TRP A 1 51 ? 5.803   -13.888 -11.628 1.00 0.00 ? 52 TRP A CZ2  4  
ATOM 4369  C CZ3  . TRP A 1 51 ? 5.200   -11.546 -11.809 1.00 0.00 ? 52 TRP A CZ3  4  
ATOM 4370  C CH2  . TRP A 1 51 ? 5.141   -12.858 -12.305 1.00 0.00 ? 52 TRP A CH2  4  
ATOM 4371  H H    . TRP A 1 51 ? 9.879   -12.292 -8.535  1.00 0.00 ? 52 TRP A H    4  
ATOM 4372  H HA   . TRP A 1 51 ? 8.563   -9.863  -9.281  1.00 0.00 ? 52 TRP A HA   4  
ATOM 4373  H HB2  . TRP A 1 51 ? 7.964   -11.577 -6.866  1.00 0.00 ? 52 TRP A HB2  4  
ATOM 4374  H HB3  . TRP A 1 51 ? 6.854   -10.548 -7.743  1.00 0.00 ? 52 TRP A HB3  4  
ATOM 4375  H HD1  . TRP A 1 51 ? 8.365   -13.885 -7.734  1.00 0.00 ? 52 TRP A HD1  4  
ATOM 4376  H HE1  . TRP A 1 51 ? 7.388   -15.300 -9.659  1.00 0.00 ? 52 TRP A HE1  4  
ATOM 4377  H HE3  . TRP A 1 51 ? 5.961   -10.253 -10.273 1.00 0.00 ? 52 TRP A HE3  4  
ATOM 4378  H HZ2  . TRP A 1 51 ? 5.764   -14.900 -12.002 1.00 0.00 ? 52 TRP A HZ2  4  
ATOM 4379  H HZ3  . TRP A 1 51 ? 4.687   -10.751 -12.319 1.00 0.00 ? 52 TRP A HZ3  4  
ATOM 4380  H HH2  . TRP A 1 51 ? 4.589   -13.071 -13.209 1.00 0.00 ? 52 TRP A HH2  4  
ATOM 4381  N N    . GLU A 1 52 ? 9.703   -9.932  -6.187  1.00 0.00 ? 53 GLU A N    4  
ATOM 4382  C CA   . GLU A 1 52 ? 10.166  -9.042  -5.075  1.00 0.00 ? 53 GLU A CA   4  
ATOM 4383  C C    . GLU A 1 52 ? 10.863  -7.796  -5.629  1.00 0.00 ? 53 GLU A C    4  
ATOM 4384  O O    . GLU A 1 52 ? 10.561  -6.686  -5.238  1.00 0.00 ? 53 GLU A O    4  
ATOM 4385  C CB   . GLU A 1 52 ? 11.135  -9.806  -4.171  1.00 0.00 ? 53 GLU A CB   4  
ATOM 4386  C CG   . GLU A 1 52 ? 10.356  -10.804 -3.312  1.00 0.00 ? 53 GLU A CG   4  
ATOM 4387  C CD   . GLU A 1 52 ? 10.816  -10.697 -1.857  1.00 0.00 ? 53 GLU A CD   4  
ATOM 4388  O OE1  . GLU A 1 52 ? 10.461  -9.723  -1.215  1.00 0.00 ? 53 GLU A OE1  4  
ATOM 4389  O OE2  . GLU A 1 52 ? 11.516  -11.591 -1.410  1.00 0.00 ? 53 GLU A OE2  4  
ATOM 4390  H H    . GLU A 1 52 ? 9.642   -10.906 -6.046  1.00 0.00 ? 53 GLU A H    4  
ATOM 4391  H HA   . GLU A 1 52 ? 9.309   -8.729  -4.499  1.00 0.00 ? 53 GLU A HA   4  
ATOM 4392  H HB2  . GLU A 1 52 ? 11.852  -10.339 -4.780  1.00 0.00 ? 53 GLU A HB2  4  
ATOM 4393  H HB3  . GLU A 1 52 ? 11.653  -9.111  -3.529  1.00 0.00 ? 53 GLU A HB3  4  
ATOM 4394  H HG2  . GLU A 1 52 ? 9.299   -10.584 -3.373  1.00 0.00 ? 53 GLU A HG2  4  
ATOM 4395  H HG3  . GLU A 1 52 ? 10.535  -11.807 -3.671  1.00 0.00 ? 53 GLU A HG3  4  
ATOM 4396  N N    . ALA A 1 53 ? 11.778  -7.959  -6.542  1.00 0.00 ? 54 ALA A N    4  
ATOM 4397  C CA   . ALA A 1 53 ? 12.461  -6.767  -7.113  1.00 0.00 ? 54 ALA A CA   4  
ATOM 4398  C C    . ALA A 1 53 ? 11.432  -5.933  -7.874  1.00 0.00 ? 54 ALA A C    4  
ATOM 4399  O O    . ALA A 1 53 ? 11.316  -4.739  -7.683  1.00 0.00 ? 54 ALA A O    4  
ATOM 4400  C CB   . ALA A 1 53 ? 13.569  -7.215  -8.069  1.00 0.00 ? 54 ALA A CB   4  
ATOM 4401  H H    . ALA A 1 53 ? 12.004  -8.858  -6.860  1.00 0.00 ? 54 ALA A H    4  
ATOM 4402  H HA   . ALA A 1 53 ? 12.883  -6.175  -6.317  1.00 0.00 ? 54 ALA A HA   4  
ATOM 4403  H HB1  . ALA A 1 53 ? 13.850  -8.233  -7.841  1.00 0.00 ? 54 ALA A HB1  4  
ATOM 4404  H HB2  . ALA A 1 53 ? 13.211  -7.160  -9.087  1.00 0.00 ? 54 ALA A HB2  4  
ATOM 4405  H HB3  . ALA A 1 53 ? 14.427  -6.570  -7.954  1.00 0.00 ? 54 ALA A HB3  4  
ATOM 4406  N N    . LYS A 1 54 ? 10.682  -6.562  -8.733  1.00 0.00 ? 55 LYS A N    4  
ATOM 4407  C CA   . LYS A 1 54 ? 9.648   -5.825  -9.513  1.00 0.00 ? 55 LYS A CA   4  
ATOM 4408  C C    . LYS A 1 54 ? 8.747   -5.014  -8.575  1.00 0.00 ? 55 LYS A C    4  
ATOM 4409  O O    . LYS A 1 54 ? 8.444   -3.867  -8.836  1.00 0.00 ? 55 LYS A O    4  
ATOM 4410  C CB   . LYS A 1 54 ? 8.794   -6.824  -10.291 1.00 0.00 ? 55 LYS A CB   4  
ATOM 4411  C CG   . LYS A 1 54 ? 9.427   -7.087  -11.658 1.00 0.00 ? 55 LYS A CG   4  
ATOM 4412  C CD   . LYS A 1 54 ? 8.726   -6.235  -12.719 1.00 0.00 ? 55 LYS A CD   4  
ATOM 4413  C CE   . LYS A 1 54 ? 9.636   -6.083  -13.939 1.00 0.00 ? 55 LYS A CE   4  
ATOM 4414  N NZ   . LYS A 1 54 ? 8.808   -6.080  -15.177 1.00 0.00 ? 55 LYS A NZ   4  
ATOM 4415  H H    . LYS A 1 54 ? 10.799  -7.526  -8.866  1.00 0.00 ? 55 LYS A H    4  
ATOM 4416  H HA   . LYS A 1 54 ? 10.133  -5.157  -10.203 1.00 0.00 ? 55 LYS A HA   4  
ATOM 4417  H HB2  . LYS A 1 54 ? 8.731   -7.749  -9.737  1.00 0.00 ? 55 LYS A HB2  4  
ATOM 4418  H HB3  . LYS A 1 54 ? 7.803   -6.419  -10.428 1.00 0.00 ? 55 LYS A HB3  4  
ATOM 4419  H HG2  . LYS A 1 54 ? 10.477  -6.830  -11.624 1.00 0.00 ? 55 LYS A HG2  4  
ATOM 4420  H HG3  . LYS A 1 54 ? 9.321   -8.132  -11.911 1.00 0.00 ? 55 LYS A HG3  4  
ATOM 4421  H HD2  . LYS A 1 54 ? 7.804   -6.714  -13.012 1.00 0.00 ? 55 LYS A HD2  4  
ATOM 4422  H HD3  . LYS A 1 54 ? 8.510   -5.259  -12.310 1.00 0.00 ? 55 LYS A HD3  4  
ATOM 4423  H HE2  . LYS A 1 54 ? 10.182  -5.154  -13.868 1.00 0.00 ? 55 LYS A HE2  4  
ATOM 4424  H HE3  . LYS A 1 54 ? 10.332  -6.908  -13.973 1.00 0.00 ? 55 LYS A HE3  4  
ATOM 4425  H HZ1  . LYS A 1 54 ? 7.882   -6.507  -14.977 1.00 0.00 ? 55 LYS A HZ1  4  
ATOM 4426  H HZ2  . LYS A 1 54 ? 8.673   -5.103  -15.502 1.00 0.00 ? 55 LYS A HZ2  4  
ATOM 4427  H HZ3  . LYS A 1 54 ? 9.292   -6.628  -15.919 1.00 0.00 ? 55 LYS A HZ3  4  
ATOM 4428  N N    . ALA A 1 55 ? 8.312   -5.594  -7.490  1.00 0.00 ? 56 ALA A N    4  
ATOM 4429  C CA   . ALA A 1 55 ? 7.431   -4.846  -6.554  1.00 0.00 ? 56 ALA A CA   4  
ATOM 4430  C C    . ALA A 1 55 ? 8.131   -3.552  -6.143  1.00 0.00 ? 56 ALA A C    4  
ATOM 4431  O O    . ALA A 1 55 ? 7.544   -2.488  -6.136  1.00 0.00 ? 56 ALA A O    4  
ATOM 4432  C CB   . ALA A 1 55 ? 7.157   -5.699  -5.314  1.00 0.00 ? 56 ALA A CB   4  
ATOM 4433  H H    . ALA A 1 55 ? 8.563   -6.515  -7.290  1.00 0.00 ? 56 ALA A H    4  
ATOM 4434  H HA   . ALA A 1 55 ? 6.496   -4.616  -7.048  1.00 0.00 ? 56 ALA A HA   4  
ATOM 4435  H HB1  . ALA A 1 55 ? 7.035   -6.731  -5.608  1.00 0.00 ? 56 ALA A HB1  4  
ATOM 4436  H HB2  . ALA A 1 55 ? 7.988   -5.616  -4.630  1.00 0.00 ? 56 ALA A HB2  4  
ATOM 4437  H HB3  . ALA A 1 55 ? 6.255   -5.353  -4.830  1.00 0.00 ? 56 ALA A HB3  4  
ATOM 4438  N N    . ALA A 1 56 ? 9.389   -3.636  -5.810  1.00 0.00 ? 57 ALA A N    4  
ATOM 4439  C CA   . ALA A 1 56 ? 10.139  -2.415  -5.412  1.00 0.00 ? 57 ALA A CA   4  
ATOM 4440  C C    . ALA A 1 56 ? 10.025  -1.380  -6.529  1.00 0.00 ? 57 ALA A C    4  
ATOM 4441  O O    . ALA A 1 56 ? 9.738   -0.223  -6.295  1.00 0.00 ? 57 ALA A O    4  
ATOM 4442  C CB   . ALA A 1 56 ? 11.611  -2.772  -5.203  1.00 0.00 ? 57 ALA A CB   4  
ATOM 4443  H H    . ALA A 1 56 ? 9.843   -4.505  -5.830  1.00 0.00 ? 57 ALA A H    4  
ATOM 4444  H HA   . ALA A 1 56 ? 9.727   -2.014  -4.499  1.00 0.00 ? 57 ALA A HA   4  
ATOM 4445  H HB1  . ALA A 1 56 ? 11.981  -3.291  -6.077  1.00 0.00 ? 57 ALA A HB1  4  
ATOM 4446  H HB2  . ALA A 1 56 ? 12.183  -1.869  -5.050  1.00 0.00 ? 57 ALA A HB2  4  
ATOM 4447  H HB3  . ALA A 1 56 ? 11.708  -3.411  -4.337  1.00 0.00 ? 57 ALA A HB3  4  
ATOM 4448  N N    . LYS A 1 57 ? 10.249  -1.793  -7.746  1.00 0.00 ? 58 LYS A N    4  
ATOM 4449  C CA   . LYS A 1 57 ? 10.154  -0.840  -8.886  1.00 0.00 ? 58 LYS A CA   4  
ATOM 4450  C C    . LYS A 1 57 ? 8.838   -0.064  -8.798  1.00 0.00 ? 58 LYS A C    4  
ATOM 4451  O O    . LYS A 1 57 ? 8.828   1.149   -8.824  1.00 0.00 ? 58 LYS A O    4  
ATOM 4452  C CB   . LYS A 1 57 ? 10.210  -1.615  -10.203 1.00 0.00 ? 58 LYS A CB   4  
ATOM 4453  C CG   . LYS A 1 57 ? 11.649  -2.057  -10.473 1.00 0.00 ? 58 LYS A CG   4  
ATOM 4454  C CD   . LYS A 1 57 ? 12.061  -1.618  -11.878 1.00 0.00 ? 58 LYS A CD   4  
ATOM 4455  C CE   . LYS A 1 57 ? 11.553  -2.638  -12.899 1.00 0.00 ? 58 LYS A CE   4  
ATOM 4456  N NZ   . LYS A 1 57 ? 11.917  -2.190  -14.274 1.00 0.00 ? 58 LYS A NZ   4  
ATOM 4457  H H    . LYS A 1 57 ? 10.480  -2.732  -7.908  1.00 0.00 ? 58 LYS A H    4  
ATOM 4458  H HA   . LYS A 1 57 ? 10.979  -0.145  -8.841  1.00 0.00 ? 58 LYS A HA   4  
ATOM 4459  H HB2  . LYS A 1 57 ? 9.571   -2.483  -10.139 1.00 0.00 ? 58 LYS A HB2  4  
ATOM 4460  H HB3  . LYS A 1 57 ? 9.875   -0.980  -11.010 1.00 0.00 ? 58 LYS A HB3  4  
ATOM 4461  H HG2  . LYS A 1 57 ? 12.307  -1.604  -9.745  1.00 0.00 ? 58 LYS A HG2  4  
ATOM 4462  H HG3  . LYS A 1 57 ? 11.715  -3.132  -10.400 1.00 0.00 ? 58 LYS A HG3  4  
ATOM 4463  H HD2  . LYS A 1 57 ? 11.633  -0.649  -12.093 1.00 0.00 ? 58 LYS A HD2  4  
ATOM 4464  H HD3  . LYS A 1 57 ? 13.137  -1.558  -11.937 1.00 0.00 ? 58 LYS A HD3  4  
ATOM 4465  H HE2  . LYS A 1 57 ? 12.004  -3.600  -12.702 1.00 0.00 ? 58 LYS A HE2  4  
ATOM 4466  H HE3  . LYS A 1 57 ? 10.479  -2.721  -12.820 1.00 0.00 ? 58 LYS A HE3  4  
ATOM 4467  H HZ1  . LYS A 1 57 ? 12.813  -1.665  -14.241 1.00 0.00 ? 58 LYS A HZ1  4  
ATOM 4468  H HZ2  . LYS A 1 57 ? 12.023  -3.021  -14.891 1.00 0.00 ? 58 LYS A HZ2  4  
ATOM 4469  H HZ3  . LYS A 1 57 ? 11.169  -1.573  -14.646 1.00 0.00 ? 58 LYS A HZ3  4  
ATOM 4470  N N    . ALA A 1 58 ? 7.725   -0.743  -8.689  1.00 0.00 ? 59 ALA A N    4  
ATOM 4471  C CA   . ALA A 1 58 ? 6.431   -0.009  -8.593  1.00 0.00 ? 59 ALA A CA   4  
ATOM 4472  C C    . ALA A 1 58 ? 6.483   0.916   -7.387  1.00 0.00 ? 59 ALA A C    4  
ATOM 4473  O O    . ALA A 1 58 ? 5.907   1.973   -7.388  1.00 0.00 ? 59 ALA A O    4  
ATOM 4474  C CB   . ALA A 1 58 ? 5.269   -0.989  -8.407  1.00 0.00 ? 59 ALA A CB   4  
ATOM 4475  H H    . ALA A 1 58 ? 7.741   -1.724  -8.662  1.00 0.00 ? 59 ALA A H    4  
ATOM 4476  H HA   . ALA A 1 58 ? 6.277   0.575   -9.490  1.00 0.00 ? 59 ALA A HA   4  
ATOM 4477  H HB1  . ALA A 1 58 ? 5.644   -1.925  -8.025  1.00 0.00 ? 59 ALA A HB1  4  
ATOM 4478  H HB2  . ALA A 1 58 ? 4.554   -0.570  -7.702  1.00 0.00 ? 59 ALA A HB2  4  
ATOM 4479  H HB3  . ALA A 1 58 ? 4.782   -1.155  -9.356  1.00 0.00 ? 59 ALA A HB3  4  
ATOM 4480  N N    . LYS A 1 59 ? 7.169   0.516   -6.357  1.00 0.00 ? 60 LYS A N    4  
ATOM 4481  C CA   . LYS A 1 59 ? 7.257   1.352   -5.144  1.00 0.00 ? 60 LYS A CA   4  
ATOM 4482  C C    . LYS A 1 59 ? 7.855   2.708   -5.484  1.00 0.00 ? 60 LYS A C    4  
ATOM 4483  O O    . LYS A 1 59 ? 7.342   3.734   -5.108  1.00 0.00 ? 60 LYS A O    4  
ATOM 4484  C CB   . LYS A 1 59 ? 8.159   0.638   -4.156  1.00 0.00 ? 60 LYS A CB   4  
ATOM 4485  C CG   . LYS A 1 59 ? 7.450   0.509   -2.808  1.00 0.00 ? 60 LYS A CG   4  
ATOM 4486  C CD   . LYS A 1 59 ? 7.958   1.596   -1.859  1.00 0.00 ? 60 LYS A CD   4  
ATOM 4487  C CE   . LYS A 1 59 ? 9.162   1.066   -1.081  1.00 0.00 ? 60 LYS A CE   4  
ATOM 4488  N NZ   . LYS A 1 59 ? 9.374   1.900   0.135   1.00 0.00 ? 60 LYS A NZ   4  
ATOM 4489  H H    . LYS A 1 59 ? 7.632   -0.345  -6.374  1.00 0.00 ? 60 LYS A H    4  
ATOM 4490  H HA   . LYS A 1 59 ? 6.277   1.485   -4.717  1.00 0.00 ? 60 LYS A HA   4  
ATOM 4491  H HB2  . LYS A 1 59 ? 8.396   -0.340  -4.544  1.00 0.00 ? 60 LYS A HB2  4  
ATOM 4492  H HB3  . LYS A 1 59 ? 9.066   1.196   -4.040  1.00 0.00 ? 60 LYS A HB3  4  
ATOM 4493  H HG2  . LYS A 1 59 ? 6.384   0.623   -2.950  1.00 0.00 ? 60 LYS A HG2  4  
ATOM 4494  H HG3  . LYS A 1 59 ? 7.655   -0.461  -2.382  1.00 0.00 ? 60 LYS A HG3  4  
ATOM 4495  H HD2  . LYS A 1 59 ? 8.249   2.465   -2.431  1.00 0.00 ? 60 LYS A HD2  4  
ATOM 4496  H HD3  . LYS A 1 59 ? 7.174   1.866   -1.166  1.00 0.00 ? 60 LYS A HD3  4  
ATOM 4497  H HE2  . LYS A 1 59 ? 8.979   0.044   -0.789  1.00 0.00 ? 60 LYS A HE2  4  
ATOM 4498  H HE3  . LYS A 1 59 ? 10.042  1.111   -1.707  1.00 0.00 ? 60 LYS A HE3  4  
ATOM 4499  H HZ1  . LYS A 1 59 ? 8.745   2.727   0.102   1.00 0.00 ? 60 LYS A HZ1  4  
ATOM 4500  H HZ2  . LYS A 1 59 ? 9.159   1.338   0.982   1.00 0.00 ? 60 LYS A HZ2  4  
ATOM 4501  H HZ3  . LYS A 1 59 ? 10.364  2.217   0.169   1.00 0.00 ? 60 LYS A HZ3  4  
ATOM 4502  N N    . ASP A 1 60 ? 8.948   2.717   -6.180  1.00 0.00 ? 61 ASP A N    4  
ATOM 4503  C CA   . ASP A 1 60 ? 9.585   4.017   -6.535  1.00 0.00 ? 61 ASP A CA   4  
ATOM 4504  C C    . ASP A 1 60 ? 8.682   4.787   -7.506  1.00 0.00 ? 61 ASP A C    4  
ATOM 4505  O O    . ASP A 1 60 ? 8.413   5.958   -7.323  1.00 0.00 ? 61 ASP A O    4  
ATOM 4506  C CB   . ASP A 1 60 ? 10.949  3.751   -7.184  1.00 0.00 ? 61 ASP A CB   4  
ATOM 4507  C CG   . ASP A 1 60 ? 11.425  5.000   -7.931  1.00 0.00 ? 61 ASP A CG   4  
ATOM 4508  O OD1  . ASP A 1 60 ? 11.002  5.189   -9.060  1.00 0.00 ? 61 ASP A OD1  4  
ATOM 4509  O OD2  . ASP A 1 60 ? 12.205  5.746   -7.362  1.00 0.00 ? 61 ASP A OD2  4  
ATOM 4510  H H    . ASP A 1 60 ? 9.356   1.866   -6.461  1.00 0.00 ? 61 ASP A H    4  
ATOM 4511  H HA   . ASP A 1 60 ? 9.720   4.603   -5.639  1.00 0.00 ? 61 ASP A HA   4  
ATOM 4512  H HB2  . ASP A 1 60 ? 11.665  3.496   -6.418  1.00 0.00 ? 61 ASP A HB2  4  
ATOM 4513  H HB3  . ASP A 1 60 ? 10.860  2.928   -7.880  1.00 0.00 ? 61 ASP A HB3  4  
ATOM 4514  N N    . ASP A 1 61 ? 8.216   4.140   -8.533  1.00 0.00 ? 62 ASP A N    4  
ATOM 4515  C CA   . ASP A 1 61 ? 7.332   4.826   -9.518  1.00 0.00 ? 62 ASP A CA   4  
ATOM 4516  C C    . ASP A 1 61 ? 5.947   5.045   -8.907  1.00 0.00 ? 62 ASP A C    4  
ATOM 4517  O O    . ASP A 1 61 ? 5.092   5.682   -9.488  1.00 0.00 ? 62 ASP A O    4  
ATOM 4518  C CB   . ASP A 1 61 ? 7.194   3.936   -10.751 1.00 0.00 ? 62 ASP A CB   4  
ATOM 4519  C CG   . ASP A 1 61 ? 8.569   3.725   -11.388 1.00 0.00 ? 62 ASP A CG   4  
ATOM 4520  O OD1  . ASP A 1 61 ? 9.342   4.668   -11.406 1.00 0.00 ? 62 ASP A OD1  4  
ATOM 4521  O OD2  . ASP A 1 61 ? 8.825   2.624   -11.847 1.00 0.00 ? 62 ASP A OD2  4  
ATOM 4522  H H    . ASP A 1 61 ? 8.446   3.197   -8.659  1.00 0.00 ? 62 ASP A H    4  
ATOM 4523  H HA   . ASP A 1 61 ? 7.762   5.775   -9.799  1.00 0.00 ? 62 ASP A HA   4  
ATOM 4524  H HB2  . ASP A 1 61 ? 6.783   2.980   -10.451 1.00 0.00 ? 62 ASP A HB2  4  
ATOM 4525  H HB3  . ASP A 1 61 ? 6.535   4.406   -11.463 1.00 0.00 ? 62 ASP A HB3  4  
ATOM 4526  N N    . TYR A 1 62 ? 5.715   4.498   -7.749  1.00 0.00 ? 63 TYR A N    4  
ATOM 4527  C CA   . TYR A 1 62 ? 4.386   4.639   -7.098  1.00 0.00 ? 63 TYR A CA   4  
ATOM 4528  C C    . TYR A 1 62 ? 4.397   5.790   -6.086  1.00 0.00 ? 63 TYR A C    4  
ATOM 4529  O O    . TYR A 1 62 ? 3.449   6.536   -5.979  1.00 0.00 ? 63 TYR A O    4  
ATOM 4530  C CB   . TYR A 1 62 ? 4.082   3.333   -6.386  1.00 0.00 ? 63 TYR A CB   4  
ATOM 4531  C CG   . TYR A 1 62 ? 2.938   3.523   -5.448  1.00 0.00 ? 63 TYR A CG   4  
ATOM 4532  C CD1  . TYR A 1 62 ? 1.647   3.681   -5.949  1.00 0.00 ? 63 TYR A CD1  4  
ATOM 4533  C CD2  . TYR A 1 62 ? 3.172   3.529   -4.077  1.00 0.00 ? 63 TYR A CD2  4  
ATOM 4534  C CE1  . TYR A 1 62 ? 0.578   3.843   -5.071  1.00 0.00 ? 63 TYR A CE1  4  
ATOM 4535  C CE2  . TYR A 1 62 ? 2.106   3.691   -3.192  1.00 0.00 ? 63 TYR A CE2  4  
ATOM 4536  C CZ   . TYR A 1 62 ? 0.804   3.847   -3.687  1.00 0.00 ? 63 TYR A CZ   4  
ATOM 4537  O OH   . TYR A 1 62 ? -0.254  4.009   -2.815  1.00 0.00 ? 63 TYR A OH   4  
ATOM 4538  H H    . TYR A 1 62 ? 6.412   3.971   -7.312  1.00 0.00 ? 63 TYR A H    4  
ATOM 4539  H HA   . TYR A 1 62 ? 3.627   4.820   -7.841  1.00 0.00 ? 63 TYR A HA   4  
ATOM 4540  H HB2  . TYR A 1 62 ? 3.830   2.580   -7.116  1.00 0.00 ? 63 TYR A HB2  4  
ATOM 4541  H HB3  . TYR A 1 62 ? 4.953   3.017   -5.831  1.00 0.00 ? 63 TYR A HB3  4  
ATOM 4542  H HD1  . TYR A 1 62 ? 1.476   3.675   -7.015  1.00 0.00 ? 63 TYR A HD1  4  
ATOM 4543  H HD2  . TYR A 1 62 ? 4.183   3.417   -3.704  1.00 0.00 ? 63 TYR A HD2  4  
ATOM 4544  H HE1  . TYR A 1 62 ? -0.417  3.965   -5.460  1.00 0.00 ? 63 TYR A HE1  4  
ATOM 4545  H HE2  . TYR A 1 62 ? 2.287   3.685   -2.131  1.00 0.00 ? 63 TYR A HE2  4  
ATOM 4546  H HH   . TYR A 1 62 ? -0.214  3.303   -2.168  1.00 0.00 ? 63 TYR A HH   4  
ATOM 4547  N N    . ASP A 1 63 ? 5.451   5.939   -5.342  1.00 0.00 ? 64 ASP A N    4  
ATOM 4548  C CA   . ASP A 1 63 ? 5.508   7.039   -4.349  1.00 0.00 ? 64 ASP A CA   4  
ATOM 4549  C C    . ASP A 1 63 ? 5.643   8.354   -5.094  1.00 0.00 ? 64 ASP A C    4  
ATOM 4550  O O    . ASP A 1 63 ? 5.091   9.369   -4.718  1.00 0.00 ? 64 ASP A O    4  
ATOM 4551  C CB   . ASP A 1 63 ? 6.718   6.842   -3.462  1.00 0.00 ? 64 ASP A CB   4  
ATOM 4552  C CG   . ASP A 1 63 ? 6.589   7.706   -2.207  1.00 0.00 ? 64 ASP A CG   4  
ATOM 4553  O OD1  . ASP A 1 63 ? 6.349   8.893   -2.352  1.00 0.00 ? 64 ASP A OD1  4  
ATOM 4554  O OD2  . ASP A 1 63 ? 6.732   7.166   -1.122  1.00 0.00 ? 64 ASP A OD2  4  
ATOM 4555  H H    . ASP A 1 63 ? 6.206   5.333   -5.437  1.00 0.00 ? 64 ASP A H    4  
ATOM 4556  H HA   . ASP A 1 63 ? 4.624   7.036   -3.746  1.00 0.00 ? 64 ASP A HA   4  
ATOM 4557  H HB2  . ASP A 1 63 ? 6.769   5.809   -3.188  1.00 0.00 ? 64 ASP A HB2  4  
ATOM 4558  H HB3  . ASP A 1 63 ? 7.606   7.120   -4.001  1.00 0.00 ? 64 ASP A HB3  4  
ATOM 4559  N N    . ARG A 1 64 ? 6.393   8.331   -6.152  1.00 0.00 ? 65 ARG A N    4  
ATOM 4560  C CA   . ARG A 1 64 ? 6.602   9.564   -6.948  1.00 0.00 ? 65 ARG A CA   4  
ATOM 4561  C C    . ARG A 1 64 ? 5.369   9.861   -7.808  1.00 0.00 ? 65 ARG A C    4  
ATOM 4562  O O    . ARG A 1 64 ? 4.985   11.000  -7.988  1.00 0.00 ? 65 ARG A O    4  
ATOM 4563  C CB   . ARG A 1 64 ? 7.817   9.383   -7.859  1.00 0.00 ? 65 ARG A CB   4  
ATOM 4564  C CG   . ARG A 1 64 ? 8.448   10.749  -8.140  1.00 0.00 ? 65 ARG A CG   4  
ATOM 4565  C CD   . ARG A 1 64 ? 9.476   10.620  -9.265  1.00 0.00 ? 65 ARG A CD   4  
ATOM 4566  N NE   . ARG A 1 64 ? 10.383  11.803  -9.246  1.00 0.00 ? 65 ARG A NE   4  
ATOM 4567  C CZ   . ARG A 1 64 ? 10.910  12.240  -10.356 1.00 0.00 ? 65 ARG A CZ   4  
ATOM 4568  N NH1  . ARG A 1 64 ? 11.984  11.673  -10.835 1.00 0.00 ? 65 ARG A NH1  4  
ATOM 4569  N NH2  . ARG A 1 64 ? 10.367  13.244  -10.986 1.00 0.00 ? 65 ARG A NH2  4  
ATOM 4570  H H    . ARG A 1 64 ? 6.830   7.493   -6.414  1.00 0.00 ? 65 ARG A H    4  
ATOM 4571  H HA   . ARG A 1 64 ? 6.777   10.383  -6.278  1.00 0.00 ? 65 ARG A HA   4  
ATOM 4572  H HB2  . ARG A 1 64 ? 8.540   8.744   -7.371  1.00 0.00 ? 65 ARG A HB2  4  
ATOM 4573  H HB3  . ARG A 1 64 ? 7.507   8.932   -8.789  1.00 0.00 ? 65 ARG A HB3  4  
ATOM 4574  H HG2  . ARG A 1 64 ? 7.677   11.447  -8.433  1.00 0.00 ? 65 ARG A HG2  4  
ATOM 4575  H HG3  . ARG A 1 64 ? 8.938   11.109  -7.247  1.00 0.00 ? 65 ARG A HG3  4  
ATOM 4576  H HD2  . ARG A 1 64 ? 10.056  9.721   -9.121  1.00 0.00 ? 65 ARG A HD2  4  
ATOM 4577  H HD3  . ARG A 1 64 ? 8.967   10.572  -10.216 1.00 0.00 ? 65 ARG A HD3  4  
ATOM 4578  H HE   . ARG A 1 64 ? 10.582  12.254  -8.398  1.00 0.00 ? 65 ARG A HE   4  
ATOM 4579  H HH11 . ARG A 1 64 ? 12.402  10.905  -10.351 1.00 0.00 ? 65 ARG A HH11 4  
ATOM 4580  H HH12 . ARG A 1 64 ? 12.389  12.009  -11.685 1.00 0.00 ? 65 ARG A HH12 4  
ATOM 4581  H HH21 . ARG A 1 64 ? 9.546   13.679  -10.618 1.00 0.00 ? 65 ARG A HH21 4  
ATOM 4582  H HH22 . ARG A 1 64 ? 10.773  13.579  -11.837 1.00 0.00 ? 65 ARG A HH22 4  
ATOM 4583  N N    . ALA A 1 65 ? 4.761   8.848   -8.359  1.00 0.00 ? 66 ALA A N    4  
ATOM 4584  C CA   . ALA A 1 65 ? 3.568   9.076   -9.230  1.00 0.00 ? 66 ALA A CA   4  
ATOM 4585  C C    . ALA A 1 65 ? 2.328   9.387   -8.393  1.00 0.00 ? 66 ALA A C    4  
ATOM 4586  O O    . ALA A 1 65 ? 1.450   10.092  -8.841  1.00 0.00 ? 66 ALA A O    4  
ATOM 4587  C CB   . ALA A 1 65 ? 3.307   7.828   -10.078 1.00 0.00 ? 66 ALA A CB   4  
ATOM 4588  H H    . ALA A 1 65 ? 5.098   7.941   -8.216  1.00 0.00 ? 66 ALA A H    4  
ATOM 4589  H HA   . ALA A 1 65 ? 3.758   9.915   -9.884  1.00 0.00 ? 66 ALA A HA   4  
ATOM 4590  H HB1  . ALA A 1 65 ? 4.178   7.612   -10.679 1.00 0.00 ? 66 ALA A HB1  4  
ATOM 4591  H HB2  . ALA A 1 65 ? 3.100   6.989   -9.429  1.00 0.00 ? 66 ALA A HB2  4  
ATOM 4592  H HB3  . ALA A 1 65 ? 2.458   8.002   -10.722 1.00 0.00 ? 66 ALA A HB3  4  
ATOM 4593  N N    . VAL A 1 66 ? 2.227   8.886   -7.191  1.00 0.00 ? 67 VAL A N    4  
ATOM 4594  C CA   . VAL A 1 66 ? 1.019   9.203   -6.393  1.00 0.00 ? 67 VAL A CA   4  
ATOM 4595  C C    . VAL A 1 66 ? 0.991   10.697  -6.135  1.00 0.00 ? 67 VAL A C    4  
ATOM 4596  O O    . VAL A 1 66 ? -0.022  11.326  -6.258  1.00 0.00 ? 67 VAL A O    4  
ATOM 4597  C CB   . VAL A 1 66 ? 1.013   8.468   -5.073  1.00 0.00 ? 67 VAL A CB   4  
ATOM 4598  C CG1  . VAL A 1 66 ? 1.014   6.967   -5.315  1.00 0.00 ? 67 VAL A CG1  4  
ATOM 4599  C CG2  . VAL A 1 66 ? 2.227   8.876   -4.289  1.00 0.00 ? 67 VAL A CG2  4  
ATOM 4600  H H    . VAL A 1 66 ? 2.929   8.323   -6.823  1.00 0.00 ? 67 VAL A H    4  
ATOM 4601  H HA   . VAL A 1 66 ? 0.156   8.923   -6.944  1.00 0.00 ? 67 VAL A HA   4  
ATOM 4602  H HB   . VAL A 1 66 ? 0.133   8.742   -4.528  1.00 0.00 ? 67 VAL A HB   4  
ATOM 4603  H HG11 . VAL A 1 66 ? 1.331   6.769   -6.327  1.00 0.00 ? 67 VAL A HG11 4  
ATOM 4604  H HG12 . VAL A 1 66 ? 1.689   6.491   -4.622  1.00 0.00 ? 67 VAL A HG12 4  
ATOM 4605  H HG13 . VAL A 1 66 ? 0.015   6.585   -5.167  1.00 0.00 ? 67 VAL A HG13 4  
ATOM 4606  H HG21 . VAL A 1 66 ? 3.031   9.066   -4.975  1.00 0.00 ? 67 VAL A HG21 4  
ATOM 4607  H HG22 . VAL A 1 66 ? 1.992   9.774   -3.741  1.00 0.00 ? 67 VAL A HG22 4  
ATOM 4608  H HG23 . VAL A 1 66 ? 2.499   8.086   -3.608  1.00 0.00 ? 67 VAL A HG23 4  
ATOM 4609  N N    . LYS A 1 67 ? 2.104   11.273  -5.790  1.00 0.00 ? 68 LYS A N    4  
ATOM 4610  C CA   . LYS A 1 67 ? 2.130   12.743  -5.549  1.00 0.00 ? 68 LYS A CA   4  
ATOM 4611  C C    . LYS A 1 67 ? 1.382   13.429  -6.693  1.00 0.00 ? 68 LYS A C    4  
ATOM 4612  O O    . LYS A 1 67 ? 0.560   14.296  -6.485  1.00 0.00 ? 68 LYS A O    4  
ATOM 4613  C CB   . LYS A 1 67 ? 3.578   13.234  -5.517  1.00 0.00 ? 68 LYS A CB   4  
ATOM 4614  C CG   . LYS A 1 67 ? 4.091   13.222  -4.077  1.00 0.00 ? 68 LYS A CG   4  
ATOM 4615  C CD   . LYS A 1 67 ? 5.560   13.645  -4.055  1.00 0.00 ? 68 LYS A CD   4  
ATOM 4616  C CE   . LYS A 1 67 ? 5.821   14.514  -2.823  1.00 0.00 ? 68 LYS A CE   4  
ATOM 4617  N NZ   . LYS A 1 67 ? 5.648   13.691  -1.593  1.00 0.00 ? 68 LYS A NZ   4  
ATOM 4618  H H    . LYS A 1 67 ? 2.920   10.743  -5.701  1.00 0.00 ? 68 LYS A H    4  
ATOM 4619  H HA   . LYS A 1 67 ? 1.646   12.968  -4.609  1.00 0.00 ? 68 LYS A HA   4  
ATOM 4620  H HB2  . LYS A 1 67 ? 4.191   12.586  -6.125  1.00 0.00 ? 68 LYS A HB2  4  
ATOM 4621  H HB3  . LYS A 1 67 ? 3.624   14.240  -5.903  1.00 0.00 ? 68 LYS A HB3  4  
ATOM 4622  H HG2  . LYS A 1 67 ? 3.508   13.911  -3.482  1.00 0.00 ? 68 LYS A HG2  4  
ATOM 4623  H HG3  . LYS A 1 67 ? 3.998   12.227  -3.670  1.00 0.00 ? 68 LYS A HG3  4  
ATOM 4624  H HD2  . LYS A 1 67 ? 6.187   12.766  -4.016  1.00 0.00 ? 68 LYS A HD2  4  
ATOM 4625  H HD3  . LYS A 1 67 ? 5.786   14.210  -4.947  1.00 0.00 ? 68 LYS A HD3  4  
ATOM 4626  H HE2  . LYS A 1 67 ? 6.829   14.899  -2.861  1.00 0.00 ? 68 LYS A HE2  4  
ATOM 4627  H HE3  . LYS A 1 67 ? 5.121   15.337  -2.808  1.00 0.00 ? 68 LYS A HE3  4  
ATOM 4628  H HZ1  . LYS A 1 67 ? 4.761   13.151  -1.659  1.00 0.00 ? 68 LYS A HZ1  4  
ATOM 4629  H HZ2  . LYS A 1 67 ? 6.446   13.032  -1.501  1.00 0.00 ? 68 LYS A HZ2  4  
ATOM 4630  H HZ3  . LYS A 1 67 ? 5.615   14.315  -0.761  1.00 0.00 ? 68 LYS A HZ3  4  
ATOM 4631  N N    . GLU A 1 68 ? 1.656   13.024  -7.905  1.00 0.00 ? 69 GLU A N    4  
ATOM 4632  C CA   . GLU A 1 68 ? 0.960   13.618  -9.082  1.00 0.00 ? 69 GLU A CA   4  
ATOM 4633  C C    . GLU A 1 68 ? -0.523  13.242  -9.011  1.00 0.00 ? 69 GLU A C    4  
ATOM 4634  O O    . GLU A 1 68 ? -1.405  14.020  -9.314  1.00 0.00 ? 69 GLU A O    4  
ATOM 4635  C CB   . GLU A 1 68 ? 1.574   13.024  -10.354 1.00 0.00 ? 69 GLU A CB   4  
ATOM 4636  C CG   . GLU A 1 68 ? 2.536   14.035  -10.979 1.00 0.00 ? 69 GLU A CG   4  
ATOM 4637  C CD   . GLU A 1 68 ? 2.466   13.929  -12.503 1.00 0.00 ? 69 GLU A CD   4  
ATOM 4638  O OE1  . GLU A 1 68 ? 2.900   12.916  -13.027 1.00 0.00 ? 69 GLU A OE1  4  
ATOM 4639  O OE2  . GLU A 1 68 ? 1.982   14.862  -13.121 1.00 0.00 ? 69 GLU A OE2  4  
ATOM 4640  H H    . GLU A 1 68 ? 2.317   12.312  -8.041  1.00 0.00 ? 69 GLU A H    4  
ATOM 4641  H HA   . GLU A 1 68 ? 1.076   14.691  -9.081  1.00 0.00 ? 69 GLU A HA   4  
ATOM 4642  H HB2  . GLU A 1 68 ? 2.117   12.114  -10.102 1.00 0.00 ? 69 GLU A HB2  4  
ATOM 4643  H HB3  . GLU A 1 68 ? 0.789   12.791  -11.056 1.00 0.00 ? 69 GLU A HB3  4  
ATOM 4644  H HG2  . GLU A 1 68 ? 2.257   15.033  -10.674 1.00 0.00 ? 69 GLU A HG2  4  
ATOM 4645  H HG3  . GLU A 1 68 ? 3.543   13.825  -10.652 1.00 0.00 ? 69 GLU A HG3  4  
ATOM 4646  N N    . PHE A 1 69 ? -0.770  12.038  -8.597  1.00 0.00 ? 70 PHE A N    4  
ATOM 4647  C CA   . PHE A 1 69 ? -2.154  11.502  -8.456  1.00 0.00 ? 70 PHE A CA   4  
ATOM 4648  C C    . PHE A 1 69 ? -2.918  12.248  -7.365  1.00 0.00 ? 70 PHE A C    4  
ATOM 4649  O O    . PHE A 1 69 ? -4.130  12.330  -7.378  1.00 0.00 ? 70 PHE A O    4  
ATOM 4650  C CB   . PHE A 1 69 ? -2.004  10.070  -8.014  1.00 0.00 ? 70 PHE A CB   4  
ATOM 4651  C CG   . PHE A 1 69 ? -3.249  9.634   -7.342  1.00 0.00 ? 70 PHE A CG   4  
ATOM 4652  C CD1  . PHE A 1 69 ? -4.331  9.258   -8.108  1.00 0.00 ? 70 PHE A CD1  4  
ATOM 4653  C CD2  . PHE A 1 69 ? -3.310  9.641   -5.957  1.00 0.00 ? 70 PHE A CD2  4  
ATOM 4654  C CE1  . PHE A 1 69 ? -5.515  8.868   -7.490  1.00 0.00 ? 70 PHE A CE1  4  
ATOM 4655  C CE2  . PHE A 1 69 ? -4.493  9.253   -5.318  1.00 0.00 ? 70 PHE A CE2  4  
ATOM 4656  C CZ   . PHE A 1 69 ? -5.602  8.864   -6.088  1.00 0.00 ? 70 PHE A CZ   4  
ATOM 4657  H H    . PHE A 1 69 ? -0.017  11.460  -8.361  1.00 0.00 ? 70 PHE A H    4  
ATOM 4658  H HA   . PHE A 1 69 ? -2.695  11.520  -9.385  1.00 0.00 ? 70 PHE A HA   4  
ATOM 4659  H HB2  . PHE A 1 69 ? -1.819  9.452   -8.873  1.00 0.00 ? 70 PHE A HB2  4  
ATOM 4660  H HB3  . PHE A 1 69 ? -1.189  10.009  -7.315  1.00 0.00 ? 70 PHE A HB3  4  
ATOM 4661  H HD1  . PHE A 1 69 ? -4.246  9.272   -9.185  1.00 0.00 ? 70 PHE A HD1  4  
ATOM 4662  H HD2  . PHE A 1 69 ? -2.436  9.953   -5.385  1.00 0.00 ? 70 PHE A HD2  4  
ATOM 4663  H HE1  . PHE A 1 69 ? -6.358  8.578   -8.091  1.00 0.00 ? 70 PHE A HE1  4  
ATOM 4664  H HE2  . PHE A 1 69 ? -4.553  9.255   -4.242  1.00 0.00 ? 70 PHE A HE2  4  
ATOM 4665  H HZ   . PHE A 1 69 ? -6.519  8.563   -5.604  1.00 0.00 ? 70 PHE A HZ   4  
ATOM 4666  N N    . GLU A 1 70 ? -2.219  12.751  -6.404  1.00 0.00 ? 71 GLU A N    4  
ATOM 4667  C CA   . GLU A 1 70 ? -2.891  13.446  -5.290  1.00 0.00 ? 71 GLU A CA   4  
ATOM 4668  C C    . GLU A 1 70 ? -2.969  14.921  -5.646  1.00 0.00 ? 71 GLU A C    4  
ATOM 4669  O O    . GLU A 1 70 ? -3.797  15.664  -5.158  1.00 0.00 ? 71 GLU A O    4  
ATOM 4670  C CB   . GLU A 1 70 ? -2.075  13.256  -4.007  1.00 0.00 ? 71 GLU A CB   4  
ATOM 4671  C CG   . GLU A 1 70 ? -1.988  11.761  -3.673  1.00 0.00 ? 71 GLU A CG   4  
ATOM 4672  C CD   . GLU A 1 70 ? -2.033  11.575  -2.156  1.00 0.00 ? 71 GLU A CD   4  
ATOM 4673  O OE1  . GLU A 1 70 ? -2.950  12.097  -1.542  1.00 0.00 ? 71 GLU A OE1  4  
ATOM 4674  O OE2  . GLU A 1 70 ? -1.151  10.914  -1.633  1.00 0.00 ? 71 GLU A OE2  4  
ATOM 4675  H H    . GLU A 1 70 ? -1.251  12.666  -6.414  1.00 0.00 ? 71 GLU A H    4  
ATOM 4676  H HA   . GLU A 1 70 ? -3.877  13.025  -5.159  1.00 0.00 ? 71 GLU A HA   4  
ATOM 4677  H HB2  . GLU A 1 70 ? -1.081  13.654  -4.149  1.00 0.00 ? 71 GLU A HB2  4  
ATOM 4678  H HB3  . GLU A 1 70 ? -2.559  13.775  -3.194  1.00 0.00 ? 71 GLU A HB3  4  
ATOM 4679  H HG2  . GLU A 1 70 ? -2.822  11.243  -4.123  1.00 0.00 ? 71 GLU A HG2  4  
ATOM 4680  H HG3  . GLU A 1 70 ? -1.061  11.352  -4.058  1.00 0.00 ? 71 GLU A HG3  4  
ATOM 4681  N N    . ALA A 1 71 ? -2.095  15.328  -6.515  1.00 0.00 ? 72 ALA A N    4  
ATOM 4682  C CA   . ALA A 1 71 ? -2.052  16.733  -6.967  1.00 0.00 ? 72 ALA A CA   4  
ATOM 4683  C C    . ALA A 1 71 ? -3.393  17.111  -7.601  1.00 0.00 ? 72 ALA A C    4  
ATOM 4684  O O    . ALA A 1 71 ? -3.733  18.272  -7.710  1.00 0.00 ? 72 ALA A O    4  
ATOM 4685  C CB   . ALA A 1 71 ? -0.934  16.833  -7.998  1.00 0.00 ? 72 ALA A CB   4  
ATOM 4686  H H    . ALA A 1 71 ? -1.452  14.690  -6.886  1.00 0.00 ? 72 ALA A H    4  
ATOM 4687  H HA   . ALA A 1 71 ? -1.838  17.384  -6.134  1.00 0.00 ? 72 ALA A HA   4  
ATOM 4688  H HB1  . ALA A 1 71 ? -0.470  15.856  -8.101  1.00 0.00 ? 72 ALA A HB1  4  
ATOM 4689  H HB2  . ALA A 1 71 ? -1.343  17.139  -8.948  1.00 0.00 ? 72 ALA A HB2  4  
ATOM 4690  H HB3  . ALA A 1 71 ? -0.199  17.553  -7.668  1.00 0.00 ? 72 ALA A HB3  4  
ATOM 4691  N N    . ASN A 1 72 ? -4.157  16.138  -8.017  1.00 0.00 ? 73 ASN A N    4  
ATOM 4692  C CA   . ASN A 1 72 ? -5.477  16.440  -8.639  1.00 0.00 ? 73 ASN A CA   4  
ATOM 4693  C C    . ASN A 1 72 ? -6.599  16.007  -7.693  1.00 0.00 ? 73 ASN A C    4  
ATOM 4694  O O    . ASN A 1 72 ? -7.621  16.656  -7.588  1.00 0.00 ? 73 ASN A O    4  
ATOM 4695  C CB   . ASN A 1 72 ? -5.606  15.684  -9.964  1.00 0.00 ? 73 ASN A CB   4  
ATOM 4696  C CG   . ASN A 1 72 ? -5.906  16.669  -11.086 1.00 0.00 ? 73 ASN A CG   4  
ATOM 4697  O OD1  . ASN A 1 72 ? -5.675  17.855  -10.952 1.00 0.00 ? 73 ASN A OD1  4  
ATOM 4698  N ND2  . ASN A 1 72 ? -6.414  16.223  -12.197 1.00 0.00 ? 73 ASN A ND2  4  
ATOM 4699  H H    . ASN A 1 72 ? -3.865  15.207  -7.918  1.00 0.00 ? 73 ASN A H    4  
ATOM 4700  H HA   . ASN A 1 72 ? -5.553  17.502  -8.823  1.00 0.00 ? 73 ASN A HA   4  
ATOM 4701  H HB2  . ASN A 1 72 ? -4.684  15.168  -10.180 1.00 0.00 ? 73 ASN A HB2  4  
ATOM 4702  H HB3  . ASN A 1 72 ? -6.412  14.970  -9.899  1.00 0.00 ? 73 ASN A HB3  4  
ATOM 4703  H HD21 . ASN A 1 72 ? -6.599  15.266  -12.303 1.00 0.00 ? 73 ASN A HD21 4  
ATOM 4704  H HD22 . ASN A 1 72 ? -6.611  16.840  -12.923 1.00 0.00 ? 73 ASN A HD22 4  
ATOM 4705  N N    . GLY A 1 73 ? -6.417  14.916  -7.000  1.00 0.00 ? 74 GLY A N    4  
ATOM 4706  C CA   . GLY A 1 73 ? -7.473  14.446  -6.058  1.00 0.00 ? 74 GLY A CA   4  
ATOM 4707  C C    . GLY A 1 73 ? -8.825  14.421  -6.775  1.00 0.00 ? 74 GLY A C    4  
ATOM 4708  O O    . GLY A 1 73 ? -8.829  14.276  -7.986  1.00 0.00 ? 74 GLY A O    4  
ATOM 4709  O OXT  . GLY A 1 73 ? -9.834  14.547  -6.100  1.00 0.00 ? 74 GLY A OXT  4  
ATOM 4710  H H    . GLY A 1 73 ? -5.585  14.407  -7.096  1.00 0.00 ? 74 GLY A H    4  
ATOM 4711  H HA2  . GLY A 1 73 ? -7.228  13.451  -5.713  1.00 0.00 ? 74 GLY A HA2  4  
ATOM 4712  H HA3  . GLY A 1 73 ? -7.529  15.117  -5.215  1.00 0.00 ? 74 GLY A HA3  4  
ATOM 4713  N N    . SER A 1 1  ? -0.718  1.635   -20.219 1.00 0.00 ? 2  SER A N    5  
ATOM 4714  C CA   . SER A 1 1  ? -0.254  2.943   -19.675 1.00 0.00 ? 2  SER A CA   5  
ATOM 4715  C C    . SER A 1 1  ? -1.322  3.514   -18.739 1.00 0.00 ? 2  SER A C    5  
ATOM 4716  O O    . SER A 1 1  ? -2.038  2.787   -18.080 1.00 0.00 ? 2  SER A O    5  
ATOM 4717  C CB   . SER A 1 1  ? -0.013  3.916   -20.830 1.00 0.00 ? 2  SER A CB   5  
ATOM 4718  O OG   . SER A 1 1  ? 0.322   3.183   -22.002 1.00 0.00 ? 2  SER A OG   5  
ATOM 4719  H H    . SER A 1 1  ? -0.306  0.801   -19.909 1.00 0.00 ? 2  SER A H    5  
ATOM 4720  H HA   . SER A 1 1  ? 0.666   2.799   -19.127 1.00 0.00 ? 2  SER A HA   5  
ATOM 4721  H HB2  . SER A 1 1  ? -0.907  4.487   -21.014 1.00 0.00 ? 2  SER A HB2  5  
ATOM 4722  H HB3  . SER A 1 1  ? 0.795   4.589   -20.570 1.00 0.00 ? 2  SER A HB3  5  
ATOM 4723  H HG   . SER A 1 1  ? -0.217  3.514   -22.724 1.00 0.00 ? 2  SER A HG   5  
ATOM 4724  N N    . ASP A 1 2  ? -1.437  4.814   -18.676 1.00 0.00 ? 3  ASP A N    5  
ATOM 4725  C CA   . ASP A 1 2  ? -2.459  5.430   -17.784 1.00 0.00 ? 3  ASP A CA   5  
ATOM 4726  C C    . ASP A 1 2  ? -2.261  4.936   -16.348 1.00 0.00 ? 3  ASP A C    5  
ATOM 4727  O O    . ASP A 1 2  ? -1.479  5.486   -15.598 1.00 0.00 ? 3  ASP A O    5  
ATOM 4728  C CB   . ASP A 1 2  ? -3.859  5.046   -18.270 1.00 0.00 ? 3  ASP A CB   5  
ATOM 4729  C CG   . ASP A 1 2  ? -4.108  5.665   -19.648 1.00 0.00 ? 3  ASP A CG   5  
ATOM 4730  O OD1  . ASP A 1 2  ? -3.759  5.033   -20.631 1.00 0.00 ? 3  ASP A OD1  5  
ATOM 4731  O OD2  . ASP A 1 2  ? -4.644  6.761   -19.695 1.00 0.00 ? 3  ASP A OD2  5  
ATOM 4732  H H    . ASP A 1 2  ? -0.850  5.383   -19.215 1.00 0.00 ? 3  ASP A H    5  
ATOM 4733  H HA   . ASP A 1 2  ? -2.354  6.505   -17.810 1.00 0.00 ? 3  ASP A HA   5  
ATOM 4734  H HB2  . ASP A 1 2  ? -3.936  3.971   -18.339 1.00 0.00 ? 3  ASP A HB2  5  
ATOM 4735  H HB3  . ASP A 1 2  ? -4.596  5.417   -17.574 1.00 0.00 ? 3  ASP A HB3  5  
ATOM 4736  N N    . LYS A 1 3  ? -2.959  3.905   -15.955 1.00 0.00 ? 4  LYS A N    5  
ATOM 4737  C CA   . LYS A 1 3  ? -2.802  3.389   -14.565 1.00 0.00 ? 4  LYS A CA   5  
ATOM 4738  C C    . LYS A 1 3  ? -1.442  2.694   -14.434 1.00 0.00 ? 4  LYS A C    5  
ATOM 4739  O O    . LYS A 1 3  ? -0.983  2.056   -15.360 1.00 0.00 ? 4  LYS A O    5  
ATOM 4740  C CB   . LYS A 1 3  ? -3.924  2.390   -14.265 1.00 0.00 ? 4  LYS A CB   5  
ATOM 4741  C CG   . LYS A 1 3  ? -4.276  2.447   -12.776 1.00 0.00 ? 4  LYS A CG   5  
ATOM 4742  C CD   . LYS A 1 3  ? -5.694  1.913   -12.558 1.00 0.00 ? 4  LYS A CD   5  
ATOM 4743  C CE   . LYS A 1 3  ? -6.049  1.996   -11.071 1.00 0.00 ? 4  LYS A CE   5  
ATOM 4744  N NZ   . LYS A 1 3  ? -7.056  0.949   -10.740 1.00 0.00 ? 4  LYS A NZ   5  
ATOM 4745  H H    . LYS A 1 3  ? -3.586  3.471   -16.570 1.00 0.00 ? 4  LYS A H    5  
ATOM 4746  H HA   . LYS A 1 3  ? -2.857  4.213   -13.870 1.00 0.00 ? 4  LYS A HA   5  
ATOM 4747  H HB2  . LYS A 1 3  ? -4.794  2.641   -14.853 1.00 0.00 ? 4  LYS A HB2  5  
ATOM 4748  H HB3  . LYS A 1 3  ? -3.594  1.394   -14.517 1.00 0.00 ? 4  LYS A HB3  5  
ATOM 4749  H HG2  . LYS A 1 3  ? -3.576  1.844   -12.218 1.00 0.00 ? 4  LYS A HG2  5  
ATOM 4750  H HG3  . LYS A 1 3  ? -4.223  3.469   -12.432 1.00 0.00 ? 4  LYS A HG3  5  
ATOM 4751  H HD2  . LYS A 1 3  ? -6.394  2.505   -13.130 1.00 0.00 ? 4  LYS A HD2  5  
ATOM 4752  H HD3  . LYS A 1 3  ? -5.745  0.884   -12.882 1.00 0.00 ? 4  LYS A HD3  5  
ATOM 4753  H HE2  . LYS A 1 3  ? -5.159  1.838   -10.480 1.00 0.00 ? 4  LYS A HE2  5  
ATOM 4754  H HE3  . LYS A 1 3  ? -6.458  2.970   -10.852 1.00 0.00 ? 4  LYS A HE3  5  
ATOM 4755  H HZ1  . LYS A 1 3  ? -7.844  1.000   -11.419 1.00 0.00 ? 4  LYS A HZ1  5  
ATOM 4756  H HZ2  . LYS A 1 3  ? -6.613  0.010   -10.794 1.00 0.00 ? 4  LYS A HZ2  5  
ATOM 4757  H HZ3  . LYS A 1 3  ? -7.417  1.105   -9.778  1.00 0.00 ? 4  LYS A HZ3  5  
ATOM 4758  N N    . PRO A 1 4  ? -0.836  2.842   -13.280 1.00 0.00 ? 5  PRO A N    5  
ATOM 4759  C CA   . PRO A 1 4  ? 0.476   2.244   -12.988 1.00 0.00 ? 5  PRO A CA   5  
ATOM 4760  C C    . PRO A 1 4  ? 0.362   0.748   -12.726 1.00 0.00 ? 5  PRO A C    5  
ATOM 4761  O O    . PRO A 1 4  ? -0.714  0.212   -12.564 1.00 0.00 ? 5  PRO A O    5  
ATOM 4762  C CB   . PRO A 1 4  ? 0.950   2.978   -11.750 1.00 0.00 ? 5  PRO A CB   5  
ATOM 4763  C CG   . PRO A 1 4  ? -0.305  3.553   -11.085 1.00 0.00 ? 5  PRO A CG   5  
ATOM 4764  C CD   . PRO A 1 4  ? -1.401  3.614   -12.161 1.00 0.00 ? 5  PRO A CD   5  
ATOM 4765  H HA   . PRO A 1 4  ? 1.159   2.436   -13.775 1.00 0.00 ? 5  PRO A HA   5  
ATOM 4766  H HB2  . PRO A 1 4  ? 1.449   2.290   -11.083 1.00 0.00 ? 5  PRO A HB2  5  
ATOM 4767  H HB3  . PRO A 1 4  ? 1.614   3.774   -12.029 1.00 0.00 ? 5  PRO A HB3  5  
ATOM 4768  H HG2  . PRO A 1 4  ? -0.611  2.912   -10.279 1.00 0.00 ? 5  PRO A HG2  5  
ATOM 4769  H HG3  . PRO A 1 4  ? -0.098  4.540   -10.725 1.00 0.00 ? 5  PRO A HG3  5  
ATOM 4770  H HD2  . PRO A 1 4  ? -2.308  3.155   -11.797 1.00 0.00 ? 5  PRO A HD2  5  
ATOM 4771  H HD3  . PRO A 1 4  ? -1.582  4.633   -12.464 1.00 0.00 ? 5  PRO A HD3  5  
ATOM 4772  N N    . LYS A 1 5  ? 1.476   0.077   -12.687 1.00 0.00 ? 6  LYS A N    5  
ATOM 4773  C CA   . LYS A 1 5  ? 1.459   -1.390  -12.434 1.00 0.00 ? 6  LYS A CA   5  
ATOM 4774  C C    . LYS A 1 5  ? 1.102   -1.655  -10.972 1.00 0.00 ? 6  LYS A C    5  
ATOM 4775  O O    . LYS A 1 5  ? 1.969   -1.834  -10.140 1.00 0.00 ? 6  LYS A O    5  
ATOM 4776  C CB   . LYS A 1 5  ? 2.825   -1.981  -12.740 1.00 0.00 ? 6  LYS A CB   5  
ATOM 4777  C CG   . LYS A 1 5  ? 3.329   -1.461  -14.090 1.00 0.00 ? 6  LYS A CG   5  
ATOM 4778  C CD   . LYS A 1 5  ? 2.463   -2.031  -15.214 1.00 0.00 ? 6  LYS A CD   5  
ATOM 4779  C CE   . LYS A 1 5  ? 3.312   -2.210  -16.473 1.00 0.00 ? 6  LYS A CE   5  
ATOM 4780  N NZ   . LYS A 1 5  ? 3.495   -3.665  -16.749 1.00 0.00 ? 6  LYS A NZ   5  
ATOM 4781  H H    . LYS A 1 5  ? 2.326   0.543   -12.822 1.00 0.00 ? 6  LYS A H    5  
ATOM 4782  H HA   . LYS A 1 5  ? 0.729   -1.859  -13.068 1.00 0.00 ? 6  LYS A HA   5  
ATOM 4783  H HB2  . LYS A 1 5  ? 3.519   -1.707  -11.962 1.00 0.00 ? 6  LYS A HB2  5  
ATOM 4784  H HB3  . LYS A 1 5  ? 2.731   -3.051  -12.785 1.00 0.00 ? 6  LYS A HB3  5  
ATOM 4785  H HG2  . LYS A 1 5  ? 3.277   -0.384  -14.104 1.00 0.00 ? 6  LYS A HG2  5  
ATOM 4786  H HG3  . LYS A 1 5  ? 4.352   -1.774  -14.235 1.00 0.00 ? 6  LYS A HG3  5  
ATOM 4787  H HD2  . LYS A 1 5  ? 2.061   -2.987  -14.909 1.00 0.00 ? 6  LYS A HD2  5  
ATOM 4788  H HD3  . LYS A 1 5  ? 1.652   -1.349  -15.423 1.00 0.00 ? 6  LYS A HD3  5  
ATOM 4789  H HE2  . LYS A 1 5  ? 2.816   -1.744  -17.312 1.00 0.00 ? 6  LYS A HE2  5  
ATOM 4790  H HE3  . LYS A 1 5  ? 4.278   -1.748  -16.325 1.00 0.00 ? 6  LYS A HE3  5  
ATOM 4791  H HZ1  . LYS A 1 5  ? 2.652   -4.185  -16.435 1.00 0.00 ? 6  LYS A HZ1  5  
ATOM 4792  H HZ2  . LYS A 1 5  ? 3.633   -3.809  -17.770 1.00 0.00 ? 6  LYS A HZ2  5  
ATOM 4793  H HZ3  . LYS A 1 5  ? 4.328   -4.013  -16.233 1.00 0.00 ? 6  LYS A HZ3  5  
ATOM 4794  N N    . ARG A 1 6  ? -0.176  -1.661  -10.674 1.00 0.00 ? 7  ARG A N    5  
ATOM 4795  C CA   . ARG A 1 6  ? -0.679  -1.897  -9.285  1.00 0.00 ? 7  ARG A CA   5  
ATOM 4796  C C    . ARG A 1 6  ? 0.412   -2.491  -8.368  1.00 0.00 ? 7  ARG A C    5  
ATOM 4797  O O    . ARG A 1 6  ? 0.902   -3.577  -8.603  1.00 0.00 ? 7  ARG A O    5  
ATOM 4798  C CB   . ARG A 1 6  ? -1.862  -2.865  -9.343  1.00 0.00 ? 7  ARG A CB   5  
ATOM 4799  C CG   . ARG A 1 6  ? -3.152  -2.123  -8.988  1.00 0.00 ? 7  ARG A CG   5  
ATOM 4800  C CD   . ARG A 1 6  ? -4.221  -3.133  -8.564  1.00 0.00 ? 7  ARG A CD   5  
ATOM 4801  N NE   . ARG A 1 6  ? -4.548  -2.935  -7.125  1.00 0.00 ? 7  ARG A NE   5  
ATOM 4802  C CZ   . ARG A 1 6  ? -5.782  -3.045  -6.716  1.00 0.00 ? 7  ARG A CZ   5  
ATOM 4803  N NH1  . ARG A 1 6  ? -6.624  -3.789  -7.379  1.00 0.00 ? 7  ARG A NH1  5  
ATOM 4804  N NH2  . ARG A 1 6  ? -6.174  -2.413  -5.644  1.00 0.00 ? 7  ARG A NH2  5  
ATOM 4805  H H    . ARG A 1 6  ? -0.826  -1.493  -11.381 1.00 0.00 ? 7  ARG A H    5  
ATOM 4806  H HA   . ARG A 1 6  ? -1.018  -0.950  -8.884  1.00 0.00 ? 7  ARG A HA   5  
ATOM 4807  H HB2  . ARG A 1 6  ? -1.943  -3.271  -10.341 1.00 0.00 ? 7  ARG A HB2  5  
ATOM 4808  H HB3  . ARG A 1 6  ? -1.705  -3.667  -8.639  1.00 0.00 ? 7  ARG A HB3  5  
ATOM 4809  H HG2  . ARG A 1 6  ? -2.961  -1.437  -8.175  1.00 0.00 ? 7  ARG A HG2  5  
ATOM 4810  H HG3  . ARG A 1 6  ? -3.500  -1.572  -9.849  1.00 0.00 ? 7  ARG A HG3  5  
ATOM 4811  H HD2  . ARG A 1 6  ? -5.110  -2.987  -9.159  1.00 0.00 ? 7  ARG A HD2  5  
ATOM 4812  H HD3  . ARG A 1 6  ? -3.847  -4.136  -8.713  1.00 0.00 ? 7  ARG A HD3  5  
ATOM 4813  H HE   . ARG A 1 6  ? -3.837  -2.721  -6.485  1.00 0.00 ? 7  ARG A HE   5  
ATOM 4814  H HH11 . ARG A 1 6  ? -6.324  -4.275  -8.199  1.00 0.00 ? 7  ARG A HH11 5  
ATOM 4815  H HH12 . ARG A 1 6  ? -7.571  -3.873  -7.066  1.00 0.00 ? 7  ARG A HH12 5  
ATOM 4816  H HH21 . ARG A 1 6  ? -5.529  -1.843  -5.135  1.00 0.00 ? 7  ARG A HH21 5  
ATOM 4817  H HH22 . ARG A 1 6  ? -7.120  -2.497  -5.331  1.00 0.00 ? 7  ARG A HH22 5  
ATOM 4818  N N    . PRO A 1 7  ? 0.748   -1.737  -7.351  1.00 0.00 ? 8  PRO A N    5  
ATOM 4819  C CA   . PRO A 1 7  ? 1.764   -2.104  -6.353  1.00 0.00 ? 8  PRO A CA   5  
ATOM 4820  C C    . PRO A 1 7  ? 1.176   -3.082  -5.331  1.00 0.00 ? 8  PRO A C    5  
ATOM 4821  O O    . PRO A 1 7  ? 0.022   -2.987  -4.962  1.00 0.00 ? 8  PRO A O    5  
ATOM 4822  C CB   . PRO A 1 7  ? 2.105   -0.756  -5.697  1.00 0.00 ? 8  PRO A CB   5  
ATOM 4823  C CG   . PRO A 1 7  ? 0.887   0.172   -5.949  1.00 0.00 ? 8  PRO A CG   5  
ATOM 4824  C CD   . PRO A 1 7  ? 0.131   -0.429  -7.125  1.00 0.00 ? 8  PRO A CD   5  
ATOM 4825  H HA   . PRO A 1 7  ? 2.638   -2.518  -6.828  1.00 0.00 ? 8  PRO A HA   5  
ATOM 4826  H HB2  . PRO A 1 7  ? 2.262   -0.891  -4.635  1.00 0.00 ? 8  PRO A HB2  5  
ATOM 4827  H HB3  . PRO A 1 7  ? 2.986   -0.332  -6.153  1.00 0.00 ? 8  PRO A HB3  5  
ATOM 4828  H HG2  . PRO A 1 7  ? 0.250   0.201   -5.078  1.00 0.00 ? 8  PRO A HG2  5  
ATOM 4829  H HG3  . PRO A 1 7  ? 1.204   1.170   -6.209  1.00 0.00 ? 8  PRO A HG3  5  
ATOM 4830  H HD2  . PRO A 1 7  ? -0.915  -0.537  -6.891  1.00 0.00 ? 8  PRO A HD2  5  
ATOM 4831  H HD3  . PRO A 1 7  ? 0.262   0.168   -8.001  1.00 0.00 ? 8  PRO A HD3  5  
ATOM 4832  N N    . LEU A 1 8  ? 1.957   -4.024  -4.872  1.00 0.00 ? 9  LEU A N    5  
ATOM 4833  C CA   . LEU A 1 8  ? 1.429   -5.000  -3.878  1.00 0.00 ? 9  LEU A CA   5  
ATOM 4834  C C    . LEU A 1 8  ? 2.506   -6.022  -3.509  1.00 0.00 ? 9  LEU A C    5  
ATOM 4835  O O    . LEU A 1 8  ? 3.636   -5.957  -3.949  1.00 0.00 ? 9  LEU A O    5  
ATOM 4836  C CB   . LEU A 1 8  ? 0.180   -5.688  -4.456  1.00 0.00 ? 9  LEU A CB   5  
ATOM 4837  C CG   . LEU A 1 8  ? 0.532   -7.048  -5.051  1.00 0.00 ? 9  LEU A CG   5  
ATOM 4838  C CD1  . LEU A 1 8  ? -0.693  -7.628  -5.752  1.00 0.00 ? 9  LEU A CD1  5  
ATOM 4839  C CD2  . LEU A 1 8  ? 1.667   -6.874  -6.054  1.00 0.00 ? 9  LEU A CD2  5  
ATOM 4840  H H    . LEU A 1 8  ? 2.882   -4.089  -5.181  1.00 0.00 ? 9  LEU A H    5  
ATOM 4841  H HA   . LEU A 1 8  ? 1.150   -4.485  -2.987  1.00 0.00 ? 9  LEU A HA   5  
ATOM 4842  H HB2  . LEU A 1 8  ? -0.547  -5.822  -3.669  1.00 0.00 ? 9  LEU A HB2  5  
ATOM 4843  H HB3  . LEU A 1 8  ? -0.241  -5.061  -5.228  1.00 0.00 ? 9  LEU A HB3  5  
ATOM 4844  H HG   . LEU A 1 8  ? 0.844   -7.714  -4.261  1.00 0.00 ? 9  LEU A HG   5  
ATOM 4845  H HD11 . LEU A 1 8  ? -1.253  -6.829  -6.213  1.00 0.00 ? 9  LEU A HD11 5  
ATOM 4846  H HD12 . LEU A 1 8  ? -0.378  -8.332  -6.508  1.00 0.00 ? 9  LEU A HD12 5  
ATOM 4847  H HD13 . LEU A 1 8  ? -1.315  -8.131  -5.027  1.00 0.00 ? 9  LEU A HD13 5  
ATOM 4848  H HD21 . LEU A 1 8  ? 2.227   -5.984  -5.806  1.00 0.00 ? 9  LEU A HD21 5  
ATOM 4849  H HD22 . LEU A 1 8  ? 2.318   -7.734  -6.013  1.00 0.00 ? 9  LEU A HD22 5  
ATOM 4850  H HD23 . LEU A 1 8  ? 1.257   -6.776  -7.048  1.00 0.00 ? 9  LEU A HD23 5  
ATOM 4851  N N    . SER A 1 9  ? 2.140   -6.952  -2.686  1.00 0.00 ? 10 SER A N    5  
ATOM 4852  C CA   . SER A 1 9  ? 3.100   -8.003  -2.232  1.00 0.00 ? 10 SER A CA   5  
ATOM 4853  C C    . SER A 1 9  ? 3.614   -8.821  -3.424  1.00 0.00 ? 10 SER A C    5  
ATOM 4854  O O    . SER A 1 9  ? 2.952   -8.964  -4.434  1.00 0.00 ? 10 SER A O    5  
ATOM 4855  C CB   . SER A 1 9  ? 2.395   -8.935  -1.246  1.00 0.00 ? 10 SER A CB   5  
ATOM 4856  O OG   . SER A 1 9  ? 3.151   -9.009  -0.045  1.00 0.00 ? 10 SER A OG   5  
ATOM 4857  H H    . SER A 1 9  ? 1.219   -6.949  -2.354  1.00 0.00 ? 10 SER A H    5  
ATOM 4858  H HA   . SER A 1 9  ? 3.936   -7.531  -1.737  1.00 0.00 ? 10 SER A HA   5  
ATOM 4859  H HB2  . SER A 1 9  ? 1.413   -8.552  -1.024  1.00 0.00 ? 10 SER A HB2  5  
ATOM 4860  H HB3  . SER A 1 9  ? 2.303   -9.919  -1.687  1.00 0.00 ? 10 SER A HB3  5  
ATOM 4861  H HG   . SER A 1 9  ? 2.763   -8.399  0.587   1.00 0.00 ? 10 SER A HG   5  
ATOM 4862  N N    . ALA A 1 10 ? 4.797   -9.364  -3.299  1.00 0.00 ? 11 ALA A N    5  
ATOM 4863  C CA   . ALA A 1 10 ? 5.377   -10.181 -4.404  1.00 0.00 ? 11 ALA A CA   5  
ATOM 4864  C C    . ALA A 1 10 ? 4.540   -11.443 -4.607  1.00 0.00 ? 11 ALA A C    5  
ATOM 4865  O O    . ALA A 1 10 ? 4.097   -11.736 -5.700  1.00 0.00 ? 11 ALA A O    5  
ATOM 4866  C CB   . ALA A 1 10 ? 6.810   -10.582 -4.044  1.00 0.00 ? 11 ALA A CB   5  
ATOM 4867  H H    . ALA A 1 10 ? 5.306   -9.237  -2.471  1.00 0.00 ? 11 ALA A H    5  
ATOM 4868  H HA   . ALA A 1 10 ? 5.385   -9.602  -5.316  1.00 0.00 ? 11 ALA A HA   5  
ATOM 4869  H HB1  . ALA A 1 10 ? 6.989   -10.381 -2.997  1.00 0.00 ? 11 ALA A HB1  5  
ATOM 4870  H HB2  . ALA A 1 10 ? 6.949   -11.637 -4.237  1.00 0.00 ? 11 ALA A HB2  5  
ATOM 4871  H HB3  . ALA A 1 10 ? 7.504   -10.012 -4.643  1.00 0.00 ? 11 ALA A HB3  5  
ATOM 4872  N N    . TYR A 1 11 ? 4.312   -12.194 -3.563  1.00 0.00 ? 12 TYR A N    5  
ATOM 4873  C CA   . TYR A 1 11 ? 3.501   -13.425 -3.698  1.00 0.00 ? 12 TYR A CA   5  
ATOM 4874  C C    . TYR A 1 11 ? 2.253   -13.101 -4.516  1.00 0.00 ? 12 TYR A C    5  
ATOM 4875  O O    . TYR A 1 11 ? 1.734   -13.929 -5.241  1.00 0.00 ? 12 TYR A O    5  
ATOM 4876  C CB   . TYR A 1 11 ? 3.109   -13.894 -2.300  1.00 0.00 ? 12 TYR A CB   5  
ATOM 4877  C CG   . TYR A 1 11 ? 1.984   -14.895 -2.387  1.00 0.00 ? 12 TYR A CG   5  
ATOM 4878  C CD1  . TYR A 1 11 ? 1.961   -15.832 -3.426  1.00 0.00 ? 12 TYR A CD1  5  
ATOM 4879  C CD2  . TYR A 1 11 ? 0.964   -14.889 -1.428  1.00 0.00 ? 12 TYR A CD2  5  
ATOM 4880  C CE1  . TYR A 1 11 ? 0.921   -16.764 -3.506  1.00 0.00 ? 12 TYR A CE1  5  
ATOM 4881  C CE2  . TYR A 1 11 ? -0.077  -15.821 -1.507  1.00 0.00 ? 12 TYR A CE2  5  
ATOM 4882  C CZ   . TYR A 1 11 ? -0.098  -16.759 -2.546  1.00 0.00 ? 12 TYR A CZ   5  
ATOM 4883  O OH   . TYR A 1 11 ? -1.125  -17.677 -2.623  1.00 0.00 ? 12 TYR A OH   5  
ATOM 4884  H H    . TYR A 1 11 ? 4.668   -11.944 -2.685  1.00 0.00 ? 12 TYR A H    5  
ATOM 4885  H HA   . TYR A 1 11 ? 4.077   -14.193 -4.194  1.00 0.00 ? 12 TYR A HA   5  
ATOM 4886  H HB2  . TYR A 1 11 ? 3.963   -14.351 -1.825  1.00 0.00 ? 12 TYR A HB2  5  
ATOM 4887  H HB3  . TYR A 1 11 ? 2.793   -13.041 -1.719  1.00 0.00 ? 12 TYR A HB3  5  
ATOM 4888  H HD1  . TYR A 1 11 ? 2.747   -15.836 -4.166  1.00 0.00 ? 12 TYR A HD1  5  
ATOM 4889  H HD2  . TYR A 1 11 ? 0.982   -14.165 -0.627  1.00 0.00 ? 12 TYR A HD2  5  
ATOM 4890  H HE1  . TYR A 1 11 ? 0.906   -17.487 -4.308  1.00 0.00 ? 12 TYR A HE1  5  
ATOM 4891  H HE2  . TYR A 1 11 ? -0.862  -15.815 -0.768  1.00 0.00 ? 12 TYR A HE2  5  
ATOM 4892  H HH   . TYR A 1 11 ? -1.763  -17.467 -1.938  1.00 0.00 ? 12 TYR A HH   5  
ATOM 4893  N N    . MET A 1 12 ? 1.775   -11.893 -4.410  1.00 0.00 ? 13 MET A N    5  
ATOM 4894  C CA   . MET A 1 12 ? 0.570   -11.497 -5.176  1.00 0.00 ? 13 MET A CA   5  
ATOM 4895  C C    . MET A 1 12 ? 0.924   -11.376 -6.657  1.00 0.00 ? 13 MET A C    5  
ATOM 4896  O O    . MET A 1 12 ? 0.199   -11.842 -7.507  1.00 0.00 ? 13 MET A O    5  
ATOM 4897  C CB   . MET A 1 12 ? 0.071   -10.152 -4.659  1.00 0.00 ? 13 MET A CB   5  
ATOM 4898  C CG   . MET A 1 12 ? 0.042   -10.170 -3.130  1.00 0.00 ? 13 MET A CG   5  
ATOM 4899  S SD   . MET A 1 12 ? -1.663  -9.968  -2.558  1.00 0.00 ? 13 MET A SD   5  
ATOM 4900  C CE   . MET A 1 12 ? -2.351  -11.422 -3.385  1.00 0.00 ? 13 MET A CE   5  
ATOM 4901  H H    . MET A 1 12 ? 2.212   -11.242 -3.825  1.00 0.00 ? 13 MET A H    5  
ATOM 4902  H HA   . MET A 1 12 ? -0.202  -12.243 -5.049  1.00 0.00 ? 13 MET A HA   5  
ATOM 4903  H HB2  . MET A 1 12 ? 0.731   -9.373  -5.002  1.00 0.00 ? 13 MET A HB2  5  
ATOM 4904  H HB3  . MET A 1 12 ? -0.922  -9.972  -5.032  1.00 0.00 ? 13 MET A HB3  5  
ATOM 4905  H HG2  . MET A 1 12 ? 0.433   -11.112 -2.774  1.00 0.00 ? 13 MET A HG2  5  
ATOM 4906  H HG3  . MET A 1 12 ? 0.649   -9.362  -2.749  1.00 0.00 ? 13 MET A HG3  5  
ATOM 4907  H HE1  . MET A 1 12 ? -1.804  -12.301 -3.084  1.00 0.00 ? 13 MET A HE1  5  
ATOM 4908  H HE2  . MET A 1 12 ? -3.389  -11.534 -3.109  1.00 0.00 ? 13 MET A HE2  5  
ATOM 4909  H HE3  . MET A 1 12 ? -2.268  -11.299 -4.456  1.00 0.00 ? 13 MET A HE3  5  
ATOM 4910  N N    . LEU A 1 13 ? 2.030   -10.757 -6.983  1.00 0.00 ? 14 LEU A N    5  
ATOM 4911  C CA   . LEU A 1 13 ? 2.389   -10.628 -8.427  1.00 0.00 ? 14 LEU A CA   5  
ATOM 4912  C C    . LEU A 1 13 ? 2.333   -12.009 -9.067  1.00 0.00 ? 14 LEU A C    5  
ATOM 4913  O O    . LEU A 1 13 ? 1.663   -12.220 -10.055 1.00 0.00 ? 14 LEU A O    5  
ATOM 4914  C CB   . LEU A 1 13 ? 3.802   -10.056 -8.601  1.00 0.00 ? 14 LEU A CB   5  
ATOM 4915  C CG   . LEU A 1 13 ? 3.967   -8.786  -7.757  1.00 0.00 ? 14 LEU A CG   5  
ATOM 4916  C CD1  . LEU A 1 13 ? 5.430   -8.332  -7.791  1.00 0.00 ? 14 LEU A CD1  5  
ATOM 4917  C CD2  . LEU A 1 13 ? 3.082   -7.682  -8.336  1.00 0.00 ? 14 LEU A CD2  5  
ATOM 4918  H H    . LEU A 1 13 ? 2.612   -10.382 -6.288  1.00 0.00 ? 14 LEU A H    5  
ATOM 4919  H HA   . LEU A 1 13 ? 1.672   -9.985  -8.916  1.00 0.00 ? 14 LEU A HA   5  
ATOM 4920  H HB2  . LEU A 1 13 ? 4.539   -10.796 -8.308  1.00 0.00 ? 14 LEU A HB2  5  
ATOM 4921  H HB3  . LEU A 1 13 ? 3.950   -9.806  -9.641  1.00 0.00 ? 14 LEU A HB3  5  
ATOM 4922  H HG   . LEU A 1 13 ? 3.678   -8.985  -6.738  1.00 0.00 ? 14 LEU A HG   5  
ATOM 4923  H HD11 . LEU A 1 13 ? 5.895   -8.683  -8.701  1.00 0.00 ? 14 LEU A HD11 5  
ATOM 4924  H HD12 . LEU A 1 13 ? 5.476   -7.250  -7.754  1.00 0.00 ? 14 LEU A HD12 5  
ATOM 4925  H HD13 . LEU A 1 13 ? 5.953   -8.742  -6.939  1.00 0.00 ? 14 LEU A HD13 5  
ATOM 4926  H HD21 . LEU A 1 13 ? 3.331   -7.530  -9.377  1.00 0.00 ? 14 LEU A HD21 5  
ATOM 4927  H HD22 . LEU A 1 13 ? 2.045   -7.973  -8.254  1.00 0.00 ? 14 LEU A HD22 5  
ATOM 4928  H HD23 . LEU A 1 13 ? 3.244   -6.765  -7.789  1.00 0.00 ? 14 LEU A HD23 5  
ATOM 4929  N N    . TRP A 1 14 ? 3.025   -12.955 -8.504  1.00 0.00 ? 15 TRP A N    5  
ATOM 4930  C CA   . TRP A 1 14 ? 2.999   -14.324 -9.076  1.00 0.00 ? 15 TRP A CA   5  
ATOM 4931  C C    . TRP A 1 14 ? 1.548   -14.811 -9.106  1.00 0.00 ? 15 TRP A C    5  
ATOM 4932  O O    . TRP A 1 14 ? 1.153   -15.572 -9.967  1.00 0.00 ? 15 TRP A O    5  
ATOM 4933  C CB   . TRP A 1 14 ? 3.843   -15.253 -8.205  1.00 0.00 ? 15 TRP A CB   5  
ATOM 4934  C CG   . TRP A 1 14 ? 3.638   -16.666 -8.637  1.00 0.00 ? 15 TRP A CG   5  
ATOM 4935  C CD1  . TRP A 1 14 ? 4.403   -17.322 -9.539  1.00 0.00 ? 15 TRP A CD1  5  
ATOM 4936  C CD2  . TRP A 1 14 ? 2.618   -17.607 -8.202  1.00 0.00 ? 15 TRP A CD2  5  
ATOM 4937  N NE1  . TRP A 1 14 ? 3.918   -18.610 -9.682  1.00 0.00 ? 15 TRP A NE1  5  
ATOM 4938  C CE2  . TRP A 1 14 ? 2.816   -18.833 -8.879  1.00 0.00 ? 15 TRP A CE2  5  
ATOM 4939  C CE3  . TRP A 1 14 ? 1.549   -17.514 -7.294  1.00 0.00 ? 15 TRP A CE3  5  
ATOM 4940  C CZ2  . TRP A 1 14 ? 1.983   -19.931 -8.659  1.00 0.00 ? 15 TRP A CZ2  5  
ATOM 4941  C CZ3  . TRP A 1 14 ? 0.709   -18.616 -7.073  1.00 0.00 ? 15 TRP A CZ3  5  
ATOM 4942  C CH2  . TRP A 1 14 ? 0.925   -19.822 -7.753  1.00 0.00 ? 15 TRP A CH2  5  
ATOM 4943  H H    . TRP A 1 14 ? 3.554   -12.765 -7.699  1.00 0.00 ? 15 TRP A H    5  
ATOM 4944  H HA   . TRP A 1 14 ? 3.398   -14.306 -10.080 1.00 0.00 ? 15 TRP A HA   5  
ATOM 4945  H HB2  . TRP A 1 14 ? 4.886   -14.994 -8.309  1.00 0.00 ? 15 TRP A HB2  5  
ATOM 4946  H HB3  . TRP A 1 14 ? 3.547   -15.146 -7.171  1.00 0.00 ? 15 TRP A HB3  5  
ATOM 4947  H HD1  . TRP A 1 14 ? 5.254   -16.909 -10.059 1.00 0.00 ? 15 TRP A HD1  5  
ATOM 4948  H HE1  . TRP A 1 14 ? 4.295   -19.293 -10.275 1.00 0.00 ? 15 TRP A HE1  5  
ATOM 4949  H HE3  . TRP A 1 14 ? 1.374   -16.590 -6.764  1.00 0.00 ? 15 TRP A HE3  5  
ATOM 4950  H HZ2  . TRP A 1 14 ? 2.155   -20.858 -9.186  1.00 0.00 ? 15 TRP A HZ2  5  
ATOM 4951  H HZ3  . TRP A 1 14 ? -0.107  -18.532 -6.372  1.00 0.00 ? 15 TRP A HZ3  5  
ATOM 4952  H HH2  . TRP A 1 14 ? 0.275   -20.666 -7.577  1.00 0.00 ? 15 TRP A HH2  5  
ATOM 4953  N N    . LEU A 1 15 ? 0.755   -14.370 -8.168  1.00 0.00 ? 16 LEU A N    5  
ATOM 4954  C CA   . LEU A 1 15 ? -0.674  -14.789 -8.127  1.00 0.00 ? 16 LEU A CA   5  
ATOM 4955  C C    . LEU A 1 15 ? -1.399  -14.324 -9.397  1.00 0.00 ? 16 LEU A C    5  
ATOM 4956  O O    . LEU A 1 15 ? -1.935  -15.123 -10.138 1.00 0.00 ? 16 LEU A O    5  
ATOM 4957  C CB   . LEU A 1 15 ? -1.344  -14.160 -6.903  1.00 0.00 ? 16 LEU A CB   5  
ATOM 4958  C CG   . LEU A 1 15 ? -2.172  -15.218 -6.174  1.00 0.00 ? 16 LEU A CG   5  
ATOM 4959  C CD1  . LEU A 1 15 ? -3.267  -15.739 -7.107  1.00 0.00 ? 16 LEU A CD1  5  
ATOM 4960  C CD2  . LEU A 1 15 ? -1.261  -16.375 -5.759  1.00 0.00 ? 16 LEU A CD2  5  
ATOM 4961  H H    . LEU A 1 15 ? 1.101   -13.757 -7.484  1.00 0.00 ? 16 LEU A H    5  
ATOM 4962  H HA   . LEU A 1 15 ? -0.731  -15.866 -8.054  1.00 0.00 ? 16 LEU A HA   5  
ATOM 4963  H HB2  . LEU A 1 15 ? -0.587  -13.773 -6.238  1.00 0.00 ? 16 LEU A HB2  5  
ATOM 4964  H HB3  . LEU A 1 15 ? -1.992  -13.357 -7.221  1.00 0.00 ? 16 LEU A HB3  5  
ATOM 4965  H HG   . LEU A 1 15 ? -2.624  -14.778 -5.296  1.00 0.00 ? 16 LEU A HG   5  
ATOM 4966  H HD11 . LEU A 1 15 ? -2.841  -15.955 -8.076  1.00 0.00 ? 16 LEU A HD11 5  
ATOM 4967  H HD12 . LEU A 1 15 ? -3.695  -16.640 -6.694  1.00 0.00 ? 16 LEU A HD12 5  
ATOM 4968  H HD13 . LEU A 1 15 ? -4.038  -14.989 -7.212  1.00 0.00 ? 16 LEU A HD13 5  
ATOM 4969  H HD21 . LEU A 1 15 ? -0.232  -16.044 -5.769  1.00 0.00 ? 16 LEU A HD21 5  
ATOM 4970  H HD22 . LEU A 1 15 ? -1.524  -16.702 -4.764  1.00 0.00 ? 16 LEU A HD22 5  
ATOM 4971  H HD23 . LEU A 1 15 ? -1.383  -17.194 -6.452  1.00 0.00 ? 16 LEU A HD23 5  
ATOM 4972  N N    . ASN A 1 16 ? -1.437  -13.039 -9.650  1.00 0.00 ? 17 ASN A N    5  
ATOM 4973  C CA   . ASN A 1 16 ? -2.141  -12.544 -10.859 1.00 0.00 ? 17 ASN A CA   5  
ATOM 4974  C C    . ASN A 1 16 ? -1.406  -12.999 -12.120 1.00 0.00 ? 17 ASN A C    5  
ATOM 4975  O O    . ASN A 1 16 ? -1.963  -13.020 -13.199 1.00 0.00 ? 17 ASN A O    5  
ATOM 4976  C CB   . ASN A 1 16 ? -2.209  -11.023 -10.813 1.00 0.00 ? 17 ASN A CB   5  
ATOM 4977  C CG   . ASN A 1 16 ? -0.890  -10.447 -10.295 1.00 0.00 ? 17 ASN A CG   5  
ATOM 4978  O OD1  . ASN A 1 16 ? 0.150   -10.638 -10.893 1.00 0.00 ? 17 ASN A OD1  5  
ATOM 4979  N ND2  . ASN A 1 16 ? -0.893  -9.740  -9.195  1.00 0.00 ? 17 ASN A ND2  5  
ATOM 4980  H H    . ASN A 1 16 ? -1.013  -12.401 -9.042  1.00 0.00 ? 17 ASN A H    5  
ATOM 4981  H HA   . ASN A 1 16 ? -3.145  -12.936 -10.871 1.00 0.00 ? 17 ASN A HA   5  
ATOM 4982  H HB2  . ASN A 1 16 ? -2.407  -10.643 -11.801 1.00 0.00 ? 17 ASN A HB2  5  
ATOM 4983  H HB3  . ASN A 1 16 ? -3.004  -10.738 -10.149 1.00 0.00 ? 17 ASN A HB3  5  
ATOM 4984  H HD21 . ASN A 1 16 ? -1.733  -9.585  -8.714  1.00 0.00 ? 17 ASN A HD21 5  
ATOM 4985  H HD22 . ASN A 1 16 ? -0.057  -9.361  -8.850  1.00 0.00 ? 17 ASN A HD22 5  
ATOM 4986  N N    . SER A 1 17 ? -0.164  -13.375 -11.996 1.00 0.00 ? 18 SER A N    5  
ATOM 4987  C CA   . SER A 1 17 ? 0.593   -13.840 -13.190 1.00 0.00 ? 18 SER A CA   5  
ATOM 4988  C C    . SER A 1 17 ? 0.252   -15.305 -13.459 1.00 0.00 ? 18 SER A C    5  
ATOM 4989  O O    . SER A 1 17 ? 0.513   -15.834 -14.521 1.00 0.00 ? 18 SER A O    5  
ATOM 4990  C CB   . SER A 1 17 ? 2.088   -13.699 -12.934 1.00 0.00 ? 18 SER A CB   5  
ATOM 4991  O OG   . SER A 1 17 ? 2.616   -14.952 -12.520 1.00 0.00 ? 18 SER A OG   5  
ATOM 4992  H H    . SER A 1 17 ? 0.266   -13.361 -11.116 1.00 0.00 ? 18 SER A H    5  
ATOM 4993  H HA   . SER A 1 17 ? 0.322   -13.243 -14.047 1.00 0.00 ? 18 SER A HA   5  
ATOM 4994  H HB2  . SER A 1 17 ? 2.575   -13.390 -13.842 1.00 0.00 ? 18 SER A HB2  5  
ATOM 4995  H HB3  . SER A 1 17 ? 2.252   -12.954 -12.169 1.00 0.00 ? 18 SER A HB3  5  
ATOM 4996  H HG   . SER A 1 17 ? 2.623   -15.537 -13.282 1.00 0.00 ? 18 SER A HG   5  
ATOM 4997  N N    . ALA A 1 18 ? -0.336  -15.964 -12.497 1.00 0.00 ? 19 ALA A N    5  
ATOM 4998  C CA   . ALA A 1 18 ? -0.705  -17.395 -12.681 1.00 0.00 ? 19 ALA A CA   5  
ATOM 4999  C C    . ALA A 1 18 ? -2.224  -17.542 -12.590 1.00 0.00 ? 19 ALA A C    5  
ATOM 5000  O O    . ALA A 1 18 ? -2.756  -18.630 -12.670 1.00 0.00 ? 19 ALA A O    5  
ATOM 5001  C CB   . ALA A 1 18 ? -0.055  -18.233 -11.578 1.00 0.00 ? 19 ALA A CB   5  
ATOM 5002  H H    . ALA A 1 18 ? -0.536  -15.514 -11.650 1.00 0.00 ? 19 ALA A H    5  
ATOM 5003  H HA   . ALA A 1 18 ? -0.363  -17.738 -13.645 1.00 0.00 ? 19 ALA A HA   5  
ATOM 5004  H HB1  . ALA A 1 18 ? 0.564   -17.598 -10.961 1.00 0.00 ? 19 ALA A HB1  5  
ATOM 5005  H HB2  . ALA A 1 18 ? -0.827  -18.685 -10.970 1.00 0.00 ? 19 ALA A HB2  5  
ATOM 5006  H HB3  . ALA A 1 18 ? 0.553   -19.007 -12.023 1.00 0.00 ? 19 ALA A HB3  5  
ATOM 5007  N N    . ARG A 1 19 ? -2.928  -16.456 -12.413 1.00 0.00 ? 20 ARG A N    5  
ATOM 5008  C CA   . ARG A 1 19 ? -4.412  -16.540 -12.306 1.00 0.00 ? 20 ARG A CA   5  
ATOM 5009  C C    . ARG A 1 19 ? -5.007  -17.045 -13.623 1.00 0.00 ? 20 ARG A C    5  
ATOM 5010  O O    . ARG A 1 19 ? -6.185  -17.326 -13.707 1.00 0.00 ? 20 ARG A O    5  
ATOM 5011  C CB   . ARG A 1 19 ? -4.984  -15.156 -11.987 1.00 0.00 ? 20 ARG A CB   5  
ATOM 5012  C CG   . ARG A 1 19 ? -6.509  -15.200 -12.093 1.00 0.00 ? 20 ARG A CG   5  
ATOM 5013  C CD   . ARG A 1 19 ? -7.123  -14.205 -11.106 1.00 0.00 ? 20 ARG A CD   5  
ATOM 5014  N NE   . ARG A 1 19 ? -8.358  -13.618 -11.699 1.00 0.00 ? 20 ARG A NE   5  
ATOM 5015  C CZ   . ARG A 1 19 ? -8.361  -12.380 -12.108 1.00 0.00 ? 20 ARG A CZ   5  
ATOM 5016  N NH1  . ARG A 1 19 ? -8.583  -11.411 -11.261 1.00 0.00 ? 20 ARG A NH1  5  
ATOM 5017  N NH2  . ARG A 1 19 ? -8.142  -12.109 -13.365 1.00 0.00 ? 20 ARG A NH2  5  
ATOM 5018  H H    . ARG A 1 19 ? -2.482  -15.587 -12.344 1.00 0.00 ? 20 ARG A H    5  
ATOM 5019  H HA   . ARG A 1 19 ? -4.673  -17.226 -11.515 1.00 0.00 ? 20 ARG A HA   5  
ATOM 5020  H HB2  . ARG A 1 19 ? -4.699  -14.871 -10.984 1.00 0.00 ? 20 ARG A HB2  5  
ATOM 5021  H HB3  . ARG A 1 19 ? -4.597  -14.434 -12.690 1.00 0.00 ? 20 ARG A HB3  5  
ATOM 5022  H HG2  . ARG A 1 19 ? -6.808  -14.942 -13.098 1.00 0.00 ? 20 ARG A HG2  5  
ATOM 5023  H HG3  . ARG A 1 19 ? -6.856  -16.196 -11.859 1.00 0.00 ? 20 ARG A HG3  5  
ATOM 5024  H HD2  . ARG A 1 19 ? -7.372  -14.716 -10.187 1.00 0.00 ? 20 ARG A HD2  5  
ATOM 5025  H HD3  . ARG A 1 19 ? -6.413  -13.418 -10.900 1.00 0.00 ? 20 ARG A HD3  5  
ATOM 5026  H HE   . ARG A 1 19 ? -9.166  -14.165 -11.784 1.00 0.00 ? 20 ARG A HE   5  
ATOM 5027  H HH11 . ARG A 1 19 ? -8.751  -11.619 -10.298 1.00 0.00 ? 20 ARG A HH11 5  
ATOM 5028  H HH12 . ARG A 1 19 ? -8.585  -10.463 -11.576 1.00 0.00 ? 20 ARG A HH12 5  
ATOM 5029  H HH21 . ARG A 1 19 ? -7.974  -12.851 -14.015 1.00 0.00 ? 20 ARG A HH21 5  
ATOM 5030  H HH22 . ARG A 1 19 ? -8.145  -11.160 -13.680 1.00 0.00 ? 20 ARG A HH22 5  
ATOM 5031  N N    . GLU A 1 20 ? -4.214  -17.167 -14.652 1.00 0.00 ? 21 GLU A N    5  
ATOM 5032  C CA   . GLU A 1 20 ? -4.762  -17.663 -15.943 1.00 0.00 ? 21 GLU A CA   5  
ATOM 5033  C C    . GLU A 1 20 ? -4.896  -19.182 -15.877 1.00 0.00 ? 21 GLU A C    5  
ATOM 5034  O O    . GLU A 1 20 ? -5.983  -19.718 -15.788 1.00 0.00 ? 21 GLU A O    5  
ATOM 5035  C CB   . GLU A 1 20 ? -3.823  -17.275 -17.088 1.00 0.00 ? 21 GLU A CB   5  
ATOM 5036  C CG   . GLU A 1 20 ? -4.394  -17.784 -18.414 1.00 0.00 ? 21 GLU A CG   5  
ATOM 5037  C CD   . GLU A 1 20 ? -3.424  -18.789 -19.038 1.00 0.00 ? 21 GLU A CD   5  
ATOM 5038  O OE1  . GLU A 1 20 ? -3.412  -19.925 -18.594 1.00 0.00 ? 21 GLU A OE1  5  
ATOM 5039  O OE2  . GLU A 1 20 ? -2.709  -18.404 -19.948 1.00 0.00 ? 21 GLU A OE2  5  
ATOM 5040  H H    . GLU A 1 20 ? -3.266  -16.937 -14.575 1.00 0.00 ? 21 GLU A H    5  
ATOM 5041  H HA   . GLU A 1 20 ? -5.733  -17.229 -16.108 1.00 0.00 ? 21 GLU A HA   5  
ATOM 5042  H HB2  . GLU A 1 20 ? -3.725  -16.201 -17.125 1.00 0.00 ? 21 GLU A HB2  5  
ATOM 5043  H HB3  . GLU A 1 20 ? -2.852  -17.720 -16.923 1.00 0.00 ? 21 GLU A HB3  5  
ATOM 5044  H HG2  . GLU A 1 20 ? -5.346  -18.265 -18.234 1.00 0.00 ? 21 GLU A HG2  5  
ATOM 5045  H HG3  . GLU A 1 20 ? -4.532  -16.953 -19.088 1.00 0.00 ? 21 GLU A HG3  5  
ATOM 5046  N N    . SER A 1 21 ? -3.800  -19.880 -15.907 1.00 0.00 ? 22 SER A N    5  
ATOM 5047  C CA   . SER A 1 21 ? -3.865  -21.364 -15.834 1.00 0.00 ? 22 SER A CA   5  
ATOM 5048  C C    . SER A 1 21 ? -4.510  -21.764 -14.508 1.00 0.00 ? 22 SER A C    5  
ATOM 5049  O O    . SER A 1 21 ? -4.937  -22.888 -14.326 1.00 0.00 ? 22 SER A O    5  
ATOM 5050  C CB   . SER A 1 21 ? -2.452  -21.944 -15.914 1.00 0.00 ? 22 SER A CB   5  
ATOM 5051  O OG   . SER A 1 21 ? -2.434  -23.005 -16.859 1.00 0.00 ? 22 SER A OG   5  
ATOM 5052  H H    . SER A 1 21 ? -2.934  -19.427 -15.972 1.00 0.00 ? 22 SER A H    5  
ATOM 5053  H HA   . SER A 1 21 ? -4.460  -21.741 -16.653 1.00 0.00 ? 22 SER A HA   5  
ATOM 5054  H HB2  . SER A 1 21 ? -1.764  -21.178 -16.228 1.00 0.00 ? 22 SER A HB2  5  
ATOM 5055  H HB3  . SER A 1 21 ? -2.160  -22.311 -14.939 1.00 0.00 ? 22 SER A HB3  5  
ATOM 5056  H HG   . SER A 1 21 ? -1.714  -22.843 -17.474 1.00 0.00 ? 22 SER A HG   5  
ATOM 5057  N N    . ILE A 1 22 ? -4.590  -20.849 -13.579 1.00 0.00 ? 23 ILE A N    5  
ATOM 5058  C CA   . ILE A 1 22 ? -5.211  -21.168 -12.266 1.00 0.00 ? 23 ILE A CA   5  
ATOM 5059  C C    . ILE A 1 22 ? -6.734  -21.073 -12.400 1.00 0.00 ? 23 ILE A C    5  
ATOM 5060  O O    . ILE A 1 22 ? -7.462  -21.931 -11.942 1.00 0.00 ? 23 ILE A O    5  
ATOM 5061  C CB   . ILE A 1 22 ? -4.704  -20.167 -11.212 1.00 0.00 ? 23 ILE A CB   5  
ATOM 5062  C CG1  . ILE A 1 22 ? -3.417  -20.706 -10.584 1.00 0.00 ? 23 ILE A CG1  5  
ATOM 5063  C CG2  . ILE A 1 22 ? -5.750  -19.960 -10.112 1.00 0.00 ? 23 ILE A CG2  5  
ATOM 5064  C CD1  . ILE A 1 22 ? -2.777  -19.619 -9.717  1.00 0.00 ? 23 ILE A CD1  5  
ATOM 5065  H H    . ILE A 1 22 ? -4.244  -19.946 -13.749 1.00 0.00 ? 23 ILE A H    5  
ATOM 5066  H HA   . ILE A 1 22 ? -4.938  -22.171 -11.972 1.00 0.00 ? 23 ILE A HA   5  
ATOM 5067  H HB   . ILE A 1 22 ? -4.500  -19.220 -11.690 1.00 0.00 ? 23 ILE A HB   5  
ATOM 5068  H HG12 . ILE A 1 22 ? -3.649  -21.566 -9.971  1.00 0.00 ? 23 ILE A HG12 5  
ATOM 5069  H HG13 . ILE A 1 22 ? -2.728  -20.993 -11.363 1.00 0.00 ? 23 ILE A HG13 5  
ATOM 5070  H HG21 . ILE A 1 22 ? -6.686  -19.642 -10.557 1.00 0.00 ? 23 ILE A HG21 5  
ATOM 5071  H HG22 . ILE A 1 22 ? -5.900  -20.887 -9.579  1.00 0.00 ? 23 ILE A HG22 5  
ATOM 5072  H HG23 . ILE A 1 22 ? -5.401  -19.202 -9.426  1.00 0.00 ? 23 ILE A HG23 5  
ATOM 5073  H HD11 . ILE A 1 22 ? -3.016  -18.647 -10.124 1.00 0.00 ? 23 ILE A HD11 5  
ATOM 5074  H HD12 . ILE A 1 22 ? -3.159  -19.691 -8.710  1.00 0.00 ? 23 ILE A HD12 5  
ATOM 5075  H HD13 . ILE A 1 22 ? -1.706  -19.751 -9.706  1.00 0.00 ? 23 ILE A HD13 5  
ATOM 5076  N N    . LYS A 1 23 ? -7.221  -20.031 -13.015 1.00 0.00 ? 24 LYS A N    5  
ATOM 5077  C CA   . LYS A 1 23 ? -8.685  -19.882 -13.164 1.00 0.00 ? 24 LYS A CA   5  
ATOM 5078  C C    . LYS A 1 23 ? -9.226  -20.986 -14.080 1.00 0.00 ? 24 LYS A C    5  
ATOM 5079  O O    . LYS A 1 23 ? -10.408 -21.265 -14.105 1.00 0.00 ? 24 LYS A O    5  
ATOM 5080  C CB   . LYS A 1 23 ? -8.966  -18.494 -13.746 1.00 0.00 ? 24 LYS A CB   5  
ATOM 5081  C CG   . LYS A 1 23 ? -8.960  -18.551 -15.272 1.00 0.00 ? 24 LYS A CG   5  
ATOM 5082  C CD   . LYS A 1 23 ? -9.125  -17.139 -15.841 1.00 0.00 ? 24 LYS A CD   5  
ATOM 5083  C CE   . LYS A 1 23 ? -10.476 -17.024 -16.549 1.00 0.00 ? 24 LYS A CE   5  
ATOM 5084  N NZ   . LYS A 1 23 ? -11.550 -17.555 -15.662 1.00 0.00 ? 24 LYS A NZ   5  
ATOM 5085  H H    . LYS A 1 23 ? -6.624  -19.339 -13.376 1.00 0.00 ? 24 LYS A H    5  
ATOM 5086  H HA   . LYS A 1 23 ? -9.148  -19.960 -12.197 1.00 0.00 ? 24 LYS A HA   5  
ATOM 5087  H HB2  . LYS A 1 23 ? -9.926  -18.144 -13.399 1.00 0.00 ? 24 LYS A HB2  5  
ATOM 5088  H HB3  . LYS A 1 23 ? -8.193  -17.819 -13.414 1.00 0.00 ? 24 LYS A HB3  5  
ATOM 5089  H HG2  . LYS A 1 23 ? -8.023  -18.971 -15.606 1.00 0.00 ? 24 LYS A HG2  5  
ATOM 5090  H HG3  . LYS A 1 23 ? -9.774  -19.173 -15.608 1.00 0.00 ? 24 LYS A HG3  5  
ATOM 5091  H HD2  . LYS A 1 23 ? -9.077  -16.421 -15.035 1.00 0.00 ? 24 LYS A HD2  5  
ATOM 5092  H HD3  . LYS A 1 23 ? -8.332  -16.942 -16.548 1.00 0.00 ? 24 LYS A HD3  5  
ATOM 5093  H HE2  . LYS A 1 23 ? -10.676 -15.987 -16.775 1.00 0.00 ? 24 LYS A HE2  5  
ATOM 5094  H HE3  . LYS A 1 23 ? -10.452 -17.594 -17.466 1.00 0.00 ? 24 LYS A HE3  5  
ATOM 5095  H HZ1  . LYS A 1 23 ? -11.271 -17.429 -14.667 1.00 0.00 ? 24 LYS A HZ1  5  
ATOM 5096  H HZ2  . LYS A 1 23 ? -12.435 -17.041 -15.843 1.00 0.00 ? 24 LYS A HZ2  5  
ATOM 5097  H HZ3  . LYS A 1 23 ? -11.694 -18.565 -15.856 1.00 0.00 ? 24 LYS A HZ3  5  
ATOM 5098  N N    . ARG A 1 24 ? -8.363  -21.615 -14.831 1.00 0.00 ? 25 ARG A N    5  
ATOM 5099  C CA   . ARG A 1 24 ? -8.819  -22.698 -15.745 1.00 0.00 ? 25 ARG A CA   5  
ATOM 5100  C C    . ARG A 1 24 ? -8.954  -24.005 -14.960 1.00 0.00 ? 25 ARG A C    5  
ATOM 5101  O O    . ARG A 1 24 ? -10.044 -24.472 -14.696 1.00 0.00 ? 25 ARG A O    5  
ATOM 5102  C CB   . ARG A 1 24 ? -7.795  -22.880 -16.865 1.00 0.00 ? 25 ARG A CB   5  
ATOM 5103  C CG   . ARG A 1 24 ? -8.192  -22.020 -18.069 1.00 0.00 ? 25 ARG A CG   5  
ATOM 5104  C CD   . ARG A 1 24 ? -6.967  -21.717 -18.928 1.00 0.00 ? 25 ARG A CD   5  
ATOM 5105  N NE   . ARG A 1 24 ? -5.917  -22.753 -18.707 1.00 0.00 ? 25 ARG A NE   5  
ATOM 5106  C CZ   . ARG A 1 24 ? -5.564  -23.543 -19.684 1.00 0.00 ? 25 ARG A CZ   5  
ATOM 5107  N NH1  . ARG A 1 24 ? -6.434  -23.882 -20.596 1.00 0.00 ? 25 ARG A NH1  5  
ATOM 5108  N NH2  . ARG A 1 24 ? -4.341  -23.992 -19.750 1.00 0.00 ? 25 ARG A NH2  5  
ATOM 5109  H H    . ARG A 1 24 ? -7.416  -21.374 -14.795 1.00 0.00 ? 25 ARG A H    5  
ATOM 5110  H HA   . ARG A 1 24 ? -9.774  -22.431 -16.169 1.00 0.00 ? 25 ARG A HA   5  
ATOM 5111  H HB2  . ARG A 1 24 ? -6.818  -22.577 -16.512 1.00 0.00 ? 25 ARG A HB2  5  
ATOM 5112  H HB3  . ARG A 1 24 ? -7.765  -23.918 -17.161 1.00 0.00 ? 25 ARG A HB3  5  
ATOM 5113  H HG2  . ARG A 1 24 ? -8.920  -22.546 -18.664 1.00 0.00 ? 25 ARG A HG2  5  
ATOM 5114  H HG3  . ARG A 1 24 ? -8.616  -21.090 -17.721 1.00 0.00 ? 25 ARG A HG3  5  
ATOM 5115  H HD2  . ARG A 1 24 ? -7.256  -21.715 -19.965 1.00 0.00 ? 25 ARG A HD2  5  
ATOM 5116  H HD3  . ARG A 1 24 ? -6.578  -20.747 -18.661 1.00 0.00 ? 25 ARG A HD3  5  
ATOM 5117  H HE   . ARG A 1 24 ? -5.492  -22.841 -17.828 1.00 0.00 ? 25 ARG A HE   5  
ATOM 5118  H HH11 . ARG A 1 24 ? -7.371  -23.536 -20.544 1.00 0.00 ? 25 ARG A HH11 5  
ATOM 5119  H HH12 . ARG A 1 24 ? -6.164  -24.486 -21.345 1.00 0.00 ? 25 ARG A HH12 5  
ATOM 5120  H HH21 . ARG A 1 24 ? -3.675  -23.733 -19.052 1.00 0.00 ? 25 ARG A HH21 5  
ATOM 5121  H HH22 . ARG A 1 24 ? -4.071  -24.597 -20.499 1.00 0.00 ? 25 ARG A HH22 5  
ATOM 5122  N N    . GLU A 1 25 ? -7.854  -24.599 -14.586 1.00 0.00 ? 26 GLU A N    5  
ATOM 5123  C CA   . GLU A 1 25 ? -7.920  -25.875 -13.819 1.00 0.00 ? 26 GLU A CA   5  
ATOM 5124  C C    . GLU A 1 25 ? -8.943  -25.739 -12.691 1.00 0.00 ? 26 GLU A C    5  
ATOM 5125  O O    . GLU A 1 25 ? -9.530  -26.707 -12.250 1.00 0.00 ? 26 GLU A O    5  
ATOM 5126  C CB   . GLU A 1 25 ? -6.543  -26.185 -13.227 1.00 0.00 ? 26 GLU A CB   5  
ATOM 5127  C CG   . GLU A 1 25 ? -6.119  -25.048 -12.294 1.00 0.00 ? 26 GLU A CG   5  
ATOM 5128  C CD   . GLU A 1 25 ? -4.591  -24.992 -12.219 1.00 0.00 ? 26 GLU A CD   5  
ATOM 5129  O OE1  . GLU A 1 25 ? -3.975  -24.771 -13.248 1.00 0.00 ? 26 GLU A OE1  5  
ATOM 5130  O OE2  . GLU A 1 25 ? -4.065  -25.172 -11.133 1.00 0.00 ? 26 GLU A OE2  5  
ATOM 5131  H H    . GLU A 1 25 ? -6.984  -24.205 -14.808 1.00 0.00 ? 26 GLU A H    5  
ATOM 5132  H HA   . GLU A 1 25 ? -8.217  -26.677 -14.479 1.00 0.00 ? 26 GLU A HA   5  
ATOM 5133  H HB2  . GLU A 1 25 ? -6.593  -27.110 -12.669 1.00 0.00 ? 26 GLU A HB2  5  
ATOM 5134  H HB3  . GLU A 1 25 ? -5.822  -26.283 -14.024 1.00 0.00 ? 26 GLU A HB3  5  
ATOM 5135  H HG2  . GLU A 1 25 ? -6.495  -24.110 -12.675 1.00 0.00 ? 26 GLU A HG2  5  
ATOM 5136  H HG3  . GLU A 1 25 ? -6.520  -25.223 -11.307 1.00 0.00 ? 26 GLU A HG3  5  
ATOM 5137  N N    . ASN A 1 26 ? -9.162  -24.542 -12.220 1.00 0.00 ? 27 ASN A N    5  
ATOM 5138  C CA   . ASN A 1 26 ? -10.147 -24.342 -11.120 1.00 0.00 ? 27 ASN A CA   5  
ATOM 5139  C C    . ASN A 1 26 ? -11.498 -23.928 -11.706 1.00 0.00 ? 27 ASN A C    5  
ATOM 5140  O O    . ASN A 1 26 ? -11.561 -23.314 -12.753 1.00 0.00 ? 27 ASN A O    5  
ATOM 5141  C CB   . ASN A 1 26 ? -9.646  -23.245 -10.178 1.00 0.00 ? 27 ASN A CB   5  
ATOM 5142  C CG   . ASN A 1 26 ? -8.260  -23.619 -9.651  1.00 0.00 ? 27 ASN A CG   5  
ATOM 5143  O OD1  . ASN A 1 26 ? -7.996  -24.769 -9.364  1.00 0.00 ? 27 ASN A OD1  5  
ATOM 5144  N ND2  . ASN A 1 26 ? -7.357  -22.687 -9.508  1.00 0.00 ? 27 ASN A ND2  5  
ATOM 5145  H H    . ASN A 1 26 ? -8.677  -23.774 -12.590 1.00 0.00 ? 27 ASN A H    5  
ATOM 5146  H HA   . ASN A 1 26 ? -10.268 -25.262 -10.568 1.00 0.00 ? 27 ASN A HA   5  
ATOM 5147  H HB2  . ASN A 1 26 ? -9.586  -22.309 -10.715 1.00 0.00 ? 27 ASN A HB2  5  
ATOM 5148  H HB3  . ASN A 1 26 ? -10.328 -23.142 -9.349  1.00 0.00 ? 27 ASN A HB3  5  
ATOM 5149  H HD21 . ASN A 1 26 ? -7.573  -21.759 -9.738  1.00 0.00 ? 27 ASN A HD21 5  
ATOM 5150  H HD22 . ASN A 1 26 ? -6.466  -22.915 -9.170  1.00 0.00 ? 27 ASN A HD22 5  
ATOM 5151  N N    . PRO A 1 27 ? -12.541 -24.277 -11.000 1.00 0.00 ? 28 PRO A N    5  
ATOM 5152  C CA   . PRO A 1 27 ? -13.918 -23.961 -11.401 1.00 0.00 ? 28 PRO A CA   5  
ATOM 5153  C C    . PRO A 1 27 ? -14.238 -22.499 -11.102 1.00 0.00 ? 28 PRO A C    5  
ATOM 5154  O O    . PRO A 1 27 ? -14.985 -22.197 -10.192 1.00 0.00 ? 28 PRO A O    5  
ATOM 5155  C CB   . PRO A 1 27 ? -14.769 -24.881 -10.542 1.00 0.00 ? 28 PRO A CB   5  
ATOM 5156  C CG   . PRO A 1 27 ? -13.905 -25.261 -9.334  1.00 0.00 ? 28 PRO A CG   5  
ATOM 5157  C CD   . PRO A 1 27 ? -12.442 -25.019 -9.731  1.00 0.00 ? 28 PRO A CD   5  
ATOM 5158  H HA   . PRO A 1 27 ? -14.071 -24.192 -12.424 1.00 0.00 ? 28 PRO A HA   5  
ATOM 5159  H HB2  . PRO A 1 27 ? -15.657 -24.358 -10.214 1.00 0.00 ? 28 PRO A HB2  5  
ATOM 5160  H HB3  . PRO A 1 27 ? -15.033 -25.766 -11.094 1.00 0.00 ? 28 PRO A HB3  5  
ATOM 5161  H HG2  . PRO A 1 27 ? -14.170 -24.643 -8.497  1.00 0.00 ? 28 PRO A HG2  5  
ATOM 5162  H HG3  . PRO A 1 27 ? -14.051 -26.297 -9.101  1.00 0.00 ? 28 PRO A HG3  5  
ATOM 5163  H HD2  . PRO A 1 27 ? -11.940 -24.426 -8.979  1.00 0.00 ? 28 PRO A HD2  5  
ATOM 5164  H HD3  . PRO A 1 27 ? -11.930 -25.956 -9.886  1.00 0.00 ? 28 PRO A HD3  5  
ATOM 5165  N N    . GLY A 1 28 ? -13.671 -21.586 -11.845 1.00 0.00 ? 29 GLY A N    5  
ATOM 5166  C CA   . GLY A 1 28 ? -13.942 -20.147 -11.570 1.00 0.00 ? 29 GLY A CA   5  
ATOM 5167  C C    . GLY A 1 28 ? -13.836 -19.927 -10.064 1.00 0.00 ? 29 GLY A C    5  
ATOM 5168  O O    . GLY A 1 28 ? -14.475 -19.061 -9.498  1.00 0.00 ? 29 GLY A O    5  
ATOM 5169  H H    . GLY A 1 28 ? -13.062 -21.844 -12.567 1.00 0.00 ? 29 GLY A H    5  
ATOM 5170  H HA2  . GLY A 1 28 ? -13.213 -19.535 -12.085 1.00 0.00 ? 29 GLY A HA2  5  
ATOM 5171  H HA3  . GLY A 1 28 ? -14.936 -19.890 -11.903 1.00 0.00 ? 29 GLY A HA3  5  
ATOM 5172  N N    . ILE A 1 29 ? -13.036 -20.732 -9.417  1.00 0.00 ? 30 ILE A N    5  
ATOM 5173  C CA   . ILE A 1 29 ? -12.862 -20.628 -7.948  1.00 0.00 ? 30 ILE A CA   5  
ATOM 5174  C C    . ILE A 1 29 ? -12.883 -19.162 -7.511  1.00 0.00 ? 30 ILE A C    5  
ATOM 5175  O O    . ILE A 1 29 ? -12.541 -18.273 -8.264  1.00 0.00 ? 30 ILE A O    5  
ATOM 5176  C CB   . ILE A 1 29 ? -11.533 -21.260 -7.584  1.00 0.00 ? 30 ILE A CB   5  
ATOM 5177  C CG1  . ILE A 1 29 ? -11.321 -21.208 -6.069  1.00 0.00 ? 30 ILE A CG1  5  
ATOM 5178  C CG2  . ILE A 1 29 ? -10.440 -20.483 -8.285  1.00 0.00 ? 30 ILE A CG2  5  
ATOM 5179  C CD1  . ILE A 1 29 ? -10.066 -22.005 -5.704  1.00 0.00 ? 30 ILE A CD1  5  
ATOM 5180  H H    . ILE A 1 29 ? -12.544 -21.425 -9.905  1.00 0.00 ? 30 ILE A H    5  
ATOM 5181  H HA   . ILE A 1 29 ? -13.647 -21.158 -7.461  1.00 0.00 ? 30 ILE A HA   5  
ATOM 5182  H HB   . ILE A 1 29 ? -11.521 -22.285 -7.925  1.00 0.00 ? 30 ILE A HB   5  
ATOM 5183  H HG12 . ILE A 1 29 ? -11.201 -20.180 -5.758  1.00 0.00 ? 30 ILE A HG12 5  
ATOM 5184  H HG13 . ILE A 1 29 ? -12.177 -21.638 -5.571  1.00 0.00 ? 30 ILE A HG13 5  
ATOM 5185  H HG21 . ILE A 1 29 ? -10.819 -19.507 -8.534  1.00 0.00 ? 30 ILE A HG21 5  
ATOM 5186  H HG22 . ILE A 1 29 ? -9.587  -20.389 -7.632  1.00 0.00 ? 30 ILE A HG22 5  
ATOM 5187  H HG23 . ILE A 1 29 ? -10.158 -21.001 -9.186  1.00 0.00 ? 30 ILE A HG23 5  
ATOM 5188  H HD11 . ILE A 1 29 ? -9.789  -22.638 -6.533  1.00 0.00 ? 30 ILE A HD11 5  
ATOM 5189  H HD12 . ILE A 1 29 ? -9.258  -21.323 -5.485  1.00 0.00 ? 30 ILE A HD12 5  
ATOM 5190  H HD13 . ILE A 1 29 ? -10.268 -22.614 -4.835  1.00 0.00 ? 30 ILE A HD13 5  
ATOM 5191  N N    . LYS A 1 30 ? -13.285 -18.907 -6.298  1.00 0.00 ? 31 LYS A N    5  
ATOM 5192  C CA   . LYS A 1 30 ? -13.335 -17.506 -5.805  1.00 0.00 ? 31 LYS A CA   5  
ATOM 5193  C C    . LYS A 1 30 ? -11.911 -16.979 -5.607  1.00 0.00 ? 31 LYS A C    5  
ATOM 5194  O O    . LYS A 1 30 ? -10.975 -17.738 -5.453  1.00 0.00 ? 31 LYS A O    5  
ATOM 5195  C CB   . LYS A 1 30 ? -14.083 -17.474 -4.477  1.00 0.00 ? 31 LYS A CB   5  
ATOM 5196  C CG   . LYS A 1 30 ? -15.588 -17.575 -4.735  1.00 0.00 ? 31 LYS A CG   5  
ATOM 5197  C CD   . LYS A 1 30 ? -16.224 -18.493 -3.691  1.00 0.00 ? 31 LYS A CD   5  
ATOM 5198  C CE   . LYS A 1 30 ? -16.099 -17.853 -2.308  1.00 0.00 ? 31 LYS A CE   5  
ATOM 5199  N NZ   . LYS A 1 30 ? -16.898 -18.637 -1.324  1.00 0.00 ? 31 LYS A NZ   5  
ATOM 5200  H H    . LYS A 1 30 ? -13.559 -19.640 -5.709  1.00 0.00 ? 31 LYS A H    5  
ATOM 5201  H HA   . LYS A 1 30 ? -13.852 -16.891 -6.521  1.00 0.00 ? 31 LYS A HA   5  
ATOM 5202  H HB2  . LYS A 1 30 ? -13.765 -18.307 -3.874  1.00 0.00 ? 31 LYS A HB2  5  
ATOM 5203  H HB3  . LYS A 1 30 ? -13.867 -16.554 -3.964  1.00 0.00 ? 31 LYS A HB3  5  
ATOM 5204  H HG2  . LYS A 1 30 ? -16.031 -16.592 -4.670  1.00 0.00 ? 31 LYS A HG2  5  
ATOM 5205  H HG3  . LYS A 1 30 ? -15.757 -17.983 -5.720  1.00 0.00 ? 31 LYS A HG3  5  
ATOM 5206  H HD2  . LYS A 1 30 ? -17.268 -18.638 -3.928  1.00 0.00 ? 31 LYS A HD2  5  
ATOM 5207  H HD3  . LYS A 1 30 ? -15.717 -19.446 -3.691  1.00 0.00 ? 31 LYS A HD3  5  
ATOM 5208  H HE2  . LYS A 1 30 ? -15.061 -17.847 -2.006  1.00 0.00 ? 31 LYS A HE2  5  
ATOM 5209  H HE3  . LYS A 1 30 ? -16.469 -16.839 -2.346  1.00 0.00 ? 31 LYS A HE3  5  
ATOM 5210  H HZ1  . LYS A 1 30 ? -17.602 -19.211 -1.830  1.00 0.00 ? 31 LYS A HZ1  5  
ATOM 5211  H HZ2  . LYS A 1 30 ? -16.267 -19.262 -0.785  1.00 0.00 ? 31 LYS A HZ2  5  
ATOM 5212  H HZ3  . LYS A 1 30 ? -17.383 -17.986 -0.674  1.00 0.00 ? 31 LYS A HZ3  5  
ATOM 5213  N N    . VAL A 1 31 ? -11.740 -15.685 -5.610  1.00 0.00 ? 32 VAL A N    5  
ATOM 5214  C CA   . VAL A 1 31 ? -10.388 -15.110 -5.423  1.00 0.00 ? 32 VAL A CA   5  
ATOM 5215  C C    . VAL A 1 31 ? -9.857  -15.512 -4.039  1.00 0.00 ? 32 VAL A C    5  
ATOM 5216  O O    . VAL A 1 31 ? -8.667  -15.644 -3.836  1.00 0.00 ? 32 VAL A O    5  
ATOM 5217  C CB   . VAL A 1 31 ? -10.457 -13.578 -5.564  1.00 0.00 ? 32 VAL A CB   5  
ATOM 5218  C CG1  . VAL A 1 31 ? -11.838 -13.088 -5.172  1.00 0.00 ? 32 VAL A CG1  5  
ATOM 5219  C CG2  . VAL A 1 31 ? -9.430  -12.916 -4.658  1.00 0.00 ? 32 VAL A CG2  5  
ATOM 5220  H H    . VAL A 1 31 ? -12.499 -15.092 -5.735  1.00 0.00 ? 32 VAL A H    5  
ATOM 5221  H HA   . VAL A 1 31 ? -9.742  -15.496 -6.179  1.00 0.00 ? 32 VAL A HA   5  
ATOM 5222  H HB   . VAL A 1 31 ? -10.264 -13.309 -6.589  1.00 0.00 ? 32 VAL A HB   5  
ATOM 5223  H HG11 . VAL A 1 31 ? -12.193 -13.669 -4.339  1.00 0.00 ? 32 VAL A HG11 5  
ATOM 5224  H HG12 . VAL A 1 31 ? -11.790 -12.046 -4.897  1.00 0.00 ? 32 VAL A HG12 5  
ATOM 5225  H HG13 . VAL A 1 31 ? -12.506 -13.215 -6.008  1.00 0.00 ? 32 VAL A HG13 5  
ATOM 5226  H HG21 . VAL A 1 31 ? -8.444  -13.266 -4.915  1.00 0.00 ? 32 VAL A HG21 5  
ATOM 5227  H HG22 . VAL A 1 31 ? -9.483  -11.847 -4.777  1.00 0.00 ? 32 VAL A HG22 5  
ATOM 5228  H HG23 . VAL A 1 31 ? -9.651  -13.180 -3.636  1.00 0.00 ? 32 VAL A HG23 5  
ATOM 5229  N N    . THR A 1 32 ? -10.732 -15.703 -3.089  1.00 0.00 ? 33 THR A N    5  
ATOM 5230  C CA   . THR A 1 32 ? -10.281 -16.091 -1.723  1.00 0.00 ? 33 THR A CA   5  
ATOM 5231  C C    . THR A 1 32 ? -9.669  -17.493 -1.762  1.00 0.00 ? 33 THR A C    5  
ATOM 5232  O O    . THR A 1 32 ? -8.597  -17.727 -1.239  1.00 0.00 ? 33 THR A O    5  
ATOM 5233  C CB   . THR A 1 32 ? -11.480 -16.081 -0.774  1.00 0.00 ? 33 THR A CB   5  
ATOM 5234  O OG1  . THR A 1 32 ? -12.445 -15.152 -1.246  1.00 0.00 ? 33 THR A OG1  5  
ATOM 5235  C CG2  . THR A 1 32 ? -11.023 -15.676 0.629   1.00 0.00 ? 33 THR A CG2  5  
ATOM 5236  H H    . THR A 1 32 ? -11.687 -15.589 -3.274  1.00 0.00 ? 33 THR A H    5  
ATOM 5237  H HA   . THR A 1 32 ? -9.541  -15.385 -1.374  1.00 0.00 ? 33 THR A HA   5  
ATOM 5238  H HB   . THR A 1 32 ? -11.917 -17.066 -0.735  1.00 0.00 ? 33 THR A HB   5  
ATOM 5239  H HG1  . THR A 1 32 ? -13.212 -15.646 -1.541  1.00 0.00 ? 33 THR A HG1  5  
ATOM 5240  H HG21 . THR A 1 32 ? -9.948  -15.755 0.695   1.00 0.00 ? 33 THR A HG21 5  
ATOM 5241  H HG22 . THR A 1 32 ? -11.323 -14.658 0.824   1.00 0.00 ? 33 THR A HG22 5  
ATOM 5242  H HG23 . THR A 1 32 ? -11.477 -16.331 1.358   1.00 0.00 ? 33 THR A HG23 5  
ATOM 5243  N N    . GLU A 1 33 ? -10.340 -18.430 -2.374  1.00 0.00 ? 34 GLU A N    5  
ATOM 5244  C CA   . GLU A 1 33 ? -9.792  -19.814 -2.443  1.00 0.00 ? 34 GLU A CA   5  
ATOM 5245  C C    . GLU A 1 33 ? -8.678  -19.870 -3.491  1.00 0.00 ? 34 GLU A C    5  
ATOM 5246  O O    . GLU A 1 33 ? -7.894  -20.798 -3.528  1.00 0.00 ? 34 GLU A O    5  
ATOM 5247  C CB   . GLU A 1 33 ? -10.907 -20.787 -2.830  1.00 0.00 ? 34 GLU A CB   5  
ATOM 5248  C CG   . GLU A 1 33 ? -12.066 -20.659 -1.841  1.00 0.00 ? 34 GLU A CG   5  
ATOM 5249  C CD   . GLU A 1 33 ? -11.564 -20.954 -0.425  1.00 0.00 ? 34 GLU A CD   5  
ATOM 5250  O OE1  . GLU A 1 33 ? -10.809 -20.149 0.094   1.00 0.00 ? 34 GLU A OE1  5  
ATOM 5251  O OE2  . GLU A 1 33 ? -11.945 -21.979 0.115   1.00 0.00 ? 34 GLU A OE2  5  
ATOM 5252  H H    . GLU A 1 33 ? -11.202 -18.222 -2.789  1.00 0.00 ? 34 GLU A H    5  
ATOM 5253  H HA   . GLU A 1 33 ? -9.393  -20.091 -1.478  1.00 0.00 ? 34 GLU A HA   5  
ATOM 5254  H HB2  . GLU A 1 33 ? -11.256 -20.555 -3.826  1.00 0.00 ? 34 GLU A HB2  5  
ATOM 5255  H HB3  . GLU A 1 33 ? -10.526 -21.797 -2.808  1.00 0.00 ? 34 GLU A HB3  5  
ATOM 5256  H HG2  . GLU A 1 33 ? -12.465 -19.657 -1.881  1.00 0.00 ? 34 GLU A HG2  5  
ATOM 5257  H HG3  . GLU A 1 33 ? -12.839 -21.366 -2.100  1.00 0.00 ? 34 GLU A HG3  5  
ATOM 5258  N N    . VAL A 1 34 ? -8.601  -18.885 -4.343  1.00 0.00 ? 35 VAL A N    5  
ATOM 5259  C CA   . VAL A 1 34 ? -7.538  -18.884 -5.385  1.00 0.00 ? 35 VAL A CA   5  
ATOM 5260  C C    . VAL A 1 34 ? -6.172  -18.701 -4.719  1.00 0.00 ? 35 VAL A C    5  
ATOM 5261  O O    . VAL A 1 34 ? -5.166  -19.181 -5.203  1.00 0.00 ? 35 VAL A O    5  
ATOM 5262  C CB   . VAL A 1 34 ? -7.791  -17.737 -6.361  1.00 0.00 ? 35 VAL A CB   5  
ATOM 5263  C CG1  . VAL A 1 34 ? -6.539  -17.485 -7.205  1.00 0.00 ? 35 VAL A CG1  5  
ATOM 5264  C CG2  . VAL A 1 34 ? -8.959  -18.102 -7.280  1.00 0.00 ? 35 VAL A CG2  5  
ATOM 5265  H H    . VAL A 1 34 ? -9.242  -18.145 -4.297  1.00 0.00 ? 35 VAL A H    5  
ATOM 5266  H HA   . VAL A 1 34 ? -7.557  -19.816 -5.919  1.00 0.00 ? 35 VAL A HA   5  
ATOM 5267  H HB   . VAL A 1 34 ? -8.036  -16.849 -5.804  1.00 0.00 ? 35 VAL A HB   5  
ATOM 5268  H HG11 . VAL A 1 34 ? -5.818  -18.267 -7.022  1.00 0.00 ? 35 VAL A HG11 5  
ATOM 5269  H HG12 . VAL A 1 34 ? -6.806  -17.478 -8.251  1.00 0.00 ? 35 VAL A HG12 5  
ATOM 5270  H HG13 . VAL A 1 34 ? -6.110  -16.530 -6.937  1.00 0.00 ? 35 VAL A HG13 5  
ATOM 5271  H HG21 . VAL A 1 34 ? -9.651  -18.738 -6.749  1.00 0.00 ? 35 VAL A HG21 5  
ATOM 5272  H HG22 . VAL A 1 34 ? -9.465  -17.201 -7.595  1.00 0.00 ? 35 VAL A HG22 5  
ATOM 5273  H HG23 . VAL A 1 34 ? -8.584  -18.624 -8.148  1.00 0.00 ? 35 VAL A HG23 5  
ATOM 5274  N N    . ALA A 1 35 ? -6.130  -18.010 -3.615  1.00 0.00 ? 36 ALA A N    5  
ATOM 5275  C CA   . ALA A 1 35 ? -4.832  -17.795 -2.920  1.00 0.00 ? 36 ALA A CA   5  
ATOM 5276  C C    . ALA A 1 35 ? -4.502  -19.020 -2.065  1.00 0.00 ? 36 ALA A C    5  
ATOM 5277  O O    . ALA A 1 35 ? -3.355  -19.298 -1.778  1.00 0.00 ? 36 ALA A O    5  
ATOM 5278  C CB   . ALA A 1 35 ? -4.934  -16.560 -2.022  1.00 0.00 ? 36 ALA A CB   5  
ATOM 5279  H H    . ALA A 1 35 ? -6.952  -17.630 -3.245  1.00 0.00 ? 36 ALA A H    5  
ATOM 5280  H HA   . ALA A 1 35 ? -4.054  -17.645 -3.651  1.00 0.00 ? 36 ALA A HA   5  
ATOM 5281  H HB1  . ALA A 1 35 ? -5.459  -15.776 -2.548  1.00 0.00 ? 36 ALA A HB1  5  
ATOM 5282  H HB2  . ALA A 1 35 ? -5.472  -16.814 -1.122  1.00 0.00 ? 36 ALA A HB2  5  
ATOM 5283  H HB3  . ALA A 1 35 ? -3.942  -16.220 -1.764  1.00 0.00 ? 36 ALA A HB3  5  
ATOM 5284  N N    . LYS A 1 36 ? -5.498  -19.757 -1.657  1.00 0.00 ? 37 LYS A N    5  
ATOM 5285  C CA   . LYS A 1 36 ? -5.243  -20.960 -0.824  1.00 0.00 ? 37 LYS A CA   5  
ATOM 5286  C C    . LYS A 1 36 ? -4.346  -21.932 -1.596  1.00 0.00 ? 37 LYS A C    5  
ATOM 5287  O O    . LYS A 1 36 ? -3.329  -22.379 -1.106  1.00 0.00 ? 37 LYS A O    5  
ATOM 5288  C CB   . LYS A 1 36 ? -6.584  -21.607 -0.488  1.00 0.00 ? 37 LYS A CB   5  
ATOM 5289  C CG   . LYS A 1 36 ? -6.412  -23.105 -0.211  1.00 0.00 ? 37 LYS A CG   5  
ATOM 5290  C CD   . LYS A 1 36 ? -5.223  -23.318 0.728   1.00 0.00 ? 37 LYS A CD   5  
ATOM 5291  C CE   . LYS A 1 36 ? -5.665  -24.151 1.932   1.00 0.00 ? 37 LYS A CE   5  
ATOM 5292  N NZ   . LYS A 1 36 ? -5.160  -25.545 1.785   1.00 0.00 ? 37 LYS A NZ   5  
ATOM 5293  H H    . LYS A 1 36 ? -6.419  -19.520 -1.898  1.00 0.00 ? 37 LYS A H    5  
ATOM 5294  H HA   . LYS A 1 36 ? -4.759  -20.668 0.088   1.00 0.00 ? 37 LYS A HA   5  
ATOM 5295  H HB2  . LYS A 1 36 ? -6.982  -21.125 0.389   1.00 0.00 ? 37 LYS A HB2  5  
ATOM 5296  H HB3  . LYS A 1 36 ? -7.261  -21.465 -1.316  1.00 0.00 ? 37 LYS A HB3  5  
ATOM 5297  H HG2  . LYS A 1 36 ? -7.310  -23.490 0.252   1.00 0.00 ? 37 LYS A HG2  5  
ATOM 5298  H HG3  . LYS A 1 36 ? -6.234  -23.626 -1.139  1.00 0.00 ? 37 LYS A HG3  5  
ATOM 5299  H HD2  . LYS A 1 36 ? -4.436  -23.838 0.199   1.00 0.00 ? 37 LYS A HD2  5  
ATOM 5300  H HD3  . LYS A 1 36 ? -4.857  -22.362 1.068   1.00 0.00 ? 37 LYS A HD3  5  
ATOM 5301  H HE2  . LYS A 1 36 ? -5.265  -23.716 2.836   1.00 0.00 ? 37 LYS A HE2  5  
ATOM 5302  H HE3  . LYS A 1 36 ? -6.745  -24.162 1.986   1.00 0.00 ? 37 LYS A HE3  5  
ATOM 5303  H HZ1  . LYS A 1 36 ? -4.441  -25.575 1.033   1.00 0.00 ? 37 LYS A HZ1  5  
ATOM 5304  H HZ2  . LYS A 1 36 ? -4.738  -25.857 2.681   1.00 0.00 ? 37 LYS A HZ2  5  
ATOM 5305  H HZ3  . LYS A 1 36 ? -5.948  -26.176 1.538   1.00 0.00 ? 37 LYS A HZ3  5  
ATOM 5306  N N    . ARG A 1 37 ? -4.721  -22.260 -2.799  1.00 0.00 ? 38 ARG A N    5  
ATOM 5307  C CA   . ARG A 1 37 ? -3.903  -23.200 -3.611  1.00 0.00 ? 38 ARG A CA   5  
ATOM 5308  C C    . ARG A 1 37 ? -2.775  -22.436 -4.308  1.00 0.00 ? 38 ARG A C    5  
ATOM 5309  O O    . ARG A 1 37 ? -1.776  -23.006 -4.696  1.00 0.00 ? 38 ARG A O    5  
ATOM 5310  C CB   . ARG A 1 37 ? -4.796  -23.857 -4.662  1.00 0.00 ? 38 ARG A CB   5  
ATOM 5311  C CG   . ARG A 1 37 ? -4.757  -25.377 -4.492  1.00 0.00 ? 38 ARG A CG   5  
ATOM 5312  C CD   . ARG A 1 37 ? -5.161  -25.743 -3.063  1.00 0.00 ? 38 ARG A CD   5  
ATOM 5313  N NE   . ARG A 1 37 ? -4.011  -26.393 -2.374  1.00 0.00 ? 38 ARG A NE   5  
ATOM 5314  C CZ   . ARG A 1 37 ? -3.929  -27.693 -2.324  1.00 0.00 ? 38 ARG A CZ   5  
ATOM 5315  N NH1  . ARG A 1 37 ? -3.693  -28.375 -3.411  1.00 0.00 ? 38 ARG A NH1  5  
ATOM 5316  N NH2  . ARG A 1 37 ? -4.082  -28.313 -1.186  1.00 0.00 ? 38 ARG A NH2  5  
ATOM 5317  H H    . ARG A 1 37 ? -5.546  -21.889 -3.171  1.00 0.00 ? 38 ARG A H    5  
ATOM 5318  H HA   . ARG A 1 37 ? -3.484  -23.958 -2.969  1.00 0.00 ? 38 ARG A HA   5  
ATOM 5319  H HB2  . ARG A 1 37 ? -5.810  -23.504 -4.535  1.00 0.00 ? 38 ARG A HB2  5  
ATOM 5320  H HB3  . ARG A 1 37 ? -4.442  -23.597 -5.647  1.00 0.00 ? 38 ARG A HB3  5  
ATOM 5321  H HG2  . ARG A 1 37 ? -5.445  -25.833 -5.190  1.00 0.00 ? 38 ARG A HG2  5  
ATOM 5322  H HG3  . ARG A 1 37 ? -3.757  -25.736 -4.684  1.00 0.00 ? 38 ARG A HG3  5  
ATOM 5323  H HD2  . ARG A 1 37 ? -5.444  -24.849 -2.528  1.00 0.00 ? 38 ARG A HD2  5  
ATOM 5324  H HD3  . ARG A 1 37 ? -5.998  -26.426 -3.091  1.00 0.00 ? 38 ARG A HD3  5  
ATOM 5325  H HE   . ARG A 1 37 ? -3.316  -25.842 -1.956  1.00 0.00 ? 38 ARG A HE   5  
ATOM 5326  H HH11 . ARG A 1 37 ? -3.575  -27.899 -4.283  1.00 0.00 ? 38 ARG A HH11 5  
ATOM 5327  H HH12 . ARG A 1 37 ? -3.631  -29.371 -3.372  1.00 0.00 ? 38 ARG A HH12 5  
ATOM 5328  H HH21 . ARG A 1 37 ? -4.261  -27.789 -0.353  1.00 0.00 ? 38 ARG A HH21 5  
ATOM 5329  H HH22 . ARG A 1 37 ? -4.019  -29.310 -1.148  1.00 0.00 ? 38 ARG A HH22 5  
ATOM 5330  N N    . GLY A 1 38 ? -2.927  -21.152 -4.475  1.00 0.00 ? 39 GLY A N    5  
ATOM 5331  C CA   . GLY A 1 38 ? -1.859  -20.359 -5.151  1.00 0.00 ? 39 GLY A CA   5  
ATOM 5332  C C    . GLY A 1 38 ? -0.611  -20.324 -4.269  1.00 0.00 ? 39 GLY A C    5  
ATOM 5333  O O    . GLY A 1 38 ? 0.488   -20.115 -4.742  1.00 0.00 ? 39 GLY A O    5  
ATOM 5334  H H    . GLY A 1 38 ? -3.742  -20.708 -4.159  1.00 0.00 ? 39 GLY A H    5  
ATOM 5335  H HA2  . GLY A 1 38 ? -1.620  -20.817 -6.101  1.00 0.00 ? 39 GLY A HA2  5  
ATOM 5336  H HA3  . GLY A 1 38 ? -2.209  -19.350 -5.315  1.00 0.00 ? 39 GLY A HA3  5  
ATOM 5337  N N    . GLY A 1 39 ? -0.771  -20.524 -2.990  1.00 0.00 ? 40 GLY A N    5  
ATOM 5338  C CA   . GLY A 1 39 ? 0.407   -20.496 -2.077  1.00 0.00 ? 40 GLY A CA   5  
ATOM 5339  C C    . GLY A 1 39 ? 1.212   -21.790 -2.226  1.00 0.00 ? 40 GLY A C    5  
ATOM 5340  O O    . GLY A 1 39 ? 2.390   -21.834 -1.930  1.00 0.00 ? 40 GLY A O    5  
ATOM 5341  H H    . GLY A 1 39 ? -1.667  -20.688 -2.629  1.00 0.00 ? 40 GLY A H    5  
ATOM 5342  H HA2  . GLY A 1 39 ? 1.034   -19.651 -2.325  1.00 0.00 ? 40 GLY A HA2  5  
ATOM 5343  H HA3  . GLY A 1 39 ? 0.068   -20.405 -1.056  1.00 0.00 ? 40 GLY A HA3  5  
ATOM 5344  N N    . GLU A 1 40 ? 0.591   -22.846 -2.678  1.00 0.00 ? 41 GLU A N    5  
ATOM 5345  C CA   . GLU A 1 40 ? 1.330   -24.130 -2.837  1.00 0.00 ? 41 GLU A CA   5  
ATOM 5346  C C    . GLU A 1 40 ? 2.393   -23.983 -3.931  1.00 0.00 ? 41 GLU A C    5  
ATOM 5347  O O    . GLU A 1 40 ? 3.487   -24.499 -3.820  1.00 0.00 ? 41 GLU A O    5  
ATOM 5348  C CB   . GLU A 1 40 ? 0.352   -25.250 -3.198  1.00 0.00 ? 41 GLU A CB   5  
ATOM 5349  C CG   . GLU A 1 40 ? 0.046   -25.232 -4.701  1.00 0.00 ? 41 GLU A CG   5  
ATOM 5350  C CD   . GLU A 1 40 ? -1.231  -26.029 -4.974  1.00 0.00 ? 41 GLU A CD   5  
ATOM 5351  O OE1  . GLU A 1 40 ? -1.685  -26.712 -4.072  1.00 0.00 ? 41 GLU A OE1  5  
ATOM 5352  O OE2  . GLU A 1 40 ? -1.734  -25.942 -6.083  1.00 0.00 ? 41 GLU A OE2  5  
ATOM 5353  H H    . GLU A 1 40 ? -0.361  -22.796 -2.910  1.00 0.00 ? 41 GLU A H    5  
ATOM 5354  H HA   . GLU A 1 40 ? 1.814   -24.378 -1.906  1.00 0.00 ? 41 GLU A HA   5  
ATOM 5355  H HB2  . GLU A 1 40 ? 0.791   -26.198 -2.930  1.00 0.00 ? 41 GLU A HB2  5  
ATOM 5356  H HB3  . GLU A 1 40 ? -0.564  -25.112 -2.645  1.00 0.00 ? 41 GLU A HB3  5  
ATOM 5357  H HG2  . GLU A 1 40 ? -0.089  -24.213 -5.029  1.00 0.00 ? 41 GLU A HG2  5  
ATOM 5358  H HG3  . GLU A 1 40 ? 0.868   -25.678 -5.240  1.00 0.00 ? 41 GLU A HG3  5  
ATOM 5359  N N    . LEU A 1 41 ? 2.079   -23.285 -4.987  1.00 0.00 ? 42 LEU A N    5  
ATOM 5360  C CA   . LEU A 1 41 ? 3.064   -23.108 -6.084  1.00 0.00 ? 42 LEU A CA   5  
ATOM 5361  C C    . LEU A 1 41 ? 3.953   -21.900 -5.784  1.00 0.00 ? 42 LEU A C    5  
ATOM 5362  O O    . LEU A 1 41 ? 5.107   -21.864 -6.152  1.00 0.00 ? 42 LEU A O    5  
ATOM 5363  C CB   . LEU A 1 41 ? 2.319   -22.882 -7.398  1.00 0.00 ? 42 LEU A CB   5  
ATOM 5364  C CG   . LEU A 1 41 ? 1.914   -24.231 -7.991  1.00 0.00 ? 42 LEU A CG   5  
ATOM 5365  C CD1  . LEU A 1 41 ? 0.946   -24.007 -9.155  1.00 0.00 ? 42 LEU A CD1  5  
ATOM 5366  C CD2  . LEU A 1 41 ? 3.160   -24.961 -8.499  1.00 0.00 ? 42 LEU A CD2  5  
ATOM 5367  H H    . LEU A 1 41 ? 1.194   -22.878 -5.061  1.00 0.00 ? 42 LEU A H    5  
ATOM 5368  H HA   . LEU A 1 41 ? 3.674   -23.994 -6.165  1.00 0.00 ? 42 LEU A HA   5  
ATOM 5369  H HB2  . LEU A 1 41 ? 1.435   -22.288 -7.214  1.00 0.00 ? 42 LEU A HB2  5  
ATOM 5370  H HB3  . LEU A 1 41 ? 2.962   -22.364 -8.092  1.00 0.00 ? 42 LEU A HB3  5  
ATOM 5371  H HG   . LEU A 1 41 ? 1.429   -24.826 -7.230  1.00 0.00 ? 42 LEU A HG   5  
ATOM 5372  H HD11 . LEU A 1 41 ? 1.165   -23.061 -9.628  1.00 0.00 ? 42 LEU A HD11 5  
ATOM 5373  H HD12 . LEU A 1 41 ? 1.059   -24.804 -9.875  1.00 0.00 ? 42 LEU A HD12 5  
ATOM 5374  H HD13 . LEU A 1 41 ? -0.068  -23.996 -8.783  1.00 0.00 ? 42 LEU A HD13 5  
ATOM 5375  H HD21 . LEU A 1 41 ? 3.875   -25.053 -7.695  1.00 0.00 ? 42 LEU A HD21 5  
ATOM 5376  H HD22 . LEU A 1 41 ? 2.883   -25.944 -8.850  1.00 0.00 ? 42 LEU A HD22 5  
ATOM 5377  H HD23 . LEU A 1 41 ? 3.601   -24.400 -9.311  1.00 0.00 ? 42 LEU A HD23 5  
ATOM 5378  N N    . TRP A 1 42 ? 3.424   -20.909 -5.122  1.00 0.00 ? 43 TRP A N    5  
ATOM 5379  C CA   . TRP A 1 42 ? 4.241   -19.704 -4.803  1.00 0.00 ? 43 TRP A CA   5  
ATOM 5380  C C    . TRP A 1 42 ? 5.477   -20.111 -3.991  1.00 0.00 ? 43 TRP A C    5  
ATOM 5381  O O    . TRP A 1 42 ? 6.596   -19.810 -4.354  1.00 0.00 ? 43 TRP A O    5  
ATOM 5382  C CB   . TRP A 1 42 ? 3.394   -18.722 -3.986  1.00 0.00 ? 43 TRP A CB   5  
ATOM 5383  C CG   . TRP A 1 42 ? 4.274   -17.672 -3.382  1.00 0.00 ? 43 TRP A CG   5  
ATOM 5384  C CD1  . TRP A 1 42 ? 4.589   -17.584 -2.069  1.00 0.00 ? 43 TRP A CD1  5  
ATOM 5385  C CD2  . TRP A 1 42 ? 4.957   -16.567 -4.042  1.00 0.00 ? 43 TRP A CD2  5  
ATOM 5386  N NE1  . TRP A 1 42 ? 5.421   -16.494 -1.881  1.00 0.00 ? 43 TRP A NE1  5  
ATOM 5387  C CE2  . TRP A 1 42 ? 5.677   -15.835 -3.068  1.00 0.00 ? 43 TRP A CE2  5  
ATOM 5388  C CE3  . TRP A 1 42 ? 5.021   -16.132 -5.377  1.00 0.00 ? 43 TRP A CE3  5  
ATOM 5389  C CZ2  . TRP A 1 42 ? 6.433   -14.711 -3.407  1.00 0.00 ? 43 TRP A CZ2  5  
ATOM 5390  C CZ3  . TRP A 1 42 ? 5.781   -15.003 -5.720  1.00 0.00 ? 43 TRP A CZ3  5  
ATOM 5391  C CH2  . TRP A 1 42 ? 6.485   -14.295 -4.737  1.00 0.00 ? 43 TRP A CH2  5  
ATOM 5392  H H    . TRP A 1 42 ? 2.488   -20.956 -4.836  1.00 0.00 ? 43 TRP A H    5  
ATOM 5393  H HA   . TRP A 1 42 ? 4.554   -19.229 -5.721  1.00 0.00 ? 43 TRP A HA   5  
ATOM 5394  H HB2  . TRP A 1 42 ? 2.666   -18.252 -4.630  1.00 0.00 ? 43 TRP A HB2  5  
ATOM 5395  H HB3  . TRP A 1 42 ? 2.882   -19.258 -3.199  1.00 0.00 ? 43 TRP A HB3  5  
ATOM 5396  H HD1  . TRP A 1 42 ? 4.248   -18.253 -1.295  1.00 0.00 ? 43 TRP A HD1  5  
ATOM 5397  H HE1  . TRP A 1 42 ? 5.794   -16.208 -1.020  1.00 0.00 ? 43 TRP A HE1  5  
ATOM 5398  H HE3  . TRP A 1 42 ? 4.482   -16.669 -6.143  1.00 0.00 ? 43 TRP A HE3  5  
ATOM 5399  H HZ2  . TRP A 1 42 ? 6.974   -14.168 -2.647  1.00 0.00 ? 43 TRP A HZ2  5  
ATOM 5400  H HZ3  . TRP A 1 42 ? 5.822   -14.678 -6.746  1.00 0.00 ? 43 TRP A HZ3  5  
ATOM 5401  H HH2  . TRP A 1 42 ? 7.068   -13.427 -5.010  1.00 0.00 ? 43 TRP A HH2  5  
ATOM 5402  N N    . ARG A 1 43 ? 5.280   -20.782 -2.890  1.00 0.00 ? 44 ARG A N    5  
ATOM 5403  C CA   . ARG A 1 43 ? 6.437   -21.196 -2.042  1.00 0.00 ? 44 ARG A CA   5  
ATOM 5404  C C    . ARG A 1 43 ? 7.318   -22.203 -2.790  1.00 0.00 ? 44 ARG A C    5  
ATOM 5405  O O    . ARG A 1 43 ? 8.502   -22.308 -2.537  1.00 0.00 ? 44 ARG A O    5  
ATOM 5406  C CB   . ARG A 1 43 ? 5.912   -21.840 -0.758  1.00 0.00 ? 44 ARG A CB   5  
ATOM 5407  C CG   . ARG A 1 43 ? 6.251   -20.947 0.437   1.00 0.00 ? 44 ARG A CG   5  
ATOM 5408  C CD   . ARG A 1 43 ? 6.530   -21.816 1.664   1.00 0.00 ? 44 ARG A CD   5  
ATOM 5409  N NE   . ARG A 1 43 ? 5.321   -21.851 2.536   1.00 0.00 ? 44 ARG A NE   5  
ATOM 5410  C CZ   . ARG A 1 43 ? 5.292   -22.632 3.581   1.00 0.00 ? 44 ARG A CZ   5  
ATOM 5411  N NH1  . ARG A 1 43 ? 4.901   -23.870 3.456   1.00 0.00 ? 44 ARG A NH1  5  
ATOM 5412  N NH2  . ARG A 1 43 ? 5.653   -22.175 4.749   1.00 0.00 ? 44 ARG A NH2  5  
ATOM 5413  H H    . ARG A 1 43 ? 4.367   -21.005 -2.611  1.00 0.00 ? 44 ARG A H    5  
ATOM 5414  H HA   . ARG A 1 43 ? 7.024   -20.326 -1.789  1.00 0.00 ? 44 ARG A HA   5  
ATOM 5415  H HB2  . ARG A 1 43 ? 4.840   -21.957 -0.827  1.00 0.00 ? 44 ARG A HB2  5  
ATOM 5416  H HB3  . ARG A 1 43 ? 6.373   -22.807 -0.625  1.00 0.00 ? 44 ARG A HB3  5  
ATOM 5417  H HG2  . ARG A 1 43 ? 7.126   -20.357 0.205   1.00 0.00 ? 44 ARG A HG2  5  
ATOM 5418  H HG3  . ARG A 1 43 ? 5.418   -20.292 0.643   1.00 0.00 ? 44 ARG A HG3  5  
ATOM 5419  H HD2  . ARG A 1 43 ? 6.772   -22.820 1.348   1.00 0.00 ? 44 ARG A HD2  5  
ATOM 5420  H HD3  . ARG A 1 43 ? 7.360   -21.403 2.217   1.00 0.00 ? 44 ARG A HD3  5  
ATOM 5421  H HE   . ARG A 1 43 ? 4.547   -21.288 2.323   1.00 0.00 ? 44 ARG A HE   5  
ATOM 5422  H HH11 . ARG A 1 43 ? 4.624   -24.219 2.561   1.00 0.00 ? 44 ARG A HH11 5  
ATOM 5423  H HH12 . ARG A 1 43 ? 4.879   -24.470 4.256   1.00 0.00 ? 44 ARG A HH12 5  
ATOM 5424  H HH21 . ARG A 1 43 ? 5.952   -21.226 4.845   1.00 0.00 ? 44 ARG A HH21 5  
ATOM 5425  H HH22 . ARG A 1 43 ? 5.630   -22.776 5.548   1.00 0.00 ? 44 ARG A HH22 5  
ATOM 5426  N N    . ALA A 1 44 ? 6.755   -22.950 -3.696  1.00 0.00 ? 45 ALA A N    5  
ATOM 5427  C CA   . ALA A 1 44 ? 7.568   -23.954 -4.441  1.00 0.00 ? 45 ALA A CA   5  
ATOM 5428  C C    . ALA A 1 44 ? 7.786   -23.489 -5.882  1.00 0.00 ? 45 ALA A C    5  
ATOM 5429  O O    . ALA A 1 44 ? 8.229   -24.241 -6.727  1.00 0.00 ? 45 ALA A O    5  
ATOM 5430  C CB   . ALA A 1 44 ? 6.825   -25.286 -4.452  1.00 0.00 ? 45 ALA A CB   5  
ATOM 5431  H H    . ALA A 1 44 ? 5.797   -22.860 -3.882  1.00 0.00 ? 45 ALA A H    5  
ATOM 5432  H HA   . ALA A 1 44 ? 8.524   -24.079 -3.953  1.00 0.00 ? 45 ALA A HA   5  
ATOM 5433  H HB1  . ALA A 1 44 ? 5.768   -25.100 -4.559  1.00 0.00 ? 45 ALA A HB1  5  
ATOM 5434  H HB2  . ALA A 1 44 ? 7.172   -25.885 -5.280  1.00 0.00 ? 45 ALA A HB2  5  
ATOM 5435  H HB3  . ALA A 1 44 ? 7.009   -25.809 -3.526  1.00 0.00 ? 45 ALA A HB3  5  
ATOM 5436  N N    . MET A 1 45 ? 7.476   -22.259 -6.170  1.00 0.00 ? 46 MET A N    5  
ATOM 5437  C CA   . MET A 1 45 ? 7.660   -21.749 -7.555  1.00 0.00 ? 46 MET A CA   5  
ATOM 5438  C C    . MET A 1 45 ? 9.159   -21.639 -7.849  1.00 0.00 ? 46 MET A C    5  
ATOM 5439  O O    . MET A 1 45 ? 9.828   -22.627 -8.078  1.00 0.00 ? 46 MET A O    5  
ATOM 5440  C CB   . MET A 1 45 ? 6.986   -20.374 -7.682  1.00 0.00 ? 46 MET A CB   5  
ATOM 5441  C CG   . MET A 1 45 ? 7.165   -19.835 -9.105  1.00 0.00 ? 46 MET A CG   5  
ATOM 5442  S SD   . MET A 1 45 ? 7.751   -18.119 -9.046  1.00 0.00 ? 46 MET A SD   5  
ATOM 5443  C CE   . MET A 1 45 ? 6.737   -17.558 -7.653  1.00 0.00 ? 46 MET A CE   5  
ATOM 5444  H H    . MET A 1 45 ? 7.118   -21.671 -5.476  1.00 0.00 ? 46 MET A H    5  
ATOM 5445  H HA   . MET A 1 45 ? 7.207   -22.438 -8.253  1.00 0.00 ? 46 MET A HA   5  
ATOM 5446  H HB2  . MET A 1 45 ? 5.932   -20.471 -7.467  1.00 0.00 ? 46 MET A HB2  5  
ATOM 5447  H HB3  . MET A 1 45 ? 7.434   -19.690 -6.980  1.00 0.00 ? 46 MET A HB3  5  
ATOM 5448  H HG2  . MET A 1 45 ? 7.886   -20.441 -9.631  1.00 0.00 ? 46 MET A HG2  5  
ATOM 5449  H HG3  . MET A 1 45 ? 6.218   -19.873 -9.623  1.00 0.00 ? 46 MET A HG3  5  
ATOM 5450  H HE1  . MET A 1 45 ? 5.744   -17.976 -7.741  1.00 0.00 ? 46 MET A HE1  5  
ATOM 5451  H HE2  . MET A 1 45 ? 7.189   -17.879 -6.726  1.00 0.00 ? 46 MET A HE2  5  
ATOM 5452  H HE3  . MET A 1 45 ? 6.674   -16.481 -7.662  1.00 0.00 ? 46 MET A HE3  5  
ATOM 5453  N N    . LYS A 1 46 ? 9.692   -20.450 -7.853  1.00 0.00 ? 47 LYS A N    5  
ATOM 5454  C CA   . LYS A 1 46 ? 11.127  -20.269 -8.137  1.00 0.00 ? 47 LYS A CA   5  
ATOM 5455  C C    . LYS A 1 46 ? 11.768  -19.519 -6.973  1.00 0.00 ? 47 LYS A C    5  
ATOM 5456  O O    . LYS A 1 46 ? 12.406  -20.096 -6.115  1.00 0.00 ? 47 LYS A O    5  
ATOM 5457  C CB   . LYS A 1 46 ? 11.233  -19.429 -9.393  1.00 0.00 ? 47 LYS A CB   5  
ATOM 5458  C CG   . LYS A 1 46 ? 12.657  -18.891 -9.553  1.00 0.00 ? 47 LYS A CG   5  
ATOM 5459  C CD   . LYS A 1 46 ? 13.209  -19.310 -10.917 1.00 0.00 ? 47 LYS A CD   5  
ATOM 5460  C CE   . LYS A 1 46 ? 13.639  -18.067 -11.699 1.00 0.00 ? 47 LYS A CE   5  
ATOM 5461  N NZ   . LYS A 1 46 ? 13.113  -18.149 -13.092 1.00 0.00 ? 47 LYS A NZ   5  
ATOM 5462  H H    . LYS A 1 46 ? 9.148   -19.666 -7.680  1.00 0.00 ? 47 LYS A H    5  
ATOM 5463  H HA   . LYS A 1 46 ? 11.603  -21.223 -8.283  1.00 0.00 ? 47 LYS A HA   5  
ATOM 5464  H HB2  . LYS A 1 46 ? 10.971  -20.030 -10.251 1.00 0.00 ? 47 LYS A HB2  5  
ATOM 5465  H HB3  . LYS A 1 46 ? 10.539  -18.606 -9.302  1.00 0.00 ? 47 LYS A HB3  5  
ATOM 5466  H HG2  . LYS A 1 46 ? 12.644  -17.813 -9.484  1.00 0.00 ? 47 LYS A HG2  5  
ATOM 5467  H HG3  . LYS A 1 46 ? 13.284  -19.295 -8.773  1.00 0.00 ? 47 LYS A HG3  5  
ATOM 5468  H HD2  . LYS A 1 46 ? 14.061  -19.961 -10.776 1.00 0.00 ? 47 LYS A HD2  5  
ATOM 5469  H HD3  . LYS A 1 46 ? 12.444  -19.834 -11.470 1.00 0.00 ? 47 LYS A HD3  5  
ATOM 5470  H HE2  . LYS A 1 46 ? 13.246  -17.185 -11.217 1.00 0.00 ? 47 LYS A HE2  5  
ATOM 5471  H HE3  . LYS A 1 46 ? 14.718  -18.014 -11.725 1.00 0.00 ? 47 LYS A HE3  5  
ATOM 5472  H HZ1  . LYS A 1 46 ? 13.186  -19.127 -13.434 1.00 0.00 ? 47 LYS A HZ1  5  
ATOM 5473  H HZ2  . LYS A 1 46 ? 12.116  -17.854 -13.104 1.00 0.00 ? 47 LYS A HZ2  5  
ATOM 5474  H HZ3  . LYS A 1 46 ? 13.669  -17.522 -13.710 1.00 0.00 ? 47 LYS A HZ3  5  
ATOM 5475  N N    . ASP A 1 47 ? 11.590  -18.228 -6.942  1.00 0.00 ? 48 ASP A N    5  
ATOM 5476  C CA   . ASP A 1 47 ? 12.168  -17.414 -5.842  1.00 0.00 ? 48 ASP A CA   5  
ATOM 5477  C C    . ASP A 1 47 ? 11.278  -16.192 -5.608  1.00 0.00 ? 48 ASP A C    5  
ATOM 5478  O O    . ASP A 1 47 ? 10.701  -15.651 -6.530  1.00 0.00 ? 48 ASP A O    5  
ATOM 5479  C CB   . ASP A 1 47 ? 13.578  -16.960 -6.226  1.00 0.00 ? 48 ASP A CB   5  
ATOM 5480  C CG   . ASP A 1 47 ? 14.599  -17.621 -5.298  1.00 0.00 ? 48 ASP A CG   5  
ATOM 5481  O OD1  . ASP A 1 47 ? 14.280  -18.659 -4.742  1.00 0.00 ? 48 ASP A OD1  5  
ATOM 5482  O OD2  . ASP A 1 47 ? 15.682  -17.078 -5.160  1.00 0.00 ? 48 ASP A OD2  5  
ATOM 5483  H H    . ASP A 1 47 ? 11.065  -17.791 -7.645  1.00 0.00 ? 48 ASP A H    5  
ATOM 5484  H HA   . ASP A 1 47 ? 12.210  -18.009 -4.943  1.00 0.00 ? 48 ASP A HA   5  
ATOM 5485  H HB2  . ASP A 1 47 ? 13.781  -17.246 -7.248  1.00 0.00 ? 48 ASP A HB2  5  
ATOM 5486  H HB3  . ASP A 1 47 ? 13.649  -15.887 -6.130  1.00 0.00 ? 48 ASP A HB3  5  
ATOM 5487  N N    . LYS A 1 48 ? 11.158  -15.752 -4.386  1.00 0.00 ? 49 LYS A N    5  
ATOM 5488  C CA   . LYS A 1 48 ? 10.298  -14.568 -4.104  1.00 0.00 ? 49 LYS A CA   5  
ATOM 5489  C C    . LYS A 1 48 ? 11.075  -13.286 -4.410  1.00 0.00 ? 49 LYS A C    5  
ATOM 5490  O O    . LYS A 1 48 ? 10.510  -12.214 -4.507  1.00 0.00 ? 49 LYS A O    5  
ATOM 5491  C CB   . LYS A 1 48 ? 9.885   -14.576 -2.631  1.00 0.00 ? 49 LYS A CB   5  
ATOM 5492  C CG   . LYS A 1 48 ? 9.022   -15.809 -2.351  1.00 0.00 ? 49 LYS A CG   5  
ATOM 5493  C CD   . LYS A 1 48 ? 9.907   -16.948 -1.843  1.00 0.00 ? 49 LYS A CD   5  
ATOM 5494  C CE   . LYS A 1 48 ? 9.182   -17.698 -0.725  1.00 0.00 ? 49 LYS A CE   5  
ATOM 5495  N NZ   . LYS A 1 48 ? 9.752   -19.069 -0.594  1.00 0.00 ? 49 LYS A NZ   5  
ATOM 5496  H H    . LYS A 1 48 ? 11.629  -16.202 -3.654  1.00 0.00 ? 49 LYS A H    5  
ATOM 5497  H HA   . LYS A 1 48 ? 9.415   -14.608 -4.726  1.00 0.00 ? 49 LYS A HA   5  
ATOM 5498  H HB2  . LYS A 1 48 ? 10.769  -14.606 -2.009  1.00 0.00 ? 49 LYS A HB2  5  
ATOM 5499  H HB3  . LYS A 1 48 ? 9.318   -13.685 -2.410  1.00 0.00 ? 49 LYS A HB3  5  
ATOM 5500  H HG2  . LYS A 1 48 ? 8.280   -15.567 -1.605  1.00 0.00 ? 49 LYS A HG2  5  
ATOM 5501  H HG3  . LYS A 1 48 ? 8.530   -16.118 -3.261  1.00 0.00 ? 49 LYS A HG3  5  
ATOM 5502  H HD2  . LYS A 1 48 ? 10.119  -17.629 -2.656  1.00 0.00 ? 49 LYS A HD2  5  
ATOM 5503  H HD3  . LYS A 1 48 ? 10.833  -16.543 -1.462  1.00 0.00 ? 49 LYS A HD3  5  
ATOM 5504  H HE2  . LYS A 1 48 ? 9.308   -17.166 0.206   1.00 0.00 ? 49 LYS A HE2  5  
ATOM 5505  H HE3  . LYS A 1 48 ? 8.130   -17.767 -0.961  1.00 0.00 ? 49 LYS A HE3  5  
ATOM 5506  H HZ1  . LYS A 1 48 ? 10.748  -19.061 -0.894  1.00 0.00 ? 49 LYS A HZ1  5  
ATOM 5507  H HZ2  . LYS A 1 48 ? 9.695   -19.375 0.398   1.00 0.00 ? 49 LYS A HZ2  5  
ATOM 5508  H HZ3  . LYS A 1 48 ? 9.213   -19.727 -1.193  1.00 0.00 ? 49 LYS A HZ3  5  
ATOM 5509  N N    . SER A 1 49 ? 12.366  -13.388 -4.566  1.00 0.00 ? 50 SER A N    5  
ATOM 5510  C CA   . SER A 1 49 ? 13.176  -12.176 -4.871  1.00 0.00 ? 50 SER A CA   5  
ATOM 5511  C C    . SER A 1 49 ? 12.853  -11.695 -6.287  1.00 0.00 ? 50 SER A C    5  
ATOM 5512  O O    . SER A 1 49 ? 13.092  -10.555 -6.636  1.00 0.00 ? 50 SER A O    5  
ATOM 5513  C CB   . SER A 1 49 ? 14.663  -12.518 -4.771  1.00 0.00 ? 50 SER A CB   5  
ATOM 5514  O OG   . SER A 1 49 ? 15.336  -11.491 -4.054  1.00 0.00 ? 50 SER A OG   5  
ATOM 5515  H H    . SER A 1 49 ? 12.802  -14.262 -4.486  1.00 0.00 ? 50 SER A H    5  
ATOM 5516  H HA   . SER A 1 49 ? 12.939  -11.396 -4.162  1.00 0.00 ? 50 SER A HA   5  
ATOM 5517  H HB2  . SER A 1 49 ? 14.785  -13.452 -4.249  1.00 0.00 ? 50 SER A HB2  5  
ATOM 5518  H HB3  . SER A 1 49 ? 15.078  -12.608 -5.766  1.00 0.00 ? 50 SER A HB3  5  
ATOM 5519  H HG   . SER A 1 49 ? 15.036  -10.645 -4.396  1.00 0.00 ? 50 SER A HG   5  
ATOM 5520  N N    . GLU A 1 50 ? 12.300  -12.554 -7.103  1.00 0.00 ? 51 GLU A N    5  
ATOM 5521  C CA   . GLU A 1 50 ? 11.955  -12.145 -8.490  1.00 0.00 ? 51 GLU A CA   5  
ATOM 5522  C C    . GLU A 1 50 ? 10.862  -11.082 -8.438  1.00 0.00 ? 51 GLU A C    5  
ATOM 5523  O O    . GLU A 1 50 ? 11.086  -9.924  -8.730  1.00 0.00 ? 51 GLU A O    5  
ATOM 5524  C CB   . GLU A 1 50 ? 11.469  -13.359 -9.262  1.00 0.00 ? 51 GLU A CB   5  
ATOM 5525  C CG   . GLU A 1 50 ? 10.660  -12.923 -10.488 1.00 0.00 ? 51 GLU A CG   5  
ATOM 5526  C CD   . GLU A 1 50 ? 10.507  -14.107 -11.443 1.00 0.00 ? 51 GLU A CD   5  
ATOM 5527  O OE1  . GLU A 1 50 ? 11.521  -14.638 -11.865 1.00 0.00 ? 51 GLU A OE1  5  
ATOM 5528  O OE2  . GLU A 1 50 ? 9.378   -14.465 -11.737 1.00 0.00 ? 51 GLU A OE2  5  
ATOM 5529  H H    . GLU A 1 50 ? 12.105  -13.463 -6.800  1.00 0.00 ? 51 GLU A H    5  
ATOM 5530  H HA   . GLU A 1 50 ? 12.827  -11.759 -8.979  1.00 0.00 ? 51 GLU A HA   5  
ATOM 5531  H HB2  . GLU A 1 50 ? 12.333  -13.909 -9.583  1.00 0.00 ? 51 GLU A HB2  5  
ATOM 5532  H HB3  . GLU A 1 50 ? 10.856  -13.975 -8.621  1.00 0.00 ? 51 GLU A HB3  5  
ATOM 5533  H HG2  . GLU A 1 50 ? 9.684   -12.585 -10.173 1.00 0.00 ? 51 GLU A HG2  5  
ATOM 5534  H HG3  . GLU A 1 50 ? 11.175  -12.120 -10.993 1.00 0.00 ? 51 GLU A HG3  5  
ATOM 5535  N N    . TRP A 1 51 ? 9.681   -11.471 -8.052  1.00 0.00 ? 52 TRP A N    5  
ATOM 5536  C CA   . TRP A 1 51 ? 8.571   -10.491 -7.960  1.00 0.00 ? 52 TRP A CA   5  
ATOM 5537  C C    . TRP A 1 51 ? 8.958   -9.412  -6.976  1.00 0.00 ? 52 TRP A C    5  
ATOM 5538  O O    . TRP A 1 51 ? 8.876   -8.246  -7.269  1.00 0.00 ? 52 TRP A O    5  
ATOM 5539  C CB   . TRP A 1 51 ? 7.330   -11.187 -7.436  1.00 0.00 ? 52 TRP A CB   5  
ATOM 5540  C CG   . TRP A 1 51 ? 7.026   -12.342 -8.289  1.00 0.00 ? 52 TRP A CG   5  
ATOM 5541  C CD1  . TRP A 1 51 ? 7.417   -13.582 -8.028  1.00 0.00 ? 52 TRP A CD1  5  
ATOM 5542  C CD2  . TRP A 1 51 ? 6.270   -12.382 -9.519  1.00 0.00 ? 52 TRP A CD2  5  
ATOM 5543  N NE1  . TRP A 1 51 ? 6.947   -14.416 -9.026  1.00 0.00 ? 52 TRP A NE1  5  
ATOM 5544  C CE2  . TRP A 1 51 ? 6.227   -13.715 -9.974  1.00 0.00 ? 52 TRP A CE2  5  
ATOM 5545  C CE3  . TRP A 1 51 ? 5.624   -11.398 -10.269 1.00 0.00 ? 52 TRP A CE3  5  
ATOM 5546  C CZ2  . TRP A 1 51 ? 5.557   -14.061 -11.147 1.00 0.00 ? 52 TRP A CZ2  5  
ATOM 5547  C CZ3  . TRP A 1 51 ? 4.949   -11.733 -11.443 1.00 0.00 ? 52 TRP A CZ3  5  
ATOM 5548  C CH2  . TRP A 1 51 ? 4.911   -13.065 -11.886 1.00 0.00 ? 52 TRP A CH2  5  
ATOM 5549  H H    . TRP A 1 51 ? 9.528   -12.407 -7.808  1.00 0.00 ? 52 TRP A H    5  
ATOM 5550  H HA   . TRP A 1 51 ? 8.372   -10.061 -8.930  1.00 0.00 ? 52 TRP A HA   5  
ATOM 5551  H HB2  . TRP A 1 51 ? 7.502   -11.524 -6.425  1.00 0.00 ? 52 TRP A HB2  5  
ATOM 5552  H HB3  . TRP A 1 51 ? 6.504   -10.517 -7.451  1.00 0.00 ? 52 TRP A HB3  5  
ATOM 5553  H HD1  . TRP A 1 51 ? 8.000   -13.866 -7.175  1.00 0.00 ? 52 TRP A HD1  5  
ATOM 5554  H HE1  . TRP A 1 51 ? 7.094   -15.375 -9.072  1.00 0.00 ? 52 TRP A HE1  5  
ATOM 5555  H HE3  . TRP A 1 51 ? 5.657   -10.371 -9.941  1.00 0.00 ? 52 TRP A HE3  5  
ATOM 5556  H HZ2  . TRP A 1 51 ? 5.533   -15.090 -11.479 1.00 0.00 ? 52 TRP A HZ2  5  
ATOM 5557  H HZ3  . TRP A 1 51 ? 4.448   -10.962 -12.001 1.00 0.00 ? 52 TRP A HZ3  5  
ATOM 5558  H HH2  . TRP A 1 51 ? 4.388   -13.319 -12.795 1.00 0.00 ? 52 TRP A HH2  5  
ATOM 5559  N N    . GLU A 1 52 ? 9.361   -9.811  -5.802  1.00 0.00 ? 53 GLU A N    5  
ATOM 5560  C CA   . GLU A 1 52 ? 9.753   -8.823  -4.748  1.00 0.00 ? 53 GLU A CA   5  
ATOM 5561  C C    . GLU A 1 52 ? 10.374  -7.578  -5.388  1.00 0.00 ? 53 GLU A C    5  
ATOM 5562  O O    . GLU A 1 52 ? 9.831   -6.494  -5.302  1.00 0.00 ? 53 GLU A O    5  
ATOM 5563  C CB   . GLU A 1 52 ? 10.759  -9.469  -3.795  1.00 0.00 ? 53 GLU A CB   5  
ATOM 5564  C CG   . GLU A 1 52 ? 10.012  -10.107 -2.622  1.00 0.00 ? 53 GLU A CG   5  
ATOM 5565  C CD   . GLU A 1 52 ? 9.309   -9.016  -1.811  1.00 0.00 ? 53 GLU A CD   5  
ATOM 5566  O OE1  . GLU A 1 52 ? 9.402   -7.863  -2.202  1.00 0.00 ? 53 GLU A OE1  5  
ATOM 5567  O OE2  . GLU A 1 52 ? 8.690   -9.352  -0.815  1.00 0.00 ? 53 GLU A OE2  5  
ATOM 5568  H H    . GLU A 1 52 ? 9.392   -10.780 -5.608  1.00 0.00 ? 53 GLU A H    5  
ATOM 5569  H HA   . GLU A 1 52 ? 8.874   -8.529  -4.195  1.00 0.00 ? 53 GLU A HA   5  
ATOM 5570  H HB2  . GLU A 1 52 ? 11.319  -10.227 -4.323  1.00 0.00 ? 53 GLU A HB2  5  
ATOM 5571  H HB3  . GLU A 1 52 ? 11.436  -8.716  -3.421  1.00 0.00 ? 53 GLU A HB3  5  
ATOM 5572  H HG2  . GLU A 1 52 ? 9.279   -10.805 -3.000  1.00 0.00 ? 53 GLU A HG2  5  
ATOM 5573  H HG3  . GLU A 1 52 ? 10.713  -10.628 -1.989  1.00 0.00 ? 53 GLU A HG3  5  
ATOM 5574  N N    . ALA A 1 53 ? 11.498  -7.715  -6.036  1.00 0.00 ? 54 ALA A N    5  
ATOM 5575  C CA   . ALA A 1 53 ? 12.120  -6.522  -6.680  1.00 0.00 ? 54 ALA A CA   5  
ATOM 5576  C C    . ALA A 1 53 ? 11.114  -5.910  -7.653  1.00 0.00 ? 54 ALA A C    5  
ATOM 5577  O O    . ALA A 1 53 ? 10.962  -4.707  -7.737  1.00 0.00 ? 54 ALA A O    5  
ATOM 5578  C CB   . ALA A 1 53 ? 13.376  -6.948  -7.444  1.00 0.00 ? 54 ALA A CB   5  
ATOM 5579  H H    . ALA A 1 53 ? 11.926  -8.596  -6.108  1.00 0.00 ? 54 ALA A H    5  
ATOM 5580  H HA   . ALA A 1 53 ? 12.380  -5.795  -5.926  1.00 0.00 ? 54 ALA A HA   5  
ATOM 5581  H HB1  . ALA A 1 53 ? 13.355  -8.017  -7.603  1.00 0.00 ? 54 ALA A HB1  5  
ATOM 5582  H HB2  . ALA A 1 53 ? 13.405  -6.443  -8.399  1.00 0.00 ? 54 ALA A HB2  5  
ATOM 5583  H HB3  . ALA A 1 53 ? 14.253  -6.687  -6.871  1.00 0.00 ? 54 ALA A HB3  5  
ATOM 5584  N N    . LYS A 1 54 ? 10.429  -6.736  -8.388  1.00 0.00 ? 55 LYS A N    5  
ATOM 5585  C CA   . LYS A 1 54 ? 9.426   -6.226  -9.366  1.00 0.00 ? 55 LYS A CA   5  
ATOM 5586  C C    . LYS A 1 54 ? 8.433   -5.290  -8.670  1.00 0.00 ? 55 LYS A C    5  
ATOM 5587  O O    . LYS A 1 54 ? 7.988   -4.313  -9.237  1.00 0.00 ? 55 LYS A O    5  
ATOM 5588  C CB   . LYS A 1 54 ? 8.662   -7.407  -9.961  1.00 0.00 ? 55 LYS A CB   5  
ATOM 5589  C CG   . LYS A 1 54 ? 7.991   -6.978  -11.267 1.00 0.00 ? 55 LYS A CG   5  
ATOM 5590  C CD   . LYS A 1 54 ? 6.676   -7.742  -11.445 1.00 0.00 ? 55 LYS A CD   5  
ATOM 5591  C CE   . LYS A 1 54 ? 6.213   -7.636  -12.900 1.00 0.00 ? 55 LYS A CE   5  
ATOM 5592  N NZ   . LYS A 1 54 ? 5.214   -8.707  -13.181 1.00 0.00 ? 55 LYS A NZ   5  
ATOM 5593  H H    . LYS A 1 54 ? 10.578  -7.700  -8.300  1.00 0.00 ? 55 LYS A H    5  
ATOM 5594  H HA   . LYS A 1 54 ? 9.930   -5.692  -10.153 1.00 0.00 ? 55 LYS A HA   5  
ATOM 5595  H HB2  . LYS A 1 54 ? 9.350   -8.218  -10.157 1.00 0.00 ? 55 LYS A HB2  5  
ATOM 5596  H HB3  . LYS A 1 54 ? 7.909   -7.736  -9.261  1.00 0.00 ? 55 LYS A HB3  5  
ATOM 5597  H HG2  . LYS A 1 54 ? 7.790   -5.917  -11.235 1.00 0.00 ? 55 LYS A HG2  5  
ATOM 5598  H HG3  . LYS A 1 54 ? 8.647   -7.194  -12.097 1.00 0.00 ? 55 LYS A HG3  5  
ATOM 5599  H HD2  . LYS A 1 54 ? 6.827   -8.781  -11.189 1.00 0.00 ? 55 LYS A HD2  5  
ATOM 5600  H HD3  . LYS A 1 54 ? 5.923   -7.318  -10.799 1.00 0.00 ? 55 LYS A HD3  5  
ATOM 5601  H HE2  . LYS A 1 54 ? 5.761   -6.669  -13.065 1.00 0.00 ? 55 LYS A HE2  5  
ATOM 5602  H HE3  . LYS A 1 54 ? 7.062   -7.755  -13.558 1.00 0.00 ? 55 LYS A HE3  5  
ATOM 5603  H HZ1  . LYS A 1 54 ? 4.724   -8.963  -12.301 1.00 0.00 ? 55 LYS A HZ1  5  
ATOM 5604  H HZ2  . LYS A 1 54 ? 4.521   -8.359  -13.876 1.00 0.00 ? 55 LYS A HZ2  5  
ATOM 5605  H HZ3  . LYS A 1 54 ? 5.699   -9.542  -13.562 1.00 0.00 ? 55 LYS A HZ3  5  
ATOM 5606  N N    . ALA A 1 55 ? 8.075   -5.581  -7.450  1.00 0.00 ? 56 ALA A N    5  
ATOM 5607  C CA   . ALA A 1 55 ? 7.106   -4.709  -6.734  1.00 0.00 ? 56 ALA A CA   5  
ATOM 5608  C C    . ALA A 1 55 ? 7.718   -3.319  -6.562  1.00 0.00 ? 56 ALA A C    5  
ATOM 5609  O O    . ALA A 1 55 ? 7.101   -2.316  -6.859  1.00 0.00 ? 56 ALA A O    5  
ATOM 5610  C CB   . ALA A 1 55 ? 6.801   -5.306  -5.358  1.00 0.00 ? 56 ALA A CB   5  
ATOM 5611  H H    . ALA A 1 55 ? 8.438   -6.370  -7.008  1.00 0.00 ? 56 ALA A H    5  
ATOM 5612  H HA   . ALA A 1 55 ? 6.193   -4.642  -7.309  1.00 0.00 ? 56 ALA A HA   5  
ATOM 5613  H HB1  . ALA A 1 55 ? 6.786   -6.384  -5.428  1.00 0.00 ? 56 ALA A HB1  5  
ATOM 5614  H HB2  . ALA A 1 55 ? 7.563   -5.003  -4.656  1.00 0.00 ? 56 ALA A HB2  5  
ATOM 5615  H HB3  . ALA A 1 55 ? 5.838   -4.953  -5.018  1.00 0.00 ? 56 ALA A HB3  5  
ATOM 5616  N N    . ALA A 1 56 ? 8.932   -3.256  -6.086  1.00 0.00 ? 57 ALA A N    5  
ATOM 5617  C CA   . ALA A 1 56 ? 9.596   -1.937  -5.897  1.00 0.00 ? 57 ALA A CA   5  
ATOM 5618  C C    . ALA A 1 56 ? 9.588   -1.177  -7.221  1.00 0.00 ? 57 ALA A C    5  
ATOM 5619  O O    . ALA A 1 56 ? 9.190   -0.032  -7.292  1.00 0.00 ? 57 ALA A O    5  
ATOM 5620  C CB   . ALA A 1 56 ? 11.041  -2.161  -5.455  1.00 0.00 ? 57 ALA A CB   5  
ATOM 5621  H H    . ALA A 1 56 ? 9.409   -4.081  -5.858  1.00 0.00 ? 57 ALA A H    5  
ATOM 5622  H HA   . ALA A 1 56 ? 9.069   -1.367  -5.146  1.00 0.00 ? 57 ALA A HA   5  
ATOM 5623  H HB1  . ALA A 1 56 ? 11.164  -3.183  -5.126  1.00 0.00 ? 57 ALA A HB1  5  
ATOM 5624  H HB2  . ALA A 1 56 ? 11.702  -1.969  -6.287  1.00 0.00 ? 57 ALA A HB2  5  
ATOM 5625  H HB3  . ALA A 1 56 ? 11.278  -1.488  -4.644  1.00 0.00 ? 57 ALA A HB3  5  
ATOM 5626  N N    . LYS A 1 57 ? 10.029  -1.808  -8.272  1.00 0.00 ? 58 LYS A N    5  
ATOM 5627  C CA   . LYS A 1 57 ? 10.047  -1.128  -9.596  1.00 0.00 ? 58 LYS A CA   5  
ATOM 5628  C C    . LYS A 1 57 ? 8.665   -0.536  -9.874  1.00 0.00 ? 58 LYS A C    5  
ATOM 5629  O O    . LYS A 1 57 ? 8.538   0.613   -10.239 1.00 0.00 ? 58 LYS A O    5  
ATOM 5630  C CB   . LYS A 1 57 ? 10.403  -2.139  -10.687 1.00 0.00 ? 58 LYS A CB   5  
ATOM 5631  C CG   . LYS A 1 57 ? 10.370  -1.451  -12.052 1.00 0.00 ? 58 LYS A CG   5  
ATOM 5632  C CD   . LYS A 1 57 ? 11.595  -0.546  -12.199 1.00 0.00 ? 58 LYS A CD   5  
ATOM 5633  C CE   . LYS A 1 57 ? 12.796  -1.380  -12.650 1.00 0.00 ? 58 LYS A CE   5  
ATOM 5634  N NZ   . LYS A 1 57 ? 12.563  -1.879  -14.033 1.00 0.00 ? 58 LYS A NZ   5  
ATOM 5635  H H    . LYS A 1 57 ? 10.348  -2.732  -8.191  1.00 0.00 ? 58 LYS A H    5  
ATOM 5636  H HA   . LYS A 1 57 ? 10.780  -0.334  -9.582  1.00 0.00 ? 58 LYS A HA   5  
ATOM 5637  H HB2  . LYS A 1 57 ? 11.393  -2.531  -10.504 1.00 0.00 ? 58 LYS A HB2  5  
ATOM 5638  H HB3  . LYS A 1 57 ? 9.687   -2.947  -10.676 1.00 0.00 ? 58 LYS A HB3  5  
ATOM 5639  H HG2  . LYS A 1 57 ? 10.378  -2.199  -12.832 1.00 0.00 ? 58 LYS A HG2  5  
ATOM 5640  H HG3  . LYS A 1 57 ? 9.473   -0.855  -12.135 1.00 0.00 ? 58 LYS A HG3  5  
ATOM 5641  H HD2  . LYS A 1 57 ? 11.391  0.219   -12.934 1.00 0.00 ? 58 LYS A HD2  5  
ATOM 5642  H HD3  . LYS A 1 57 ? 11.817  -0.084  -11.249 1.00 0.00 ? 58 LYS A HD3  5  
ATOM 5643  H HE2  . LYS A 1 57 ? 13.687  -0.769  -12.632 1.00 0.00 ? 58 LYS A HE2  5  
ATOM 5644  H HE3  . LYS A 1 57 ? 12.923  -2.220  -11.981 1.00 0.00 ? 58 LYS A HE3  5  
ATOM 5645  H HZ1  . LYS A 1 57 ? 11.624  -1.574  -14.359 1.00 0.00 ? 58 LYS A HZ1  5  
ATOM 5646  H HZ2  . LYS A 1 57 ? 13.293  -1.494  -14.668 1.00 0.00 ? 58 LYS A HZ2  5  
ATOM 5647  H HZ3  . LYS A 1 57 ? 12.609  -2.917  -14.041 1.00 0.00 ? 58 LYS A HZ3  5  
ATOM 5648  N N    . ALA A 1 58 ? 7.625   -1.306  -9.696  1.00 0.00 ? 59 ALA A N    5  
ATOM 5649  C CA   . ALA A 1 58 ? 6.261   -0.764  -9.945  1.00 0.00 ? 59 ALA A CA   5  
ATOM 5650  C C    . ALA A 1 58 ? 6.046   0.443   -9.041  1.00 0.00 ? 59 ALA A C    5  
ATOM 5651  O O    . ALA A 1 58 ? 5.384   1.391   -9.402  1.00 0.00 ? 59 ALA A O    5  
ATOM 5652  C CB   . ALA A 1 58 ? 5.209   -1.830  -9.623  1.00 0.00 ? 59 ALA A CB   5  
ATOM 5653  H H    . ALA A 1 58 ? 7.740   -2.232  -9.390  1.00 0.00 ? 59 ALA A H    5  
ATOM 5654  H HA   . ALA A 1 58 ? 6.171   -0.462  -10.979 1.00 0.00 ? 59 ALA A HA   5  
ATOM 5655  H HB1  . ALA A 1 58 ? 5.616   -2.534  -8.912  1.00 0.00 ? 59 ALA A HB1  5  
ATOM 5656  H HB2  . ALA A 1 58 ? 4.333   -1.356  -9.200  1.00 0.00 ? 59 ALA A HB2  5  
ATOM 5657  H HB3  . ALA A 1 58 ? 4.934   -2.351  -10.529 1.00 0.00 ? 59 ALA A HB3  5  
ATOM 5658  N N    . LYS A 1 59 ? 6.617   0.416   -7.871  1.00 0.00 ? 60 LYS A N    5  
ATOM 5659  C CA   . LYS A 1 59 ? 6.470   1.551   -6.934  1.00 0.00 ? 60 LYS A CA   5  
ATOM 5660  C C    . LYS A 1 59 ? 6.968   2.824   -7.605  1.00 0.00 ? 60 LYS A C    5  
ATOM 5661  O O    . LYS A 1 59 ? 6.257   3.799   -7.720  1.00 0.00 ? 60 LYS A O    5  
ATOM 5662  C CB   . LYS A 1 59 ? 7.331   1.265   -5.714  1.00 0.00 ? 60 LYS A CB   5  
ATOM 5663  C CG   . LYS A 1 59 ? 6.542   1.557   -4.437  1.00 0.00 ? 60 LYS A CG   5  
ATOM 5664  C CD   . LYS A 1 59 ? 7.483   2.144   -3.385  1.00 0.00 ? 60 LYS A CD   5  
ATOM 5665  C CE   . LYS A 1 59 ? 6.697   2.449   -2.109  1.00 0.00 ? 60 LYS A CE   5  
ATOM 5666  N NZ   . LYS A 1 59 ? 7.490   2.024   -0.922  1.00 0.00 ? 60 LYS A NZ   5  
ATOM 5667  H H    . LYS A 1 59 ? 7.156   -0.354  -7.606  1.00 0.00 ? 60 LYS A H    5  
ATOM 5668  H HA   . LYS A 1 59 ? 5.438   1.662   -6.640  1.00 0.00 ? 60 LYS A HA   5  
ATOM 5669  H HB2  . LYS A 1 59 ? 7.632   0.230   -5.731  1.00 0.00 ? 60 LYS A HB2  5  
ATOM 5670  H HB3  . LYS A 1 59 ? 8.205   1.885   -5.749  1.00 0.00 ? 60 LYS A HB3  5  
ATOM 5671  H HG2  . LYS A 1 59 ? 5.755   2.265   -4.654  1.00 0.00 ? 60 LYS A HG2  5  
ATOM 5672  H HG3  . LYS A 1 59 ? 6.111   0.641   -4.062  1.00 0.00 ? 60 LYS A HG3  5  
ATOM 5673  H HD2  . LYS A 1 59 ? 8.266   1.432   -3.165  1.00 0.00 ? 60 LYS A HD2  5  
ATOM 5674  H HD3  . LYS A 1 59 ? 7.920   3.056   -3.761  1.00 0.00 ? 60 LYS A HD3  5  
ATOM 5675  H HE2  . LYS A 1 59 ? 6.502   3.509   -2.051  1.00 0.00 ? 60 LYS A HE2  5  
ATOM 5676  H HE3  . LYS A 1 59 ? 5.759   1.911   -2.126  1.00 0.00 ? 60 LYS A HE3  5  
ATOM 5677  H HZ1  . LYS A 1 59 ? 8.470   2.356   -1.021  1.00 0.00 ? 60 LYS A HZ1  5  
ATOM 5678  H HZ2  . LYS A 1 59 ? 7.070   2.431   -0.060  1.00 0.00 ? 60 LYS A HZ2  5  
ATOM 5679  H HZ3  . LYS A 1 59 ? 7.484   0.987   -0.852  1.00 0.00 ? 60 LYS A HZ3  5  
ATOM 5680  N N    . ASP A 1 60 ? 8.191   2.815   -8.043  1.00 0.00 ? 61 ASP A N    5  
ATOM 5681  C CA   . ASP A 1 60 ? 8.756   4.024   -8.710  1.00 0.00 ? 61 ASP A CA   5  
ATOM 5682  C C    . ASP A 1 60 ? 7.879   4.410   -9.906  1.00 0.00 ? 61 ASP A C    5  
ATOM 5683  O O    . ASP A 1 60 ? 7.465   5.544   -10.045 1.00 0.00 ? 61 ASP A O    5  
ATOM 5684  C CB   . ASP A 1 60 ? 10.174  3.719   -9.196  1.00 0.00 ? 61 ASP A CB   5  
ATOM 5685  C CG   . ASP A 1 60 ? 11.091  4.900   -8.872  1.00 0.00 ? 61 ASP A CG   5  
ATOM 5686  O OD1  . ASP A 1 60 ? 10.730  6.014   -9.212  1.00 0.00 ? 61 ASP A OD1  5  
ATOM 5687  O OD2  . ASP A 1 60 ? 12.139  4.669   -8.292  1.00 0.00 ? 61 ASP A OD2  5  
ATOM 5688  H H    . ASP A 1 60 ? 8.746   2.009   -7.926  1.00 0.00 ? 61 ASP A H    5  
ATOM 5689  H HA   . ASP A 1 60 ? 8.782   4.844   -8.007  1.00 0.00 ? 61 ASP A HA   5  
ATOM 5690  H HB2  . ASP A 1 60 ? 10.540  2.829   -8.701  1.00 0.00 ? 61 ASP A HB2  5  
ATOM 5691  H HB3  . ASP A 1 60 ? 10.162  3.557   -10.263 1.00 0.00 ? 61 ASP A HB3  5  
ATOM 5692  N N    . ASP A 1 61 ? 7.596   3.475   -10.771 1.00 0.00 ? 62 ASP A N    5  
ATOM 5693  C CA   . ASP A 1 61 ? 6.749   3.779   -11.960 1.00 0.00 ? 62 ASP A CA   5  
ATOM 5694  C C    . ASP A 1 61 ? 5.313   4.054   -11.512 1.00 0.00 ? 62 ASP A C    5  
ATOM 5695  O O    . ASP A 1 61 ? 4.484   4.496   -12.282 1.00 0.00 ? 62 ASP A O    5  
ATOM 5696  C CB   . ASP A 1 61 ? 6.756   2.571   -12.899 1.00 0.00 ? 62 ASP A CB   5  
ATOM 5697  C CG   . ASP A 1 61 ? 8.199   2.183   -13.222 1.00 0.00 ? 62 ASP A CG   5  
ATOM 5698  O OD1  . ASP A 1 61 ? 9.008   3.079   -13.393 1.00 0.00 ? 62 ASP A OD1  5  
ATOM 5699  O OD2  . ASP A 1 61 ? 8.471   0.996   -13.292 1.00 0.00 ? 62 ASP A OD2  5  
ATOM 5700  H H    . ASP A 1 61 ? 7.940   2.569   -10.638 1.00 0.00 ? 62 ASP A H    5  
ATOM 5701  H HA   . ASP A 1 61 ? 7.142   4.641   -12.477 1.00 0.00 ? 62 ASP A HA   5  
ATOM 5702  H HB2  . ASP A 1 61 ? 6.258   1.741   -12.416 1.00 0.00 ? 62 ASP A HB2  5  
ATOM 5703  H HB3  . ASP A 1 61 ? 6.238   2.822   -13.812 1.00 0.00 ? 62 ASP A HB3  5  
ATOM 5704  N N    . TYR A 1 62 ? 5.016   3.779   -10.276 1.00 0.00 ? 63 TYR A N    5  
ATOM 5705  C CA   . TYR A 1 62 ? 3.639   3.996   -9.757  1.00 0.00 ? 63 TYR A CA   5  
ATOM 5706  C C    . TYR A 1 62 ? 3.490   5.421   -9.213  1.00 0.00 ? 63 TYR A C    5  
ATOM 5707  O O    . TYR A 1 62 ? 2.447   6.029   -9.330  1.00 0.00 ? 63 TYR A O    5  
ATOM 5708  C CB   . TYR A 1 62 ? 3.385   2.977   -8.650  1.00 0.00 ? 63 TYR A CB   5  
ATOM 5709  C CG   . TYR A 1 62 ? 2.021   3.175   -8.086  1.00 0.00 ? 63 TYR A CG   5  
ATOM 5710  C CD1  . TYR A 1 62 ? 1.714   4.321   -7.352  1.00 0.00 ? 63 TYR A CD1  5  
ATOM 5711  C CD2  . TYR A 1 62 ? 1.071   2.191   -8.282  1.00 0.00 ? 63 TYR A CD2  5  
ATOM 5712  C CE1  . TYR A 1 62 ? 0.434   4.477   -6.818  1.00 0.00 ? 63 TYR A CE1  5  
ATOM 5713  C CE2  . TYR A 1 62 ? -0.201  2.333   -7.749  1.00 0.00 ? 63 TYR A CE2  5  
ATOM 5714  C CZ   . TYR A 1 62 ? -0.530  3.479   -7.017  1.00 0.00 ? 63 TYR A CZ   5  
ATOM 5715  O OH   . TYR A 1 62 ? -1.796  3.623   -6.486  1.00 0.00 ? 63 TYR A OH   5  
ATOM 5716  H H    . TYR A 1 62 ? 5.702   3.413   -9.686  1.00 0.00 ? 63 TYR A H    5  
ATOM 5717  H HA   . TYR A 1 62 ? 2.918   3.841   -10.543 1.00 0.00 ? 63 TYR A HA   5  
ATOM 5718  H HB2  . TYR A 1 62 ? 3.448   1.982   -9.062  1.00 0.00 ? 63 TYR A HB2  5  
ATOM 5719  H HB3  . TYR A 1 62 ? 4.108   3.084   -7.867  1.00 0.00 ? 63 TYR A HB3  5  
ATOM 5720  H HD1  . TYR A 1 62 ? 2.464   5.085   -7.200  1.00 0.00 ? 63 TYR A HD1  5  
ATOM 5721  H HD2  . TYR A 1 62 ? 1.317   1.307   -8.856  1.00 0.00 ? 63 TYR A HD2  5  
ATOM 5722  H HE1  . TYR A 1 62 ? 0.190   5.361   -6.260  1.00 0.00 ? 63 TYR A HE1  5  
ATOM 5723  H HE2  . TYR A 1 62 ? -0.919  1.546   -7.900  1.00 0.00 ? 63 TYR A HE2  5  
ATOM 5724  H HH   . TYR A 1 62 ? -2.248  2.780   -6.565  1.00 0.00 ? 63 TYR A HH   5  
ATOM 5725  N N    . ASP A 1 63 ? 4.519   5.963   -8.626  1.00 0.00 ? 64 ASP A N    5  
ATOM 5726  C CA   . ASP A 1 63 ? 4.425   7.343   -8.084  1.00 0.00 ? 64 ASP A CA   5  
ATOM 5727  C C    . ASP A 1 63 ? 4.439   8.326   -9.240  1.00 0.00 ? 64 ASP A C    5  
ATOM 5728  O O    . ASP A 1 63 ? 3.716   9.300   -9.264  1.00 0.00 ? 64 ASP A O    5  
ATOM 5729  C CB   . ASP A 1 63 ? 5.620   7.610   -7.194  1.00 0.00 ? 64 ASP A CB   5  
ATOM 5730  C CG   . ASP A 1 63 ? 5.406   8.912   -6.420  1.00 0.00 ? 64 ASP A CG   5  
ATOM 5731  O OD1  . ASP A 1 63 ? 4.304   9.117   -5.938  1.00 0.00 ? 64 ASP A OD1  5  
ATOM 5732  O OD2  . ASP A 1 63 ? 6.347   9.682   -6.324  1.00 0.00 ? 64 ASP A OD2  5  
ATOM 5733  H H    . ASP A 1 63 ? 5.352   5.468   -8.546  1.00 0.00 ? 64 ASP A H    5  
ATOM 5734  H HA   . ASP A 1 63 ? 3.527   7.451   -7.511  1.00 0.00 ? 64 ASP A HA   5  
ATOM 5735  H HB2  . ASP A 1 63 ? 5.723   6.794   -6.511  1.00 0.00 ? 64 ASP A HB2  5  
ATOM 5736  H HB3  . ASP A 1 63 ? 6.505   7.692   -7.798  1.00 0.00 ? 64 ASP A HB3  5  
ATOM 5737  N N    . ARG A 1 64 ? 5.278   8.070   -10.192 1.00 0.00 ? 65 ARG A N    5  
ATOM 5738  C CA   . ARG A 1 64 ? 5.377   8.978   -11.363 1.00 0.00 ? 65 ARG A CA   5  
ATOM 5739  C C    . ARG A 1 64 ? 4.204   8.735   -12.318 1.00 0.00 ? 65 ARG A C    5  
ATOM 5740  O O    . ARG A 1 64 ? 3.703   9.645   -12.949 1.00 0.00 ? 65 ARG A O    5  
ATOM 5741  C CB   . ARG A 1 64 ? 6.690   8.707   -12.099 1.00 0.00 ? 65 ARG A CB   5  
ATOM 5742  C CG   . ARG A 1 64 ? 6.868   9.723   -13.228 1.00 0.00 ? 65 ARG A CG   5  
ATOM 5743  C CD   . ARG A 1 64 ? 8.191   9.457   -13.951 1.00 0.00 ? 65 ARG A CD   5  
ATOM 5744  N NE   . ARG A 1 64 ? 9.048   10.675  -13.884 1.00 0.00 ? 65 ARG A NE   5  
ATOM 5745  C CZ   . ARG A 1 64 ? 9.938   10.798  -12.935 1.00 0.00 ? 65 ARG A CZ   5  
ATOM 5746  N NH1  . ARG A 1 64 ? 10.772  9.824   -12.693 1.00 0.00 ? 65 ARG A NH1  5  
ATOM 5747  N NH2  . ARG A 1 64 ? 9.993   11.894  -12.229 1.00 0.00 ? 65 ARG A NH2  5  
ATOM 5748  H H    . ARG A 1 64 ? 5.856   7.280   -10.130 1.00 0.00 ? 65 ARG A H    5  
ATOM 5749  H HA   . ARG A 1 64 ? 5.360   9.994   -11.020 1.00 0.00 ? 65 ARG A HA   5  
ATOM 5750  H HB2  . ARG A 1 64 ? 7.514   8.789   -11.405 1.00 0.00 ? 65 ARG A HB2  5  
ATOM 5751  H HB3  . ARG A 1 64 ? 6.666   7.709   -12.513 1.00 0.00 ? 65 ARG A HB3  5  
ATOM 5752  H HG2  . ARG A 1 64 ? 6.049   9.630   -13.928 1.00 0.00 ? 65 ARG A HG2  5  
ATOM 5753  H HG3  . ARG A 1 64 ? 6.879   10.721  -12.816 1.00 0.00 ? 65 ARG A HG3  5  
ATOM 5754  H HD2  . ARG A 1 64 ? 8.701   8.631   -13.477 1.00 0.00 ? 65 ARG A HD2  5  
ATOM 5755  H HD3  . ARG A 1 64 ? 7.994   9.213   -14.985 1.00 0.00 ? 65 ARG A HD3  5  
ATOM 5756  H HE   . ARG A 1 64 ? 8.943   11.385  -14.550 1.00 0.00 ? 65 ARG A HE   5  
ATOM 5757  H HH11 . ARG A 1 64 ? 10.729  8.983   -13.233 1.00 0.00 ? 65 ARG A HH11 5  
ATOM 5758  H HH12 . ARG A 1 64 ? 11.454  9.919   -11.968 1.00 0.00 ? 65 ARG A HH12 5  
ATOM 5759  H HH21 . ARG A 1 64 ? 9.354   12.639  -12.415 1.00 0.00 ? 65 ARG A HH21 5  
ATOM 5760  H HH22 . ARG A 1 64 ? 10.675  11.987  -11.505 1.00 0.00 ? 65 ARG A HH22 5  
ATOM 5761  N N    . ALA A 1 65 ? 3.781   7.510   -12.445 1.00 0.00 ? 66 ALA A N    5  
ATOM 5762  C CA   . ALA A 1 65 ? 2.660   7.190   -13.378 1.00 0.00 ? 66 ALA A CA   5  
ATOM 5763  C C    . ALA A 1 65 ? 1.310   7.586   -12.778 1.00 0.00 ? 66 ALA A C    5  
ATOM 5764  O O    . ALA A 1 65 ? 0.352   7.765   -13.495 1.00 0.00 ? 66 ALA A O    5  
ATOM 5765  C CB   . ALA A 1 65 ? 2.657   5.691   -13.649 1.00 0.00 ? 66 ALA A CB   5  
ATOM 5766  H H    . ALA A 1 65 ? 4.217   6.792   -11.940 1.00 0.00 ? 66 ALA A H    5  
ATOM 5767  H HA   . ALA A 1 65 ? 2.803   7.723   -14.310 1.00 0.00 ? 66 ALA A HA   5  
ATOM 5768  H HB1  . ALA A 1 65 ? 2.558   5.166   -12.713 1.00 0.00 ? 66 ALA A HB1  5  
ATOM 5769  H HB2  . ALA A 1 65 ? 1.827   5.442   -14.294 1.00 0.00 ? 66 ALA A HB2  5  
ATOM 5770  H HB3  . ALA A 1 65 ? 3.584   5.408   -14.126 1.00 0.00 ? 66 ALA A HB3  5  
ATOM 5771  N N    . VAL A 1 66 ? 1.200   7.716   -11.485 1.00 0.00 ? 67 VAL A N    5  
ATOM 5772  C CA   . VAL A 1 66 ? -0.119  8.101   -10.907 1.00 0.00 ? 67 VAL A CA   5  
ATOM 5773  C C    . VAL A 1 66 ? -0.455  9.527   -11.335 1.00 0.00 ? 67 VAL A C    5  
ATOM 5774  O O    . VAL A 1 66 ? -1.600  9.878   -11.489 1.00 0.00 ? 67 VAL A O    5  
ATOM 5775  C CB   . VAL A 1 66 ? -0.078  8.057   -9.400  1.00 0.00 ? 67 VAL A CB   5  
ATOM 5776  C CG1  . VAL A 1 66 ? -0.039  6.610   -8.909  1.00 0.00 ? 67 VAL A CG1  5  
ATOM 5777  C CG2  . VAL A 1 66 ? 1.148   8.799   -8.953  1.00 0.00 ? 67 VAL A CG2  5  
ATOM 5778  H H    . VAL A 1 66 ? 1.970   7.557   -10.904 1.00 0.00 ? 67 VAL A H    5  
ATOM 5779  H HA   . VAL A 1 66 ? -0.868  7.429   -11.257 1.00 0.00 ? 67 VAL A HA   5  
ATOM 5780  H HB   . VAL A 1 66 ? -0.947  8.550   -9.016  1.00 0.00 ? 67 VAL A HB   5  
ATOM 5781  H HG11 . VAL A 1 66 ? 0.390   5.983   -9.675  1.00 0.00 ? 67 VAL A HG11 5  
ATOM 5782  H HG12 . VAL A 1 66 ? 0.563   6.548   -8.014  1.00 0.00 ? 67 VAL A HG12 5  
ATOM 5783  H HG13 . VAL A 1 66 ? -1.043  6.279   -8.693  1.00 0.00 ? 67 VAL A HG13 5  
ATOM 5784  H HG21 . VAL A 1 66 ? 1.725   9.047   -9.824  1.00 0.00 ? 67 VAL A HG21 5  
ATOM 5785  H HG22 . VAL A 1 66 ? 0.846   9.702   -8.450  1.00 0.00 ? 67 VAL A HG22 5  
ATOM 5786  H HG23 . VAL A 1 66 ? 1.725   8.180   -8.289  1.00 0.00 ? 67 VAL A HG23 5  
ATOM 5787  N N    . LYS A 1 67 ? 0.546   10.350  -11.516 1.00 0.00 ? 68 LYS A N    5  
ATOM 5788  C CA   . LYS A 1 67 ? 0.304   11.766  -11.939 1.00 0.00 ? 68 LYS A CA   5  
ATOM 5789  C C    . LYS A 1 67 ? -0.225  11.765  -13.376 1.00 0.00 ? 68 LYS A C    5  
ATOM 5790  O O    . LYS A 1 67 ? -1.293  12.268  -13.655 1.00 0.00 ? 68 LYS A O    5  
ATOM 5791  C CB   . LYS A 1 67 ? 1.615   12.556  -11.876 1.00 0.00 ? 68 LYS A CB   5  
ATOM 5792  C CG   . LYS A 1 67 ? 1.445   13.889  -12.611 1.00 0.00 ? 68 LYS A CG   5  
ATOM 5793  C CD   . LYS A 1 67 ? 1.885   15.039  -11.703 1.00 0.00 ? 68 LYS A CD   5  
ATOM 5794  C CE   . LYS A 1 67 ? 3.412   15.097  -11.656 1.00 0.00 ? 68 LYS A CE   5  
ATOM 5795  N NZ   . LYS A 1 67 ? 3.894   16.230  -12.496 1.00 0.00 ? 68 LYS A NZ   5  
ATOM 5796  H H    . LYS A 1 67 ? 1.457   10.034  -11.368 1.00 0.00 ? 68 LYS A H    5  
ATOM 5797  H HA   . LYS A 1 67 ? -0.427  12.220  -11.285 1.00 0.00 ? 68 LYS A HA   5  
ATOM 5798  H HB2  . LYS A 1 67 ? 1.873   12.743  -10.844 1.00 0.00 ? 68 LYS A HB2  5  
ATOM 5799  H HB3  . LYS A 1 67 ? 2.402   11.986  -12.346 1.00 0.00 ? 68 LYS A HB3  5  
ATOM 5800  H HG2  . LYS A 1 67 ? 2.049   13.886  -13.507 1.00 0.00 ? 68 LYS A HG2  5  
ATOM 5801  H HG3  . LYS A 1 67 ? 0.406   14.021  -12.878 1.00 0.00 ? 68 LYS A HG3  5  
ATOM 5802  H HD2  . LYS A 1 67 ? 1.499   15.971  -12.090 1.00 0.00 ? 68 LYS A HD2  5  
ATOM 5803  H HD3  . LYS A 1 67 ? 1.502   14.877  -10.706 1.00 0.00 ? 68 LYS A HD3  5  
ATOM 5804  H HE2  . LYS A 1 67 ? 3.736   15.243  -10.636 1.00 0.00 ? 68 LYS A HE2  5  
ATOM 5805  H HE3  . LYS A 1 67 ? 3.820   14.170  -12.033 1.00 0.00 ? 68 LYS A HE3  5  
ATOM 5806  H HZ1  . LYS A 1 67 ? 3.169   16.471  -13.203 1.00 0.00 ? 68 LYS A HZ1  5  
ATOM 5807  H HZ2  . LYS A 1 67 ? 4.077   17.056  -11.893 1.00 0.00 ? 68 LYS A HZ2  5  
ATOM 5808  H HZ3  . LYS A 1 67 ? 4.773   15.956  -12.979 1.00 0.00 ? 68 LYS A HZ3  5  
ATOM 5809  N N    . GLU A 1 68 ? 0.505   11.174  -14.286 1.00 0.00 ? 69 GLU A N    5  
ATOM 5810  C CA   . GLU A 1 68 ? 0.027   11.096  -15.696 1.00 0.00 ? 69 GLU A CA   5  
ATOM 5811  C C    . GLU A 1 68 ? -1.314  10.370  -15.669 1.00 0.00 ? 69 GLU A C    5  
ATOM 5812  O O    . GLU A 1 68 ? -2.220  10.623  -16.438 1.00 0.00 ? 69 GLU A O    5  
ATOM 5813  C CB   . GLU A 1 68 ? 1.028   10.268  -16.501 1.00 0.00 ? 69 GLU A CB   5  
ATOM 5814  C CG   . GLU A 1 68 ? 1.924   11.197  -17.324 1.00 0.00 ? 69 GLU A CG   5  
ATOM 5815  C CD   . GLU A 1 68 ? 1.675   10.960  -18.816 1.00 0.00 ? 69 GLU A CD   5  
ATOM 5816  O OE1  . GLU A 1 68 ? 1.705   9.811   -19.227 1.00 0.00 ? 69 GLU A OE1  5  
ATOM 5817  O OE2  . GLU A 1 68 ? 1.461   11.932  -19.523 1.00 0.00 ? 69 GLU A OE2  5  
ATOM 5818  H H    . GLU A 1 68 ? 1.354   10.752  -14.035 1.00 0.00 ? 69 GLU A H    5  
ATOM 5819  H HA   . GLU A 1 68 ? -0.081  12.084  -16.119 1.00 0.00 ? 69 GLU A HA   5  
ATOM 5820  H HB2  . GLU A 1 68 ? 1.637   9.684   -15.815 1.00 0.00 ? 69 GLU A HB2  5  
ATOM 5821  H HB3  . GLU A 1 68 ? 0.495   9.603   -17.161 1.00 0.00 ? 69 GLU A HB3  5  
ATOM 5822  H HG2  . GLU A 1 68 ? 1.697   12.225  -17.080 1.00 0.00 ? 69 GLU A HG2  5  
ATOM 5823  H HG3  . GLU A 1 68 ? 2.960   10.993  -17.098 1.00 0.00 ? 69 GLU A HG3  5  
ATOM 5824  N N    . PHE A 1 69 ? -1.404  9.471   -14.745 1.00 0.00 ? 70 PHE A N    5  
ATOM 5825  C CA   . PHE A 1 69 ? -2.620  8.651   -14.521 1.00 0.00 ? 70 PHE A CA   5  
ATOM 5826  C C    . PHE A 1 69 ? -3.738  9.520   -13.952 1.00 0.00 ? 70 PHE A C    5  
ATOM 5827  O O    . PHE A 1 69 ? -4.909  9.285   -14.180 1.00 0.00 ? 70 PHE A O    5  
ATOM 5828  C CB   . PHE A 1 69 ? -2.243  7.615   -13.491 1.00 0.00 ? 70 PHE A CB   5  
ATOM 5829  C CG   . PHE A 1 69 ? -3.466  7.119   -12.826 1.00 0.00 ? 70 PHE A CG   5  
ATOM 5830  C CD1  . PHE A 1 69 ? -4.247  6.180   -13.468 1.00 0.00 ? 70 PHE A CD1  5  
ATOM 5831  C CD2  . PHE A 1 69 ? -3.819  7.624   -11.584 1.00 0.00 ? 70 PHE A CD2  5  
ATOM 5832  C CE1  . PHE A 1 69 ? -5.413  5.718   -12.865 1.00 0.00 ? 70 PHE A CE1  5  
ATOM 5833  C CE2  . PHE A 1 69 ? -4.986  7.170   -10.962 1.00 0.00 ? 70 PHE A CE2  5  
ATOM 5834  C CZ   . PHE A 1 69 ? -5.788  6.211   -11.605 1.00 0.00 ? 70 PHE A CZ   5  
ATOM 5835  H H    . PHE A 1 69 ? -0.637  9.335   -14.160 1.00 0.00 ? 70 PHE A H    5  
ATOM 5836  H HA   . PHE A 1 69 ? -2.941  8.149   -15.416 1.00 0.00 ? 70 PHE A HA   5  
ATOM 5837  H HB2  . PHE A 1 69 ? -1.744  6.798   -13.979 1.00 0.00 ? 70 PHE A HB2  5  
ATOM 5838  H HB3  . PHE A 1 69 ? -1.600  8.071   -12.757 1.00 0.00 ? 70 PHE A HB3  5  
ATOM 5839  H HD1  . PHE A 1 69 ? -3.942  5.813   -14.436 1.00 0.00 ? 70 PHE A HD1  5  
ATOM 5840  H HD2  . PHE A 1 69 ? -3.183  8.371   -11.110 1.00 0.00 ? 70 PHE A HD2  5  
ATOM 5841  H HE1  . PHE A 1 69 ? -6.021  4.990   -13.370 1.00 0.00 ? 70 PHE A HE1  5  
ATOM 5842  H HE2  . PHE A 1 69 ? -5.270  7.553   -9.995  1.00 0.00 ? 70 PHE A HE2  5  
ATOM 5843  H HZ   . PHE A 1 69 ? -6.691  5.856   -11.131 1.00 0.00 ? 70 PHE A HZ   5  
ATOM 5844  N N    . GLU A 1 70 ? -3.378  10.508  -13.198 1.00 0.00 ? 71 GLU A N    5  
ATOM 5845  C CA   . GLU A 1 70 ? -4.402  11.386  -12.589 1.00 0.00 ? 71 GLU A CA   5  
ATOM 5846  C C    . GLU A 1 70 ? -4.727  12.482  -13.595 1.00 0.00 ? 71 GLU A C    5  
ATOM 5847  O O    . GLU A 1 70 ? -5.687  13.215  -13.468 1.00 0.00 ? 71 GLU A O    5  
ATOM 5848  C CB   . GLU A 1 70 ? -3.842  12.021  -11.313 1.00 0.00 ? 71 GLU A CB   5  
ATOM 5849  C CG   . GLU A 1 70 ? -3.676  10.945  -10.243 1.00 0.00 ? 71 GLU A CG   5  
ATOM 5850  C CD   . GLU A 1 70 ? -4.696  11.171  -9.125  1.00 0.00 ? 71 GLU A CD   5  
ATOM 5851  O OE1  . GLU A 1 70 ? -4.887  12.316  -8.745  1.00 0.00 ? 71 GLU A OE1  5  
ATOM 5852  O OE2  . GLU A 1 70 ? -5.268  10.196  -8.666  1.00 0.00 ? 71 GLU A OE2  5  
ATOM 5853  H H    . GLU A 1 70 ? -2.433  10.674  -13.037 1.00 0.00 ? 71 GLU A H    5  
ATOM 5854  H HA   . GLU A 1 70 ? -5.275  10.796  -12.353 1.00 0.00 ? 71 GLU A HA   5  
ATOM 5855  H HB2  . GLU A 1 70 ? -2.883  12.469  -11.525 1.00 0.00 ? 71 GLU A HB2  5  
ATOM 5856  H HB3  . GLU A 1 70 ? -4.524  12.778  -10.957 1.00 0.00 ? 71 GLU A HB3  5  
ATOM 5857  H HG2  . GLU A 1 70 ? -3.838  9.978   -10.688 1.00 0.00 ? 71 GLU A HG2  5  
ATOM 5858  H HG3  . GLU A 1 70 ? -2.678  10.991  -9.836  1.00 0.00 ? 71 GLU A HG3  5  
ATOM 5859  N N    . ALA A 1 71 ? -3.891  12.596  -14.584 1.00 0.00 ? 72 ALA A N    5  
ATOM 5860  C CA   . ALA A 1 71 ? -4.051  13.630  -15.623 1.00 0.00 ? 72 ALA A CA   5  
ATOM 5861  C C    . ALA A 1 71 ? -4.967  13.120  -16.738 1.00 0.00 ? 72 ALA A C    5  
ATOM 5862  O O    . ALA A 1 71 ? -5.587  13.890  -17.444 1.00 0.00 ? 72 ALA A O    5  
ATOM 5863  C CB   . ALA A 1 71 ? -2.659  13.904  -16.176 1.00 0.00 ? 72 ALA A CB   5  
ATOM 5864  H H    . ALA A 1 71 ? -3.121  11.997  -14.634 1.00 0.00 ? 72 ALA A H    5  
ATOM 5865  H HA   . ALA A 1 71 ? -4.456  14.530  -15.191 1.00 0.00 ? 72 ALA A HA   5  
ATOM 5866  H HB1  . ALA A 1 71 ? -1.957  13.230  -15.691 1.00 0.00 ? 72 ALA A HB1  5  
ATOM 5867  H HB2  . ALA A 1 71 ? -2.652  13.734  -17.242 1.00 0.00 ? 72 ALA A HB2  5  
ATOM 5868  H HB3  . ALA A 1 71 ? -2.381  14.925  -15.966 1.00 0.00 ? 72 ALA A HB3  5  
ATOM 5869  N N    . ASN A 1 72 ? -5.055  11.827  -16.906 1.00 0.00 ? 73 ASN A N    5  
ATOM 5870  C CA   . ASN A 1 72 ? -5.928  11.275  -17.979 1.00 0.00 ? 73 ASN A CA   5  
ATOM 5871  C C    . ASN A 1 72 ? -7.298  10.925  -17.394 1.00 0.00 ? 73 ASN A C    5  
ATOM 5872  O O    . ASN A 1 72 ? -7.510  10.992  -16.200 1.00 0.00 ? 73 ASN A O    5  
ATOM 5873  C CB   . ASN A 1 72 ? -5.283  10.019  -18.566 1.00 0.00 ? 73 ASN A CB   5  
ATOM 5874  C CG   . ASN A 1 72 ? -4.152  10.417  -19.504 1.00 0.00 ? 73 ASN A CG   5  
ATOM 5875  O OD1  . ASN A 1 72 ? -4.079  11.545  -19.949 1.00 0.00 ? 73 ASN A OD1  5  
ATOM 5876  N ND2  . ASN A 1 72 ? -3.257  9.529   -19.825 1.00 0.00 ? 73 ASN A ND2  5  
ATOM 5877  H H    . ASN A 1 72 ? -4.544  11.222  -16.328 1.00 0.00 ? 73 ASN A H    5  
ATOM 5878  H HA   . ASN A 1 72 ? -6.050  12.014  -18.758 1.00 0.00 ? 73 ASN A HA   5  
ATOM 5879  H HB2  . ASN A 1 72 ? -4.885  9.408   -17.771 1.00 0.00 ? 73 ASN A HB2  5  
ATOM 5880  H HB3  . ASN A 1 72 ? -6.019  9.456   -19.119 1.00 0.00 ? 73 ASN A HB3  5  
ATOM 5881  H HD21 . ASN A 1 72 ? -3.317  8.619   -19.465 1.00 0.00 ? 73 ASN A HD21 5  
ATOM 5882  H HD22 . ASN A 1 72 ? -2.528  9.768   -20.424 1.00 0.00 ? 73 ASN A HD22 5  
ATOM 5883  N N    . GLY A 1 73 ? -8.233  10.555  -18.226 1.00 0.00 ? 74 GLY A N    5  
ATOM 5884  C CA   . GLY A 1 73 ? -9.588  10.206  -17.715 1.00 0.00 ? 74 GLY A CA   5  
ATOM 5885  C C    . GLY A 1 73 ? -10.494 11.437  -17.790 1.00 0.00 ? 74 GLY A C    5  
ATOM 5886  O O    . GLY A 1 73 ? -11.304 11.607  -16.894 1.00 0.00 ? 74 GLY A O    5  
ATOM 5887  O OXT  . GLY A 1 73 ? -10.362 12.188  -18.742 1.00 0.00 ? 74 GLY A OXT  5  
ATOM 5888  H H    . GLY A 1 73 ? -8.045  10.509  -19.186 1.00 0.00 ? 74 GLY A H    5  
ATOM 5889  H HA2  . GLY A 1 73 ? -10.007 9.412   -18.317 1.00 0.00 ? 74 GLY A HA2  5  
ATOM 5890  H HA3  . GLY A 1 73 ? -9.515  9.880   -16.689 1.00 0.00 ? 74 GLY A HA3  5  
ATOM 5891  N N    . SER A 1 1  ? -3.377  8.470   -18.054 1.00 0.00 ? 2  SER A N    6  
ATOM 5892  C CA   . SER A 1 1  ? -3.156  7.870   -16.708 1.00 0.00 ? 2  SER A CA   6  
ATOM 5893  C C    . SER A 1 1  ? -3.283  8.949   -15.631 1.00 0.00 ? 2  SER A C    6  
ATOM 5894  O O    . SER A 1 1  ? -3.675  10.069  -15.897 1.00 0.00 ? 2  SER A O    6  
ATOM 5895  C CB   . SER A 1 1  ? -1.757  7.257   -16.647 1.00 0.00 ? 2  SER A CB   6  
ATOM 5896  O OG   . SER A 1 1  ? -1.747  6.211   -15.684 1.00 0.00 ? 2  SER A OG   6  
ATOM 5897  H H    . SER A 1 1  ? -3.591  9.421   -18.139 1.00 0.00 ? 2  SER A H    6  
ATOM 5898  H HA   . SER A 1 1  ? -3.892  7.099   -16.533 1.00 0.00 ? 2  SER A HA   6  
ATOM 5899  H HB2  . SER A 1 1  ? -1.493  6.856   -17.611 1.00 0.00 ? 2  SER A HB2  6  
ATOM 5900  H HB3  . SER A 1 1  ? -1.042  8.022   -16.369 1.00 0.00 ? 2  SER A HB3  6  
ATOM 5901  H HG   . SER A 1 1  ? -1.045  5.598   -15.920 1.00 0.00 ? 2  SER A HG   6  
ATOM 5902  N N    . ASP A 1 2  ? -2.953  8.615   -14.415 1.00 0.00 ? 3  ASP A N    6  
ATOM 5903  C CA   . ASP A 1 2  ? -3.049  9.606   -13.308 1.00 0.00 ? 3  ASP A CA   6  
ATOM 5904  C C    . ASP A 1 2  ? -2.578  8.948   -12.012 1.00 0.00 ? 3  ASP A C    6  
ATOM 5905  O O    . ASP A 1 2  ? -1.764  9.486   -11.288 1.00 0.00 ? 3  ASP A O    6  
ATOM 5906  C CB   . ASP A 1 2  ? -4.502  10.063  -13.154 1.00 0.00 ? 3  ASP A CB   6  
ATOM 5907  C CG   . ASP A 1 2  ? -4.535  11.541  -12.760 1.00 0.00 ? 3  ASP A CG   6  
ATOM 5908  O OD1  . ASP A 1 2  ? -3.472  12.107  -12.572 1.00 0.00 ? 3  ASP A OD1  6  
ATOM 5909  O OD2  . ASP A 1 2  ? -5.624  12.080  -12.654 1.00 0.00 ? 3  ASP A OD2  6  
ATOM 5910  H H    . ASP A 1 2  ? -2.641  7.705   -14.228 1.00 0.00 ? 3  ASP A H    6  
ATOM 5911  H HA   . ASP A 1 2  ? -2.422  10.458  -13.529 1.00 0.00 ? 3  ASP A HA   6  
ATOM 5912  H HB2  . ASP A 1 2  ? -5.022  9.927   -14.091 1.00 0.00 ? 3  ASP A HB2  6  
ATOM 5913  H HB3  . ASP A 1 2  ? -4.983  9.477   -12.385 1.00 0.00 ? 3  ASP A HB3  6  
ATOM 5914  N N    . LYS A 1 3  ? -3.079  7.779   -11.719 1.00 0.00 ? 4  LYS A N    6  
ATOM 5915  C CA   . LYS A 1 3  ? -2.657  7.075   -10.478 1.00 0.00 ? 4  LYS A CA   6  
ATOM 5916  C C    . LYS A 1 3  ? -1.568  6.053   -10.833 1.00 0.00 ? 4  LYS A C    6  
ATOM 5917  O O    . LYS A 1 3  ? -1.671  5.371   -11.833 1.00 0.00 ? 4  LYS A O    6  
ATOM 5918  C CB   . LYS A 1 3  ? -3.863  6.357   -9.869  1.00 0.00 ? 4  LYS A CB   6  
ATOM 5919  C CG   . LYS A 1 3  ? -3.455  5.693   -8.554  1.00 0.00 ? 4  LYS A CG   6  
ATOM 5920  C CD   . LYS A 1 3  ? -4.654  4.948   -7.965  1.00 0.00 ? 4  LYS A CD   6  
ATOM 5921  C CE   . LYS A 1 3  ? -5.651  5.957   -7.391  1.00 0.00 ? 4  LYS A CE   6  
ATOM 5922  N NZ   . LYS A 1 3  ? -6.802  6.108   -8.327  1.00 0.00 ? 4  LYS A NZ   6  
ATOM 5923  H H    . LYS A 1 3  ? -3.729  7.361   -12.321 1.00 0.00 ? 4  LYS A H    6  
ATOM 5924  H HA   . LYS A 1 3  ? -2.270  7.794   -9.772  1.00 0.00 ? 4  LYS A HA   6  
ATOM 5925  H HB2  . LYS A 1 3  ? -4.650  7.073   -9.683  1.00 0.00 ? 4  LYS A HB2  6  
ATOM 5926  H HB3  . LYS A 1 3  ? -4.218  5.604   -10.555 1.00 0.00 ? 4  LYS A HB3  6  
ATOM 5927  H HG2  . LYS A 1 3  ? -2.650  4.996   -8.736  1.00 0.00 ? 4  LYS A HG2  6  
ATOM 5928  H HG3  . LYS A 1 3  ? -3.126  6.449   -7.856  1.00 0.00 ? 4  LYS A HG3  6  
ATOM 5929  H HD2  . LYS A 1 3  ? -5.133  4.368   -8.741  1.00 0.00 ? 4  LYS A HD2  6  
ATOM 5930  H HD3  . LYS A 1 3  ? -4.318  4.290   -7.178  1.00 0.00 ? 4  LYS A HD3  6  
ATOM 5931  H HE2  . LYS A 1 3  ? -6.010  5.605   -6.435  1.00 0.00 ? 4  LYS A HE2  6  
ATOM 5932  H HE3  . LYS A 1 3  ? -5.164  6.912   -7.263  1.00 0.00 ? 4  LYS A HE3  6  
ATOM 5933  H HZ1  . LYS A 1 3  ? -6.576  5.651   -9.233  1.00 0.00 ? 4  LYS A HZ1  6  
ATOM 5934  H HZ2  . LYS A 1 3  ? -7.646  5.661   -7.913  1.00 0.00 ? 4  LYS A HZ2  6  
ATOM 5935  H HZ3  . LYS A 1 3  ? -6.987  7.118   -8.489  1.00 0.00 ? 4  LYS A HZ3  6  
ATOM 5936  N N    . PRO A 1 4  ? -0.552  5.986   -10.010 1.00 0.00 ? 5  PRO A N    6  
ATOM 5937  C CA   . PRO A 1 4  ? 0.577   5.067   -10.219 1.00 0.00 ? 5  PRO A CA   6  
ATOM 5938  C C    . PRO A 1 4  ? 0.219   3.637   -9.822  1.00 0.00 ? 5  PRO A C    6  
ATOM 5939  O O    . PRO A 1 4  ? -0.756  3.392   -9.139  1.00 0.00 ? 5  PRO A O    6  
ATOM 5940  C CB   . PRO A 1 4  ? 1.669   5.615   -9.323  1.00 0.00 ? 5  PRO A CB   6  
ATOM 5941  C CG   . PRO A 1 4  ? 0.960   6.453   -8.249  1.00 0.00 ? 5  PRO A CG   6  
ATOM 5942  C CD   . PRO A 1 4  ? -0.431  6.811   -8.799  1.00 0.00 ? 5  PRO A CD   6  
ATOM 5943  H HA   . PRO A 1 4  ? 0.912   5.106   -11.223 1.00 0.00 ? 5  PRO A HA   6  
ATOM 5944  H HB2  . PRO A 1 4  ? 2.217   4.801   -8.870  1.00 0.00 ? 5  PRO A HB2  6  
ATOM 5945  H HB3  . PRO A 1 4  ? 2.332   6.240   -9.897  1.00 0.00 ? 5  PRO A HB3  6  
ATOM 5946  H HG2  . PRO A 1 4  ? 0.865   5.875   -7.349  1.00 0.00 ? 5  PRO A HG2  6  
ATOM 5947  H HG3  . PRO A 1 4  ? 1.519   7.349   -8.068  1.00 0.00 ? 5  PRO A HG3  6  
ATOM 5948  H HD2  . PRO A 1 4  ? -1.199  6.554   -8.082  1.00 0.00 ? 5  PRO A HD2  6  
ATOM 5949  H HD3  . PRO A 1 4  ? -0.481  7.858   -9.055  1.00 0.00 ? 5  PRO A HD3  6  
ATOM 5950  N N    . LYS A 1 5  ? 1.014   2.695   -10.241 1.00 0.00 ? 6  LYS A N    6  
ATOM 5951  C CA   . LYS A 1 5  ? 0.743   1.275   -9.889  1.00 0.00 ? 6  LYS A CA   6  
ATOM 5952  C C    . LYS A 1 5  ? 1.157   1.029   -8.438  1.00 0.00 ? 6  LYS A C    6  
ATOM 5953  O O    . LYS A 1 5  ? 2.321   0.867   -8.133  1.00 0.00 ? 6  LYS A O    6  
ATOM 5954  C CB   . LYS A 1 5  ? 1.532   0.357   -10.806 1.00 0.00 ? 6  LYS A CB   6  
ATOM 5955  C CG   . LYS A 1 5  ? 1.388   0.823   -12.257 1.00 0.00 ? 6  LYS A CG   6  
ATOM 5956  C CD   . LYS A 1 5  ? 2.458   0.146   -13.117 1.00 0.00 ? 6  LYS A CD   6  
ATOM 5957  C CE   . LYS A 1 5  ? 1.796   -0.518  -14.325 1.00 0.00 ? 6  LYS A CE   6  
ATOM 5958  N NZ   . LYS A 1 5  ? 0.960   -1.664  -13.867 1.00 0.00 ? 6  LYS A NZ   6  
ATOM 5959  H H    . LYS A 1 5  ? 1.796   2.927   -10.782 1.00 0.00 ? 6  LYS A H    6  
ATOM 5960  H HA   . LYS A 1 5  ? -0.305  1.063   -10.004 1.00 0.00 ? 6  LYS A HA   6  
ATOM 5961  H HB2  . LYS A 1 5  ? 2.572   0.370   -10.522 1.00 0.00 ? 6  LYS A HB2  6  
ATOM 5962  H HB3  . LYS A 1 5  ? 1.140   -0.640  -10.712 1.00 0.00 ? 6  LYS A HB3  6  
ATOM 5963  H HG2  . LYS A 1 5  ? 0.408   0.553   -12.624 1.00 0.00 ? 6  LYS A HG2  6  
ATOM 5964  H HG3  . LYS A 1 5  ? 1.511   1.893   -12.308 1.00 0.00 ? 6  LYS A HG3  6  
ATOM 5965  H HD2  . LYS A 1 5  ? 3.168   0.887   -13.456 1.00 0.00 ? 6  LYS A HD2  6  
ATOM 5966  H HD3  . LYS A 1 5  ? 2.969   -0.602  -12.532 1.00 0.00 ? 6  LYS A HD3  6  
ATOM 5967  H HE2  . LYS A 1 5  ? 1.172   0.202   -14.834 1.00 0.00 ? 6  LYS A HE2  6  
ATOM 5968  H HE3  . LYS A 1 5  ? 2.558   -0.876  -15.001 1.00 0.00 ? 6  LYS A HE3  6  
ATOM 5969  H HZ1  . LYS A 1 5  ? 1.510   -2.254  -13.211 1.00 0.00 ? 6  LYS A HZ1  6  
ATOM 5970  H HZ2  . LYS A 1 5  ? 0.115   -1.305  -13.382 1.00 0.00 ? 6  LYS A HZ2  6  
ATOM 5971  H HZ3  . LYS A 1 5  ? 0.673   -2.234  -14.690 1.00 0.00 ? 6  LYS A HZ3  6  
ATOM 5972  N N    . ARG A 1 6  ? 0.211   1.009   -7.543  1.00 0.00 ? 7  ARG A N    6  
ATOM 5973  C CA   . ARG A 1 6  ? 0.543   0.786   -6.107  1.00 0.00 ? 7  ARG A CA   6  
ATOM 5974  C C    . ARG A 1 6  ? 1.399   -0.480  -5.950  1.00 0.00 ? 7  ARG A C    6  
ATOM 5975  O O    . ARG A 1 6  ? 1.190   -1.458  -6.642  1.00 0.00 ? 7  ARG A O    6  
ATOM 5976  C CB   . ARG A 1 6  ? -0.752  0.620   -5.309  1.00 0.00 ? 7  ARG A CB   6  
ATOM 5977  C CG   . ARG A 1 6  ? -1.579  -0.519  -5.909  1.00 0.00 ? 7  ARG A CG   6  
ATOM 5978  C CD   . ARG A 1 6  ? -2.607  -0.998  -4.883  1.00 0.00 ? 7  ARG A CD   6  
ATOM 5979  N NE   . ARG A 1 6  ? -1.957  -1.117  -3.548  1.00 0.00 ? 7  ARG A NE   6  
ATOM 5980  C CZ   . ARG A 1 6  ? -2.589  -0.720  -2.478  1.00 0.00 ? 7  ARG A CZ   6  
ATOM 5981  N NH1  . ARG A 1 6  ? -2.640  0.551   -2.184  1.00 0.00 ? 7  ARG A NH1  6  
ATOM 5982  N NH2  . ARG A 1 6  ? -3.172  -1.592  -1.703  1.00 0.00 ? 7  ARG A NH2  6  
ATOM 5983  H H    . ARG A 1 6  ? -0.721  1.149   -7.812  1.00 0.00 ? 7  ARG A H    6  
ATOM 5984  H HA   . ARG A 1 6  ? 1.086   1.640   -5.733  1.00 0.00 ? 7  ARG A HA   6  
ATOM 5985  H HB2  . ARG A 1 6  ? -0.512  0.390   -4.281  1.00 0.00 ? 7  ARG A HB2  6  
ATOM 5986  H HB3  . ARG A 1 6  ? -1.320  1.537   -5.350  1.00 0.00 ? 7  ARG A HB3  6  
ATOM 5987  H HG2  . ARG A 1 6  ? -2.090  -0.166  -6.794  1.00 0.00 ? 7  ARG A HG2  6  
ATOM 5988  H HG3  . ARG A 1 6  ? -0.928  -1.339  -6.172  1.00 0.00 ? 7  ARG A HG3  6  
ATOM 5989  H HD2  . ARG A 1 6  ? -3.418  -0.287  -4.827  1.00 0.00 ? 7  ARG A HD2  6  
ATOM 5990  H HD3  . ARG A 1 6  ? -2.994  -1.961  -5.183  1.00 0.00 ? 7  ARG A HD3  6  
ATOM 5991  H HE   . ARG A 1 6  ? -1.056  -1.494  -3.474  1.00 0.00 ? 7  ARG A HE   6  
ATOM 5992  H HH11 . ARG A 1 6  ? -2.193  1.219   -2.779  1.00 0.00 ? 7  ARG A HH11 6  
ATOM 5993  H HH12 . ARG A 1 6  ? -3.123  0.855   -1.364  1.00 0.00 ? 7  ARG A HH12 6  
ATOM 5994  H HH21 . ARG A 1 6  ? -3.135  -2.566  -1.930  1.00 0.00 ? 7  ARG A HH21 6  
ATOM 5995  H HH22 . ARG A 1 6  ? -3.657  -1.289  -0.884  1.00 0.00 ? 7  ARG A HH22 6  
ATOM 5996  N N    . PRO A 1 7  ? 2.331   -0.424  -5.027  1.00 0.00 ? 8  PRO A N    6  
ATOM 5997  C CA   . PRO A 1 7  ? 3.235   -1.553  -4.728  1.00 0.00 ? 8  PRO A CA   6  
ATOM 5998  C C    . PRO A 1 7  ? 2.480   -2.661  -3.989  1.00 0.00 ? 8  PRO A C    6  
ATOM 5999  O O    . PRO A 1 7  ? 1.586   -2.405  -3.209  1.00 0.00 ? 8  PRO A O    6  
ATOM 6000  C CB   . PRO A 1 7  ? 4.306   -0.930  -3.824  1.00 0.00 ? 8  PRO A CB   6  
ATOM 6001  C CG   . PRO A 1 7  ? 3.662   0.334   -3.210  1.00 0.00 ? 8  PRO A CG   6  
ATOM 6002  C CD   . PRO A 1 7  ? 2.571   0.774   -4.199  1.00 0.00 ? 8  PRO A CD   6  
ATOM 6003  H HA   . PRO A 1 7  ? 3.686   -1.933  -5.629  1.00 0.00 ? 8  PRO A HA   6  
ATOM 6004  H HB2  . PRO A 1 7  ? 4.585   -1.627  -3.045  1.00 0.00 ? 8  PRO A HB2  6  
ATOM 6005  H HB3  . PRO A 1 7  ? 5.170   -0.653  -4.406  1.00 0.00 ? 8  PRO A HB3  6  
ATOM 6006  H HG2  . PRO A 1 7  ? 3.224   0.097   -2.250  1.00 0.00 ? 8  PRO A HG2  6  
ATOM 6007  H HG3  . PRO A 1 7  ? 4.395   1.118   -3.099  1.00 0.00 ? 8  PRO A HG3  6  
ATOM 6008  H HD2  . PRO A 1 7  ? 1.673   1.062   -3.673  1.00 0.00 ? 8  PRO A HD2  6  
ATOM 6009  H HD3  . PRO A 1 7  ? 2.929   1.579   -4.821  1.00 0.00 ? 8  PRO A HD3  6  
ATOM 6010  N N    . LEU A 1 8  ? 2.834   -3.891  -4.235  1.00 0.00 ? 9  LEU A N    6  
ATOM 6011  C CA   . LEU A 1 8  ? 2.141   -5.017  -3.558  1.00 0.00 ? 9  LEU A CA   6  
ATOM 6012  C C    . LEU A 1 8  ? 3.144   -6.131  -3.246  1.00 0.00 ? 9  LEU A C    6  
ATOM 6013  O O    . LEU A 1 8  ? 4.252   -6.146  -3.743  1.00 0.00 ? 9  LEU A O    6  
ATOM 6014  C CB   . LEU A 1 8  ? 1.025   -5.522  -4.466  1.00 0.00 ? 9  LEU A CB   6  
ATOM 6015  C CG   . LEU A 1 8  ? 1.591   -5.813  -5.845  1.00 0.00 ? 9  LEU A CG   6  
ATOM 6016  C CD1  . LEU A 1 8  ? 2.428   -7.073  -5.753  1.00 0.00 ? 9  LEU A CD1  6  
ATOM 6017  C CD2  . LEU A 1 8  ? 0.442   -6.026  -6.827  1.00 0.00 ? 9  LEU A CD2  6  
ATOM 6018  H H    . LEU A 1 8  ? 3.553   -4.074  -4.871  1.00 0.00 ? 9  LEU A H    6  
ATOM 6019  H HA   . LEU A 1 8  ? 1.713   -4.682  -2.641  1.00 0.00 ? 9  LEU A HA   6  
ATOM 6020  H HB2  . LEU A 1 8  ? 0.603   -6.425  -4.050  1.00 0.00 ? 9  LEU A HB2  6  
ATOM 6021  H HB3  . LEU A 1 8  ? 0.260   -4.767  -4.545  1.00 0.00 ? 9  LEU A HB3  6  
ATOM 6022  H HG   . LEU A 1 8  ? 2.207   -4.986  -6.170  1.00 0.00 ? 9  LEU A HG   6  
ATOM 6023  H HD11 . LEU A 1 8  ? 2.232   -7.540  -4.802  1.00 0.00 ? 9  LEU A HD11 6  
ATOM 6024  H HD12 . LEU A 1 8  ? 2.163   -7.747  -6.551  1.00 0.00 ? 9  LEU A HD12 6  
ATOM 6025  H HD13 . LEU A 1 8  ? 3.475   -6.818  -5.819  1.00 0.00 ? 9  LEU A HD13 6  
ATOM 6026  H HD21 . LEU A 1 8  ? -0.372  -5.362  -6.574  1.00 0.00 ? 9  LEU A HD21 6  
ATOM 6027  H HD22 . LEU A 1 8  ? 0.781   -5.814  -7.830  1.00 0.00 ? 9  LEU A HD22 6  
ATOM 6028  H HD23 . LEU A 1 8  ? 0.104   -7.050  -6.768  1.00 0.00 ? 9  LEU A HD23 6  
ATOM 6029  N N    . SER A 1 9  ? 2.759   -7.051  -2.410  1.00 0.00 ? 10 SER A N    6  
ATOM 6030  C CA   . SER A 1 9  ? 3.680   -8.167  -2.031  1.00 0.00 ? 10 SER A CA   6  
ATOM 6031  C C    . SER A 1 9  ? 4.140   -8.940  -3.274  1.00 0.00 ? 10 SER A C    6  
ATOM 6032  O O    . SER A 1 9  ? 3.420   -9.085  -4.245  1.00 0.00 ? 10 SER A O    6  
ATOM 6033  C CB   . SER A 1 9  ? 2.952   -9.122  -1.085  1.00 0.00 ? 10 SER A CB   6  
ATOM 6034  O OG   . SER A 1 9  ? 3.659   -9.192  0.147   1.00 0.00 ? 10 SER A OG   6  
ATOM 6035  H H    . SER A 1 9  ? 1.863   -6.999  -2.015  1.00 0.00 ? 10 SER A H    6  
ATOM 6036  H HA   . SER A 1 9  ? 4.542   -7.759  -1.526  1.00 0.00 ? 10 SER A HA   6  
ATOM 6037  H HB2  . SER A 1 9  ? 1.954   -8.759  -0.900  1.00 0.00 ? 10 SER A HB2  6  
ATOM 6038  H HB3  . SER A 1 9  ? 2.898   -10.104 -1.537  1.00 0.00 ? 10 SER A HB3  6  
ATOM 6039  H HG   . SER A 1 9  ? 4.351   -9.850  0.055   1.00 0.00 ? 10 SER A HG   6  
ATOM 6040  N N    . ALA A 1 10 ? 5.340   -9.454  -3.244  1.00 0.00 ? 11 ALA A N    6  
ATOM 6041  C CA   . ALA A 1 10 ? 5.853   -10.227 -4.409  1.00 0.00 ? 11 ALA A CA   6  
ATOM 6042  C C    . ALA A 1 10 ? 4.899   -11.386 -4.706  1.00 0.00 ? 11 ALA A C    6  
ATOM 6043  O O    . ALA A 1 10 ? 4.650   -11.723 -5.848  1.00 0.00 ? 11 ALA A O    6  
ATOM 6044  C CB   . ALA A 1 10 ? 7.238   -10.785 -4.076  1.00 0.00 ? 11 ALA A CB   6  
ATOM 6045  H H    . ALA A 1 10 ? 5.902   -9.334  -2.450  1.00 0.00 ? 11 ALA A H    6  
ATOM 6046  H HA   . ALA A 1 10 ? 5.921   -9.582  -5.272  1.00 0.00 ? 11 ALA A HA   6  
ATOM 6047  H HB1  . ALA A 1 10 ? 7.568   -10.388 -3.128  1.00 0.00 ? 11 ALA A HB1  6  
ATOM 6048  H HB2  . ALA A 1 10 ? 7.187   -11.863 -4.016  1.00 0.00 ? 11 ALA A HB2  6  
ATOM 6049  H HB3  . ALA A 1 10 ? 7.937   -10.500 -4.848  1.00 0.00 ? 11 ALA A HB3  6  
ATOM 6050  N N    . TYR A 1 11 ? 4.360   -11.997 -3.686  1.00 0.00 ? 12 TYR A N    6  
ATOM 6051  C CA   . TYR A 1 11 ? 3.426   -13.127 -3.899  1.00 0.00 ? 12 TYR A CA   6  
ATOM 6052  C C    . TYR A 1 11 ? 2.263   -12.663 -4.776  1.00 0.00 ? 12 TYR A C    6  
ATOM 6053  O O    . TYR A 1 11 ? 1.728   -13.418 -5.564  1.00 0.00 ? 12 TYR A O    6  
ATOM 6054  C CB   . TYR A 1 11 ? 2.904   -13.576 -2.538  1.00 0.00 ? 12 TYR A CB   6  
ATOM 6055  C CG   . TYR A 1 11 ? 1.757   -14.539 -2.719  1.00 0.00 ? 12 TYR A CG   6  
ATOM 6056  C CD1  . TYR A 1 11 ? 1.813   -15.514 -3.722  1.00 0.00 ? 12 TYR A CD1  6  
ATOM 6057  C CD2  . TYR A 1 11 ? 0.639   -14.461 -1.879  1.00 0.00 ? 12 TYR A CD2  6  
ATOM 6058  C CE1  . TYR A 1 11 ? 0.751   -16.412 -3.886  1.00 0.00 ? 12 TYR A CE1  6  
ATOM 6059  C CE2  . TYR A 1 11 ? -0.423  -15.359 -2.044  1.00 0.00 ? 12 TYR A CE2  6  
ATOM 6060  C CZ   . TYR A 1 11 ? -0.367  -16.334 -3.046  1.00 0.00 ? 12 TYR A CZ   6  
ATOM 6061  O OH   . TYR A 1 11 ? -1.413  -17.219 -3.207  1.00 0.00 ? 12 TYR A OH   6  
ATOM 6062  H H    . TYR A 1 11 ? 4.570   -11.711 -2.772  1.00 0.00 ? 12 TYR A H    6  
ATOM 6063  H HA   . TYR A 1 11 ? 3.943   -13.944 -4.377  1.00 0.00 ? 12 TYR A HA   6  
ATOM 6064  H HB2  . TYR A 1 11 ? 3.701   -14.060 -1.994  1.00 0.00 ? 12 TYR A HB2  6  
ATOM 6065  H HB3  . TYR A 1 11 ? 2.569   -12.710 -1.986  1.00 0.00 ? 12 TYR A HB3  6  
ATOM 6066  H HD1  . TYR A 1 11 ? 2.674   -15.573 -4.369  1.00 0.00 ? 12 TYR A HD1  6  
ATOM 6067  H HD2  . TYR A 1 11 ? 0.595   -13.710 -1.106  1.00 0.00 ? 12 TYR A HD2  6  
ATOM 6068  H HE1  . TYR A 1 11 ? 0.796   -17.164 -4.659  1.00 0.00 ? 12 TYR A HE1  6  
ATOM 6069  H HE2  . TYR A 1 11 ? -1.285  -15.298 -1.396  1.00 0.00 ? 12 TYR A HE2  6  
ATOM 6070  H HH   . TYR A 1 11 ? -2.222  -16.709 -3.296  1.00 0.00 ? 12 TYR A HH   6  
ATOM 6071  N N    . MET A 1 12 ? 1.868   -11.427 -4.646  1.00 0.00 ? 13 MET A N    6  
ATOM 6072  C CA   . MET A 1 12 ? 0.744   -10.916 -5.469  1.00 0.00 ? 13 MET A CA   6  
ATOM 6073  C C    . MET A 1 12 ? 1.193   -10.777 -6.926  1.00 0.00 ? 13 MET A C    6  
ATOM 6074  O O    . MET A 1 12 ? 0.501   -11.198 -7.830  1.00 0.00 ? 13 MET A O    6  
ATOM 6075  C CB   . MET A 1 12 ? 0.299   -9.556  -4.937  1.00 0.00 ? 13 MET A CB   6  
ATOM 6076  C CG   . MET A 1 12 ? 0.320   -9.565  -3.408  1.00 0.00 ? 13 MET A CG   6  
ATOM 6077  S SD   . MET A 1 12 ? -1.345  -9.234  -2.781  1.00 0.00 ? 13 MET A SD   6  
ATOM 6078  C CE   . MET A 1 12 ? -2.182  -10.594 -3.632  1.00 0.00 ? 13 MET A CE   6  
ATOM 6079  H H    . MET A 1 12 ? 2.309   -10.835 -4.006  1.00 0.00 ? 13 MET A H    6  
ATOM 6080  H HA   . MET A 1 12 ? -0.083  -11.609 -5.414  1.00 0.00 ? 13 MET A HA   6  
ATOM 6081  H HB2  . MET A 1 12 ? 0.964   -8.794  -5.304  1.00 0.00 ? 13 MET A HB2  6  
ATOM 6082  H HB3  . MET A 1 12 ? -0.701  -9.350  -5.278  1.00 0.00 ? 13 MET A HB3  6  
ATOM 6083  H HG2  . MET A 1 12 ? 0.651   -10.530 -3.056  1.00 0.00 ? 13 MET A HG2  6  
ATOM 6084  H HG3  . MET A 1 12 ? 0.996   -8.801  -3.052  1.00 0.00 ? 13 MET A HG3  6  
ATOM 6085  H HE1  . MET A 1 12 ? -1.722  -10.753 -4.597  1.00 0.00 ? 13 MET A HE1  6  
ATOM 6086  H HE2  . MET A 1 12 ? -2.097  -11.494 -3.044  1.00 0.00 ? 13 MET A HE2  6  
ATOM 6087  H HE3  . MET A 1 12 ? -3.228  -10.348 -3.762  1.00 0.00 ? 13 MET A HE3  6  
ATOM 6088  N N    . LEU A 1 13 ? 2.342   -10.195 -7.175  1.00 0.00 ? 14 LEU A N    6  
ATOM 6089  C CA   . LEU A 1 13 ? 2.784   -10.060 -8.598  1.00 0.00 ? 14 LEU A CA   6  
ATOM 6090  C C    . LEU A 1 13 ? 2.639   -11.419 -9.277  1.00 0.00 ? 14 LEU A C    6  
ATOM 6091  O O    . LEU A 1 13 ? 2.186   -11.523 -10.399 1.00 0.00 ? 14 LEU A O    6  
ATOM 6092  C CB   . LEU A 1 13 ? 4.250   -9.605  -8.698  1.00 0.00 ? 14 LEU A CB   6  
ATOM 6093  C CG   . LEU A 1 13 ? 4.491   -8.387  -7.794  1.00 0.00 ? 14 LEU A CG   6  
ATOM 6094  C CD1  . LEU A 1 13 ? 5.968   -7.979  -7.851  1.00 0.00 ? 14 LEU A CD1  6  
ATOM 6095  C CD2  . LEU A 1 13 ? 3.632   -7.220  -8.291  1.00 0.00 ? 14 LEU A CD2  6  
ATOM 6096  H H    . LEU A 1 13 ? 2.899   -9.857  -6.440  1.00 0.00 ? 14 LEU A H    6  
ATOM 6097  H HA   . LEU A 1 13 ? 2.148   -9.345  -9.102  1.00 0.00 ? 14 LEU A HA   6  
ATOM 6098  H HB2  . LEU A 1 13 ? 4.914   -10.421 -8.417  1.00 0.00 ? 14 LEU A HB2  6  
ATOM 6099  H HB3  . LEU A 1 13 ? 4.452   -9.325  -9.720  1.00 0.00 ? 14 LEU A HB3  6  
ATOM 6100  H HG   . LEU A 1 13 ? 4.222   -8.628  -6.777  1.00 0.00 ? 14 LEU A HG   6  
ATOM 6101  H HD11 . LEU A 1 13 ? 6.366   -8.201  -8.830  1.00 0.00 ? 14 LEU A HD11 6  
ATOM 6102  H HD12 . LEU A 1 13 ? 6.060   -6.915  -7.657  1.00 0.00 ? 14 LEU A HD12 6  
ATOM 6103  H HD13 . LEU A 1 13 ? 6.522   -8.529  -7.105  1.00 0.00 ? 14 LEU A HD13 6  
ATOM 6104  H HD21 . LEU A 1 13 ? 2.597   -7.527  -8.331  1.00 0.00 ? 14 LEU A HD21 6  
ATOM 6105  H HD22 . LEU A 1 13 ? 3.736   -6.384  -7.616  1.00 0.00 ? 14 LEU A HD22 6  
ATOM 6106  H HD23 . LEU A 1 13 ? 3.960   -6.929  -9.278  1.00 0.00 ? 14 LEU A HD23 6  
ATOM 6107  N N    . TRP A 1 14 ? 3.015   -12.464 -8.594  1.00 0.00 ? 15 TRP A N    6  
ATOM 6108  C CA   . TRP A 1 14 ? 2.897   -13.824 -9.184  1.00 0.00 ? 15 TRP A CA   6  
ATOM 6109  C C    . TRP A 1 14 ? 1.418   -14.149 -9.413  1.00 0.00 ? 15 TRP A C    6  
ATOM 6110  O O    . TRP A 1 14 ? 1.028   -14.603 -10.470 1.00 0.00 ? 15 TRP A O    6  
ATOM 6111  C CB   . TRP A 1 14 ? 3.509   -14.840 -8.218  1.00 0.00 ? 15 TRP A CB   6  
ATOM 6112  C CG   . TRP A 1 14 ? 3.325   -16.220 -8.756  1.00 0.00 ? 15 TRP A CG   6  
ATOM 6113  C CD1  . TRP A 1 14 ? 4.102   -16.796 -9.700  1.00 0.00 ? 15 TRP A CD1  6  
ATOM 6114  C CD2  . TRP A 1 14 ? 2.317   -17.206 -8.395  1.00 0.00 ? 15 TRP A CD2  6  
ATOM 6115  N NE1  . TRP A 1 14 ? 3.634   -18.075 -9.943  1.00 0.00 ? 15 TRP A NE1  6  
ATOM 6116  C CE2  . TRP A 1 14 ? 2.535   -18.374 -9.161  1.00 0.00 ? 15 TRP A CE2  6  
ATOM 6117  C CE3  . TRP A 1 14 ? 1.247   -17.199 -7.484  1.00 0.00 ? 15 TRP A CE3  6  
ATOM 6118  C CZ2  . TRP A 1 14 ? 1.719   -19.497 -9.029  1.00 0.00 ? 15 TRP A CZ2  6  
ATOM 6119  C CZ3  . TRP A 1 14 ? 0.422   -18.326 -7.348  1.00 0.00 ? 15 TRP A CZ3  6  
ATOM 6120  C CH2  . TRP A 1 14 ? 0.657   -19.474 -8.119  1.00 0.00 ? 15 TRP A CH2  6  
ATOM 6121  H H    . TRP A 1 14 ? 3.372   -12.354 -7.687  1.00 0.00 ? 15 TRP A H    6  
ATOM 6122  H HA   . TRP A 1 14 ? 3.423   -13.856 -10.125 1.00 0.00 ? 15 TRP A HA   6  
ATOM 6123  H HB2  . TRP A 1 14 ? 4.563   -14.636 -8.103  1.00 0.00 ? 15 TRP A HB2  6  
ATOM 6124  H HB3  . TRP A 1 14 ? 3.020   -14.760 -7.258  1.00 0.00 ? 15 TRP A HB3  6  
ATOM 6125  H HD1  . TRP A 1 14 ? 4.949   -16.334 -10.186 1.00 0.00 ? 15 TRP A HD1  6  
ATOM 6126  H HE1  . TRP A 1 14 ? 4.021   -18.706 -10.585 1.00 0.00 ? 15 TRP A HE1  6  
ATOM 6127  H HE3  . TRP A 1 14 ? 1.057   -16.320 -6.885  1.00 0.00 ? 15 TRP A HE3  6  
ATOM 6128  H HZ2  . TRP A 1 14 ? 1.905   -20.378 -9.626  1.00 0.00 ? 15 TRP A HZ2  6  
ATOM 6129  H HZ3  . TRP A 1 14 ? -0.397  -18.309 -6.646  1.00 0.00 ? 15 TRP A HZ3  6  
ATOM 6130  H HH2  . TRP A 1 14 ? 0.021   -20.340 -8.009  1.00 0.00 ? 15 TRP A HH2  6  
ATOM 6131  N N    . LEU A 1 15 ? 0.594   -13.916 -8.427  1.00 0.00 ? 16 LEU A N    6  
ATOM 6132  C CA   . LEU A 1 15 ? -0.860  -14.207 -8.579  1.00 0.00 ? 16 LEU A CA   6  
ATOM 6133  C C    . LEU A 1 15 ? -1.407  -13.508 -9.827  1.00 0.00 ? 16 LEU A C    6  
ATOM 6134  O O    . LEU A 1 15 ? -2.319  -13.991 -10.467 1.00 0.00 ? 16 LEU A O    6  
ATOM 6135  C CB   . LEU A 1 15 ? -1.607  -13.691 -7.349  1.00 0.00 ? 16 LEU A CB   6  
ATOM 6136  C CG   . LEU A 1 15 ? -1.323  -14.605 -6.157  1.00 0.00 ? 16 LEU A CG   6  
ATOM 6137  C CD1  . LEU A 1 15 ? -1.486  -13.814 -4.860  1.00 0.00 ? 16 LEU A CD1  6  
ATOM 6138  C CD2  . LEU A 1 15 ? -2.311  -15.772 -6.169  1.00 0.00 ? 16 LEU A CD2  6  
ATOM 6139  H H    . LEU A 1 15 ? 0.931   -13.550 -7.583  1.00 0.00 ? 16 LEU A H    6  
ATOM 6140  H HA   . LEU A 1 15 ? -1.007  -15.273 -8.668  1.00 0.00 ? 16 LEU A HA   6  
ATOM 6141  H HB2  . LEU A 1 15 ? -1.276  -12.689 -7.121  1.00 0.00 ? 16 LEU A HB2  6  
ATOM 6142  H HB3  . LEU A 1 15 ? -2.668  -13.683 -7.549  1.00 0.00 ? 16 LEU A HB3  6  
ATOM 6143  H HG   . LEU A 1 15 ? -0.314  -14.982 -6.225  1.00 0.00 ? 16 LEU A HG   6  
ATOM 6144  H HD11 . LEU A 1 15 ? -2.310  -13.122 -4.960  1.00 0.00 ? 16 LEU A HD11 6  
ATOM 6145  H HD12 . LEU A 1 15 ? -1.685  -14.496 -4.046  1.00 0.00 ? 16 LEU A HD12 6  
ATOM 6146  H HD13 . LEU A 1 15 ? -0.577  -13.265 -4.657  1.00 0.00 ? 16 LEU A HD13 6  
ATOM 6147  H HD21 . LEU A 1 15 ? -2.296  -16.246 -7.140  1.00 0.00 ? 16 LEU A HD21 6  
ATOM 6148  H HD22 . LEU A 1 15 ? -2.031  -16.490 -5.414  1.00 0.00 ? 16 LEU A HD22 6  
ATOM 6149  H HD23 . LEU A 1 15 ? -3.306  -15.403 -5.965  1.00 0.00 ? 16 LEU A HD23 6  
ATOM 6150  N N    . ASN A 1 16 ? -0.866  -12.372 -10.174 1.00 0.00 ? 17 ASN A N    6  
ATOM 6151  C CA   . ASN A 1 16 ? -1.365  -11.646 -11.371 1.00 0.00 ? 17 ASN A CA   6  
ATOM 6152  C C    . ASN A 1 16 ? -1.043  -12.442 -12.638 1.00 0.00 ? 17 ASN A C    6  
ATOM 6153  O O    . ASN A 1 16 ? -1.892  -12.649 -13.482 1.00 0.00 ? 17 ASN A O    6  
ATOM 6154  C CB   . ASN A 1 16 ? -0.703  -10.281 -11.436 1.00 0.00 ? 17 ASN A CB   6  
ATOM 6155  C CG   . ASN A 1 16 ? -0.673  -9.659  -10.038 1.00 0.00 ? 17 ASN A CG   6  
ATOM 6156  O OD1  . ASN A 1 16 ? -1.202  -10.220 -9.099  1.00 0.00 ? 17 ASN A OD1  6  
ATOM 6157  N ND2  . ASN A 1 16 ? -0.072  -8.514  -9.858  1.00 0.00 ? 17 ASN A ND2  6  
ATOM 6158  H H    . ASN A 1 16 ? -0.133  -11.991 -9.646  1.00 0.00 ? 17 ASN A H    6  
ATOM 6159  H HA   . ASN A 1 16 ? -2.430  -11.509 -11.297 1.00 0.00 ? 17 ASN A HA   6  
ATOM 6160  H HB2  . ASN A 1 16 ? 0.303   -10.387 -11.809 1.00 0.00 ? 17 ASN A HB2  6  
ATOM 6161  H HB3  . ASN A 1 16 ? -1.276  -9.652  -12.094 1.00 0.00 ? 17 ASN A HB3  6  
ATOM 6162  H HD21 . ASN A 1 16 ? 0.355   -8.061  -10.615 1.00 0.00 ? 17 ASN A HD21 6  
ATOM 6163  H HD22 . ASN A 1 16 ? -0.048  -8.107  -8.967  1.00 0.00 ? 17 ASN A HD22 6  
ATOM 6164  N N    . SER A 1 17 ? 0.173   -12.896 -12.778 1.00 0.00 ? 18 SER A N    6  
ATOM 6165  C CA   . SER A 1 17 ? 0.535   -13.681 -13.988 1.00 0.00 ? 18 SER A CA   6  
ATOM 6166  C C    . SER A 1 17 ? 0.059   -15.126 -13.829 1.00 0.00 ? 18 SER A C    6  
ATOM 6167  O O    . SER A 1 17 ? 0.335   -15.974 -14.654 1.00 0.00 ? 18 SER A O    6  
ATOM 6168  C CB   . SER A 1 17 ? 2.042   -13.659 -14.170 1.00 0.00 ? 18 SER A CB   6  
ATOM 6169  O OG   . SER A 1 17 ? 2.529   -12.347 -13.918 1.00 0.00 ? 18 SER A OG   6  
ATOM 6170  H H    . SER A 1 17 ? 0.846   -12.724 -12.088 1.00 0.00 ? 18 SER A H    6  
ATOM 6171  H HA   . SER A 1 17 ? 0.076   -13.246 -14.858 1.00 0.00 ? 18 SER A HA   6  
ATOM 6172  H HB2  . SER A 1 17 ? 2.501   -14.348 -13.484 1.00 0.00 ? 18 SER A HB2  6  
ATOM 6173  H HB3  . SER A 1 17 ? 2.269   -13.949 -15.183 1.00 0.00 ? 18 SER A HB3  6  
ATOM 6174  H HG   . SER A 1 17 ? 3.174   -12.135 -14.598 1.00 0.00 ? 18 SER A HG   6  
ATOM 6175  N N    . ALA A 1 18 ? -0.657  -15.414 -12.775 1.00 0.00 ? 19 ALA A N    6  
ATOM 6176  C CA   . ALA A 1 18 ? -1.151  -16.805 -12.566 1.00 0.00 ? 19 ALA A CA   6  
ATOM 6177  C C    . ALA A 1 18 ? -2.678  -16.803 -12.515 1.00 0.00 ? 19 ALA A C    6  
ATOM 6178  O O    . ALA A 1 18 ? -3.308  -17.838 -12.557 1.00 0.00 ? 19 ALA A O    6  
ATOM 6179  C CB   . ALA A 1 18 ? -0.605  -17.351 -11.246 1.00 0.00 ? 19 ALA A CB   6  
ATOM 6180  H H    . ALA A 1 18 ? -0.871  -14.716 -12.121 1.00 0.00 ? 19 ALA A H    6  
ATOM 6181  H HA   . ALA A 1 18 ? -0.819  -17.432 -13.380 1.00 0.00 ? 19 ALA A HA   6  
ATOM 6182  H HB1  . ALA A 1 18 ? 0.456   -17.157 -11.185 1.00 0.00 ? 19 ALA A HB1  6  
ATOM 6183  H HB2  . ALA A 1 18 ? -1.108  -16.867 -10.421 1.00 0.00 ? 19 ALA A HB2  6  
ATOM 6184  H HB3  . ALA A 1 18 ? -0.780  -18.416 -11.198 1.00 0.00 ? 19 ALA A HB3  6  
ATOM 6185  N N    . ARG A 1 19 ? -3.277  -15.648 -12.413 1.00 0.00 ? 20 ARG A N    6  
ATOM 6186  C CA   . ARG A 1 19 ? -4.765  -15.582 -12.347 1.00 0.00 ? 20 ARG A CA   6  
ATOM 6187  C C    . ARG A 1 19 ? -5.373  -16.172 -13.620 1.00 0.00 ? 20 ARG A C    6  
ATOM 6188  O O    . ARG A 1 19 ? -6.550  -16.470 -13.673 1.00 0.00 ? 20 ARG A O    6  
ATOM 6189  C CB   . ARG A 1 19 ? -5.207  -14.125 -12.196 1.00 0.00 ? 20 ARG A CB   6  
ATOM 6190  C CG   . ARG A 1 19 ? -6.011  -13.968 -10.905 1.00 0.00 ? 20 ARG A CG   6  
ATOM 6191  C CD   . ARG A 1 19 ? -5.603  -12.670 -10.208 1.00 0.00 ? 20 ARG A CD   6  
ATOM 6192  N NE   . ARG A 1 19 ? -6.639  -12.300 -9.204  1.00 0.00 ? 20 ARG A NE   6  
ATOM 6193  C CZ   . ARG A 1 19 ? -6.536  -11.177 -8.547  1.00 0.00 ? 20 ARG A CZ   6  
ATOM 6194  N NH1  . ARG A 1 19 ? -6.575  -10.041 -9.188  1.00 0.00 ? 20 ARG A NH1  6  
ATOM 6195  N NH2  . ARG A 1 19 ? -6.393  -11.191 -7.250  1.00 0.00 ? 20 ARG A NH2  6  
ATOM 6196  H H    . ARG A 1 19 ? -2.749  -14.824 -12.373 1.00 0.00 ? 20 ARG A H    6  
ATOM 6197  H HA   . ARG A 1 19 ? -5.109  -16.151 -11.496 1.00 0.00 ? 20 ARG A HA   6  
ATOM 6198  H HB2  . ARG A 1 19 ? -4.335  -13.488 -12.160 1.00 0.00 ? 20 ARG A HB2  6  
ATOM 6199  H HB3  . ARG A 1 19 ? -5.823  -13.846 -13.038 1.00 0.00 ? 20 ARG A HB3  6  
ATOM 6200  H HG2  . ARG A 1 19 ? -7.065  -13.940 -11.137 1.00 0.00 ? 20 ARG A HG2  6  
ATOM 6201  H HG3  . ARG A 1 19 ? -5.808  -14.804 -10.251 1.00 0.00 ? 20 ARG A HG3  6  
ATOM 6202  H HD2  . ARG A 1 19 ? -4.655  -12.812 -9.711  1.00 0.00 ? 20 ARG A HD2  6  
ATOM 6203  H HD3  . ARG A 1 19 ? -5.513  -11.883 -10.940 1.00 0.00 ? 20 ARG A HD3  6  
ATOM 6204  H HE   . ARG A 1 19 ? -7.398  -12.898 -9.037  1.00 0.00 ? 20 ARG A HE   6  
ATOM 6205  H HH11 . ARG A 1 19 ? -6.684  -10.031 -10.182 1.00 0.00 ? 20 ARG A HH11 6  
ATOM 6206  H HH12 . ARG A 1 19 ? -6.495  -9.180  -8.686  1.00 0.00 ? 20 ARG A HH12 6  
ATOM 6207  H HH21 . ARG A 1 19 ? -6.362  -12.061 -6.760  1.00 0.00 ? 20 ARG A HH21 6  
ATOM 6208  H HH22 . ARG A 1 19 ? -6.313  -10.330 -6.747  1.00 0.00 ? 20 ARG A HH22 6  
ATOM 6209  N N    . GLU A 1 20 ? -4.589  -16.350 -14.645 1.00 0.00 ? 21 GLU A N    6  
ATOM 6210  C CA   . GLU A 1 20 ? -5.138  -16.928 -15.901 1.00 0.00 ? 21 GLU A CA   6  
ATOM 6211  C C    . GLU A 1 20 ? -5.190  -18.445 -15.763 1.00 0.00 ? 21 GLU A C    6  
ATOM 6212  O O    . GLU A 1 20 ? -6.247  -19.046 -15.763 1.00 0.00 ? 21 GLU A O    6  
ATOM 6213  C CB   . GLU A 1 20 ? -4.241  -16.548 -17.080 1.00 0.00 ? 21 GLU A CB   6  
ATOM 6214  C CG   . GLU A 1 20 ? -4.305  -15.037 -17.305 1.00 0.00 ? 21 GLU A CG   6  
ATOM 6215  C CD   . GLU A 1 20 ? -2.908  -14.511 -17.637 1.00 0.00 ? 21 GLU A CD   6  
ATOM 6216  O OE1  . GLU A 1 20 ? -2.449  -14.763 -18.740 1.00 0.00 ? 21 GLU A OE1  6  
ATOM 6217  O OE2  . GLU A 1 20 ? -2.320  -13.869 -16.783 1.00 0.00 ? 21 GLU A OE2  6  
ATOM 6218  H H    . GLU A 1 20 ? -3.642  -16.108 -14.589 1.00 0.00 ? 21 GLU A H    6  
ATOM 6219  H HA   . GLU A 1 20 ? -6.132  -16.551 -16.062 1.00 0.00 ? 21 GLU A HA   6  
ATOM 6220  H HB2  . GLU A 1 20 ? -3.222  -16.839 -16.865 1.00 0.00 ? 21 GLU A HB2  6  
ATOM 6221  H HB3  . GLU A 1 20 ? -4.581  -17.057 -17.970 1.00 0.00 ? 21 GLU A HB3  6  
ATOM 6222  H HG2  . GLU A 1 20 ? -4.976  -14.823 -18.125 1.00 0.00 ? 21 GLU A HG2  6  
ATOM 6223  H HG3  . GLU A 1 20 ? -4.665  -14.554 -16.409 1.00 0.00 ? 21 GLU A HG3  6  
ATOM 6224  N N    . SER A 1 21 ? -4.056  -19.069 -15.633 1.00 0.00 ? 22 SER A N    6  
ATOM 6225  C CA   . SER A 1 21 ? -4.036  -20.548 -15.478 1.00 0.00 ? 22 SER A CA   6  
ATOM 6226  C C    . SER A 1 21 ? -4.685  -20.917 -14.144 1.00 0.00 ? 22 SER A C    6  
ATOM 6227  O O    . SER A 1 21 ? -4.961  -22.069 -13.872 1.00 0.00 ? 22 SER A O    6  
ATOM 6228  C CB   . SER A 1 21 ? -2.590  -21.046 -15.503 1.00 0.00 ? 22 SER A CB   6  
ATOM 6229  O OG   . SER A 1 21 ? -2.054  -20.866 -16.807 1.00 0.00 ? 22 SER A OG   6  
ATOM 6230  H H    . SER A 1 21 ? -3.220  -18.562 -15.627 1.00 0.00 ? 22 SER A H    6  
ATOM 6231  H HA   . SER A 1 21 ? -4.591  -21.003 -16.286 1.00 0.00 ? 22 SER A HA   6  
ATOM 6232  H HB2  . SER A 1 21 ? -2.002  -20.486 -14.796 1.00 0.00 ? 22 SER A HB2  6  
ATOM 6233  H HB3  . SER A 1 21 ? -2.568  -22.094 -15.235 1.00 0.00 ? 22 SER A HB3  6  
ATOM 6234  H HG   . SER A 1 21 ? -2.310  -21.622 -17.341 1.00 0.00 ? 22 SER A HG   6  
ATOM 6235  N N    . ILE A 1 22 ? -4.939  -19.943 -13.310 1.00 0.00 ? 23 ILE A N    6  
ATOM 6236  C CA   . ILE A 1 22 ? -5.578  -20.229 -11.998 1.00 0.00 ? 23 ILE A CA   6  
ATOM 6237  C C    . ILE A 1 22 ? -7.094  -20.171 -12.169 1.00 0.00 ? 23 ILE A C    6  
ATOM 6238  O O    . ILE A 1 22 ? -7.818  -21.029 -11.706 1.00 0.00 ? 23 ILE A O    6  
ATOM 6239  C CB   . ILE A 1 22 ? -5.134  -19.173 -10.974 1.00 0.00 ? 23 ILE A CB   6  
ATOM 6240  C CG1  . ILE A 1 22 ? -3.783  -19.578 -10.380 1.00 0.00 ? 23 ILE A CG1  6  
ATOM 6241  C CG2  . ILE A 1 22 ? -6.165  -19.060 -9.845  1.00 0.00 ? 23 ILE A CG2  6  
ATOM 6242  C CD1  . ILE A 1 22 ? -3.267  -18.458 -9.474  1.00 0.00 ? 23 ILE A CD1  6  
ATOM 6243  H H    . ILE A 1 22 ? -4.714  -19.019 -13.549 1.00 0.00 ? 23 ILE A H    6  
ATOM 6244  H HA   . ILE A 1 22 ? -5.288  -21.212 -11.658 1.00 0.00 ? 23 ILE A HA   6  
ATOM 6245  H HB   . ILE A 1 22 ? -5.039  -18.217 -11.465 1.00 0.00 ? 23 ILE A HB   6  
ATOM 6246  H HG12 . ILE A 1 22 ? -3.900  -20.484 -9.803  1.00 0.00 ? 23 ILE A HG12 6  
ATOM 6247  H HG13 . ILE A 1 22 ? -3.075  -19.748 -11.177 1.00 0.00 ? 23 ILE A HG13 6  
ATOM 6248  H HG21 . ILE A 1 22 ? -7.142  -18.848 -10.266 1.00 0.00 ? 23 ILE A HG21 6  
ATOM 6249  H HG22 . ILE A 1 22 ? -6.202  -19.989 -9.297  1.00 0.00 ? 23 ILE A HG22 6  
ATOM 6250  H HG23 . ILE A 1 22 ? -5.879  -18.259 -9.179  1.00 0.00 ? 23 ILE A HG23 6  
ATOM 6251  H HD11 . ILE A 1 22 ? -3.723  -17.522 -9.763  1.00 0.00 ? 23 ILE A HD11 6  
ATOM 6252  H HD12 . ILE A 1 22 ? -3.521  -18.679 -8.448  1.00 0.00 ? 23 ILE A HD12 6  
ATOM 6253  H HD13 . ILE A 1 22 ? -2.195  -18.381 -9.571  1.00 0.00 ? 23 ILE A HD13 6  
ATOM 6254  N N    . LYS A 1 23 ? -7.580  -19.150 -12.817 1.00 0.00 ? 24 LYS A N    6  
ATOM 6255  C CA   . LYS A 1 23 ? -9.040  -19.018 -13.000 1.00 0.00 ? 24 LYS A CA   6  
ATOM 6256  C C    . LYS A 1 23 ? -9.528  -20.029 -14.042 1.00 0.00 ? 24 LYS A C    6  
ATOM 6257  O O    . LYS A 1 23 ? -10.699 -20.344 -14.113 1.00 0.00 ? 24 LYS A O    6  
ATOM 6258  C CB   . LYS A 1 23 ? -9.331  -17.603 -13.482 1.00 0.00 ? 24 LYS A CB   6  
ATOM 6259  C CG   . LYS A 1 23 ? -9.349  -16.652 -12.285 1.00 0.00 ? 24 LYS A CG   6  
ATOM 6260  C CD   . LYS A 1 23 ? -10.635 -16.860 -11.483 1.00 0.00 ? 24 LYS A CD   6  
ATOM 6261  C CE   . LYS A 1 23 ? -11.272 -15.502 -11.186 1.00 0.00 ? 24 LYS A CE   6  
ATOM 6262  N NZ   . LYS A 1 23 ? -11.667 -14.847 -12.465 1.00 0.00 ? 24 LYS A NZ   6  
ATOM 6263  H H    . LYS A 1 23 ? -6.984  -18.457 -13.174 1.00 0.00 ? 24 LYS A H    6  
ATOM 6264  H HA   . LYS A 1 23 ? -9.535  -19.189 -12.055 1.00 0.00 ? 24 LYS A HA   6  
ATOM 6265  H HB2  . LYS A 1 23 ? -8.550  -17.301 -14.167 1.00 0.00 ? 24 LYS A HB2  6  
ATOM 6266  H HB3  . LYS A 1 23 ? -10.287 -17.575 -13.981 1.00 0.00 ? 24 LYS A HB3  6  
ATOM 6267  H HG2  . LYS A 1 23 ? -8.493  -16.854 -11.656 1.00 0.00 ? 24 LYS A HG2  6  
ATOM 6268  H HG3  . LYS A 1 23 ? -9.305  -15.632 -12.635 1.00 0.00 ? 24 LYS A HG3  6  
ATOM 6269  H HD2  . LYS A 1 23 ? -11.322 -17.464 -12.056 1.00 0.00 ? 24 LYS A HD2  6  
ATOM 6270  H HD3  . LYS A 1 23 ? -10.403 -17.358 -10.554 1.00 0.00 ? 24 LYS A HD3  6  
ATOM 6271  H HE2  . LYS A 1 23 ? -12.147 -15.643 -10.568 1.00 0.00 ? 24 LYS A HE2  6  
ATOM 6272  H HE3  . LYS A 1 23 ? -10.561 -14.877 -10.666 1.00 0.00 ? 24 LYS A HE3  6  
ATOM 6273  H HZ1  . LYS A 1 23 ? -11.886 -15.574 -13.174 1.00 0.00 ? 24 LYS A HZ1  6  
ATOM 6274  H HZ2  . LYS A 1 23 ? -12.507 -14.253 -12.305 1.00 0.00 ? 24 LYS A HZ2  6  
ATOM 6275  H HZ3  . LYS A 1 23 ? -10.883 -14.256 -12.808 1.00 0.00 ? 24 LYS A HZ3  6  
ATOM 6276  N N    . ARG A 1 24 ? -8.641  -20.535 -14.857 1.00 0.00 ? 25 ARG A N    6  
ATOM 6277  C CA   . ARG A 1 24 ? -9.059  -21.516 -15.897 1.00 0.00 ? 25 ARG A CA   6  
ATOM 6278  C C    . ARG A 1 24 ? -8.850  -22.942 -15.381 1.00 0.00 ? 25 ARG A C    6  
ATOM 6279  O O    . ARG A 1 24 ? -9.791  -23.686 -15.188 1.00 0.00 ? 25 ARG A O    6  
ATOM 6280  C CB   . ARG A 1 24 ? -8.223  -21.305 -17.162 1.00 0.00 ? 25 ARG A CB   6  
ATOM 6281  C CG   . ARG A 1 24 ? -8.910  -20.275 -18.064 1.00 0.00 ? 25 ARG A CG   6  
ATOM 6282  C CD   . ARG A 1 24 ? -8.181  -20.175 -19.401 1.00 0.00 ? 25 ARG A CD   6  
ATOM 6283  N NE   . ARG A 1 24 ? -7.454  -21.445 -19.684 1.00 0.00 ? 25 ARG A NE   6  
ATOM 6284  C CZ   . ARG A 1 24 ? -7.814  -22.192 -20.692 1.00 0.00 ? 25 ARG A CZ   6  
ATOM 6285  N NH1  . ARG A 1 24 ? -8.252  -21.640 -21.790 1.00 0.00 ? 25 ARG A NH1  6  
ATOM 6286  N NH2  . ARG A 1 24 ? -7.735  -23.492 -20.601 1.00 0.00 ? 25 ARG A NH2  6  
ATOM 6287  H H    . ARG A 1 24 ? -7.702  -20.265 -14.791 1.00 0.00 ? 25 ARG A H    6  
ATOM 6288  H HA   . ARG A 1 24 ? -10.101 -21.366 -16.126 1.00 0.00 ? 25 ARG A HA   6  
ATOM 6289  H HB2  . ARG A 1 24 ? -7.241  -20.946 -16.888 1.00 0.00 ? 25 ARG A HB2  6  
ATOM 6290  H HB3  . ARG A 1 24 ? -8.131  -22.240 -17.693 1.00 0.00 ? 25 ARG A HB3  6  
ATOM 6291  H HG2  . ARG A 1 24 ? -9.932  -20.572 -18.239 1.00 0.00 ? 25 ARG A HG2  6  
ATOM 6292  H HG3  . ARG A 1 24 ? -8.895  -19.309 -17.582 1.00 0.00 ? 25 ARG A HG3  6  
ATOM 6293  H HD2  . ARG A 1 24 ? -8.902  -19.993 -20.183 1.00 0.00 ? 25 ARG A HD2  6  
ATOM 6294  H HD3  . ARG A 1 24 ? -7.479  -19.357 -19.362 1.00 0.00 ? 25 ARG A HD3  6  
ATOM 6295  H HE   . ARG A 1 24 ? -6.704  -21.718 -19.115 1.00 0.00 ? 25 ARG A HE   6  
ATOM 6296  H HH11 . ARG A 1 24 ? -8.312  -20.644 -21.861 1.00 0.00 ? 25 ARG A HH11 6  
ATOM 6297  H HH12 . ARG A 1 24 ? -8.528  -22.213 -22.562 1.00 0.00 ? 25 ARG A HH12 6  
ATOM 6298  H HH21 . ARG A 1 24 ? -7.400  -23.915 -19.759 1.00 0.00 ? 25 ARG A HH21 6  
ATOM 6299  H HH22 . ARG A 1 24 ? -8.011  -24.064 -21.373 1.00 0.00 ? 25 ARG A HH22 6  
ATOM 6300  N N    . GLU A 1 25 ? -7.624  -23.331 -15.165 1.00 0.00 ? 26 GLU A N    6  
ATOM 6301  C CA   . GLU A 1 25 ? -7.355  -24.712 -14.669 1.00 0.00 ? 26 GLU A CA   6  
ATOM 6302  C C    . GLU A 1 25 ? -8.292  -25.039 -13.503 1.00 0.00 ? 26 GLU A C    6  
ATOM 6303  O O    . GLU A 1 25 ? -8.633  -26.181 -13.273 1.00 0.00 ? 26 GLU A O    6  
ATOM 6304  C CB   . GLU A 1 25 ? -5.902  -24.810 -14.197 1.00 0.00 ? 26 GLU A CB   6  
ATOM 6305  C CG   . GLU A 1 25 ? -4.963  -24.506 -15.367 1.00 0.00 ? 26 GLU A CG   6  
ATOM 6306  C CD   . GLU A 1 25 ? -3.531  -24.878 -14.982 1.00 0.00 ? 26 GLU A CD   6  
ATOM 6307  O OE1  . GLU A 1 25 ? -3.292  -25.094 -13.804 1.00 0.00 ? 26 GLU A OE1  6  
ATOM 6308  O OE2  . GLU A 1 25 ? -2.697  -24.940 -15.869 1.00 0.00 ? 26 GLU A OE2  6  
ATOM 6309  H H    . GLU A 1 25 ? -6.878  -22.718 -15.331 1.00 0.00 ? 26 GLU A H    6  
ATOM 6310  H HA   . GLU A 1 25 ? -7.519  -25.419 -15.469 1.00 0.00 ? 26 GLU A HA   6  
ATOM 6311  H HB2  . GLU A 1 25 ? -5.732  -24.095 -13.404 1.00 0.00 ? 26 GLU A HB2  6  
ATOM 6312  H HB3  . GLU A 1 25 ? -5.708  -25.807 -13.831 1.00 0.00 ? 26 GLU A HB3  6  
ATOM 6313  H HG2  . GLU A 1 25 ? -5.267  -25.081 -16.230 1.00 0.00 ? 26 GLU A HG2  6  
ATOM 6314  H HG3  . GLU A 1 25 ? -5.010  -23.453 -15.602 1.00 0.00 ? 26 GLU A HG3  6  
ATOM 6315  N N    . ASN A 1 26 ? -8.708  -24.048 -12.764 1.00 0.00 ? 27 ASN A N    6  
ATOM 6316  C CA   . ASN A 1 26 ? -9.618  -24.311 -11.612 1.00 0.00 ? 27 ASN A CA   6  
ATOM 6317  C C    . ASN A 1 26 ? -11.073 -24.321 -12.092 1.00 0.00 ? 27 ASN A C    6  
ATOM 6318  O O    . ASN A 1 26 ? -11.433 -23.597 -13.000 1.00 0.00 ? 27 ASN A O    6  
ATOM 6319  C CB   . ASN A 1 26 ? -9.439  -23.220 -10.554 1.00 0.00 ? 27 ASN A CB   6  
ATOM 6320  C CG   . ASN A 1 26 ? -7.981  -23.181 -10.095 1.00 0.00 ? 27 ASN A CG   6  
ATOM 6321  O OD1  . ASN A 1 26 ? -7.253  -24.139 -10.265 1.00 0.00 ? 27 ASN A OD1  6  
ATOM 6322  N ND2  . ASN A 1 26 ? -7.522  -22.106 -9.516  1.00 0.00 ? 27 ASN A ND2  6  
ATOM 6323  H H    . ASN A 1 26 ? -8.421  -23.131 -12.961 1.00 0.00 ? 27 ASN A H    6  
ATOM 6324  H HA   . ASN A 1 26 ? -9.380  -25.272 -11.181 1.00 0.00 ? 27 ASN A HA   6  
ATOM 6325  H HB2  . ASN A 1 26 ? -9.711  -22.262 -10.975 1.00 0.00 ? 27 ASN A HB2  6  
ATOM 6326  H HB3  . ASN A 1 26 ? -10.074 -23.433 -9.707  1.00 0.00 ? 27 ASN A HB3  6  
ATOM 6327  H HD21 . ASN A 1 26 ? -8.111  -21.334 -9.379  1.00 0.00 ? 27 ASN A HD21 6  
ATOM 6328  H HD22 . ASN A 1 26 ? -6.589  -22.071 -9.216  1.00 0.00 ? 27 ASN A HD22 6  
ATOM 6329  N N    . PRO A 1 27 ? -11.865 -25.145 -11.456 1.00 0.00 ? 28 PRO A N    6  
ATOM 6330  C CA   . PRO A 1 27 ? -13.292 -25.286 -11.777 1.00 0.00 ? 28 PRO A CA   6  
ATOM 6331  C C    . PRO A 1 27 ? -14.093 -24.124 -11.193 1.00 0.00 ? 28 PRO A C    6  
ATOM 6332  O O    . PRO A 1 27 ? -14.810 -24.288 -10.225 1.00 0.00 ? 28 PRO A O    6  
ATOM 6333  C CB   . PRO A 1 27 ? -13.688 -26.594 -11.114 1.00 0.00 ? 28 PRO A CB   6  
ATOM 6334  C CG   . PRO A 1 27 ? -12.652 -26.851 -10.013 1.00 0.00 ? 28 PRO A CG   6  
ATOM 6335  C CD   . PRO A 1 27 ? -11.411 -26.016 -10.358 1.00 0.00 ? 28 PRO A CD   6  
ATOM 6336  H HA   . PRO A 1 27 ? -13.433 -25.367 -12.824 1.00 0.00 ? 28 PRO A HA   6  
ATOM 6337  H HB2  . PRO A 1 27 ? -14.674 -26.501 -10.678 1.00 0.00 ? 28 PRO A HB2  6  
ATOM 6338  H HB3  . PRO A 1 27 ? -13.665 -27.397 -11.830 1.00 0.00 ? 28 PRO A HB3  6  
ATOM 6339  H HG2  . PRO A 1 27 ? -13.053 -26.546 -9.065  1.00 0.00 ? 28 PRO A HG2  6  
ATOM 6340  H HG3  . PRO A 1 27 ? -12.396 -27.891 -9.999  1.00 0.00 ? 28 PRO A HG3  6  
ATOM 6341  H HD2  . PRO A 1 27 ? -11.103 -25.427 -9.506  1.00 0.00 ? 28 PRO A HD2  6  
ATOM 6342  H HD3  . PRO A 1 27 ? -10.608 -26.651 -10.694 1.00 0.00 ? 28 PRO A HD3  6  
ATOM 6343  N N    . GLY A 1 28 ? -13.971 -22.950 -11.754 1.00 0.00 ? 29 GLY A N    6  
ATOM 6344  C CA   . GLY A 1 28 ? -14.723 -21.790 -11.198 1.00 0.00 ? 29 GLY A CA   6  
ATOM 6345  C C    . GLY A 1 28 ? -14.569 -21.813 -9.679  1.00 0.00 ? 29 GLY A C    6  
ATOM 6346  O O    . GLY A 1 28 ? -15.426 -21.360 -8.946  1.00 0.00 ? 29 GLY A O    6  
ATOM 6347  H H    . GLY A 1 28 ? -13.380 -22.830 -12.528 1.00 0.00 ? 29 GLY A H    6  
ATOM 6348  H HA2  . GLY A 1 28 ? -14.319 -20.869 -11.595 1.00 0.00 ? 29 GLY A HA2  6  
ATOM 6349  H HA3  . GLY A 1 28 ? -15.767 -21.874 -11.455 1.00 0.00 ? 29 GLY A HA3  6  
ATOM 6350  N N    . ILE A 1 29 ? -13.478 -22.360 -9.213  1.00 0.00 ? 30 ILE A N    6  
ATOM 6351  C CA   . ILE A 1 29 ? -13.230 -22.453 -7.753  1.00 0.00 ? 30 ILE A CA   6  
ATOM 6352  C C    . ILE A 1 29 ? -13.735 -21.195 -7.042  1.00 0.00 ? 30 ILE A C    6  
ATOM 6353  O O    . ILE A 1 29 ? -13.808 -20.128 -7.619  1.00 0.00 ? 30 ILE A O    6  
ATOM 6354  C CB   . ILE A 1 29 ? -11.736 -22.611 -7.535  1.00 0.00 ? 30 ILE A CB   6  
ATOM 6355  C CG1  . ILE A 1 29 ? -11.439 -22.770 -6.043  1.00 0.00 ? 30 ILE A CG1  6  
ATOM 6356  C CG2  . ILE A 1 29 ? -11.047 -21.373 -8.067  1.00 0.00 ? 30 ILE A CG2  6  
ATOM 6357  C CD1  . ILE A 1 29 ? -9.936  -22.978 -5.845  1.00 0.00 ? 30 ILE A CD1  6  
ATOM 6358  H H    . ILE A 1 29 ? -12.813 -22.725 -9.834  1.00 0.00 ? 30 ILE A H    6  
ATOM 6359  H HA   . ILE A 1 29 ? -13.731 -23.310 -7.366  1.00 0.00 ? 30 ILE A HA   6  
ATOM 6360  H HB   . ILE A 1 29 ? -11.387 -23.478 -8.077  1.00 0.00 ? 30 ILE A HB   6  
ATOM 6361  H HG12 . ILE A 1 29 ? -11.755 -21.882 -5.516  1.00 0.00 ? 30 ILE A HG12 6  
ATOM 6362  H HG13 . ILE A 1 29 ? -11.972 -23.627 -5.659  1.00 0.00 ? 30 ILE A HG13 6  
ATOM 6363  H HG21 . ILE A 1 29 ? -11.721 -20.538 -7.983  1.00 0.00 ? 30 ILE A HG21 6  
ATOM 6364  H HG22 . ILE A 1 29 ? -10.154 -21.181 -7.494  1.00 0.00 ? 30 ILE A HG22 6  
ATOM 6365  H HG23 . ILE A 1 29 ? -10.792 -21.527 -9.102  1.00 0.00 ? 30 ILE A HG23 6  
ATOM 6366  H HD11 . ILE A 1 29 ? -9.550  -23.592 -6.645  1.00 0.00 ? 30 ILE A HD11 6  
ATOM 6367  H HD12 . ILE A 1 29 ? -9.437  -22.020 -5.854  1.00 0.00 ? 30 ILE A HD12 6  
ATOM 6368  H HD13 . ILE A 1 29 ? -9.762  -23.467 -4.899  1.00 0.00 ? 30 ILE A HD13 6  
ATOM 6369  N N    . LYS A 1 30 ? -14.082 -21.315 -5.790  1.00 0.00 ? 31 LYS A N    6  
ATOM 6370  C CA   . LYS A 1 30 ? -14.583 -20.130 -5.033  1.00 0.00 ? 31 LYS A CA   6  
ATOM 6371  C C    . LYS A 1 30 ? -13.436 -19.141 -4.814  1.00 0.00 ? 31 LYS A C    6  
ATOM 6372  O O    . LYS A 1 30 ? -12.277 -19.506 -4.834  1.00 0.00 ? 31 LYS A O    6  
ATOM 6373  C CB   . LYS A 1 30 ? -15.130 -20.586 -3.679  1.00 0.00 ? 31 LYS A CB   6  
ATOM 6374  C CG   . LYS A 1 30 ? -16.655 -20.463 -3.674  1.00 0.00 ? 31 LYS A CG   6  
ATOM 6375  C CD   . LYS A 1 30 ? -17.241 -21.356 -4.770  1.00 0.00 ? 31 LYS A CD   6  
ATOM 6376  C CE   . LYS A 1 30 ? -17.603 -22.719 -4.177  1.00 0.00 ? 31 LYS A CE   6  
ATOM 6377  N NZ   . LYS A 1 30 ? -17.367 -23.782 -5.196  1.00 0.00 ? 31 LYS A NZ   6  
ATOM 6378  H H    . LYS A 1 30 ? -14.014 -22.186 -5.346  1.00 0.00 ? 31 LYS A H    6  
ATOM 6379  H HA   . LYS A 1 30 ? -15.369 -19.650 -5.596  1.00 0.00 ? 31 LYS A HA   6  
ATOM 6380  H HB2  . LYS A 1 30 ? -14.850 -21.614 -3.507  1.00 0.00 ? 31 LYS A HB2  6  
ATOM 6381  H HB3  . LYS A 1 30 ? -14.717 -19.965 -2.897  1.00 0.00 ? 31 LYS A HB3  6  
ATOM 6382  H HG2  . LYS A 1 30 ? -17.037 -20.771 -2.712  1.00 0.00 ? 31 LYS A HG2  6  
ATOM 6383  H HG3  . LYS A 1 30 ? -16.934 -19.437 -3.862  1.00 0.00 ? 31 LYS A HG3  6  
ATOM 6384  H HD2  . LYS A 1 30 ? -18.128 -20.891 -5.175  1.00 0.00 ? 31 LYS A HD2  6  
ATOM 6385  H HD3  . LYS A 1 30 ? -16.513 -21.489 -5.555  1.00 0.00 ? 31 LYS A HD3  6  
ATOM 6386  H HE2  . LYS A 1 30 ? -16.989 -22.910 -3.309  1.00 0.00 ? 31 LYS A HE2  6  
ATOM 6387  H HE3  . LYS A 1 30 ? -18.644 -22.721 -3.889  1.00 0.00 ? 31 LYS A HE3  6  
ATOM 6388  H HZ1  . LYS A 1 30 ? -16.455 -23.615 -5.666  1.00 0.00 ? 31 LYS A HZ1  6  
ATOM 6389  H HZ2  . LYS A 1 30 ? -17.353 -24.712 -4.728  1.00 0.00 ? 31 LYS A HZ2  6  
ATOM 6390  H HZ3  . LYS A 1 30 ? -18.129 -23.760 -5.903  1.00 0.00 ? 31 LYS A HZ3  6  
ATOM 6391  N N    . VAL A 1 31 ? -13.751 -17.894 -4.600  1.00 0.00 ? 32 VAL A N    6  
ATOM 6392  C CA   . VAL A 1 31 ? -12.690 -16.887 -4.377  1.00 0.00 ? 32 VAL A CA   6  
ATOM 6393  C C    . VAL A 1 31 ? -12.055 -17.126 -3.003  1.00 0.00 ? 32 VAL A C    6  
ATOM 6394  O O    . VAL A 1 31 ? -10.945 -16.706 -2.739  1.00 0.00 ? 32 VAL A O    6  
ATOM 6395  C CB   . VAL A 1 31 ? -13.300 -15.485 -4.459  1.00 0.00 ? 32 VAL A CB   6  
ATOM 6396  C CG1  . VAL A 1 31 ? -14.705 -15.515 -3.891  1.00 0.00 ? 32 VAL A CG1  6  
ATOM 6397  C CG2  . VAL A 1 31 ? -12.465 -14.510 -3.650  1.00 0.00 ? 32 VAL A CG2  6  
ATOM 6398  H H    . VAL A 1 31 ? -14.682 -17.618 -4.583  1.00 0.00 ? 32 VAL A H    6  
ATOM 6399  H HA   . VAL A 1 31 ? -11.950 -16.988 -5.137  1.00 0.00 ? 32 VAL A HA   6  
ATOM 6400  H HB   . VAL A 1 31 ? -13.335 -15.168 -5.490  1.00 0.00 ? 32 VAL A HB   6  
ATOM 6401  H HG11 . VAL A 1 31 ? -14.787 -16.353 -3.219  1.00 0.00 ? 32 VAL A HG11 6  
ATOM 6402  H HG12 . VAL A 1 31 ? -14.902 -14.598 -3.360  1.00 0.00 ? 32 VAL A HG12 6  
ATOM 6403  H HG13 . VAL A 1 31 ? -15.410 -15.631 -4.698  1.00 0.00 ? 32 VAL A HG13 6  
ATOM 6404  H HG21 . VAL A 1 31 ? -11.425 -14.640 -3.896  1.00 0.00 ? 32 VAL A HG21 6  
ATOM 6405  H HG22 . VAL A 1 31 ? -12.773 -13.501 -3.874  1.00 0.00 ? 32 VAL A HG22 6  
ATOM 6406  H HG23 . VAL A 1 31 ? -12.617 -14.712 -2.602  1.00 0.00 ? 32 VAL A HG23 6  
ATOM 6407  N N    . THR A 1 32 ? -12.748 -17.800 -2.127  1.00 0.00 ? 33 THR A N    6  
ATOM 6408  C CA   . THR A 1 32 ? -12.183 -18.067 -0.776  1.00 0.00 ? 33 THR A CA   6  
ATOM 6409  C C    . THR A 1 32 ? -11.176 -19.215 -0.864  1.00 0.00 ? 33 THR A C    6  
ATOM 6410  O O    . THR A 1 32 ? -10.455 -19.493 0.073   1.00 0.00 ? 33 THR A O    6  
ATOM 6411  C CB   . THR A 1 32 ? -13.311 -18.450 0.186   1.00 0.00 ? 33 THR A CB   6  
ATOM 6412  O OG1  . THR A 1 32 ? -14.483 -17.720 -0.148  1.00 0.00 ? 33 THR A OG1  6  
ATOM 6413  C CG2  . THR A 1 32 ? -12.894 -18.124 1.620   1.00 0.00 ? 33 THR A CG2  6  
ATOM 6414  H H    . THR A 1 32 ? -13.641 -18.131 -2.360  1.00 0.00 ? 33 THR A H    6  
ATOM 6415  H HA   . THR A 1 32 ? -11.686 -17.180 -0.412  1.00 0.00 ? 33 THR A HA   6  
ATOM 6416  H HB   . THR A 1 32 ? -13.509 -19.508 0.105   1.00 0.00 ? 33 THR A HB   6  
ATOM 6417  H HG1  . THR A 1 32 ? -14.214 -16.915 -0.596  1.00 0.00 ? 33 THR A HG1  6  
ATOM 6418  H HG21 . THR A 1 32 ? -11.843 -17.874 1.640   1.00 0.00 ? 33 THR A HG21 6  
ATOM 6419  H HG22 . THR A 1 32 ? -13.470 -17.286 1.982   1.00 0.00 ? 33 THR A HG22 6  
ATOM 6420  H HG23 . THR A 1 32 ? -13.071 -18.983 2.251   1.00 0.00 ? 33 THR A HG23 6  
ATOM 6421  N N    . GLU A 1 33 ? -11.122 -19.885 -1.983  1.00 0.00 ? 34 GLU A N    6  
ATOM 6422  C CA   . GLU A 1 33 ? -10.161 -21.014 -2.129  1.00 0.00 ? 34 GLU A CA   6  
ATOM 6423  C C    . GLU A 1 33 ? -9.170  -20.703 -3.254  1.00 0.00 ? 34 GLU A C    6  
ATOM 6424  O O    . GLU A 1 33 ? -8.178  -21.384 -3.423  1.00 0.00 ? 34 GLU A O    6  
ATOM 6425  C CB   . GLU A 1 33 ? -10.929 -22.296 -2.462  1.00 0.00 ? 34 GLU A CB   6  
ATOM 6426  C CG   . GLU A 1 33 ? -11.633 -22.811 -1.206  1.00 0.00 ? 34 GLU A CG   6  
ATOM 6427  C CD   . GLU A 1 33 ? -11.573 -24.339 -1.174  1.00 0.00 ? 34 GLU A CD   6  
ATOM 6428  O OE1  . GLU A 1 33 ? -10.803 -24.899 -1.937  1.00 0.00 ? 34 GLU A OE1  6  
ATOM 6429  O OE2  . GLU A 1 33 ? -12.298 -24.924 -0.386  1.00 0.00 ? 34 GLU A OE2  6  
ATOM 6430  H H    . GLU A 1 33 ? -11.713 -19.645 -2.727  1.00 0.00 ? 34 GLU A H    6  
ATOM 6431  H HA   . GLU A 1 33 ? -9.623  -21.149 -1.203  1.00 0.00 ? 34 GLU A HA   6  
ATOM 6432  H HB2  . GLU A 1 33 ? -11.663 -22.087 -3.228  1.00 0.00 ? 34 GLU A HB2  6  
ATOM 6433  H HB3  . GLU A 1 33 ? -10.240 -23.046 -2.820  1.00 0.00 ? 34 GLU A HB3  6  
ATOM 6434  H HG2  . GLU A 1 33 ? -11.141 -22.412 -0.330  1.00 0.00 ? 34 GLU A HG2  6  
ATOM 6435  H HG3  . GLU A 1 33 ? -12.664 -22.493 -1.216  1.00 0.00 ? 34 GLU A HG3  6  
ATOM 6436  N N    . VAL A 1 34 ? -9.428  -19.680 -4.023  1.00 0.00 ? 35 VAL A N    6  
ATOM 6437  C CA   . VAL A 1 34 ? -8.497  -19.330 -5.133  1.00 0.00 ? 35 VAL A CA   6  
ATOM 6438  C C    . VAL A 1 34 ? -7.138  -18.938 -4.550  1.00 0.00 ? 35 VAL A C    6  
ATOM 6439  O O    . VAL A 1 34 ? -6.101  -19.249 -5.102  1.00 0.00 ? 35 VAL A O    6  
ATOM 6440  C CB   . VAL A 1 34 ? -9.079  -18.161 -5.931  1.00 0.00 ? 35 VAL A CB   6  
ATOM 6441  C CG1  . VAL A 1 34 ? -7.985  -17.507 -6.780  1.00 0.00 ? 35 VAL A CG1  6  
ATOM 6442  C CG2  . VAL A 1 34 ? -10.188 -18.680 -6.849  1.00 0.00 ? 35 VAL A CG2  6  
ATOM 6443  H H    . VAL A 1 34 ? -10.233 -19.142 -3.870  1.00 0.00 ? 35 VAL A H    6  
ATOM 6444  H HA   . VAL A 1 34 ? -8.377  -20.178 -5.781  1.00 0.00 ? 35 VAL A HA   6  
ATOM 6445  H HB   . VAL A 1 34 ? -9.487  -17.437 -5.249  1.00 0.00 ? 35 VAL A HB   6  
ATOM 6446  H HG11 . VAL A 1 34 ? -7.149  -18.185 -6.874  1.00 0.00 ? 35 VAL A HG11 6  
ATOM 6447  H HG12 . VAL A 1 34 ? -8.376  -17.283 -7.762  1.00 0.00 ? 35 VAL A HG12 6  
ATOM 6448  H HG13 . VAL A 1 34 ? -7.658  -16.595 -6.305  1.00 0.00 ? 35 VAL A HG13 6  
ATOM 6449  H HG21 . VAL A 1 34 ? -10.789 -19.401 -6.315  1.00 0.00 ? 35 VAL A HG21 6  
ATOM 6450  H HG22 . VAL A 1 34 ? -10.810 -17.855 -7.163  1.00 0.00 ? 35 VAL A HG22 6  
ATOM 6451  H HG23 . VAL A 1 34 ? -9.748  -19.150 -7.716  1.00 0.00 ? 35 VAL A HG23 6  
ATOM 6452  N N    . ALA A 1 35 ? -7.136  -18.259 -3.439  1.00 0.00 ? 36 ALA A N    6  
ATOM 6453  C CA   . ALA A 1 35 ? -5.847  -17.849 -2.818  1.00 0.00 ? 36 ALA A CA   6  
ATOM 6454  C C    . ALA A 1 35 ? -5.140  -19.084 -2.255  1.00 0.00 ? 36 ALA A C    6  
ATOM 6455  O O    . ALA A 1 35 ? -3.927  -19.152 -2.211  1.00 0.00 ? 36 ALA A O    6  
ATOM 6456  C CB   . ALA A 1 35 ? -6.118  -16.855 -1.687  1.00 0.00 ? 36 ALA A CB   6  
ATOM 6457  H H    . ALA A 1 35 ? -7.985  -18.020 -3.011  1.00 0.00 ? 36 ALA A H    6  
ATOM 6458  H HA   . ALA A 1 35 ? -5.219  -17.382 -3.565  1.00 0.00 ? 36 ALA A HA   6  
ATOM 6459  H HB1  . ALA A 1 35 ? -7.159  -16.906 -1.406  1.00 0.00 ? 36 ALA A HB1  6  
ATOM 6460  H HB2  . ALA A 1 35 ? -5.502  -17.103 -0.835  1.00 0.00 ? 36 ALA A HB2  6  
ATOM 6461  H HB3  . ALA A 1 35 ? -5.884  -15.855 -2.021  1.00 0.00 ? 36 ALA A HB3  6  
ATOM 6462  N N    . LYS A 1 36 ? -5.890  -20.063 -1.828  1.00 0.00 ? 37 LYS A N    6  
ATOM 6463  C CA   . LYS A 1 36 ? -5.267  -21.292 -1.271  1.00 0.00 ? 37 LYS A CA   6  
ATOM 6464  C C    . LYS A 1 36 ? -4.489  -22.011 -2.376  1.00 0.00 ? 37 LYS A C    6  
ATOM 6465  O O    . LYS A 1 36 ? -3.345  -22.386 -2.205  1.00 0.00 ? 37 LYS A O    6  
ATOM 6466  C CB   . LYS A 1 36 ? -6.374  -22.187 -0.720  1.00 0.00 ? 37 LYS A CB   6  
ATOM 6467  C CG   . LYS A 1 36 ? -5.941  -23.659 -0.730  1.00 0.00 ? 37 LYS A CG   6  
ATOM 6468  C CD   . LYS A 1 36 ? -4.687  -23.830 0.129   1.00 0.00 ? 37 LYS A CD   6  
ATOM 6469  C CE   . LYS A 1 36 ? -4.165  -25.261 -0.011  1.00 0.00 ? 37 LYS A CE   6  
ATOM 6470  N NZ   . LYS A 1 36 ? -3.059  -25.483 0.961   1.00 0.00 ? 37 LYS A NZ   6  
ATOM 6471  H H    . LYS A 1 36 ? -6.866  -19.991 -1.874  1.00 0.00 ? 37 LYS A H    6  
ATOM 6472  H HA   . LYS A 1 36 ? -4.602  -21.027 -0.472  1.00 0.00 ? 37 LYS A HA   6  
ATOM 6473  H HB2  . LYS A 1 36 ? -6.581  -21.885 0.294   1.00 0.00 ? 37 LYS A HB2  6  
ATOM 6474  H HB3  . LYS A 1 36 ? -7.261  -22.065 -1.320  1.00 0.00 ? 37 LYS A HB3  6  
ATOM 6475  H HG2  . LYS A 1 36 ? -6.737  -24.270 -0.331  1.00 0.00 ? 37 LYS A HG2  6  
ATOM 6476  H HG3  . LYS A 1 36 ? -5.726  -23.963 -1.743  1.00 0.00 ? 37 LYS A HG3  6  
ATOM 6477  H HD2  . LYS A 1 36 ? -3.928  -23.134 -0.199  1.00 0.00 ? 37 LYS A HD2  6  
ATOM 6478  H HD3  . LYS A 1 36 ? -4.930  -23.637 1.163   1.00 0.00 ? 37 LYS A HD3  6  
ATOM 6479  H HE2  . LYS A 1 36 ? -4.966  -25.957 0.190   1.00 0.00 ? 37 LYS A HE2  6  
ATOM 6480  H HE3  . LYS A 1 36 ? -3.799  -25.413 -1.015  1.00 0.00 ? 37 LYS A HE3  6  
ATOM 6481  H HZ1  . LYS A 1 36 ? -3.353  -25.158 1.903   1.00 0.00 ? 37 LYS A HZ1  6  
ATOM 6482  H HZ2  . LYS A 1 36 ? -2.831  -26.497 1.002   1.00 0.00 ? 37 LYS A HZ2  6  
ATOM 6483  H HZ3  . LYS A 1 36 ? -2.218  -24.950 0.657   1.00 0.00 ? 37 LYS A HZ3  6  
ATOM 6484  N N    . ARG A 1 37 ? -5.104  -22.204 -3.508  1.00 0.00 ? 38 ARG A N    6  
ATOM 6485  C CA   . ARG A 1 37 ? -4.411  -22.894 -4.630  1.00 0.00 ? 38 ARG A CA   6  
ATOM 6486  C C    . ARG A 1 37 ? -3.305  -21.990 -5.182  1.00 0.00 ? 38 ARG A C    6  
ATOM 6487  O O    . ARG A 1 37 ? -2.404  -22.441 -5.862  1.00 0.00 ? 38 ARG A O    6  
ATOM 6488  C CB   . ARG A 1 37 ? -5.427  -23.190 -5.736  1.00 0.00 ? 38 ARG A CB   6  
ATOM 6489  C CG   . ARG A 1 37 ? -5.294  -24.647 -6.178  1.00 0.00 ? 38 ARG A CG   6  
ATOM 6490  C CD   . ARG A 1 37 ? -3.937  -24.850 -6.854  1.00 0.00 ? 38 ARG A CD   6  
ATOM 6491  N NE   . ARG A 1 37 ? -3.965  -24.244 -8.215  1.00 0.00 ? 38 ARG A NE   6  
ATOM 6492  C CZ   . ARG A 1 37 ? -3.032  -24.535 -9.077  1.00 0.00 ? 38 ARG A CZ   6  
ATOM 6493  N NH1  . ARG A 1 37 ? -1.783  -24.564 -8.701  1.00 0.00 ? 38 ARG A NH1  6  
ATOM 6494  N NH2  . ARG A 1 37 ? -3.346  -24.799 -10.316 1.00 0.00 ? 38 ARG A NH2  6  
ATOM 6495  H H    . ARG A 1 37 ? -6.025  -21.891 -3.620  1.00 0.00 ? 38 ARG A H    6  
ATOM 6496  H HA   . ARG A 1 37 ? -3.981  -23.820 -4.277  1.00 0.00 ? 38 ARG A HA   6  
ATOM 6497  H HB2  . ARG A 1 37 ? -6.424  -23.015 -5.360  1.00 0.00 ? 38 ARG A HB2  6  
ATOM 6498  H HB3  . ARG A 1 37 ? -5.240  -22.541 -6.579  1.00 0.00 ? 38 ARG A HB3  6  
ATOM 6499  H HG2  . ARG A 1 37 ? -5.369  -25.294 -5.316  1.00 0.00 ? 38 ARG A HG2  6  
ATOM 6500  H HG3  . ARG A 1 37 ? -6.081  -24.885 -6.878  1.00 0.00 ? 38 ARG A HG3  6  
ATOM 6501  H HD2  . ARG A 1 37 ? -3.168  -24.373 -6.264  1.00 0.00 ? 38 ARG A HD2  6  
ATOM 6502  H HD3  . ARG A 1 37 ? -3.729  -25.906 -6.934  1.00 0.00 ? 38 ARG A HD3  6  
ATOM 6503  H HE   . ARG A 1 37 ? -4.685  -23.624 -8.461  1.00 0.00 ? 38 ARG A HE   6  
ATOM 6504  H HH11 . ARG A 1 37 ? -1.542  -24.362 -7.752  1.00 0.00 ? 38 ARG A HH11 6  
ATOM 6505  H HH12 . ARG A 1 37 ? -1.066  -24.786 -9.362  1.00 0.00 ? 38 ARG A HH12 6  
ATOM 6506  H HH21 . ARG A 1 37 ? -4.304  -24.779 -10.604 1.00 0.00 ? 38 ARG A HH21 6  
ATOM 6507  H HH22 . ARG A 1 37 ? -2.630  -25.023 -10.977 1.00 0.00 ? 38 ARG A HH22 6  
ATOM 6508  N N    . GLY A 1 38 ? -3.366  -20.719 -4.892  1.00 0.00 ? 39 GLY A N    6  
ATOM 6509  C CA   . GLY A 1 38 ? -2.318  -19.789 -5.399  1.00 0.00 ? 39 GLY A CA   6  
ATOM 6510  C C    . GLY A 1 38 ? -1.139  -19.768 -4.424  1.00 0.00 ? 39 GLY A C    6  
ATOM 6511  O O    . GLY A 1 38 ? -0.068  -19.289 -4.739  1.00 0.00 ? 39 GLY A O    6  
ATOM 6512  H H    . GLY A 1 38 ? -4.100  -20.377 -4.342  1.00 0.00 ? 39 GLY A H    6  
ATOM 6513  H HA2  . GLY A 1 38 ? -1.979  -20.122 -6.369  1.00 0.00 ? 39 GLY A HA2  6  
ATOM 6514  H HA3  . GLY A 1 38 ? -2.729  -18.794 -5.482  1.00 0.00 ? 39 GLY A HA3  6  
ATOM 6515  N N    . GLY A 1 39 ? -1.329  -20.286 -3.242  1.00 0.00 ? 40 GLY A N    6  
ATOM 6516  C CA   . GLY A 1 39 ? -0.219  -20.298 -2.247  1.00 0.00 ? 40 GLY A CA   6  
ATOM 6517  C C    . GLY A 1 39 ? 0.569   -21.602 -2.378  1.00 0.00 ? 40 GLY A C    6  
ATOM 6518  O O    . GLY A 1 39 ? 1.721   -21.683 -2.003  1.00 0.00 ? 40 GLY A O    6  
ATOM 6519  H H    . GLY A 1 39 ? -2.200  -20.668 -3.008  1.00 0.00 ? 40 GLY A H    6  
ATOM 6520  H HA2  . GLY A 1 39 ? 0.437   -19.458 -2.429  1.00 0.00 ? 40 GLY A HA2  6  
ATOM 6521  H HA3  . GLY A 1 39 ? -0.628  -20.227 -1.251  1.00 0.00 ? 40 GLY A HA3  6  
ATOM 6522  N N    . GLU A 1 40 ? -0.045  -22.625 -2.906  1.00 0.00 ? 41 GLU A N    6  
ATOM 6523  C CA   . GLU A 1 40 ? 0.668   -23.922 -3.061  1.00 0.00 ? 41 GLU A CA   6  
ATOM 6524  C C    . GLU A 1 40 ? 1.821   -23.759 -4.056  1.00 0.00 ? 41 GLU A C    6  
ATOM 6525  O O    . GLU A 1 40 ? 2.929   -24.194 -3.816  1.00 0.00 ? 41 GLU A O    6  
ATOM 6526  C CB   . GLU A 1 40 ? -0.309  -24.984 -3.563  1.00 0.00 ? 41 GLU A CB   6  
ATOM 6527  C CG   . GLU A 1 40 ? -0.546  -24.814 -5.067  1.00 0.00 ? 41 GLU A CG   6  
ATOM 6528  C CD   . GLU A 1 40 ? -1.535  -25.877 -5.549  1.00 0.00 ? 41 GLU A CD   6  
ATOM 6529  O OE1  . GLU A 1 40 ? -2.600  -25.976 -4.962  1.00 0.00 ? 41 GLU A OE1  6  
ATOM 6530  O OE2  . GLU A 1 40 ? -1.211  -26.572 -6.497  1.00 0.00 ? 41 GLU A OE2  6  
ATOM 6531  H H    . GLU A 1 40 ? -0.976  -22.540 -3.202  1.00 0.00 ? 41 GLU A H    6  
ATOM 6532  H HA   . GLU A 1 40 ? 1.061   -24.233 -2.106  1.00 0.00 ? 41 GLU A HA   6  
ATOM 6533  H HB2  . GLU A 1 40 ? 0.103   -25.960 -3.370  1.00 0.00 ? 41 GLU A HB2  6  
ATOM 6534  H HB3  . GLU A 1 40 ? -1.246  -24.880 -3.039  1.00 0.00 ? 41 GLU A HB3  6  
ATOM 6535  H HG2  . GLU A 1 40 ? -0.951  -23.831 -5.259  1.00 0.00 ? 41 GLU A HG2  6  
ATOM 6536  H HG3  . GLU A 1 40 ? 0.388   -24.930 -5.595  1.00 0.00 ? 41 GLU A HG3  6  
ATOM 6537  N N    . LEU A 1 41 ? 1.567   -23.131 -5.172  1.00 0.00 ? 42 LEU A N    6  
ATOM 6538  C CA   . LEU A 1 41 ? 2.643   -22.937 -6.181  1.00 0.00 ? 42 LEU A CA   6  
ATOM 6539  C C    . LEU A 1 41 ? 3.610   -21.859 -5.690  1.00 0.00 ? 42 LEU A C    6  
ATOM 6540  O O    . LEU A 1 41 ? 4.809   -21.961 -5.864  1.00 0.00 ? 42 LEU A O    6  
ATOM 6541  C CB   . LEU A 1 41 ? 2.018   -22.496 -7.504  1.00 0.00 ? 42 LEU A CB   6  
ATOM 6542  C CG   . LEU A 1 41 ? 1.555   -23.725 -8.284  1.00 0.00 ? 42 LEU A CG   6  
ATOM 6543  C CD1  . LEU A 1 41 ? 0.963   -23.285 -9.624  1.00 0.00 ? 42 LEU A CD1  6  
ATOM 6544  C CD2  . LEU A 1 41 ? 2.748   -24.650 -8.532  1.00 0.00 ? 42 LEU A CD2  6  
ATOM 6545  H H    . LEU A 1 41 ? 0.666   -22.785 -5.345  1.00 0.00 ? 42 LEU A H    6  
ATOM 6546  H HA   . LEU A 1 41 ? 3.175   -23.864 -6.324  1.00 0.00 ? 42 LEU A HA   6  
ATOM 6547  H HB2  . LEU A 1 41 ? 1.172   -21.853 -7.307  1.00 0.00 ? 42 LEU A HB2  6  
ATOM 6548  H HB3  . LEU A 1 41 ? 2.750   -21.958 -8.085  1.00 0.00 ? 42 LEU A HB3  6  
ATOM 6549  H HG   . LEU A 1 41 ? 0.802   -24.251 -7.713  1.00 0.00 ? 42 LEU A HG   6  
ATOM 6550  H HD11 . LEU A 1 41 ? 1.394   -22.337 -9.912  1.00 0.00 ? 42 LEU A HD11 6  
ATOM 6551  H HD12 . LEU A 1 41 ? 1.184   -24.025 -10.376 1.00 0.00 ? 42 LEU A HD12 6  
ATOM 6552  H HD13 . LEU A 1 41 ? -0.107  -23.179 -9.526  1.00 0.00 ? 42 LEU A HD13 6  
ATOM 6553  H HD21 . LEU A 1 41 ? 3.642   -24.058 -8.660  1.00 0.00 ? 42 LEU A HD21 6  
ATOM 6554  H HD22 . LEU A 1 41 ? 2.873   -25.313 -7.688  1.00 0.00 ? 42 LEU A HD22 6  
ATOM 6555  H HD23 . LEU A 1 41 ? 2.573   -25.234 -9.424  1.00 0.00 ? 42 LEU A HD23 6  
ATOM 6556  N N    . TRP A 1 42 ? 3.099   -20.827 -5.081  1.00 0.00 ? 43 TRP A N    6  
ATOM 6557  C CA   . TRP A 1 42 ? 3.985   -19.740 -4.582  1.00 0.00 ? 43 TRP A CA   6  
ATOM 6558  C C    . TRP A 1 42 ? 4.853   -20.269 -3.439  1.00 0.00 ? 43 TRP A C    6  
ATOM 6559  O O    . TRP A 1 42 ? 5.837   -19.663 -3.062  1.00 0.00 ? 43 TRP A O    6  
ATOM 6560  C CB   . TRP A 1 42 ? 3.133   -18.578 -4.076  1.00 0.00 ? 43 TRP A CB   6  
ATOM 6561  C CG   . TRP A 1 42 ? 4.017   -17.557 -3.439  1.00 0.00 ? 43 TRP A CG   6  
ATOM 6562  C CD1  . TRP A 1 42 ? 4.244   -17.445 -2.110  1.00 0.00 ? 43 TRP A CD1  6  
ATOM 6563  C CD2  . TRP A 1 42 ? 4.797   -16.506 -4.079  1.00 0.00 ? 43 TRP A CD2  6  
ATOM 6564  N NE1  . TRP A 1 42 ? 5.112   -16.391 -1.893  1.00 0.00 ? 43 TRP A NE1  6  
ATOM 6565  C CE2  . TRP A 1 42 ? 5.481   -15.780 -3.076  1.00 0.00 ? 43 TRP A CE2  6  
ATOM 6566  C CE3  . TRP A 1 42 ? 4.974   -16.117 -5.418  1.00 0.00 ? 43 TRP A CE3  6  
ATOM 6567  C CZ2  . TRP A 1 42 ? 6.313   -14.705 -3.392  1.00 0.00 ? 43 TRP A CZ2  6  
ATOM 6568  C CZ3  . TRP A 1 42 ? 5.810   -15.036 -5.739  1.00 0.00 ? 43 TRP A CZ3  6  
ATOM 6569  C CH2  . TRP A 1 42 ? 6.478   -14.331 -4.728  1.00 0.00 ? 43 TRP A CH2  6  
ATOM 6570  H H    . TRP A 1 42 ? 2.129   -20.764 -4.953  1.00 0.00 ? 43 TRP A H    6  
ATOM 6571  H HA   . TRP A 1 42 ? 4.620   -19.394 -5.386  1.00 0.00 ? 43 TRP A HA   6  
ATOM 6572  H HB2  . TRP A 1 42 ? 2.604   -18.132 -4.905  1.00 0.00 ? 43 TRP A HB2  6  
ATOM 6573  H HB3  . TRP A 1 42 ? 2.420   -18.941 -3.349  1.00 0.00 ? 43 TRP A HB3  6  
ATOM 6574  H HD1  . TRP A 1 42 ? 3.818   -18.077 -1.345  1.00 0.00 ? 43 TRP A HD1  6  
ATOM 6575  H HE1  . TRP A 1 42 ? 5.436   -16.096 -1.016  1.00 0.00 ? 43 TRP A HE1  6  
ATOM 6576  H HE3  . TRP A 1 42 ? 4.465   -16.653 -6.205  1.00 0.00 ? 43 TRP A HE3  6  
ATOM 6577  H HZ2  . TRP A 1 42 ? 6.825   -14.166 -2.608  1.00 0.00 ? 43 TRP A HZ2  6  
ATOM 6578  H HZ3  . TRP A 1 42 ? 5.939   -14.746 -6.771  1.00 0.00 ? 43 TRP A HZ3  6  
ATOM 6579  H HH2  . TRP A 1 42 ? 7.121   -13.500 -4.982  1.00 0.00 ? 43 TRP A HH2  6  
ATOM 6580  N N    . ARG A 1 43 ? 4.499   -21.395 -2.880  1.00 0.00 ? 44 ARG A N    6  
ATOM 6581  C CA   . ARG A 1 43 ? 5.309   -21.953 -1.761  1.00 0.00 ? 44 ARG A CA   6  
ATOM 6582  C C    . ARG A 1 43 ? 6.711   -22.287 -2.272  1.00 0.00 ? 44 ARG A C    6  
ATOM 6583  O O    . ARG A 1 43 ? 7.694   -21.740 -1.816  1.00 0.00 ? 44 ARG A O    6  
ATOM 6584  C CB   . ARG A 1 43 ? 4.643   -23.221 -1.221  1.00 0.00 ? 44 ARG A CB   6  
ATOM 6585  C CG   . ARG A 1 43 ? 4.378   -23.056 0.277   1.00 0.00 ? 44 ARG A CG   6  
ATOM 6586  C CD   . ARG A 1 43 ? 4.673   -24.373 0.998   1.00 0.00 ? 44 ARG A CD   6  
ATOM 6587  N NE   . ARG A 1 43 ? 3.392   -25.070 1.300   1.00 0.00 ? 44 ARG A NE   6  
ATOM 6588  C CZ   . ARG A 1 43 ? 2.989   -26.049 0.540   1.00 0.00 ? 44 ARG A CZ   6  
ATOM 6589  N NH1  . ARG A 1 43 ? 2.522   -25.799 -0.654  1.00 0.00 ? 44 ARG A NH1  6  
ATOM 6590  N NH2  . ARG A 1 43 ? 3.050   -27.278 0.972   1.00 0.00 ? 44 ARG A NH2  6  
ATOM 6591  H H    . ARG A 1 43 ? 3.702   -21.872 -3.195  1.00 0.00 ? 44 ARG A H    6  
ATOM 6592  H HA   . ARG A 1 43 ? 5.379   -21.218 -0.971  1.00 0.00 ? 44 ARG A HA   6  
ATOM 6593  H HB2  . ARG A 1 43 ? 3.709   -23.385 -1.738  1.00 0.00 ? 44 ARG A HB2  6  
ATOM 6594  H HB3  . ARG A 1 43 ? 5.296   -24.066 -1.379  1.00 0.00 ? 44 ARG A HB3  6  
ATOM 6595  H HG2  . ARG A 1 43 ? 5.015   -22.277 0.670   1.00 0.00 ? 44 ARG A HG2  6  
ATOM 6596  H HG3  . ARG A 1 43 ? 3.344   -22.786 0.432   1.00 0.00 ? 44 ARG A HG3  6  
ATOM 6597  H HD2  . ARG A 1 43 ? 5.285   -25.000 0.368   1.00 0.00 ? 44 ARG A HD2  6  
ATOM 6598  H HD3  . ARG A 1 43 ? 5.198   -24.168 1.920   1.00 0.00 ? 44 ARG A HD3  6  
ATOM 6599  H HE   . ARG A 1 43 ? 2.854   -24.794 2.071   1.00 0.00 ? 44 ARG A HE   6  
ATOM 6600  H HH11 . ARG A 1 43 ? 2.475   -24.857 -0.986  1.00 0.00 ? 44 ARG A HH11 6  
ATOM 6601  H HH12 . ARG A 1 43 ? 2.212   -26.550 -1.237  1.00 0.00 ? 44 ARG A HH12 6  
ATOM 6602  H HH21 . ARG A 1 43 ? 3.408   -27.467 1.887   1.00 0.00 ? 44 ARG A HH21 6  
ATOM 6603  H HH22 . ARG A 1 43 ? 2.740   -28.030 0.391   1.00 0.00 ? 44 ARG A HH22 6  
ATOM 6604  N N    . ALA A 1 44 ? 6.812   -23.178 -3.222  1.00 0.00 ? 45 ALA A N    6  
ATOM 6605  C CA   . ALA A 1 44 ? 8.154   -23.533 -3.765  1.00 0.00 ? 45 ALA A CA   6  
ATOM 6606  C C    . ALA A 1 44 ? 8.814   -22.268 -4.316  1.00 0.00 ? 45 ALA A C    6  
ATOM 6607  O O    . ALA A 1 44 ? 10.022  -22.155 -4.357  1.00 0.00 ? 45 ALA A O    6  
ATOM 6608  C CB   . ALA A 1 44 ? 7.995   -24.564 -4.885  1.00 0.00 ? 45 ALA A CB   6  
ATOM 6609  H H    . ALA A 1 44 ? 6.007   -23.605 -3.584  1.00 0.00 ? 45 ALA A H    6  
ATOM 6610  H HA   . ALA A 1 44 ? 8.765   -23.946 -2.976  1.00 0.00 ? 45 ALA A HA   6  
ATOM 6611  H HB1  . ALA A 1 44 ? 7.500   -25.442 -4.497  1.00 0.00 ? 45 ALA A HB1  6  
ATOM 6612  H HB2  . ALA A 1 44 ? 7.403   -24.140 -5.683  1.00 0.00 ? 45 ALA A HB2  6  
ATOM 6613  H HB3  . ALA A 1 44 ? 8.968   -24.837 -5.263  1.00 0.00 ? 45 ALA A HB3  6  
ATOM 6614  N N    . MET A 1 45 ? 8.014   -21.325 -4.744  1.00 0.00 ? 46 MET A N    6  
ATOM 6615  C CA   . MET A 1 45 ? 8.551   -20.045 -5.305  1.00 0.00 ? 46 MET A CA   6  
ATOM 6616  C C    . MET A 1 45 ? 9.884   -19.650 -4.651  1.00 0.00 ? 46 MET A C    6  
ATOM 6617  O O    . MET A 1 45 ? 10.742  -19.107 -5.307  1.00 0.00 ? 46 MET A O    6  
ATOM 6618  C CB   . MET A 1 45 ? 7.540   -18.934 -5.050  1.00 0.00 ? 46 MET A CB   6  
ATOM 6619  C CG   . MET A 1 45 ? 7.877   -17.725 -5.925  1.00 0.00 ? 46 MET A CG   6  
ATOM 6620  S SD   . MET A 1 45 ? 7.828   -18.209 -7.670  1.00 0.00 ? 46 MET A SD   6  
ATOM 6621  C CE   . MET A 1 45 ? 6.463   -17.133 -8.168  1.00 0.00 ? 46 MET A CE   6  
ATOM 6622  H H    . MET A 1 45 ? 7.038   -21.464 -4.704  1.00 0.00 ? 46 MET A H    6  
ATOM 6623  H HA   . MET A 1 45 ? 8.695   -20.156 -6.368  1.00 0.00 ? 46 MET A HA   6  
ATOM 6624  H HB2  . MET A 1 45 ? 6.546   -19.289 -5.285  1.00 0.00 ? 46 MET A HB2  6  
ATOM 6625  H HB3  . MET A 1 45 ? 7.586   -18.648 -4.009  1.00 0.00 ? 46 MET A HB3  6  
ATOM 6626  H HG2  . MET A 1 45 ? 7.155   -16.942 -5.750  1.00 0.00 ? 46 MET A HG2  6  
ATOM 6627  H HG3  . MET A 1 45 ? 8.865   -17.366 -5.679  1.00 0.00 ? 46 MET A HG3  6  
ATOM 6628  H HE1  . MET A 1 45 ? 6.632   -16.138 -7.779  1.00 0.00 ? 46 MET A HE1  6  
ATOM 6629  H HE2  . MET A 1 45 ? 6.407   -17.100 -9.246  1.00 0.00 ? 46 MET A HE2  6  
ATOM 6630  H HE3  . MET A 1 45 ? 5.537   -17.518 -7.774  1.00 0.00 ? 46 MET A HE3  6  
ATOM 6631  N N    . LYS A 1 46 ? 10.056  -19.940 -3.378  1.00 0.00 ? 47 LYS A N    6  
ATOM 6632  C CA   . LYS A 1 46 ? 11.316  -19.621 -2.649  1.00 0.00 ? 47 LYS A CA   6  
ATOM 6633  C C    . LYS A 1 46 ? 12.105  -18.468 -3.290  1.00 0.00 ? 47 LYS A C    6  
ATOM 6634  O O    . LYS A 1 46 ? 12.067  -17.351 -2.815  1.00 0.00 ? 47 LYS A O    6  
ATOM 6635  C CB   . LYS A 1 46 ? 12.125  -20.897 -2.627  1.00 0.00 ? 47 LYS A CB   6  
ATOM 6636  C CG   . LYS A 1 46 ? 13.058  -20.907 -1.414  1.00 0.00 ? 47 LYS A CG   6  
ATOM 6637  C CD   . LYS A 1 46 ? 12.264  -21.272 -0.158  1.00 0.00 ? 47 LYS A CD   6  
ATOM 6638  C CE   . LYS A 1 46 ? 13.093  -20.937 1.083   1.00 0.00 ? 47 LYS A CE   6  
ATOM 6639  N NZ   . LYS A 1 46 ? 12.185  -20.512 2.185   1.00 0.00 ? 47 LYS A NZ   6  
ATOM 6640  H H    . LYS A 1 46 ? 9.356   -20.402 -2.893  1.00 0.00 ? 47 LYS A H    6  
ATOM 6641  H HA   . LYS A 1 46 ? 11.072  -19.350 -1.632  1.00 0.00 ? 47 LYS A HA   6  
ATOM 6642  H HB2  . LYS A 1 46 ? 11.427  -21.721 -2.565  1.00 0.00 ? 47 LYS A HB2  6  
ATOM 6643  H HB3  . LYS A 1 46 ? 12.703  -20.981 -3.532  1.00 0.00 ? 47 LYS A HB3  6  
ATOM 6644  H HG2  . LYS A 1 46 ? 13.841  -21.634 -1.569  1.00 0.00 ? 47 LYS A HG2  6  
ATOM 6645  H HG3  . LYS A 1 46 ? 13.495  -19.928 -1.288  1.00 0.00 ? 47 LYS A HG3  6  
ATOM 6646  H HD2  . LYS A 1 46 ? 11.342  -20.709 -0.139  1.00 0.00 ? 47 LYS A HD2  6  
ATOM 6647  H HD3  . LYS A 1 46 ? 12.042  -22.329 -0.167  1.00 0.00 ? 47 LYS A HD3  6  
ATOM 6648  H HE2  . LYS A 1 46 ? 13.649  -21.810 1.390   1.00 0.00 ? 47 LYS A HE2  6  
ATOM 6649  H HE3  . LYS A 1 46 ? 13.780  -20.136 0.852   1.00 0.00 ? 47 LYS A HE3  6  
ATOM 6650  H HZ1  . LYS A 1 46 ? 11.223  -20.376 1.808   1.00 0.00 ? 47 LYS A HZ1  6  
ATOM 6651  H HZ2  . LYS A 1 46 ? 12.169  -21.244 2.923   1.00 0.00 ? 47 LYS A HZ2  6  
ATOM 6652  H HZ3  . LYS A 1 46 ? 12.528  -19.619 2.592   1.00 0.00 ? 47 LYS A HZ3  6  
ATOM 6653  N N    . ASP A 1 47 ? 12.821  -18.715 -4.354  1.00 0.00 ? 48 ASP A N    6  
ATOM 6654  C CA   . ASP A 1 47 ? 13.599  -17.616 -4.989  1.00 0.00 ? 48 ASP A CA   6  
ATOM 6655  C C    . ASP A 1 47 ? 12.657  -16.739 -5.820  1.00 0.00 ? 48 ASP A C    6  
ATOM 6656  O O    . ASP A 1 47 ? 12.537  -16.897 -7.018  1.00 0.00 ? 48 ASP A O    6  
ATOM 6657  C CB   . ASP A 1 47 ? 14.676  -18.214 -5.896  1.00 0.00 ? 48 ASP A CB   6  
ATOM 6658  C CG   . ASP A 1 47 ? 16.058  -17.774 -5.409  1.00 0.00 ? 48 ASP A CG   6  
ATOM 6659  O OD1  . ASP A 1 47 ? 16.119  -16.836 -4.631  1.00 0.00 ? 48 ASP A OD1  6  
ATOM 6660  O OD2  . ASP A 1 47 ? 17.031  -18.382 -5.822  1.00 0.00 ? 48 ASP A OD2  6  
ATOM 6661  H H    . ASP A 1 47 ? 12.851  -19.618 -4.731  1.00 0.00 ? 48 ASP A H    6  
ATOM 6662  H HA   . ASP A 1 47 ? 14.067  -17.016 -4.222  1.00 0.00 ? 48 ASP A HA   6  
ATOM 6663  H HB2  . ASP A 1 47 ? 14.610  -19.292 -5.867  1.00 0.00 ? 48 ASP A HB2  6  
ATOM 6664  H HB3  . ASP A 1 47 ? 14.527  -17.871 -6.908  1.00 0.00 ? 48 ASP A HB3  6  
ATOM 6665  N N    . LYS A 1 48 ? 11.992  -15.813 -5.182  1.00 0.00 ? 49 LYS A N    6  
ATOM 6666  C CA   . LYS A 1 48 ? 11.056  -14.914 -5.918  1.00 0.00 ? 49 LYS A CA   6  
ATOM 6667  C C    . LYS A 1 48 ? 11.821  -13.688 -6.416  1.00 0.00 ? 49 LYS A C    6  
ATOM 6668  O O    . LYS A 1 48 ? 11.238  -12.680 -6.762  1.00 0.00 ? 49 LYS A O    6  
ATOM 6669  C CB   . LYS A 1 48 ? 9.934   -14.462 -4.979  1.00 0.00 ? 49 LYS A CB   6  
ATOM 6670  C CG   . LYS A 1 48 ? 9.652   -15.557 -3.948  1.00 0.00 ? 49 LYS A CG   6  
ATOM 6671  C CD   . LYS A 1 48 ? 10.242  -15.150 -2.596  1.00 0.00 ? 49 LYS A CD   6  
ATOM 6672  C CE   . LYS A 1 48 ? 9.519   -15.900 -1.477  1.00 0.00 ? 49 LYS A CE   6  
ATOM 6673  N NZ   . LYS A 1 48 ? 9.336   -14.993 -0.310  1.00 0.00 ? 49 LYS A NZ   6  
ATOM 6674  H H    . LYS A 1 48 ? 12.110  -15.706 -4.216  1.00 0.00 ? 49 LYS A H    6  
ATOM 6675  H HA   . LYS A 1 48 ? 10.628  -15.439 -6.760  1.00 0.00 ? 49 LYS A HA   6  
ATOM 6676  H HB2  . LYS A 1 48 ? 10.234  -13.557 -4.470  1.00 0.00 ? 49 LYS A HB2  6  
ATOM 6677  H HB3  . LYS A 1 48 ? 9.039   -14.271 -5.552  1.00 0.00 ? 49 LYS A HB3  6  
ATOM 6678  H HG2  . LYS A 1 48 ? 8.585   -15.692 -3.849  1.00 0.00 ? 49 LYS A HG2  6  
ATOM 6679  H HG3  . LYS A 1 48 ? 10.105  -16.482 -4.272  1.00 0.00 ? 49 LYS A HG3  6  
ATOM 6680  H HD2  . LYS A 1 48 ? 11.294  -15.395 -2.574  1.00 0.00 ? 49 LYS A HD2  6  
ATOM 6681  H HD3  . LYS A 1 48 ? 10.117  -14.088 -2.454  1.00 0.00 ? 49 LYS A HD3  6  
ATOM 6682  H HE2  . LYS A 1 48 ? 8.554   -16.232 -1.831  1.00 0.00 ? 49 LYS A HE2  6  
ATOM 6683  H HE3  . LYS A 1 48 ? 10.106  -16.756 -1.180  1.00 0.00 ? 49 LYS A HE3  6  
ATOM 6684  H HZ1  . LYS A 1 48 ? 9.374   -14.004 -0.630  1.00 0.00 ? 49 LYS A HZ1  6  
ATOM 6685  H HZ2  . LYS A 1 48 ? 8.413   -15.178 0.132   1.00 0.00 ? 49 LYS A HZ2  6  
ATOM 6686  H HZ3  . LYS A 1 48 ? 10.094  -15.163 0.382   1.00 0.00 ? 49 LYS A HZ3  6  
ATOM 6687  N N    . SER A 1 49 ? 13.125  -13.766 -6.458  1.00 0.00 ? 50 SER A N    6  
ATOM 6688  C CA   . SER A 1 49 ? 13.926  -12.604 -6.937  1.00 0.00 ? 50 SER A CA   6  
ATOM 6689  C C    . SER A 1 49 ? 13.267  -12.017 -8.187  1.00 0.00 ? 50 SER A C    6  
ATOM 6690  O O    . SER A 1 49 ? 13.413  -10.847 -8.488  1.00 0.00 ? 50 SER A O    6  
ATOM 6691  C CB   . SER A 1 49 ? 15.345  -13.065 -7.273  1.00 0.00 ? 50 SER A CB   6  
ATOM 6692  O OG   . SER A 1 49 ? 15.858  -12.274 -8.336  1.00 0.00 ? 50 SER A OG   6  
ATOM 6693  H H    . SER A 1 49 ? 13.576  -14.589 -6.176  1.00 0.00 ? 50 SER A H    6  
ATOM 6694  H HA   . SER A 1 49 ? 13.964  -11.851 -6.164  1.00 0.00 ? 50 SER A HA   6  
ATOM 6695  H HB2  . SER A 1 49 ? 15.977  -12.949 -6.409  1.00 0.00 ? 50 SER A HB2  6  
ATOM 6696  H HB3  . SER A 1 49 ? 15.324  -14.107 -7.563  1.00 0.00 ? 50 SER A HB3  6  
ATOM 6697  H HG   . SER A 1 49 ? 15.780  -11.351 -8.083  1.00 0.00 ? 50 SER A HG   6  
ATOM 6698  N N    . GLU A 1 50 ? 12.535  -12.819 -8.912  1.00 0.00 ? 51 GLU A N    6  
ATOM 6699  C CA   . GLU A 1 50 ? 11.860  -12.312 -10.134 1.00 0.00 ? 51 GLU A CA   6  
ATOM 6700  C C    . GLU A 1 50 ? 10.939  -11.155 -9.761  1.00 0.00 ? 51 GLU A C    6  
ATOM 6701  O O    . GLU A 1 50 ? 11.125  -10.024 -10.173 1.00 0.00 ? 51 GLU A O    6  
ATOM 6702  C CB   . GLU A 1 50 ? 11.046  -13.430 -10.752 1.00 0.00 ? 51 GLU A CB   6  
ATOM 6703  C CG   . GLU A 1 50 ? 10.067  -12.860 -11.782 1.00 0.00 ? 51 GLU A CG   6  
ATOM 6704  C CD   . GLU A 1 50 ? 10.816  -11.916 -12.724 1.00 0.00 ? 51 GLU A CD   6  
ATOM 6705  O OE1  . GLU A 1 50 ? 11.779  -12.358 -13.331 1.00 0.00 ? 51 GLU A OE1  6  
ATOM 6706  O OE2  . GLU A 1 50 ? 10.418  -10.768 -12.823 1.00 0.00 ? 51 GLU A OE2  6  
ATOM 6707  H H    . GLU A 1 50 ? 12.423  -13.754 -8.649  1.00 0.00 ? 51 GLU A H    6  
ATOM 6708  H HA   . GLU A 1 50 ? 12.594  -11.995 -10.848 1.00 0.00 ? 51 GLU A HA   6  
ATOM 6709  H HB2  . GLU A 1 50 ? 11.727  -14.100 -11.239 1.00 0.00 ? 51 GLU A HB2  6  
ATOM 6710  H HB3  . GLU A 1 50 ? 10.499  -13.953 -9.979  1.00 0.00 ? 51 GLU A HB3  6  
ATOM 6711  H HG2  . GLU A 1 50 ? 9.630   -13.668 -12.351 1.00 0.00 ? 51 GLU A HG2  6  
ATOM 6712  H HG3  . GLU A 1 50 ? 9.287   -12.313 -11.274 1.00 0.00 ? 51 GLU A HG3  6  
ATOM 6713  N N    . TRP A 1 51 ? 9.941   -11.442 -8.979  1.00 0.00 ? 52 TRP A N    6  
ATOM 6714  C CA   . TRP A 1 51 ? 8.988   -10.390 -8.563  1.00 0.00 ? 52 TRP A CA   6  
ATOM 6715  C C    . TRP A 1 51 ? 9.672   -9.419  -7.619  1.00 0.00 ? 52 TRP A C    6  
ATOM 6716  O O    . TRP A 1 51 ? 9.885   -8.287  -7.958  1.00 0.00 ? 52 TRP A O    6  
ATOM 6717  C CB   . TRP A 1 51 ? 7.823   -11.041 -7.837  1.00 0.00 ? 52 TRP A CB   6  
ATOM 6718  C CG   . TRP A 1 51 ? 7.342   -12.188 -8.627  1.00 0.00 ? 52 TRP A CG   6  
ATOM 6719  C CD1  . TRP A 1 51 ? 7.673   -13.452 -8.385  1.00 0.00 ? 52 TRP A CD1  6  
ATOM 6720  C CD2  . TRP A 1 51 ? 6.456   -12.195 -9.766  1.00 0.00 ? 52 TRP A CD2  6  
ATOM 6721  N NE1  . TRP A 1 51 ? 7.040   -14.264 -9.306  1.00 0.00 ? 52 TRP A NE1  6  
ATOM 6722  C CE2  . TRP A 1 51 ? 6.270   -13.528 -10.184 1.00 0.00 ? 52 TRP A CE2  6  
ATOM 6723  C CE3  . TRP A 1 51 ? 5.800   -11.180 -10.466 1.00 0.00 ? 52 TRP A CE3  6  
ATOM 6724  C CZ2  . TRP A 1 51 ? 5.451   -13.846 -11.269 1.00 0.00 ? 52 TRP A CZ2  6  
ATOM 6725  C CZ3  . TRP A 1 51 ? 4.977   -11.485 -11.552 1.00 0.00 ? 52 TRP A CZ3  6  
ATOM 6726  C CH2  . TRP A 1 51 ? 4.798   -12.817 -11.956 1.00 0.00 ? 52 TRP A CH2  6  
ATOM 6727  H H    . TRP A 1 51 ? 9.818   -12.361 -8.663  1.00 0.00 ? 52 TRP A H    6  
ATOM 6728  H HA   . TRP A 1 51 ? 8.623   -9.862  -9.431  1.00 0.00 ? 52 TRP A HA   6  
ATOM 6729  H HB2  . TRP A 1 51 ? 8.145   -11.382 -6.866  1.00 0.00 ? 52 TRP A HB2  6  
ATOM 6730  H HB3  . TRP A 1 51 ? 7.028   -10.341 -7.723  1.00 0.00 ? 52 TRP A HB3  6  
ATOM 6731  H HD1  . TRP A 1 51 ? 8.324   -13.768 -7.599  1.00 0.00 ? 52 TRP A HD1  6  
ATOM 6732  H HE1  . TRP A 1 51 ? 7.114   -15.232 -9.344  1.00 0.00 ? 52 TRP A HE1  6  
ATOM 6733  H HE3  . TRP A 1 51 ? 5.943   -10.154 -10.170 1.00 0.00 ? 52 TRP A HE3  6  
ATOM 6734  H HZ2  . TRP A 1 51 ? 5.320   -14.874 -11.573 1.00 0.00 ? 52 TRP A HZ2  6  
ATOM 6735  H HZ3  . TRP A 1 51 ? 4.471   -10.690 -12.070 1.00 0.00 ? 52 TRP A HZ3  6  
ATOM 6736  H HH2  . TRP A 1 51 ? 4.160   -13.047 -12.796 1.00 0.00 ? 52 TRP A HH2  6  
ATOM 6737  N N    . GLU A 1 52 ? 10.000  -9.863  -6.434  1.00 0.00 ? 53 GLU A N    6  
ATOM 6738  C CA   . GLU A 1 52 ? 10.659  -8.964  -5.430  1.00 0.00 ? 53 GLU A CA   6  
ATOM 6739  C C    . GLU A 1 52 ? 11.461  -7.861  -6.126  1.00 0.00 ? 53 GLU A C    6  
ATOM 6740  O O    . GLU A 1 52 ? 11.397  -6.708  -5.747  1.00 0.00 ? 53 GLU A O    6  
ATOM 6741  C CB   . GLU A 1 52 ? 11.587  -9.788  -4.534  1.00 0.00 ? 53 GLU A CB   6  
ATOM 6742  C CG   . GLU A 1 52 ? 10.807  -10.288 -3.318  1.00 0.00 ? 53 GLU A CG   6  
ATOM 6743  C CD   . GLU A 1 52 ? 11.575  -11.433 -2.654  1.00 0.00 ? 53 GLU A CD   6  
ATOM 6744  O OE1  . GLU A 1 52 ? 12.652  -11.753 -3.129  1.00 0.00 ? 53 GLU A OE1  6  
ATOM 6745  O OE2  . GLU A 1 52 ? 11.071  -11.970 -1.681  1.00 0.00 ? 53 GLU A OE2  6  
ATOM 6746  H H    . GLU A 1 52 ? 9.795   -10.795 -6.194  1.00 0.00 ? 53 GLU A H    6  
ATOM 6747  H HA   . GLU A 1 52 ? 9.896   -8.500  -4.825  1.00 0.00 ? 53 GLU A HA   6  
ATOM 6748  H HB2  . GLU A 1 52 ? 11.969  -10.631 -5.091  1.00 0.00 ? 53 GLU A HB2  6  
ATOM 6749  H HB3  . GLU A 1 52 ? 12.410  -9.172  -4.204  1.00 0.00 ? 53 GLU A HB3  6  
ATOM 6750  H HG2  . GLU A 1 52 ? 10.682  -9.479  -2.612  1.00 0.00 ? 53 GLU A HG2  6  
ATOM 6751  H HG3  . GLU A 1 52 ? 9.838   -10.644 -3.634  1.00 0.00 ? 53 GLU A HG3  6  
ATOM 6752  N N    . ALA A 1 53 ? 12.199  -8.189  -7.148  1.00 0.00 ? 54 ALA A N    6  
ATOM 6753  C CA   . ALA A 1 53 ? 12.970  -7.133  -7.858  1.00 0.00 ? 54 ALA A CA   6  
ATOM 6754  C C    . ALA A 1 53 ? 11.985  -6.220  -8.587  1.00 0.00 ? 54 ALA A C    6  
ATOM 6755  O O    . ALA A 1 53 ? 11.995  -5.016  -8.427  1.00 0.00 ? 54 ALA A O    6  
ATOM 6756  C CB   . ALA A 1 53 ? 13.917  -7.782  -8.870  1.00 0.00 ? 54 ALA A CB   6  
ATOM 6757  H H    . ALA A 1 53 ? 12.233  -9.120  -7.457  1.00 0.00 ? 54 ALA A H    6  
ATOM 6758  H HA   . ALA A 1 53 ? 13.537  -6.556  -7.145  1.00 0.00 ? 54 ALA A HA   6  
ATOM 6759  H HB1  . ALA A 1 53 ? 13.405  -8.586  -9.377  1.00 0.00 ? 54 ALA A HB1  6  
ATOM 6760  H HB2  . ALA A 1 53 ? 14.232  -7.043  -9.592  1.00 0.00 ? 54 ALA A HB2  6  
ATOM 6761  H HB3  . ALA A 1 53 ? 14.781  -8.173  -8.355  1.00 0.00 ? 54 ALA A HB3  6  
ATOM 6762  N N    . LYS A 1 54 ? 11.133  -6.796  -9.386  1.00 0.00 ? 55 LYS A N    6  
ATOM 6763  C CA   . LYS A 1 54 ? 10.131  -5.987  -10.139 1.00 0.00 ? 55 LYS A CA   6  
ATOM 6764  C C    . LYS A 1 54 ? 9.319   -5.101  -9.182  1.00 0.00 ? 55 LYS A C    6  
ATOM 6765  O O    . LYS A 1 54 ? 9.011   -3.968  -9.492  1.00 0.00 ? 55 LYS A O    6  
ATOM 6766  C CB   . LYS A 1 54 ? 9.184   -6.933  -10.879 1.00 0.00 ? 55 LYS A CB   6  
ATOM 6767  C CG   . LYS A 1 54 ? 8.262   -6.124  -11.793 1.00 0.00 ? 55 LYS A CG   6  
ATOM 6768  C CD   . LYS A 1 54 ? 7.042   -5.654  -11.000 1.00 0.00 ? 55 LYS A CD   6  
ATOM 6769  C CE   . LYS A 1 54 ? 5.945   -5.214  -11.969 1.00 0.00 ? 55 LYS A CE   6  
ATOM 6770  N NZ   . LYS A 1 54 ? 5.730   -3.745  -11.838 1.00 0.00 ? 55 LYS A NZ   6  
ATOM 6771  H H    . LYS A 1 54 ? 11.153  -7.770  -9.495  1.00 0.00 ? 55 LYS A H    6  
ATOM 6772  H HA   . LYS A 1 54 ? 10.641  -5.363  -10.852 1.00 0.00 ? 55 LYS A HA   6  
ATOM 6773  H HB2  . LYS A 1 54 ? 9.763   -7.626  -11.474 1.00 0.00 ? 55 LYS A HB2  6  
ATOM 6774  H HB3  . LYS A 1 54 ? 8.590   -7.479  -10.162 1.00 0.00 ? 55 LYS A HB3  6  
ATOM 6775  H HG2  . LYS A 1 54 ? 8.796   -5.266  -12.176 1.00 0.00 ? 55 LYS A HG2  6  
ATOM 6776  H HG3  . LYS A 1 54 ? 7.937   -6.743  -12.614 1.00 0.00 ? 55 LYS A HG3  6  
ATOM 6777  H HD2  . LYS A 1 54 ? 6.678   -6.464  -10.385 1.00 0.00 ? 55 LYS A HD2  6  
ATOM 6778  H HD3  . LYS A 1 54 ? 7.318   -4.822  -10.371 1.00 0.00 ? 55 LYS A HD3  6  
ATOM 6779  H HE2  . LYS A 1 54 ? 6.245   -5.445  -12.980 1.00 0.00 ? 55 LYS A HE2  6  
ATOM 6780  H HE3  . LYS A 1 54 ? 5.028   -5.735  -11.736 1.00 0.00 ? 55 LYS A HE3  6  
ATOM 6781  H HZ1  . LYS A 1 54 ? 6.287   -3.382  -11.040 1.00 0.00 ? 55 LYS A HZ1  6  
ATOM 6782  H HZ2  . LYS A 1 54 ? 6.031   -3.271  -12.713 1.00 0.00 ? 55 LYS A HZ2  6  
ATOM 6783  H HZ3  . LYS A 1 54 ? 4.720   -3.558  -11.671 1.00 0.00 ? 55 LYS A HZ3  6  
ATOM 6784  N N    . ALA A 1 55 ? 8.966   -5.601  -8.028  1.00 0.00 ? 56 ALA A N    6  
ATOM 6785  C CA   . ALA A 1 55 ? 8.174   -4.777  -7.075  1.00 0.00 ? 56 ALA A CA   6  
ATOM 6786  C C    . ALA A 1 55 ? 9.006   -3.564  -6.661  1.00 0.00 ? 56 ALA A C    6  
ATOM 6787  O O    . ALA A 1 55 ? 8.491   -2.484  -6.445  1.00 0.00 ? 56 ALA A O    6  
ATOM 6788  C CB   . ALA A 1 55 ? 7.832   -5.609  -5.838  1.00 0.00 ? 56 ALA A CB   6  
ATOM 6789  H H    . ALA A 1 55 ? 9.219   -6.508  -7.788  1.00 0.00 ? 56 ALA A H    6  
ATOM 6790  H HA   . ALA A 1 55 ? 7.261   -4.451  -7.556  1.00 0.00 ? 56 ALA A HA   6  
ATOM 6791  H HB1  . ALA A 1 55 ? 8.465   -6.483  -5.805  1.00 0.00 ? 56 ALA A HB1  6  
ATOM 6792  H HB2  . ALA A 1 55 ? 7.991   -5.016  -4.949  1.00 0.00 ? 56 ALA A HB2  6  
ATOM 6793  H HB3  . ALA A 1 55 ? 6.798   -5.917  -5.886  1.00 0.00 ? 56 ALA A HB3  6  
ATOM 6794  N N    . ALA A 1 56 ? 10.296  -3.737  -6.556  1.00 0.00 ? 57 ALA A N    6  
ATOM 6795  C CA   . ALA A 1 56 ? 11.174  -2.602  -6.164  1.00 0.00 ? 57 ALA A CA   6  
ATOM 6796  C C    . ALA A 1 56 ? 11.041  -1.484  -7.199  1.00 0.00 ? 57 ALA A C    6  
ATOM 6797  O O    . ALA A 1 56 ? 10.874  -0.329  -6.861  1.00 0.00 ? 57 ALA A O    6  
ATOM 6798  C CB   . ALA A 1 56 ? 12.626  -3.079  -6.113  1.00 0.00 ? 57 ALA A CB   6  
ATOM 6799  H H    . ALA A 1 56 ? 10.687  -4.616  -6.741  1.00 0.00 ? 57 ALA A H    6  
ATOM 6800  H HA   . ALA A 1 56 ? 10.879  -2.235  -5.192  1.00 0.00 ? 57 ALA A HA   6  
ATOM 6801  H HB1  . ALA A 1 56 ? 12.690  -3.979  -5.518  1.00 0.00 ? 57 ALA A HB1  6  
ATOM 6802  H HB2  . ALA A 1 56 ? 12.971  -3.286  -7.115  1.00 0.00 ? 57 ALA A HB2  6  
ATOM 6803  H HB3  . ALA A 1 56 ? 13.242  -2.310  -5.672  1.00 0.00 ? 57 ALA A HB3  6  
ATOM 6804  N N    . LYS A 1 57 ? 11.113  -1.819  -8.458  1.00 0.00 ? 58 LYS A N    6  
ATOM 6805  C CA   . LYS A 1 57 ? 10.990  -0.775  -9.513  1.00 0.00 ? 58 LYS A CA   6  
ATOM 6806  C C    . LYS A 1 57 ? 9.713   0.034   -9.278  1.00 0.00 ? 58 LYS A C    6  
ATOM 6807  O O    . LYS A 1 57 ? 9.747   1.245   -9.192  1.00 0.00 ? 58 LYS A O    6  
ATOM 6808  C CB   . LYS A 1 57 ? 10.931  -1.439  -10.891 1.00 0.00 ? 58 LYS A CB   6  
ATOM 6809  C CG   . LYS A 1 57 ? 11.512  -0.489  -11.940 1.00 0.00 ? 58 LYS A CG   6  
ATOM 6810  C CD   . LYS A 1 57 ? 13.018  -0.730  -12.070 1.00 0.00 ? 58 LYS A CD   6  
ATOM 6811  C CE   . LYS A 1 57 ? 13.777  0.333   -11.272 1.00 0.00 ? 58 LYS A CE   6  
ATOM 6812  N NZ   . LYS A 1 57 ? 14.811  0.964   -12.141 1.00 0.00 ? 58 LYS A NZ   6  
ATOM 6813  H H    . LYS A 1 57 ? 11.249  -2.757  -8.709  1.00 0.00 ? 58 LYS A H    6  
ATOM 6814  H HA   . LYS A 1 57 ? 11.843  -0.112  -9.467  1.00 0.00 ? 58 LYS A HA   6  
ATOM 6815  H HB2  . LYS A 1 57 ? 11.506  -2.353  -10.873 1.00 0.00 ? 58 LYS A HB2  6  
ATOM 6816  H HB3  . LYS A 1 57 ? 9.905   -1.664  -11.139 1.00 0.00 ? 58 LYS A HB3  6  
ATOM 6817  H HG2  . LYS A 1 57 ? 11.034  -0.669  -12.892 1.00 0.00 ? 58 LYS A HG2  6  
ATOM 6818  H HG3  . LYS A 1 57 ? 11.338  0.533   -11.637 1.00 0.00 ? 58 LYS A HG3  6  
ATOM 6819  H HD2  . LYS A 1 57 ? 13.259  -1.711  -11.687 1.00 0.00 ? 58 LYS A HD2  6  
ATOM 6820  H HD3  . LYS A 1 57 ? 13.303  -0.669  -13.110 1.00 0.00 ? 58 LYS A HD3  6  
ATOM 6821  H HE2  . LYS A 1 57 ? 13.085  1.088   -10.931 1.00 0.00 ? 58 LYS A HE2  6  
ATOM 6822  H HE3  . LYS A 1 57 ? 14.255  -0.129  -10.422 1.00 0.00 ? 58 LYS A HE3  6  
ATOM 6823  H HZ1  . LYS A 1 57 ? 15.190  0.256   -12.801 1.00 0.00 ? 58 LYS A HZ1  6  
ATOM 6824  H HZ2  . LYS A 1 57 ? 14.382  1.746   -12.677 1.00 0.00 ? 58 LYS A HZ2  6  
ATOM 6825  H HZ3  . LYS A 1 57 ? 15.584  1.330   -11.550 1.00 0.00 ? 58 LYS A HZ3  6  
ATOM 6826  N N    . ALA A 1 58 ? 8.586   -0.617  -9.159  1.00 0.00 ? 59 ALA A N    6  
ATOM 6827  C CA   . ALA A 1 58 ? 7.330   0.144   -8.917  1.00 0.00 ? 59 ALA A CA   6  
ATOM 6828  C C    . ALA A 1 58 ? 7.490   0.939   -7.632  1.00 0.00 ? 59 ALA A C    6  
ATOM 6829  O O    . ALA A 1 58 ? 6.934   1.999   -7.477  1.00 0.00 ? 59 ALA A O    6  
ATOM 6830  C CB   . ALA A 1 58 ? 6.146   -0.816  -8.760  1.00 0.00 ? 59 ALA A CB   6  
ATOM 6831  H H    . ALA A 1 58 ? 8.568   -1.597  -9.220  1.00 0.00 ? 59 ALA A H    6  
ATOM 6832  H HA   . ALA A 1 58 ? 7.148   0.820   -9.742  1.00 0.00 ? 59 ALA A HA   6  
ATOM 6833  H HB1  . ALA A 1 58 ? 6.503   -1.775  -8.415  1.00 0.00 ? 59 ALA A HB1  6  
ATOM 6834  H HB2  . ALA A 1 58 ? 5.447   -0.410  -8.035  1.00 0.00 ? 59 ALA A HB2  6  
ATOM 6835  H HB3  . ALA A 1 58 ? 5.649   -0.935  -9.710  1.00 0.00 ? 59 ALA A HB3  6  
ATOM 6836  N N    . LYS A 1 59 ? 8.252   0.430   -6.707  1.00 0.00 ? 60 LYS A N    6  
ATOM 6837  C CA   . LYS A 1 59 ? 8.457   1.134   -5.425  1.00 0.00 ? 60 LYS A CA   6  
ATOM 6838  C C    . LYS A 1 59 ? 9.070   2.500   -5.675  1.00 0.00 ? 60 LYS A C    6  
ATOM 6839  O O    . LYS A 1 59 ? 8.634   3.493   -5.143  1.00 0.00 ? 60 LYS A O    6  
ATOM 6840  C CB   . LYS A 1 59 ? 9.416   0.303   -4.592  1.00 0.00 ? 60 LYS A CB   6  
ATOM 6841  C CG   . LYS A 1 59 ? 8.814   0.041   -3.211  1.00 0.00 ? 60 LYS A CG   6  
ATOM 6842  C CD   . LYS A 1 59 ? 9.452   -1.210  -2.604  1.00 0.00 ? 60 LYS A CD   6  
ATOM 6843  C CE   . LYS A 1 59 ? 8.399   -1.991  -1.817  1.00 0.00 ? 60 LYS A CE   6  
ATOM 6844  N NZ   . LYS A 1 59 ? 9.035   -2.623  -0.626  1.00 0.00 ? 60 LYS A NZ   6  
ATOM 6845  H H    . LYS A 1 59 ? 8.699   -0.428  -6.854  1.00 0.00 ? 60 LYS A H    6  
ATOM 6846  H HA   . LYS A 1 59 ? 7.518   1.245   -4.910  1.00 0.00 ? 60 LYS A HA   6  
ATOM 6847  H HB2  . LYS A 1 59 ? 9.596   -0.632  -5.099  1.00 0.00 ? 60 LYS A HB2  6  
ATOM 6848  H HB3  . LYS A 1 59 ? 10.341  0.831   -4.493  1.00 0.00 ? 60 LYS A HB3  6  
ATOM 6849  H HG2  . LYS A 1 59 ? 9.004   0.891   -2.569  1.00 0.00 ? 60 LYS A HG2  6  
ATOM 6850  H HG3  . LYS A 1 59 ? 7.749   -0.109  -3.304  1.00 0.00 ? 60 LYS A HG3  6  
ATOM 6851  H HD2  . LYS A 1 59 ? 9.846   -1.832  -3.396  1.00 0.00 ? 60 LYS A HD2  6  
ATOM 6852  H HD3  . LYS A 1 59 ? 10.253  -0.920  -1.941  1.00 0.00 ? 60 LYS A HD3  6  
ATOM 6853  H HE2  . LYS A 1 59 ? 7.619   -1.317  -1.493  1.00 0.00 ? 60 LYS A HE2  6  
ATOM 6854  H HE3  . LYS A 1 59 ? 7.973   -2.757  -2.447  1.00 0.00 ? 60 LYS A HE3  6  
ATOM 6855  H HZ1  . LYS A 1 59 ? 9.625   -1.922  -0.135  1.00 0.00 ? 60 LYS A HZ1  6  
ATOM 6856  H HZ2  . LYS A 1 59 ? 8.297   -2.966  0.020   1.00 0.00 ? 60 LYS A HZ2  6  
ATOM 6857  H HZ3  . LYS A 1 59 ? 9.627   -3.422  -0.933  1.00 0.00 ? 60 LYS A HZ3  6  
ATOM 6858  N N    . ASP A 1 60 ? 10.092  2.555   -6.468  1.00 0.00 ? 61 ASP A N    6  
ATOM 6859  C CA   . ASP A 1 60 ? 10.738  3.868   -6.739  1.00 0.00 ? 61 ASP A CA   6  
ATOM 6860  C C    . ASP A 1 60 ? 9.794   4.746   -7.564  1.00 0.00 ? 61 ASP A C    6  
ATOM 6861  O O    . ASP A 1 60 ? 9.547   5.889   -7.233  1.00 0.00 ? 61 ASP A O    6  
ATOM 6862  C CB   . ASP A 1 60 ? 12.045  3.646   -7.507  1.00 0.00 ? 61 ASP A CB   6  
ATOM 6863  C CG   . ASP A 1 60 ? 13.166  3.321   -6.520  1.00 0.00 ? 61 ASP A CG   6  
ATOM 6864  O OD1  . ASP A 1 60 ? 13.157  2.226   -5.982  1.00 0.00 ? 61 ASP A OD1  6  
ATOM 6865  O OD2  . ASP A 1 60 ? 14.017  4.172   -6.319  1.00 0.00 ? 61 ASP A OD2  6  
ATOM 6866  H H    . ASP A 1 60 ? 10.441  1.730   -6.874  1.00 0.00 ? 61 ASP A H    6  
ATOM 6867  H HA   . ASP A 1 60 ? 10.946  4.360   -5.801  1.00 0.00 ? 61 ASP A HA   6  
ATOM 6868  H HB2  . ASP A 1 60 ? 11.920  2.822   -8.199  1.00 0.00 ? 61 ASP A HB2  6  
ATOM 6869  H HB3  . ASP A 1 60 ? 12.297  4.541   -8.055  1.00 0.00 ? 61 ASP A HB3  6  
ATOM 6870  N N    . ASP A 1 61 ? 9.265   4.225   -8.633  1.00 0.00 ? 62 ASP A N    6  
ATOM 6871  C CA   . ASP A 1 61 ? 8.336   5.029   -9.478  1.00 0.00 ? 62 ASP A CA   6  
ATOM 6872  C C    . ASP A 1 61 ? 7.017   5.240   -8.733  1.00 0.00 ? 62 ASP A C    6  
ATOM 6873  O O    . ASP A 1 61 ? 6.157   5.977   -9.168  1.00 0.00 ? 62 ASP A O    6  
ATOM 6874  C CB   . ASP A 1 61 ? 8.057   4.269   -10.772 1.00 0.00 ? 62 ASP A CB   6  
ATOM 6875  C CG   . ASP A 1 61 ? 9.210   4.488   -11.753 1.00 0.00 ? 62 ASP A CG   6  
ATOM 6876  O OD1  . ASP A 1 61 ? 10.348  4.463   -11.314 1.00 0.00 ? 62 ASP A OD1  6  
ATOM 6877  O OD2  . ASP A 1 61 ? 8.935   4.676   -12.927 1.00 0.00 ? 62 ASP A OD2  6  
ATOM 6878  H H    . ASP A 1 61 ? 9.476   3.301   -8.883  1.00 0.00 ? 62 ASP A H    6  
ATOM 6879  H HA   . ASP A 1 61 ? 8.784   5.984   -9.705  1.00 0.00 ? 62 ASP A HA   6  
ATOM 6880  H HB2  . ASP A 1 61 ? 7.961   3.214   -10.551 1.00 0.00 ? 62 ASP A HB2  6  
ATOM 6881  H HB3  . ASP A 1 61 ? 7.139   4.630   -11.209 1.00 0.00 ? 62 ASP A HB3  6  
ATOM 6882  N N    . TYR A 1 62 ? 6.844   4.577   -7.627  1.00 0.00 ? 63 TYR A N    6  
ATOM 6883  C CA   . TYR A 1 62 ? 5.575   4.709   -6.862  1.00 0.00 ? 63 TYR A CA   6  
ATOM 6884  C C    . TYR A 1 62 ? 5.704   5.788   -5.784  1.00 0.00 ? 63 TYR A C    6  
ATOM 6885  O O    . TYR A 1 62 ? 4.850   6.636   -5.643  1.00 0.00 ? 63 TYR A O    6  
ATOM 6886  C CB   . TYR A 1 62 ? 5.280   3.366   -6.217  1.00 0.00 ? 63 TYR A CB   6  
ATOM 6887  C CG   . TYR A 1 62 ? 4.172   3.498   -5.224  1.00 0.00 ? 63 TYR A CG   6  
ATOM 6888  C CD1  . TYR A 1 62 ? 2.881   3.806   -5.653  1.00 0.00 ? 63 TYR A CD1  6  
ATOM 6889  C CD2  . TYR A 1 62 ? 4.434   3.278   -3.877  1.00 0.00 ? 63 TYR A CD2  6  
ATOM 6890  C CE1  . TYR A 1 62 ? 1.844   3.901   -4.725  1.00 0.00 ? 63 TYR A CE1  6  
ATOM 6891  C CE2  . TYR A 1 62 ? 3.401   3.361   -2.943  1.00 0.00 ? 63 TYR A CE2  6  
ATOM 6892  C CZ   . TYR A 1 62 ? 2.101   3.677   -3.365  1.00 0.00 ? 63 TYR A CZ   6  
ATOM 6893  O OH   . TYR A 1 62 ? 1.077   3.759   -2.445  1.00 0.00 ? 63 TYR A OH   6  
ATOM 6894  H H    . TYR A 1 62 ? 7.543   3.971   -7.305  1.00 0.00 ? 63 TYR A H    6  
ATOM 6895  H HA   . TYR A 1 62 ? 4.771   4.965   -7.532  1.00 0.00 ? 63 TYR A HA   6  
ATOM 6896  H HB2  . TYR A 1 62 ? 4.991   2.661   -6.981  1.00 0.00 ? 63 TYR A HB2  6  
ATOM 6897  H HB3  . TYR A 1 62 ? 6.168   3.007   -5.718  1.00 0.00 ? 63 TYR A HB3  6  
ATOM 6898  H HD1  . TYR A 1 62 ? 2.686   3.978   -6.702  1.00 0.00 ? 63 TYR A HD1  6  
ATOM 6899  H HD2  . TYR A 1 62 ? 5.442   3.048   -3.557  1.00 0.00 ? 63 TYR A HD2  6  
ATOM 6900  H HE1  . TYR A 1 62 ? 0.849   4.144   -5.057  1.00 0.00 ? 63 TYR A HE1  6  
ATOM 6901  H HE2  . TYR A 1 62 ? 3.604   3.179   -1.900  1.00 0.00 ? 63 TYR A HE2  6  
ATOM 6902  H HH   . TYR A 1 62 ? 0.633   4.602   -2.567  1.00 0.00 ? 63 TYR A HH   6  
ATOM 6903  N N    . ASP A 1 63 ? 6.758   5.772   -5.022  1.00 0.00 ? 64 ASP A N    6  
ATOM 6904  C CA   . ASP A 1 63 ? 6.920   6.802   -3.968  1.00 0.00 ? 64 ASP A CA   6  
ATOM 6905  C C    . ASP A 1 63 ? 7.222   8.134   -4.631  1.00 0.00 ? 64 ASP A C    6  
ATOM 6906  O O    . ASP A 1 63 ? 6.890   9.190   -4.130  1.00 0.00 ? 64 ASP A O    6  
ATOM 6907  C CB   . ASP A 1 63 ? 8.073   6.416   -3.070  1.00 0.00 ? 64 ASP A CB   6  
ATOM 6908  C CG   . ASP A 1 63 ? 7.875   7.028   -1.682  1.00 0.00 ? 64 ASP A CG   6  
ATOM 6909  O OD1  . ASP A 1 63 ? 6.802   6.855   -1.129  1.00 0.00 ? 64 ASP A OD1  6  
ATOM 6910  O OD2  . ASP A 1 63 ? 8.798   7.660   -1.196  1.00 0.00 ? 64 ASP A OD2  6  
ATOM 6911  H H    . ASP A 1 63 ? 7.443   5.090   -5.146  1.00 0.00 ? 64 ASP A H    6  
ATOM 6912  H HA   . ASP A 1 63 ? 6.027   6.867   -3.383  1.00 0.00 ? 64 ASP A HA   6  
ATOM 6913  H HB2  . ASP A 1 63 ? 8.095   5.352   -2.995  1.00 0.00 ? 64 ASP A HB2  6  
ATOM 6914  H HB3  . ASP A 1 63 ? 8.997   6.773   -3.493  1.00 0.00 ? 64 ASP A HB3  6  
ATOM 6915  N N    . ARG A 1 64 ? 7.867   8.082   -5.757  1.00 0.00 ? 65 ARG A N    6  
ATOM 6916  C CA   . ARG A 1 64 ? 8.219   9.333   -6.472  1.00 0.00 ? 65 ARG A CA   6  
ATOM 6917  C C    . ARG A 1 64 ? 7.057   9.790   -7.361  1.00 0.00 ? 65 ARG A C    6  
ATOM 6918  O O    . ARG A 1 64 ? 6.772   10.966  -7.464  1.00 0.00 ? 65 ARG A O    6  
ATOM 6919  C CB   . ARG A 1 64 ? 9.456   9.094   -7.338  1.00 0.00 ? 65 ARG A CB   6  
ATOM 6920  C CG   . ARG A 1 64 ? 10.121  10.433  -7.658  1.00 0.00 ? 65 ARG A CG   6  
ATOM 6921  C CD   . ARG A 1 64 ? 10.837  10.335  -9.005  1.00 0.00 ? 65 ARG A CD   6  
ATOM 6922  N NE   . ARG A 1 64 ? 12.050  11.199  -8.988  1.00 0.00 ? 65 ARG A NE   6  
ATOM 6923  C CZ   . ARG A 1 64 ? 12.947  11.046  -8.053  1.00 0.00 ? 65 ARG A CZ   6  
ATOM 6924  N NH1  . ARG A 1 64 ? 13.912  10.179  -8.208  1.00 0.00 ? 65 ARG A NH1  6  
ATOM 6925  N NH2  . ARG A 1 64 ? 12.881  11.761  -6.964  1.00 0.00 ? 65 ARG A NH2  6  
ATOM 6926  H H    . ARG A 1 64 ? 8.132   7.214   -6.125  1.00 0.00 ? 65 ARG A H    6  
ATOM 6927  H HA   . ARG A 1 64 ? 8.434   10.094  -5.748  1.00 0.00 ? 65 ARG A HA   6  
ATOM 6928  H HB2  . ARG A 1 64 ? 10.153  8.463   -6.804  1.00 0.00 ? 65 ARG A HB2  6  
ATOM 6929  H HB3  . ARG A 1 64 ? 9.163   8.611   -8.257  1.00 0.00 ? 65 ARG A HB3  6  
ATOM 6930  H HG2  . ARG A 1 64 ? 9.368   11.206  -7.703  1.00 0.00 ? 65 ARG A HG2  6  
ATOM 6931  H HG3  . ARG A 1 64 ? 10.839  10.674  -6.888  1.00 0.00 ? 65 ARG A HG3  6  
ATOM 6932  H HD2  . ARG A 1 64 ? 11.127  9.310   -9.184  1.00 0.00 ? 65 ARG A HD2  6  
ATOM 6933  H HD3  . ARG A 1 64 ? 10.171  10.663  -9.789  1.00 0.00 ? 65 ARG A HD3  6  
ATOM 6934  H HE   . ARG A 1 64 ? 12.174  11.884  -9.678  1.00 0.00 ? 65 ARG A HE   6  
ATOM 6935  H HH11 . ARG A 1 64 ? 13.964  9.633   -9.044  1.00 0.00 ? 65 ARG A HH11 6  
ATOM 6936  H HH12 . ARG A 1 64 ? 14.598  10.063  -7.490  1.00 0.00 ? 65 ARG A HH12 6  
ATOM 6937  H HH21 . ARG A 1 64 ? 12.144  12.426  -6.846  1.00 0.00 ? 65 ARG A HH21 6  
ATOM 6938  H HH22 . ARG A 1 64 ? 13.567  11.642  -6.246  1.00 0.00 ? 65 ARG A HH22 6  
ATOM 6939  N N    . ALA A 1 65 ? 6.391   8.875   -8.012  1.00 0.00 ? 66 ALA A N    6  
ATOM 6940  C CA   . ALA A 1 65 ? 5.260   9.273   -8.901  1.00 0.00 ? 66 ALA A CA   6  
ATOM 6941  C C    . ALA A 1 65 ? 4.048   9.663   -8.067  1.00 0.00 ? 66 ALA A C    6  
ATOM 6942  O O    . ALA A 1 65 ? 3.493   10.721  -8.254  1.00 0.00 ? 66 ALA A O    6  
ATOM 6943  C CB   . ALA A 1 65 ? 4.892   8.110   -9.824  1.00 0.00 ? 66 ALA A CB   6  
ATOM 6944  H H    . ALA A 1 65 ? 6.640   7.931   -7.923  1.00 0.00 ? 66 ALA A H    6  
ATOM 6945  H HA   . ALA A 1 65 ? 5.553   10.125  -9.497  1.00 0.00 ? 66 ALA A HA   6  
ATOM 6946  H HB1  . ALA A 1 65 ? 5.787   7.722   -10.290 1.00 0.00 ? 66 ALA A HB1  6  
ATOM 6947  H HB2  . ALA A 1 65 ? 4.419   7.329   -9.249  1.00 0.00 ? 66 ALA A HB2  6  
ATOM 6948  H HB3  . ALA A 1 65 ? 4.212   8.458   -10.587 1.00 0.00 ? 66 ALA A HB3  6  
ATOM 6949  N N    . VAL A 1 66 ? 3.625   8.829   -7.157  1.00 0.00 ? 67 VAL A N    6  
ATOM 6950  C CA   . VAL A 1 66 ? 2.440   9.190   -6.337  1.00 0.00 ? 67 VAL A CA   6  
ATOM 6951  C C    . VAL A 1 66 ? 2.562   10.638  -5.892  1.00 0.00 ? 67 VAL A C    6  
ATOM 6952  O O    . VAL A 1 66 ? 1.615   11.373  -5.899  1.00 0.00 ? 67 VAL A O    6  
ATOM 6953  C CB   . VAL A 1 66 ? 2.350   8.317   -5.112  1.00 0.00 ? 67 VAL A CB   6  
ATOM 6954  C CG1  . VAL A 1 66 ? 2.301   6.852   -5.519  1.00 0.00 ? 67 VAL A CG1  6  
ATOM 6955  C CG2  . VAL A 1 66 ? 3.552   8.598   -4.253  1.00 0.00 ? 67 VAL A CG2  6  
ATOM 6956  H H    . VAL A 1 66 ? 4.077   7.979   -7.020  1.00 0.00 ? 67 VAL A H    6  
ATOM 6957  H HA   . VAL A 1 66 ? 1.561   9.062   -6.917  1.00 0.00 ? 67 VAL A HA   6  
ATOM 6958  H HB   . VAL A 1 66 ? 1.464   8.570   -4.572  1.00 0.00 ? 67 VAL A HB   6  
ATOM 6959  H HG11 . VAL A 1 66 ? 2.638   6.754   -6.541  1.00 0.00 ? 67 VAL A HG11 6  
ATOM 6960  H HG12 . VAL A 1 66 ? 2.941   6.275   -4.868  1.00 0.00 ? 67 VAL A HG12 6  
ATOM 6961  H HG13 . VAL A 1 66 ? 1.287   6.495   -5.439  1.00 0.00 ? 67 VAL A HG13 6  
ATOM 6962  H HG21 . VAL A 1 66 ? 4.421   8.668   -4.884  1.00 0.00 ? 67 VAL A HG21 6  
ATOM 6963  H HG22 . VAL A 1 66 ? 3.393   9.535   -3.745  1.00 0.00 ? 67 VAL A HG22 6  
ATOM 6964  H HG23 . VAL A 1 66 ? 3.677   7.808   -3.534  1.00 0.00 ? 67 VAL A HG23 6  
ATOM 6965  N N    . LYS A 1 67 ? 3.733   11.049  -5.508  1.00 0.00 ? 68 LYS A N    6  
ATOM 6966  C CA   . LYS A 1 67 ? 3.917   12.466  -5.075  1.00 0.00 ? 68 LYS A CA   6  
ATOM 6967  C C    . LYS A 1 67 ? 3.295   13.376  -6.136  1.00 0.00 ? 68 LYS A C    6  
ATOM 6968  O O    . LYS A 1 67 ? 2.461   14.211  -5.849  1.00 0.00 ? 68 LYS A O    6  
ATOM 6969  C CB   . LYS A 1 67 ? 5.412   12.772  -4.949  1.00 0.00 ? 68 LYS A CB   6  
ATOM 6970  C CG   . LYS A 1 67 ? 5.703   13.345  -3.562  1.00 0.00 ? 68 LYS A CG   6  
ATOM 6971  C CD   . LYS A 1 67 ? 6.979   14.187  -3.614  1.00 0.00 ? 68 LYS A CD   6  
ATOM 6972  C CE   . LYS A 1 67 ? 6.663   15.621  -3.187  1.00 0.00 ? 68 LYS A CE   6  
ATOM 6973  N NZ   . LYS A 1 67 ? 7.724   16.109  -2.262  1.00 0.00 ? 68 LYS A NZ   6  
ATOM 6974  H H    . LYS A 1 67 ? 4.487   10.430  -5.510  1.00 0.00 ? 68 LYS A H    6  
ATOM 6975  H HA   . LYS A 1 67 ? 3.429   12.624  -4.125  1.00 0.00 ? 68 LYS A HA   6  
ATOM 6976  H HB2  . LYS A 1 67 ? 5.978   11.863  -5.090  1.00 0.00 ? 68 LYS A HB2  6  
ATOM 6977  H HB3  . LYS A 1 67 ? 5.695   13.494  -5.701  1.00 0.00 ? 68 LYS A HB3  6  
ATOM 6978  H HG2  . LYS A 1 67 ? 4.875   13.965  -3.247  1.00 0.00 ? 68 LYS A HG2  6  
ATOM 6979  H HG3  . LYS A 1 67 ? 5.836   12.537  -2.859  1.00 0.00 ? 68 LYS A HG3  6  
ATOM 6980  H HD2  . LYS A 1 67 ? 7.716   13.765  -2.945  1.00 0.00 ? 68 LYS A HD2  6  
ATOM 6981  H HD3  . LYS A 1 67 ? 7.368   14.191  -4.621  1.00 0.00 ? 68 LYS A HD3  6  
ATOM 6982  H HE2  . LYS A 1 67 ? 6.625   16.256  -4.059  1.00 0.00 ? 68 LYS A HE2  6  
ATOM 6983  H HE3  . LYS A 1 67 ? 5.708   15.644  -2.684  1.00 0.00 ? 68 LYS A HE3  6  
ATOM 6984  H HZ1  . LYS A 1 67 ? 8.596   15.565  -2.418  1.00 0.00 ? 68 LYS A HZ1  6  
ATOM 6985  H HZ2  . LYS A 1 67 ? 7.908   17.115  -2.445  1.00 0.00 ? 68 LYS A HZ2  6  
ATOM 6986  H HZ3  . LYS A 1 67 ? 7.409   15.987  -1.278  1.00 0.00 ? 68 LYS A HZ3  6  
ATOM 6987  N N    . GLU A 1 68 ? 3.688   13.196  -7.366  1.00 0.00 ? 69 GLU A N    6  
ATOM 6988  C CA   . GLU A 1 68 ? 3.120   14.016  -8.474  1.00 0.00 ? 69 GLU A CA   6  
ATOM 6989  C C    . GLU A 1 68 ? 1.601   13.817  -8.491  1.00 0.00 ? 69 GLU A C    6  
ATOM 6990  O O    . GLU A 1 68 ? 0.827   14.733  -8.692  1.00 0.00 ? 69 GLU A O    6  
ATOM 6991  C CB   . GLU A 1 68 ? 3.718   13.515  -9.793  1.00 0.00 ? 69 GLU A CB   6  
ATOM 6992  C CG   . GLU A 1 68 ? 4.757   14.520  -10.296 1.00 0.00 ? 69 GLU A CG   6  
ATOM 6993  C CD   . GLU A 1 68 ? 4.774   14.514  -11.826 1.00 0.00 ? 69 GLU A CD   6  
ATOM 6994  O OE1  . GLU A 1 68 ? 3.849   13.969  -12.406 1.00 0.00 ? 69 GLU A OE1  6  
ATOM 6995  O OE2  . GLU A 1 68 ? 5.711   15.053  -12.390 1.00 0.00 ? 69 GLU A OE2  6  
ATOM 6996  H H    . GLU A 1 68 ? 4.351   12.503  -7.567  1.00 0.00 ? 69 GLU A H    6  
ATOM 6997  H HA   . GLU A 1 68 ? 3.359   15.058  -8.329  1.00 0.00 ? 69 GLU A HA   6  
ATOM 6998  H HB2  . GLU A 1 68 ? 4.196   12.550  -9.630  1.00 0.00 ? 69 GLU A HB2  6  
ATOM 6999  H HB3  . GLU A 1 68 ? 2.935   13.410  -10.527 1.00 0.00 ? 69 GLU A HB3  6  
ATOM 7000  H HG2  . GLU A 1 68 ? 4.503   15.509  -9.941  1.00 0.00 ? 69 GLU A HG2  6  
ATOM 7001  H HG3  . GLU A 1 68 ? 5.733   14.244  -9.926  1.00 0.00 ? 69 GLU A HG3  6  
ATOM 7002  N N    . PHE A 1 69 ? 1.199   12.608  -8.262  1.00 0.00 ? 70 PHE A N    6  
ATOM 7003  C CA   . PHE A 1 69 ? -0.238  12.224  -8.223  1.00 0.00 ? 70 PHE A CA   6  
ATOM 7004  C C    . PHE A 1 69 ? -0.937  12.865  -7.025  1.00 0.00 ? 70 PHE A C    6  
ATOM 7005  O O    . PHE A 1 69 ? -2.138  13.050  -7.010  1.00 0.00 ? 70 PHE A O    6  
ATOM 7006  C CB   . PHE A 1 69 ? -0.261  10.734  -8.029  1.00 0.00 ? 70 PHE A CB   6  
ATOM 7007  C CG   . PHE A 1 69 ? -1.580  10.337  -7.496  1.00 0.00 ? 70 PHE A CG   6  
ATOM 7008  C CD1  . PHE A 1 69 ? -2.621  10.144  -8.374  1.00 0.00 ? 70 PHE A CD1  6  
ATOM 7009  C CD2  . PHE A 1 69 ? -1.748  10.187  -6.127  1.00 0.00 ? 70 PHE A CD2  6  
ATOM 7010  C CE1  . PHE A 1 69 ? -3.876  9.786   -7.895  1.00 0.00 ? 70 PHE A CE1  6  
ATOM 7011  C CE2  . PHE A 1 69 ? -3.003  9.827   -5.625  1.00 0.00 ? 70 PHE A CE2  6  
ATOM 7012  C CZ   . PHE A 1 69 ? -4.074  9.625   -6.513  1.00 0.00 ? 70 PHE A CZ   6  
ATOM 7013  H H    . PHE A 1 69 ? 1.869   11.918  -8.097  1.00 0.00 ? 70 PHE A H    6  
ATOM 7014  H HA   . PHE A 1 69 ? -0.750  12.459  -9.142  1.00 0.00 ? 70 PHE A HA   6  
ATOM 7015  H HB2  . PHE A 1 69 ? -0.095  10.251  -8.974  1.00 0.00 ? 70 PHE A HB2  6  
ATOM 7016  H HB3  . PHE A 1 69 ? 0.502   10.465  -7.322  1.00 0.00 ? 70 PHE A HB3  6  
ATOM 7017  H HD1  . PHE A 1 69 ? -2.448  10.281  -9.432  1.00 0.00 ? 70 PHE A HD1  6  
ATOM 7018  H HD2  . PHE A 1 69 ? -0.900  10.356  -5.460  1.00 0.00 ? 70 PHE A HD2  6  
ATOM 7019  H HE1  . PHE A 1 69 ? -4.688  9.637   -8.583  1.00 0.00 ? 70 PHE A HE1  6  
ATOM 7020  H HE2  . PHE A 1 69 ? -3.148  9.709   -4.563  1.00 0.00 ? 70 PHE A HE2  6  
ATOM 7021  H HZ   . PHE A 1 69 ? -5.045  9.347   -6.134  1.00 0.00 ? 70 PHE A HZ   6  
ATOM 7022  N N    . GLU A 1 70 ? -0.194  13.162  -6.012  1.00 0.00 ? 71 GLU A N    6  
ATOM 7023  C CA   . GLU A 1 70 ? -0.796  13.743  -4.789  1.00 0.00 ? 71 GLU A CA   6  
ATOM 7024  C C    . GLU A 1 70 ? -0.661  15.258  -4.860  1.00 0.00 ? 71 GLU A C    6  
ATOM 7025  O O    . GLU A 1 70 ? -1.226  15.994  -4.076  1.00 0.00 ? 71 GLU A O    6  
ATOM 7026  C CB   . GLU A 1 70 ? -0.050  13.213  -3.561  1.00 0.00 ? 71 GLU A CB   6  
ATOM 7027  C CG   . GLU A 1 70 ? -0.172  11.684  -3.499  1.00 0.00 ? 71 GLU A CG   6  
ATOM 7028  C CD   . GLU A 1 70 ? -0.081  11.223  -2.043  1.00 0.00 ? 71 GLU A CD   6  
ATOM 7029  O OE1  . GLU A 1 70 ? -1.108  11.194  -1.386  1.00 0.00 ? 71 GLU A OE1  6  
ATOM 7030  O OE2  . GLU A 1 70 ? 1.015   10.908  -1.611  1.00 0.00 ? 71 GLU A OE2  6  
ATOM 7031  H H    . GLU A 1 70 ? 0.763   12.994  -6.051  1.00 0.00 ? 71 GLU A H    6  
ATOM 7032  H HA   . GLU A 1 70 ? -1.835  13.455  -4.735  1.00 0.00 ? 71 GLU A HA   6  
ATOM 7033  H HB2  . GLU A 1 70 ? 0.993   13.489  -3.628  1.00 0.00 ? 71 GLU A HB2  6  
ATOM 7034  H HB3  . GLU A 1 70 ? -0.479  13.642  -2.667  1.00 0.00 ? 71 GLU A HB3  6  
ATOM 7035  H HG2  . GLU A 1 70 ? -1.124  11.381  -3.914  1.00 0.00 ? 71 GLU A HG2  6  
ATOM 7036  H HG3  . GLU A 1 70 ? 0.627   11.230  -4.068  1.00 0.00 ? 71 GLU A HG3  6  
ATOM 7037  N N    . ALA A 1 71 ? 0.107   15.716  -5.804  1.00 0.00 ? 72 ALA A N    6  
ATOM 7038  C CA   . ALA A 1 71 ? 0.334   17.165  -5.976  1.00 0.00 ? 72 ALA A CA   6  
ATOM 7039  C C    . ALA A 1 71 ? -0.855  17.793  -6.708  1.00 0.00 ? 72 ALA A C    6  
ATOM 7040  O O    . ALA A 1 71 ? -1.125  18.972  -6.578  1.00 0.00 ? 72 ALA A O    6  
ATOM 7041  C CB   . ALA A 1 71 ? 1.600   17.321  -6.808  1.00 0.00 ? 72 ALA A CB   6  
ATOM 7042  H H    . ALA A 1 71 ? 0.554   15.090  -6.410  1.00 0.00 ? 72 ALA A H    6  
ATOM 7043  H HA   . ALA A 1 71 ? 0.469   17.635  -5.015  1.00 0.00 ? 72 ALA A HA   6  
ATOM 7044  H HB1  . ALA A 1 71 ? 1.996   16.332  -7.024  1.00 0.00 ? 72 ALA A HB1  6  
ATOM 7045  H HB2  . ALA A 1 71 ? 1.366   17.827  -7.733  1.00 0.00 ? 72 ALA A HB2  6  
ATOM 7046  H HB3  . ALA A 1 71 ? 2.330   17.891  -6.255  1.00 0.00 ? 72 ALA A HB3  6  
ATOM 7047  N N    . ASN A 1 72 ? -1.567  17.016  -7.478  1.00 0.00 ? 73 ASN A N    6  
ATOM 7048  C CA   . ASN A 1 72 ? -2.737  17.569  -8.219  1.00 0.00 ? 73 ASN A CA   6  
ATOM 7049  C C    . ASN A 1 72 ? -3.967  16.695  -7.961  1.00 0.00 ? 73 ASN A C    6  
ATOM 7050  O O    . ASN A 1 72 ? -4.499  16.078  -8.862  1.00 0.00 ? 73 ASN A O    6  
ATOM 7051  C CB   . ASN A 1 72 ? -2.431  17.581  -9.719  1.00 0.00 ? 73 ASN A CB   6  
ATOM 7052  C CG   . ASN A 1 72 ? -1.196  18.430  -9.987  1.00 0.00 ? 73 ASN A CG   6  
ATOM 7053  O OD1  . ASN A 1 72 ? -0.876  19.323  -9.228  1.00 0.00 ? 73 ASN A OD1  6  
ATOM 7054  N ND2  . ASN A 1 72 ? -0.481  18.182  -11.045 1.00 0.00 ? 73 ASN A ND2  6  
ATOM 7055  H H    . ASN A 1 72 ? -1.332  16.069  -7.570  1.00 0.00 ? 73 ASN A H    6  
ATOM 7056  H HA   . ASN A 1 72 ? -2.933  18.577  -7.884  1.00 0.00 ? 73 ASN A HA   6  
ATOM 7057  H HB2  . ASN A 1 72 ? -2.248  16.574  -10.060 1.00 0.00 ? 73 ASN A HB2  6  
ATOM 7058  H HB3  . ASN A 1 72 ? -3.268  17.996  -10.256 1.00 0.00 ? 73 ASN A HB3  6  
ATOM 7059  H HD21 . ASN A 1 72 ? -0.741  17.461  -11.655 1.00 0.00 ? 73 ASN A HD21 6  
ATOM 7060  H HD22 . ASN A 1 72 ? 0.310   18.717  -11.233 1.00 0.00 ? 73 ASN A HD22 6  
ATOM 7061  N N    . GLY A 1 73 ? -4.427  16.640  -6.741  1.00 0.00 ? 74 GLY A N    6  
ATOM 7062  C CA   . GLY A 1 73 ? -5.624  15.805  -6.437  1.00 0.00 ? 74 GLY A CA   6  
ATOM 7063  C C    . GLY A 1 73 ? -5.754  15.627  -4.924  1.00 0.00 ? 74 GLY A C    6  
ATOM 7064  O O    . GLY A 1 73 ? -5.952  16.621  -4.244  1.00 0.00 ? 74 GLY A O    6  
ATOM 7065  O OXT  . GLY A 1 73 ? -5.657  14.499  -4.471  1.00 0.00 ? 74 GLY A OXT  6  
ATOM 7066  H H    . GLY A 1 73 ? -3.986  17.145  -6.027  1.00 0.00 ? 74 GLY A H    6  
ATOM 7067  H HA2  . GLY A 1 73 ? -6.509  16.294  -6.821  1.00 0.00 ? 74 GLY A HA2  6  
ATOM 7068  H HA3  . GLY A 1 73 ? -5.517  14.838  -6.903  1.00 0.00 ? 74 GLY A HA3  6  
ATOM 7069  N N    . SER A 1 1  ? 3.959   11.337  -15.909 1.00 0.00 ? 2  SER A N    7  
ATOM 7070  C CA   . SER A 1 1  ? 2.971   10.765  -14.951 1.00 0.00 ? 2  SER A CA   7  
ATOM 7071  C C    . SER A 1 1  ? 2.998   11.567  -13.649 1.00 0.00 ? 2  SER A C    7  
ATOM 7072  O O    . SER A 1 1  ? 4.033   12.038  -13.218 1.00 0.00 ? 2  SER A O    7  
ATOM 7073  C CB   . SER A 1 1  ? 3.331   9.307   -14.659 1.00 0.00 ? 2  SER A CB   7  
ATOM 7074  O OG   . SER A 1 1  ? 4.435   9.266   -13.765 1.00 0.00 ? 2  SER A OG   7  
ATOM 7075  H H    . SER A 1 1  ? 4.850   10.936  -15.991 1.00 0.00 ? 2  SER A H    7  
ATOM 7076  H HA   . SER A 1 1  ? 1.983   10.811  -15.382 1.00 0.00 ? 2  SER A HA   7  
ATOM 7077  H HB2  . SER A 1 1  ? 2.490   8.810   -14.206 1.00 0.00 ? 2  SER A HB2  7  
ATOM 7078  H HB3  . SER A 1 1  ? 3.585   8.809   -15.585 1.00 0.00 ? 2  SER A HB3  7  
ATOM 7079  H HG   . SER A 1 1  ? 4.245   8.615   -13.087 1.00 0.00 ? 2  SER A HG   7  
ATOM 7080  N N    . ASP A 1 2  ? 1.868   11.729  -13.017 1.00 0.00 ? 3  ASP A N    7  
ATOM 7081  C CA   . ASP A 1 2  ? 1.830   12.504  -11.745 1.00 0.00 ? 3  ASP A CA   7  
ATOM 7082  C C    . ASP A 1 2  ? 1.865   11.539  -10.557 1.00 0.00 ? 3  ASP A C    7  
ATOM 7083  O O    . ASP A 1 2  ? 2.759   11.584  -9.736  1.00 0.00 ? 3  ASP A O    7  
ATOM 7084  C CB   . ASP A 1 2  ? 0.545   13.335  -11.686 1.00 0.00 ? 3  ASP A CB   7  
ATOM 7085  C CG   . ASP A 1 2  ? 0.123   13.733  -13.102 1.00 0.00 ? 3  ASP A CG   7  
ATOM 7086  O OD1  . ASP A 1 2  ? 0.990   13.826  -13.953 1.00 0.00 ? 3  ASP A OD1  7  
ATOM 7087  O OD2  . ASP A 1 2  ? -1.062  13.937  -13.309 1.00 0.00 ? 3  ASP A OD2  7  
ATOM 7088  H H    . ASP A 1 2  ? 1.044   11.343  -13.380 1.00 0.00 ? 3  ASP A H    7  
ATOM 7089  H HA   . ASP A 1 2  ? 2.686   13.161  -11.698 1.00 0.00 ? 3  ASP A HA   7  
ATOM 7090  H HB2  . ASP A 1 2  ? -0.239  12.750  -11.226 1.00 0.00 ? 3  ASP A HB2  7  
ATOM 7091  H HB3  . ASP A 1 2  ? 0.720   14.226  -11.101 1.00 0.00 ? 3  ASP A HB3  7  
ATOM 7092  N N    . LYS A 1 3  ? 0.898   10.666  -10.461 1.00 0.00 ? 4  LYS A N    7  
ATOM 7093  C CA   . LYS A 1 3  ? 0.870   9.702   -9.335  1.00 0.00 ? 4  LYS A CA   7  
ATOM 7094  C C    . LYS A 1 3  ? 1.940   8.628   -9.566  1.00 0.00 ? 4  LYS A C    7  
ATOM 7095  O O    . LYS A 1 3  ? 2.302   8.353   -10.692 1.00 0.00 ? 4  LYS A O    7  
ATOM 7096  C CB   . LYS A 1 3  ? -0.518  9.071   -9.283  1.00 0.00 ? 4  LYS A CB   7  
ATOM 7097  C CG   . LYS A 1 3  ? -1.063  9.125   -7.854  1.00 0.00 ? 4  LYS A CG   7  
ATOM 7098  C CD   . LYS A 1 3  ? -1.509  7.727   -7.417  1.00 0.00 ? 4  LYS A CD   7  
ATOM 7099  C CE   . LYS A 1 3  ? -2.442  7.844   -6.210  1.00 0.00 ? 4  LYS A CE   7  
ATOM 7100  N NZ   . LYS A 1 3  ? -3.377  6.684   -6.188  1.00 0.00 ? 4  LYS A NZ   7  
ATOM 7101  H H    . LYS A 1 3  ? 0.186   10.641  -11.133 1.00 0.00 ? 4  LYS A H    7  
ATOM 7102  H HA   . LYS A 1 3  ? 1.067   10.216  -8.410  1.00 0.00 ? 4  LYS A HA   7  
ATOM 7103  H HB2  . LYS A 1 3  ? -1.182  9.615   -9.940  1.00 0.00 ? 4  LYS A HB2  7  
ATOM 7104  H HB3  . LYS A 1 3  ? -0.456  8.053   -9.608  1.00 0.00 ? 4  LYS A HB3  7  
ATOM 7105  H HG2  . LYS A 1 3  ? -0.291  9.483   -7.188  1.00 0.00 ? 4  LYS A HG2  7  
ATOM 7106  H HG3  . LYS A 1 3  ? -1.906  9.796   -7.817  1.00 0.00 ? 4  LYS A HG3  7  
ATOM 7107  H HD2  . LYS A 1 3  ? -2.031  7.246   -8.233  1.00 0.00 ? 4  LYS A HD2  7  
ATOM 7108  H HD3  . LYS A 1 3  ? -0.645  7.140   -7.146  1.00 0.00 ? 4  LYS A HD3  7  
ATOM 7109  H HE2  . LYS A 1 3  ? -1.857  7.851   -5.302  1.00 0.00 ? 4  LYS A HE2  7  
ATOM 7110  H HE3  . LYS A 1 3  ? -3.008  8.761   -6.280  1.00 0.00 ? 4  LYS A HE3  7  
ATOM 7111  H HZ1  . LYS A 1 3  ? -3.643  6.435   -7.162  1.00 0.00 ? 4  LYS A HZ1  7  
ATOM 7112  H HZ2  . LYS A 1 3  ? -2.911  5.871   -5.736  1.00 0.00 ? 4  LYS A HZ2  7  
ATOM 7113  H HZ3  . LYS A 1 3  ? -4.232  6.937   -5.652  1.00 0.00 ? 4  LYS A HZ3  7  
ATOM 7114  N N    . PRO A 1 4  ? 2.422   8.062   -8.488  1.00 0.00 ? 5  PRO A N    7  
ATOM 7115  C CA   . PRO A 1 4  ? 3.465   7.026   -8.531  1.00 0.00 ? 5  PRO A CA   7  
ATOM 7116  C C    . PRO A 1 4  ? 2.908   5.678   -8.983  1.00 0.00 ? 5  PRO A C    7  
ATOM 7117  O O    . PRO A 1 4  ? 1.713   5.459   -9.012  1.00 0.00 ? 5  PRO A O    7  
ATOM 7118  C CB   . PRO A 1 4  ? 3.982   6.959   -7.107  1.00 0.00 ? 5  PRO A CB   7  
ATOM 7119  C CG   . PRO A 1 4  ? 2.873   7.542   -6.221  1.00 0.00 ? 5  PRO A CG   7  
ATOM 7120  C CD   . PRO A 1 4  ? 1.973   8.399   -7.129  1.00 0.00 ? 5  PRO A CD   7  
ATOM 7121  H HA   . PRO A 1 4  ? 4.261   7.330   -9.161  1.00 0.00 ? 5  PRO A HA   7  
ATOM 7122  H HB2  . PRO A 1 4  ? 4.183   5.932   -6.837  1.00 0.00 ? 5  PRO A HB2  7  
ATOM 7123  H HB3  . PRO A 1 4  ? 4.875   7.553   -7.015  1.00 0.00 ? 5  PRO A HB3  7  
ATOM 7124  H HG2  . PRO A 1 4  ? 2.306   6.743   -5.782  1.00 0.00 ? 5  PRO A HG2  7  
ATOM 7125  H HG3  . PRO A 1 4  ? 3.310   8.158   -5.461  1.00 0.00 ? 5  PRO A HG3  7  
ATOM 7126  H HD2  . PRO A 1 4  ? 0.936   8.128   -6.991  1.00 0.00 ? 5  PRO A HD2  7  
ATOM 7127  H HD3  . PRO A 1 4  ? 2.125   9.449   -6.933  1.00 0.00 ? 5  PRO A HD3  7  
ATOM 7128  N N    . LYS A 1 5  ? 3.778   4.780   -9.342  1.00 0.00 ? 6  LYS A N    7  
ATOM 7129  C CA   . LYS A 1 5  ? 3.327   3.439   -9.805  1.00 0.00 ? 6  LYS A CA   7  
ATOM 7130  C C    . LYS A 1 5  ? 2.956   2.570   -8.600  1.00 0.00 ? 6  LYS A C    7  
ATOM 7131  O O    . LYS A 1 5  ? 3.762   1.805   -8.108  1.00 0.00 ? 6  LYS A O    7  
ATOM 7132  C CB   . LYS A 1 5  ? 4.445   2.781   -10.609 1.00 0.00 ? 6  LYS A CB   7  
ATOM 7133  C CG   . LYS A 1 5  ? 4.235   1.264   -10.669 1.00 0.00 ? 6  LYS A CG   7  
ATOM 7134  C CD   . LYS A 1 5  ? 4.791   0.721   -11.987 1.00 0.00 ? 6  LYS A CD   7  
ATOM 7135  C CE   . LYS A 1 5  ? 3.754   -0.194  -12.640 1.00 0.00 ? 6  LYS A CE   7  
ATOM 7136  N NZ   . LYS A 1 5  ? 4.427   -1.085  -13.627 1.00 0.00 ? 6  LYS A NZ   7  
ATOM 7137  H H    . LYS A 1 5  ? 4.734   4.994   -9.311  1.00 0.00 ? 6  LYS A H    7  
ATOM 7138  H HA   . LYS A 1 5  ? 2.468   3.555   -10.443 1.00 0.00 ? 6  LYS A HA   7  
ATOM 7139  H HB2  . LYS A 1 5  ? 4.427   3.182   -11.609 1.00 0.00 ? 6  LYS A HB2  7  
ATOM 7140  H HB3  . LYS A 1 5  ? 5.396   2.996   -10.148 1.00 0.00 ? 6  LYS A HB3  7  
ATOM 7141  H HG2  . LYS A 1 5  ? 4.748   0.797   -9.841  1.00 0.00 ? 6  LYS A HG2  7  
ATOM 7142  H HG3  . LYS A 1 5  ? 3.179   1.045   -10.609 1.00 0.00 ? 6  LYS A HG3  7  
ATOM 7143  H HD2  . LYS A 1 5  ? 5.015   1.545   -12.649 1.00 0.00 ? 6  LYS A HD2  7  
ATOM 7144  H HD3  . LYS A 1 5  ? 5.693   0.160   -11.793 1.00 0.00 ? 6  LYS A HD3  7  
ATOM 7145  H HE2  . LYS A 1 5  ? 3.275   -0.794  -11.882 1.00 0.00 ? 6  LYS A HE2  7  
ATOM 7146  H HE3  . LYS A 1 5  ? 3.012   0.407   -13.147 1.00 0.00 ? 6  LYS A HE3  7  
ATOM 7147  H HZ1  . LYS A 1 5  ? 5.125   -0.539  -14.170 1.00 0.00 ? 6  LYS A HZ1  7  
ATOM 7148  H HZ2  . LYS A 1 5  ? 4.909   -1.858  -13.126 1.00 0.00 ? 6  LYS A HZ2  7  
ATOM 7149  H HZ3  . LYS A 1 5  ? 3.716   -1.481  -14.276 1.00 0.00 ? 6  LYS A HZ3  7  
ATOM 7150  N N    . ARG A 1 6  ? 1.741   2.708   -8.129  1.00 0.00 ? 7  ARG A N    7  
ATOM 7151  C CA   . ARG A 1 6  ? 1.250   1.927   -6.952  1.00 0.00 ? 7  ARG A CA   7  
ATOM 7152  C C    . ARG A 1 6  ? 2.060   0.623   -6.757  1.00 0.00 ? 7  ARG A C    7  
ATOM 7153  O O    . ARG A 1 6  ? 2.054   -0.248  -7.603  1.00 0.00 ? 7  ARG A O    7  
ATOM 7154  C CB   . ARG A 1 6  ? -0.223  1.575   -7.164  1.00 0.00 ? 7  ARG A CB   7  
ATOM 7155  C CG   . ARG A 1 6  ? -1.087  2.396   -6.206  1.00 0.00 ? 7  ARG A CG   7  
ATOM 7156  C CD   . ARG A 1 6  ? -2.316  2.924   -6.949  1.00 0.00 ? 7  ARG A CD   7  
ATOM 7157  N NE   . ARG A 1 6  ? -1.888  3.586   -8.214  1.00 0.00 ? 7  ARG A NE   7  
ATOM 7158  C CZ   . ARG A 1 6  ? -2.738  3.730   -9.194  1.00 0.00 ? 7  ARG A CZ   7  
ATOM 7159  N NH1  . ARG A 1 6  ? -4.016  3.818   -8.944  1.00 0.00 ? 7  ARG A NH1  7  
ATOM 7160  N NH2  . ARG A 1 6  ? -2.308  3.789   -10.425 1.00 0.00 ? 7  ARG A NH2  7  
ATOM 7161  H H    . ARG A 1 6  ? 1.139   3.350   -8.548  1.00 0.00 ? 7  ARG A H    7  
ATOM 7162  H HA   . ARG A 1 6  ? 1.340   2.548   -6.072  1.00 0.00 ? 7  ARG A HA   7  
ATOM 7163  H HB2  . ARG A 1 6  ? -0.501  1.799   -8.184  1.00 0.00 ? 7  ARG A HB2  7  
ATOM 7164  H HB3  . ARG A 1 6  ? -0.372  0.523   -6.971  1.00 0.00 ? 7  ARG A HB3  7  
ATOM 7165  H HG2  . ARG A 1 6  ? -1.405  1.771   -5.383  1.00 0.00 ? 7  ARG A HG2  7  
ATOM 7166  H HG3  . ARG A 1 6  ? -0.514  3.227   -5.824  1.00 0.00 ? 7  ARG A HG3  7  
ATOM 7167  H HD2  . ARG A 1 6  ? -2.977  2.102   -7.180  1.00 0.00 ? 7  ARG A HD2  7  
ATOM 7168  H HD3  . ARG A 1 6  ? -2.834  3.638   -6.327  1.00 0.00 ? 7  ARG A HD3  7  
ATOM 7169  H HE   . ARG A 1 6  ? -0.969  3.913   -8.310  1.00 0.00 ? 7  ARG A HE   7  
ATOM 7170  H HH11 . ARG A 1 6  ? -4.344  3.773   -8.000  1.00 0.00 ? 7  ARG A HH11 7  
ATOM 7171  H HH12 . ARG A 1 6  ? -4.667  3.928   -9.696  1.00 0.00 ? 7  ARG A HH12 7  
ATOM 7172  H HH21 . ARG A 1 6  ? -1.330  3.723   -10.618 1.00 0.00 ? 7  ARG A HH21 7  
ATOM 7173  H HH22 . ARG A 1 6  ? -2.960  3.900   -11.177 1.00 0.00 ? 7  ARG A HH22 7  
ATOM 7174  N N    . PRO A 1 7  ? 2.732   0.556   -5.634  1.00 0.00 ? 8  PRO A N    7  
ATOM 7175  C CA   . PRO A 1 7  ? 3.577   -0.584  -5.237  1.00 0.00 ? 8  PRO A CA   7  
ATOM 7176  C C    . PRO A 1 7  ? 2.717   -1.714  -4.661  1.00 0.00 ? 8  PRO A C    7  
ATOM 7177  O O    . PRO A 1 7  ? 1.686   -1.478  -4.064  1.00 0.00 ? 8  PRO A O    7  
ATOM 7178  C CB   . PRO A 1 7  ? 4.483   0.020   -4.153  1.00 0.00 ? 8  PRO A CB   7  
ATOM 7179  C CG   . PRO A 1 7  ? 3.735   1.263   -3.603  1.00 0.00 ? 8  PRO A CG   7  
ATOM 7180  C CD   . PRO A 1 7  ? 2.711   1.647   -4.660  1.00 0.00 ? 8  PRO A CD   7  
ATOM 7181  H HA   . PRO A 1 7  ? 4.170   -0.933  -6.066  1.00 0.00 ? 8  PRO A HA   7  
ATOM 7182  H HB2  . PRO A 1 7  ? 4.647   -0.701  -3.363  1.00 0.00 ? 8  PRO A HB2  7  
ATOM 7183  H HB3  . PRO A 1 7  ? 5.425   0.323   -4.582  1.00 0.00 ? 8  PRO A HB3  7  
ATOM 7184  H HG2  . PRO A 1 7  ? 3.235   1.022   -2.678  1.00 0.00 ? 8  PRO A HG2  7  
ATOM 7185  H HG3  . PRO A 1 7  ? 4.408   2.093   -3.453  1.00 0.00 ? 8  PRO A HG3  7  
ATOM 7186  H HD2  . PRO A 1 7  ? 1.731   1.747   -4.224  1.00 0.00 ? 8  PRO A HD2  7  
ATOM 7187  H HD3  . PRO A 1 7  ? 3.001   2.548   -5.150  1.00 0.00 ? 8  PRO A HD3  7  
ATOM 7188  N N    . LEU A 1 8  ? 3.133   -2.939  -4.831  1.00 0.00 ? 9  LEU A N    7  
ATOM 7189  C CA   . LEU A 1 8  ? 2.339   -4.076  -4.289  1.00 0.00 ? 9  LEU A CA   7  
ATOM 7190  C C    . LEU A 1 8  ? 3.267   -5.254  -3.955  1.00 0.00 ? 9  LEU A C    7  
ATOM 7191  O O    . LEU A 1 8  ? 4.242   -5.510  -4.634  1.00 0.00 ? 9  LEU A O    7  
ATOM 7192  C CB   . LEU A 1 8  ? 1.250   -4.484  -5.298  1.00 0.00 ? 9  LEU A CB   7  
ATOM 7193  C CG   . LEU A 1 8  ? 1.848   -5.139  -6.552  1.00 0.00 ? 9  LEU A CG   7  
ATOM 7194  C CD1  . LEU A 1 8  ? 3.044   -4.333  -7.062  1.00 0.00 ? 9  LEU A CD1  7  
ATOM 7195  C CD2  . LEU A 1 8  ? 2.284   -6.565  -6.221  1.00 0.00 ? 9  LEU A CD2  7  
ATOM 7196  H H    . LEU A 1 8  ? 3.967   -3.109  -5.313  1.00 0.00 ? 9  LEU A H    7  
ATOM 7197  H HA   . LEU A 1 8  ? 1.860   -3.752  -3.375  1.00 0.00 ? 9  LEU A HA   7  
ATOM 7198  H HB2  . LEU A 1 8  ? 0.574   -5.179  -4.826  1.00 0.00 ? 9  LEU A HB2  7  
ATOM 7199  H HB3  . LEU A 1 8  ? 0.701   -3.602  -5.591  1.00 0.00 ? 9  LEU A HB3  7  
ATOM 7200  H HG   . LEU A 1 8  ? 1.092   -5.170  -7.324  1.00 0.00 ? 9  LEU A HG   7  
ATOM 7201  H HD11 . LEU A 1 8  ? 2.831   -3.278  -6.974  1.00 0.00 ? 9  LEU A HD11 7  
ATOM 7202  H HD12 . LEU A 1 8  ? 3.918   -4.573  -6.475  1.00 0.00 ? 9  LEU A HD12 7  
ATOM 7203  H HD13 . LEU A 1 8  ? 3.227   -4.577  -8.097  1.00 0.00 ? 9  LEU A HD13 7  
ATOM 7204  H HD21 . LEU A 1 8  ? 2.016   -6.788  -5.200  1.00 0.00 ? 9  LEU A HD21 7  
ATOM 7205  H HD22 . LEU A 1 8  ? 1.787   -7.259  -6.887  1.00 0.00 ? 9  LEU A HD22 7  
ATOM 7206  H HD23 . LEU A 1 8  ? 3.354   -6.653  -6.337  1.00 0.00 ? 9  LEU A HD23 7  
ATOM 7207  N N    . SER A 1 9  ? 2.975   -5.949  -2.886  1.00 0.00 ? 10 SER A N    7  
ATOM 7208  C CA   . SER A 1 9  ? 3.829   -7.097  -2.442  1.00 0.00 ? 10 SER A CA   7  
ATOM 7209  C C    . SER A 1 9  ? 4.261   -7.976  -3.623  1.00 0.00 ? 10 SER A C    7  
ATOM 7210  O O    . SER A 1 9  ? 3.577   -8.089  -4.622  1.00 0.00 ? 10 SER A O    7  
ATOM 7211  C CB   . SER A 1 9  ? 3.036   -7.949  -1.451  1.00 0.00 ? 10 SER A CB   7  
ATOM 7212  O OG   . SER A 1 9  ? 2.733   -7.172  -0.299  1.00 0.00 ? 10 SER A OG   7  
ATOM 7213  H H    . SER A 1 9  ? 2.194   -5.698  -2.350  1.00 0.00 ? 10 SER A H    7  
ATOM 7214  H HA   . SER A 1 9  ? 4.707   -6.712  -1.948  1.00 0.00 ? 10 SER A HA   7  
ATOM 7215  H HB2  . SER A 1 9  ? 2.117   -8.276  -1.909  1.00 0.00 ? 10 SER A HB2  7  
ATOM 7216  H HB3  . SER A 1 9  ? 3.622   -8.814  -1.171  1.00 0.00 ? 10 SER A HB3  7  
ATOM 7217  H HG   . SER A 1 9  ? 2.442   -7.771  0.395   1.00 0.00 ? 10 SER A HG   7  
ATOM 7218  N N    . ALA A 1 10 ? 5.395   -8.621  -3.493  1.00 0.00 ? 11 ALA A N    7  
ATOM 7219  C CA   . ALA A 1 10 ? 5.885   -9.515  -4.580  1.00 0.00 ? 11 ALA A CA   7  
ATOM 7220  C C    . ALA A 1 10 ? 4.898   -10.669 -4.752  1.00 0.00 ? 11 ALA A C    7  
ATOM 7221  O O    . ALA A 1 10 ? 4.508   -11.008 -5.853  1.00 0.00 ? 11 ALA A O    7  
ATOM 7222  C CB   . ALA A 1 10 ? 7.261   -10.072 -4.205  1.00 0.00 ? 11 ALA A CB   7  
ATOM 7223  H H    . ALA A 1 10 ? 5.918   -8.524  -2.670  1.00 0.00 ? 11 ALA A H    7  
ATOM 7224  H HA   . ALA A 1 10 ? 5.956   -8.958  -5.503  1.00 0.00 ? 11 ALA A HA   7  
ATOM 7225  H HB1  . ALA A 1 10 ? 7.593   -9.620  -3.283  1.00 0.00 ? 11 ALA A HB1  7  
ATOM 7226  H HB2  . ALA A 1 10 ? 7.196   -11.142 -4.078  1.00 0.00 ? 11 ALA A HB2  7  
ATOM 7227  H HB3  . ALA A 1 10 ? 7.967   -9.845  -4.991  1.00 0.00 ? 11 ALA A HB3  7  
ATOM 7228  N N    . TYR A 1 11 ? 4.473   -11.264 -3.669  1.00 0.00 ? 12 TYR A N    7  
ATOM 7229  C CA   . TYR A 1 11 ? 3.496   -12.372 -3.767  1.00 0.00 ? 12 TYR A CA   7  
ATOM 7230  C C    . TYR A 1 11 ? 2.316   -11.894 -4.606  1.00 0.00 ? 12 TYR A C    7  
ATOM 7231  O O    . TYR A 1 11 ? 1.614   -12.672 -5.222  1.00 0.00 ? 12 TYR A O    7  
ATOM 7232  C CB   . TYR A 1 11 ? 3.020   -12.717 -2.361  1.00 0.00 ? 12 TYR A CB   7  
ATOM 7233  C CG   . TYR A 1 11 ? 1.774   -13.564 -2.444  1.00 0.00 ? 12 TYR A CG   7  
ATOM 7234  C CD1  . TYR A 1 11 ? 1.836   -14.819 -3.051  1.00 0.00 ? 12 TYR A CD1  7  
ATOM 7235  C CD2  . TYR A 1 11 ? 0.564   -13.096 -1.920  1.00 0.00 ? 12 TYR A CD2  7  
ATOM 7236  C CE1  . TYR A 1 11 ? 0.691   -15.612 -3.137  1.00 0.00 ? 12 TYR A CE1  7  
ATOM 7237  C CE2  . TYR A 1 11 ? -0.586  -13.891 -2.004  1.00 0.00 ? 12 TYR A CE2  7  
ATOM 7238  C CZ   . TYR A 1 11 ? -0.521  -15.150 -2.613  1.00 0.00 ? 12 TYR A CZ   7  
ATOM 7239  O OH   . TYR A 1 11 ? -1.653  -15.935 -2.697  1.00 0.00 ? 12 TYR A OH   7  
ATOM 7240  H H    . TYR A 1 11 ? 4.782   -10.968 -2.788  1.00 0.00 ? 12 TYR A H    7  
ATOM 7241  H HA   . TYR A 1 11 ? 3.951   -13.239 -4.225  1.00 0.00 ? 12 TYR A HA   7  
ATOM 7242  H HB2  . TYR A 1 11 ? 3.797   -13.261 -1.843  1.00 0.00 ? 12 TYR A HB2  7  
ATOM 7243  H HB3  . TYR A 1 11 ? 2.805   -11.804 -1.827  1.00 0.00 ? 12 TYR A HB3  7  
ATOM 7244  H HD1  . TYR A 1 11 ? 2.768   -15.173 -3.457  1.00 0.00 ? 12 TYR A HD1  7  
ATOM 7245  H HD2  . TYR A 1 11 ? 0.517   -12.124 -1.453  1.00 0.00 ? 12 TYR A HD2  7  
ATOM 7246  H HE1  . TYR A 1 11 ? 0.745   -16.581 -3.607  1.00 0.00 ? 12 TYR A HE1  7  
ATOM 7247  H HE2  . TYR A 1 11 ? -1.520  -13.533 -1.601  1.00 0.00 ? 12 TYR A HE2  7  
ATOM 7248  H HH   . TYR A 1 11 ? -2.188  -15.768 -1.918  1.00 0.00 ? 12 TYR A HH   7  
ATOM 7249  N N    . MET A 1 12 ? 2.098   -10.610 -4.627  1.00 0.00 ? 13 MET A N    7  
ATOM 7250  C CA   . MET A 1 12 ? 0.970   -10.057 -5.416  1.00 0.00 ? 13 MET A CA   7  
ATOM 7251  C C    . MET A 1 12 ? 1.356   -10.014 -6.897  1.00 0.00 ? 13 MET A C    7  
ATOM 7252  O O    . MET A 1 12 ? 0.545   -10.284 -7.758  1.00 0.00 ? 13 MET A O    7  
ATOM 7253  C CB   . MET A 1 12 ? 0.651   -8.648  -4.915  1.00 0.00 ? 13 MET A CB   7  
ATOM 7254  C CG   . MET A 1 12 ? -0.606  -8.683  -4.042  1.00 0.00 ? 13 MET A CG   7  
ATOM 7255  S SD   . MET A 1 12 ? -2.071  -8.478  -5.082  1.00 0.00 ? 13 MET A SD   7  
ATOM 7256  C CE   . MET A 1 12 ? -2.107  -10.159 -5.744  1.00 0.00 ? 13 MET A CE   7  
ATOM 7257  H H    . MET A 1 12 ? 2.681   -10.008 -4.119  1.00 0.00 ? 13 MET A H    7  
ATOM 7258  H HA   . MET A 1 12 ? 0.104   -10.690 -5.289  1.00 0.00 ? 13 MET A HA   7  
ATOM 7259  H HB2  . MET A 1 12 ? 1.481   -8.285  -4.328  1.00 0.00 ? 13 MET A HB2  7  
ATOM 7260  H HB3  . MET A 1 12 ? 0.486   -7.993  -5.756  1.00 0.00 ? 13 MET A HB3  7  
ATOM 7261  H HG2  . MET A 1 12 ? -0.660  -9.630  -3.527  1.00 0.00 ? 13 MET A HG2  7  
ATOM 7262  H HG3  . MET A 1 12 ? -0.563  -7.882  -3.318  1.00 0.00 ? 13 MET A HG3  7  
ATOM 7263  H HE1  . MET A 1 12 ? -1.752  -10.850 -4.994  1.00 0.00 ? 13 MET A HE1  7  
ATOM 7264  H HE2  . MET A 1 12 ? -3.119  -10.418 -6.020  1.00 0.00 ? 13 MET A HE2  7  
ATOM 7265  H HE3  . MET A 1 12 ? -1.464  -10.215 -6.612  1.00 0.00 ? 13 MET A HE3  7  
ATOM 7266  N N    . LEU A 1 13 ? 2.587   -9.689  -7.210  1.00 0.00 ? 14 LEU A N    7  
ATOM 7267  C CA   . LEU A 1 13 ? 2.980   -9.658  -8.653  1.00 0.00 ? 14 LEU A CA   7  
ATOM 7268  C C    . LEU A 1 13 ? 2.711   -11.037 -9.254  1.00 0.00 ? 14 LEU A C    7  
ATOM 7269  O O    . LEU A 1 13 ? 2.013   -11.173 -10.238 1.00 0.00 ? 14 LEU A O    7  
ATOM 7270  C CB   . LEU A 1 13 ? 4.468   -9.322  -8.823  1.00 0.00 ? 14 LEU A CB   7  
ATOM 7271  C CG   . LEU A 1 13 ? 4.839   -8.101  -7.973  1.00 0.00 ? 14 LEU A CG   7  
ATOM 7272  C CD1  . LEU A 1 13 ? 6.350   -7.852  -8.044  1.00 0.00 ? 14 LEU A CD1  7  
ATOM 7273  C CD2  . LEU A 1 13 ? 4.105   -6.876  -8.518  1.00 0.00 ? 14 LEU A CD2  7  
ATOM 7274  H H    . LEU A 1 13 ? 3.240   -9.478  -6.509  1.00 0.00 ? 14 LEU A H    7  
ATOM 7275  H HA   . LEU A 1 13 ? 2.383   -8.920  -9.168  1.00 0.00 ? 14 LEU A HA   7  
ATOM 7276  H HB2  . LEU A 1 13 ? 5.076   -10.176 -8.540  1.00 0.00 ? 14 LEU A HB2  7  
ATOM 7277  H HB3  . LEU A 1 13 ? 4.653   -9.092  -9.862  1.00 0.00 ? 14 LEU A HB3  7  
ATOM 7278  H HG   . LEU A 1 13 ? 4.551   -8.270  -6.946  1.00 0.00 ? 14 LEU A HG   7  
ATOM 7279  H HD11 . LEU A 1 13 ? 6.699   -8.051  -9.046  1.00 0.00 ? 14 LEU A HD11 7  
ATOM 7280  H HD12 . LEU A 1 13 ? 6.563   -6.820  -7.786  1.00 0.00 ? 14 LEU A HD12 7  
ATOM 7281  H HD13 . LEU A 1 13 ? 6.855   -8.507  -7.351  1.00 0.00 ? 14 LEU A HD13 7  
ATOM 7282  H HD21 . LEU A 1 13 ? 4.332   -6.759  -9.568  1.00 0.00 ? 14 LEU A HD21 7  
ATOM 7283  H HD22 . LEU A 1 13 ? 3.040   -7.009  -8.394  1.00 0.00 ? 14 LEU A HD22 7  
ATOM 7284  H HD23 . LEU A 1 13 ? 4.424   -5.995  -7.981  1.00 0.00 ? 14 LEU A HD23 7  
ATOM 7285  N N    . TRP A 1 14 ? 3.256   -12.064 -8.659  1.00 0.00 ? 15 TRP A N    7  
ATOM 7286  C CA   . TRP A 1 14 ? 3.029   -13.441 -9.183  1.00 0.00 ? 15 TRP A CA   7  
ATOM 7287  C C    . TRP A 1 14 ? 1.528   -13.733 -9.182  1.00 0.00 ? 15 TRP A C    7  
ATOM 7288  O O    . TRP A 1 14 ? 1.009   -14.373 -10.075 1.00 0.00 ? 15 TRP A O    7  
ATOM 7289  C CB   . TRP A 1 14 ? 3.751   -14.445 -8.285  1.00 0.00 ? 15 TRP A CB   7  
ATOM 7290  C CG   . TRP A 1 14 ? 3.346   -15.834 -8.657  1.00 0.00 ? 15 TRP A CG   7  
ATOM 7291  C CD1  . TRP A 1 14 ? 3.913   -16.572 -9.638  1.00 0.00 ? 15 TRP A CD1  7  
ATOM 7292  C CD2  . TRP A 1 14 ? 2.304   -16.662 -8.071  1.00 0.00 ? 15 TRP A CD2  7  
ATOM 7293  N NE1  . TRP A 1 14 ? 3.281   -17.803 -9.692  1.00 0.00 ? 15 TRP A NE1  7  
ATOM 7294  C CE2  . TRP A 1 14 ? 2.282   -17.905 -8.744  1.00 0.00 ? 15 TRP A CE2  7  
ATOM 7295  C CE3  . TRP A 1 14 ? 1.383   -16.454 -7.029  1.00 0.00 ? 15 TRP A CE3  7  
ATOM 7296  C CZ2  . TRP A 1 14 ? 1.378   -18.909 -8.395  1.00 0.00 ? 15 TRP A CZ2  7  
ATOM 7297  C CZ3  . TRP A 1 14 ? 0.473   -17.461 -6.676  1.00 0.00 ? 15 TRP A CZ3  7  
ATOM 7298  C CH2  . TRP A 1 14 ? 0.469   -18.686 -7.357  1.00 0.00 ? 15 TRP A CH2  7  
ATOM 7299  H H    . TRP A 1 14 ? 3.811   -11.930 -7.861  1.00 0.00 ? 15 TRP A H    7  
ATOM 7300  H HA   . TRP A 1 14 ? 3.414   -13.513 -10.190 1.00 0.00 ? 15 TRP A HA   7  
ATOM 7301  H HB2  . TRP A 1 14 ? 4.816   -14.337 -8.411  1.00 0.00 ? 15 TRP A HB2  7  
ATOM 7302  H HB3  . TRP A 1 14 ? 3.489   -14.259 -7.254  1.00 0.00 ? 15 TRP A HB3  7  
ATOM 7303  H HD1  . TRP A 1 14 ? 4.725   -16.254 -10.276 1.00 0.00 ? 15 TRP A HD1  7  
ATOM 7304  H HE1  . TRP A 1 14 ? 3.501   -18.525 -10.315 1.00 0.00 ? 15 TRP A HE1  7  
ATOM 7305  H HE3  . TRP A 1 14 ? 1.378   -15.515 -6.497  1.00 0.00 ? 15 TRP A HE3  7  
ATOM 7306  H HZ2  . TRP A 1 14 ? 1.380   -19.851 -8.924  1.00 0.00 ? 15 TRP A HZ2  7  
ATOM 7307  H HZ3  . TRP A 1 14 ? -0.231  -17.287 -5.875  1.00 0.00 ? 15 TRP A HZ3  7  
ATOM 7308  H HH2  . TRP A 1 14 ? -0.236  -19.457 -7.080  1.00 0.00 ? 15 TRP A HH2  7  
ATOM 7309  N N    . LEU A 1 15 ? 0.827   -13.259 -8.189  1.00 0.00 ? 16 LEU A N    7  
ATOM 7310  C CA   . LEU A 1 15 ? -0.642  -13.493 -8.124  1.00 0.00 ? 16 LEU A CA   7  
ATOM 7311  C C    . LEU A 1 15 ? -1.295  -12.928 -9.386  1.00 0.00 ? 16 LEU A C    7  
ATOM 7312  O O    . LEU A 1 15 ? -2.234  -13.487 -9.920  1.00 0.00 ? 16 LEU A O    7  
ATOM 7313  C CB   . LEU A 1 15 ? -1.213  -12.774 -6.899  1.00 0.00 ? 16 LEU A CB   7  
ATOM 7314  C CG   . LEU A 1 15 ? -1.939  -13.777 -6.006  1.00 0.00 ? 16 LEU A CG   7  
ATOM 7315  C CD1  . LEU A 1 15 ? -3.099  -14.405 -6.783  1.00 0.00 ? 16 LEU A CD1  7  
ATOM 7316  C CD2  . LEU A 1 15 ? -0.963  -14.873 -5.575  1.00 0.00 ? 16 LEU A CD2  7  
ATOM 7317  H H    . LEU A 1 15 ? 1.270   -12.743 -7.483  1.00 0.00 ? 16 LEU A H    7  
ATOM 7318  H HA   . LEU A 1 15 ? -0.842  -14.552 -8.054  1.00 0.00 ? 16 LEU A HA   7  
ATOM 7319  H HB2  . LEU A 1 15 ? -0.407  -12.316 -6.344  1.00 0.00 ? 16 LEU A HB2  7  
ATOM 7320  H HB3  . LEU A 1 15 ? -1.907  -12.013 -7.220  1.00 0.00 ? 16 LEU A HB3  7  
ATOM 7321  H HG   . LEU A 1 15 ? -2.321  -13.268 -5.133  1.00 0.00 ? 16 LEU A HG   7  
ATOM 7322  H HD11 . LEU A 1 15 ? -2.769  -14.657 -7.780  1.00 0.00 ? 16 LEU A HD11 7  
ATOM 7323  H HD12 . LEU A 1 15 ? -3.429  -15.300 -6.276  1.00 0.00 ? 16 LEU A HD12 7  
ATOM 7324  H HD13 . LEU A 1 15 ? -3.916  -13.701 -6.841  1.00 0.00 ? 16 LEU A HD13 7  
ATOM 7325  H HD21 . LEU A 1 15 ? -0.081  -14.420 -5.144  1.00 0.00 ? 16 LEU A HD21 7  
ATOM 7326  H HD22 . LEU A 1 15 ? -1.435  -15.509 -4.842  1.00 0.00 ? 16 LEU A HD22 7  
ATOM 7327  H HD23 . LEU A 1 15 ? -0.682  -15.460 -6.434  1.00 0.00 ? 16 LEU A HD23 7  
ATOM 7328  N N    . ASN A 1 16 ? -0.804  -11.819 -9.864  1.00 0.00 ? 17 ASN A N    7  
ATOM 7329  C CA   . ASN A 1 16 ? -1.380  -11.205 -11.084 1.00 0.00 ? 17 ASN A CA   7  
ATOM 7330  C C    . ASN A 1 16 ? -0.892  -11.968 -12.316 1.00 0.00 ? 17 ASN A C    7  
ATOM 7331  O O    . ASN A 1 16 ? -1.479  -11.899 -13.377 1.00 0.00 ? 17 ASN A O    7  
ATOM 7332  C CB   . ASN A 1 16 ? -0.926  -9.756  -11.161 1.00 0.00 ? 17 ASN A CB   7  
ATOM 7333  C CG   . ASN A 1 16 ? -0.835  -9.165  -9.749  1.00 0.00 ? 17 ASN A CG   7  
ATOM 7334  O OD1  . ASN A 1 16 ? -1.710  -9.376  -8.932  1.00 0.00 ? 17 ASN A OD1  7  
ATOM 7335  N ND2  . ASN A 1 16 ? 0.195   -8.428  -9.427  1.00 0.00 ? 17 ASN A ND2  7  
ATOM 7336  H H    . ASN A 1 16 ? -0.048  -11.387 -9.420  1.00 0.00 ? 17 ASN A H    7  
ATOM 7337  H HA   . ASN A 1 16 ? -2.454  -11.234 -11.040 1.00 0.00 ? 17 ASN A HA   7  
ATOM 7338  H HB2  . ASN A 1 16 ? 0.041   -9.710  -11.632 1.00 0.00 ? 17 ASN A HB2  7  
ATOM 7339  H HB3  . ASN A 1 16 ? -1.643  -9.198  -11.737 1.00 0.00 ? 17 ASN A HB3  7  
ATOM 7340  H HD21 . ASN A 1 16 ? 0.898   -8.257  -10.086 1.00 0.00 ? 17 ASN A HD21 7  
ATOM 7341  H HD22 . ASN A 1 16 ? 0.266   -8.049  -8.523  1.00 0.00 ? 17 ASN A HD22 7  
ATOM 7342  N N    . SER A 1 17 ? 0.181   -12.698 -12.179 1.00 0.00 ? 18 SER A N    7  
ATOM 7343  C CA   . SER A 1 17 ? 0.716   -13.470 -13.336 1.00 0.00 ? 18 SER A CA   7  
ATOM 7344  C C    . SER A 1 17 ? 0.113   -14.878 -13.346 1.00 0.00 ? 18 SER A C    7  
ATOM 7345  O O    . SER A 1 17 ? 0.310   -15.639 -14.274 1.00 0.00 ? 18 SER A O    7  
ATOM 7346  C CB   . SER A 1 17 ? 2.232   -13.569 -13.222 1.00 0.00 ? 18 SER A CB   7  
ATOM 7347  O OG   . SER A 1 17 ? 2.576   -14.753 -12.514 1.00 0.00 ? 18 SER A OG   7  
ATOM 7348  H H    . SER A 1 17 ? 0.639   -12.737 -11.313 1.00 0.00 ? 18 SER A H    7  
ATOM 7349  H HA   . SER A 1 17 ? 0.466   -12.964 -14.255 1.00 0.00 ? 18 SER A HA   7  
ATOM 7350  H HB2  . SER A 1 17 ? 2.660   -13.606 -14.208 1.00 0.00 ? 18 SER A HB2  7  
ATOM 7351  H HB3  . SER A 1 17 ? 2.609   -12.700 -12.701 1.00 0.00 ? 18 SER A HB3  7  
ATOM 7352  H HG   . SER A 1 17 ? 2.617   -15.475 -13.145 1.00 0.00 ? 18 SER A HG   7  
ATOM 7353  N N    . ALA A 1 18 ? -0.618  -15.234 -12.325 1.00 0.00 ? 19 ALA A N    7  
ATOM 7354  C CA   . ALA A 1 18 ? -1.228  -16.595 -12.285 1.00 0.00 ? 19 ALA A CA   7  
ATOM 7355  C C    . ALA A 1 18 ? -2.743  -16.479 -12.124 1.00 0.00 ? 19 ALA A C    7  
ATOM 7356  O O    . ALA A 1 18 ? -3.435  -17.466 -12.007 1.00 0.00 ? 19 ALA A O    7  
ATOM 7357  C CB   . ALA A 1 18 ? -0.664  -17.377 -11.098 1.00 0.00 ? 19 ALA A CB   7  
ATOM 7358  H H    . ALA A 1 18 ? -0.767  -14.609 -11.585 1.00 0.00 ? 19 ALA A H    7  
ATOM 7359  H HA   . ALA A 1 18 ? -1.001  -17.119 -13.202 1.00 0.00 ? 19 ALA A HA   7  
ATOM 7360  H HB1  . ALA A 1 18 ? 0.081   -16.779 -10.594 1.00 0.00 ? 19 ALA A HB1  7  
ATOM 7361  H HB2  . ALA A 1 18 ? -1.465  -17.612 -10.411 1.00 0.00 ? 19 ALA A HB2  7  
ATOM 7362  H HB3  . ALA A 1 18 ? -0.213  -18.293 -11.452 1.00 0.00 ? 19 ALA A HB3  7  
ATOM 7363  N N    . ARG A 1 19 ? -3.263  -15.285 -12.106 1.00 0.00 ? 20 ARG A N    7  
ATOM 7364  C CA   . ARG A 1 19 ? -4.735  -15.121 -11.938 1.00 0.00 ? 20 ARG A CA   7  
ATOM 7365  C C    . ARG A 1 19 ? -5.474  -15.835 -13.072 1.00 0.00 ? 20 ARG A C    7  
ATOM 7366  O O    . ARG A 1 19 ? -6.231  -16.757 -12.843 1.00 0.00 ? 20 ARG A O    7  
ATOM 7367  C CB   . ARG A 1 19 ? -5.089  -13.634 -11.958 1.00 0.00 ? 20 ARG A CB   7  
ATOM 7368  C CG   . ARG A 1 19 ? -6.046  -13.319 -10.808 1.00 0.00 ? 20 ARG A CG   7  
ATOM 7369  C CD   . ARG A 1 19 ? -6.385  -11.828 -10.827 1.00 0.00 ? 20 ARG A CD   7  
ATOM 7370  N NE   . ARG A 1 19 ? -7.777  -11.628 -10.338 1.00 0.00 ? 20 ARG A NE   7  
ATOM 7371  C CZ   . ARG A 1 19 ? -8.035  -10.687 -9.472  1.00 0.00 ? 20 ARG A CZ   7  
ATOM 7372  N NH1  . ARG A 1 19 ? -7.630  -9.466  -9.696  1.00 0.00 ? 20 ARG A NH1  7  
ATOM 7373  N NH2  . ARG A 1 19 ? -8.695  -10.964 -8.380  1.00 0.00 ? 20 ARG A NH2  7  
ATOM 7374  H H    . ARG A 1 19 ? -2.688  -14.498 -12.192 1.00 0.00 ? 20 ARG A H    7  
ATOM 7375  H HA   . ARG A 1 19 ? -5.037  -15.550 -10.996 1.00 0.00 ? 20 ARG A HA   7  
ATOM 7376  H HB2  . ARG A 1 19 ? -4.187  -13.049 -11.848 1.00 0.00 ? 20 ARG A HB2  7  
ATOM 7377  H HB3  . ARG A 1 19 ? -5.564  -13.389 -12.896 1.00 0.00 ? 20 ARG A HB3  7  
ATOM 7378  H HG2  . ARG A 1 19 ? -6.952  -13.898 -10.925 1.00 0.00 ? 20 ARG A HG2  7  
ATOM 7379  H HG3  . ARG A 1 19 ? -5.577  -13.568 -9.869  1.00 0.00 ? 20 ARG A HG3  7  
ATOM 7380  H HD2  . ARG A 1 19 ? -5.698  -11.295 -10.188 1.00 0.00 ? 20 ARG A HD2  7  
ATOM 7381  H HD3  . ARG A 1 19 ? -6.301  -11.452 -11.836 1.00 0.00 ? 20 ARG A HD3  7  
ATOM 7382  H HE   . ARG A 1 19 ? -8.500  -12.202 -10.667 1.00 0.00 ? 20 ARG A HE   7  
ATOM 7383  H HH11 . ARG A 1 19 ? -7.122  -9.253  -10.532 1.00 0.00 ? 20 ARG A HH11 7  
ATOM 7384  H HH12 . ARG A 1 19 ? -7.827  -8.744  -9.034  1.00 0.00 ? 20 ARG A HH12 7  
ATOM 7385  H HH21 . ARG A 1 19 ? -9.003  -11.900 -8.207  1.00 0.00 ? 20 ARG A HH21 7  
ATOM 7386  H HH22 . ARG A 1 19 ? -8.891  -10.242 -7.717  1.00 0.00 ? 20 ARG A HH22 7  
ATOM 7387  N N    . GLU A 1 20 ? -5.271  -15.415 -14.288 1.00 0.00 ? 21 GLU A N    7  
ATOM 7388  C CA   . GLU A 1 20 ? -5.974  -16.070 -15.427 1.00 0.00 ? 21 GLU A CA   7  
ATOM 7389  C C    . GLU A 1 20 ? -5.598  -17.550 -15.486 1.00 0.00 ? 21 GLU A C    7  
ATOM 7390  O O    . GLU A 1 20 ? -6.441  -18.410 -15.656 1.00 0.00 ? 21 GLU A O    7  
ATOM 7391  C CB   . GLU A 1 20 ? -5.569  -15.387 -16.736 1.00 0.00 ? 21 GLU A CB   7  
ATOM 7392  C CG   . GLU A 1 20 ? -6.138  -13.968 -16.771 1.00 0.00 ? 21 GLU A CG   7  
ATOM 7393  C CD   . GLU A 1 20 ? -6.677  -13.666 -18.170 1.00 0.00 ? 21 GLU A CD   7  
ATOM 7394  O OE1  . GLU A 1 20 ? -7.717  -14.203 -18.510 1.00 0.00 ? 21 GLU A OE1  7  
ATOM 7395  O OE2  . GLU A 1 20 ? -6.037  -12.905 -18.877 1.00 0.00 ? 21 GLU A OE2  7  
ATOM 7396  H H    . GLU A 1 20 ? -4.661  -14.665 -14.453 1.00 0.00 ? 21 GLU A H    7  
ATOM 7397  H HA   . GLU A 1 20 ? -7.038  -15.980 -15.288 1.00 0.00 ? 21 GLU A HA   7  
ATOM 7398  H HB2  . GLU A 1 20 ? -4.492  -15.347 -16.801 1.00 0.00 ? 21 GLU A HB2  7  
ATOM 7399  H HB3  . GLU A 1 20 ? -5.959  -15.950 -17.570 1.00 0.00 ? 21 GLU A HB3  7  
ATOM 7400  H HG2  . GLU A 1 20 ? -6.938  -13.883 -16.049 1.00 0.00 ? 21 GLU A HG2  7  
ATOM 7401  H HG3  . GLU A 1 20 ? -5.358  -13.262 -16.528 1.00 0.00 ? 21 GLU A HG3  7  
ATOM 7402  N N    . SER A 1 21 ? -4.339  -17.854 -15.355 1.00 0.00 ? 22 SER A N    7  
ATOM 7403  C CA   . SER A 1 21 ? -3.907  -19.280 -15.412 1.00 0.00 ? 22 SER A CA   7  
ATOM 7404  C C    . SER A 1 21 ? -4.374  -20.013 -14.154 1.00 0.00 ? 22 SER A C    7  
ATOM 7405  O O    . SER A 1 21 ? -4.331  -21.226 -14.083 1.00 0.00 ? 22 SER A O    7  
ATOM 7406  C CB   . SER A 1 21 ? -2.383  -19.349 -15.502 1.00 0.00 ? 22 SER A CB   7  
ATOM 7407  O OG   . SER A 1 21 ? -2.016  -20.052 -16.681 1.00 0.00 ? 22 SER A OG   7  
ATOM 7408  H H    . SER A 1 21 ? -3.678  -17.144 -15.223 1.00 0.00 ? 22 SER A H    7  
ATOM 7409  H HA   . SER A 1 21 ? -4.339  -19.751 -16.281 1.00 0.00 ? 22 SER A HA   7  
ATOM 7410  H HB2  . SER A 1 21 ? -1.976  -18.353 -15.541 1.00 0.00 ? 22 SER A HB2  7  
ATOM 7411  H HB3  . SER A 1 21 ? -1.995  -19.860 -14.630 1.00 0.00 ? 22 SER A HB3  7  
ATOM 7412  H HG   . SER A 1 21 ? -1.198  -19.672 -17.011 1.00 0.00 ? 22 SER A HG   7  
ATOM 7413  N N    . ILE A 1 22 ? -4.826  -19.295 -13.165 1.00 0.00 ? 23 ILE A N    7  
ATOM 7414  C CA   . ILE A 1 22 ? -5.300  -19.963 -11.923 1.00 0.00 ? 23 ILE A CA   7  
ATOM 7415  C C    . ILE A 1 22 ? -6.765  -20.358 -12.109 1.00 0.00 ? 23 ILE A C    7  
ATOM 7416  O O    . ILE A 1 22 ? -7.176  -21.447 -11.760 1.00 0.00 ? 23 ILE A O    7  
ATOM 7417  C CB   . ILE A 1 22 ? -5.145  -18.995 -10.736 1.00 0.00 ? 23 ILE A CB   7  
ATOM 7418  C CG1  . ILE A 1 22 ? -3.769  -19.200 -10.096 1.00 0.00 ? 23 ILE A CG1  7  
ATOM 7419  C CG2  . ILE A 1 22 ? -6.225  -19.252 -9.678  1.00 0.00 ? 23 ILE A CG2  7  
ATOM 7420  C CD1  . ILE A 1 22 ? -3.530  -18.113 -9.047  1.00 0.00 ? 23 ILE A CD1  7  
ATOM 7421  H H    . ILE A 1 22 ? -4.861  -18.317 -13.241 1.00 0.00 ? 23 ILE A H    7  
ATOM 7422  H HA   . ILE A 1 22 ? -4.708  -20.850 -11.746 1.00 0.00 ? 23 ILE A HA   7  
ATOM 7423  H HB   . ILE A 1 22 ? -5.229  -17.980 -11.090 1.00 0.00 ? 23 ILE A HB   7  
ATOM 7424  H HG12 . ILE A 1 22 ? -3.733  -20.170 -9.624  1.00 0.00 ? 23 ILE A HG12 7  
ATOM 7425  H HG13 . ILE A 1 22 ? -3.003  -19.141 -10.855 1.00 0.00 ? 23 ILE A HG13 7  
ATOM 7426  H HG21 . ILE A 1 22 ? -7.203  -19.213 -10.141 1.00 0.00 ? 23 ILE A HG21 7  
ATOM 7427  H HG22 . ILE A 1 22 ? -6.072  -20.224 -9.237  1.00 0.00 ? 23 ILE A HG22 7  
ATOM 7428  H HG23 . ILE A 1 22 ? -6.159  -18.494 -8.911  1.00 0.00 ? 23 ILE A HG23 7  
ATOM 7429  H HD11 . ILE A 1 22 ? -3.938  -17.177 -9.399  1.00 0.00 ? 23 ILE A HD11 7  
ATOM 7430  H HD12 . ILE A 1 22 ? -4.015  -18.391 -8.123  1.00 0.00 ? 23 ILE A HD12 7  
ATOM 7431  H HD13 . ILE A 1 22 ? -2.469  -18.002 -8.877  1.00 0.00 ? 23 ILE A HD13 7  
ATOM 7432  N N    . LYS A 1 23 ? -7.557  -19.477 -12.648 1.00 0.00 ? 24 LYS A N    7  
ATOM 7433  C CA   . LYS A 1 23 ? -8.988  -19.789 -12.849 1.00 0.00 ? 24 LYS A CA   7  
ATOM 7434  C C    . LYS A 1 23 ? -9.133  -20.915 -13.882 1.00 0.00 ? 24 LYS A C    7  
ATOM 7435  O O    . LYS A 1 23 ? -10.157 -21.564 -13.968 1.00 0.00 ? 24 LYS A O    7  
ATOM 7436  C CB   . LYS A 1 23 ? -9.690  -18.515 -13.325 1.00 0.00 ? 24 LYS A CB   7  
ATOM 7437  C CG   . LYS A 1 23 ? -9.626  -18.419 -14.849 1.00 0.00 ? 24 LYS A CG   7  
ATOM 7438  C CD   . LYS A 1 23 ? -10.361 -17.163 -15.319 1.00 0.00 ? 24 LYS A CD   7  
ATOM 7439  C CE   . LYS A 1 23 ? -11.588 -17.566 -16.139 1.00 0.00 ? 24 LYS A CE   7  
ATOM 7440  N NZ   . LYS A 1 23 ? -12.629 -16.506 -16.026 1.00 0.00 ? 24 LYS A NZ   7  
ATOM 7441  H H    . LYS A 1 23 ? -7.211  -18.598 -12.918 1.00 0.00 ? 24 LYS A H    7  
ATOM 7442  H HA   . LYS A 1 23 ? -9.416  -20.102 -11.915 1.00 0.00 ? 24 LYS A HA   7  
ATOM 7443  H HB2  . LYS A 1 23 ? -10.721 -18.528 -13.005 1.00 0.00 ? 24 LYS A HB2  7  
ATOM 7444  H HB3  . LYS A 1 23 ? -9.186  -17.661 -12.896 1.00 0.00 ? 24 LYS A HB3  7  
ATOM 7445  H HG2  . LYS A 1 23 ? -8.593  -18.373 -15.158 1.00 0.00 ? 24 LYS A HG2  7  
ATOM 7446  H HG3  . LYS A 1 23 ? -10.092 -19.292 -15.279 1.00 0.00 ? 24 LYS A HG3  7  
ATOM 7447  H HD2  . LYS A 1 23 ? -10.674 -16.587 -14.461 1.00 0.00 ? 24 LYS A HD2  7  
ATOM 7448  H HD3  . LYS A 1 23 ? -9.702  -16.568 -15.933 1.00 0.00 ? 24 LYS A HD3  7  
ATOM 7449  H HE2  . LYS A 1 23 ? -11.306 -17.686 -17.175 1.00 0.00 ? 24 LYS A HE2  7  
ATOM 7450  H HE3  . LYS A 1 23 ? -11.982 -18.499 -15.764 1.00 0.00 ? 24 LYS A HE3  7  
ATOM 7451  H HZ1  . LYS A 1 23 ? -12.470 -15.955 -15.160 1.00 0.00 ? 24 LYS A HZ1  7  
ATOM 7452  H HZ2  . LYS A 1 23 ? -12.575 -15.878 -16.854 1.00 0.00 ? 24 LYS A HZ2  7  
ATOM 7453  H HZ3  . LYS A 1 23 ? -13.570 -16.947 -15.985 1.00 0.00 ? 24 LYS A HZ3  7  
ATOM 7454  N N    . ARG A 1 24 ? -8.119  -21.143 -14.674 1.00 0.00 ? 25 ARG A N    7  
ATOM 7455  C CA   . ARG A 1 24 ? -8.204  -22.215 -15.704 1.00 0.00 ? 25 ARG A CA   7  
ATOM 7456  C C    . ARG A 1 24 ? -7.488  -23.475 -15.209 1.00 0.00 ? 25 ARG A C    7  
ATOM 7457  O O    . ARG A 1 24 ? -7.845  -24.580 -15.566 1.00 0.00 ? 25 ARG A O    7  
ATOM 7458  C CB   . ARG A 1 24 ? -7.543  -21.730 -16.996 1.00 0.00 ? 25 ARG A CB   7  
ATOM 7459  C CG   . ARG A 1 24 ? -8.240  -20.457 -17.481 1.00 0.00 ? 25 ARG A CG   7  
ATOM 7460  C CD   . ARG A 1 24 ? -8.382  -20.492 -18.995 1.00 0.00 ? 25 ARG A CD   7  
ATOM 7461  N NE   . ARG A 1 24 ? -8.880  -21.829 -19.421 1.00 0.00 ? 25 ARG A NE   7  
ATOM 7462  C CZ   . ARG A 1 24 ? -8.613  -22.273 -20.618 1.00 0.00 ? 25 ARG A CZ   7  
ATOM 7463  N NH1  . ARG A 1 24 ? -7.373  -22.397 -21.006 1.00 0.00 ? 25 ARG A NH1  7  
ATOM 7464  N NH2  . ARG A 1 24 ? -9.584  -22.592 -21.428 1.00 0.00 ? 25 ARG A NH2  7  
ATOM 7465  H H    . ARG A 1 24 ? -7.306  -20.606 -14.597 1.00 0.00 ? 25 ARG A H    7  
ATOM 7466  H HA   . ARG A 1 24 ? -9.239  -22.442 -15.895 1.00 0.00 ? 25 ARG A HA   7  
ATOM 7467  H HB2  . ARG A 1 24 ? -6.499  -21.522 -16.810 1.00 0.00 ? 25 ARG A HB2  7  
ATOM 7468  H HB3  . ARG A 1 24 ? -7.627  -22.496 -17.752 1.00 0.00 ? 25 ARG A HB3  7  
ATOM 7469  H HG2  . ARG A 1 24 ? -9.219  -20.384 -17.035 1.00 0.00 ? 25 ARG A HG2  7  
ATOM 7470  H HG3  . ARG A 1 24 ? -7.653  -19.597 -17.204 1.00 0.00 ? 25 ARG A HG3  7  
ATOM 7471  H HD2  . ARG A 1 24 ? -9.083  -19.732 -19.299 1.00 0.00 ? 25 ARG A HD2  7  
ATOM 7472  H HD3  . ARG A 1 24 ? -7.422  -20.300 -19.446 1.00 0.00 ? 25 ARG A HD3  7  
ATOM 7473  H HE   . ARG A 1 24 ? -9.407  -22.376 -18.802 1.00 0.00 ? 25 ARG A HE   7  
ATOM 7474  H HH11 . ARG A 1 24 ? -6.629  -22.152 -20.386 1.00 0.00 ? 25 ARG A HH11 7  
ATOM 7475  H HH12 . ARG A 1 24 ? -7.169  -22.736 -21.924 1.00 0.00 ? 25 ARG A HH12 7  
ATOM 7476  H HH21 . ARG A 1 24 ? -10.535 -22.497 -21.132 1.00 0.00 ? 25 ARG A HH21 7  
ATOM 7477  H HH22 . ARG A 1 24 ? -9.379  -22.932 -22.346 1.00 0.00 ? 25 ARG A HH22 7  
ATOM 7478  N N    . GLU A 1 25 ? -6.479  -23.322 -14.397 1.00 0.00 ? 26 GLU A N    7  
ATOM 7479  C CA   . GLU A 1 25 ? -5.743  -24.513 -13.892 1.00 0.00 ? 26 GLU A CA   7  
ATOM 7480  C C    . GLU A 1 25 ? -6.377  -24.993 -12.584 1.00 0.00 ? 26 GLU A C    7  
ATOM 7481  O O    . GLU A 1 25 ? -5.718  -25.562 -11.737 1.00 0.00 ? 26 GLU A O    7  
ATOM 7482  C CB   . GLU A 1 25 ? -4.281  -24.138 -13.639 1.00 0.00 ? 26 GLU A CB   7  
ATOM 7483  C CG   . GLU A 1 25 ? -3.529  -24.076 -14.970 1.00 0.00 ? 26 GLU A CG   7  
ATOM 7484  C CD   . GLU A 1 25 ? -3.228  -25.495 -15.454 1.00 0.00 ? 26 GLU A CD   7  
ATOM 7485  O OE1  . GLU A 1 25 ? -4.097  -26.342 -15.320 1.00 0.00 ? 26 GLU A OE1  7  
ATOM 7486  O OE2  . GLU A 1 25 ? -2.135  -25.710 -15.952 1.00 0.00 ? 26 GLU A OE2  7  
ATOM 7487  H H    . GLU A 1 25 ? -6.202  -22.424 -14.125 1.00 0.00 ? 26 GLU A H    7  
ATOM 7488  H HA   . GLU A 1 25 ? -5.790  -25.300 -14.626 1.00 0.00 ? 26 GLU A HA   7  
ATOM 7489  H HB2  . GLU A 1 25 ? -4.236  -23.173 -13.153 1.00 0.00 ? 26 GLU A HB2  7  
ATOM 7490  H HB3  . GLU A 1 25 ? -3.824  -24.882 -13.003 1.00 0.00 ? 26 GLU A HB3  7  
ATOM 7491  H HG2  . GLU A 1 25 ? -4.136  -23.565 -15.702 1.00 0.00 ? 26 GLU A HG2  7  
ATOM 7492  H HG3  . GLU A 1 25 ? -2.601  -23.540 -14.834 1.00 0.00 ? 26 GLU A HG3  7  
ATOM 7493  N N    . ASN A 1 26 ? -7.650  -24.768 -12.410 1.00 0.00 ? 27 ASN A N    7  
ATOM 7494  C CA   . ASN A 1 26 ? -8.317  -25.211 -11.152 1.00 0.00 ? 27 ASN A CA   7  
ATOM 7495  C C    . ASN A 1 26 ? -9.656  -25.875 -11.478 1.00 0.00 ? 27 ASN A C    7  
ATOM 7496  O O    . ASN A 1 26 ? -10.266 -25.587 -12.487 1.00 0.00 ? 27 ASN A O    7  
ATOM 7497  C CB   . ASN A 1 26 ? -8.559  -23.999 -10.250 1.00 0.00 ? 27 ASN A CB   7  
ATOM 7498  C CG   . ASN A 1 26 ? -7.247  -23.596 -9.574  1.00 0.00 ? 27 ASN A CG   7  
ATOM 7499  O OD1  . ASN A 1 26 ? -6.448  -24.440 -9.220  1.00 0.00 ? 27 ASN A OD1  7  
ATOM 7500  N ND2  . ASN A 1 26 ? -6.992  -22.333 -9.377  1.00 0.00 ? 27 ASN A ND2  7  
ATOM 7501  H H    . ASN A 1 26 ? -8.167  -24.305 -13.102 1.00 0.00 ? 27 ASN A H    7  
ATOM 7502  H HA   . ASN A 1 26 ? -7.686  -25.920 -10.637 1.00 0.00 ? 27 ASN A HA   7  
ATOM 7503  H HB2  . ASN A 1 26 ? -8.926  -23.175 -10.845 1.00 0.00 ? 27 ASN A HB2  7  
ATOM 7504  H HB3  . ASN A 1 26 ? -9.288  -24.252 -9.496  1.00 0.00 ? 27 ASN A HB3  7  
ATOM 7505  H HD21 . ASN A 1 26 ? -7.638  -21.652 -9.662  1.00 0.00 ? 27 ASN A HD21 7  
ATOM 7506  H HD22 . ASN A 1 26 ? -6.154  -22.064 -8.946  1.00 0.00 ? 27 ASN A HD22 7  
ATOM 7507  N N    . PRO A 1 27 ? -10.067 -26.748 -10.597 1.00 0.00 ? 28 PRO A N    7  
ATOM 7508  C CA   . PRO A 1 27 ? -11.333 -27.483 -10.732 1.00 0.00 ? 28 PRO A CA   7  
ATOM 7509  C C    . PRO A 1 27 ? -12.517 -26.594 -10.361 1.00 0.00 ? 28 PRO A C    7  
ATOM 7510  O O    . PRO A 1 27 ? -13.140 -26.779 -9.334  1.00 0.00 ? 28 PRO A O    7  
ATOM 7511  C CB   . PRO A 1 27 ? -11.196 -28.629 -9.745  1.00 0.00 ? 28 PRO A CB   7  
ATOM 7512  C CG   . PRO A 1 27 ? -10.138 -28.195 -8.724  1.00 0.00 ? 28 PRO A CG   7  
ATOM 7513  C CD   . PRO A 1 27 ? -9.308  -27.083 -9.381  1.00 0.00 ? 28 PRO A CD   7  
ATOM 7514  H HA   . PRO A 1 27 ? -11.434 -27.875 -11.713 1.00 0.00 ? 28 PRO A HA   7  
ATOM 7515  H HB2  . PRO A 1 27 ? -12.142 -28.800 -9.248  1.00 0.00 ? 28 PRO A HB2  7  
ATOM 7516  H HB3  . PRO A 1 27 ? -10.868 -29.521 -10.252 1.00 0.00 ? 28 PRO A HB3  7  
ATOM 7517  H HG2  . PRO A 1 27 ? -10.622 -27.823 -7.841  1.00 0.00 ? 28 PRO A HG2  7  
ATOM 7518  H HG3  . PRO A 1 27 ? -9.506  -29.026 -8.488  1.00 0.00 ? 28 PRO A HG3  7  
ATOM 7519  H HD2  . PRO A 1 27 ? -9.237  -26.225 -8.726  1.00 0.00 ? 28 PRO A HD2  7  
ATOM 7520  H HD3  . PRO A 1 27 ? -8.326  -27.445 -9.643  1.00 0.00 ? 28 PRO A HD3  7  
ATOM 7521  N N    . GLY A 1 28 ? -12.827 -25.619 -11.172 1.00 0.00 ? 29 GLY A N    7  
ATOM 7522  C CA   . GLY A 1 28 ? -13.963 -24.719 -10.832 1.00 0.00 ? 29 GLY A CA   7  
ATOM 7523  C C    . GLY A 1 28 ? -13.821 -24.311 -9.368  1.00 0.00 ? 29 GLY A C    7  
ATOM 7524  O O    . GLY A 1 28 ? -14.784 -24.018 -8.689  1.00 0.00 ? 29 GLY A O    7  
ATOM 7525  H H    . GLY A 1 28 ? -12.309 -25.473 -11.991 1.00 0.00 ? 29 GLY A H    7  
ATOM 7526  H HA2  . GLY A 1 28 ? -13.934 -23.841 -11.462 1.00 0.00 ? 29 GLY A HA2  7  
ATOM 7527  H HA3  . GLY A 1 28 ? -14.898 -25.241 -10.970 1.00 0.00 ? 29 GLY A HA3  7  
ATOM 7528  N N    . ILE A 1 29 ? -12.609 -24.310 -8.879  1.00 0.00 ? 30 ILE A N    7  
ATOM 7529  C CA   . ILE A 1 29 ? -12.360 -23.944 -7.464  1.00 0.00 ? 30 ILE A CA   7  
ATOM 7530  C C    . ILE A 1 29 ? -13.248 -22.767 -7.055  1.00 0.00 ? 30 ILE A C    7  
ATOM 7531  O O    . ILE A 1 29 ? -13.644 -21.962 -7.874  1.00 0.00 ? 30 ILE A O    7  
ATOM 7532  C CB   . ILE A 1 29 ? -10.894 -23.571 -7.315  1.00 0.00 ? 30 ILE A CB   7  
ATOM 7533  C CG1  . ILE A 1 29 ? -10.572 -23.283 -5.848  1.00 0.00 ? 30 ILE A CG1  7  
ATOM 7534  C CG2  . ILE A 1 29 ? -10.627 -22.336 -8.151  1.00 0.00 ? 30 ILE A CG2  7  
ATOM 7535  C CD1  . ILE A 1 29 ? -9.068  -23.055 -5.697  1.00 0.00 ? 30 ILE A CD1  7  
ATOM 7536  H H    . ILE A 1 29 ? -11.852 -24.560 -9.450  1.00 0.00 ? 30 ILE A H    7  
ATOM 7537  H HA   . ILE A 1 29 ? -12.569 -24.784 -6.842  1.00 0.00 ? 30 ILE A HA   7  
ATOM 7538  H HB   . ILE A 1 29 ? -10.282 -24.387 -7.672  1.00 0.00 ? 30 ILE A HB   7  
ATOM 7539  H HG12 . ILE A 1 29 ? -11.107 -22.399 -5.530  1.00 0.00 ? 30 ILE A HG12 7  
ATOM 7540  H HG13 . ILE A 1 29 ? -10.871 -24.123 -5.240  1.00 0.00 ? 30 ILE A HG13 7  
ATOM 7541  H HG21 . ILE A 1 29 ? -11.504 -21.712 -8.140  1.00 0.00 ? 30 ILE A HG21 7  
ATOM 7542  H HG22 . ILE A 1 29 ? -9.790  -21.797 -7.740  1.00 0.00 ? 30 ILE A HG22 7  
ATOM 7543  H HG23 . ILE A 1 29 ? -10.409 -22.634 -9.162  1.00 0.00 ? 30 ILE A HG23 7  
ATOM 7544  H HD11 . ILE A 1 29 ? -8.536  -23.685 -6.397  1.00 0.00 ? 30 ILE A HD11 7  
ATOM 7545  H HD12 . ILE A 1 29 ? -8.838  -22.019 -5.900  1.00 0.00 ? 30 ILE A HD12 7  
ATOM 7546  H HD13 . ILE A 1 29 ? -8.766  -23.300 -4.689  1.00 0.00 ? 30 ILE A HD13 7  
ATOM 7547  N N    . LYS A 1 30 ? -13.561 -22.663 -5.793  1.00 0.00 ? 31 LYS A N    7  
ATOM 7548  C CA   . LYS A 1 30 ? -14.422 -21.540 -5.328  1.00 0.00 ? 31 LYS A CA   7  
ATOM 7549  C C    . LYS A 1 30 ? -13.691 -20.211 -5.534  1.00 0.00 ? 31 LYS A C    7  
ATOM 7550  O O    . LYS A 1 30 ? -12.501 -20.105 -5.313  1.00 0.00 ? 31 LYS A O    7  
ATOM 7551  C CB   . LYS A 1 30 ? -14.734 -21.721 -3.841  1.00 0.00 ? 31 LYS A CB   7  
ATOM 7552  C CG   . LYS A 1 30 ? -16.241 -21.899 -3.655  1.00 0.00 ? 31 LYS A CG   7  
ATOM 7553  C CD   . LYS A 1 30 ? -16.736 -23.023 -4.566  1.00 0.00 ? 31 LYS A CD   7  
ATOM 7554  C CE   . LYS A 1 30 ? -17.690 -23.929 -3.785  1.00 0.00 ? 31 LYS A CE   7  
ATOM 7555  N NZ   . LYS A 1 30 ? -18.334 -24.893 -4.718  1.00 0.00 ? 31 LYS A NZ   7  
ATOM 7556  H H    . LYS A 1 30 ? -13.228 -23.324 -5.152  1.00 0.00 ? 31 LYS A H    7  
ATOM 7557  H HA   . LYS A 1 30 ? -15.343 -21.535 -5.890  1.00 0.00 ? 31 LYS A HA   7  
ATOM 7558  H HB2  . LYS A 1 30 ? -14.218 -22.594 -3.468  1.00 0.00 ? 31 LYS A HB2  7  
ATOM 7559  H HB3  . LYS A 1 30 ? -14.408 -20.848 -3.295  1.00 0.00 ? 31 LYS A HB3  7  
ATOM 7560  H HG2  . LYS A 1 30 ? -16.450 -22.151 -2.625  1.00 0.00 ? 31 LYS A HG2  7  
ATOM 7561  H HG3  . LYS A 1 30 ? -16.749 -20.982 -3.911  1.00 0.00 ? 31 LYS A HG3  7  
ATOM 7562  H HD2  . LYS A 1 30 ? -17.253 -22.599 -5.414  1.00 0.00 ? 31 LYS A HD2  7  
ATOM 7563  H HD3  . LYS A 1 30 ? -15.894 -23.604 -4.911  1.00 0.00 ? 31 LYS A HD3  7  
ATOM 7564  H HE2  . LYS A 1 30 ? -17.136 -24.470 -3.032  1.00 0.00 ? 31 LYS A HE2  7  
ATOM 7565  H HE3  . LYS A 1 30 ? -18.449 -23.325 -3.308  1.00 0.00 ? 31 LYS A HE3  7  
ATOM 7566  H HZ1  . LYS A 1 30 ? -18.186 -24.581 -5.698  1.00 0.00 ? 31 LYS A HZ1  7  
ATOM 7567  H HZ2  . LYS A 1 30 ? -17.914 -25.835 -4.589  1.00 0.00 ? 31 LYS A HZ2  7  
ATOM 7568  H HZ3  . LYS A 1 30 ? -19.355 -24.939 -4.519  1.00 0.00 ? 31 LYS A HZ3  7  
ATOM 7569  N N    . VAL A 1 31 ? -14.395 -19.195 -5.954  1.00 0.00 ? 32 VAL A N    7  
ATOM 7570  C CA   . VAL A 1 31 ? -13.751 -17.880 -6.174  1.00 0.00 ? 32 VAL A CA   7  
ATOM 7571  C C    . VAL A 1 31 ? -12.986 -17.476 -4.905  1.00 0.00 ? 32 VAL A C    7  
ATOM 7572  O O    . VAL A 1 31 ? -12.043 -16.711 -4.956  1.00 0.00 ? 32 VAL A O    7  
ATOM 7573  C CB   . VAL A 1 31 ? -14.824 -16.833 -6.540  1.00 0.00 ? 32 VAL A CB   7  
ATOM 7574  C CG1  . VAL A 1 31 ? -16.188 -17.282 -6.043  1.00 0.00 ? 32 VAL A CG1  7  
ATOM 7575  C CG2  . VAL A 1 31 ? -14.498 -15.489 -5.904  1.00 0.00 ? 32 VAL A CG2  7  
ATOM 7576  H H    . VAL A 1 31 ? -15.345 -19.296 -6.127  1.00 0.00 ? 32 VAL A H    7  
ATOM 7577  H HA   . VAL A 1 31 ? -13.065 -17.967 -6.989  1.00 0.00 ? 32 VAL A HA   7  
ATOM 7578  H HB   . VAL A 1 31 ? -14.858 -16.727 -7.612  1.00 0.00 ? 32 VAL A HB   7  
ATOM 7579  H HG11 . VAL A 1 31 ? -16.061 -17.847 -5.135  1.00 0.00 ? 32 VAL A HG11 7  
ATOM 7580  H HG12 . VAL A 1 31 ? -16.808 -16.420 -5.856  1.00 0.00 ? 32 VAL A HG12 7  
ATOM 7581  H HG13 . VAL A 1 31 ? -16.646 -17.906 -6.793  1.00 0.00 ? 32 VAL A HG13 7  
ATOM 7582  H HG21 . VAL A 1 31 ? -13.518 -15.169 -6.222  1.00 0.00 ? 32 VAL A HG21 7  
ATOM 7583  H HG22 . VAL A 1 31 ? -15.235 -14.762 -6.202  1.00 0.00 ? 32 VAL A HG22 7  
ATOM 7584  H HG23 . VAL A 1 31 ? -14.512 -15.602 -4.832  1.00 0.00 ? 32 VAL A HG23 7  
ATOM 7585  N N    . THR A 1 32 ? -13.387 -17.981 -3.770  1.00 0.00 ? 33 THR A N    7  
ATOM 7586  C CA   . THR A 1 32 ? -12.684 -17.621 -2.505  1.00 0.00 ? 33 THR A CA   7  
ATOM 7587  C C    . THR A 1 32 ? -11.452 -18.512 -2.326  1.00 0.00 ? 33 THR A C    7  
ATOM 7588  O O    . THR A 1 32 ? -10.411 -18.067 -1.887  1.00 0.00 ? 33 THR A O    7  
ATOM 7589  C CB   . THR A 1 32 ? -13.633 -17.820 -1.321  1.00 0.00 ? 33 THR A CB   7  
ATOM 7590  O OG1  . THR A 1 32 ? -14.150 -19.144 -1.347  1.00 0.00 ? 33 THR A OG1  7  
ATOM 7591  C CG2  . THR A 1 32 ? -14.787 -16.819 -1.413  1.00 0.00 ? 33 THR A CG2  7  
ATOM 7592  H H    . THR A 1 32 ? -14.151 -18.594 -3.749  1.00 0.00 ? 33 THR A H    7  
ATOM 7593  H HA   . THR A 1 32 ? -12.376 -16.586 -2.547  1.00 0.00 ? 33 THR A HA   7  
ATOM 7594  H HB   . THR A 1 32 ? -13.097 -17.660 -0.398  1.00 0.00 ? 33 THR A HB   7  
ATOM 7595  H HG1  . THR A 1 32 ? -13.407 -19.751 -1.387  1.00 0.00 ? 33 THR A HG1  7  
ATOM 7596  H HG21 . THR A 1 32 ? -14.389 -15.820 -1.499  1.00 0.00 ? 33 THR A HG21 7  
ATOM 7597  H HG22 . THR A 1 32 ? -15.389 -17.044 -2.280  1.00 0.00 ? 33 THR A HG22 7  
ATOM 7598  H HG23 . THR A 1 32 ? -15.396 -16.890 -0.524  1.00 0.00 ? 33 THR A HG23 7  
ATOM 7599  N N    . GLU A 1 33 ? -11.563 -19.769 -2.661  1.00 0.00 ? 34 GLU A N    7  
ATOM 7600  C CA   . GLU A 1 33 ? -10.397 -20.686 -2.506  1.00 0.00 ? 34 GLU A CA   7  
ATOM 7601  C C    . GLU A 1 33 ? -9.372  -20.400 -3.604  1.00 0.00 ? 34 GLU A C    7  
ATOM 7602  O O    . GLU A 1 33 ? -8.276  -20.924 -3.595  1.00 0.00 ? 34 GLU A O    7  
ATOM 7603  C CB   . GLU A 1 33 ? -10.872 -22.136 -2.624  1.00 0.00 ? 34 GLU A CB   7  
ATOM 7604  C CG   . GLU A 1 33 ? -11.397 -22.616 -1.270  1.00 0.00 ? 34 GLU A CG   7  
ATOM 7605  C CD   . GLU A 1 33 ? -12.480 -23.673 -1.489  1.00 0.00 ? 34 GLU A CD   7  
ATOM 7606  O OE1  . GLU A 1 33 ? -12.138 -24.765 -1.912  1.00 0.00 ? 34 GLU A OE1  7  
ATOM 7607  O OE2  . GLU A 1 33 ? -13.634 -23.373 -1.229  1.00 0.00 ? 34 GLU A OE2  7  
ATOM 7608  H H    . GLU A 1 33 ? -12.411 -20.110 -3.011  1.00 0.00 ? 34 GLU A H    7  
ATOM 7609  H HA   . GLU A 1 33 ? -9.942  -20.533 -1.539  1.00 0.00 ? 34 GLU A HA   7  
ATOM 7610  H HB2  . GLU A 1 33 ? -11.661 -22.197 -3.360  1.00 0.00 ? 34 GLU A HB2  7  
ATOM 7611  H HB3  . GLU A 1 33 ? -10.046 -22.761 -2.929  1.00 0.00 ? 34 GLU A HB3  7  
ATOM 7612  H HG2  . GLU A 1 33 ? -10.586 -23.042 -0.700  1.00 0.00 ? 34 GLU A HG2  7  
ATOM 7613  H HG3  . GLU A 1 33 ? -11.817 -21.780 -0.730  1.00 0.00 ? 34 GLU A HG3  7  
ATOM 7614  N N    . VAL A 1 34 ? -9.719  -19.576 -4.554  1.00 0.00 ? 35 VAL A N    7  
ATOM 7615  C CA   . VAL A 1 34 ? -8.767  -19.263 -5.653  1.00 0.00 ? 35 VAL A CA   7  
ATOM 7616  C C    . VAL A 1 34 ? -7.626  -18.395 -5.118  1.00 0.00 ? 35 VAL A C    7  
ATOM 7617  O O    . VAL A 1 34 ? -6.522  -18.426 -5.624  1.00 0.00 ? 35 VAL A O    7  
ATOM 7618  C CB   . VAL A 1 34 ? -9.511  -18.517 -6.758  1.00 0.00 ? 35 VAL A CB   7  
ATOM 7619  C CG1  . VAL A 1 34 ? -8.509  -17.869 -7.716  1.00 0.00 ? 35 VAL A CG1  7  
ATOM 7620  C CG2  . VAL A 1 34 ? -10.389 -19.504 -7.531  1.00 0.00 ? 35 VAL A CG2  7  
ATOM 7621  H H    . VAL A 1 34 ? -10.609 -19.167 -4.545  1.00 0.00 ? 35 VAL A H    7  
ATOM 7622  H HA   . VAL A 1 34 ? -8.366  -20.178 -6.051  1.00 0.00 ? 35 VAL A HA   7  
ATOM 7623  H HB   . VAL A 1 34 ? -10.129 -17.757 -6.315  1.00 0.00 ? 35 VAL A HB   7  
ATOM 7624  H HG11 . VAL A 1 34 ? -7.885  -18.634 -8.154  1.00 0.00 ? 35 VAL A HG11 7  
ATOM 7625  H HG12 . VAL A 1 34 ? -9.043  -17.349 -8.497  1.00 0.00 ? 35 VAL A HG12 7  
ATOM 7626  H HG13 . VAL A 1 34 ? -7.892  -17.169 -7.173  1.00 0.00 ? 35 VAL A HG13 7  
ATOM 7627  H HG21 . VAL A 1 34 ? -10.788 -20.240 -6.848  1.00 0.00 ? 35 VAL A HG21 7  
ATOM 7628  H HG22 . VAL A 1 34 ? -11.202 -18.971 -8.001  1.00 0.00 ? 35 VAL A HG22 7  
ATOM 7629  H HG23 . VAL A 1 34 ? -9.798  -19.999 -8.287  1.00 0.00 ? 35 VAL A HG23 7  
ATOM 7630  N N    . ALA A 1 35 ? -7.882  -17.619 -4.100  1.00 0.00 ? 36 ALA A N    7  
ATOM 7631  C CA   . ALA A 1 35 ? -6.812  -16.750 -3.539  1.00 0.00 ? 36 ALA A CA   7  
ATOM 7632  C C    . ALA A 1 35 ? -6.074  -17.493 -2.423  1.00 0.00 ? 36 ALA A C    7  
ATOM 7633  O O    . ALA A 1 35 ? -4.875  -17.369 -2.270  1.00 0.00 ? 36 ALA A O    7  
ATOM 7634  C CB   . ALA A 1 35 ? -7.437  -15.473 -2.974  1.00 0.00 ? 36 ALA A CB   7  
ATOM 7635  H H    . ALA A 1 35 ? -8.778  -17.605 -3.708  1.00 0.00 ? 36 ALA A H    7  
ATOM 7636  H HA   . ALA A 1 35 ? -6.116  -16.493 -4.321  1.00 0.00 ? 36 ALA A HA   7  
ATOM 7637  H HB1  . ALA A 1 35 ? -8.514  -15.549 -3.022  1.00 0.00 ? 36 ALA A HB1  7  
ATOM 7638  H HB2  . ALA A 1 35 ? -7.131  -15.346 -1.947  1.00 0.00 ? 36 ALA A HB2  7  
ATOM 7639  H HB3  . ALA A 1 35 ? -7.110  -14.624 -3.556  1.00 0.00 ? 36 ALA A HB3  7  
ATOM 7640  N N    . LYS A 1 36 ? -6.780  -18.263 -1.640  1.00 0.00 ? 37 LYS A N    7  
ATOM 7641  C CA   . LYS A 1 36 ? -6.121  -19.007 -0.537  1.00 0.00 ? 37 LYS A CA   7  
ATOM 7642  C C    . LYS A 1 36 ? -5.144  -20.031 -1.121  1.00 0.00 ? 37 LYS A C    7  
ATOM 7643  O O    . LYS A 1 36 ? -4.134  -20.351 -0.526  1.00 0.00 ? 37 LYS A O    7  
ATOM 7644  C CB   . LYS A 1 36 ? -7.197  -19.701 0.285   1.00 0.00 ? 37 LYS A CB   7  
ATOM 7645  C CG   . LYS A 1 36 ? -6.586  -20.836 1.114   1.00 0.00 ? 37 LYS A CG   7  
ATOM 7646  C CD   . LYS A 1 36 ? -7.048  -22.184 0.557   1.00 0.00 ? 37 LYS A CD   7  
ATOM 7647  C CE   . LYS A 1 36 ? -5.863  -23.152 0.522   1.00 0.00 ? 37 LYS A CE   7  
ATOM 7648  N NZ   . LYS A 1 36 ? -5.358  -23.370 1.907   1.00 0.00 ? 37 LYS A NZ   7  
ATOM 7649  H H    . LYS A 1 36 ? -7.747  -18.353 -1.774  1.00 0.00 ? 37 LYS A H    7  
ATOM 7650  H HA   . LYS A 1 36 ? -5.593  -18.317 0.096   1.00 0.00 ? 37 LYS A HA   7  
ATOM 7651  H HB2  . LYS A 1 36 ? -7.640  -18.976 0.944   1.00 0.00 ? 37 LYS A HB2  7  
ATOM 7652  H HB3  . LYS A 1 36 ? -7.951  -20.096 -0.378  1.00 0.00 ? 37 LYS A HB3  7  
ATOM 7653  H HG2  . LYS A 1 36 ? -5.509  -20.776 1.069   1.00 0.00 ? 37 LYS A HG2  7  
ATOM 7654  H HG3  . LYS A 1 36 ? -6.910  -20.744 2.140   1.00 0.00 ? 37 LYS A HG3  7  
ATOM 7655  H HD2  . LYS A 1 36 ? -7.825  -22.588 1.190   1.00 0.00 ? 37 LYS A HD2  7  
ATOM 7656  H HD3  . LYS A 1 36 ? -7.430  -22.049 -0.443  1.00 0.00 ? 37 LYS A HD3  7  
ATOM 7657  H HE2  . LYS A 1 36 ? -6.181  -24.093 0.102   1.00 0.00 ? 37 LYS A HE2  7  
ATOM 7658  H HE3  . LYS A 1 36 ? -5.075  -22.733 -0.087  1.00 0.00 ? 37 LYS A HE3  7  
ATOM 7659  H HZ1  . LYS A 1 36 ? -5.872  -22.751 2.564   1.00 0.00 ? 37 LYS A HZ1  7  
ATOM 7660  H HZ2  . LYS A 1 36 ? -5.509  -24.362 2.178   1.00 0.00 ? 37 LYS A HZ2  7  
ATOM 7661  H HZ3  . LYS A 1 36 ? -4.342  -23.150 1.943   1.00 0.00 ? 37 LYS A HZ3  7  
ATOM 7662  N N    . ARG A 1 37 ? -5.436  -20.544 -2.285  1.00 0.00 ? 38 ARG A N    7  
ATOM 7663  C CA   . ARG A 1 37 ? -4.525  -21.541 -2.912  1.00 0.00 ? 38 ARG A CA   7  
ATOM 7664  C C    . ARG A 1 37 ? -3.340  -20.817 -3.554  1.00 0.00 ? 38 ARG A C    7  
ATOM 7665  O O    . ARG A 1 37 ? -2.304  -21.397 -3.799  1.00 0.00 ? 38 ARG A O    7  
ATOM 7666  C CB   . ARG A 1 37 ? -5.292  -22.316 -3.984  1.00 0.00 ? 38 ARG A CB   7  
ATOM 7667  C CG   . ARG A 1 37 ? -5.554  -23.743 -3.497  1.00 0.00 ? 38 ARG A CG   7  
ATOM 7668  C CD   . ARG A 1 37 ? -6.789  -23.756 -2.596  1.00 0.00 ? 38 ARG A CD   7  
ATOM 7669  N NE   . ARG A 1 37 ? -7.130  -25.163 -2.241  1.00 0.00 ? 38 ARG A NE   7  
ATOM 7670  C CZ   . ARG A 1 37 ? -7.936  -25.406 -1.244  1.00 0.00 ? 38 ARG A CZ   7  
ATOM 7671  N NH1  . ARG A 1 37 ? -9.203  -25.109 -1.342  1.00 0.00 ? 38 ARG A NH1  7  
ATOM 7672  N NH2  . ARG A 1 37 ? -7.476  -25.947 -0.149  1.00 0.00 ? 38 ARG A NH2  7  
ATOM 7673  H H    . ARG A 1 37 ? -6.253  -20.272 -2.750  1.00 0.00 ? 38 ARG A H    7  
ATOM 7674  H HA   . ARG A 1 37 ? -4.166  -22.228 -2.158  1.00 0.00 ? 38 ARG A HA   7  
ATOM 7675  H HB2  . ARG A 1 37 ? -6.234  -21.821 -4.175  1.00 0.00 ? 38 ARG A HB2  7  
ATOM 7676  H HB3  . ARG A 1 37 ? -4.710  -22.348 -4.892  1.00 0.00 ? 38 ARG A HB3  7  
ATOM 7677  H HG2  . ARG A 1 37 ? -5.720  -24.388 -4.347  1.00 0.00 ? 38 ARG A HG2  7  
ATOM 7678  H HG3  . ARG A 1 37 ? -4.700  -24.095 -2.939  1.00 0.00 ? 38 ARG A HG3  7  
ATOM 7679  H HD2  . ARG A 1 37 ? -6.582  -23.197 -1.696  1.00 0.00 ? 38 ARG A HD2  7  
ATOM 7680  H HD3  . ARG A 1 37 ? -7.620  -23.305 -3.117  1.00 0.00 ? 38 ARG A HD3  7  
ATOM 7681  H HE   . ARG A 1 37 ? -6.750  -25.904 -2.757  1.00 0.00 ? 38 ARG A HE   7  
ATOM 7682  H HH11 . ARG A 1 37 ? -9.556  -24.694 -2.181  1.00 0.00 ? 38 ARG A HH11 7  
ATOM 7683  H HH12 . ARG A 1 37 ? -9.820  -25.296 -0.579  1.00 0.00 ? 38 ARG A HH12 7  
ATOM 7684  H HH21 . ARG A 1 37 ? -6.504  -26.175 -0.074  1.00 0.00 ? 38 ARG A HH21 7  
ATOM 7685  H HH22 . ARG A 1 37 ? -8.093  -26.133 0.615   1.00 0.00 ? 38 ARG A HH22 7  
ATOM 7686  N N    . GLY A 1 38 ? -3.483  -19.550 -3.832  1.00 0.00 ? 39 GLY A N    7  
ATOM 7687  C CA   . GLY A 1 38 ? -2.362  -18.793 -4.462  1.00 0.00 ? 39 GLY A CA   7  
ATOM 7688  C C    . GLY A 1 38 ? -1.134  -18.831 -3.549  1.00 0.00 ? 39 GLY A C    7  
ATOM 7689  O O    . GLY A 1 38 ? -0.035  -18.514 -3.961  1.00 0.00 ? 39 GLY A O    7  
ATOM 7690  H H    . GLY A 1 38 ? -4.328  -19.095 -3.629  1.00 0.00 ? 39 GLY A H    7  
ATOM 7691  H HA2  . GLY A 1 38 ? -2.118  -19.244 -5.414  1.00 0.00 ? 39 GLY A HA2  7  
ATOM 7692  H HA3  . GLY A 1 38 ? -2.661  -17.767 -4.616  1.00 0.00 ? 39 GLY A HA3  7  
ATOM 7693  N N    . GLY A 1 39 ? -1.308  -19.214 -2.313  1.00 0.00 ? 40 GLY A N    7  
ATOM 7694  C CA   . GLY A 1 39 ? -0.146  -19.268 -1.380  1.00 0.00 ? 40 GLY A CA   7  
ATOM 7695  C C    . GLY A 1 39 ? 0.572   -20.610 -1.528  1.00 0.00 ? 40 GLY A C    7  
ATOM 7696  O O    . GLY A 1 39 ? 1.775   -20.700 -1.382  1.00 0.00 ? 40 GLY A O    7  
ATOM 7697  H H    . GLY A 1 39 ? -2.201  -19.465 -1.999  1.00 0.00 ? 40 GLY A H    7  
ATOM 7698  H HA2  . GLY A 1 39 ? 0.539   -18.464 -1.611  1.00 0.00 ? 40 GLY A HA2  7  
ATOM 7699  H HA3  . GLY A 1 39 ? -0.496  -19.161 -0.364  1.00 0.00 ? 40 GLY A HA3  7  
ATOM 7700  N N    . GLU A 1 40 ? -0.155  -21.656 -1.814  1.00 0.00 ? 41 GLU A N    7  
ATOM 7701  C CA   . GLU A 1 40 ? 0.489   -22.990 -1.968  1.00 0.00 ? 41 GLU A CA   7  
ATOM 7702  C C    . GLU A 1 40 ? 1.442   -22.968 -3.168  1.00 0.00 ? 41 GLU A C    7  
ATOM 7703  O O    . GLU A 1 40 ? 2.515   -23.536 -3.134  1.00 0.00 ? 41 GLU A O    7  
ATOM 7704  C CB   . GLU A 1 40 ? -0.591  -24.058 -2.166  1.00 0.00 ? 41 GLU A CB   7  
ATOM 7705  C CG   . GLU A 1 40 ? -0.996  -24.148 -3.641  1.00 0.00 ? 41 GLU A CG   7  
ATOM 7706  C CD   . GLU A 1 40 ? -2.215  -25.060 -3.782  1.00 0.00 ? 41 GLU A CD   7  
ATOM 7707  O OE1  . GLU A 1 40 ? -2.295  -26.028 -3.044  1.00 0.00 ? 41 GLU A OE1  7  
ATOM 7708  O OE2  . GLU A 1 40 ? -3.049  -24.776 -4.627  1.00 0.00 ? 41 GLU A OE2  7  
ATOM 7709  H H    . GLU A 1 40 ? -1.124  -21.564 -1.925  1.00 0.00 ? 41 GLU A H    7  
ATOM 7710  H HA   . GLU A 1 40 ? 1.047   -23.221 -1.075  1.00 0.00 ? 41 GLU A HA   7  
ATOM 7711  H HB2  . GLU A 1 40 ? -0.205  -25.010 -1.839  1.00 0.00 ? 41 GLU A HB2  7  
ATOM 7712  H HB3  . GLU A 1 40 ? -1.456  -23.801 -1.573  1.00 0.00 ? 41 GLU A HB3  7  
ATOM 7713  H HG2  . GLU A 1 40 ? -1.239  -23.163 -4.009  1.00 0.00 ? 41 GLU A HG2  7  
ATOM 7714  H HG3  . GLU A 1 40 ? -0.178  -24.554 -4.215  1.00 0.00 ? 41 GLU A HG3  7  
ATOM 7715  N N    . LEU A 1 41 ? 1.053   -22.319 -4.230  1.00 0.00 ? 42 LEU A N    7  
ATOM 7716  C CA   . LEU A 1 41 ? 1.924   -22.261 -5.434  1.00 0.00 ? 42 LEU A CA   7  
ATOM 7717  C C    . LEU A 1 41 ? 3.044   -21.240 -5.217  1.00 0.00 ? 42 LEU A C    7  
ATOM 7718  O O    . LEU A 1 41 ? 4.180   -21.464 -5.582  1.00 0.00 ? 42 LEU A O    7  
ATOM 7719  C CB   . LEU A 1 41 ? 1.084   -21.843 -6.640  1.00 0.00 ? 42 LEU A CB   7  
ATOM 7720  C CG   . LEU A 1 41 ? 0.359   -23.064 -7.206  1.00 0.00 ? 42 LEU A CG   7  
ATOM 7721  C CD1  . LEU A 1 41 ? -0.406  -22.662 -8.469  1.00 0.00 ? 42 LEU A CD1  7  
ATOM 7722  C CD2  . LEU A 1 41 ? 1.382   -24.148 -7.553  1.00 0.00 ? 42 LEU A CD2  7  
ATOM 7723  H H    . LEU A 1 41 ? 0.182   -21.871 -4.239  1.00 0.00 ? 42 LEU A H    7  
ATOM 7724  H HA   . LEU A 1 41 ? 2.354   -23.236 -5.615  1.00 0.00 ? 42 LEU A HA   7  
ATOM 7725  H HB2  . LEU A 1 41 ? 0.360   -21.103 -6.333  1.00 0.00 ? 42 LEU A HB2  7  
ATOM 7726  H HB3  . LEU A 1 41 ? 1.727   -21.424 -7.397  1.00 0.00 ? 42 LEU A HB3  7  
ATOM 7727  H HG   . LEU A 1 41 ? -0.335  -23.443 -6.471  1.00 0.00 ? 42 LEU A HG   7  
ATOM 7728  H HD11 . LEU A 1 41 ? -0.155  -21.646 -8.733  1.00 0.00 ? 42 LEU A HD11 7  
ATOM 7729  H HD12 . LEU A 1 41 ? -0.135  -23.322 -9.278  1.00 0.00 ? 42 LEU A HD12 7  
ATOM 7730  H HD13 . LEU A 1 41 ? -1.468  -22.734 -8.284  1.00 0.00 ? 42 LEU A HD13 7  
ATOM 7731  H HD21 . LEU A 1 41 ? 2.335   -23.689 -7.767  1.00 0.00 ? 42 LEU A HD21 7  
ATOM 7732  H HD22 . LEU A 1 41 ? 1.488   -24.824 -6.716  1.00 0.00 ? 42 LEU A HD22 7  
ATOM 7733  H HD23 . LEU A 1 41 ? 1.045   -24.698 -8.420  1.00 0.00 ? 42 LEU A HD23 7  
ATOM 7734  N N    . TRP A 1 42 ? 2.730   -20.118 -4.632  1.00 0.00 ? 43 TRP A N    7  
ATOM 7735  C CA   . TRP A 1 42 ? 3.772   -19.077 -4.397  1.00 0.00 ? 43 TRP A CA   7  
ATOM 7736  C C    . TRP A 1 42 ? 4.895   -19.649 -3.528  1.00 0.00 ? 43 TRP A C    7  
ATOM 7737  O O    . TRP A 1 42 ? 5.988   -19.118 -3.483  1.00 0.00 ? 43 TRP A O    7  
ATOM 7738  C CB   . TRP A 1 42 ? 3.139   -17.886 -3.681  1.00 0.00 ? 43 TRP A CB   7  
ATOM 7739  C CG   . TRP A 1 42 ? 4.212   -16.958 -3.206  1.00 0.00 ? 43 TRP A CG   7  
ATOM 7740  C CD1  . TRP A 1 42 ? 4.710   -16.926 -1.949  1.00 0.00 ? 43 TRP A CD1  7  
ATOM 7741  C CD2  . TRP A 1 42 ? 4.921   -15.933 -3.955  1.00 0.00 ? 43 TRP A CD2  7  
ATOM 7742  N NE1  . TRP A 1 42 ? 5.680   -15.941 -1.879  1.00 0.00 ? 43 TRP A NE1  7  
ATOM 7743  C CE2  . TRP A 1 42 ? 5.847   -15.300 -3.092  1.00 0.00 ? 43 TRP A CE2  7  
ATOM 7744  C CE3  . TRP A 1 42 ? 4.851   -15.492 -5.288  1.00 0.00 ? 43 TRP A CE3  7  
ATOM 7745  C CZ2  . TRP A 1 42 ? 6.673   -14.266 -3.536  1.00 0.00 ? 43 TRP A CZ2  7  
ATOM 7746  C CZ3  . TRP A 1 42 ? 5.681   -14.455 -5.739  1.00 0.00 ? 43 TRP A CZ3  7  
ATOM 7747  C CH2  . TRP A 1 42 ? 6.590   -13.842 -4.865  1.00 0.00 ? 43 TRP A CH2  7  
ATOM 7748  H H    . TRP A 1 42 ? 1.805   -19.955 -4.351  1.00 0.00 ? 43 TRP A H    7  
ATOM 7749  H HA   . TRP A 1 42 ? 4.178   -18.752 -5.344  1.00 0.00 ? 43 TRP A HA   7  
ATOM 7750  H HB2  . TRP A 1 42 ? 2.486   -17.362 -4.363  1.00 0.00 ? 43 TRP A HB2  7  
ATOM 7751  H HB3  . TRP A 1 42 ? 2.567   -18.238 -2.835  1.00 0.00 ? 43 TRP A HB3  7  
ATOM 7752  H HD1  . TRP A 1 42 ? 4.400   -17.564 -1.135  1.00 0.00 ? 43 TRP A HD1  7  
ATOM 7753  H HE1  . TRP A 1 42 ? 6.196   -15.712 -1.078  1.00 0.00 ? 43 TRP A HE1  7  
ATOM 7754  H HE3  . TRP A 1 42 ? 4.156   -15.957 -5.971  1.00 0.00 ? 43 TRP A HE3  7  
ATOM 7755  H HZ2  . TRP A 1 42 ? 7.371   -13.796 -2.858  1.00 0.00 ? 43 TRP A HZ2  7  
ATOM 7756  H HZ3  . TRP A 1 42 ? 5.619   -14.127 -6.763  1.00 0.00 ? 43 TRP A HZ3  7  
ATOM 7757  H HH2  . TRP A 1 42 ? 7.226   -13.044 -5.218  1.00 0.00 ? 43 TRP A HH2  7  
ATOM 7758  N N    . ARG A 1 43 ? 4.637   -20.717 -2.826  1.00 0.00 ? 44 ARG A N    7  
ATOM 7759  C CA   . ARG A 1 43 ? 5.690   -21.302 -1.953  1.00 0.00 ? 44 ARG A CA   7  
ATOM 7760  C C    . ARG A 1 43 ? 6.572   -22.259 -2.761  1.00 0.00 ? 44 ARG A C    7  
ATOM 7761  O O    . ARG A 1 43 ? 7.773   -22.304 -2.588  1.00 0.00 ? 44 ARG A O    7  
ATOM 7762  C CB   . ARG A 1 43 ? 5.028   -22.068 -0.805  1.00 0.00 ? 44 ARG A CB   7  
ATOM 7763  C CG   . ARG A 1 43 ? 6.102   -22.753 0.043   1.00 0.00 ? 44 ARG A CG   7  
ATOM 7764  C CD   . ARG A 1 43 ? 6.582   -21.790 1.133   1.00 0.00 ? 44 ARG A CD   7  
ATOM 7765  N NE   . ARG A 1 43 ? 7.999   -22.097 1.477   1.00 0.00 ? 44 ARG A NE   7  
ATOM 7766  C CZ   . ARG A 1 43 ? 8.329   -22.359 2.712   1.00 0.00 ? 44 ARG A CZ   7  
ATOM 7767  N NH1  . ARG A 1 43 ? 8.506   -21.385 3.561   1.00 0.00 ? 44 ARG A NH1  7  
ATOM 7768  N NH2  . ARG A 1 43 ? 8.487   -23.597 3.096   1.00 0.00 ? 44 ARG A NH2  7  
ATOM 7769  H H    . ARG A 1 43 ? 3.749   -21.126 -2.865  1.00 0.00 ? 44 ARG A H    7  
ATOM 7770  H HA   . ARG A 1 43 ? 6.298   -20.508 -1.548  1.00 0.00 ? 44 ARG A HA   7  
ATOM 7771  H HB2  . ARG A 1 43 ? 4.468   -21.379 -0.189  1.00 0.00 ? 44 ARG A HB2  7  
ATOM 7772  H HB3  . ARG A 1 43 ? 4.361   -22.815 -1.208  1.00 0.00 ? 44 ARG A HB3  7  
ATOM 7773  H HG2  . ARG A 1 43 ? 5.688   -23.639 0.502   1.00 0.00 ? 44 ARG A HG2  7  
ATOM 7774  H HG3  . ARG A 1 43 ? 6.936   -23.028 -0.582  1.00 0.00 ? 44 ARG A HG3  7  
ATOM 7775  H HD2  . ARG A 1 43 ? 6.511   -20.775 0.773   1.00 0.00 ? 44 ARG A HD2  7  
ATOM 7776  H HD3  . ARG A 1 43 ? 5.964   -21.905 2.011   1.00 0.00 ? 44 ARG A HD3  7  
ATOM 7777  H HE   . ARG A 1 43 ? 8.683   -22.100 0.776   1.00 0.00 ? 44 ARG A HE   7  
ATOM 7778  H HH11 . ARG A 1 43 ? 8.387   -20.436 3.266   1.00 0.00 ? 44 ARG A HH11 7  
ATOM 7779  H HH12 . ARG A 1 43 ? 8.760   -21.585 4.506   1.00 0.00 ? 44 ARG A HH12 7  
ATOM 7780  H HH21 . ARG A 1 43 ? 8.353   -24.343 2.444   1.00 0.00 ? 44 ARG A HH21 7  
ATOM 7781  H HH22 . ARG A 1 43 ? 8.741   -23.798 4.042   1.00 0.00 ? 44 ARG A HH22 7  
ATOM 7782  N N    . ALA A 1 44 ? 5.986   -23.030 -3.635  1.00 0.00 ? 45 ALA A N    7  
ATOM 7783  C CA   . ALA A 1 44 ? 6.789   -23.991 -4.444  1.00 0.00 ? 45 ALA A CA   7  
ATOM 7784  C C    . ALA A 1 44 ? 6.787   -23.560 -5.908  1.00 0.00 ? 45 ALA A C    7  
ATOM 7785  O O    . ALA A 1 44 ? 7.071   -24.337 -6.799  1.00 0.00 ? 45 ALA A O    7  
ATOM 7786  C CB   . ALA A 1 44 ? 6.158   -25.372 -4.338  1.00 0.00 ? 45 ALA A CB   7  
ATOM 7787  H H    . ALA A 1 44 ? 5.014   -22.985 -3.754  1.00 0.00 ? 45 ALA A H    7  
ATOM 7788  H HA   . ALA A 1 44 ? 7.802   -24.025 -4.072  1.00 0.00 ? 45 ALA A HA   7  
ATOM 7789  H HB1  . ALA A 1 44 ? 5.118   -25.305 -4.620  1.00 0.00 ? 45 ALA A HB1  7  
ATOM 7790  H HB2  . ALA A 1 44 ? 6.668   -26.053 -5.001  1.00 0.00 ? 45 ALA A HB2  7  
ATOM 7791  H HB3  . ALA A 1 44 ? 6.235   -25.727 -3.322  1.00 0.00 ? 45 ALA A HB3  7  
ATOM 7792  N N    . MET A 1 45 ? 6.461   -22.331 -6.161  1.00 0.00 ? 46 MET A N    7  
ATOM 7793  C CA   . MET A 1 45 ? 6.424   -21.835 -7.553  1.00 0.00 ? 46 MET A CA   7  
ATOM 7794  C C    . MET A 1 45 ? 7.828   -21.915 -8.160  1.00 0.00 ? 46 MET A C    7  
ATOM 7795  O O    . MET A 1 45 ? 8.328   -22.985 -8.448  1.00 0.00 ? 46 MET A O    7  
ATOM 7796  C CB   . MET A 1 45 ? 5.915   -20.391 -7.550  1.00 0.00 ? 46 MET A CB   7  
ATOM 7797  C CG   . MET A 1 45 ? 6.554   -19.627 -6.389  1.00 0.00 ? 46 MET A CG   7  
ATOM 7798  S SD   . MET A 1 45 ? 6.193   -17.857 -6.531  1.00 0.00 ? 46 MET A SD   7  
ATOM 7799  C CE   . MET A 1 45 ? 6.657   -17.648 -8.265  1.00 0.00 ? 46 MET A CE   7  
ATOM 7800  H H    . MET A 1 45 ? 6.235   -21.735 -5.434  1.00 0.00 ? 46 MET A H    7  
ATOM 7801  H HA   . MET A 1 45 ? 5.753   -22.444 -8.126  1.00 0.00 ? 46 MET A HA   7  
ATOM 7802  H HB2  . MET A 1 45 ? 6.172   -19.916 -8.485  1.00 0.00 ? 46 MET A HB2  7  
ATOM 7803  H HB3  . MET A 1 45 ? 4.845   -20.394 -7.426  1.00 0.00 ? 46 MET A HB3  7  
ATOM 7804  H HG2  . MET A 1 45 ? 6.151   -19.993 -5.461  1.00 0.00 ? 46 MET A HG2  7  
ATOM 7805  H HG3  . MET A 1 45 ? 7.621   -19.782 -6.400  1.00 0.00 ? 46 MET A HG3  7  
ATOM 7806  H HE1  . MET A 1 45 ? 7.569   -18.185 -8.463  1.00 0.00 ? 46 MET A HE1  7  
ATOM 7807  H HE2  . MET A 1 45 ? 5.869   -18.034 -8.896  1.00 0.00 ? 46 MET A HE2  7  
ATOM 7808  H HE3  . MET A 1 45 ? 6.809   -16.598 -8.468  1.00 0.00 ? 46 MET A HE3  7  
ATOM 7809  N N    . LYS A 1 46 ? 8.462   -20.799 -8.368  1.00 0.00 ? 47 LYS A N    7  
ATOM 7810  C CA   . LYS A 1 46 ? 9.814   -20.806 -8.965  1.00 0.00 ? 47 LYS A CA   7  
ATOM 7811  C C    . LYS A 1 46 ? 10.794  -20.093 -8.031  1.00 0.00 ? 47 LYS A C    7  
ATOM 7812  O O    . LYS A 1 46 ? 11.393  -20.697 -7.163  1.00 0.00 ? 47 LYS A O    7  
ATOM 7813  C CB   . LYS A 1 46 ? 9.724   -20.057 -10.281 1.00 0.00 ? 47 LYS A CB   7  
ATOM 7814  C CG   . LYS A 1 46 ? 9.543   -21.053 -11.427 1.00 0.00 ? 47 LYS A CG   7  
ATOM 7815  C CD   . LYS A 1 46 ? 9.953   -20.393 -12.744 1.00 0.00 ? 47 LYS A CD   7  
ATOM 7816  C CE   . LYS A 1 46 ? 11.189  -21.098 -13.304 1.00 0.00 ? 47 LYS A CE   7  
ATOM 7817  N NZ   . LYS A 1 46 ? 10.792  -22.415 -13.878 1.00 0.00 ? 47 LYS A NZ   7  
ATOM 7818  H H    . LYS A 1 46 ? 8.046   -19.952 -8.151  1.00 0.00 ? 47 LYS A H    7  
ATOM 7819  H HA   . LYS A 1 46 ? 10.134  -21.818 -9.141  1.00 0.00 ? 47 LYS A HA   7  
ATOM 7820  H HB2  . LYS A 1 46 ? 8.869   -19.394 -10.234 1.00 0.00 ? 47 LYS A HB2  7  
ATOM 7821  H HB3  . LYS A 1 46 ? 10.624  -19.482 -10.435 1.00 0.00 ? 47 LYS A HB3  7  
ATOM 7822  H HG2  . LYS A 1 46 ? 10.161  -21.921 -11.250 1.00 0.00 ? 47 LYS A HG2  7  
ATOM 7823  H HG3  . LYS A 1 46 ? 8.507   -21.352 -11.484 1.00 0.00 ? 47 LYS A HG3  7  
ATOM 7824  H HD2  . LYS A 1 46 ? 9.141   -20.469 -13.453 1.00 0.00 ? 47 LYS A HD2  7  
ATOM 7825  H HD3  . LYS A 1 46 ? 10.183  -19.352 -12.570 1.00 0.00 ? 47 LYS A HD3  7  
ATOM 7826  H HE2  . LYS A 1 46 ? 11.632  -20.487 -14.076 1.00 0.00 ? 47 LYS A HE2  7  
ATOM 7827  H HE3  . LYS A 1 46 ? 11.904  -21.253 -12.510 1.00 0.00 ? 47 LYS A HE3  7  
ATOM 7828  H HZ1  . LYS A 1 46 ? 10.086  -22.268 -14.626 1.00 0.00 ? 47 LYS A HZ1  7  
ATOM 7829  H HZ2  . LYS A 1 46 ? 11.627  -22.884 -14.281 1.00 0.00 ? 47 LYS A HZ2  7  
ATOM 7830  H HZ3  . LYS A 1 46 ? 10.385  -23.011 -13.127 1.00 0.00 ? 47 LYS A HZ3  7  
ATOM 7831  N N    . ASP A 1 47 ? 10.959  -18.807 -8.200  1.00 0.00 ? 48 ASP A N    7  
ATOM 7832  C CA   . ASP A 1 47 ? 11.892  -18.047 -7.323  1.00 0.00 ? 48 ASP A CA   7  
ATOM 7833  C C    . ASP A 1 47 ? 11.261  -16.700 -6.971  1.00 0.00 ? 48 ASP A C    7  
ATOM 7834  O O    . ASP A 1 47 ? 10.568  -16.102 -7.769  1.00 0.00 ? 48 ASP A O    7  
ATOM 7835  C CB   . ASP A 1 47 ? 13.215  -17.815 -8.059  1.00 0.00 ? 48 ASP A CB   7  
ATOM 7836  C CG   . ASP A 1 47 ? 14.358  -18.453 -7.266  1.00 0.00 ? 48 ASP A CG   7  
ATOM 7837  O OD1  . ASP A 1 47 ? 14.232  -18.547 -6.056  1.00 0.00 ? 48 ASP A OD1  7  
ATOM 7838  O OD2  . ASP A 1 47 ? 15.341  -18.833 -7.882  1.00 0.00 ? 48 ASP A OD2  7  
ATOM 7839  H H    . ASP A 1 47 ? 10.462  -18.339 -8.903  1.00 0.00 ? 48 ASP A H    7  
ATOM 7840  H HA   . ASP A 1 47 ? 12.076  -18.608 -6.418  1.00 0.00 ? 48 ASP A HA   7  
ATOM 7841  H HB2  . ASP A 1 47 ? 13.164  -18.264 -9.041  1.00 0.00 ? 48 ASP A HB2  7  
ATOM 7842  H HB3  . ASP A 1 47 ? 13.394  -16.755 -8.155  1.00 0.00 ? 48 ASP A HB3  7  
ATOM 7843  N N    . LYS A 1 48 ? 11.488  -16.219 -5.781  1.00 0.00 ? 49 LYS A N    7  
ATOM 7844  C CA   . LYS A 1 48 ? 10.893  -14.913 -5.382  1.00 0.00 ? 49 LYS A CA   7  
ATOM 7845  C C    . LYS A 1 48 ? 11.751  -13.771 -5.930  1.00 0.00 ? 49 LYS A C    7  
ATOM 7846  O O    . LYS A 1 48 ? 11.265  -12.687 -6.185  1.00 0.00 ? 49 LYS A O    7  
ATOM 7847  C CB   . LYS A 1 48 ? 10.834  -14.827 -3.856  1.00 0.00 ? 49 LYS A CB   7  
ATOM 7848  C CG   . LYS A 1 48 ? 10.012  -15.999 -3.312  1.00 0.00 ? 49 LYS A CG   7  
ATOM 7849  C CD   . LYS A 1 48 ? 10.586  -16.446 -1.966  1.00 0.00 ? 49 LYS A CD   7  
ATOM 7850  C CE   . LYS A 1 48 ? 9.526   -16.275 -0.877  1.00 0.00 ? 49 LYS A CE   7  
ATOM 7851  N NZ   . LYS A 1 48 ? 10.101  -16.664 0.442   1.00 0.00 ? 49 LYS A NZ   7  
ATOM 7852  H H    . LYS A 1 48 ? 12.047  -16.717 -5.147  1.00 0.00 ? 49 LYS A H    7  
ATOM 7853  H HA   . LYS A 1 48 ? 9.892   -14.838 -5.786  1.00 0.00 ? 49 LYS A HA   7  
ATOM 7854  H HB2  . LYS A 1 48 ? 11.836  -14.871 -3.453  1.00 0.00 ? 49 LYS A HB2  7  
ATOM 7855  H HB3  . LYS A 1 48 ? 10.368  -13.899 -3.564  1.00 0.00 ? 49 LYS A HB3  7  
ATOM 7856  H HG2  . LYS A 1 48 ? 8.986   -15.688 -3.182  1.00 0.00 ? 49 LYS A HG2  7  
ATOM 7857  H HG3  . LYS A 1 48 ? 10.053  -16.822 -4.010  1.00 0.00 ? 49 LYS A HG3  7  
ATOM 7858  H HD2  . LYS A 1 48 ? 10.877  -17.485 -2.027  1.00 0.00 ? 49 LYS A HD2  7  
ATOM 7859  H HD3  . LYS A 1 48 ? 11.448  -15.844 -1.724  1.00 0.00 ? 49 LYS A HD3  7  
ATOM 7860  H HE2  . LYS A 1 48 ? 9.208   -15.243 -0.841  1.00 0.00 ? 49 LYS A HE2  7  
ATOM 7861  H HE3  . LYS A 1 48 ? 8.677   -16.906 -1.099  1.00 0.00 ? 49 LYS A HE3  7  
ATOM 7862  H HZ1  . LYS A 1 48 ? 11.062  -16.279 0.529   1.00 0.00 ? 49 LYS A HZ1  7  
ATOM 7863  H HZ2  . LYS A 1 48 ? 9.504   -16.284 1.205   1.00 0.00 ? 49 LYS A HZ2  7  
ATOM 7864  H HZ3  . LYS A 1 48 ? 10.137  -17.700 0.513   1.00 0.00 ? 49 LYS A HZ3  7  
ATOM 7865  N N    . SER A 1 49 ? 13.022  -14.002 -6.115  1.00 0.00 ? 50 SER A N    7  
ATOM 7866  C CA   . SER A 1 49 ? 13.903  -12.925 -6.649  1.00 0.00 ? 50 SER A CA   7  
ATOM 7867  C C    . SER A 1 49 ? 13.277  -12.341 -7.915  1.00 0.00 ? 50 SER A C    7  
ATOM 7868  O O    . SER A 1 49 ? 13.504  -11.199 -8.262  1.00 0.00 ? 50 SER A O    7  
ATOM 7869  C CB   . SER A 1 49 ? 15.277  -13.506 -6.984  1.00 0.00 ? 50 SER A CB   7  
ATOM 7870  O OG   . SER A 1 49 ? 16.199  -13.143 -5.966  1.00 0.00 ? 50 SER A OG   7  
ATOM 7871  H H    . SER A 1 49 ? 13.396  -14.884 -5.905  1.00 0.00 ? 50 SER A H    7  
ATOM 7872  H HA   . SER A 1 49 ? 14.011  -12.147 -5.908  1.00 0.00 ? 50 SER A HA   7  
ATOM 7873  H HB2  . SER A 1 49 ? 15.214  -14.579 -7.039  1.00 0.00 ? 50 SER A HB2  7  
ATOM 7874  H HB3  . SER A 1 49 ? 15.607  -13.117 -7.939  1.00 0.00 ? 50 SER A HB3  7  
ATOM 7875  H HG   . SER A 1 49 ? 16.957  -13.728 -6.031  1.00 0.00 ? 50 SER A HG   7  
ATOM 7876  N N    . GLU A 1 50 ? 12.479  -13.114 -8.600  1.00 0.00 ? 51 GLU A N    7  
ATOM 7877  C CA   . GLU A 1 50 ? 11.830  -12.608 -9.833  1.00 0.00 ? 51 GLU A CA   7  
ATOM 7878  C C    . GLU A 1 50 ? 10.919  -11.437 -9.481  1.00 0.00 ? 51 GLU A C    7  
ATOM 7879  O O    . GLU A 1 50 ? 11.147  -10.313 -9.883  1.00 0.00 ? 51 GLU A O    7  
ATOM 7880  C CB   . GLU A 1 50 ? 11.012  -13.715 -10.456 1.00 0.00 ? 51 GLU A CB   7  
ATOM 7881  C CG   . GLU A 1 50 ? 11.775  -15.043 -10.381 1.00 0.00 ? 51 GLU A CG   7  
ATOM 7882  C CD   . GLU A 1 50 ? 13.230  -14.828 -10.806 1.00 0.00 ? 51 GLU A CD   7  
ATOM 7883  O OE1  . GLU A 1 50 ? 13.455  -14.017 -11.689 1.00 0.00 ? 51 GLU A OE1  7  
ATOM 7884  O OE2  . GLU A 1 50 ? 14.094  -15.476 -10.239 1.00 0.00 ? 51 GLU A OE2  7  
ATOM 7885  H H    . GLU A 1 50 ? 12.299  -14.025 -8.297  1.00 0.00 ? 51 GLU A H    7  
ATOM 7886  H HA   . GLU A 1 50 ? 12.569  -12.291 -10.542 1.00 0.00 ? 51 GLU A HA   7  
ATOM 7887  H HB2  . GLU A 1 50 ? 10.073  -13.806 -9.933  1.00 0.00 ? 51 GLU A HB2  7  
ATOM 7888  H HB3  . GLU A 1 50 ? 10.841  -13.462 -11.483 1.00 0.00 ? 51 GLU A HB3  7  
ATOM 7889  H HG2  . GLU A 1 50 ? 11.745  -15.420 -9.370  1.00 0.00 ? 51 GLU A HG2  7  
ATOM 7890  H HG3  . GLU A 1 50 ? 11.313  -15.760 -11.045 1.00 0.00 ? 51 GLU A HG3  7  
ATOM 7891  N N    . TRP A 1 51 ? 9.891   -11.693 -8.725  1.00 0.00 ? 52 TRP A N    7  
ATOM 7892  C CA   . TRP A 1 51 ? 8.964   -10.603 -8.337  1.00 0.00 ? 52 TRP A CA   7  
ATOM 7893  C C    . TRP A 1 51 ? 9.628   -9.729  -7.293  1.00 0.00 ? 52 TRP A C    7  
ATOM 7894  O O    . TRP A 1 51 ? 9.838   -8.566  -7.511  1.00 0.00 ? 52 TRP A O    7  
ATOM 7895  C CB   . TRP A 1 51 ? 7.709   -11.202 -7.735  1.00 0.00 ? 52 TRP A CB   7  
ATOM 7896  C CG   . TRP A 1 51 ? 7.180   -12.223 -8.651  1.00 0.00 ? 52 TRP A CG   7  
ATOM 7897  C CD1  . TRP A 1 51 ? 7.319   -13.530 -8.468  1.00 0.00 ? 52 TRP A CD1  7  
ATOM 7898  C CD2  . TRP A 1 51 ? 6.434   -12.043 -9.874  1.00 0.00 ? 52 TRP A CD2  7  
ATOM 7899  N NE1  . TRP A 1 51 ? 6.700   -14.195 -9.509  1.00 0.00 ? 52 TRP A NE1  7  
ATOM 7900  C CE2  . TRP A 1 51 ? 6.131   -13.312 -10.407 1.00 0.00 ? 52 TRP A CE2  7  
ATOM 7901  C CE3  . TRP A 1 51 ? 5.995   -10.909 -10.560 1.00 0.00 ? 52 TRP A CE3  7  
ATOM 7902  C CZ2  . TRP A 1 51 ? 5.409   -13.452 -11.592 1.00 0.00 ? 52 TRP A CZ2  7  
ATOM 7903  C CZ3  . TRP A 1 51 ? 5.268   -11.035 -11.745 1.00 0.00 ? 52 TRP A CZ3  7  
ATOM 7904  C CH2  . TRP A 1 51 ? 4.971   -12.306 -12.264 1.00 0.00 ? 52 TRP A CH2  7  
ATOM 7905  H H    . TRP A 1 51 ? 9.730   -12.605 -8.407  1.00 0.00 ? 52 TRP A H    7  
ATOM 7906  H HA   . TRP A 1 51 ? 8.709   -10.011 -9.202  1.00 0.00 ? 52 TRP A HA   7  
ATOM 7907  H HB2  . TRP A 1 51 ? 7.941   -11.656 -6.784  1.00 0.00 ? 52 TRP A HB2  7  
ATOM 7908  H HB3  . TRP A 1 51 ? 6.974   -10.443 -7.598  1.00 0.00 ? 52 TRP A HB3  7  
ATOM 7909  H HD1  . TRP A 1 51 ? 7.833   -13.974 -7.639  1.00 0.00 ? 52 TRP A HD1  7  
ATOM 7910  H HE1  . TRP A 1 51 ? 6.655   -15.161 -9.610  1.00 0.00 ? 52 TRP A HE1  7  
ATOM 7911  H HE3  . TRP A 1 51 ? 6.228   -9.929  -10.176 1.00 0.00 ? 52 TRP A HE3  7  
ATOM 7912  H HZ2  . TRP A 1 51 ? 5.185   -14.433 -11.982 1.00 0.00 ? 52 TRP A HZ2  7  
ATOM 7913  H HZ3  . TRP A 1 51 ? 4.928   -10.150 -12.251 1.00 0.00 ? 52 TRP A HZ3  7  
ATOM 7914  H HH2  . TRP A 1 51 ? 4.409   -12.397 -13.182 1.00 0.00 ? 52 TRP A HH2  7  
ATOM 7915  N N    . GLU A 1 52 ? 9.938   -10.287 -6.155  1.00 0.00 ? 53 GLU A N    7  
ATOM 7916  C CA   . GLU A 1 52 ? 10.578  -9.482  -5.068  1.00 0.00 ? 53 GLU A CA   7  
ATOM 7917  C C    . GLU A 1 52 ? 11.485  -8.398  -5.659  1.00 0.00 ? 53 GLU A C    7  
ATOM 7918  O O    . GLU A 1 52 ? 11.367  -7.236  -5.325  1.00 0.00 ? 53 GLU A O    7  
ATOM 7919  C CB   . GLU A 1 52 ? 11.399  -10.402 -4.164  1.00 0.00 ? 53 GLU A CB   7  
ATOM 7920  C CG   . GLU A 1 52 ? 10.487  -11.009 -3.099  1.00 0.00 ? 53 GLU A CG   7  
ATOM 7921  C CD   . GLU A 1 52 ? 11.132  -10.848 -1.721  1.00 0.00 ? 53 GLU A CD   7  
ATOM 7922  O OE1  . GLU A 1 52 ? 12.285  -10.453 -1.671  1.00 0.00 ? 53 GLU A OE1  7  
ATOM 7923  O OE2  . GLU A 1 52 ? 10.463  -11.122 -0.740  1.00 0.00 ? 53 GLU A OE2  7  
ATOM 7924  H H    . GLU A 1 52 ? 9.734   -11.243 -6.010  1.00 0.00 ? 53 GLU A H    7  
ATOM 7925  H HA   . GLU A 1 52 ? 9.806   -9.004  -4.486  1.00 0.00 ? 53 GLU A HA   7  
ATOM 7926  H HB2  . GLU A 1 52 ? 11.839  -11.192 -4.757  1.00 0.00 ? 53 GLU A HB2  7  
ATOM 7927  H HB3  . GLU A 1 52 ? 12.182  -9.834  -3.685  1.00 0.00 ? 53 GLU A HB3  7  
ATOM 7928  H HG2  . GLU A 1 52 ? 9.533   -10.502 -3.113  1.00 0.00 ? 53 GLU A HG2  7  
ATOM 7929  H HG3  . GLU A 1 52 ? 10.340  -12.057 -3.307  1.00 0.00 ? 53 GLU A HG3  7  
ATOM 7930  N N    . ALA A 1 53 ? 12.377  -8.754  -6.540  1.00 0.00 ? 54 ALA A N    7  
ATOM 7931  C CA   . ALA A 1 53 ? 13.261  -7.717  -7.142  1.00 0.00 ? 54 ALA A CA   7  
ATOM 7932  C C    . ALA A 1 53 ? 12.403  -6.769  -7.981  1.00 0.00 ? 54 ALA A C    7  
ATOM 7933  O O    . ALA A 1 53 ? 12.545  -5.564  -7.928  1.00 0.00 ? 54 ALA A O    7  
ATOM 7934  C CB   . ALA A 1 53 ? 14.307  -8.388  -8.033  1.00 0.00 ? 54 ALA A CB   7  
ATOM 7935  H H    . ALA A 1 53 ? 12.460  -9.693  -6.813  1.00 0.00 ? 54 ALA A H    7  
ATOM 7936  H HA   . ALA A 1 53 ? 13.753  -7.161  -6.360  1.00 0.00 ? 54 ALA A HA   7  
ATOM 7937  H HB1  . ALA A 1 53 ? 13.811  -9.020  -8.756  1.00 0.00 ? 54 ALA A HB1  7  
ATOM 7938  H HB2  . ALA A 1 53 ? 14.879  -7.631  -8.549  1.00 0.00 ? 54 ALA A HB2  7  
ATOM 7939  H HB3  . ALA A 1 53 ? 14.968  -8.987  -7.424  1.00 0.00 ? 54 ALA A HB3  7  
ATOM 7940  N N    . LYS A 1 54 ? 11.515  -7.320  -8.756  1.00 0.00 ? 55 LYS A N    7  
ATOM 7941  C CA   . LYS A 1 54 ? 10.630  -6.484  -9.617  1.00 0.00 ? 55 LYS A CA   7  
ATOM 7942  C C    . LYS A 1 54 ? 9.885   -5.441  -8.775  1.00 0.00 ? 55 LYS A C    7  
ATOM 7943  O O    . LYS A 1 54 ? 9.712   -4.312  -9.190  1.00 0.00 ? 55 LYS A O    7  
ATOM 7944  C CB   . LYS A 1 54 ? 9.611   -7.388  -10.308 1.00 0.00 ? 55 LYS A CB   7  
ATOM 7945  C CG   . LYS A 1 54 ? 9.356   -6.881  -11.728 1.00 0.00 ? 55 LYS A CG   7  
ATOM 7946  C CD   . LYS A 1 54 ? 10.129  -7.747  -12.726 1.00 0.00 ? 55 LYS A CD   7  
ATOM 7947  C CE   . LYS A 1 54 ? 9.320   -7.882  -14.018 1.00 0.00 ? 55 LYS A CE   7  
ATOM 7948  N NZ   . LYS A 1 54 ? 10.208  -8.361  -15.114 1.00 0.00 ? 55 LYS A NZ   7  
ATOM 7949  H H    . LYS A 1 54 ? 11.433  -8.295  -8.779  1.00 0.00 ? 55 LYS A H    7  
ATOM 7950  H HA   . LYS A 1 54 ? 11.224  -5.983  -10.361 1.00 0.00 ? 55 LYS A HA   7  
ATOM 7951  H HB2  . LYS A 1 54 ? 9.995   -8.398  -10.348 1.00 0.00 ? 55 LYS A HB2  7  
ATOM 7952  H HB3  . LYS A 1 54 ? 8.686   -7.376  -9.750  1.00 0.00 ? 55 LYS A HB3  7  
ATOM 7953  H HG2  . LYS A 1 54 ? 8.299   -6.936  -11.946 1.00 0.00 ? 55 LYS A HG2  7  
ATOM 7954  H HG3  . LYS A 1 54 ? 9.688   -5.857  -11.811 1.00 0.00 ? 55 LYS A HG3  7  
ATOM 7955  H HD2  . LYS A 1 54 ? 11.081  -7.282  -12.943 1.00 0.00 ? 55 LYS A HD2  7  
ATOM 7956  H HD3  . LYS A 1 54 ? 10.295  -8.725  -12.302 1.00 0.00 ? 55 LYS A HD3  7  
ATOM 7957  H HE2  . LYS A 1 54 ? 8.520   -8.593  -13.867 1.00 0.00 ? 55 LYS A HE2  7  
ATOM 7958  H HE3  . LYS A 1 54 ? 8.903   -6.923  -14.284 1.00 0.00 ? 55 LYS A HE3  7  
ATOM 7959  H HZ1  . LYS A 1 54 ? 10.768  -9.171  -14.778 1.00 0.00 ? 55 LYS A HZ1  7  
ATOM 7960  H HZ2  . LYS A 1 54 ? 9.631   -8.651  -15.927 1.00 0.00 ? 55 LYS A HZ2  7  
ATOM 7961  H HZ3  . LYS A 1 54 ? 10.847  -7.594  -15.403 1.00 0.00 ? 55 LYS A HZ3  7  
ATOM 7962  N N    . ALA A 1 55 ? 9.437   -5.803  -7.605  1.00 0.00 ? 56 ALA A N    7  
ATOM 7963  C CA   . ALA A 1 55 ? 8.702   -4.827  -6.759  1.00 0.00 ? 56 ALA A CA   7  
ATOM 7964  C C    . ALA A 1 55 ? 9.645   -3.683  -6.391  1.00 0.00 ? 56 ALA A C    7  
ATOM 7965  O O    . ALA A 1 55 ? 9.292   -2.522  -6.457  1.00 0.00 ? 56 ALA A O    7  
ATOM 7966  C CB   . ALA A 1 55 ? 8.217   -5.516  -5.482  1.00 0.00 ? 56 ALA A CB   7  
ATOM 7967  H H    . ALA A 1 55 ? 9.581   -6.710  -7.285  1.00 0.00 ? 56 ALA A H    7  
ATOM 7968  H HA   . ALA A 1 55 ? 7.851   -4.445  -7.309  1.00 0.00 ? 56 ALA A HA   7  
ATOM 7969  H HB1  . ALA A 1 55 ? 8.585   -6.532  -5.458  1.00 0.00 ? 56 ALA A HB1  7  
ATOM 7970  H HB2  . ALA A 1 55 ? 8.588   -4.980  -4.621  1.00 0.00 ? 56 ALA A HB2  7  
ATOM 7971  H HB3  . ALA A 1 55 ? 7.138   -5.523  -5.463  1.00 0.00 ? 56 ALA A HB3  7  
ATOM 7972  N N    . ALA A 1 56 ? 10.852  -4.009  -6.012  1.00 0.00 ? 57 ALA A N    7  
ATOM 7973  C CA   . ALA A 1 56 ? 11.836  -2.955  -5.645  1.00 0.00 ? 57 ALA A CA   7  
ATOM 7974  C C    . ALA A 1 56 ? 11.761  -1.825  -6.666  1.00 0.00 ? 57 ALA A C    7  
ATOM 7975  O O    . ALA A 1 56 ? 11.752  -0.660  -6.324  1.00 0.00 ? 57 ALA A O    7  
ATOM 7976  C CB   . ALA A 1 56 ? 13.242  -3.554  -5.662  1.00 0.00 ? 57 ALA A CB   7  
ATOM 7977  H H    . ALA A 1 56 ? 11.113  -4.953  -5.975  1.00 0.00 ? 57 ALA A H    7  
ATOM 7978  H HA   . ALA A 1 56 ? 11.614  -2.573  -4.659  1.00 0.00 ? 57 ALA A HA   7  
ATOM 7979  H HB1  . ALA A 1 56 ? 13.242  -4.489  -5.120  1.00 0.00 ? 57 ALA A HB1  7  
ATOM 7980  H HB2  . ALA A 1 56 ? 13.542  -3.729  -6.684  1.00 0.00 ? 57 ALA A HB2  7  
ATOM 7981  H HB3  . ALA A 1 56 ? 13.932  -2.867  -5.195  1.00 0.00 ? 57 ALA A HB3  7  
ATOM 7982  N N    . LYS A 1 57 ? 11.710  -2.165  -7.923  1.00 0.00 ? 58 LYS A N    7  
ATOM 7983  C CA   . LYS A 1 57 ? 11.636  -1.118  -8.979  1.00 0.00 ? 58 LYS A CA   7  
ATOM 7984  C C    . LYS A 1 57 ? 10.537  -0.113  -8.628  1.00 0.00 ? 58 LYS A C    7  
ATOM 7985  O O    . LYS A 1 57 ? 10.806  1.046   -8.386  1.00 0.00 ? 58 LYS A O    7  
ATOM 7986  C CB   . LYS A 1 57 ? 11.322  -1.770  -10.328 1.00 0.00 ? 58 LYS A CB   7  
ATOM 7987  C CG   . LYS A 1 57 ? 11.405  -0.719  -11.437 1.00 0.00 ? 58 LYS A CG   7  
ATOM 7988  C CD   . LYS A 1 57 ? 10.183  -0.842  -12.349 1.00 0.00 ? 58 LYS A CD   7  
ATOM 7989  C CE   . LYS A 1 57 ? 9.899   0.508   -13.009 1.00 0.00 ? 58 LYS A CE   7  
ATOM 7990  N NZ   . LYS A 1 57 ? 10.430  0.499   -14.402 1.00 0.00 ? 58 LYS A NZ   7  
ATOM 7991  H H    . LYS A 1 57 ? 11.723  -3.115  -8.172  1.00 0.00 ? 58 LYS A H    7  
ATOM 7992  H HA   . LYS A 1 57 ? 12.583  -0.600  -9.039  1.00 0.00 ? 58 LYS A HA   7  
ATOM 7993  H HB2  . LYS A 1 57 ? 12.036  -2.557  -10.522 1.00 0.00 ? 58 LYS A HB2  7  
ATOM 7994  H HB3  . LYS A 1 57 ? 10.326  -2.186  -10.303 1.00 0.00 ? 58 LYS A HB3  7  
ATOM 7995  H HG2  . LYS A 1 57 ? 11.430  0.268   -10.997 1.00 0.00 ? 58 LYS A HG2  7  
ATOM 7996  H HG3  . LYS A 1 57 ? 12.302  -0.877  -12.017 1.00 0.00 ? 58 LYS A HG3  7  
ATOM 7997  H HD2  . LYS A 1 57 ? 10.377  -1.583  -13.111 1.00 0.00 ? 58 LYS A HD2  7  
ATOM 7998  H HD3  . LYS A 1 57 ? 9.326   -1.142  -11.765 1.00 0.00 ? 58 LYS A HD3  7  
ATOM 7999  H HE2  . LYS A 1 57 ? 8.833   0.681   -13.032 1.00 0.00 ? 58 LYS A HE2  7  
ATOM 8000  H HE3  . LYS A 1 57 ? 10.379  1.294   -12.445 1.00 0.00 ? 58 LYS A HE3  7  
ATOM 8001  H HZ1  . LYS A 1 57 ? 11.216  -0.180  -14.468 1.00 0.00 ? 58 LYS A HZ1  7  
ATOM 8002  H HZ2  . LYS A 1 57 ? 9.675   0.222   -15.061 1.00 0.00 ? 58 LYS A HZ2  7  
ATOM 8003  H HZ3  . LYS A 1 57 ? 10.772  1.450   -14.649 1.00 0.00 ? 58 LYS A HZ3  7  
ATOM 8004  N N    . ALA A 1 58 ? 9.302   -0.539  -8.593  1.00 0.00 ? 59 ALA A N    7  
ATOM 8005  C CA   . ALA A 1 58 ? 8.210   0.416   -8.251  1.00 0.00 ? 59 ALA A CA   7  
ATOM 8006  C C    . ALA A 1 58 ? 8.598   1.169   -6.981  1.00 0.00 ? 59 ALA A C    7  
ATOM 8007  O O    . ALA A 1 58 ? 8.208   2.298   -6.772  1.00 0.00 ? 59 ALA A O    7  
ATOM 8008  C CB   . ALA A 1 58 ? 6.903   -0.345  -8.011  1.00 0.00 ? 59 ALA A CB   7  
ATOM 8009  H H    . ALA A 1 58 ? 9.095   -1.480  -8.787  1.00 0.00 ? 59 ALA A H    7  
ATOM 8010  H HA   . ALA A 1 58 ? 8.079   1.120   -9.060  1.00 0.00 ? 59 ALA A HA   7  
ATOM 8011  H HB1  . ALA A 1 58 ? 7.113   -1.262  -7.481  1.00 0.00 ? 59 ALA A HB1  7  
ATOM 8012  H HB2  . ALA A 1 58 ? 6.230   0.267   -7.422  1.00 0.00 ? 59 ALA A HB2  7  
ATOM 8013  H HB3  . ALA A 1 58 ? 6.441   -0.575  -8.959  1.00 0.00 ? 59 ALA A HB3  7  
ATOM 8014  N N    . LYS A 1 59 ? 9.373   0.551   -6.138  1.00 0.00 ? 60 LYS A N    7  
ATOM 8015  C CA   . LYS A 1 59 ? 9.802   1.214   -4.887  1.00 0.00 ? 60 LYS A CA   7  
ATOM 8016  C C    . LYS A 1 59 ? 10.578  2.479   -5.226  1.00 0.00 ? 60 LYS A C    7  
ATOM 8017  O O    . LYS A 1 59 ? 10.215  3.568   -4.840  1.00 0.00 ? 60 LYS A O    7  
ATOM 8018  C CB   . LYS A 1 59 ? 10.716  0.259   -4.132  1.00 0.00 ? 60 LYS A CB   7  
ATOM 8019  C CG   . LYS A 1 59 ? 10.351  0.250   -2.647  1.00 0.00 ? 60 LYS A CG   7  
ATOM 8020  C CD   . LYS A 1 59 ? 11.124  -0.864  -1.939  1.00 0.00 ? 60 LYS A CD   7  
ATOM 8021  C CE   . LYS A 1 59 ? 12.033  -0.254  -0.870  1.00 0.00 ? 60 LYS A CE   7  
ATOM 8022  N NZ   . LYS A 1 59 ? 12.835  -1.332  -0.223  1.00 0.00 ? 60 LYS A NZ   7  
ATOM 8023  H H    . LYS A 1 59 ? 9.685   -0.356  -6.332  1.00 0.00 ? 60 LYS A H    7  
ATOM 8024  H HA   . LYS A 1 59 ? 8.943   1.458   -4.283  1.00 0.00 ? 60 LYS A HA   7  
ATOM 8025  H HB2  . LYS A 1 59 ? 10.609  -0.732  -4.542  1.00 0.00 ? 60 LYS A HB2  7  
ATOM 8026  H HB3  . LYS A 1 59 ? 11.735  0.579   -4.252  1.00 0.00 ? 60 LYS A HB3  7  
ATOM 8027  H HG2  . LYS A 1 59 ? 10.607  1.203   -2.209  1.00 0.00 ? 60 LYS A HG2  7  
ATOM 8028  H HG3  . LYS A 1 59 ? 9.291   0.075   -2.538  1.00 0.00 ? 60 LYS A HG3  7  
ATOM 8029  H HD2  . LYS A 1 59 ? 10.427  -1.547  -1.474  1.00 0.00 ? 60 LYS A HD2  7  
ATOM 8030  H HD3  . LYS A 1 59 ? 11.726  -1.398  -2.658  1.00 0.00 ? 60 LYS A HD3  7  
ATOM 8031  H HE2  . LYS A 1 59 ? 12.698  0.462   -1.329  1.00 0.00 ? 60 LYS A HE2  7  
ATOM 8032  H HE3  . LYS A 1 59 ? 11.429  0.242   -0.124  1.00 0.00 ? 60 LYS A HE3  7  
ATOM 8033  H HZ1  . LYS A 1 59 ? 12.259  -2.194  -0.146  1.00 0.00 ? 60 LYS A HZ1  7  
ATOM 8034  H HZ2  . LYS A 1 59 ? 13.680  -1.528  -0.797  1.00 0.00 ? 60 LYS A HZ2  7  
ATOM 8035  H HZ3  . LYS A 1 59 ? 13.124  -1.026  0.728   1.00 0.00 ? 60 LYS A HZ3  7  
ATOM 8036  N N    . ASP A 1 60 ? 11.653  2.330   -5.939  1.00 0.00 ? 61 ASP A N    7  
ATOM 8037  C CA   . ASP A 1 60 ? 12.479  3.516   -6.304  1.00 0.00 ? 61 ASP A CA   7  
ATOM 8038  C C    . ASP A 1 60 ? 11.632  4.533   -7.077  1.00 0.00 ? 61 ASP A C    7  
ATOM 8039  O O    . ASP A 1 60 ? 11.663  5.715   -6.799  1.00 0.00 ? 61 ASP A O    7  
ATOM 8040  C CB   . ASP A 1 60 ? 13.654  3.066   -7.175  1.00 0.00 ? 61 ASP A CB   7  
ATOM 8041  C CG   . ASP A 1 60 ? 14.962  3.244   -6.400  1.00 0.00 ? 61 ASP A CG   7  
ATOM 8042  O OD1  . ASP A 1 60 ? 15.220  4.353   -5.961  1.00 0.00 ? 61 ASP A OD1  7  
ATOM 8043  O OD2  . ASP A 1 60 ? 15.682  2.270   -6.260  1.00 0.00 ? 61 ASP A OD2  7  
ATOM 8044  H H    . ASP A 1 60 ? 11.925  1.431   -6.227  1.00 0.00 ? 61 ASP A H    7  
ATOM 8045  H HA   . ASP A 1 60 ? 12.855  3.981   -5.404  1.00 0.00 ? 61 ASP A HA   7  
ATOM 8046  H HB2  . ASP A 1 60 ? 13.529  2.023   -7.439  1.00 0.00 ? 61 ASP A HB2  7  
ATOM 8047  H HB3  . ASP A 1 60 ? 13.686  3.664   -8.073  1.00 0.00 ? 61 ASP A HB3  7  
ATOM 8048  N N    . ASP A 1 61 ? 10.884  4.089   -8.049  1.00 0.00 ? 62 ASP A N    7  
ATOM 8049  C CA   . ASP A 1 61 ? 10.049  5.040   -8.837  1.00 0.00 ? 62 ASP A CA   7  
ATOM 8050  C C    . ASP A 1 61 ? 8.867   5.517   -7.991  1.00 0.00 ? 62 ASP A C    7  
ATOM 8051  O O    . ASP A 1 61 ? 8.162   6.435   -8.357  1.00 0.00 ? 62 ASP A O    7  
ATOM 8052  C CB   . ASP A 1 61 ? 9.520   4.333   -10.085 1.00 0.00 ? 62 ASP A CB   7  
ATOM 8053  C CG   . ASP A 1 61 ? 10.687  3.956   -10.998 1.00 0.00 ? 62 ASP A CG   7  
ATOM 8054  O OD1  . ASP A 1 61 ? 11.803  3.898   -10.507 1.00 0.00 ? 62 ASP A OD1  7  
ATOM 8055  O OD2  . ASP A 1 61 ? 10.447  3.730   -12.173 1.00 0.00 ? 62 ASP A OD2  7  
ATOM 8056  H H    . ASP A 1 61 ? 10.873  3.132   -8.264  1.00 0.00 ? 62 ASP A H    7  
ATOM 8057  H HA   . ASP A 1 61 ? 10.648  5.887   -9.131  1.00 0.00 ? 62 ASP A HA   7  
ATOM 8058  H HB2  . ASP A 1 61 ? 8.987   3.439   -9.790  1.00 0.00 ? 62 ASP A HB2  7  
ATOM 8059  H HB3  . ASP A 1 61 ? 8.849   4.993   -10.615 1.00 0.00 ? 62 ASP A HB3  7  
ATOM 8060  N N    . TYR A 1 62 ? 8.635   4.893   -6.873  1.00 0.00 ? 63 TYR A N    7  
ATOM 8061  C CA   . TYR A 1 62 ? 7.489   5.298   -6.016  1.00 0.00 ? 63 TYR A CA   7  
ATOM 8062  C C    . TYR A 1 62 ? 7.924   6.358   -4.999  1.00 0.00 ? 63 TYR A C    7  
ATOM 8063  O O    . TYR A 1 62 ? 7.171   7.253   -4.670  1.00 0.00 ? 63 TYR A O    7  
ATOM 8064  C CB   . TYR A 1 62 ? 6.962   4.062   -5.301  1.00 0.00 ? 63 TYR A CB   7  
ATOM 8065  C CG   . TYR A 1 62 ? 5.839   4.446   -4.403  1.00 0.00 ? 63 TYR A CG   7  
ATOM 8066  C CD1  . TYR A 1 62 ? 6.066   5.208   -3.256  1.00 0.00 ? 63 TYR A CD1  7  
ATOM 8067  C CD2  . TYR A 1 62 ? 4.569   4.018   -4.722  1.00 0.00 ? 63 TYR A CD2  7  
ATOM 8068  C CE1  . TYR A 1 62 ? 4.992   5.536   -2.423  1.00 0.00 ? 63 TYR A CE1  7  
ATOM 8069  C CE2  . TYR A 1 62 ? 3.499   4.335   -3.903  1.00 0.00 ? 63 TYR A CE2  7  
ATOM 8070  C CZ   . TYR A 1 62 ? 3.701   5.095   -2.745  1.00 0.00 ? 63 TYR A CZ   7  
ATOM 8071  O OH   . TYR A 1 62 ? 2.635   5.415   -1.930  1.00 0.00 ? 63 TYR A OH   7  
ATOM 8072  H H    . TYR A 1 62 ? 9.206   4.144   -6.604  1.00 0.00 ? 63 TYR A H    7  
ATOM 8073  H HA   . TYR A 1 62 ? 6.703   5.706   -6.629  1.00 0.00 ? 63 TYR A HA   7  
ATOM 8074  H HB2  . TYR A 1 62 ? 6.599   3.358   -6.033  1.00 0.00 ? 63 TYR A HB2  7  
ATOM 8075  H HB3  . TYR A 1 62 ? 7.736   3.602   -4.721  1.00 0.00 ? 63 TYR A HB3  7  
ATOM 8076  H HD1  . TYR A 1 62 ? 7.066   5.537   -3.011  1.00 0.00 ? 63 TYR A HD1  7  
ATOM 8077  H HD2  . TYR A 1 62 ? 4.407   3.436   -5.619  1.00 0.00 ? 63 TYR A HD2  7  
ATOM 8078  H HE1  . TYR A 1 62 ? 5.160   6.124   -1.539  1.00 0.00 ? 63 TYR A HE1  7  
ATOM 8079  H HE2  . TYR A 1 62 ? 2.520   3.972   -4.162  1.00 0.00 ? 63 TYR A HE2  7  
ATOM 8080  H HH   . TYR A 1 62 ? 1.840   5.045   -2.323  1.00 0.00 ? 63 TYR A HH   7  
ATOM 8081  N N    . ASP A 1 63 ? 9.126   6.276   -4.503  1.00 0.00 ? 64 ASP A N    7  
ATOM 8082  C CA   . ASP A 1 63 ? 9.592   7.288   -3.521  1.00 0.00 ? 64 ASP A CA   7  
ATOM 8083  C C    . ASP A 1 63 ? 9.962   8.555   -4.272  1.00 0.00 ? 64 ASP A C    7  
ATOM 8084  O O    . ASP A 1 63 ? 9.689   9.660   -3.846  1.00 0.00 ? 64 ASP A O    7  
ATOM 8085  C CB   . ASP A 1 63 ? 10.813  6.757   -2.803  1.00 0.00 ? 64 ASP A CB   7  
ATOM 8086  C CG   . ASP A 1 63 ? 11.094  7.605   -1.561  1.00 0.00 ? 64 ASP A CG   7  
ATOM 8087  O OD1  . ASP A 1 63 ? 10.677  8.752   -1.542  1.00 0.00 ? 64 ASP A OD1  7  
ATOM 8088  O OD2  . ASP A 1 63 ? 11.722  7.092   -0.649  1.00 0.00 ? 64 ASP A OD2  7  
ATOM 8089  H H    . ASP A 1 63 ? 9.724   5.559   -4.782  1.00 0.00 ? 64 ASP A H    7  
ATOM 8090  H HA   . ASP A 1 63 ? 8.820   7.487   -2.806  1.00 0.00 ? 64 ASP A HA   7  
ATOM 8091  H HB2  . ASP A 1 63 ? 10.623  5.745   -2.515  1.00 0.00 ? 64 ASP A HB2  7  
ATOM 8092  H HB3  . ASP A 1 63 ? 11.661  6.795   -3.464  1.00 0.00 ? 64 ASP A HB3  7  
ATOM 8093  N N    . ARG A 1 64 ? 10.594  8.385   -5.393  1.00 0.00 ? 65 ARG A N    7  
ATOM 8094  C CA   . ARG A 1 64 ? 11.010  9.554   -6.207  1.00 0.00 ? 65 ARG A CA   7  
ATOM 8095  C C    . ARG A 1 64 ? 9.801   10.140  -6.940  1.00 0.00 ? 65 ARG A C    7  
ATOM 8096  O O    . ARG A 1 64 ? 9.690   11.337  -7.115  1.00 0.00 ? 65 ARG A O    7  
ATOM 8097  C CB   . ARG A 1 64 ? 12.052  9.107   -7.231  1.00 0.00 ? 65 ARG A CB   7  
ATOM 8098  C CG   . ARG A 1 64 ? 12.681  10.335  -7.892  1.00 0.00 ? 65 ARG A CG   7  
ATOM 8099  C CD   . ARG A 1 64 ? 13.299  9.931   -9.230  1.00 0.00 ? 65 ARG A CD   7  
ATOM 8100  N NE   . ARG A 1 64 ? 14.463  10.812  -9.524  1.00 0.00 ? 65 ARG A NE   7  
ATOM 8101  C CZ   . ARG A 1 64 ? 14.357  12.104  -9.371  1.00 0.00 ? 65 ARG A CZ   7  
ATOM 8102  N NH1  . ARG A 1 64 ? 13.343  12.740  -9.888  1.00 0.00 ? 65 ARG A NH1  7  
ATOM 8103  N NH2  . ARG A 1 64 ? 15.266  12.758  -8.701  1.00 0.00 ? 65 ARG A NH2  7  
ATOM 8104  H H    . ARG A 1 64 ? 10.801  7.475   -5.696  1.00 0.00 ? 65 ARG A H    7  
ATOM 8105  H HA   . ARG A 1 64 ? 11.436  10.299  -5.563  1.00 0.00 ? 65 ARG A HA   7  
ATOM 8106  H HB2  . ARG A 1 64 ? 12.821  8.530   -6.736  1.00 0.00 ? 65 ARG A HB2  7  
ATOM 8107  H HB3  . ARG A 1 64 ? 11.575  8.499   -7.985  1.00 0.00 ? 65 ARG A HB3  7  
ATOM 8108  H HG2  . ARG A 1 64 ? 11.919  11.084  -8.057  1.00 0.00 ? 65 ARG A HG2  7  
ATOM 8109  H HG3  . ARG A 1 64 ? 13.449  10.738  -7.249  1.00 0.00 ? 65 ARG A HG3  7  
ATOM 8110  H HD2  . ARG A 1 64 ? 13.629  8.904   -9.180  1.00 0.00 ? 65 ARG A HD2  7  
ATOM 8111  H HD3  . ARG A 1 64 ? 12.563  10.035  -10.013 1.00 0.00 ? 65 ARG A HD3  7  
ATOM 8112  H HE   . ARG A 1 64 ? 15.309  10.423  -9.832  1.00 0.00 ? 65 ARG A HE   7  
ATOM 8113  H HH11 . ARG A 1 64 ? 12.646  12.237  -10.400 1.00 0.00 ? 65 ARG A HH11 7  
ATOM 8114  H HH12 . ARG A 1 64 ? 13.260  13.729  -9.771  1.00 0.00 ? 65 ARG A HH12 7  
ATOM 8115  H HH21 . ARG A 1 64 ? 16.044  12.269  -8.306  1.00 0.00 ? 65 ARG A HH21 7  
ATOM 8116  H HH22 . ARG A 1 64 ? 15.185  13.747  -8.583  1.00 0.00 ? 65 ARG A HH22 7  
ATOM 8117  N N    . ALA A 1 65 ? 8.902   9.309   -7.385  1.00 0.00 ? 66 ALA A N    7  
ATOM 8118  C CA   . ALA A 1 65 ? 7.711   9.825   -8.123  1.00 0.00 ? 66 ALA A CA   7  
ATOM 8119  C C    . ALA A 1 65 ? 6.714   10.452  -7.152  1.00 0.00 ? 66 ALA A C    7  
ATOM 8120  O O    . ALA A 1 65 ? 5.953   11.314  -7.527  1.00 0.00 ? 66 ALA A O    7  
ATOM 8121  C CB   . ALA A 1 65 ? 7.036   8.676   -8.873  1.00 0.00 ? 66 ALA A CB   7  
ATOM 8122  H H    . ALA A 1 65 ? 9.014   8.344   -7.245  1.00 0.00 ? 66 ALA A H    7  
ATOM 8123  H HA   . ALA A 1 65 ? 8.030   10.580  -8.832  1.00 0.00 ? 66 ALA A HA   7  
ATOM 8124  H HB1  . ALA A 1 65 ? 7.752   8.203   -9.528  1.00 0.00 ? 66 ALA A HB1  7  
ATOM 8125  H HB2  . ALA A 1 65 ? 6.666   7.952   -8.162  1.00 0.00 ? 66 ALA A HB2  7  
ATOM 8126  H HB3  . ALA A 1 65 ? 6.212   9.061   -9.456  1.00 0.00 ? 66 ALA A HB3  7  
ATOM 8127  N N    . VAL A 1 66 ? 6.700   10.045  -5.911  1.00 0.00 ? 67 VAL A N    7  
ATOM 8128  C CA   . VAL A 1 66 ? 5.739   10.663  -4.961  1.00 0.00 ? 67 VAL A CA   7  
ATOM 8129  C C    . VAL A 1 66 ? 6.178   12.096  -4.689  1.00 0.00 ? 67 VAL A C    7  
ATOM 8130  O O    . VAL A 1 66 ? 5.371   12.967  -4.469  1.00 0.00 ? 67 VAL A O    7  
ATOM 8131  C CB   . VAL A 1 66 ? 5.715   9.910   -3.655  1.00 0.00 ? 67 VAL A CB   7  
ATOM 8132  C CG1  . VAL A 1 66 ? 5.092   8.531   -3.852  1.00 0.00 ? 67 VAL A CG1  7  
ATOM 8133  C CG2  . VAL A 1 66 ? 7.129   9.783   -3.163  1.00 0.00 ? 67 VAL A CG2  7  
ATOM 8134  H H    . VAL A 1 66 ? 7.317   9.350   -5.609  1.00 0.00 ? 67 VAL A H    7  
ATOM 8135  H HA   . VAL A 1 66 ? 4.764   10.654  -5.385  1.00 0.00 ? 67 VAL A HA   7  
ATOM 8136  H HB   . VAL A 1 66 ? 5.144   10.469  -2.945  1.00 0.00 ? 67 VAL A HB   7  
ATOM 8137  H HG11 . VAL A 1 66 ? 5.263   8.200   -4.865  1.00 0.00 ? 67 VAL A HG11 7  
ATOM 8138  H HG12 . VAL A 1 66 ? 5.540   7.832   -3.163  1.00 0.00 ? 67 VAL A HG12 7  
ATOM 8139  H HG13 . VAL A 1 66 ? 4.030   8.591   -3.666  1.00 0.00 ? 67 VAL A HG13 7  
ATOM 8140  H HG21 . VAL A 1 66 ? 7.583   10.757  -3.189  1.00 0.00 ? 67 VAL A HG21 7  
ATOM 8141  H HG22 . VAL A 1 66 ? 7.126   9.406   -2.155  1.00 0.00 ? 67 VAL A HG22 7  
ATOM 8142  H HG23 . VAL A 1 66 ? 7.667   9.114   -3.807  1.00 0.00 ? 67 VAL A HG23 7  
ATOM 8143  N N    . LYS A 1 67 ? 7.462   12.328  -4.698  1.00 0.00 ? 68 LYS A N    7  
ATOM 8144  C CA   . LYS A 1 67 ? 7.995   13.703  -4.449  1.00 0.00 ? 68 LYS A CA   7  
ATOM 8145  C C    . LYS A 1 67 ? 7.550   14.619  -5.590  1.00 0.00 ? 68 LYS A C    7  
ATOM 8146  O O    . LYS A 1 67 ? 6.887   15.614  -5.381  1.00 0.00 ? 68 LYS A O    7  
ATOM 8147  C CB   . LYS A 1 67 ? 9.524   13.655  -4.398  1.00 0.00 ? 68 LYS A CB   7  
ATOM 8148  C CG   . LYS A 1 67 ? 9.972   12.879  -3.157  1.00 0.00 ? 68 LYS A CG   7  
ATOM 8149  C CD   . LYS A 1 67 ? 11.299  12.174  -3.448  1.00 0.00 ? 68 LYS A CD   7  
ATOM 8150  C CE   . LYS A 1 67 ? 12.456  13.152  -3.239  1.00 0.00 ? 68 LYS A CE   7  
ATOM 8151  N NZ   . LYS A 1 67 ? 13.678  12.398  -2.837  1.00 0.00 ? 68 LYS A NZ   7  
ATOM 8152  H H    . LYS A 1 67 ? 8.078   11.590  -4.869  1.00 0.00 ? 68 LYS A H    7  
ATOM 8153  H HA   . LYS A 1 67 ? 7.610   14.077  -3.511  1.00 0.00 ? 68 LYS A HA   7  
ATOM 8154  H HB2  . LYS A 1 67 ? 9.899   13.164  -5.285  1.00 0.00 ? 68 LYS A HB2  7  
ATOM 8155  H HB3  . LYS A 1 67 ? 9.914   14.660  -4.351  1.00 0.00 ? 68 LYS A HB3  7  
ATOM 8156  H HG2  . LYS A 1 67 ? 10.101  13.565  -2.332  1.00 0.00 ? 68 LYS A HG2  7  
ATOM 8157  H HG3  . LYS A 1 67 ? 9.224   12.145  -2.903  1.00 0.00 ? 68 LYS A HG3  7  
ATOM 8158  H HD2  . LYS A 1 67 ? 11.411  11.331  -2.781  1.00 0.00 ? 68 LYS A HD2  7  
ATOM 8159  H HD3  . LYS A 1 67 ? 11.304  11.826  -4.471  1.00 0.00 ? 68 LYS A HD3  7  
ATOM 8160  H HE2  . LYS A 1 67 ? 12.647  13.685  -4.158  1.00 0.00 ? 68 LYS A HE2  7  
ATOM 8161  H HE3  . LYS A 1 67 ? 12.196  13.856  -2.462  1.00 0.00 ? 68 LYS A HE3  7  
ATOM 8162  H HZ1  . LYS A 1 67 ? 13.708  11.491  -3.345  1.00 0.00 ? 68 LYS A HZ1  7  
ATOM 8163  H HZ2  . LYS A 1 67 ? 14.522  12.957  -3.074  1.00 0.00 ? 68 LYS A HZ2  7  
ATOM 8164  H HZ3  . LYS A 1 67 ? 13.656  12.222  -1.813  1.00 0.00 ? 68 LYS A HZ3  7  
ATOM 8165  N N    . GLU A 1 68 ? 7.888   14.271  -6.804  1.00 0.00 ? 69 GLU A N    7  
ATOM 8166  C CA   . GLU A 1 68 ? 7.457   15.091  -7.969  1.00 0.00 ? 69 GLU A CA   7  
ATOM 8167  C C    . GLU A 1 68 ? 5.931   15.120  -7.964  1.00 0.00 ? 69 GLU A C    7  
ATOM 8168  O O    . GLU A 1 68 ? 5.287   16.078  -8.344  1.00 0.00 ? 69 GLU A O    7  
ATOM 8169  C CB   . GLU A 1 68 ? 7.948   14.397  -9.239  1.00 0.00 ? 69 GLU A CB   7  
ATOM 8170  C CG   . GLU A 1 68 ? 9.320   14.948  -9.628  1.00 0.00 ? 69 GLU A CG   7  
ATOM 8171  C CD   . GLU A 1 68 ? 9.478   14.904  -11.149 1.00 0.00 ? 69 GLU A CD   7  
ATOM 8172  O OE1  . GLU A 1 68 ? 9.222   13.857  -11.722 1.00 0.00 ? 69 GLU A OE1  7  
ATOM 8173  O OE2  . GLU A 1 68 ? 9.853   15.917  -11.716 1.00 0.00 ? 69 GLU A OE2  7  
ATOM 8174  H H    . GLU A 1 68 ? 8.404   13.451  -6.953  1.00 0.00 ? 69 GLU A H    7  
ATOM 8175  H HA   . GLU A 1 68 ? 7.860   16.091  -7.903  1.00 0.00 ? 69 GLU A HA   7  
ATOM 8176  H HB2  . GLU A 1 68 ? 8.024   13.328  -9.048  1.00 0.00 ? 69 GLU A HB2  7  
ATOM 8177  H HB3  . GLU A 1 68 ? 7.246   14.572  -10.040 1.00 0.00 ? 69 GLU A HB3  7  
ATOM 8178  H HG2  . GLU A 1 68 ? 9.408   15.969  -9.285  1.00 0.00 ? 69 GLU A HG2  7  
ATOM 8179  H HG3  . GLU A 1 68 ? 10.092  14.347  -9.171  1.00 0.00 ? 69 GLU A HG3  7  
ATOM 8180  N N    . PHE A 1 69 ? 5.384   14.041  -7.507  1.00 0.00 ? 70 PHE A N    7  
ATOM 8181  C CA   . PHE A 1 69 ? 3.914   13.856  -7.400  1.00 0.00 ? 70 PHE A CA   7  
ATOM 8182  C C    . PHE A 1 69 ? 3.343   14.738  -6.294  1.00 0.00 ? 70 PHE A C    7  
ATOM 8183  O O    . PHE A 1 69 ? 2.195   15.134  -6.323  1.00 0.00 ? 70 PHE A O    7  
ATOM 8184  C CB   . PHE A 1 69 ? 3.714   12.418  -7.001  1.00 0.00 ? 70 PHE A CB   7  
ATOM 8185  C CG   . PHE A 1 69 ? 2.381   12.256  -6.383  1.00 0.00 ? 70 PHE A CG   7  
ATOM 8186  C CD1  . PHE A 1 69 ? 1.273   12.157  -7.197  1.00 0.00 ? 70 PHE A CD1  7  
ATOM 8187  C CD2  . PHE A 1 69 ? 2.269   12.224  -5.002  1.00 0.00 ? 70 PHE A CD2  7  
ATOM 8188  C CE1  . PHE A 1 69 ? 0.009   12.015  -6.635  1.00 0.00 ? 70 PHE A CE1  7  
ATOM 8189  C CE2  . PHE A 1 69 ? 1.005   12.084  -4.418  1.00 0.00 ? 70 PHE A CE2  7  
ATOM 8190  C CZ   . PHE A 1 69 ? -0.132  11.977  -5.238  1.00 0.00 ? 70 PHE A CZ   7  
ATOM 8191  H H    . PHE A 1 69 ? 5.969   13.318  -7.212  1.00 0.00 ? 70 PHE A H    7  
ATOM 8192  H HA   . PHE A 1 69 ? 3.411   14.029  -8.334  1.00 0.00 ? 70 PHE A HA   7  
ATOM 8193  H HB2  . PHE A 1 69 ? 3.782   11.797  -7.875  1.00 0.00 ? 70 PHE A HB2  7  
ATOM 8194  H HB3  . PHE A 1 69 ? 4.471   12.152  -6.283  1.00 0.00 ? 70 PHE A HB3  7  
ATOM 8195  H HD1  . PHE A 1 69 ? 1.401   12.189  -8.267  1.00 0.00 ? 70 PHE A HD1  7  
ATOM 8196  H HD2  . PHE A 1 69 ? 3.167   12.314  -4.390  1.00 0.00 ? 70 PHE A HD2  7  
ATOM 8197  H HE1  . PHE A 1 69 ? -0.852  11.939  -7.276  1.00 0.00 ? 70 PHE A HE1  7  
ATOM 8198  H HE2  . PHE A 1 69 ? 0.904   12.056  -3.346  1.00 0.00 ? 70 PHE A HE2  7  
ATOM 8199  H HZ   . PHE A 1 69 ? -1.111  11.868  -4.796  1.00 0.00 ? 70 PHE A HZ   7  
ATOM 8200  N N    . GLU A 1 70 ? 4.133   15.014  -5.308  1.00 0.00 ? 71 GLU A N    7  
ATOM 8201  C CA   . GLU A 1 70 ? 3.642   15.835  -4.176  1.00 0.00 ? 71 GLU A CA   7  
ATOM 8202  C C    . GLU A 1 70 ? 3.815   17.295  -4.555  1.00 0.00 ? 71 GLU A C    7  
ATOM 8203  O O    . GLU A 1 70 ? 3.162   18.183  -4.043  1.00 0.00 ? 71 GLU A O    7  
ATOM 8204  C CB   . GLU A 1 70 ? 4.471   15.528  -2.925  1.00 0.00 ? 71 GLU A CB   7  
ATOM 8205  C CG   . GLU A 1 70 ? 4.204   14.090  -2.473  1.00 0.00 ? 71 GLU A CG   7  
ATOM 8206  C CD   . GLU A 1 70 ? 3.613   14.099  -1.063  1.00 0.00 ? 71 GLU A CD   7  
ATOM 8207  O OE1  . GLU A 1 70 ? 2.417   14.316  -0.944  1.00 0.00 ? 71 GLU A OE1  7  
ATOM 8208  O OE2  . GLU A 1 70 ? 4.365   13.890  -0.126  1.00 0.00 ? 71 GLU A OE2  7  
ATOM 8209  H H    . GLU A 1 70 ? 5.047   14.679  -5.314  1.00 0.00 ? 71 GLU A H    7  
ATOM 8210  H HA   . GLU A 1 70 ? 2.603   15.602  -3.993  1.00 0.00 ? 71 GLU A HA   7  
ATOM 8211  H HB2  . GLU A 1 70 ? 5.520   15.645  -3.151  1.00 0.00 ? 71 GLU A HB2  7  
ATOM 8212  H HB3  . GLU A 1 70 ? 4.194   16.209  -2.134  1.00 0.00 ? 71 GLU A HB3  7  
ATOM 8213  H HG2  . GLU A 1 70 ? 3.507   13.623  -3.154  1.00 0.00 ? 71 GLU A HG2  7  
ATOM 8214  H HG3  . GLU A 1 70 ? 5.130   13.534  -2.470  1.00 0.00 ? 71 GLU A HG3  7  
ATOM 8215  N N    . ALA A 1 71 ? 4.710   17.524  -5.463  1.00 0.00 ? 72 ALA A N    7  
ATOM 8216  C CA   . ALA A 1 71 ? 4.999   18.888  -5.942  1.00 0.00 ? 72 ALA A CA   7  
ATOM 8217  C C    . ALA A 1 71 ? 3.787   19.442  -6.695  1.00 0.00 ? 72 ALA A C    7  
ATOM 8218  O O    . ALA A 1 71 ? 3.693   20.625  -6.957  1.00 0.00 ? 72 ALA A O    7  
ATOM 8219  C CB   . ALA A 1 71 ? 6.193   18.771  -6.878  1.00 0.00 ? 72 ALA A CB   7  
ATOM 8220  H H    . ALA A 1 71 ? 5.211   16.774  -5.844  1.00 0.00 ? 72 ALA A H    7  
ATOM 8221  H HA   . ALA A 1 71 ? 5.248   19.529  -5.110  1.00 0.00 ? 72 ALA A HA   7  
ATOM 8222  H HB1  . ALA A 1 71 ? 6.478   17.722  -6.941  1.00 0.00 ? 72 ALA A HB1  7  
ATOM 8223  H HB2  . ALA A 1 71 ? 5.922   19.129  -7.858  1.00 0.00 ? 72 ALA A HB2  7  
ATOM 8224  H HB3  . ALA A 1 71 ? 7.016   19.350  -6.490  1.00 0.00 ? 72 ALA A HB3  7  
ATOM 8225  N N    . ASN A 1 72 ? 2.859   18.594  -7.044  1.00 0.00 ? 73 ASN A N    7  
ATOM 8226  C CA   . ASN A 1 72 ? 1.653   19.068  -7.778  1.00 0.00 ? 73 ASN A CA   7  
ATOM 8227  C C    . ASN A 1 72 ? 0.396   18.500  -7.114  1.00 0.00 ? 73 ASN A C    7  
ATOM 8228  O O    . ASN A 1 72 ? -0.437  17.893  -7.756  1.00 0.00 ? 73 ASN A O    7  
ATOM 8229  C CB   . ASN A 1 72 ? 1.725   18.593  -9.231  1.00 0.00 ? 73 ASN A CB   7  
ATOM 8230  C CG   . ASN A 1 72 ? 2.323   19.692  -10.097 1.00 0.00 ? 73 ASN A CG   7  
ATOM 8231  O OD1  . ASN A 1 72 ? 1.792   20.782  -10.179 1.00 0.00 ? 73 ASN A OD1  7  
ATOM 8232  N ND2  . ASN A 1 72 ? 3.419   19.448  -10.753 1.00 0.00 ? 73 ASN A ND2  7  
ATOM 8233  H H    . ASN A 1 72 ? 2.955   17.645  -6.821  1.00 0.00 ? 73 ASN A H    7  
ATOM 8234  H HA   . ASN A 1 72 ? 1.616   20.147  -7.753  1.00 0.00 ? 73 ASN A HA   7  
ATOM 8235  H HB2  . ASN A 1 72 ? 2.351   17.717  -9.294  1.00 0.00 ? 73 ASN A HB2  7  
ATOM 8236  H HB3  . ASN A 1 72 ? 0.735   18.358  -9.586  1.00 0.00 ? 73 ASN A HB3  7  
ATOM 8237  H HD21 . ASN A 1 72 ? 3.845   18.568  -10.684 1.00 0.00 ? 73 ASN A HD21 7  
ATOM 8238  H HD22 . ASN A 1 72 ? 3.814   20.139  -11.311 1.00 0.00 ? 73 ASN A HD22 7  
ATOM 8239  N N    . GLY A 1 73 ? 0.254   18.695  -5.832  1.00 0.00 ? 74 GLY A N    7  
ATOM 8240  C CA   . GLY A 1 73 ? -0.948  18.169  -5.126  1.00 0.00 ? 74 GLY A CA   7  
ATOM 8241  C C    . GLY A 1 73 ? -0.604  16.845  -4.441  1.00 0.00 ? 74 GLY A C    7  
ATOM 8242  O O    . GLY A 1 73 ? -1.134  16.598  -3.371  1.00 0.00 ? 74 GLY A O    7  
ATOM 8243  O OXT  . GLY A 1 73 ? 0.185   16.100  -5.001  1.00 0.00 ? 74 GLY A OXT  7  
ATOM 8244  H H    . GLY A 1 73 ? 0.938   19.189  -5.333  1.00 0.00 ? 74 GLY A H    7  
ATOM 8245  H HA2  . GLY A 1 73 ? -1.271  18.885  -4.383  1.00 0.00 ? 74 GLY A HA2  7  
ATOM 8246  H HA3  . GLY A 1 73 ? -1.742  18.006  -5.838  1.00 0.00 ? 74 GLY A HA3  7  
ATOM 8247  N N    . SER A 1 1  ? 1.393   8.596   -18.287 1.00 0.00 ? 2  SER A N    8  
ATOM 8248  C CA   . SER A 1 1  ? 0.213   8.441   -17.393 1.00 0.00 ? 2  SER A CA   8  
ATOM 8249  C C    . SER A 1 1  ? 0.392   9.315   -16.150 1.00 0.00 ? 2  SER A C    8  
ATOM 8250  O O    . SER A 1 1  ? 1.307   10.110  -16.065 1.00 0.00 ? 2  SER A O    8  
ATOM 8251  C CB   . SER A 1 1  ? 0.086   6.976   -16.972 1.00 0.00 ? 2  SER A CB   8  
ATOM 8252  O OG   . SER A 1 1  ? 1.328   6.533   -16.440 1.00 0.00 ? 2  SER A OG   8  
ATOM 8253  H H    . SER A 1 1  ? 2.253   8.197   -18.036 1.00 0.00 ? 2  SER A H    8  
ATOM 8254  H HA   . SER A 1 1  ? -0.681  8.743   -17.919 1.00 0.00 ? 2  SER A HA   8  
ATOM 8255  H HB2  . SER A 1 1  ? -0.677  6.881   -16.218 1.00 0.00 ? 2  SER A HB2  8  
ATOM 8256  H HB3  . SER A 1 1  ? -0.184  6.379   -17.833 1.00 0.00 ? 2  SER A HB3  8  
ATOM 8257  H HG   . SER A 1 1  ? 1.573   7.124   -15.724 1.00 0.00 ? 2  SER A HG   8  
ATOM 8258  N N    . ASP A 1 2  ? -0.477  9.176   -15.186 1.00 0.00 ? 3  ASP A N    8  
ATOM 8259  C CA   . ASP A 1 2  ? -0.358  9.999   -13.951 1.00 0.00 ? 3  ASP A CA   8  
ATOM 8260  C C    . ASP A 1 2  ? -0.170  9.083   -12.740 1.00 0.00 ? 3  ASP A C    8  
ATOM 8261  O O    . ASP A 1 2  ? 0.927   8.895   -12.252 1.00 0.00 ? 3  ASP A O    8  
ATOM 8262  C CB   . ASP A 1 2  ? -1.634  10.826  -13.766 1.00 0.00 ? 3  ASP A CB   8  
ATOM 8263  C CG   . ASP A 1 2  ? -1.788  11.802  -14.933 1.00 0.00 ? 3  ASP A CG   8  
ATOM 8264  O OD1  . ASP A 1 2  ? -0.801  12.421  -15.296 1.00 0.00 ? 3  ASP A OD1  8  
ATOM 8265  O OD2  . ASP A 1 2  ? -2.891  11.915  -15.443 1.00 0.00 ? 3  ASP A OD2  8  
ATOM 8266  H H    . ASP A 1 2  ? -1.208  8.529   -15.275 1.00 0.00 ? 3  ASP A H    8  
ATOM 8267  H HA   . ASP A 1 2  ? 0.492   10.661  -14.038 1.00 0.00 ? 3  ASP A HA   8  
ATOM 8268  H HB2  . ASP A 1 2  ? -2.487  10.165  -13.733 1.00 0.00 ? 3  ASP A HB2  8  
ATOM 8269  H HB3  . ASP A 1 2  ? -1.572  11.379  -12.841 1.00 0.00 ? 3  ASP A HB3  8  
ATOM 8270  N N    . LYS A 1 3  ? -1.235  8.514   -12.250 1.00 0.00 ? 4  LYS A N    8  
ATOM 8271  C CA   . LYS A 1 3  ? -1.125  7.613   -11.068 1.00 0.00 ? 4  LYS A CA   8  
ATOM 8272  C C    . LYS A 1 3  ? -0.002  6.592   -11.303 1.00 0.00 ? 4  LYS A C    8  
ATOM 8273  O O    . LYS A 1 3  ? -0.011  5.887   -12.292 1.00 0.00 ? 4  LYS A O    8  
ATOM 8274  C CB   . LYS A 1 3  ? -2.451  6.876   -10.872 1.00 0.00 ? 4  LYS A CB   8  
ATOM 8275  C CG   . LYS A 1 3  ? -2.381  6.036   -9.598  1.00 0.00 ? 4  LYS A CG   8  
ATOM 8276  C CD   . LYS A 1 3  ? -2.830  6.880   -8.404  1.00 0.00 ? 4  LYS A CD   8  
ATOM 8277  C CE   . LYS A 1 3  ? -3.359  5.960   -7.303  1.00 0.00 ? 4  LYS A CE   8  
ATOM 8278  N NZ   . LYS A 1 3  ? -2.336  5.833   -6.226  1.00 0.00 ? 4  LYS A NZ   8  
ATOM 8279  H H    . LYS A 1 3  ? -2.111  8.681   -12.657 1.00 0.00 ? 4  LYS A H    8  
ATOM 8280  H HA   . LYS A 1 3  ? -0.912  8.203   -10.192 1.00 0.00 ? 4  LYS A HA   8  
ATOM 8281  H HB2  . LYS A 1 3  ? -3.253  7.596   -10.786 1.00 0.00 ? 4  LYS A HB2  8  
ATOM 8282  H HB3  . LYS A 1 3  ? -2.633  6.230   -11.717 1.00 0.00 ? 4  LYS A HB3  8  
ATOM 8283  H HG2  . LYS A 1 3  ? -3.031  5.177   -9.697  1.00 0.00 ? 4  LYS A HG2  8  
ATOM 8284  H HG3  . LYS A 1 3  ? -1.366  5.704   -9.439  1.00 0.00 ? 4  LYS A HG3  8  
ATOM 8285  H HD2  . LYS A 1 3  ? -1.992  7.449   -8.029  1.00 0.00 ? 4  LYS A HD2  8  
ATOM 8286  H HD3  . LYS A 1 3  ? -3.615  7.554   -8.715  1.00 0.00 ? 4  LYS A HD3  8  
ATOM 8287  H HE2  . LYS A 1 3  ? -4.266  6.376   -6.890  1.00 0.00 ? 4  LYS A HE2  8  
ATOM 8288  H HE3  . LYS A 1 3  ? -3.568  4.985   -7.718  1.00 0.00 ? 4  LYS A HE3  8  
ATOM 8289  H HZ1  . LYS A 1 3  ? -1.751  6.692   -6.199  1.00 0.00 ? 4  LYS A HZ1  8  
ATOM 8290  H HZ2  . LYS A 1 3  ? -2.813  5.708   -5.310  1.00 0.00 ? 4  LYS A HZ2  8  
ATOM 8291  H HZ3  . LYS A 1 3  ? -1.731  5.010   -6.417  1.00 0.00 ? 4  LYS A HZ3  8  
ATOM 8292  N N    . PRO A 1 4  ? 0.933   6.540   -10.384 1.00 0.00 ? 5  PRO A N    8  
ATOM 8293  C CA   . PRO A 1 4  ? 2.074   5.614   -10.463 1.00 0.00 ? 5  PRO A CA   8  
ATOM 8294  C C    . PRO A 1 4  ? 1.674   4.208   -10.025 1.00 0.00 ? 5  PRO A C    8  
ATOM 8295  O O    . PRO A 1 4  ? 0.643   4.001   -9.416  1.00 0.00 ? 5  PRO A O    8  
ATOM 8296  C CB   . PRO A 1 4  ? 3.090   6.198   -9.505  1.00 0.00 ? 5  PRO A CB   8  
ATOM 8297  C CG   . PRO A 1 4  ? 2.299   7.074   -8.524  1.00 0.00 ? 5  PRO A CG   8  
ATOM 8298  C CD   . PRO A 1 4  ? 0.949   7.397   -9.189  1.00 0.00 ? 5  PRO A CD   8  
ATOM 8299  H HA   . PRO A 1 4  ? 2.488   5.607   -11.437 1.00 0.00 ? 5  PRO A HA   8  
ATOM 8300  H HB2  . PRO A 1 4  ? 3.599   5.402   -8.979  1.00 0.00 ? 5  PRO A HB2  8  
ATOM 8301  H HB3  . PRO A 1 4  ? 3.798   6.802   -10.046 1.00 0.00 ? 5  PRO A HB3  8  
ATOM 8302  H HG2  . PRO A 1 4  ? 2.142   6.534   -7.609  1.00 0.00 ? 5  PRO A HG2  8  
ATOM 8303  H HG3  . PRO A 1 4  ? 2.837   7.979   -8.341  1.00 0.00 ? 5  PRO A HG3  8  
ATOM 8304  H HD2  . PRO A 1 4  ? 0.132   7.144   -8.526  1.00 0.00 ? 5  PRO A HD2  8  
ATOM 8305  H HD3  . PRO A 1 4  ? 0.904   8.436   -9.473  1.00 0.00 ? 5  PRO A HD3  8  
ATOM 8306  N N    . LYS A 1 5  ? 2.495   3.245   -10.325 1.00 0.00 ? 6  LYS A N    8  
ATOM 8307  C CA   . LYS A 1 5  ? 2.187   1.847   -9.926  1.00 0.00 ? 6  LYS A CA   8  
ATOM 8308  C C    . LYS A 1 5  ? 2.463   1.673   -8.432  1.00 0.00 ? 6  LYS A C    8  
ATOM 8309  O O    . LYS A 1 5  ? 3.595   1.541   -8.009  1.00 0.00 ? 6  LYS A O    8  
ATOM 8310  C CB   . LYS A 1 5  ? 3.064   0.894   -10.718 1.00 0.00 ? 6  LYS A CB   8  
ATOM 8311  C CG   . LYS A 1 5  ? 3.150   1.362   -12.171 1.00 0.00 ? 6  LYS A CG   8  
ATOM 8312  C CD   . LYS A 1 5  ? 4.597   1.729   -12.502 1.00 0.00 ? 6  LYS A CD   8  
ATOM 8313  C CE   . LYS A 1 5  ? 4.617   2.756   -13.636 1.00 0.00 ? 6  LYS A CE   8  
ATOM 8314  N NZ   . LYS A 1 5  ? 4.412   2.061   -14.937 1.00 0.00 ? 6  LYS A NZ   8  
ATOM 8315  H H    . LYS A 1 5  ? 3.322   3.445   -10.809 1.00 0.00 ? 6  LYS A H    8  
ATOM 8316  H HA   . LYS A 1 5  ? 1.156   1.623   -10.131 1.00 0.00 ? 6  LYS A HA   8  
ATOM 8317  H HB2  . LYS A 1 5  ? 4.051   0.873   -10.285 1.00 0.00 ? 6  LYS A HB2  8  
ATOM 8318  H HB3  . LYS A 1 5  ? 2.626   -0.087  -10.683 1.00 0.00 ? 6  LYS A HB3  8  
ATOM 8319  H HG2  . LYS A 1 5  ? 2.820   0.567   -12.825 1.00 0.00 ? 6  LYS A HG2  8  
ATOM 8320  H HG3  . LYS A 1 5  ? 2.520   2.228   -12.308 1.00 0.00 ? 6  LYS A HG3  8  
ATOM 8321  H HD2  . LYS A 1 5  ? 5.071   2.148   -11.626 1.00 0.00 ? 6  LYS A HD2  8  
ATOM 8322  H HD3  . LYS A 1 5  ? 5.132   0.844   -12.812 1.00 0.00 ? 6  LYS A HD3  8  
ATOM 8323  H HE2  . LYS A 1 5  ? 3.827   3.476   -13.484 1.00 0.00 ? 6  LYS A HE2  8  
ATOM 8324  H HE3  . LYS A 1 5  ? 5.571   3.264   -13.646 1.00 0.00 ? 6  LYS A HE3  8  
ATOM 8325  H HZ1  . LYS A 1 5  ? 4.008   1.118   -14.767 1.00 0.00 ? 6  LYS A HZ1  8  
ATOM 8326  H HZ2  . LYS A 1 5  ? 3.759   2.617   -15.527 1.00 0.00 ? 6  LYS A HZ2  8  
ATOM 8327  H HZ3  . LYS A 1 5  ? 5.324   1.962   -15.425 1.00 0.00 ? 6  LYS A HZ3  8  
ATOM 8328  N N    . ARG A 1 6  ? 1.437   1.679   -7.628  1.00 0.00 ? 7  ARG A N    8  
ATOM 8329  C CA   . ARG A 1 6  ? 1.637   1.524   -6.160  1.00 0.00 ? 7  ARG A CA   8  
ATOM 8330  C C    . ARG A 1 6  ? 2.499   0.282   -5.877  1.00 0.00 ? 7  ARG A C    8  
ATOM 8331  O O    . ARG A 1 6  ? 2.377   -0.720  -6.552  1.00 0.00 ? 7  ARG A O    8  
ATOM 8332  C CB   . ARG A 1 6  ? 0.277   1.358   -5.480  1.00 0.00 ? 7  ARG A CB   8  
ATOM 8333  C CG   . ARG A 1 6  ? -0.562  2.620   -5.694  1.00 0.00 ? 7  ARG A CG   8  
ATOM 8334  C CD   . ARG A 1 6  ? -0.980  3.191   -4.338  1.00 0.00 ? 7  ARG A CD   8  
ATOM 8335  N NE   . ARG A 1 6  ? -2.454  3.052   -4.172  1.00 0.00 ? 7  ARG A NE   8  
ATOM 8336  C CZ   . ARG A 1 6  ? -2.961  2.851   -2.985  1.00 0.00 ? 7  ARG A CZ   8  
ATOM 8337  N NH1  . ARG A 1 6  ? -2.872  1.676   -2.428  1.00 0.00 ? 7  ARG A NH1  8  
ATOM 8338  N NH2  . ARG A 1 6  ? -3.554  3.829   -2.355  1.00 0.00 ? 7  ARG A NH2  8  
ATOM 8339  H H    . ARG A 1 6  ? 0.533   1.792   -7.990  1.00 0.00 ? 7  ARG A H    8  
ATOM 8340  H HA   . ARG A 1 6  ? 2.128   2.407   -5.774  1.00 0.00 ? 7  ARG A HA   8  
ATOM 8341  H HB2  . ARG A 1 6  ? -0.235  0.507   -5.904  1.00 0.00 ? 7  ARG A HB2  8  
ATOM 8342  H HB3  . ARG A 1 6  ? 0.422   1.201   -4.421  1.00 0.00 ? 7  ARG A HB3  8  
ATOM 8343  H HG2  . ARG A 1 6  ? 0.022   3.353   -6.231  1.00 0.00 ? 7  ARG A HG2  8  
ATOM 8344  H HG3  . ARG A 1 6  ? -1.444  2.372   -6.266  1.00 0.00 ? 7  ARG A HG3  8  
ATOM 8345  H HD2  . ARG A 1 6  ? -0.477  2.652   -3.548  1.00 0.00 ? 7  ARG A HD2  8  
ATOM 8346  H HD3  . ARG A 1 6  ? -0.711  4.236   -4.289  1.00 0.00 ? 7  ARG A HD3  8  
ATOM 8347  H HE   . ARG A 1 6  ? -3.043  3.109   -4.953  1.00 0.00 ? 7  ARG A HE   8  
ATOM 8348  H HH11 . ARG A 1 6  ? -2.417  0.927   -2.909  1.00 0.00 ? 7  ARG A HH11 8  
ATOM 8349  H HH12 . ARG A 1 6  ? -3.261  1.522   -1.519  1.00 0.00 ? 7  ARG A HH12 8  
ATOM 8350  H HH21 . ARG A 1 6  ? -3.621  4.732   -2.782  1.00 0.00 ? 7  ARG A HH21 8  
ATOM 8351  H HH22 . ARG A 1 6  ? -3.943  3.675   -1.447  1.00 0.00 ? 7  ARG A HH22 8  
ATOM 8352  N N    . PRO A 1 7  ? 3.334   0.389   -4.871  1.00 0.00 ? 8  PRO A N    8  
ATOM 8353  C CA   . PRO A 1 7  ? 4.223   -0.708  -4.449  1.00 0.00 ? 8  PRO A CA   8  
ATOM 8354  C C    . PRO A 1 7  ? 3.420   -1.790  -3.722  1.00 0.00 ? 8  PRO A C    8  
ATOM 8355  O O    . PRO A 1 7  ? 2.497   -1.503  -2.985  1.00 0.00 ? 8  PRO A O    8  
ATOM 8356  C CB   . PRO A 1 7  ? 5.217   -0.021  -3.501  1.00 0.00 ? 8  PRO A CB   8  
ATOM 8357  C CG   . PRO A 1 7  ? 4.519   1.266   -3.002  1.00 0.00 ? 8  PRO A CG   8  
ATOM 8358  C CD   . PRO A 1 7  ? 3.467   1.617   -4.066  1.00 0.00 ? 8  PRO A CD   8  
ATOM 8359  H HA   . PRO A 1 7  ? 4.746   -1.123  -5.295  1.00 0.00 ? 8  PRO A HA   8  
ATOM 8360  H HB2  . PRO A 1 7  ? 5.443   -0.673  -2.668  1.00 0.00 ? 8  PRO A HB2  8  
ATOM 8361  H HB3  . PRO A 1 7  ? 6.121   0.236   -4.031  1.00 0.00 ? 8  PRO A HB3  8  
ATOM 8362  H HG2  . PRO A 1 7  ? 4.041   1.082   -2.050  1.00 0.00 ? 8  PRO A HG2  8  
ATOM 8363  H HG3  . PRO A 1 7  ? 5.231   2.076   -2.911  1.00 0.00 ? 8  PRO A HG3  8  
ATOM 8364  H HD2  . PRO A 1 7  ? 2.526   1.873   -3.602  1.00 0.00 ? 8  PRO A HD2  8  
ATOM 8365  H HD3  . PRO A 1 7  ? 3.818   2.420   -4.689  1.00 0.00 ? 8  PRO A HD3  8  
ATOM 8366  N N    . LEU A 1 8  ? 3.760   -3.033  -3.928  1.00 0.00 ? 9  LEU A N    8  
ATOM 8367  C CA   . LEU A 1 8  ? 3.014   -4.131  -3.254  1.00 0.00 ? 9  LEU A CA   8  
ATOM 8368  C C    . LEU A 1 8  ? 3.945   -5.292  -2.942  1.00 0.00 ? 9  LEU A C    8  
ATOM 8369  O O    . LEU A 1 8  ? 5.152   -5.198  -3.034  1.00 0.00 ? 9  LEU A O    8  
ATOM 8370  C CB   . LEU A 1 8  ? 1.849   -4.606  -4.130  1.00 0.00 ? 9  LEU A CB   8  
ATOM 8371  C CG   . LEU A 1 8  ? 2.354   -5.595  -5.169  1.00 0.00 ? 9  LEU A CG   8  
ATOM 8372  C CD1  . LEU A 1 8  ? 1.216   -5.958  -6.118  1.00 0.00 ? 9  LEU A CD1  8  
ATOM 8373  C CD2  . LEU A 1 8  ? 3.490   -4.937  -5.935  1.00 0.00 ? 9  LEU A CD2  8  
ATOM 8374  H H    . LEU A 1 8  ? 4.507   -3.243  -4.527  1.00 0.00 ? 9  LEU A H    8  
ATOM 8375  H HA   . LEU A 1 8  ? 2.614   -3.777  -2.334  1.00 0.00 ? 9  LEU A HA   8  
ATOM 8376  H HB2  . LEU A 1 8  ? 1.105   -5.085  -3.511  1.00 0.00 ? 9  LEU A HB2  8  
ATOM 8377  H HB3  . LEU A 1 8  ? 1.407   -3.757  -4.630  1.00 0.00 ? 9  LEU A HB3  8  
ATOM 8378  H HG   . LEU A 1 8  ? 2.715   -6.486  -4.676  1.00 0.00 ? 9  LEU A HG   8  
ATOM 8379  H HD11 . LEU A 1 8  ? 0.412   -6.401  -5.551  1.00 0.00 ? 9  LEU A HD11 8  
ATOM 8380  H HD12 . LEU A 1 8  ? 0.861   -5.066  -6.610  1.00 0.00 ? 9  LEU A HD12 8  
ATOM 8381  H HD13 . LEU A 1 8  ? 1.570   -6.664  -6.857  1.00 0.00 ? 9  LEU A HD13 8  
ATOM 8382  H HD21 . LEU A 1 8  ? 3.384   -3.866  -5.869  1.00 0.00 ? 9  LEU A HD21 8  
ATOM 8383  H HD22 . LEU A 1 8  ? 4.431   -5.233  -5.496  1.00 0.00 ? 9  LEU A HD22 8  
ATOM 8384  H HD23 . LEU A 1 8  ? 3.456   -5.240  -6.968  1.00 0.00 ? 9  LEU A HD23 8  
ATOM 8385  N N    . SER A 1 9  ? 3.367   -6.374  -2.544  1.00 0.00 ? 10 SER A N    8  
ATOM 8386  C CA   . SER A 1 9  ? 4.168   -7.577  -2.172  1.00 0.00 ? 10 SER A CA   8  
ATOM 8387  C C    . SER A 1 9  ? 4.534   -8.407  -3.409  1.00 0.00 ? 10 SER A C    8  
ATOM 8388  O O    . SER A 1 9  ? 3.794   -8.485  -4.379  1.00 0.00 ? 10 SER A O    8  
ATOM 8389  C CB   . SER A 1 9  ? 3.354   -8.442  -1.209  1.00 0.00 ? 10 SER A CB   8  
ATOM 8390  O OG   . SER A 1 9  ? 3.067   -7.694  -0.035  1.00 0.00 ? 10 SER A OG   8  
ATOM 8391  H H    . SER A 1 9  ? 2.391   -6.382  -2.467  1.00 0.00 ? 10 SER A H    8  
ATOM 8392  H HA   . SER A 1 9  ? 5.074   -7.259  -1.678  1.00 0.00 ? 10 SER A HA   8  
ATOM 8393  H HB2  . SER A 1 9  ? 2.429   -8.733  -1.679  1.00 0.00 ? 10 SER A HB2  8  
ATOM 8394  H HB3  . SER A 1 9  ? 3.920   -9.328  -0.956  1.00 0.00 ? 10 SER A HB3  8  
ATOM 8395  H HG   . SER A 1 9  ? 2.113   -7.657  0.069   1.00 0.00 ? 10 SER A HG   8  
ATOM 8396  N N    . ALA A 1 10 ? 5.673   -9.047  -3.365  1.00 0.00 ? 11 ALA A N    8  
ATOM 8397  C CA   . ALA A 1 10 ? 6.103   -9.896  -4.509  1.00 0.00 ? 11 ALA A CA   8  
ATOM 8398  C C    . ALA A 1 10 ? 5.081   -11.014 -4.698  1.00 0.00 ? 11 ALA A C    8  
ATOM 8399  O O    . ALA A 1 10 ? 4.778   -11.423 -5.803  1.00 0.00 ? 11 ALA A O    8  
ATOM 8400  C CB   . ALA A 1 10 ? 7.471   -10.505 -4.205  1.00 0.00 ? 11 ALA A CB   8  
ATOM 8401  H H    . ALA A 1 10 ? 6.240   -8.981  -2.568  1.00 0.00 ? 11 ALA A H    8  
ATOM 8402  H HA   . ALA A 1 10 ? 6.163   -9.298  -5.404  1.00 0.00 ? 11 ALA A HA   8  
ATOM 8403  H HB1  . ALA A 1 10 ? 8.084   -9.779  -3.692  1.00 0.00 ? 11 ALA A HB1  8  
ATOM 8404  H HB2  . ALA A 1 10 ? 7.347   -11.377 -3.579  1.00 0.00 ? 11 ALA A HB2  8  
ATOM 8405  H HB3  . ALA A 1 10 ? 7.949   -10.792 -5.128  1.00 0.00 ? 11 ALA A HB3  8  
ATOM 8406  N N    . TYR A 1 11 ? 4.536   -11.502 -3.616  1.00 0.00 ? 12 TYR A N    8  
ATOM 8407  C CA   . TYR A 1 11 ? 3.525   -12.579 -3.702  1.00 0.00 ? 12 TYR A CA   8  
ATOM 8408  C C    . TYR A 1 11 ? 2.371   -12.103 -4.582  1.00 0.00 ? 12 TYR A C    8  
ATOM 8409  O O    . TYR A 1 11 ? 1.722   -12.882 -5.251  1.00 0.00 ? 12 TYR A O    8  
ATOM 8410  C CB   . TYR A 1 11 ? 3.020   -12.868 -2.292  1.00 0.00 ? 12 TYR A CB   8  
ATOM 8411  C CG   . TYR A 1 11 ? 1.738   -13.655 -2.360  1.00 0.00 ? 12 TYR A CG   8  
ATOM 8412  C CD1  . TYR A 1 11 ? 1.680   -14.822 -3.124  1.00 0.00 ? 12 TYR A CD1  8  
ATOM 8413  C CD2  . TYR A 1 11 ? 0.609   -13.220 -1.657  1.00 0.00 ? 12 TYR A CD2  8  
ATOM 8414  C CE1  . TYR A 1 11 ? 0.495   -15.559 -3.188  1.00 0.00 ? 12 TYR A CE1  8  
ATOM 8415  C CE2  . TYR A 1 11 ? -0.579  -13.955 -1.721  1.00 0.00 ? 12 TYR A CE2  8  
ATOM 8416  C CZ   . TYR A 1 11 ? -0.636  -15.127 -2.487  1.00 0.00 ? 12 TYR A CZ   8  
ATOM 8417  O OH   . TYR A 1 11 ? -1.807  -15.855 -2.548  1.00 0.00 ? 12 TYR A OH   8  
ATOM 8418  H H    . TYR A 1 11 ? 4.788   -11.149 -2.737  1.00 0.00 ? 12 TYR A H    8  
ATOM 8419  H HA   . TYR A 1 11 ? 3.964   -13.471 -4.123  1.00 0.00 ? 12 TYR A HA   8  
ATOM 8420  H HB2  . TYR A 1 11 ? 3.765   -13.436 -1.756  1.00 0.00 ? 12 TYR A HB2  8  
ATOM 8421  H HB3  . TYR A 1 11 ? 2.847   -11.934 -1.781  1.00 0.00 ? 12 TYR A HB3  8  
ATOM 8422  H HD1  . TYR A 1 11 ? 2.551   -15.154 -3.666  1.00 0.00 ? 12 TYR A HD1  8  
ATOM 8423  H HD2  . TYR A 1 11 ? 0.654   -12.316 -1.069  1.00 0.00 ? 12 TYR A HD2  8  
ATOM 8424  H HE1  . TYR A 1 11 ? 0.456   -16.461 -3.779  1.00 0.00 ? 12 TYR A HE1  8  
ATOM 8425  H HE2  . TYR A 1 11 ? -1.451  -13.619 -1.181  1.00 0.00 ? 12 TYR A HE2  8  
ATOM 8426  H HH   . TYR A 1 11 ? -1.742  -16.575 -1.916  1.00 0.00 ? 12 TYR A HH   8  
ATOM 8427  N N    . MET A 1 12 ? 2.113   -10.825 -4.587  1.00 0.00 ? 13 MET A N    8  
ATOM 8428  C CA   . MET A 1 12 ? 1.007   -10.295 -5.422  1.00 0.00 ? 13 MET A CA   8  
ATOM 8429  C C    . MET A 1 12 ? 1.430   -10.315 -6.891  1.00 0.00 ? 13 MET A C    8  
ATOM 8430  O O    . MET A 1 12 ? 0.691   -10.757 -7.745  1.00 0.00 ? 13 MET A O    8  
ATOM 8431  C CB   . MET A 1 12 ? 0.680   -8.862  -5.000  1.00 0.00 ? 13 MET A CB   8  
ATOM 8432  C CG   . MET A 1 12 ? -0.718  -8.819  -4.380  1.00 0.00 ? 13 MET A CG   8  
ATOM 8433  S SD   . MET A 1 12 ? -0.825  -7.429  -3.227  1.00 0.00 ? 13 MET A SD   8  
ATOM 8434  C CE   . MET A 1 12 ? -0.417  -8.348  -1.721  1.00 0.00 ? 13 MET A CE   8  
ATOM 8435  H H    . MET A 1 12 ? 2.652   -10.215 -4.041  1.00 0.00 ? 13 MET A H    8  
ATOM 8436  H HA   . MET A 1 12 ? 0.131   -10.917 -5.294  1.00 0.00 ? 13 MET A HA   8  
ATOM 8437  H HB2  . MET A 1 12 ? 1.407   -8.525  -4.276  1.00 0.00 ? 13 MET A HB2  8  
ATOM 8438  H HB3  . MET A 1 12 ? 0.706   -8.219  -5.866  1.00 0.00 ? 13 MET A HB3  8  
ATOM 8439  H HG2  . MET A 1 12 ? -1.455  -8.697  -5.161  1.00 0.00 ? 13 MET A HG2  8  
ATOM 8440  H HG3  . MET A 1 12 ? -0.907  -9.742  -3.850  1.00 0.00 ? 13 MET A HG3  8  
ATOM 8441  H HE1  . MET A 1 12 ? -0.600  -9.402  -1.882  1.00 0.00 ? 13 MET A HE1  8  
ATOM 8442  H HE2  . MET A 1 12 ? 0.622   -8.197  -1.478  1.00 0.00 ? 13 MET A HE2  8  
ATOM 8443  H HE3  . MET A 1 12 ? -1.032  -7.991  -0.906  1.00 0.00 ? 13 MET A HE3  8  
ATOM 8444  N N    . LEU A 1 13 ? 2.613   -9.847  -7.199  1.00 0.00 ? 14 LEU A N    8  
ATOM 8445  C CA   . LEU A 1 13 ? 3.046   -9.865  -8.631  1.00 0.00 ? 14 LEU A CA   8  
ATOM 8446  C C    . LEU A 1 13 ? 2.762   -11.246 -9.216  1.00 0.00 ? 14 LEU A C    8  
ATOM 8447  O O    . LEU A 1 13 ? 2.241   -11.376 -10.307 1.00 0.00 ? 14 LEU A O    8  
ATOM 8448  C CB   . LEU A 1 13 ? 4.546   -9.577  -8.753  1.00 0.00 ? 14 LEU A CB   8  
ATOM 8449  C CG   . LEU A 1 13 ? 4.964   -8.534  -7.716  1.00 0.00 ? 14 LEU A CG   8  
ATOM 8450  C CD1  . LEU A 1 13 ? 6.364   -8.009  -8.052  1.00 0.00 ? 14 LEU A CD1  8  
ATOM 8451  C CD2  . LEU A 1 13 ? 3.974   -7.371  -7.741  1.00 0.00 ? 14 LEU A CD2  8  
ATOM 8452  H H    . LEU A 1 13 ? 3.207   -9.493  -6.499  1.00 0.00 ? 14 LEU A H    8  
ATOM 8453  H HA   . LEU A 1 13 ? 2.489   -9.122  -9.183  1.00 0.00 ? 14 LEU A HA   8  
ATOM 8454  H HB2  . LEU A 1 13 ? 5.106   -10.495 -8.605  1.00 0.00 ? 14 LEU A HB2  8  
ATOM 8455  H HB3  . LEU A 1 13 ? 4.752   -9.194  -9.741  1.00 0.00 ? 14 LEU A HB3  8  
ATOM 8456  H HG   . LEU A 1 13 ? 4.972   -8.984  -6.736  1.00 0.00 ? 14 LEU A HG   8  
ATOM 8457  H HD11 . LEU A 1 13 ? 6.462   -7.908  -9.123  1.00 0.00 ? 14 LEU A HD11 8  
ATOM 8458  H HD12 . LEU A 1 13 ? 6.513   -7.043  -7.584  1.00 0.00 ? 14 LEU A HD12 8  
ATOM 8459  H HD13 . LEU A 1 13 ? 7.106   -8.705  -7.687  1.00 0.00 ? 14 LEU A HD13 8  
ATOM 8460  H HD21 . LEU A 1 13 ? 3.275   -7.512  -8.552  1.00 0.00 ? 14 LEU A HD21 8  
ATOM 8461  H HD22 . LEU A 1 13 ? 3.437   -7.334  -6.804  1.00 0.00 ? 14 LEU A HD22 8  
ATOM 8462  H HD23 . LEU A 1 13 ? 4.512   -6.447  -7.886  1.00 0.00 ? 14 LEU A HD23 8  
ATOM 8463  N N    . TRP A 1 14 ? 3.105   -12.278 -8.499  1.00 0.00 ? 15 TRP A N    8  
ATOM 8464  C CA   . TRP A 1 14 ? 2.858   -13.654 -9.009  1.00 0.00 ? 15 TRP A CA   8  
ATOM 8465  C C    . TRP A 1 14 ? 1.351   -13.887 -9.135  1.00 0.00 ? 15 TRP A C    8  
ATOM 8466  O O    . TRP A 1 14 ? 0.877   -14.441 -10.107 1.00 0.00 ? 15 TRP A O    8  
ATOM 8467  C CB   . TRP A 1 14 ? 3.457   -14.671 -8.036  1.00 0.00 ? 15 TRP A CB   8  
ATOM 8468  C CG   . TRP A 1 14 ? 3.020   -16.046 -8.418  1.00 0.00 ? 15 TRP A CG   8  
ATOM 8469  C CD1  . TRP A 1 14 ? 3.558   -16.785 -9.415  1.00 0.00 ? 15 TRP A CD1  8  
ATOM 8470  C CD2  . TRP A 1 14 ? 1.966   -16.858 -7.829  1.00 0.00 ? 15 TRP A CD2  8  
ATOM 8471  N NE1  . TRP A 1 14 ? 2.901   -18.001 -9.473  1.00 0.00 ? 15 TRP A NE1  8  
ATOM 8472  C CE2  . TRP A 1 14 ? 1.911   -18.093 -8.515  1.00 0.00 ? 15 TRP A CE2  8  
ATOM 8473  C CE3  . TRP A 1 14 ? 1.060   -16.643 -6.775  1.00 0.00 ? 15 TRP A CE3  8  
ATOM 8474  C CZ2  . TRP A 1 14 ? 0.991   -19.081 -8.167  1.00 0.00 ? 15 TRP A CZ2  8  
ATOM 8475  C CZ3  . TRP A 1 14 ? 0.131   -17.636 -6.422  1.00 0.00 ? 15 TRP A CZ3  8  
ATOM 8476  C CH2  . TRP A 1 14 ? 0.097   -18.853 -7.117  1.00 0.00 ? 15 TRP A CH2  8  
ATOM 8477  H H    . TRP A 1 14 ? 3.525   -12.149 -7.621  1.00 0.00 ? 15 TRP A H    8  
ATOM 8478  H HA   . TRP A 1 14 ? 3.322   -13.767 -9.978  1.00 0.00 ? 15 TRP A HA   8  
ATOM 8479  H HB2  . TRP A 1 14 ? 4.536   -14.613 -8.072  1.00 0.00 ? 15 TRP A HB2  8  
ATOM 8480  H HB3  . TRP A 1 14 ? 3.120   -14.451 -7.033  1.00 0.00 ? 15 TRP A HB3  8  
ATOM 8481  H HD1  . TRP A 1 14 ? 4.368   -16.476 -10.059 1.00 0.00 ? 15 TRP A HD1  8  
ATOM 8482  H HE1  . TRP A 1 14 ? 3.098   -18.721 -10.108 1.00 0.00 ? 15 TRP A HE1  8  
ATOM 8483  H HE3  . TRP A 1 14 ? 1.079   -15.709 -6.232  1.00 0.00 ? 15 TRP A HE3  8  
ATOM 8484  H HZ2  . TRP A 1 14 ? 0.971   -20.016 -8.706  1.00 0.00 ? 15 TRP A HZ2  8  
ATOM 8485  H HZ3  . TRP A 1 14 ? -0.560  -17.458 -5.611  1.00 0.00 ? 15 TRP A HZ3  8  
ATOM 8486  H HH2  . TRP A 1 14 ? -0.619  -19.612 -6.842  1.00 0.00 ? 15 TRP A HH2  8  
ATOM 8487  N N    . LEU A 1 15 ? 0.592   -13.463 -8.159  1.00 0.00 ? 16 LEU A N    8  
ATOM 8488  C CA   . LEU A 1 15 ? -0.884  -13.656 -8.223  1.00 0.00 ? 16 LEU A CA   8  
ATOM 8489  C C    . LEU A 1 15 ? -1.447  -12.937 -9.450  1.00 0.00 ? 16 LEU A C    8  
ATOM 8490  O O    . LEU A 1 15 ? -2.498  -13.282 -9.954  1.00 0.00 ? 16 LEU A O    8  
ATOM 8491  C CB   . LEU A 1 15 ? -1.528  -13.073 -6.964  1.00 0.00 ? 16 LEU A CB   8  
ATOM 8492  C CG   . LEU A 1 15 ? -1.150  -13.929 -5.757  1.00 0.00 ? 16 LEU A CG   8  
ATOM 8493  C CD1  . LEU A 1 15 ? -1.108  -13.054 -4.504  1.00 0.00 ? 16 LEU A CD1  8  
ATOM 8494  C CD2  . LEU A 1 15 ? -2.191  -15.035 -5.576  1.00 0.00 ? 16 LEU A CD2  8  
ATOM 8495  H H    . LEU A 1 15 ? 0.993   -13.018 -7.385  1.00 0.00 ? 16 LEU A H    8  
ATOM 8496  H HA   . LEU A 1 15 ? -1.108  -14.710 -8.287  1.00 0.00 ? 16 LEU A HA   8  
ATOM 8497  H HB2  . LEU A 1 15 ? -1.175  -12.063 -6.815  1.00 0.00 ? 16 LEU A HB2  8  
ATOM 8498  H HB3  . LEU A 1 15 ? -2.600  -13.067 -7.077  1.00 0.00 ? 16 LEU A HB3  8  
ATOM 8499  H HG   . LEU A 1 15 ? -0.178  -14.368 -5.919  1.00 0.00 ? 16 LEU A HG   8  
ATOM 8500  H HD11 . LEU A 1 15 ? -1.396  -12.045 -4.760  1.00 0.00 ? 16 LEU A HD11 8  
ATOM 8501  H HD12 . LEU A 1 15 ? -1.791  -13.447 -3.766  1.00 0.00 ? 16 LEU A HD12 8  
ATOM 8502  H HD13 . LEU A 1 15 ? -0.105  -13.051 -4.101  1.00 0.00 ? 16 LEU A HD13 8  
ATOM 8503  H HD21 . LEU A 1 15 ? -3.169  -14.653 -5.831  1.00 0.00 ? 16 LEU A HD21 8  
ATOM 8504  H HD22 . LEU A 1 15 ? -1.949  -15.865 -6.221  1.00 0.00 ? 16 LEU A HD22 8  
ATOM 8505  H HD23 . LEU A 1 15 ? -2.192  -15.364 -4.549  1.00 0.00 ? 16 LEU A HD23 8  
ATOM 8506  N N    . ASN A 1 16 ? -0.763  -11.938 -9.933  1.00 0.00 ? 17 ASN A N    8  
ATOM 8507  C CA   . ASN A 1 16 ? -1.265  -11.198 -11.116 1.00 0.00 ? 17 ASN A CA   8  
ATOM 8508  C C    . ASN A 1 16 ? -0.892  -11.950 -12.394 1.00 0.00 ? 17 ASN A C    8  
ATOM 8509  O O    . ASN A 1 16 ? -1.656  -12.005 -13.337 1.00 0.00 ? 17 ASN A O    8  
ATOM 8510  C CB   . ASN A 1 16 ? -0.641  -9.813  -11.132 1.00 0.00 ? 17 ASN A CB   8  
ATOM 8511  C CG   . ASN A 1 16 ? -0.537  -9.277  -9.701  1.00 0.00 ? 17 ASN A CG   8  
ATOM 8512  O OD1  . ASN A 1 16 ? -1.290  -9.675  -8.834  1.00 0.00 ? 17 ASN A OD1  8  
ATOM 8513  N ND2  . ASN A 1 16 ? 0.373   -8.382  -9.416  1.00 0.00 ? 17 ASN A ND2  8  
ATOM 8514  H H    . ASN A 1 16 ? 0.079   -11.668 -9.515  1.00 0.00 ? 17 ASN A H    8  
ATOM 8515  H HA   . ASN A 1 16 ? -2.333  -11.100 -11.059 1.00 0.00 ? 17 ASN A HA   8  
ATOM 8516  H HB2  . ASN A 1 16 ? 0.341   -9.868  -11.570 1.00 0.00 ? 17 ASN A HB2  8  
ATOM 8517  H HB3  . ASN A 1 16 ? -1.267  -9.159  -11.714 1.00 0.00 ? 17 ASN A HB3  8  
ATOM 8518  H HD21 . ASN A 1 16 ? 0.979   -8.061  -10.115 1.00 0.00 ? 17 ASN A HD21 8  
ATOM 8519  H HD22 . ASN A 1 16 ? 0.448   -8.030  -8.501  1.00 0.00 ? 17 ASN A HD22 8  
ATOM 8520  N N    . SER A 1 17 ? 0.272   -12.535 -12.434 1.00 0.00 ? 18 SER A N    8  
ATOM 8521  C CA   . SER A 1 17 ? 0.684   -13.285 -13.647 1.00 0.00 ? 18 SER A CA   8  
ATOM 8522  C C    . SER A 1 17 ? 0.229   -14.740 -13.528 1.00 0.00 ? 18 SER A C    8  
ATOM 8523  O O    . SER A 1 17 ? 0.555   -15.573 -14.351 1.00 0.00 ? 18 SER A O    8  
ATOM 8524  C CB   . SER A 1 17 ? 2.193   -13.234 -13.770 1.00 0.00 ? 18 SER A CB   8  
ATOM 8525  O OG   . SER A 1 17 ? 2.660   -11.962 -13.344 1.00 0.00 ? 18 SER A OG   8  
ATOM 8526  H H    . SER A 1 17 ? 0.877   -12.487 -11.665 1.00 0.00 ? 18 SER A H    8  
ATOM 8527  H HA   . SER A 1 17 ? 0.247   -12.839 -14.523 1.00 0.00 ? 18 SER A HA   8  
ATOM 8528  H HB2  . SER A 1 17 ? 2.629   -13.998 -13.152 1.00 0.00 ? 18 SER A HB2  8  
ATOM 8529  H HB3  . SER A 1 17 ? 2.461   -13.403 -14.801 1.00 0.00 ? 18 SER A HB3  8  
ATOM 8530  H HG   . SER A 1 17 ? 2.193   -11.290 -13.847 1.00 0.00 ? 18 SER A HG   8  
ATOM 8531  N N    . ALA A 1 18 ? -0.525  -15.055 -12.510 1.00 0.00 ? 19 ALA A N    8  
ATOM 8532  C CA   . ALA A 1 18 ? -1.000  -16.456 -12.341 1.00 0.00 ? 19 ALA A CA   8  
ATOM 8533  C C    . ALA A 1 18 ? -2.526  -16.473 -12.251 1.00 0.00 ? 19 ALA A C    8  
ATOM 8534  O O    . ALA A 1 18 ? -3.142  -17.513 -12.328 1.00 0.00 ? 19 ALA A O    8  
ATOM 8535  C CB   . ALA A 1 18 ? -0.420  -17.047 -11.055 1.00 0.00 ? 19 ALA A CB   8  
ATOM 8536  H H    . ALA A 1 18 ? -0.777  -14.370 -11.857 1.00 0.00 ? 19 ALA A H    8  
ATOM 8537  H HA   . ALA A 1 18 ? -0.683  -17.049 -13.186 1.00 0.00 ? 19 ALA A HA   8  
ATOM 8538  H HB1  . ALA A 1 18 ? 0.582   -16.672 -10.905 1.00 0.00 ? 19 ALA A HB1  8  
ATOM 8539  H HB2  . ALA A 1 18 ? -1.041  -16.765 -10.218 1.00 0.00 ? 19 ALA A HB2  8  
ATOM 8540  H HB3  . ALA A 1 18 ? -0.394  -18.124 -11.136 1.00 0.00 ? 19 ALA A HB3  8  
ATOM 8541  N N    . ARG A 1 19 ? -3.142  -15.335 -12.078 1.00 0.00 ? 20 ARG A N    8  
ATOM 8542  C CA   . ARG A 1 19 ? -4.628  -15.310 -11.972 1.00 0.00 ? 20 ARG A CA   8  
ATOM 8543  C C    . ARG A 1 19 ? -5.249  -15.836 -13.267 1.00 0.00 ? 20 ARG A C    8  
ATOM 8544  O O    . ARG A 1 19 ? -6.368  -16.311 -13.278 1.00 0.00 ? 20 ARG A O    8  
ATOM 8545  C CB   . ARG A 1 19 ? -5.100  -13.875 -11.713 1.00 0.00 ? 20 ARG A CB   8  
ATOM 8546  C CG   . ARG A 1 19 ? -4.974  -13.049 -12.994 1.00 0.00 ? 20 ARG A CG   8  
ATOM 8547  C CD   . ARG A 1 19 ? -5.670  -11.701 -12.803 1.00 0.00 ? 20 ARG A CD   8  
ATOM 8548  N NE   . ARG A 1 19 ? -6.785  -11.577 -13.784 1.00 0.00 ? 20 ARG A NE   8  
ATOM 8549  C CZ   . ARG A 1 19 ? -7.076  -10.412 -14.298 1.00 0.00 ? 20 ARG A CZ   8  
ATOM 8550  N NH1  . ARG A 1 19 ? -7.021  -9.339  -13.558 1.00 0.00 ? 20 ARG A NH1  8  
ATOM 8551  N NH2  . ARG A 1 19 ? -7.419  -10.321 -15.554 1.00 0.00 ? 20 ARG A NH2  8  
ATOM 8552  H H    . ARG A 1 19 ? -2.630  -14.501 -12.008 1.00 0.00 ? 20 ARG A H    8  
ATOM 8553  H HA   . ARG A 1 19 ? -4.936  -15.942 -11.154 1.00 0.00 ? 20 ARG A HA   8  
ATOM 8554  H HB2  . ARG A 1 19 ? -6.131  -13.887 -11.394 1.00 0.00 ? 20 ARG A HB2  8  
ATOM 8555  H HB3  . ARG A 1 19 ? -4.490  -13.430 -10.941 1.00 0.00 ? 20 ARG A HB3  8  
ATOM 8556  H HG2  . ARG A 1 19 ? -3.928  -12.888 -13.217 1.00 0.00 ? 20 ARG A HG2  8  
ATOM 8557  H HG3  . ARG A 1 19 ? -5.438  -13.578 -13.812 1.00 0.00 ? 20 ARG A HG3  8  
ATOM 8558  H HD2  . ARG A 1 19 ? -6.065  -11.639 -11.800 1.00 0.00 ? 20 ARG A HD2  8  
ATOM 8559  H HD3  . ARG A 1 19 ? -4.961  -10.903 -12.961 1.00 0.00 ? 20 ARG A HD3  8  
ATOM 8560  H HE   . ARG A 1 19 ? -7.300  -12.369 -14.043 1.00 0.00 ? 20 ARG A HE   8  
ATOM 8561  H HH11 . ARG A 1 19 ? -6.756  -9.407  -12.596 1.00 0.00 ? 20 ARG A HH11 8  
ATOM 8562  H HH12 . ARG A 1 19 ? -7.245  -8.447  -13.953 1.00 0.00 ? 20 ARG A HH12 8  
ATOM 8563  H HH21 . ARG A 1 19 ? -7.459  -11.143 -16.122 1.00 0.00 ? 20 ARG A HH21 8  
ATOM 8564  H HH22 . ARG A 1 19 ? -7.642  -9.430  -15.948 1.00 0.00 ? 20 ARG A HH22 8  
ATOM 8565  N N    . GLU A 1 20 ? -4.539  -15.763 -14.357 1.00 0.00 ? 21 GLU A N    8  
ATOM 8566  C CA   . GLU A 1 20 ? -5.105  -16.267 -15.638 1.00 0.00 ? 21 GLU A CA   8  
ATOM 8567  C C    . GLU A 1 20 ? -4.959  -17.785 -15.695 1.00 0.00 ? 21 GLU A C    8  
ATOM 8568  O O    . GLU A 1 20 ? -5.924  -18.507 -15.846 1.00 0.00 ? 21 GLU A O    8  
ATOM 8569  C CB   . GLU A 1 20 ? -4.358  -15.635 -16.814 1.00 0.00 ? 21 GLU A CB   8  
ATOM 8570  C CG   . GLU A 1 20 ? -4.549  -14.118 -16.786 1.00 0.00 ? 21 GLU A CG   8  
ATOM 8571  C CD   . GLU A 1 20 ? -3.244  -13.431 -17.190 1.00 0.00 ? 21 GLU A CD   8  
ATOM 8572  O OE1  . GLU A 1 20 ? -2.674  -13.828 -18.192 1.00 0.00 ? 21 GLU A OE1  8  
ATOM 8573  O OE2  . GLU A 1 20 ? -2.836  -12.518 -16.491 1.00 0.00 ? 21 GLU A OE2  8  
ATOM 8574  H H    . GLU A 1 20 ? -3.639  -15.379 -14.334 1.00 0.00 ? 21 GLU A H    8  
ATOM 8575  H HA   . GLU A 1 20 ? -6.149  -16.011 -15.689 1.00 0.00 ? 21 GLU A HA   8  
ATOM 8576  H HB2  . GLU A 1 20 ? -3.305  -15.868 -16.738 1.00 0.00 ? 21 GLU A HB2  8  
ATOM 8577  H HB3  . GLU A 1 20 ? -4.748  -16.028 -17.741 1.00 0.00 ? 21 GLU A HB3  8  
ATOM 8578  H HG2  . GLU A 1 20 ? -5.332  -13.841 -17.478 1.00 0.00 ? 21 GLU A HG2  8  
ATOM 8579  H HG3  . GLU A 1 20 ? -4.823  -13.807 -15.789 1.00 0.00 ? 21 GLU A HG3  8  
ATOM 8580  N N    . SER A 1 21 ? -3.761  -18.274 -15.571 1.00 0.00 ? 22 SER A N    8  
ATOM 8581  C CA   . SER A 1 21 ? -3.554  -19.747 -15.612 1.00 0.00 ? 22 SER A CA   8  
ATOM 8582  C C    . SER A 1 21 ? -4.111  -20.370 -14.333 1.00 0.00 ? 22 SER A C    8  
ATOM 8583  O O    . SER A 1 21 ? -4.184  -21.576 -14.200 1.00 0.00 ? 22 SER A O    8  
ATOM 8584  C CB   . SER A 1 21 ? -2.060  -20.054 -15.724 1.00 0.00 ? 22 SER A CB   8  
ATOM 8585  O OG   . SER A 1 21 ? -1.696  -20.119 -17.097 1.00 0.00 ? 22 SER A OG   8  
ATOM 8586  H H    . SER A 1 21 ? -2.999  -17.673 -15.446 1.00 0.00 ? 22 SER A H    8  
ATOM 8587  H HA   . SER A 1 21 ? -4.073  -20.159 -16.465 1.00 0.00 ? 22 SER A HA   8  
ATOM 8588  H HB2  . SER A 1 21 ? -1.494  -19.274 -15.243 1.00 0.00 ? 22 SER A HB2  8  
ATOM 8589  H HB3  . SER A 1 21 ? -1.852  -20.999 -15.241 1.00 0.00 ? 22 SER A HB3  8  
ATOM 8590  H HG   . SER A 1 21 ? -1.505  -19.227 -17.395 1.00 0.00 ? 22 SER A HG   8  
ATOM 8591  N N    . ILE A 1 22 ? -4.514  -19.560 -13.393 1.00 0.00 ? 23 ILE A N    8  
ATOM 8592  C CA   . ILE A 1 22 ? -5.076  -20.108 -12.131 1.00 0.00 ? 23 ILE A CA   8  
ATOM 8593  C C    . ILE A 1 22 ? -6.580  -20.284 -12.310 1.00 0.00 ? 23 ILE A C    8  
ATOM 8594  O O    . ILE A 1 22 ? -7.153  -21.284 -11.925 1.00 0.00 ? 23 ILE A O    8  
ATOM 8595  C CB   . ILE A 1 22 ? -4.804  -19.125 -10.982 1.00 0.00 ? 23 ILE A CB   8  
ATOM 8596  C CG1  . ILE A 1 22 ? -3.397  -19.363 -10.430 1.00 0.00 ? 23 ILE A CG1  8  
ATOM 8597  C CG2  . ILE A 1 22 ? -5.827  -19.323 -9.858  1.00 0.00 ? 23 ILE A CG2  8  
ATOM 8598  C CD1  . ILE A 1 22 ? -3.080  -18.306 -9.371  1.00 0.00 ? 23 ILE A CD1  8  
ATOM 8599  H H    . ILE A 1 22 ? -4.458  -18.588 -13.521 1.00 0.00 ? 23 ILE A H    8  
ATOM 8600  H HA   . ILE A 1 22 ? -4.620  -21.062 -11.913 1.00 0.00 ? 23 ILE A HA   8  
ATOM 8601  H HB   . ILE A 1 22 ? -4.878  -18.113 -11.352 1.00 0.00 ? 23 ILE A HB   8  
ATOM 8602  H HG12 . ILE A 1 22 ? -3.348  -20.348 -9.985  1.00 0.00 ? 23 ILE A HG12 8  
ATOM 8603  H HG13 . ILE A 1 22 ? -2.678  -19.295 -11.232 1.00 0.00 ? 23 ILE A HG13 8  
ATOM 8604  H HG21 . ILE A 1 22 ? -6.829  -19.223 -10.259 1.00 0.00 ? 23 ILE A HG21 8  
ATOM 8605  H HG22 . ILE A 1 22 ? -5.706  -20.307 -9.431  1.00 0.00 ? 23 ILE A HG22 8  
ATOM 8606  H HG23 . ILE A 1 22 ? -5.668  -18.577 -9.094  1.00 0.00 ? 23 ILE A HG23 8  
ATOM 8607  H HD11 . ILE A 1 22 ? -3.951  -18.142 -8.754  1.00 0.00 ? 23 ILE A HD11 8  
ATOM 8608  H HD12 . ILE A 1 22 ? -2.262  -18.648 -8.753  1.00 0.00 ? 23 ILE A HD12 8  
ATOM 8609  H HD13 . ILE A 1 22 ? -2.803  -17.382 -9.856  1.00 0.00 ? 23 ILE A HD13 8  
ATOM 8610  N N    . LYS A 1 23 ? -7.226  -19.303 -12.872 1.00 0.00 ? 24 LYS A N    8  
ATOM 8611  C CA   . LYS A 1 23 ? -8.688  -19.390 -13.056 1.00 0.00 ? 24 LYS A CA   8  
ATOM 8612  C C    . LYS A 1 23 ? -9.032  -20.418 -14.146 1.00 0.00 ? 24 LYS A C    8  
ATOM 8613  O O    . LYS A 1 23 ? -10.179 -20.775 -14.328 1.00 0.00 ? 24 LYS A O    8  
ATOM 8614  C CB   . LYS A 1 23 ? -9.196  -17.999 -13.434 1.00 0.00 ? 24 LYS A CB   8  
ATOM 8615  C CG   . LYS A 1 23 ? -9.167  -17.820 -14.950 1.00 0.00 ? 24 LYS A CG   8  
ATOM 8616  C CD   . LYS A 1 23 ? -9.473  -16.365 -15.294 1.00 0.00 ? 24 LYS A CD   8  
ATOM 8617  C CE   . LYS A 1 23 ? -10.904 -16.030 -14.873 1.00 0.00 ? 24 LYS A CE   8  
ATOM 8618  N NZ   . LYS A 1 23 ? -11.645 -15.462 -16.034 1.00 0.00 ? 24 LYS A NZ   8  
ATOM 8619  H H    . LYS A 1 23 ? -6.748  -18.493 -13.161 1.00 0.00 ? 24 LYS A H    8  
ATOM 8620  H HA   . LYS A 1 23 ? -9.139  -19.686 -12.127 1.00 0.00 ? 24 LYS A HA   8  
ATOM 8621  H HB2  . LYS A 1 23 ? -10.205 -17.869 -13.072 1.00 0.00 ? 24 LYS A HB2  8  
ATOM 8622  H HB3  . LYS A 1 23 ? -8.550  -17.260 -12.979 1.00 0.00 ? 24 LYS A HB3  8  
ATOM 8623  H HG2  . LYS A 1 23 ? -8.187  -18.085 -15.321 1.00 0.00 ? 24 LYS A HG2  8  
ATOM 8624  H HG3  . LYS A 1 23 ? -9.909  -18.462 -15.398 1.00 0.00 ? 24 LYS A HG3  8  
ATOM 8625  H HD2  . LYS A 1 23 ? -8.782  -15.721 -14.770 1.00 0.00 ? 24 LYS A HD2  8  
ATOM 8626  H HD3  . LYS A 1 23 ? -9.368  -16.216 -16.358 1.00 0.00 ? 24 LYS A HD3  8  
ATOM 8627  H HE2  . LYS A 1 23 ? -11.400 -16.929 -14.534 1.00 0.00 ? 24 LYS A HE2  8  
ATOM 8628  H HE3  . LYS A 1 23 ? -10.884 -15.307 -14.071 1.00 0.00 ? 24 LYS A HE3  8  
ATOM 8629  H HZ1  . LYS A 1 23 ? -11.196 -15.775 -16.918 1.00 0.00 ? 24 LYS A HZ1  8  
ATOM 8630  H HZ2  . LYS A 1 23 ? -12.630 -15.792 -16.012 1.00 0.00 ? 24 LYS A HZ2  8  
ATOM 8631  H HZ3  . LYS A 1 23 ? -11.625 -14.423 -15.982 1.00 0.00 ? 24 LYS A HZ3  8  
ATOM 8632  N N    . ARG A 1 24 ? -8.056  -20.886 -14.880 1.00 0.00 ? 25 ARG A N    8  
ATOM 8633  C CA   . ARG A 1 24 ? -8.351  -21.872 -15.957 1.00 0.00 ? 25 ARG A CA   8  
ATOM 8634  C C    . ARG A 1 24 ? -7.855  -23.265 -15.560 1.00 0.00 ? 25 ARG A C    8  
ATOM 8635  O O    . ARG A 1 24 ? -8.482  -24.263 -15.861 1.00 0.00 ? 25 ARG A O    8  
ATOM 8636  C CB   . ARG A 1 24 ? -7.660  -21.436 -17.250 1.00 0.00 ? 25 ARG A CB   8  
ATOM 8637  C CG   . ARG A 1 24 ? -8.243  -20.099 -17.713 1.00 0.00 ? 25 ARG A CG   8  
ATOM 8638  C CD   . ARG A 1 24 ? -7.246  -19.391 -18.620 1.00 0.00 ? 25 ARG A CD   8  
ATOM 8639  N NE   . ARG A 1 24 ? -6.499  -20.396 -19.428 1.00 0.00 ? 25 ARG A NE   8  
ATOM 8640  C CZ   . ARG A 1 24 ? -6.405  -20.250 -20.721 1.00 0.00 ? 25 ARG A CZ   8  
ATOM 8641  N NH1  . ARG A 1 24 ? -6.285  -19.058 -21.237 1.00 0.00 ? 25 ARG A NH1  8  
ATOM 8642  N NH2  . ARG A 1 24 ? -6.433  -21.297 -21.501 1.00 0.00 ? 25 ARG A NH2  8  
ATOM 8643  H H    . ARG A 1 24 ? -7.138  -20.584 -14.732 1.00 0.00 ? 25 ARG A H    8  
ATOM 8644  H HA   . ARG A 1 24 ? -9.415  -21.906 -16.120 1.00 0.00 ? 25 ARG A HA   8  
ATOM 8645  H HB2  . ARG A 1 24 ? -6.599  -21.326 -17.072 1.00 0.00 ? 25 ARG A HB2  8  
ATOM 8646  H HB3  . ARG A 1 24 ? -7.822  -22.181 -18.015 1.00 0.00 ? 25 ARG A HB3  8  
ATOM 8647  H HG2  . ARG A 1 24 ? -9.157  -20.271 -18.255 1.00 0.00 ? 25 ARG A HG2  8  
ATOM 8648  H HG3  . ARG A 1 24 ? -8.442  -19.478 -16.855 1.00 0.00 ? 25 ARG A HG3  8  
ATOM 8649  H HD2  . ARG A 1 24 ? -7.782  -18.725 -19.278 1.00 0.00 ? 25 ARG A HD2  8  
ATOM 8650  H HD3  . ARG A 1 24 ? -6.556  -18.826 -18.016 1.00 0.00 ? 25 ARG A HD3  8  
ATOM 8651  H HE   . ARG A 1 24 ? -6.079  -21.165 -18.989 1.00 0.00 ? 25 ARG A HE   8  
ATOM 8652  H HH11 . ARG A 1 24 ? -6.266  -18.255 -20.641 1.00 0.00 ? 25 ARG A HH11 8  
ATOM 8653  H HH12 . ARG A 1 24 ? -6.211  -18.946 -22.228 1.00 0.00 ? 25 ARG A HH12 8  
ATOM 8654  H HH21 . ARG A 1 24 ? -6.528  -22.211 -21.107 1.00 0.00 ? 25 ARG A HH21 8  
ATOM 8655  H HH22 . ARG A 1 24 ? -6.360  -21.184 -22.492 1.00 0.00 ? 25 ARG A HH22 8  
ATOM 8656  N N    . GLU A 1 25 ? -6.733  -23.349 -14.899 1.00 0.00 ? 26 GLU A N    8  
ATOM 8657  C CA   . GLU A 1 25 ? -6.205  -24.687 -14.502 1.00 0.00 ? 26 GLU A CA   8  
ATOM 8658  C C    . GLU A 1 25 ? -6.926  -25.183 -13.243 1.00 0.00 ? 26 GLU A C    8  
ATOM 8659  O O    . GLU A 1 25 ? -6.563  -26.189 -12.668 1.00 0.00 ? 26 GLU A O    8  
ATOM 8660  C CB   . GLU A 1 25 ? -4.703  -24.581 -14.228 1.00 0.00 ? 26 GLU A CB   8  
ATOM 8661  C CG   . GLU A 1 25 ? -4.468  -23.900 -12.879 1.00 0.00 ? 26 GLU A CG   8  
ATOM 8662  C CD   . GLU A 1 25 ? -3.018  -23.420 -12.796 1.00 0.00 ? 26 GLU A CD   8  
ATOM 8663  O OE1  . GLU A 1 25 ? -2.338  -23.474 -13.807 1.00 0.00 ? 26 GLU A OE1  8  
ATOM 8664  O OE2  . GLU A 1 25 ? -2.612  -23.006 -11.723 1.00 0.00 ? 26 GLU A OE2  8  
ATOM 8665  H H    . GLU A 1 25 ? -6.235  -22.539 -14.672 1.00 0.00 ? 26 GLU A H    8  
ATOM 8666  H HA   . GLU A 1 25 ? -6.371  -25.387 -15.307 1.00 0.00 ? 26 GLU A HA   8  
ATOM 8667  H HB2  . GLU A 1 25 ? -4.269  -25.571 -14.213 1.00 0.00 ? 26 GLU A HB2  8  
ATOM 8668  H HB3  . GLU A 1 25 ? -4.237  -23.996 -15.008 1.00 0.00 ? 26 GLU A HB3  8  
ATOM 8669  H HG2  . GLU A 1 25 ? -5.134  -23.056 -12.780 1.00 0.00 ? 26 GLU A HG2  8  
ATOM 8670  H HG3  . GLU A 1 25 ? -4.658  -24.604 -12.082 1.00 0.00 ? 26 GLU A HG3  8  
ATOM 8671  N N    . ASN A 1 26 ? -7.943  -24.488 -12.813 1.00 0.00 ? 27 ASN A N    8  
ATOM 8672  C CA   . ASN A 1 26 ? -8.680  -24.925 -11.593 1.00 0.00 ? 27 ASN A CA   8  
ATOM 8673  C C    . ASN A 1 26 ? -10.103 -25.336 -11.970 1.00 0.00 ? 27 ASN A C    8  
ATOM 8674  O O    . ASN A 1 26 ? -10.674 -24.812 -12.905 1.00 0.00 ? 27 ASN A O    8  
ATOM 8675  C CB   . ASN A 1 26 ? -8.734  -23.773 -10.589 1.00 0.00 ? 27 ASN A CB   8  
ATOM 8676  C CG   . ASN A 1 26 ? -7.332  -23.515 -10.037 1.00 0.00 ? 27 ASN A CG   8  
ATOM 8677  O OD1  . ASN A 1 26 ? -6.530  -24.423 -9.937  1.00 0.00 ? 27 ASN A OD1  8  
ATOM 8678  N ND2  . ASN A 1 26 ? -6.998  -22.308 -9.674  1.00 0.00 ? 27 ASN A ND2  8  
ATOM 8679  H H    . ASN A 1 26 ? -8.223  -23.679 -13.289 1.00 0.00 ? 27 ASN A H    8  
ATOM 8680  H HA   . ASN A 1 26 ? -8.174  -25.768 -11.145 1.00 0.00 ? 27 ASN A HA   8  
ATOM 8681  H HB2  . ASN A 1 26 ? -9.098  -22.882 -11.080 1.00 0.00 ? 27 ASN A HB2  8  
ATOM 8682  H HB3  . ASN A 1 26 ? -9.396  -24.033 -9.775  1.00 0.00 ? 27 ASN A HB3  8  
ATOM 8683  H HD21 . ASN A 1 26 ? -7.645  -21.576 -9.756  1.00 0.00 ? 27 ASN A HD21 8  
ATOM 8684  H HD22 . ASN A 1 26 ? -6.103  -22.133 -9.317  1.00 0.00 ? 27 ASN A HD22 8  
ATOM 8685  N N    . PRO A 1 27 ? -10.634 -26.266 -11.219 1.00 0.00 ? 28 PRO A N    8  
ATOM 8686  C CA   . PRO A 1 27 ? -11.993 -26.783 -11.430 1.00 0.00 ? 28 PRO A CA   8  
ATOM 8687  C C    . PRO A 1 27 ? -13.026 -25.798 -10.889 1.00 0.00 ? 28 PRO A C    8  
ATOM 8688  O O    . PRO A 1 27 ? -13.664 -26.050 -9.886  1.00 0.00 ? 28 PRO A O    8  
ATOM 8689  C CB   . PRO A 1 27 ? -12.018 -28.078 -10.635 1.00 0.00 ? 28 PRO A CB   8  
ATOM 8690  C CG   . PRO A 1 27 ? -10.903 -27.965 -9.590  1.00 0.00 ? 28 PRO A CG   8  
ATOM 8691  C CD   . PRO A 1 27 ? -9.925  -26.891 -10.088 1.00 0.00 ? 28 PRO A CD   8  
ATOM 8692  H HA   . PRO A 1 27 ? -12.158 -26.996 -12.455 1.00 0.00 ? 28 PRO A HA   8  
ATOM 8693  H HB2  . PRO A 1 27 ? -12.977 -28.189 -10.144 1.00 0.00 ? 28 PRO A HB2  8  
ATOM 8694  H HB3  . PRO A 1 27 ? -11.826 -28.917 -11.282 1.00 0.00 ? 28 PRO A HB3  8  
ATOM 8695  H HG2  . PRO A 1 27 ? -11.325 -27.673 -8.647  1.00 0.00 ? 28 PRO A HG2  8  
ATOM 8696  H HG3  . PRO A 1 27 ? -10.396 -28.904 -9.504  1.00 0.00 ? 28 PRO A HG3  8  
ATOM 8697  H HD2  . PRO A 1 27 ? -9.732  -26.165 -9.311  1.00 0.00 ? 28 PRO A HD2  8  
ATOM 8698  H HD3  . PRO A 1 27 ? -9.006  -27.342 -10.428 1.00 0.00 ? 28 PRO A HD3  8  
ATOM 8699  N N    . GLY A 1 28 ? -13.190 -24.672 -11.529 1.00 0.00 ? 29 GLY A N    8  
ATOM 8700  C CA   . GLY A 1 28 ? -14.174 -23.679 -11.020 1.00 0.00 ? 29 GLY A CA   8  
ATOM 8701  C C    . GLY A 1 28 ? -13.968 -23.539 -9.514  1.00 0.00 ? 29 GLY A C    8  
ATOM 8702  O O    . GLY A 1 28 ? -14.880 -23.225 -8.775  1.00 0.00 ? 29 GLY A O    8  
ATOM 8703  H H    . GLY A 1 28 ? -12.661 -24.477 -12.331 1.00 0.00 ? 29 GLY A H    8  
ATOM 8704  H HA2  . GLY A 1 28 ? -14.013 -22.726 -11.505 1.00 0.00 ? 29 GLY A HA2  8  
ATOM 8705  H HA3  . GLY A 1 28 ? -15.177 -24.024 -11.215 1.00 0.00 ? 29 GLY A HA3  8  
ATOM 8706  N N    . ILE A 1 29 ? -12.768 -23.791 -9.062  1.00 0.00 ? 30 ILE A N    8  
ATOM 8707  C CA   . ILE A 1 29 ? -12.464 -23.698 -7.614  1.00 0.00 ? 30 ILE A CA   8  
ATOM 8708  C C    . ILE A 1 29 ? -13.207 -22.515 -6.990  1.00 0.00 ? 30 ILE A C    8  
ATOM 8709  O O    . ILE A 1 29 ? -13.440 -21.509 -7.630  1.00 0.00 ? 30 ILE A O    8  
ATOM 8710  C CB   . ILE A 1 29 ? -10.966 -23.517 -7.448  1.00 0.00 ? 30 ILE A CB   8  
ATOM 8711  C CG1  . ILE A 1 29 ? -10.605 -23.466 -5.963  1.00 0.00 ? 30 ILE A CG1  8  
ATOM 8712  C CG2  . ILE A 1 29 ? -10.570 -22.217 -8.116  1.00 0.00 ? 30 ILE A CG2  8  
ATOM 8713  C CD1  . ILE A 1 29 ? -9.087  -23.566 -5.805  1.00 0.00 ? 30 ILE A CD1  8  
ATOM 8714  H H    . ILE A 1 29 ? -12.057 -24.051 -9.685  1.00 0.00 ? 30 ILE A H    8  
ATOM 8715  H HA   . ILE A 1 29 ? -12.759 -24.602 -7.135  1.00 0.00 ? 30 ILE A HA   8  
ATOM 8716  H HB   . ILE A 1 29 ? -10.453 -24.338 -7.926  1.00 0.00 ? 30 ILE A HB   8  
ATOM 8717  H HG12 . ILE A 1 29 ? -10.952 -22.533 -5.540  1.00 0.00 ? 30 ILE A HG12 8  
ATOM 8718  H HG13 . ILE A 1 29 ? -11.075 -24.290 -5.449  1.00 0.00 ? 30 ILE A HG13 8  
ATOM 8719  H HG21 . ILE A 1 29 ? -11.359 -21.499 -7.970  1.00 0.00 ? 30 ILE A HG21 8  
ATOM 8720  H HG22 . ILE A 1 29 ? -9.655  -21.850 -7.680  1.00 0.00 ? 30 ILE A HG22 8  
ATOM 8721  H HG23 . ILE A 1 29 ? -10.431 -22.389 -9.170  1.00 0.00 ? 30 ILE A HG23 8  
ATOM 8722  H HD11 . ILE A 1 29 ? -8.624  -23.594 -6.781  1.00 0.00 ? 30 ILE A HD11 8  
ATOM 8723  H HD12 . ILE A 1 29 ? -8.724  -22.707 -5.259  1.00 0.00 ? 30 ILE A HD12 8  
ATOM 8724  H HD13 . ILE A 1 29 ? -8.840  -24.467 -5.263  1.00 0.00 ? 30 ILE A HD13 8  
ATOM 8725  N N    . LYS A 1 30 ? -13.581 -22.628 -5.745  1.00 0.00 ? 31 LYS A N    8  
ATOM 8726  C CA   . LYS A 1 30 ? -14.312 -21.512 -5.082  1.00 0.00 ? 31 LYS A CA   8  
ATOM 8727  C C    . LYS A 1 30 ? -13.508 -20.218 -5.225  1.00 0.00 ? 31 LYS A C    8  
ATOM 8728  O O    . LYS A 1 30 ? -12.310 -20.239 -5.431  1.00 0.00 ? 31 LYS A O    8  
ATOM 8729  C CB   . LYS A 1 30 ? -14.498 -21.835 -3.599  1.00 0.00 ? 31 LYS A CB   8  
ATOM 8730  C CG   . LYS A 1 30 ? -15.888 -22.435 -3.376  1.00 0.00 ? 31 LYS A CG   8  
ATOM 8731  C CD   . LYS A 1 30 ? -15.801 -23.961 -3.427  1.00 0.00 ? 31 LYS A CD   8  
ATOM 8732  C CE   . LYS A 1 30 ? -15.481 -24.504 -2.033  1.00 0.00 ? 31 LYS A CE   8  
ATOM 8733  N NZ   . LYS A 1 30 ? -16.140 -25.829 -1.850  1.00 0.00 ? 31 LYS A NZ   8  
ATOM 8734  H H    . LYS A 1 30 ? -13.385 -23.449 -5.247  1.00 0.00 ? 31 LYS A H    8  
ATOM 8735  H HA   . LYS A 1 30 ? -15.276 -21.390 -5.545  1.00 0.00 ? 31 LYS A HA   8  
ATOM 8736  H HB2  . LYS A 1 30 ? -13.747 -22.546 -3.293  1.00 0.00 ? 31 LYS A HB2  8  
ATOM 8737  H HB3  . LYS A 1 30 ? -14.400 -20.932 -3.018  1.00 0.00 ? 31 LYS A HB3  8  
ATOM 8738  H HG2  . LYS A 1 30 ? -16.261 -22.126 -2.410  1.00 0.00 ? 31 LYS A HG2  8  
ATOM 8739  H HG3  . LYS A 1 30 ? -16.558 -22.089 -4.148  1.00 0.00 ? 31 LYS A HG3  8  
ATOM 8740  H HD2  . LYS A 1 30 ? -16.745 -24.364 -3.762  1.00 0.00 ? 31 LYS A HD2  8  
ATOM 8741  H HD3  . LYS A 1 30 ? -15.020 -24.254 -4.113  1.00 0.00 ? 31 LYS A HD3  8  
ATOM 8742  H HE2  . LYS A 1 30 ? -14.412 -24.617 -1.927  1.00 0.00 ? 31 LYS A HE2  8  
ATOM 8743  H HE3  . LYS A 1 30 ? -15.845 -23.815 -1.285  1.00 0.00 ? 31 LYS A HE3  8  
ATOM 8744  H HZ1  . LYS A 1 30 ? -16.596 -26.115 -2.741  1.00 0.00 ? 31 LYS A HZ1  8  
ATOM 8745  H HZ2  . LYS A 1 30 ? -15.427 -26.537 -1.582  1.00 0.00 ? 31 LYS A HZ2  8  
ATOM 8746  H HZ3  . LYS A 1 30 ? -16.857 -25.760 -1.100  1.00 0.00 ? 31 LYS A HZ3  8  
ATOM 8747  N N    . VAL A 1 31 ? -14.156 -19.090 -5.114  1.00 0.00 ? 32 VAL A N    8  
ATOM 8748  C CA   . VAL A 1 31 ? -13.439 -17.802 -5.240  1.00 0.00 ? 32 VAL A CA   8  
ATOM 8749  C C    . VAL A 1 31 ? -12.570 -17.588 -3.994  1.00 0.00 ? 32 VAL A C    8  
ATOM 8750  O O    . VAL A 1 31 ? -11.567 -16.904 -4.035  1.00 0.00 ? 32 VAL A O    8  
ATOM 8751  C CB   . VAL A 1 31 ? -14.459 -16.671 -5.392  1.00 0.00 ? 32 VAL A CB   8  
ATOM 8752  C CG1  . VAL A 1 31 ? -15.682 -16.983 -4.551  1.00 0.00 ? 32 VAL A CG1  8  
ATOM 8753  C CG2  . VAL A 1 31 ? -13.858 -15.361 -4.915  1.00 0.00 ? 32 VAL A CG2  8  
ATOM 8754  H H    . VAL A 1 31 ? -15.113 -19.090 -4.948  1.00 0.00 ? 32 VAL A H    8  
ATOM 8755  H HA   . VAL A 1 31 ? -12.821 -17.830 -6.107  1.00 0.00 ? 32 VAL A HA   8  
ATOM 8756  H HB   . VAL A 1 31 ? -14.747 -16.585 -6.429  1.00 0.00 ? 32 VAL A HB   8  
ATOM 8757  H HG11 . VAL A 1 31 ? -15.400 -17.675 -3.776  1.00 0.00 ? 32 VAL A HG11 8  
ATOM 8758  H HG12 . VAL A 1 31 ? -16.063 -16.075 -4.112  1.00 0.00 ? 32 VAL A HG12 8  
ATOM 8759  H HG13 . VAL A 1 31 ? -16.437 -17.432 -5.177  1.00 0.00 ? 32 VAL A HG13 8  
ATOM 8760  H HG21 . VAL A 1 31 ? -12.864 -15.257 -5.317  1.00 0.00 ? 32 VAL A HG21 8  
ATOM 8761  H HG22 . VAL A 1 31 ? -14.474 -14.542 -5.245  1.00 0.00 ? 32 VAL A HG22 8  
ATOM 8762  H HG23 . VAL A 1 31 ? -13.814 -15.373 -3.838  1.00 0.00 ? 32 VAL A HG23 8  
ATOM 8763  N N    . THR A 1 32 ? -12.951 -18.169 -2.890  1.00 0.00 ? 33 THR A N    8  
ATOM 8764  C CA   . THR A 1 32 ? -12.149 -18.002 -1.644  1.00 0.00 ? 33 THR A CA   8  
ATOM 8765  C C    . THR A 1 32 ? -11.044 -19.059 -1.606  1.00 0.00 ? 33 THR A C    8  
ATOM 8766  O O    . THR A 1 32 ? -9.997  -18.855 -1.023  1.00 0.00 ? 33 THR A O    8  
ATOM 8767  C CB   . THR A 1 32 ? -13.060 -18.175 -0.428  1.00 0.00 ? 33 THR A CB   8  
ATOM 8768  O OG1  . THR A 1 32 ? -13.872 -19.327 -0.607  1.00 0.00 ? 33 THR A OG1  8  
ATOM 8769  C CG2  . THR A 1 32 ? -13.950 -16.940 -0.274  1.00 0.00 ? 33 THR A CG2  8  
ATOM 8770  H H    . THR A 1 32 ? -13.763 -18.716 -2.879  1.00 0.00 ? 33 THR A H    8  
ATOM 8771  H HA   . THR A 1 32 ? -11.708 -17.017 -1.629  1.00 0.00 ? 33 THR A HA   8  
ATOM 8772  H HB   . THR A 1 32 ? -12.458 -18.292 0.460   1.00 0.00 ? 33 THR A HB   8  
ATOM 8773  H HG1  . THR A 1 32 ? -13.294 -20.075 -0.776  1.00 0.00 ? 33 THR A HG1  8  
ATOM 8774  H HG21 . THR A 1 32 ? -14.460 -16.746 -1.205  1.00 0.00 ? 33 THR A HG21 8  
ATOM 8775  H HG22 . THR A 1 32 ? -14.676 -17.114 0.505   1.00 0.00 ? 33 THR A HG22 8  
ATOM 8776  H HG23 . THR A 1 32 ? -13.339 -16.088 -0.013  1.00 0.00 ? 33 THR A HG23 8  
ATOM 8777  N N    . GLU A 1 33 ? -11.269 -20.188 -2.222  1.00 0.00 ? 34 GLU A N    8  
ATOM 8778  C CA   . GLU A 1 33 ? -10.231 -21.255 -2.220  1.00 0.00 ? 34 GLU A CA   8  
ATOM 8779  C C    . GLU A 1 33 ? -9.179  -20.940 -3.284  1.00 0.00 ? 34 GLU A C    8  
ATOM 8780  O O    . GLU A 1 33 ? -8.118  -21.533 -3.318  1.00 0.00 ? 34 GLU A O    8  
ATOM 8781  C CB   . GLU A 1 33 ? -10.885 -22.604 -2.530  1.00 0.00 ? 34 GLU A CB   8  
ATOM 8782  C CG   . GLU A 1 33 ? -11.667 -23.086 -1.307  1.00 0.00 ? 34 GLU A CG   8  
ATOM 8783  C CD   . GLU A 1 33 ? -11.359 -24.561 -1.052  1.00 0.00 ? 34 GLU A CD   8  
ATOM 8784  O OE1  . GLU A 1 33 ? -10.324 -24.837 -0.467  1.00 0.00 ? 34 GLU A OE1  8  
ATOM 8785  O OE2  . GLU A 1 33 ? -12.163 -25.390 -1.445  1.00 0.00 ? 34 GLU A OE2  8  
ATOM 8786  H H    . GLU A 1 33 ? -12.120 -20.332 -2.685  1.00 0.00 ? 34 GLU A H    8  
ATOM 8787  H HA   . GLU A 1 33 ? -9.760  -21.298 -1.249  1.00 0.00 ? 34 GLU A HA   8  
ATOM 8788  H HB2  . GLU A 1 33 ? -11.558 -22.492 -3.369  1.00 0.00 ? 34 GLU A HB2  8  
ATOM 8789  H HB3  . GLU A 1 33 ? -10.121 -23.328 -2.775  1.00 0.00 ? 34 GLU A HB3  8  
ATOM 8790  H HG2  . GLU A 1 33 ? -11.380 -22.502 -0.444  1.00 0.00 ? 34 GLU A HG2  8  
ATOM 8791  H HG3  . GLU A 1 33 ? -12.725 -22.966 -1.486  1.00 0.00 ? 34 GLU A HG3  8  
ATOM 8792  N N    . VAL A 1 34 ? -9.463  -20.009 -4.152  1.00 0.00 ? 35 VAL A N    8  
ATOM 8793  C CA   . VAL A 1 34 ? -8.481  -19.655 -5.210  1.00 0.00 ? 35 VAL A CA   8  
ATOM 8794  C C    . VAL A 1 34 ? -7.318  -18.887 -4.586  1.00 0.00 ? 35 VAL A C    8  
ATOM 8795  O O    . VAL A 1 34 ? -6.166  -19.239 -4.750  1.00 0.00 ? 35 VAL A O    8  
ATOM 8796  C CB   . VAL A 1 34 ? -9.166  -18.785 -6.257  1.00 0.00 ? 35 VAL A CB   8  
ATOM 8797  C CG1  . VAL A 1 34 ? -8.114  -18.168 -7.182  1.00 0.00 ? 35 VAL A CG1  8  
ATOM 8798  C CG2  . VAL A 1 34 ? -10.132 -19.640 -7.081  1.00 0.00 ? 35 VAL A CG2  8  
ATOM 8799  H H    . VAL A 1 34 ? -10.324 -19.541 -4.106  1.00 0.00 ? 35 VAL A H    8  
ATOM 8800  H HA   . VAL A 1 34 ? -8.114  -20.550 -5.675  1.00 0.00 ? 35 VAL A HA   8  
ATOM 8801  H HB   . VAL A 1 34 ? -9.713  -18.003 -5.760  1.00 0.00 ? 35 VAL A HB   8  
ATOM 8802  H HG11 . VAL A 1 34 ? -7.152  -18.612 -6.976  1.00 0.00 ? 35 VAL A HG11 8  
ATOM 8803  H HG12 . VAL A 1 34 ? -8.385  -18.356 -8.210  1.00 0.00 ? 35 VAL A HG12 8  
ATOM 8804  H HG13 . VAL A 1 34 ? -8.065  -17.103 -7.011  1.00 0.00 ? 35 VAL A HG13 8  
ATOM 8805  H HG21 . VAL A 1 34 ? -10.414 -20.514 -6.512  1.00 0.00 ? 35 VAL A HG21 8  
ATOM 8806  H HG22 . VAL A 1 34 ? -11.015 -19.063 -7.314  1.00 0.00 ? 35 VAL A HG22 8  
ATOM 8807  H HG23 . VAL A 1 34 ? -9.650  -19.947 -7.998  1.00 0.00 ? 35 VAL A HG23 8  
ATOM 8808  N N    . ALA A 1 35 ? -7.613  -17.840 -3.870  1.00 0.00 ? 36 ALA A N    8  
ATOM 8809  C CA   . ALA A 1 35 ? -6.529  -17.044 -3.229  1.00 0.00 ? 36 ALA A CA   8  
ATOM 8810  C C    . ALA A 1 35 ? -5.748  -17.934 -2.261  1.00 0.00 ? 36 ALA A C    8  
ATOM 8811  O O    . ALA A 1 35 ? -4.547  -17.807 -2.119  1.00 0.00 ? 36 ALA A O    8  
ATOM 8812  C CB   . ALA A 1 35 ? -7.140  -15.870 -2.462  1.00 0.00 ? 36 ALA A CB   8  
ATOM 8813  H H    . ALA A 1 35 ? -8.548  -17.579 -3.752  1.00 0.00 ? 36 ALA A H    8  
ATOM 8814  H HA   . ALA A 1 35 ? -5.860  -16.668 -3.989  1.00 0.00 ? 36 ALA A HA   8  
ATOM 8815  H HB1  . ALA A 1 35 ? -8.166  -15.735 -2.768  1.00 0.00 ? 36 ALA A HB1  8  
ATOM 8816  H HB2  . ALA A 1 35 ? -7.105  -16.076 -1.401  1.00 0.00 ? 36 ALA A HB2  8  
ATOM 8817  H HB3  . ALA A 1 35 ? -6.580  -14.971 -2.672  1.00 0.00 ? 36 ALA A HB3  8  
ATOM 8818  N N    . LYS A 1 36 ? -6.415  -18.839 -1.596  1.00 0.00 ? 37 LYS A N    8  
ATOM 8819  C CA   . LYS A 1 36 ? -5.706  -19.735 -0.646  1.00 0.00 ? 37 LYS A CA   8  
ATOM 8820  C C    . LYS A 1 36 ? -4.677  -20.567 -1.416  1.00 0.00 ? 37 LYS A C    8  
ATOM 8821  O O    . LYS A 1 36 ? -3.550  -20.732 -0.991  1.00 0.00 ? 37 LYS A O    8  
ATOM 8822  C CB   . LYS A 1 36 ? -6.732  -20.636 0.034   1.00 0.00 ? 37 LYS A CB   8  
ATOM 8823  C CG   . LYS A 1 36 ? -6.078  -21.940 0.507   1.00 0.00 ? 37 LYS A CG   8  
ATOM 8824  C CD   . LYS A 1 36 ? -7.099  -22.773 1.285   1.00 0.00 ? 37 LYS A CD   8  
ATOM 8825  C CE   . LYS A 1 36 ? -6.706  -22.813 2.762   1.00 0.00 ? 37 LYS A CE   8  
ATOM 8826  N NZ   . LYS A 1 36 ? -5.884  -24.029 3.028   1.00 0.00 ? 37 LYS A NZ   8  
ATOM 8827  H H    . LYS A 1 36 ? -7.382  -18.933 -1.723  1.00 0.00 ? 37 LYS A H    8  
ATOM 8828  H HA   . LYS A 1 36 ? -5.211  -19.144 0.101   1.00 0.00 ? 37 LYS A HA   8  
ATOM 8829  H HB2  . LYS A 1 36 ? -7.134  -20.110 0.884   1.00 0.00 ? 37 LYS A HB2  8  
ATOM 8830  H HB3  . LYS A 1 36 ? -7.525  -20.858 -0.662  1.00 0.00 ? 37 LYS A HB3  8  
ATOM 8831  H HG2  . LYS A 1 36 ? -5.732  -22.499 -0.350  1.00 0.00 ? 37 LYS A HG2  8  
ATOM 8832  H HG3  . LYS A 1 36 ? -5.240  -21.710 1.149   1.00 0.00 ? 37 LYS A HG3  8  
ATOM 8833  H HD2  . LYS A 1 36 ? -8.077  -22.327 1.184   1.00 0.00 ? 37 LYS A HD2  8  
ATOM 8834  H HD3  . LYS A 1 36 ? -7.117  -23.777 0.891   1.00 0.00 ? 37 LYS A HD3  8  
ATOM 8835  H HE2  . LYS A 1 36 ? -6.133  -21.931 3.007   1.00 0.00 ? 37 LYS A HE2  8  
ATOM 8836  H HE3  . LYS A 1 36 ? -7.598  -22.842 3.370   1.00 0.00 ? 37 LYS A HE3  8  
ATOM 8837  H HZ1  . LYS A 1 36 ? -5.719  -24.537 2.137   1.00 0.00 ? 37 LYS A HZ1  8  
ATOM 8838  H HZ2  . LYS A 1 36 ? -4.972  -23.747 3.439   1.00 0.00 ? 37 LYS A HZ2  8  
ATOM 8839  H HZ3  . LYS A 1 36 ? -6.389  -24.649 3.694   1.00 0.00 ? 37 LYS A HZ3  8  
ATOM 8840  N N    . ARG A 1 37 ? -5.060  -21.086 -2.548  1.00 0.00 ? 38 ARG A N    8  
ATOM 8841  C CA   . ARG A 1 37 ? -4.110  -21.900 -3.355  1.00 0.00 ? 38 ARG A CA   8  
ATOM 8842  C C    . ARG A 1 37 ? -2.995  -20.995 -3.878  1.00 0.00 ? 38 ARG A C    8  
ATOM 8843  O O    . ARG A 1 37 ? -1.899  -21.439 -4.155  1.00 0.00 ? 38 ARG A O    8  
ATOM 8844  C CB   . ARG A 1 37 ? -4.857  -22.529 -4.533  1.00 0.00 ? 38 ARG A CB   8  
ATOM 8845  C CG   . ARG A 1 37 ? -4.766  -24.053 -4.439  1.00 0.00 ? 38 ARG A CG   8  
ATOM 8846  C CD   . ARG A 1 37 ? -5.816  -24.566 -3.453  1.00 0.00 ? 38 ARG A CD   8  
ATOM 8847  N NE   . ARG A 1 37 ? -5.281  -25.751 -2.727  1.00 0.00 ? 38 ARG A NE   8  
ATOM 8848  C CZ   . ARG A 1 37 ? -6.042  -26.404 -1.891  1.00 0.00 ? 38 ARG A CZ   8  
ATOM 8849  N NH1  . ARG A 1 37 ? -7.165  -26.925 -2.304  1.00 0.00 ? 38 ARG A NH1  8  
ATOM 8850  N NH2  . ARG A 1 37 ? -5.683  -26.534 -0.643  1.00 0.00 ? 38 ARG A NH2  8  
ATOM 8851  H H    . ARG A 1 37 ? -5.972  -20.934 -2.871  1.00 0.00 ? 38 ARG A H    8  
ATOM 8852  H HA   . ARG A 1 37 ? -3.684  -22.677 -2.738  1.00 0.00 ? 38 ARG A HA   8  
ATOM 8853  H HB2  . ARG A 1 37 ? -5.893  -22.226 -4.502  1.00 0.00 ? 38 ARG A HB2  8  
ATOM 8854  H HB3  . ARG A 1 37 ? -4.413  -22.200 -5.460  1.00 0.00 ? 38 ARG A HB3  8  
ATOM 8855  H HG2  . ARG A 1 37 ? -4.946  -24.484 -5.414  1.00 0.00 ? 38 ARG A HG2  8  
ATOM 8856  H HG3  . ARG A 1 37 ? -3.783  -24.335 -4.095  1.00 0.00 ? 38 ARG A HG3  8  
ATOM 8857  H HD2  . ARG A 1 37 ? -6.054  -23.787 -2.743  1.00 0.00 ? 38 ARG A HD2  8  
ATOM 8858  H HD3  . ARG A 1 37 ? -6.710  -24.847 -3.992  1.00 0.00 ? 38 ARG A HD3  8  
ATOM 8859  H HE   . ARG A 1 37 ? -4.357  -26.042 -2.878  1.00 0.00 ? 38 ARG A HE   8  
ATOM 8860  H HH11 . ARG A 1 37 ? -7.442  -26.826 -3.259  1.00 0.00 ? 38 ARG A HH11 8  
ATOM 8861  H HH12 . ARG A 1 37 ? -7.749  -27.425 -1.664  1.00 0.00 ? 38 ARG A HH12 8  
ATOM 8862  H HH21 . ARG A 1 37 ? -4.823  -26.134 -0.325  1.00 0.00 ? 38 ARG A HH21 8  
ATOM 8863  H HH22 . ARG A 1 37 ? -6.267  -27.034 -0.004  1.00 0.00 ? 38 ARG A HH22 8  
ATOM 8864  N N    . GLY A 1 38 ? -3.264  -19.724 -4.012  1.00 0.00 ? 39 GLY A N    8  
ATOM 8865  C CA   . GLY A 1 38 ? -2.220  -18.789 -4.512  1.00 0.00 ? 39 GLY A CA   8  
ATOM 8866  C C    . GLY A 1 38 ? -1.092  -18.688 -3.483  1.00 0.00 ? 39 GLY A C    8  
ATOM 8867  O O    . GLY A 1 38 ? 0.062   -18.526 -3.825  1.00 0.00 ? 39 GLY A O    8  
ATOM 8868  H H    . GLY A 1 38 ? -4.155  -19.386 -3.779  1.00 0.00 ? 39 GLY A H    8  
ATOM 8869  H HA2  . GLY A 1 38 ? -1.824  -19.158 -5.447  1.00 0.00 ? 39 GLY A HA2  8  
ATOM 8870  H HA3  . GLY A 1 38 ? -2.653  -17.812 -4.663  1.00 0.00 ? 39 GLY A HA3  8  
ATOM 8871  N N    . GLY A 1 39 ? -1.417  -18.782 -2.221  1.00 0.00 ? 40 GLY A N    8  
ATOM 8872  C CA   . GLY A 1 39 ? -0.361  -18.693 -1.172  1.00 0.00 ? 40 GLY A CA   8  
ATOM 8873  C C    . GLY A 1 39 ? 0.525   -19.940 -1.232  1.00 0.00 ? 40 GLY A C    8  
ATOM 8874  O O    . GLY A 1 39 ? 1.713   -19.881 -0.980  1.00 0.00 ? 40 GLY A O    8  
ATOM 8875  H H    . GLY A 1 39 ? -2.353  -18.913 -1.964  1.00 0.00 ? 40 GLY A H    8  
ATOM 8876  H HA2  . GLY A 1 39 ? 0.241   -17.813 -1.342  1.00 0.00 ? 40 GLY A HA2  8  
ATOM 8877  H HA3  . GLY A 1 39 ? -0.824  -18.631 -0.198  1.00 0.00 ? 40 GLY A HA3  8  
ATOM 8878  N N    . GLU A 1 40 ? -0.042  -21.066 -1.565  1.00 0.00 ? 41 GLU A N    8  
ATOM 8879  C CA   . GLU A 1 40 ? 0.765   -22.315 -1.642  1.00 0.00 ? 41 GLU A CA   8  
ATOM 8880  C C    . GLU A 1 40 ? 1.629   -22.293 -2.904  1.00 0.00 ? 41 GLU A C    8  
ATOM 8881  O O    . GLU A 1 40 ? 2.841   -22.312 -2.838  1.00 0.00 ? 41 GLU A O    8  
ATOM 8882  C CB   . GLU A 1 40 ? -0.162  -23.517 -1.680  1.00 0.00 ? 41 GLU A CB   8  
ATOM 8883  C CG   . GLU A 1 40 ? -1.229  -23.377 -0.592  1.00 0.00 ? 41 GLU A CG   8  
ATOM 8884  C CD   . GLU A 1 40 ? -1.159  -24.585 0.345   1.00 0.00 ? 41 GLU A CD   8  
ATOM 8885  O OE1  . GLU A 1 40 ? -0.389  -24.534 1.290   1.00 0.00 ? 41 GLU A OE1  8  
ATOM 8886  O OE2  . GLU A 1 40 ? -1.878  -25.540 0.103   1.00 0.00 ? 41 GLU A OE2  8  
ATOM 8887  H H    . GLU A 1 40 ? -1.001  -21.092 -1.766  1.00 0.00 ? 41 GLU A H    8  
ATOM 8888  H HA   . GLU A 1 40 ? 1.398   -22.396 -0.778  1.00 0.00 ? 41 GLU A HA   8  
ATOM 8889  H HB2  . GLU A 1 40 ? -0.634  -23.580 -2.648  1.00 0.00 ? 41 GLU A HB2  8  
ATOM 8890  H HB3  . GLU A 1 40 ? 0.419   -24.403 -1.497  1.00 0.00 ? 41 GLU A HB3  8  
ATOM 8891  H HG2  . GLU A 1 40 ? -1.051  -22.472 -0.029  1.00 0.00 ? 41 GLU A HG2  8  
ATOM 8892  H HG3  . GLU A 1 40 ? -2.206  -23.334 -1.048  1.00 0.00 ? 41 GLU A HG3  8  
ATOM 8893  N N    . LEU A 1 41 ? 1.015   -22.253 -4.054  1.00 0.00 ? 42 LEU A N    8  
ATOM 8894  C CA   . LEU A 1 41 ? 1.799   -22.228 -5.319  1.00 0.00 ? 42 LEU A CA   8  
ATOM 8895  C C    . LEU A 1 41 ? 2.857   -21.125 -5.245  1.00 0.00 ? 42 LEU A C    8  
ATOM 8896  O O    . LEU A 1 41 ? 3.988   -21.308 -5.643  1.00 0.00 ? 42 LEU A O    8  
ATOM 8897  C CB   . LEU A 1 41 ? 0.852   -21.949 -6.487  1.00 0.00 ? 42 LEU A CB   8  
ATOM 8898  C CG   . LEU A 1 41 ? 0.254   -23.264 -6.989  1.00 0.00 ? 42 LEU A CG   8  
ATOM 8899  C CD1  . LEU A 1 41 ? -0.645  -22.986 -8.195  1.00 0.00 ? 42 LEU A CD1  8  
ATOM 8900  C CD2  . LEU A 1 41 ? 1.381   -24.214 -7.401  1.00 0.00 ? 42 LEU A CD2  8  
ATOM 8901  H H    . LEU A 1 41 ? 0.038   -22.237 -4.088  1.00 0.00 ? 42 LEU A H    8  
ATOM 8902  H HA   . LEU A 1 41 ? 2.281   -23.184 -5.465  1.00 0.00 ? 42 LEU A HA   8  
ATOM 8903  H HB2  . LEU A 1 41 ? 0.058   -21.295 -6.156  1.00 0.00 ? 42 LEU A HB2  8  
ATOM 8904  H HB3  . LEU A 1 41 ? 1.398   -21.476 -7.285  1.00 0.00 ? 42 LEU A HB3  8  
ATOM 8905  H HG   . LEU A 1 41 ? -0.332  -23.717 -6.201  1.00 0.00 ? 42 LEU A HG   8  
ATOM 8906  H HD11 . LEU A 1 41 ? -0.420  -22.008 -8.594  1.00 0.00 ? 42 LEU A HD11 8  
ATOM 8907  H HD12 . LEU A 1 41 ? -0.471  -23.733 -8.955  1.00 0.00 ? 42 LEU A HD12 8  
ATOM 8908  H HD13 . LEU A 1 41 ? -1.680  -23.019 -7.887  1.00 0.00 ? 42 LEU A HD13 8  
ATOM 8909  H HD21 . LEU A 1 41 ? 2.308   -23.664 -7.467  1.00 0.00 ? 42 LEU A HD21 8  
ATOM 8910  H HD22 . LEU A 1 41 ? 1.479   -24.998 -6.666  1.00 0.00 ? 42 LEU A HD22 8  
ATOM 8911  H HD23 . LEU A 1 41 ? 1.152   -24.649 -8.363  1.00 0.00 ? 42 LEU A HD23 8  
ATOM 8912  N N    . TRP A 1 42 ? 2.495   -19.978 -4.741  1.00 0.00 ? 43 TRP A N    8  
ATOM 8913  C CA   . TRP A 1 42 ? 3.471   -18.855 -4.641  1.00 0.00 ? 43 TRP A CA   8  
ATOM 8914  C C    . TRP A 1 42 ? 4.792   -19.363 -4.043  1.00 0.00 ? 43 TRP A C    8  
ATOM 8915  O O    . TRP A 1 42 ? 5.824   -19.336 -4.684  1.00 0.00 ? 43 TRP A O    8  
ATOM 8916  C CB   . TRP A 1 42 ? 2.872   -17.759 -3.744  1.00 0.00 ? 43 TRP A CB   8  
ATOM 8917  C CG   . TRP A 1 42 ? 3.958   -16.921 -3.144  1.00 0.00 ? 43 TRP A CG   8  
ATOM 8918  C CD1  . TRP A 1 42 ? 4.348   -16.969 -1.849  1.00 0.00 ? 43 TRP A CD1  8  
ATOM 8919  C CD2  . TRP A 1 42 ? 4.795   -15.919 -3.788  1.00 0.00 ? 43 TRP A CD2  8  
ATOM 8920  N NE1  . TRP A 1 42 ? 5.372   -16.058 -1.657  1.00 0.00 ? 43 TRP A NE1  8  
ATOM 8921  C CE2  . TRP A 1 42 ? 5.683   -15.386 -2.823  1.00 0.00 ? 43 TRP A CE2  8  
ATOM 8922  C CE3  . TRP A 1 42 ? 4.867   -15.425 -5.102  1.00 0.00 ? 43 TRP A CE3  8  
ATOM 8923  C CZ2  . TRP A 1 42 ? 6.612   -14.399 -3.152  1.00 0.00 ? 43 TRP A CZ2  8  
ATOM 8924  C CZ3  . TRP A 1 42 ? 5.800   -14.431 -5.436  1.00 0.00 ? 43 TRP A CZ3  8  
ATOM 8925  C CH2  . TRP A 1 42 ? 6.672   -13.918 -4.463  1.00 0.00 ? 43 TRP A CH2  8  
ATOM 8926  H H    . TRP A 1 42 ? 1.575   -19.852 -4.430  1.00 0.00 ? 43 TRP A H    8  
ATOM 8927  H HA   . TRP A 1 42 ? 3.654   -18.451 -5.625  1.00 0.00 ? 43 TRP A HA   8  
ATOM 8928  H HB2  . TRP A 1 42 ? 2.223   -17.131 -4.335  1.00 0.00 ? 43 TRP A HB2  8  
ATOM 8929  H HB3  . TRP A 1 42 ? 2.296   -18.220 -2.954  1.00 0.00 ? 43 TRP A HB3  8  
ATOM 8930  H HD1  . TRP A 1 42 ? 3.928   -17.612 -1.091  1.00 0.00 ? 43 TRP A HD1  8  
ATOM 8931  H HE1  . TRP A 1 42 ? 5.832   -15.896 -0.808  1.00 0.00 ? 43 TRP A HE1  8  
ATOM 8932  H HE3  . TRP A 1 42 ? 4.200   -15.814 -5.858  1.00 0.00 ? 43 TRP A HE3  8  
ATOM 8933  H HZ2  . TRP A 1 42 ? 7.280   -14.008 -2.399  1.00 0.00 ? 43 TRP A HZ2  8  
ATOM 8934  H HZ3  . TRP A 1 42 ? 5.849   -14.057 -6.449  1.00 0.00 ? 43 TRP A HZ3  8  
ATOM 8935  H HH2  . TRP A 1 42 ? 7.387   -13.153 -4.727  1.00 0.00 ? 43 TRP A HH2  8  
ATOM 8936  N N    . ARG A 1 43 ? 4.768   -19.803 -2.816  1.00 0.00 ? 44 ARG A N    8  
ATOM 8937  C CA   . ARG A 1 43 ? 6.019   -20.290 -2.166  1.00 0.00 ? 44 ARG A CA   8  
ATOM 8938  C C    . ARG A 1 43 ? 6.635   -21.431 -2.980  1.00 0.00 ? 44 ARG A C    8  
ATOM 8939  O O    . ARG A 1 43 ? 7.809   -21.418 -3.297  1.00 0.00 ? 44 ARG A O    8  
ATOM 8940  C CB   . ARG A 1 43 ? 5.688   -20.793 -0.758  1.00 0.00 ? 44 ARG A CB   8  
ATOM 8941  C CG   . ARG A 1 43 ? 6.982   -21.015 0.027   1.00 0.00 ? 44 ARG A CG   8  
ATOM 8942  C CD   . ARG A 1 43 ? 6.805   -22.204 0.975   1.00 0.00 ? 44 ARG A CD   8  
ATOM 8943  N NE   . ARG A 1 43 ? 6.912   -21.738 2.386   1.00 0.00 ? 44 ARG A NE   8  
ATOM 8944  C CZ   . ARG A 1 43 ? 8.085   -21.594 2.939   1.00 0.00 ? 44 ARG A CZ   8  
ATOM 8945  N NH1  . ARG A 1 43 ? 8.717   -22.634 3.409   1.00 0.00 ? 44 ARG A NH1  8  
ATOM 8946  N NH2  . ARG A 1 43 ? 8.625   -20.409 3.022   1.00 0.00 ? 44 ARG A NH2  8  
ATOM 8947  H H    . ARG A 1 43 ? 3.926   -19.799 -2.313  1.00 0.00 ? 44 ARG A H    8  
ATOM 8948  H HA   . ARG A 1 43 ? 6.726   -19.477 -2.096  1.00 0.00 ? 44 ARG A HA   8  
ATOM 8949  H HB2  . ARG A 1 43 ? 5.079   -20.061 -0.248  1.00 0.00 ? 44 ARG A HB2  8  
ATOM 8950  H HB3  . ARG A 1 43 ? 5.148   -21.726 -0.828  1.00 0.00 ? 44 ARG A HB3  8  
ATOM 8951  H HG2  . ARG A 1 43 ? 7.791   -21.219 -0.661  1.00 0.00 ? 44 ARG A HG2  8  
ATOM 8952  H HG3  . ARG A 1 43 ? 7.211   -20.130 0.601   1.00 0.00 ? 44 ARG A HG3  8  
ATOM 8953  H HD2  . ARG A 1 43 ? 5.834   -22.648 0.815   1.00 0.00 ? 44 ARG A HD2  8  
ATOM 8954  H HD3  . ARG A 1 43 ? 7.572   -22.938 0.779   1.00 0.00 ? 44 ARG A HD3  8  
ATOM 8955  H HE   . ARG A 1 43 ? 6.101   -21.541 2.900   1.00 0.00 ? 44 ARG A HE   8  
ATOM 8956  H HH11 . ARG A 1 43 ? 8.303   -23.542 3.345   1.00 0.00 ? 44 ARG A HH11 8  
ATOM 8957  H HH12 . ARG A 1 43 ? 9.616   -22.524 3.834   1.00 0.00 ? 44 ARG A HH12 8  
ATOM 8958  H HH21 . ARG A 1 43 ? 8.140   -19.612 2.662   1.00 0.00 ? 44 ARG A HH21 8  
ATOM 8959  H HH22 . ARG A 1 43 ? 9.524   -20.298 3.447   1.00 0.00 ? 44 ARG A HH22 8  
ATOM 8960  N N    . ALA A 1 44 ? 5.861   -22.427 -3.307  1.00 0.00 ? 45 ALA A N    8  
ATOM 8961  C CA   . ALA A 1 44 ? 6.404   -23.580 -4.082  1.00 0.00 ? 45 ALA A CA   8  
ATOM 8962  C C    . ALA A 1 44 ? 6.434   -23.258 -5.576  1.00 0.00 ? 45 ALA A C    8  
ATOM 8963  O O    . ALA A 1 44 ? 6.599   -24.132 -6.403  1.00 0.00 ? 45 ALA A O    8  
ATOM 8964  C CB   . ALA A 1 44 ? 5.506   -24.791 -3.861  1.00 0.00 ? 45 ALA A CB   8  
ATOM 8965  H H    . ALA A 1 44 ? 4.920   -22.425 -3.030  1.00 0.00 ? 45 ALA A H    8  
ATOM 8966  H HA   . ALA A 1 44 ? 7.402   -23.807 -3.740  1.00 0.00 ? 45 ALA A HA   8  
ATOM 8967  H HB1  . ALA A 1 44 ? 5.048   -24.724 -2.886  1.00 0.00 ? 45 ALA A HB1  8  
ATOM 8968  H HB2  . ALA A 1 44 ? 4.740   -24.805 -4.620  1.00 0.00 ? 45 ALA A HB2  8  
ATOM 8969  H HB3  . ALA A 1 44 ? 6.095   -25.693 -3.924  1.00 0.00 ? 45 ALA A HB3  8  
ATOM 8970  N N    . MET A 1 45 ? 6.273   -22.019 -5.934  1.00 0.00 ? 46 MET A N    8  
ATOM 8971  C CA   . MET A 1 45 ? 6.290   -21.656 -7.375  1.00 0.00 ? 46 MET A CA   8  
ATOM 8972  C C    . MET A 1 45 ? 7.707   -21.847 -7.922  1.00 0.00 ? 46 MET A C    8  
ATOM 8973  O O    . MET A 1 45 ? 8.149   -22.956 -8.146  1.00 0.00 ? 46 MET A O    8  
ATOM 8974  C CB   . MET A 1 45 ? 5.846   -20.196 -7.535  1.00 0.00 ? 46 MET A CB   8  
ATOM 8975  C CG   . MET A 1 45 ? 5.850   -19.814 -9.017  1.00 0.00 ? 46 MET A CG   8  
ATOM 8976  S SD   . MET A 1 45 ? 6.692   -18.223 -9.240  1.00 0.00 ? 46 MET A SD   8  
ATOM 8977  C CE   . MET A 1 45 ? 6.053   -17.398 -7.758  1.00 0.00 ? 46 MET A CE   8  
ATOM 8978  H H    . MET A 1 45 ? 6.139   -21.330 -5.258  1.00 0.00 ? 46 MET A H    8  
ATOM 8979  H HA   . MET A 1 45 ? 5.609   -22.299 -7.913  1.00 0.00 ? 46 MET A HA   8  
ATOM 8980  H HB2  . MET A 1 45 ? 4.848   -20.079 -7.137  1.00 0.00 ? 46 MET A HB2  8  
ATOM 8981  H HB3  . MET A 1 45 ? 6.525   -19.552 -6.996  1.00 0.00 ? 46 MET A HB3  8  
ATOM 8982  H HG2  . MET A 1 45 ? 6.368   -20.575 -9.582  1.00 0.00 ? 46 MET A HG2  8  
ATOM 8983  H HG3  . MET A 1 45 ? 4.833   -19.735 -9.370  1.00 0.00 ? 46 MET A HG3  8  
ATOM 8984  H HE1  . MET A 1 45 ? 5.210   -17.956 -7.370  1.00 0.00 ? 46 MET A HE1  8  
ATOM 8985  H HE2  . MET A 1 45 ? 6.834   -17.347 -7.012  1.00 0.00 ? 46 MET A HE2  8  
ATOM 8986  H HE3  . MET A 1 45 ? 5.735   -16.400 -8.010  1.00 0.00 ? 46 MET A HE3  8  
ATOM 8987  N N    . LYS A 1 46 ? 8.423   -20.782 -8.148  1.00 0.00 ? 47 LYS A N    8  
ATOM 8988  C CA   . LYS A 1 46 ? 9.794   -20.899 -8.685  1.00 0.00 ? 47 LYS A CA   8  
ATOM 8989  C C    . LYS A 1 46 ? 10.767  -20.197 -7.740  1.00 0.00 ? 47 LYS A C    8  
ATOM 8990  O O    . LYS A 1 46 ? 11.369  -20.808 -6.878  1.00 0.00 ? 47 LYS A O    8  
ATOM 8991  C CB   . LYS A 1 46 ? 9.814   -20.208 -10.034 1.00 0.00 ? 47 LYS A CB   8  
ATOM 8992  C CG   . LYS A 1 46 ? 9.722   -21.252 -11.149 1.00 0.00 ? 47 LYS A CG   8  
ATOM 8993  C CD   . LYS A 1 46 ? 10.706  -20.894 -12.264 1.00 0.00 ? 47 LYS A CD   8  
ATOM 8994  C CE   . LYS A 1 46 ? 10.070  -21.201 -13.621 1.00 0.00 ? 47 LYS A CE   8  
ATOM 8995  N NZ   . LYS A 1 46 ? 9.485   -22.571 -13.598 1.00 0.00 ? 47 LYS A NZ   8  
ATOM 8996  H H    . LYS A 1 46 ? 8.057   -19.898 -7.978  1.00 0.00 ? 47 LYS A H    8  
ATOM 8997  H HA   . LYS A 1 46 ? 10.061  -21.935 -8.797  1.00 0.00 ? 47 LYS A HA   8  
ATOM 8998  H HB2  . LYS A 1 46 ? 8.961   -19.543 -10.084 1.00 0.00 ? 47 LYS A HB2  8  
ATOM 8999  H HB3  . LYS A 1 46 ? 10.725  -19.640 -10.140 1.00 0.00 ? 47 LYS A HB3  8  
ATOM 9000  H HG2  . LYS A 1 46 ? 9.967   -22.225 -10.750 1.00 0.00 ? 47 LYS A HG2  8  
ATOM 9001  H HG3  . LYS A 1 46 ? 8.720   -21.266 -11.548 1.00 0.00 ? 47 LYS A HG3  8  
ATOM 9002  H HD2  . LYS A 1 46 ? 10.949  -19.843 -12.208 1.00 0.00 ? 47 LYS A HD2  8  
ATOM 9003  H HD3  . LYS A 1 46 ? 11.607  -21.479 -12.151 1.00 0.00 ? 47 LYS A HD3  8  
ATOM 9004  H HE2  . LYS A 1 46 ? 9.293   -20.480 -13.825 1.00 0.00 ? 47 LYS A HE2  8  
ATOM 9005  H HE3  . LYS A 1 46 ? 10.824  -21.146 -14.392 1.00 0.00 ? 47 LYS A HE3  8  
ATOM 9006  H HZ1  . LYS A 1 46 ? 10.009  -23.160 -12.918 1.00 0.00 ? 47 LYS A HZ1  8  
ATOM 9007  H HZ2  . LYS A 1 46 ? 8.487   -22.516 -13.312 1.00 0.00 ? 47 LYS A HZ2  8  
ATOM 9008  H HZ3  . LYS A 1 46 ? 9.550   -22.992 -14.545 1.00 0.00 ? 47 LYS A HZ3  8  
ATOM 9009  N N    . ASP A 1 47 ? 10.917  -18.911 -7.893  1.00 0.00 ? 48 ASP A N    8  
ATOM 9010  C CA   . ASP A 1 47 ? 11.839  -18.149 -7.007  1.00 0.00 ? 48 ASP A CA   8  
ATOM 9011  C C    . ASP A 1 47 ? 11.146  -16.859 -6.564  1.00 0.00 ? 48 ASP A C    8  
ATOM 9012  O O    . ASP A 1 47 ? 10.347  -16.296 -7.286  1.00 0.00 ? 48 ASP A O    8  
ATOM 9013  C CB   . ASP A 1 47 ? 13.121  -17.805 -7.770  1.00 0.00 ? 48 ASP A CB   8  
ATOM 9014  C CG   . ASP A 1 47 ? 13.420  -18.899 -8.797  1.00 0.00 ? 48 ASP A CG   8  
ATOM 9015  O OD1  . ASP A 1 47 ? 12.695  -18.979 -9.775  1.00 0.00 ? 48 ASP A OD1  8  
ATOM 9016  O OD2  . ASP A 1 47 ? 14.369  -19.637 -8.588  1.00 0.00 ? 48 ASP A OD2  8  
ATOM 9017  H H    . ASP A 1 47 ? 10.415  -18.442 -8.591  1.00 0.00 ? 48 ASP A H    8  
ATOM 9018  H HA   . ASP A 1 47 ? 12.082  -18.746 -6.141  1.00 0.00 ? 48 ASP A HA   8  
ATOM 9019  H HB2  . ASP A 1 47 ? 12.994  -16.859 -8.277  1.00 0.00 ? 48 ASP A HB2  8  
ATOM 9020  H HB3  . ASP A 1 47 ? 13.944  -17.732 -7.075  1.00 0.00 ? 48 ASP A HB3  8  
ATOM 9021  N N    . LYS A 1 48 ? 11.438  -16.387 -5.384  1.00 0.00 ? 49 LYS A N    8  
ATOM 9022  C CA   . LYS A 1 48 ? 10.787  -15.135 -4.906  1.00 0.00 ? 49 LYS A CA   8  
ATOM 9023  C C    . LYS A 1 48 ? 11.602  -13.926 -5.368  1.00 0.00 ? 49 LYS A C    8  
ATOM 9024  O O    . LYS A 1 48 ? 11.084  -12.836 -5.512  1.00 0.00 ? 49 LYS A O    8  
ATOM 9025  C CB   . LYS A 1 48 ? 10.715  -15.152 -3.377  1.00 0.00 ? 49 LYS A CB   8  
ATOM 9026  C CG   . LYS A 1 48 ? 9.828   -16.313 -2.923  1.00 0.00 ? 49 LYS A CG   8  
ATOM 9027  C CD   . LYS A 1 48 ? 10.063  -16.584 -1.434  1.00 0.00 ? 49 LYS A CD   8  
ATOM 9028  C CE   . LYS A 1 48 ? 10.453  -18.050 -1.236  1.00 0.00 ? 49 LYS A CE   8  
ATOM 9029  N NZ   . LYS A 1 48 ? 9.495   -18.698 -0.295  1.00 0.00 ? 49 LYS A NZ   8  
ATOM 9030  H H    . LYS A 1 48 ? 12.083  -16.854 -4.814  1.00 0.00 ? 49 LYS A H    8  
ATOM 9031  H HA   . LYS A 1 48 ? 9.787   -15.070 -5.315  1.00 0.00 ? 49 LYS A HA   8  
ATOM 9032  H HB2  . LYS A 1 48 ? 11.708  -15.275 -2.971  1.00 0.00 ? 49 LYS A HB2  8  
ATOM 9033  H HB3  . LYS A 1 48 ? 10.294  -14.221 -3.026  1.00 0.00 ? 49 LYS A HB3  8  
ATOM 9034  H HG2  . LYS A 1 48 ? 8.790   -16.057 -3.086  1.00 0.00 ? 49 LYS A HG2  8  
ATOM 9035  H HG3  . LYS A 1 48 ? 10.074  -17.197 -3.491  1.00 0.00 ? 49 LYS A HG3  8  
ATOM 9036  H HD2  . LYS A 1 48 ? 10.858  -15.947 -1.074  1.00 0.00 ? 49 LYS A HD2  8  
ATOM 9037  H HD3  . LYS A 1 48 ? 9.157   -16.377 -0.883  1.00 0.00 ? 49 LYS A HD3  8  
ATOM 9038  H HE2  . LYS A 1 48 ? 10.426  -18.562 -2.187  1.00 0.00 ? 49 LYS A HE2  8  
ATOM 9039  H HE3  . LYS A 1 48 ? 11.451  -18.105 -0.826  1.00 0.00 ? 49 LYS A HE3  8  
ATOM 9040  H HZ1  . LYS A 1 48 ? 8.843   -17.982 0.084   1.00 0.00 ? 49 LYS A HZ1  8  
ATOM 9041  H HZ2  . LYS A 1 48 ? 8.953   -19.428 -0.801  1.00 0.00 ? 49 LYS A HZ2  8  
ATOM 9042  H HZ3  . LYS A 1 48 ? 10.020  -19.135 0.489   1.00 0.00 ? 49 LYS A HZ3  8  
ATOM 9043  N N    . SER A 1 49 ? 12.871  -14.108 -5.610  1.00 0.00 ? 50 SER A N    8  
ATOM 9044  C CA   . SER A 1 49 ? 13.709  -12.965 -6.069  1.00 0.00 ? 50 SER A CA   8  
ATOM 9045  C C    . SER A 1 49 ? 13.188  -12.475 -7.420  1.00 0.00 ? 50 SER A C    8  
ATOM 9046  O O    . SER A 1 49 ? 13.480  -11.377 -7.852  1.00 0.00 ? 50 SER A O    8  
ATOM 9047  C CB   . SER A 1 49 ? 15.162  -13.420 -6.211  1.00 0.00 ? 50 SER A CB   8  
ATOM 9048  O OG   . SER A 1 49 ? 15.915  -12.930 -5.110  1.00 0.00 ? 50 SER A OG   8  
ATOM 9049  H H    . SER A 1 49 ? 13.272  -14.995 -5.493  1.00 0.00 ? 50 SER A H    8  
ATOM 9050  H HA   . SER A 1 49 ? 13.651  -12.162 -5.348  1.00 0.00 ? 50 SER A HA   8  
ATOM 9051  H HB2  . SER A 1 49 ? 15.206  -14.496 -6.222  1.00 0.00 ? 50 SER A HB2  8  
ATOM 9052  H HB3  . SER A 1 49 ? 15.569  -13.036 -7.139  1.00 0.00 ? 50 SER A HB3  8  
ATOM 9053  H HG   . SER A 1 49 ? 15.395  -13.060 -4.313  1.00 0.00 ? 50 SER A HG   8  
ATOM 9054  N N    . GLU A 1 50 ? 12.404  -13.281 -8.086  1.00 0.00 ? 51 GLU A N    8  
ATOM 9055  C CA   . GLU A 1 50 ? 11.850  -12.867 -9.401  1.00 0.00 ? 51 GLU A CA   8  
ATOM 9056  C C    . GLU A 1 50 ? 10.927  -11.672 -9.191  1.00 0.00 ? 51 GLU A C    8  
ATOM 9057  O O    . GLU A 1 50 ? 11.225  -10.553 -9.567  1.00 0.00 ? 51 GLU A O    8  
ATOM 9058  C CB   . GLU A 1 50 ? 11.072  -14.027 -9.998  1.00 0.00 ? 51 GLU A CB   8  
ATOM 9059  C CG   . GLU A 1 50 ? 10.100  -13.524 -11.071 1.00 0.00 ? 51 GLU A CG   8  
ATOM 9060  C CD   . GLU A 1 50 ? 10.072  -14.513 -12.238 1.00 0.00 ? 51 GLU A CD   8  
ATOM 9061  O OE1  . GLU A 1 50 ? 10.630  -15.587 -12.092 1.00 0.00 ? 51 GLU A OE1  8  
ATOM 9062  O OE2  . GLU A 1 50 ? 9.492   -14.180 -13.258 1.00 0.00 ? 51 GLU A OE2  8  
ATOM 9063  H H    . GLU A 1 50 ? 12.171  -14.156 -7.712  1.00 0.00 ? 51 GLU A H    8  
ATOM 9064  H HA   . GLU A 1 50 ? 12.649  -12.612 -10.069 1.00 0.00 ? 51 GLU A HA   8  
ATOM 9065  H HB2  . GLU A 1 50 ? 11.780  -14.699 -10.445 1.00 0.00 ? 51 GLU A HB2  8  
ATOM 9066  H HB3  . GLU A 1 50 ? 10.523  -14.533 -9.219  1.00 0.00 ? 51 GLU A HB3  8  
ATOM 9067  H HG2  . GLU A 1 50 ? 9.110   -13.438 -10.647 1.00 0.00 ? 51 GLU A HG2  8  
ATOM 9068  H HG3  . GLU A 1 50 ? 10.425  -12.558 -11.427 1.00 0.00 ? 51 GLU A HG3  8  
ATOM 9069  N N    . TRP A 1 51 ? 9.806   -11.910 -8.577  1.00 0.00 ? 52 TRP A N    8  
ATOM 9070  C CA   . TRP A 1 51 ? 8.845   -10.813 -8.316  1.00 0.00 ? 52 TRP A CA   8  
ATOM 9071  C C    . TRP A 1 51 ? 9.454   -9.839  -7.323  1.00 0.00 ? 52 TRP A C    8  
ATOM 9072  O O    . TRP A 1 51 ? 9.584   -8.674  -7.600  1.00 0.00 ? 52 TRP A O    8  
ATOM 9073  C CB   . TRP A 1 51 ? 7.584   -11.403 -7.711  1.00 0.00 ? 52 TRP A CB   8  
ATOM 9074  C CG   . TRP A 1 51 ? 7.134   -12.535 -8.538  1.00 0.00 ? 52 TRP A CG   8  
ATOM 9075  C CD1  . TRP A 1 51 ? 7.363   -13.813 -8.248  1.00 0.00 ? 52 TRP A CD1  8  
ATOM 9076  C CD2  . TRP A 1 51 ? 6.380   -12.511 -9.772  1.00 0.00 ? 52 TRP A CD2  8  
ATOM 9077  N NE1  . TRP A 1 51 ? 6.797   -14.602 -9.231  1.00 0.00 ? 52 TRP A NE1  8  
ATOM 9078  C CE2  . TRP A 1 51 ? 6.172   -13.838 -10.197 1.00 0.00 ? 52 TRP A CE2  8  
ATOM 9079  C CE3  . TRP A 1 51 ? 5.863   -11.472 -10.551 1.00 0.00 ? 52 TRP A CE3  8  
ATOM 9080  C CZ2  . TRP A 1 51 ? 5.465   -14.126 -11.366 1.00 0.00 ? 52 TRP A CZ2  8  
ATOM 9081  C CZ3  . TRP A 1 51 ? 5.153   -11.747 -11.718 1.00 0.00 ? 52 TRP A CZ3  8  
ATOM 9082  C CH2  . TRP A 1 51 ? 4.949   -13.073 -12.130 1.00 0.00 ? 52 TRP A CH2  8  
ATOM 9083  H H    . TRP A 1 51 ? 9.598   -12.819 -8.279  1.00 0.00 ? 52 TRP A H    8  
ATOM 9084  H HA   . TRP A 1 51 ? 8.607   -10.303 -9.237  1.00 0.00 ? 52 TRP A HA   8  
ATOM 9085  H HB2  . TRP A 1 51 ? 7.790   -11.750 -6.711  1.00 0.00 ? 52 TRP A HB2  8  
ATOM 9086  H HB3  . TRP A 1 51 ? 6.815   -10.666 -7.680  1.00 0.00 ? 52 TRP A HB3  8  
ATOM 9087  H HD1  . TRP A 1 51 ? 7.905   -14.155 -7.387  1.00 0.00 ? 52 TRP A HD1  8  
ATOM 9088  H HE1  . TRP A 1 51 ? 6.821   -15.573 -9.254  1.00 0.00 ? 52 TRP A HE1  8  
ATOM 9089  H HE3  . TRP A 1 51 ? 6.021   -10.449 -10.250 1.00 0.00 ? 52 TRP A HE3  8  
ATOM 9090  H HZ2  . TRP A 1 51 ? 5.313   -15.151 -11.674 1.00 0.00 ? 52 TRP A HZ2  8  
ATOM 9091  H HZ3  . TRP A 1 51 ? 4.754   -10.931 -12.292 1.00 0.00 ? 52 TRP A HZ3  8  
ATOM 9092  H HH2  . TRP A 1 51 ? 4.399   -13.280 -13.035 1.00 0.00 ? 52 TRP A HH2  8  
ATOM 9093  N N    . GLU A 1 52 ? 9.812   -10.320 -6.163  1.00 0.00 ? 53 GLU A N    8  
ATOM 9094  C CA   . GLU A 1 52 ? 10.406  -9.424  -5.122  1.00 0.00 ? 53 GLU A CA   8  
ATOM 9095  C C    . GLU A 1 52 ? 11.278  -8.352  -5.780  1.00 0.00 ? 53 GLU A C    8  
ATOM 9096  O O    . GLU A 1 52 ? 11.188  -7.185  -5.455  1.00 0.00 ? 53 GLU A O    8  
ATOM 9097  C CB   . GLU A 1 52 ? 11.253  -10.255 -4.158  1.00 0.00 ? 53 GLU A CB   8  
ATOM 9098  C CG   . GLU A 1 52 ? 10.346  -10.918 -3.119  1.00 0.00 ? 53 GLU A CG   8  
ATOM 9099  C CD   . GLU A 1 52 ? 11.206  -11.646 -2.084  1.00 0.00 ? 53 GLU A CD   8  
ATOM 9100  O OE1  . GLU A 1 52 ? 12.289  -12.080 -2.443  1.00 0.00 ? 53 GLU A OE1  8  
ATOM 9101  O OE2  . GLU A 1 52 ? 10.770  -11.756 -0.951  1.00 0.00 ? 53 GLU A OE2  8  
ATOM 9102  H H    . GLU A 1 52 ? 9.677   -11.278 -5.971  1.00 0.00 ? 53 GLU A H    8  
ATOM 9103  H HA   . GLU A 1 52 ? 9.609   -8.942  -4.574  1.00 0.00 ? 53 GLU A HA   8  
ATOM 9104  H HB2  . GLU A 1 52 ? 11.784  -11.017 -4.711  1.00 0.00 ? 53 GLU A HB2  8  
ATOM 9105  H HB3  . GLU A 1 52 ? 11.962  -9.614  -3.656  1.00 0.00 ? 53 GLU A HB3  8  
ATOM 9106  H HG2  . GLU A 1 52 ? 9.750   -10.163 -2.626  1.00 0.00 ? 53 GLU A HG2  8  
ATOM 9107  H HG3  . GLU A 1 52 ? 9.697   -11.629 -3.607  1.00 0.00 ? 53 GLU A HG3  8  
ATOM 9108  N N    . ALA A 1 53 ? 12.112  -8.727  -6.711  1.00 0.00 ? 54 ALA A N    8  
ATOM 9109  C CA   . ALA A 1 53 ? 12.967  -7.711  -7.386  1.00 0.00 ? 54 ALA A CA   8  
ATOM 9110  C C    . ALA A 1 53 ? 12.072  -6.764  -8.185  1.00 0.00 ? 54 ALA A C    8  
ATOM 9111  O O    . ALA A 1 53 ? 12.195  -5.557  -8.109  1.00 0.00 ? 54 ALA A O    8  
ATOM 9112  C CB   . ALA A 1 53 ? 13.948  -8.408  -8.331  1.00 0.00 ? 54 ALA A CB   8  
ATOM 9113  H H    . ALA A 1 53 ? 12.169  -9.672  -6.971  1.00 0.00 ? 54 ALA A H    8  
ATOM 9114  H HA   . ALA A 1 53 ? 13.512  -7.149  -6.645  1.00 0.00 ? 54 ALA A HA   8  
ATOM 9115  H HB1  . ALA A 1 53 ? 14.517  -9.144  -7.781  1.00 0.00 ? 54 ALA A HB1  8  
ATOM 9116  H HB2  . ALA A 1 53 ? 13.401  -8.896  -9.124  1.00 0.00 ? 54 ALA A HB2  8  
ATOM 9117  H HB3  . ALA A 1 53 ? 14.622  -7.678  -8.755  1.00 0.00 ? 54 ALA A HB3  8  
ATOM 9118  N N    . LYS A 1 54 ? 11.167  -7.308  -8.950  1.00 0.00 ? 55 LYS A N    8  
ATOM 9119  C CA   . LYS A 1 54 ? 10.252  -6.452  -9.757  1.00 0.00 ? 55 LYS A CA   8  
ATOM 9120  C C    . LYS A 1 54 ? 9.558   -5.433  -8.851  1.00 0.00 ? 55 LYS A C    8  
ATOM 9121  O O    . LYS A 1 54 ? 9.351   -4.295  -9.225  1.00 0.00 ? 55 LYS A O    8  
ATOM 9122  C CB   . LYS A 1 54 ? 9.196   -7.332  -10.427 1.00 0.00 ? 55 LYS A CB   8  
ATOM 9123  C CG   . LYS A 1 54 ? 9.869   -8.245  -11.452 1.00 0.00 ? 55 LYS A CG   8  
ATOM 9124  C CD   . LYS A 1 54 ? 10.438  -7.399  -12.592 1.00 0.00 ? 55 LYS A CD   8  
ATOM 9125  C CE   . LYS A 1 54 ? 9.894   -7.912  -13.927 1.00 0.00 ? 55 LYS A CE   8  
ATOM 9126  N NZ   . LYS A 1 54 ? 10.921  -7.718  -14.990 1.00 0.00 ? 55 LYS A NZ   8  
ATOM 9127  H H    . LYS A 1 54 ? 11.090  -8.285  -8.991  1.00 0.00 ? 55 LYS A H    8  
ATOM 9128  H HA   . LYS A 1 54 ? 10.819  -5.933  -10.514 1.00 0.00 ? 55 LYS A HA   8  
ATOM 9129  H HB2  . LYS A 1 54 ? 8.701   -7.933  -9.676  1.00 0.00 ? 55 LYS A HB2  8  
ATOM 9130  H HB3  . LYS A 1 54 ? 8.470   -6.708  -10.925 1.00 0.00 ? 55 LYS A HB3  8  
ATOM 9131  H HG2  . LYS A 1 54 ? 10.669  -8.793  -10.976 1.00 0.00 ? 55 LYS A HG2  8  
ATOM 9132  H HG3  . LYS A 1 54 ? 9.143   -8.938  -11.849 1.00 0.00 ? 55 LYS A HG3  8  
ATOM 9133  H HD2  . LYS A 1 54 ? 10.146  -6.368  -12.456 1.00 0.00 ? 55 LYS A HD2  8  
ATOM 9134  H HD3  . LYS A 1 54 ? 11.515  -7.472  -12.594 1.00 0.00 ? 55 LYS A HD3  8  
ATOM 9135  H HE2  . LYS A 1 54 ? 9.661   -8.963  -13.839 1.00 0.00 ? 55 LYS A HE2  8  
ATOM 9136  H HE3  . LYS A 1 54 ? 9.000   -7.365  -14.186 1.00 0.00 ? 55 LYS A HE3  8  
ATOM 9137  H HZ1  . LYS A 1 54 ? 11.817  -8.147  -14.688 1.00 0.00 ? 55 LYS A HZ1  8  
ATOM 9138  H HZ2  . LYS A 1 54 ? 10.600  -8.171  -15.868 1.00 0.00 ? 55 LYS A HZ2  8  
ATOM 9139  H HZ3  . LYS A 1 54 ? 11.060  -6.700  -15.155 1.00 0.00 ? 55 LYS A HZ3  8  
ATOM 9140  N N    . ALA A 1 55 ? 9.195   -5.830  -7.662  1.00 0.00 ? 56 ALA A N    8  
ATOM 9141  C CA   . ALA A 1 55 ? 8.516   -4.889  -6.735  1.00 0.00 ? 56 ALA A CA   8  
ATOM 9142  C C    . ALA A 1 55 ? 9.427   -3.687  -6.493  1.00 0.00 ? 56 ALA A C    8  
ATOM 9143  O O    . ALA A 1 55 ? 9.000   -2.550  -6.525  1.00 0.00 ? 56 ALA A O    8  
ATOM 9144  C CB   . ALA A 1 55 ? 8.240   -5.593  -5.405  1.00 0.00 ? 56 ALA A CB   8  
ATOM 9145  H H    . ALA A 1 55 ? 9.371   -6.745  -7.380  1.00 0.00 ? 56 ALA A H    8  
ATOM 9146  H HA   . ALA A 1 55 ? 7.582   -4.563  -7.173  1.00 0.00 ? 56 ALA A HA   8  
ATOM 9147  H HB1  . ALA A 1 55 ? 8.411   -6.653  -5.517  1.00 0.00 ? 56 ALA A HB1  8  
ATOM 9148  H HB2  . ALA A 1 55 ? 8.901   -5.201  -4.646  1.00 0.00 ? 56 ALA A HB2  8  
ATOM 9149  H HB3  . ALA A 1 55 ? 7.214   -5.423  -5.113  1.00 0.00 ? 56 ALA A HB3  8  
ATOM 9150  N N    . ALA A 1 56 ? 10.686  -3.935  -6.256  1.00 0.00 ? 57 ALA A N    8  
ATOM 9151  C CA   . ALA A 1 56 ? 11.638  -2.816  -6.016  1.00 0.00 ? 57 ALA A CA   8  
ATOM 9152  C C    . ALA A 1 56 ? 11.513  -1.798  -7.148  1.00 0.00 ? 57 ALA A C    8  
ATOM 9153  O O    . ALA A 1 56 ? 11.432  -0.608  -6.922  1.00 0.00 ? 57 ALA A O    8  
ATOM 9154  C CB   . ALA A 1 56 ? 13.064  -3.365  -5.991  1.00 0.00 ? 57 ALA A CB   8  
ATOM 9155  H H    . ALA A 1 56 ? 11.007  -4.861  -6.240  1.00 0.00 ? 57 ALA A H    8  
ATOM 9156  H HA   . ALA A 1 56 ? 11.414  -2.342  -5.073  1.00 0.00 ? 57 ALA A HA   8  
ATOM 9157  H HB1  . ALA A 1 56 ? 13.053  -4.385  -5.633  1.00 0.00 ? 57 ALA A HB1  8  
ATOM 9158  H HB2  . ALA A 1 56 ? 13.473  -3.340  -6.991  1.00 0.00 ? 57 ALA A HB2  8  
ATOM 9159  H HB3  . ALA A 1 56 ? 13.672  -2.759  -5.336  1.00 0.00 ? 57 ALA A HB3  8  
ATOM 9160  N N    . LYS A 1 57 ? 11.503  -2.261  -8.367  1.00 0.00 ? 58 LYS A N    8  
ATOM 9161  C CA   . LYS A 1 57 ? 11.388  -1.327  -9.519  1.00 0.00 ? 58 LYS A CA   8  
ATOM 9162  C C    . LYS A 1 57 ? 10.219  -0.368  -9.288  1.00 0.00 ? 58 LYS A C    8  
ATOM 9163  O O    . LYS A 1 57 ? 10.382  0.831   -9.334  1.00 0.00 ? 58 LYS A O    8  
ATOM 9164  C CB   . LYS A 1 57 ? 11.154  -2.125  -10.805 1.00 0.00 ? 58 LYS A CB   8  
ATOM 9165  C CG   . LYS A 1 57 ? 12.495  -2.630  -11.344 1.00 0.00 ? 58 LYS A CG   8  
ATOM 9166  C CD   . LYS A 1 57 ? 12.296  -3.213  -12.745 1.00 0.00 ? 58 LYS A CD   8  
ATOM 9167  C CE   . LYS A 1 57 ? 13.645  -3.295  -13.462 1.00 0.00 ? 58 LYS A CE   8  
ATOM 9168  N NZ   . LYS A 1 57 ? 14.418  -4.455  -12.935 1.00 0.00 ? 58 LYS A NZ   8  
ATOM 9169  H H    . LYS A 1 57 ? 11.577  -3.226  -8.522  1.00 0.00 ? 58 LYS A H    8  
ATOM 9170  H HA   . LYS A 1 57 ? 12.301  -0.754  -9.609  1.00 0.00 ? 58 LYS A HA   8  
ATOM 9171  H HB2  . LYS A 1 57 ? 10.511  -2.966  -10.593 1.00 0.00 ? 58 LYS A HB2  8  
ATOM 9172  H HB3  . LYS A 1 57 ? 10.688  -1.490  -11.544 1.00 0.00 ? 58 LYS A HB3  8  
ATOM 9173  H HG2  . LYS A 1 57 ? 13.197  -1.809  -11.390 1.00 0.00 ? 58 LYS A HG2  8  
ATOM 9174  H HG3  . LYS A 1 57 ? 12.880  -3.397  -10.689 1.00 0.00 ? 58 LYS A HG3  8  
ATOM 9175  H HD2  . LYS A 1 57 ? 11.870  -4.202  -12.665 1.00 0.00 ? 58 LYS A HD2  8  
ATOM 9176  H HD3  . LYS A 1 57 ? 11.629  -2.578  -13.308 1.00 0.00 ? 58 LYS A HD3  8  
ATOM 9177  H HE2  . LYS A 1 57 ? 13.482  -3.421  -14.522 1.00 0.00 ? 58 LYS A HE2  8  
ATOM 9178  H HE3  . LYS A 1 57 ? 14.200  -2.384  -13.290 1.00 0.00 ? 58 LYS A HE3  8  
ATOM 9179  H HZ1  . LYS A 1 57 ? 14.163  -4.620  -11.941 1.00 0.00 ? 58 LYS A HZ1  8  
ATOM 9180  H HZ2  . LYS A 1 57 ? 14.194  -5.303  -13.496 1.00 0.00 ? 58 LYS A HZ2  8  
ATOM 9181  H HZ3  . LYS A 1 57 ? 15.435  -4.253  -13.001 1.00 0.00 ? 58 LYS A HZ3  8  
ATOM 9182  N N    . ALA A 1 58 ? 9.042   -0.877  -9.032  1.00 0.00 ? 59 ALA A N    8  
ATOM 9183  C CA   . ALA A 1 58 ? 7.890   0.040   -8.795  1.00 0.00 ? 59 ALA A CA   8  
ATOM 9184  C C    . ALA A 1 58 ? 8.229   0.964   -7.634  1.00 0.00 ? 59 ALA A C    8  
ATOM 9185  O O    . ALA A 1 58 ? 7.791   2.086   -7.583  1.00 0.00 ? 59 ALA A O    8  
ATOM 9186  C CB   . ALA A 1 58 ? 6.633   -0.761  -8.438  1.00 0.00 ? 59 ALA A CB   8  
ATOM 9187  H H    . ALA A 1 58 ? 8.918   -1.849  -8.991  1.00 0.00 ? 59 ALA A H    8  
ATOM 9188  H HA   . ALA A 1 58 ? 7.707   0.631   -9.684  1.00 0.00 ? 59 ALA A HA   8  
ATOM 9189  H HB1  . ALA A 1 58 ? 6.921   -1.714  -8.017  1.00 0.00 ? 59 ALA A HB1  8  
ATOM 9190  H HB2  . ALA A 1 58 ? 6.047   -0.208  -7.711  1.00 0.00 ? 59 ALA A HB2  8  
ATOM 9191  H HB3  . ALA A 1 58 ? 6.043   -0.922  -9.328  1.00 0.00 ? 59 ALA A HB3  8  
ATOM 9192  N N    . LYS A 1 59 ? 9.009   0.497   -6.702  1.00 0.00 ? 60 LYS A N    8  
ATOM 9193  C CA   . LYS A 1 59 ? 9.380   1.335   -5.541  1.00 0.00 ? 60 LYS A CA   8  
ATOM 9194  C C    . LYS A 1 59 ? 10.079  2.596   -6.015  1.00 0.00 ? 60 LYS A C    8  
ATOM 9195  O O    . LYS A 1 59 ? 9.746   3.687   -5.618  1.00 0.00 ? 60 LYS A O    8  
ATOM 9196  C CB   . LYS A 1 59 ? 10.336  0.537   -4.672  1.00 0.00 ? 60 LYS A CB   8  
ATOM 9197  C CG   . LYS A 1 59 ? 9.874   0.578   -3.215  1.00 0.00 ? 60 LYS A CG   8  
ATOM 9198  C CD   . LYS A 1 59 ? 10.605  1.704   -2.478  1.00 0.00 ? 60 LYS A CD   8  
ATOM 9199  C CE   . LYS A 1 59 ? 10.132  1.754   -1.025  1.00 0.00 ? 60 LYS A CE   8  
ATOM 9200  N NZ   . LYS A 1 59 ? 8.838   2.491   -0.949  1.00 0.00 ? 60 LYS A NZ   8  
ATOM 9201  H H    . LYS A 1 59 ? 9.359   -0.413  -6.762  1.00 0.00 ? 60 LYS A H    8  
ATOM 9202  H HA   . LYS A 1 59 ? 8.500   1.597   -4.977  1.00 0.00 ? 60 LYS A HA   8  
ATOM 9203  H HB2  . LYS A 1 59 ? 10.362  -0.481  -5.023  1.00 0.00 ? 60 LYS A HB2  8  
ATOM 9204  H HB3  . LYS A 1 59 ? 11.318  0.958   -4.753  1.00 0.00 ? 60 LYS A HB3  8  
ATOM 9205  H HG2  . LYS A 1 59 ? 8.809   0.757   -3.179  1.00 0.00 ? 60 LYS A HG2  8  
ATOM 9206  H HG3  . LYS A 1 59 ? 10.098  -0.364  -2.738  1.00 0.00 ? 60 LYS A HG3  8  
ATOM 9207  H HD2  . LYS A 1 59 ? 11.669  1.520   -2.506  1.00 0.00 ? 60 LYS A HD2  8  
ATOM 9208  H HD3  . LYS A 1 59 ? 10.389  2.647   -2.958  1.00 0.00 ? 60 LYS A HD3  8  
ATOM 9209  H HE2  . LYS A 1 59 ? 9.995   0.749   -0.655  1.00 0.00 ? 60 LYS A HE2  8  
ATOM 9210  H HE3  . LYS A 1 59 ? 10.871  2.263   -0.422  1.00 0.00 ? 60 LYS A HE3  8  
ATOM 9211  H HZ1  . LYS A 1 59 ? 8.822   3.237   -1.675  1.00 0.00 ? 60 LYS A HZ1  8  
ATOM 9212  H HZ2  . LYS A 1 59 ? 8.053   1.830   -1.113  1.00 0.00 ? 60 LYS A HZ2  8  
ATOM 9213  H HZ3  . LYS A 1 59 ? 8.737   2.920   -0.008  1.00 0.00 ? 60 LYS A HZ3  8  
ATOM 9214  N N    . ASP A 1 60 ? 11.061  2.452   -6.847  1.00 0.00 ? 61 ASP A N    8  
ATOM 9215  C CA   . ASP A 1 60 ? 11.793  3.655   -7.336  1.00 0.00 ? 61 ASP A CA   8  
ATOM 9216  C C    . ASP A 1 60 ? 10.881  4.487   -8.243  1.00 0.00 ? 61 ASP A C    8  
ATOM 9217  O O    . ASP A 1 60 ? 10.819  5.696   -8.139  1.00 0.00 ? 61 ASP A O    8  
ATOM 9218  C CB   . ASP A 1 60 ? 13.035  3.213   -8.115  1.00 0.00 ? 61 ASP A CB   8  
ATOM 9219  C CG   . ASP A 1 60 ? 14.264  3.300   -7.209  1.00 0.00 ? 61 ASP A CG   8  
ATOM 9220  O OD1  . ASP A 1 60 ? 14.166  2.875   -6.070  1.00 0.00 ? 61 ASP A OD1  8  
ATOM 9221  O OD2  . ASP A 1 60 ? 15.282  3.790   -7.669  1.00 0.00 ? 61 ASP A OD2  8  
ATOM 9222  H H    . ASP A 1 60 ? 11.326  1.551   -7.139  1.00 0.00 ? 61 ASP A H    8  
ATOM 9223  H HA   . ASP A 1 60 ? 12.088  4.258   -6.489  1.00 0.00 ? 61 ASP A HA   8  
ATOM 9224  H HB2  . ASP A 1 60 ? 12.904  2.191   -8.451  1.00 0.00 ? 61 ASP A HB2  8  
ATOM 9225  H HB3  . ASP A 1 60 ? 13.173  3.859   -8.969  1.00 0.00 ? 61 ASP A HB3  8  
ATOM 9226  N N    . ASP A 1 61 ? 10.172  3.848   -9.128  1.00 0.00 ? 62 ASP A N    8  
ATOM 9227  C CA   . ASP A 1 61 ? 9.259   4.589   -10.043 1.00 0.00 ? 62 ASP A CA   8  
ATOM 9228  C C    . ASP A 1 61 ? 8.013   5.036   -9.276  1.00 0.00 ? 62 ASP A C    8  
ATOM 9229  O O    . ASP A 1 61 ? 7.176   5.752   -9.789  1.00 0.00 ? 62 ASP A O    8  
ATOM 9230  C CB   . ASP A 1 61 ? 8.831   3.653   -11.172 1.00 0.00 ? 62 ASP A CB   8  
ATOM 9231  C CG   . ASP A 1 61 ? 8.424   4.475   -12.396 1.00 0.00 ? 62 ASP A CG   8  
ATOM 9232  O OD1  . ASP A 1 61 ? 8.490   5.691   -12.318 1.00 0.00 ? 62 ASP A OD1  8  
ATOM 9233  O OD2  . ASP A 1 61 ? 8.052   3.874   -13.392 1.00 0.00 ? 62 ASP A OD2  8  
ATOM 9234  H H    . ASP A 1 61 ? 10.237  2.875   -9.190  1.00 0.00 ? 62 ASP A H    8  
ATOM 9235  H HA   . ASP A 1 61 ? 9.767   5.448   -10.454 1.00 0.00 ? 62 ASP A HA   8  
ATOM 9236  H HB2  . ASP A 1 61 ? 9.654   3.001   -11.429 1.00 0.00 ? 62 ASP A HB2  8  
ATOM 9237  H HB3  . ASP A 1 61 ? 7.992   3.057   -10.841 1.00 0.00 ? 62 ASP A HB3  8  
ATOM 9238  N N    . TYR A 1 62 ? 7.872   4.590   -8.063  1.00 0.00 ? 63 TYR A N    8  
ATOM 9239  C CA   . TYR A 1 62 ? 6.672   4.948   -7.263  1.00 0.00 ? 63 TYR A CA   8  
ATOM 9240  C C    . TYR A 1 62 ? 6.965   6.119   -6.320  1.00 0.00 ? 63 TYR A C    8  
ATOM 9241  O O    . TYR A 1 62 ? 6.179   7.030   -6.195  1.00 0.00 ? 63 TYR A O    8  
ATOM 9242  C CB   . TYR A 1 62 ? 6.281   3.722   -6.455  1.00 0.00 ? 63 TYR A CB   8  
ATOM 9243  C CG   . TYR A 1 62 ? 5.249   4.087   -5.442  1.00 0.00 ? 63 TYR A CG   8  
ATOM 9244  C CD1  . TYR A 1 62 ? 3.956   4.416   -5.850  1.00 0.00 ? 63 TYR A CD1  8  
ATOM 9245  C CD2  . TYR A 1 62 ? 5.582   4.069   -4.091  1.00 0.00 ? 63 TYR A CD2  8  
ATOM 9246  C CE1  . TYR A 1 62 ? 2.989   4.735   -4.898  1.00 0.00 ? 63 TYR A CE1  8  
ATOM 9247  C CE2  . TYR A 1 62 ? 4.616   4.382   -3.132  1.00 0.00 ? 63 TYR A CE2  8  
ATOM 9248  C CZ   . TYR A 1 62 ? 3.316   4.717   -3.535  1.00 0.00 ? 63 TYR A CZ   8  
ATOM 9249  O OH   . TYR A 1 62 ? 2.359   5.028   -2.591  1.00 0.00 ? 63 TYR A OH   8  
ATOM 9250  H H    . TYR A 1 62 ? 8.547   3.994   -7.681  1.00 0.00 ? 63 TYR A H    8  
ATOM 9251  H HA   . TYR A 1 62 ? 5.860   5.211   -7.920  1.00 0.00 ? 63 TYR A HA   8  
ATOM 9252  H HB2  . TYR A 1 62 ? 5.883   2.969   -7.118  1.00 0.00 ? 63 TYR A HB2  8  
ATOM 9253  H HB3  . TYR A 1 62 ? 7.154   3.332   -5.952  1.00 0.00 ? 63 TYR A HB3  8  
ATOM 9254  H HD1  . TYR A 1 62 ? 3.707   4.429   -6.900  1.00 0.00 ? 63 TYR A HD1  8  
ATOM 9255  H HD2  . TYR A 1 62 ? 6.591   3.820   -3.789  1.00 0.00 ? 63 TYR A HD2  8  
ATOM 9256  H HE1  . TYR A 1 62 ? 1.993   4.990   -5.215  1.00 0.00 ? 63 TYR A HE1  8  
ATOM 9257  H HE2  . TYR A 1 62 ? 4.872   4.361   -2.087  1.00 0.00 ? 63 TYR A HE2  8  
ATOM 9258  H HH   . TYR A 1 62 ? 1.497   4.850   -2.974  1.00 0.00 ? 63 TYR A HH   8  
ATOM 9259  N N    . ASP A 1 63 ? 8.079   6.104   -5.650  1.00 0.00 ? 64 ASP A N    8  
ATOM 9260  C CA   . ASP A 1 63 ? 8.399   7.217   -4.719  1.00 0.00 ? 64 ASP A CA   8  
ATOM 9261  C C    . ASP A 1 63 ? 8.732   8.457   -5.528  1.00 0.00 ? 64 ASP A C    8  
ATOM 9262  O O    . ASP A 1 63 ? 8.479   9.575   -5.123  1.00 0.00 ? 64 ASP A O    8  
ATOM 9263  C CB   . ASP A 1 63 ? 9.597   6.828   -3.883  1.00 0.00 ? 64 ASP A CB   8  
ATOM 9264  C CG   . ASP A 1 63 ? 9.611   7.639   -2.586  1.00 0.00 ? 64 ASP A CG   8  
ATOM 9265  O OD1  . ASP A 1 63 ? 8.955   8.666   -2.545  1.00 0.00 ? 64 ASP A OD1  8  
ATOM 9266  O OD2  . ASP A 1 63 ? 10.279  7.219   -1.654  1.00 0.00 ? 64 ASP A OD2  8  
ATOM 9267  H H    . ASP A 1 63 ? 8.705   5.366   -5.756  1.00 0.00 ? 64 ASP A H    8  
ATOM 9268  H HA   . ASP A 1 63 ? 7.567   7.401   -4.073  1.00 0.00 ? 64 ASP A HA   8  
ATOM 9269  H HB2  . ASP A 1 63 ? 9.523   5.786   -3.656  1.00 0.00 ? 64 ASP A HB2  8  
ATOM 9270  H HB3  . ASP A 1 63 ? 10.500  7.018   -4.436  1.00 0.00 ? 64 ASP A HB3  8  
ATOM 9271  N N    . ARG A 1 64 ? 9.317   8.256   -6.666  1.00 0.00 ? 65 ARG A N    8  
ATOM 9272  C CA   . ARG A 1 64 ? 9.702   9.405   -7.523  1.00 0.00 ? 65 ARG A CA   8  
ATOM 9273  C C    . ARG A 1 64 ? 8.521   9.855   -8.391  1.00 0.00 ? 65 ARG A C    8  
ATOM 9274  O O    . ARG A 1 64 ? 8.345   11.029  -8.653  1.00 0.00 ? 65 ARG A O    8  
ATOM 9275  C CB   . ARG A 1 64 ? 10.854  8.987   -8.436  1.00 0.00 ? 65 ARG A CB   8  
ATOM 9276  C CG   . ARG A 1 64 ? 12.093  8.674   -7.595  1.00 0.00 ? 65 ARG A CG   8  
ATOM 9277  C CD   . ARG A 1 64 ? 12.940  7.619   -8.310  1.00 0.00 ? 65 ARG A CD   8  
ATOM 9278  N NE   . ARG A 1 64 ? 13.927  8.293   -9.201  1.00 0.00 ? 65 ARG A NE   8  
ATOM 9279  C CZ   . ARG A 1 64 ? 13.551  9.289   -9.957  1.00 0.00 ? 65 ARG A CZ   8  
ATOM 9280  N NH1  . ARG A 1 64 ? 12.632  9.107   -10.864 1.00 0.00 ? 65 ARG A NH1  8  
ATOM 9281  N NH2  . ARG A 1 64 ? 14.096  10.465  -9.806  1.00 0.00 ? 65 ARG A NH2  8  
ATOM 9282  H H    . ARG A 1 64 ? 9.520   7.339   -6.950  1.00 0.00 ? 65 ARG A H    8  
ATOM 9283  H HA   . ARG A 1 64 ? 10.019  10.214  -6.896  1.00 0.00 ? 65 ARG A HA   8  
ATOM 9284  H HB2  . ARG A 1 64 ? 10.565  8.106   -8.993  1.00 0.00 ? 65 ARG A HB2  8  
ATOM 9285  H HB3  . ARG A 1 64 ? 11.080  9.788   -9.122  1.00 0.00 ? 65 ARG A HB3  8  
ATOM 9286  H HG2  . ARG A 1 64 ? 12.675  9.574   -7.462  1.00 0.00 ? 65 ARG A HG2  8  
ATOM 9287  H HG3  . ARG A 1 64 ? 11.788  8.295   -6.631  1.00 0.00 ? 65 ARG A HG3  8  
ATOM 9288  H HD2  . ARG A 1 64 ? 13.465  7.022   -7.579  1.00 0.00 ? 65 ARG A HD2  8  
ATOM 9289  H HD3  . ARG A 1 64 ? 12.298  6.983   -8.901  1.00 0.00 ? 65 ARG A HD3  8  
ATOM 9290  H HE   . ARG A 1 64 ? 14.858  7.988   -9.219  1.00 0.00 ? 65 ARG A HE   8  
ATOM 9291  H HH11 . ARG A 1 64 ? 12.213  8.206   -10.980 1.00 0.00 ? 65 ARG A HH11 8  
ATOM 9292  H HH12 . ARG A 1 64 ? 12.343  9.869   -11.443 1.00 0.00 ? 65 ARG A HH12 8  
ATOM 9293  H HH21 . ARG A 1 64 ? 14.801  10.604  -9.111  1.00 0.00 ? 65 ARG A HH21 8  
ATOM 9294  H HH22 . ARG A 1 64 ? 13.808  11.227  -10.386 1.00 0.00 ? 65 ARG A HH22 8  
ATOM 9295  N N    . ALA A 1 65 ? 7.732   8.932   -8.864  1.00 0.00 ? 66 ALA A N    8  
ATOM 9296  C CA   . ALA A 1 65 ? 6.586   9.304   -9.746  1.00 0.00 ? 66 ALA A CA   8  
ATOM 9297  C C    . ALA A 1 65 ? 5.380   9.771   -8.930  1.00 0.00 ? 66 ALA A C    8  
ATOM 9298  O O    . ALA A 1 65 ? 4.574   10.532  -9.416  1.00 0.00 ? 66 ALA A O    8  
ATOM 9299  C CB   . ALA A 1 65 ? 6.184   8.092   -10.586 1.00 0.00 ? 66 ALA A CB   8  
ATOM 9300  H H    . ALA A 1 65 ? 7.908   7.990   -8.660  1.00 0.00 ? 66 ALA A H    8  
ATOM 9301  H HA   . ALA A 1 65 ? 6.888   10.108  -10.404 1.00 0.00 ? 66 ALA A HA   8  
ATOM 9302  H HB1  . ALA A 1 65 ? 7.072   7.569   -10.912 1.00 0.00 ? 66 ALA A HB1  8  
ATOM 9303  H HB2  . ALA A 1 65 ? 5.574   7.429   -9.990  1.00 0.00 ? 66 ALA A HB2  8  
ATOM 9304  H HB3  . ALA A 1 65 ? 5.623   8.420   -11.448 1.00 0.00 ? 66 ALA A HB3  8  
ATOM 9305  N N    . VAL A 1 66 ? 5.230   9.341   -7.708  1.00 0.00 ? 67 VAL A N    8  
ATOM 9306  C CA   . VAL A 1 66 ? 4.053   9.806   -6.929  1.00 0.00 ? 67 VAL A CA   8  
ATOM 9307  C C    . VAL A 1 66 ? 4.168   11.307  -6.718  1.00 0.00 ? 67 VAL A C    8  
ATOM 9308  O O    . VAL A 1 66 ? 3.195   12.012  -6.708  1.00 0.00 ? 67 VAL A O    8  
ATOM 9309  C CB   . VAL A 1 66 ? 3.990   9.136   -5.582  1.00 0.00 ? 67 VAL A CB   8  
ATOM 9310  C CG1  . VAL A 1 66 ? 3.755   7.638   -5.747  1.00 0.00 ? 67 VAL A CG1  8  
ATOM 9311  C CG2  . VAL A 1 66 ? 5.286   9.397   -4.869  1.00 0.00 ? 67 VAL A CG2  8  
ATOM 9312  H H    . VAL A 1 66 ? 5.875   8.727   -7.313  1.00 0.00 ? 67 VAL A H    8  
ATOM 9313  H HA   . VAL A 1 66 ? 3.166   9.584   -7.469  1.00 0.00 ? 67 VAL A HA   8  
ATOM 9314  H HB   . VAL A 1 66 ? 3.190   9.568   -5.023  1.00 0.00 ? 67 VAL A HB   8  
ATOM 9315  H HG11 . VAL A 1 66 ? 4.073   7.331   -6.733  1.00 0.00 ? 67 VAL A HG11 8  
ATOM 9316  H HG12 . VAL A 1 66 ? 4.320   7.099   -5.002  1.00 0.00 ? 67 VAL A HG12 8  
ATOM 9317  H HG13 . VAL A 1 66 ? 2.703   7.426   -5.627  1.00 0.00 ? 67 VAL A HG13 8  
ATOM 9318  H HG21 . VAL A 1 66 ? 6.077   9.431   -5.597  1.00 0.00 ? 67 VAL A HG21 8  
ATOM 9319  H HG22 . VAL A 1 66 ? 5.211   10.347  -4.367  1.00 0.00 ? 67 VAL A HG22 8  
ATOM 9320  H HG23 . VAL A 1 66 ? 5.473   8.613   -4.156  1.00 0.00 ? 67 VAL A HG23 8  
ATOM 9321  N N    . LYS A 1 67 ? 5.361   11.795  -6.546  1.00 0.00 ? 68 LYS A N    8  
ATOM 9322  C CA   . LYS A 1 67 ? 5.546   13.261  -6.347  1.00 0.00 ? 68 LYS A CA   8  
ATOM 9323  C C    . LYS A 1 67 ? 4.942   13.992  -7.548  1.00 0.00 ? 68 LYS A C    8  
ATOM 9324  O O    . LYS A 1 67 ? 4.104   14.859  -7.406  1.00 0.00 ? 68 LYS A O    8  
ATOM 9325  C CB   . LYS A 1 67 ? 7.039   13.585  -6.247  1.00 0.00 ? 68 LYS A CB   8  
ATOM 9326  C CG   . LYS A 1 67 ? 7.471   13.551  -4.780  1.00 0.00 ? 68 LYS A CG   8  
ATOM 9327  C CD   . LYS A 1 67 ? 8.965   13.868  -4.678  1.00 0.00 ? 68 LYS A CD   8  
ATOM 9328  C CE   . LYS A 1 67 ? 9.179   15.012  -3.687  1.00 0.00 ? 68 LYS A CE   8  
ATOM 9329  N NZ   . LYS A 1 67 ? 10.513  14.864  -3.039  1.00 0.00 ? 68 LYS A NZ   8  
ATOM 9330  H H    . LYS A 1 67 ? 6.132   11.196  -6.550  1.00 0.00 ? 68 LYS A H    8  
ATOM 9331  H HA   . LYS A 1 67 ? 5.044   13.572  -5.442  1.00 0.00 ? 68 LYS A HA   8  
ATOM 9332  H HB2  . LYS A 1 67 ? 7.603   12.853  -6.807  1.00 0.00 ? 68 LYS A HB2  8  
ATOM 9333  H HB3  . LYS A 1 67 ? 7.222   14.568  -6.652  1.00 0.00 ? 68 LYS A HB3  8  
ATOM 9334  H HG2  . LYS A 1 67 ? 6.909   14.285  -4.222  1.00 0.00 ? 68 LYS A HG2  8  
ATOM 9335  H HG3  . LYS A 1 67 ? 7.286   12.569  -4.373  1.00 0.00 ? 68 LYS A HG3  8  
ATOM 9336  H HD2  . LYS A 1 67 ? 9.495   12.991  -4.338  1.00 0.00 ? 68 LYS A HD2  8  
ATOM 9337  H HD3  . LYS A 1 67 ? 9.338   14.159  -5.649  1.00 0.00 ? 68 LYS A HD3  8  
ATOM 9338  H HE2  . LYS A 1 67 ? 9.135   15.956  -4.211  1.00 0.00 ? 68 LYS A HE2  8  
ATOM 9339  H HE3  . LYS A 1 67 ? 8.408   14.984  -2.932  1.00 0.00 ? 68 LYS A HE3  8  
ATOM 9340  H HZ1  . LYS A 1 67 ? 10.591  13.916  -2.619  1.00 0.00 ? 68 LYS A HZ1  8  
ATOM 9341  H HZ2  . LYS A 1 67 ? 11.260  14.992  -3.751  1.00 0.00 ? 68 LYS A HZ2  8  
ATOM 9342  H HZ3  . LYS A 1 67 ? 10.618  15.580  -2.293  1.00 0.00 ? 68 LYS A HZ3  8  
ATOM 9343  N N    . GLU A 1 68 ? 5.348   13.625  -8.735  1.00 0.00 ? 69 GLU A N    8  
ATOM 9344  C CA   . GLU A 1 68 ? 4.785   14.261  -9.961  1.00 0.00 ? 69 GLU A CA   8  
ATOM 9345  C C    . GLU A 1 68 ? 3.273   14.036  -9.952  1.00 0.00 ? 69 GLU A C    8  
ATOM 9346  O O    . GLU A 1 68 ? 2.484   14.867  -10.356 1.00 0.00 ? 69 GLU A O    8  
ATOM 9347  C CB   . GLU A 1 68 ? 5.395   13.568  -11.182 1.00 0.00 ? 69 GLU A CB   8  
ATOM 9348  C CG   . GLU A 1 68 ? 6.485   14.456  -11.785 1.00 0.00 ? 69 GLU A CG   8  
ATOM 9349  C CD   . GLU A 1 68 ? 5.835   15.564  -12.616 1.00 0.00 ? 69 GLU A CD   8  
ATOM 9350  O OE1  . GLU A 1 68 ? 4.667   15.427  -12.939 1.00 0.00 ? 69 GLU A OE1  8  
ATOM 9351  O OE2  . GLU A 1 68 ? 6.518   16.531  -12.917 1.00 0.00 ? 69 GLU A OE2  8  
ATOM 9352  H H    . GLU A 1 68 ? 6.011   12.908  -8.822  1.00 0.00 ? 69 GLU A H    8  
ATOM 9353  H HA   . GLU A 1 68 ? 5.011   15.317  -9.976  1.00 0.00 ? 69 GLU A HA   8  
ATOM 9354  H HB2  . GLU A 1 68 ? 5.827   12.616  -10.876 1.00 0.00 ? 69 GLU A HB2  8  
ATOM 9355  H HB3  . GLU A 1 68 ? 4.625   13.393  -11.918 1.00 0.00 ? 69 GLU A HB3  8  
ATOM 9356  H HG2  . GLU A 1 68 ? 7.071   14.896  -10.992 1.00 0.00 ? 69 GLU A HG2  8  
ATOM 9357  H HG3  . GLU A 1 68 ? 7.125   13.862  -12.419 1.00 0.00 ? 69 GLU A HG3  8  
ATOM 9358  N N    . PHE A 1 69 ? 2.900   12.895  -9.470  1.00 0.00 ? 70 PHE A N    8  
ATOM 9359  C CA   . PHE A 1 69 ? 1.475   12.484  -9.361  1.00 0.00 ? 70 PHE A CA   8  
ATOM 9360  C C    . PHE A 1 69 ? 0.749   13.320  -8.309  1.00 0.00 ? 70 PHE A C    8  
ATOM 9361  O O    . PHE A 1 69 ? -0.452  13.503  -8.360  1.00 0.00 ? 70 PHE A O    8  
ATOM 9362  C CB   . PHE A 1 69 ? 1.492   11.055  -8.891  1.00 0.00 ? 70 PHE A CB   8  
ATOM 9363  C CG   . PHE A 1 69 ? 0.190   10.731  -8.267  1.00 0.00 ? 70 PHE A CG   8  
ATOM 9364  C CD1  . PHE A 1 69 ? -0.867  10.382  -9.078  1.00 0.00 ? 70 PHE A CD1  8  
ATOM 9365  C CD2  . PHE A 1 69 ? 0.053   10.807  -6.888  1.00 0.00 ? 70 PHE A CD2  8  
ATOM 9366  C CE1  . PHE A 1 69 ? -2.105  10.092  -8.515  1.00 0.00 ? 70 PHE A CE1  8  
ATOM 9367  C CE2  . PHE A 1 69 ? -1.186  10.517  -6.305  1.00 0.00 ? 70 PHE A CE2  8  
ATOM 9368  C CZ   . PHE A 1 69 ? -2.270  10.157  -7.122  1.00 0.00 ? 70 PHE A CZ   8  
ATOM 9369  H H    . PHE A 1 69 ? 3.589   12.280  -9.156  1.00 0.00 ? 70 PHE A H    8  
ATOM 9370  H HA   . PHE A 1 69 ? 0.964   12.527  -10.308 1.00 0.00 ? 70 PHE A HA   8  
ATOM 9371  H HB2  . PHE A 1 69 ? 1.656   10.407  -9.733  1.00 0.00 ? 70 PHE A HB2  8  
ATOM 9372  H HB3  . PHE A 1 69 ? 2.272   10.940  -8.163  1.00 0.00 ? 70 PHE A HB3  8  
ATOM 9373  H HD1  . PHE A 1 69 ? -0.718  10.340  -10.146 1.00 0.00 ? 70 PHE A HD1  8  
ATOM 9374  H HD2  . PHE A 1 69 ? 0.908   11.097  -6.276  1.00 0.00 ? 70 PHE A HD2  8  
ATOM 9375  H HE1  . PHE A 1 69 ? -2.929  9.824   -9.151  1.00 0.00 ? 70 PHE A HE1  8  
ATOM 9376  H HE2  . PHE A 1 69 ? -1.306  10.570  -5.235  1.00 0.00 ? 70 PHE A HE2  8  
ATOM 9377  H HZ   . PHE A 1 69 ? -3.231  9.933   -6.680  1.00 0.00 ? 70 PHE A HZ   8  
ATOM 9378  N N    . GLU A 1 70 ? 1.462   13.788  -7.339  1.00 0.00 ? 71 GLU A N    8  
ATOM 9379  C CA   . GLU A 1 70 ? 0.818   14.568  -6.258  1.00 0.00 ? 71 GLU A CA   8  
ATOM 9380  C C    . GLU A 1 70 ? 0.949   16.049  -6.586  1.00 0.00 ? 71 GLU A C    8  
ATOM 9381  O O    . GLU A 1 70 ? 0.331   16.902  -5.979  1.00 0.00 ? 71 GLU A O    8  
ATOM 9382  C CB   . GLU A 1 70 ? 1.517   14.269  -4.930  1.00 0.00 ? 71 GLU A CB   8  
ATOM 9383  C CG   . GLU A 1 70 ? 1.328   12.791  -4.577  1.00 0.00 ? 71 GLU A CG   8  
ATOM 9384  C CD   . GLU A 1 70 ? 1.187   12.640  -3.061  1.00 0.00 ? 71 GLU A CD   8  
ATOM 9385  O OE1  . GLU A 1 70 ? 2.100   13.039  -2.358  1.00 0.00 ? 71 GLU A OE1  8  
ATOM 9386  O OE2  . GLU A 1 70 ? 0.168   12.128  -2.630  1.00 0.00 ? 71 GLU A OE2  8  
ATOM 9387  H H    . GLU A 1 70 ? 2.422   13.619  -7.317  1.00 0.00 ? 71 GLU A H    8  
ATOM 9388  H HA   . GLU A 1 70 ? -0.220  14.280  -6.192  1.00 0.00 ? 71 GLU A HA   8  
ATOM 9389  H HB2  . GLU A 1 70 ? 2.572   14.487  -5.021  1.00 0.00 ? 71 GLU A HB2  8  
ATOM 9390  H HB3  . GLU A 1 70 ? 1.087   14.880  -4.151  1.00 0.00 ? 71 GLU A HB3  8  
ATOM 9391  H HG2  . GLU A 1 70 ? 0.439   12.417  -5.062  1.00 0.00 ? 71 GLU A HG2  8  
ATOM 9392  H HG3  . GLU A 1 70 ? 2.185   12.226  -4.914  1.00 0.00 ? 71 GLU A HG3  8  
ATOM 9393  N N    . ALA A 1 71 ? 1.772   16.346  -7.545  1.00 0.00 ? 72 ALA A N    8  
ATOM 9394  C CA   . ALA A 1 71 ? 2.007   17.747  -7.953  1.00 0.00 ? 72 ALA A CA   8  
ATOM 9395  C C    . ALA A 1 71 ? 0.864   18.226  -8.852  1.00 0.00 ? 72 ALA A C    8  
ATOM 9396  O O    . ALA A 1 71 ? 0.616   19.408  -8.980  1.00 0.00 ? 72 ALA A O    8  
ATOM 9397  C CB   . ALA A 1 71 ? 3.320   17.771  -8.719  1.00 0.00 ? 72 ALA A CB   8  
ATOM 9398  H H    . ALA A 1 71 ? 2.259   15.633  -8.003  1.00 0.00 ? 72 ALA A H    8  
ATOM 9399  H HA   . ALA A 1 71 ? 2.081   18.379  -7.081  1.00 0.00 ? 72 ALA A HA   8  
ATOM 9400  H HB1  . ALA A 1 71 ? 3.737   16.767  -8.722  1.00 0.00 ? 72 ALA A HB1  8  
ATOM 9401  H HB2  . ALA A 1 71 ? 3.140   18.091  -9.735  1.00 0.00 ? 72 ALA A HB2  8  
ATOM 9402  H HB3  . ALA A 1 71 ? 4.009   18.448  -8.239  1.00 0.00 ? 72 ALA A HB3  8  
ATOM 9403  N N    . ASN A 1 72 ? 0.168   17.315  -9.476  1.00 0.00 ? 73 ASN A N    8  
ATOM 9404  C CA   . ASN A 1 72 ? -0.956  17.719  -10.366 1.00 0.00 ? 73 ASN A CA   8  
ATOM 9405  C C    . ASN A 1 72 ? -2.258  17.096  -9.859  1.00 0.00 ? 73 ASN A C    8  
ATOM 9406  O O    . ASN A 1 72 ? -2.813  16.207  -10.474 1.00 0.00 ? 73 ASN A O    8  
ATOM 9407  C CB   . ASN A 1 72 ? -0.680  17.229  -11.790 1.00 0.00 ? 73 ASN A CB   8  
ATOM 9408  C CG   . ASN A 1 72 ? 0.583   17.891  -12.326 1.00 0.00 ? 73 ASN A CG   8  
ATOM 9409  O OD1  . ASN A 1 72 ? 1.517   18.140  -11.589 1.00 0.00 ? 73 ASN A OD1  8  
ATOM 9410  N ND2  . ASN A 1 72 ? 0.649   18.188  -13.590 1.00 0.00 ? 73 ASN A ND2  8  
ATOM 9411  H H    . ASN A 1 72 ? 0.385   16.368  -9.358  1.00 0.00 ? 73 ASN A H    8  
ATOM 9412  H HA   . ASN A 1 72 ? -1.048  18.794  -10.367 1.00 0.00 ? 73 ASN A HA   8  
ATOM 9413  H HB2  . ASN A 1 72 ? -0.548  16.159  -11.786 1.00 0.00 ? 73 ASN A HB2  8  
ATOM 9414  H HB3  . ASN A 1 72 ? -1.510  17.487  -12.428 1.00 0.00 ? 73 ASN A HB3  8  
ATOM 9415  H HD21 . ASN A 1 72 ? -0.106  17.985  -14.181 1.00 0.00 ? 73 ASN A HD21 8  
ATOM 9416  H HD22 . ASN A 1 72 ? 1.448   18.611  -13.948 1.00 0.00 ? 73 ASN A HD22 8  
ATOM 9417  N N    . GLY A 1 73 ? -2.751  17.555  -8.742  1.00 0.00 ? 74 GLY A N    8  
ATOM 9418  C CA   . GLY A 1 73 ? -4.018  16.987  -8.199  1.00 0.00 ? 74 GLY A CA   8  
ATOM 9419  C C    . GLY A 1 73 ? -5.039  16.847  -9.328  1.00 0.00 ? 74 GLY A C    8  
ATOM 9420  O O    . GLY A 1 73 ? -5.617  17.854  -9.707  1.00 0.00 ? 74 GLY A O    8  
ATOM 9421  O OXT  . GLY A 1 73 ? -5.229  15.736  -9.795  1.00 0.00 ? 74 GLY A OXT  8  
ATOM 9422  H H    . GLY A 1 73 ? -2.290  18.273  -8.261  1.00 0.00 ? 74 GLY A H    8  
ATOM 9423  H HA2  . GLY A 1 73 ? -3.819  16.015  -7.769  1.00 0.00 ? 74 GLY A HA2  8  
ATOM 9424  H HA3  . GLY A 1 73 ? -4.412  17.645  -7.440  1.00 0.00 ? 74 GLY A HA3  8  
ATOM 9425  N N    . SER A 1 1  ? -3.352  8.961   -15.247 1.00 0.00 ? 2  SER A N    9  
ATOM 9426  C CA   . SER A 1 1  ? -3.890  8.512   -13.933 1.00 0.00 ? 2  SER A CA   9  
ATOM 9427  C C    . SER A 1 1  ? -3.230  9.317   -12.812 1.00 0.00 ? 2  SER A C    9  
ATOM 9428  O O    . SER A 1 1  ? -2.036  9.543   -12.816 1.00 0.00 ? 2  SER A O    9  
ATOM 9429  C CB   . SER A 1 1  ? -3.592  7.026   -13.739 1.00 0.00 ? 2  SER A CB   9  
ATOM 9430  O OG   . SER A 1 1  ? -4.716  6.398   -13.135 1.00 0.00 ? 2  SER A OG   9  
ATOM 9431  H H    . SER A 1 1  ? -2.426  9.269   -15.317 1.00 0.00 ? 2  SER A H    9  
ATOM 9432  H HA   . SER A 1 1  ? -4.958  8.671   -13.908 1.00 0.00 ? 2  SER A HA   9  
ATOM 9433  H HB2  . SER A 1 1  ? -3.401  6.567   -14.694 1.00 0.00 ? 2  SER A HB2  9  
ATOM 9434  H HB3  . SER A 1 1  ? -2.721  6.913   -13.107 1.00 0.00 ? 2  SER A HB3  9  
ATOM 9435  H HG   . SER A 1 1  ? -4.477  5.490   -12.934 1.00 0.00 ? 2  SER A HG   9  
ATOM 9436  N N    . ASP A 1 2  ? -3.999  9.750   -11.852 1.00 0.00 ? 3  ASP A N    9  
ATOM 9437  C CA   . ASP A 1 2  ? -3.419  10.541  -10.731 1.00 0.00 ? 3  ASP A CA   9  
ATOM 9438  C C    . ASP A 1 2  ? -2.765  9.596   -9.721  1.00 0.00 ? 3  ASP A C    9  
ATOM 9439  O O    . ASP A 1 2  ? -1.560  9.574   -9.568  1.00 0.00 ? 3  ASP A O    9  
ATOM 9440  C CB   . ASP A 1 2  ? -4.528  11.336  -10.040 1.00 0.00 ? 3  ASP A CB   9  
ATOM 9441  C CG   . ASP A 1 2  ? -4.510  12.781  -10.540 1.00 0.00 ? 3  ASP A CG   9  
ATOM 9442  O OD1  . ASP A 1 2  ? -3.467  13.212  -11.003 1.00 0.00 ? 3  ASP A OD1  9  
ATOM 9443  O OD2  . ASP A 1 2  ? -5.538  13.431  -10.452 1.00 0.00 ? 3  ASP A OD2  9  
ATOM 9444  H H    . ASP A 1 2  ? -4.959  9.556   -11.869 1.00 0.00 ? 3  ASP A H    9  
ATOM 9445  H HA   . ASP A 1 2  ? -2.676  11.223  -11.118 1.00 0.00 ? 3  ASP A HA   9  
ATOM 9446  H HB2  . ASP A 1 2  ? -5.485  10.888  -10.263 1.00 0.00 ? 3  ASP A HB2  9  
ATOM 9447  H HB3  . ASP A 1 2  ? -4.367  11.325  -8.972  1.00 0.00 ? 3  ASP A HB3  9  
ATOM 9448  N N    . LYS A 1 3  ? -3.550  8.816   -9.029  1.00 0.00 ? 4  LYS A N    9  
ATOM 9449  C CA   . LYS A 1 3  ? -2.972  7.875   -8.028  1.00 0.00 ? 4  LYS A CA   9  
ATOM 9450  C C    . LYS A 1 3  ? -2.023  6.895   -8.733  1.00 0.00 ? 4  LYS A C    9  
ATOM 9451  O O    . LYS A 1 3  ? -2.414  6.231   -9.672  1.00 0.00 ? 4  LYS A O    9  
ATOM 9452  C CB   . LYS A 1 3  ? -4.105  7.093   -7.359  1.00 0.00 ? 4  LYS A CB   9  
ATOM 9453  C CG   . LYS A 1 3  ? -3.583  6.417   -6.089  1.00 0.00 ? 4  LYS A CG   9  
ATOM 9454  C CD   . LYS A 1 3  ? -4.252  7.043   -4.863  1.00 0.00 ? 4  LYS A CD   9  
ATOM 9455  C CE   . LYS A 1 3  ? -5.529  6.270   -4.525  1.00 0.00 ? 4  LYS A CE   9  
ATOM 9456  N NZ   . LYS A 1 3  ? -5.273  5.372   -3.363  1.00 0.00 ? 4  LYS A NZ   9  
ATOM 9457  H H    . LYS A 1 3  ? -4.520  8.850   -9.167  1.00 0.00 ? 4  LYS A H    9  
ATOM 9458  H HA   . LYS A 1 3  ? -2.436  8.438   -7.281  1.00 0.00 ? 4  LYS A HA   9  
ATOM 9459  H HB2  . LYS A 1 3  ? -4.907  7.770   -7.104  1.00 0.00 ? 4  LYS A HB2  9  
ATOM 9460  H HB3  . LYS A 1 3  ? -4.473  6.341   -8.039  1.00 0.00 ? 4  LYS A HB3  9  
ATOM 9461  H HG2  . LYS A 1 3  ? -3.811  5.361   -6.125  1.00 0.00 ? 4  LYS A HG2  9  
ATOM 9462  H HG3  . LYS A 1 3  ? -2.515  6.553   -6.022  1.00 0.00 ? 4  LYS A HG3  9  
ATOM 9463  H HD2  . LYS A 1 3  ? -3.573  7.003   -4.024  1.00 0.00 ? 4  LYS A HD2  9  
ATOM 9464  H HD3  . LYS A 1 3  ? -4.502  8.071   -5.076  1.00 0.00 ? 4  LYS A HD3  9  
ATOM 9465  H HE2  . LYS A 1 3  ? -6.316  6.967   -4.274  1.00 0.00 ? 4  LYS A HE2  9  
ATOM 9466  H HE3  . LYS A 1 3  ? -5.830  5.679   -5.377  1.00 0.00 ? 4  LYS A HE3  9  
ATOM 9467  H HZ1  . LYS A 1 3  ? -4.971  5.938   -2.546  1.00 0.00 ? 4  LYS A HZ1  9  
ATOM 9468  H HZ2  . LYS A 1 3  ? -6.144  4.858   -3.123  1.00 0.00 ? 4  LYS A HZ2  9  
ATOM 9469  H HZ3  . LYS A 1 3  ? -4.525  4.691   -3.609  1.00 0.00 ? 4  LYS A HZ3  9  
ATOM 9470  N N    . PRO A 1 4  ? -0.801  6.828   -8.258  1.00 0.00 ? 5  PRO A N    9  
ATOM 9471  C CA   . PRO A 1 4  ? 0.221   5.934   -8.825  1.00 0.00 ? 5  PRO A CA   9  
ATOM 9472  C C    . PRO A 1 4  ? 0.010   4.488   -8.389  1.00 0.00 ? 5  PRO A C    9  
ATOM 9473  O O    . PRO A 1 4  ? -0.710  4.202   -7.454  1.00 0.00 ? 5  PRO A O    9  
ATOM 9474  C CB   . PRO A 1 4  ? 1.528   6.470   -8.278  1.00 0.00 ? 5  PRO A CB   9  
ATOM 9475  C CG   . PRO A 1 4  ? 1.169   7.274   -7.021  1.00 0.00 ? 5  PRO A CG   9  
ATOM 9476  C CD   . PRO A 1 4  ? -0.324  7.631   -7.122  1.00 0.00 ? 5  PRO A CD   9  
ATOM 9477  H HA   . PRO A 1 4  ? 0.241   6.012   -9.882  1.00 0.00 ? 5  PRO A HA   9  
ATOM 9478  H HB2  . PRO A 1 4  ? 2.183   5.647   -8.025  1.00 0.00 ? 5  PRO A HB2  9  
ATOM 9479  H HB3  . PRO A 1 4  ? 1.995   7.113   -9.005  1.00 0.00 ? 5  PRO A HB3  9  
ATOM 9480  H HG2  . PRO A 1 4  ? 1.348   6.673   -6.149  1.00 0.00 ? 5  PRO A HG2  9  
ATOM 9481  H HG3  . PRO A 1 4  ? 1.754   8.169   -6.991  1.00 0.00 ? 5  PRO A HG3  9  
ATOM 9482  H HD2  . PRO A 1 4  ? -0.840  7.355   -6.213  1.00 0.00 ? 5  PRO A HD2  9  
ATOM 9483  H HD3  . PRO A 1 4  ? -0.450  8.682   -7.329  1.00 0.00 ? 5  PRO A HD3  9  
ATOM 9484  N N    . LYS A 1 5  ? 0.646   3.575   -9.065  1.00 0.00 ? 6  LYS A N    9  
ATOM 9485  C CA   . LYS A 1 5  ? 0.503   2.139   -8.701  1.00 0.00 ? 6  LYS A CA   9  
ATOM 9486  C C    . LYS A 1 5  ? 1.166   1.897   -7.344  1.00 0.00 ? 6  LYS A C    9  
ATOM 9487  O O    . LYS A 1 5  ? 2.366   2.015   -7.198  1.00 0.00 ? 6  LYS A O    9  
ATOM 9488  C CB   . LYS A 1 5  ? 1.174   1.283   -9.766  1.00 0.00 ? 6  LYS A CB   9  
ATOM 9489  C CG   . LYS A 1 5  ? 2.602   1.777   -10.003 1.00 0.00 ? 6  LYS A CG   9  
ATOM 9490  C CD   . LYS A 1 5  ? 3.551   0.579   -10.078 1.00 0.00 ? 6  LYS A CD   9  
ATOM 9491  C CE   . LYS A 1 5  ? 3.276   -0.209  -11.361 1.00 0.00 ? 6  LYS A CE   9  
ATOM 9492  N NZ   . LYS A 1 5  ? 4.261   -1.323  -11.480 1.00 0.00 ? 6  LYS A NZ   9  
ATOM 9493  H H    . LYS A 1 5  ? 1.223   3.837   -9.811  1.00 0.00 ? 6  LYS A H    9  
ATOM 9494  H HA   . LYS A 1 5  ? -0.541  1.882   -8.647  1.00 0.00 ? 6  LYS A HA   9  
ATOM 9495  H HB2  . LYS A 1 5  ? 1.192   0.256   -9.438  1.00 0.00 ? 6  LYS A HB2  9  
ATOM 9496  H HB3  . LYS A 1 5  ? 0.612   1.360   -10.681 1.00 0.00 ? 6  LYS A HB3  9  
ATOM 9497  H HG2  . LYS A 1 5  ? 2.641   2.328   -10.931 1.00 0.00 ? 6  LYS A HG2  9  
ATOM 9498  H HG3  . LYS A 1 5  ? 2.901   2.421   -9.189  1.00 0.00 ? 6  LYS A HG3  9  
ATOM 9499  H HD2  . LYS A 1 5  ? 4.573   0.930   -10.082 1.00 0.00 ? 6  LYS A HD2  9  
ATOM 9500  H HD3  . LYS A 1 5  ? 3.392   -0.060  -9.223  1.00 0.00 ? 6  LYS A HD3  9  
ATOM 9501  H HE2  . LYS A 1 5  ? 2.277   -0.615  -11.327 1.00 0.00 ? 6  LYS A HE2  9  
ATOM 9502  H HE3  . LYS A 1 5  ? 3.370   0.447   -12.213 1.00 0.00 ? 6  LYS A HE3  9  
ATOM 9503  H HZ1  . LYS A 1 5  ? 4.471   -1.702  -10.534 1.00 0.00 ? 6  LYS A HZ1  9  
ATOM 9504  H HZ2  . LYS A 1 5  ? 3.862   -2.076  -12.075 1.00 0.00 ? 6  LYS A HZ2  9  
ATOM 9505  H HZ3  . LYS A 1 5  ? 5.136   -0.968  -11.915 1.00 0.00 ? 6  LYS A HZ3  9  
ATOM 9506  N N    . ARG A 1 6  ? 0.390   1.573   -6.349  1.00 0.00 ? 7  ARG A N    9  
ATOM 9507  C CA   . ARG A 1 6  ? 0.968   1.339   -4.996  1.00 0.00 ? 7  ARG A CA   9  
ATOM 9508  C C    . ARG A 1 6  ? 1.857   0.087   -5.001  1.00 0.00 ? 7  ARG A C    9  
ATOM 9509  O O    . ARG A 1 6  ? 1.608   -0.849  -5.733  1.00 0.00 ? 7  ARG A O    9  
ATOM 9510  C CB   . ARG A 1 6  ? -0.168  1.145   -3.991  1.00 0.00 ? 7  ARG A CB   9  
ATOM 9511  C CG   . ARG A 1 6  ? -0.977  -0.095  -4.376  1.00 0.00 ? 7  ARG A CG   9  
ATOM 9512  C CD   . ARG A 1 6  ? -1.948  -0.447  -3.248  1.00 0.00 ? 7  ARG A CD   9  
ATOM 9513  N NE   . ARG A 1 6  ? -3.334  -0.514  -3.791  1.00 0.00 ? 7  ARG A NE   9  
ATOM 9514  C CZ   . ARG A 1 6  ? -4.217  -1.291  -3.228  1.00 0.00 ? 7  ARG A CZ   9  
ATOM 9515  N NH1  . ARG A 1 6  ? -4.076  -1.641  -1.978  1.00 0.00 ? 7  ARG A NH1  9  
ATOM 9516  N NH2  . ARG A 1 6  ? -5.242  -1.717  -3.914  1.00 0.00 ? 7  ARG A NH2  9  
ATOM 9517  H H    . ARG A 1 6  ? -0.577  1.496   -6.487  1.00 0.00 ? 7  ARG A H    9  
ATOM 9518  H HA   . ARG A 1 6  ? 1.555   2.198   -4.707  1.00 0.00 ? 7  ARG A HA   9  
ATOM 9519  H HB2  . ARG A 1 6  ? 0.246   1.012   -3.001  1.00 0.00 ? 7  ARG A HB2  9  
ATOM 9520  H HB3  . ARG A 1 6  ? -0.811  2.011   -4.001  1.00 0.00 ? 7  ARG A HB3  9  
ATOM 9521  H HG2  . ARG A 1 6  ? -1.534  0.107   -5.281  1.00 0.00 ? 7  ARG A HG2  9  
ATOM 9522  H HG3  . ARG A 1 6  ? -0.308  -0.925  -4.544  1.00 0.00 ? 7  ARG A HG3  9  
ATOM 9523  H HD2  . ARG A 1 6  ? -1.678  -1.404  -2.827  1.00 0.00 ? 7  ARG A HD2  9  
ATOM 9524  H HD3  . ARG A 1 6  ? -1.897  0.311   -2.481  1.00 0.00 ? 7  ARG A HD3  9  
ATOM 9525  H HE   . ARG A 1 6  ? -3.580  0.024   -4.572  1.00 0.00 ? 7  ARG A HE   9  
ATOM 9526  H HH11 . ARG A 1 6  ? -3.291  -1.313  -1.453  1.00 0.00 ? 7  ARG A HH11 9  
ATOM 9527  H HH12 . ARG A 1 6  ? -4.754  -2.236  -1.546  1.00 0.00 ? 7  ARG A HH12 9  
ATOM 9528  H HH21 . ARG A 1 6  ? -5.349  -1.448  -4.872  1.00 0.00 ? 7  ARG A HH21 9  
ATOM 9529  H HH22 . ARG A 1 6  ? -5.920  -2.313  -3.483  1.00 0.00 ? 7  ARG A HH22 9  
ATOM 9530  N N    . PRO A 1 7  ? 2.864   0.113   -4.160  1.00 0.00 ? 8  PRO A N    9  
ATOM 9531  C CA   . PRO A 1 7  ? 3.815   -1.003  -4.008  1.00 0.00 ? 8  PRO A CA   9  
ATOM 9532  C C    . PRO A 1 7  ? 3.155   -2.167  -3.269  1.00 0.00 ? 8  PRO A C    9  
ATOM 9533  O O    . PRO A 1 7  ? 2.182   -1.998  -2.560  1.00 0.00 ? 8  PRO A O    9  
ATOM 9534  C CB   . PRO A 1 7  ? 4.957   -0.396  -3.183  1.00 0.00 ? 8  PRO A CB   9  
ATOM 9535  C CG   . PRO A 1 7  ? 4.353   0.822   -2.445  1.00 0.00 ? 8  PRO A CG   9  
ATOM 9536  C CD   . PRO A 1 7  ? 3.142   1.264   -3.282  1.00 0.00 ? 8  PRO A CD   9  
ATOM 9537  H HA   . PRO A 1 7  ? 4.185   -1.326  -4.967  1.00 0.00 ? 8  PRO A HA   9  
ATOM 9538  H HB2  . PRO A 1 7  ? 5.326   -1.123  -2.469  1.00 0.00 ? 8  PRO A HB2  9  
ATOM 9539  H HB3  . PRO A 1 7  ? 5.755   -0.071  -3.831  1.00 0.00 ? 8  PRO A HB3  9  
ATOM 9540  H HG2  . PRO A 1 7  ? 4.036   0.533   -1.452  1.00 0.00 ? 8  PRO A HG2  9  
ATOM 9541  H HG3  . PRO A 1 7  ? 5.071   1.627   -2.387  1.00 0.00 ? 8  PRO A HG3  9  
ATOM 9542  H HD2  . PRO A 1 7  ? 2.295   1.473   -2.648  1.00 0.00 ? 8  PRO A HD2  9  
ATOM 9543  H HD3  . PRO A 1 7  ? 3.393   2.120   -3.883  1.00 0.00 ? 8  PRO A HD3  9  
ATOM 9544  N N    . LEU A 1 8  ? 3.675   -3.346  -3.439  1.00 0.00 ? 9  LEU A N    9  
ATOM 9545  C CA   . LEU A 1 8  ? 3.083   -4.533  -2.761  1.00 0.00 ? 9  LEU A CA   9  
ATOM 9546  C C    . LEU A 1 8  ? 4.144   -5.597  -2.550  1.00 0.00 ? 9  LEU A C    9  
ATOM 9547  O O    . LEU A 1 8  ? 5.331   -5.366  -2.671  1.00 0.00 ? 9  LEU A O    9  
ATOM 9548  C CB   . LEU A 1 8  ? 1.939   -5.106  -3.603  1.00 0.00 ? 9  LEU A CB   9  
ATOM 9549  C CG   . LEU A 1 8  ? 2.511   -5.910  -4.765  1.00 0.00 ? 9  LEU A CG   9  
ATOM 9550  C CD1  . LEU A 1 8  ? 1.402   -6.213  -5.767  1.00 0.00 ? 9  LEU A CD1  9  
ATOM 9551  C CD2  . LEU A 1 8  ? 3.606   -5.084  -5.429  1.00 0.00 ? 9  LEU A CD2  9  
ATOM 9552  H H    . LEU A 1 8  ? 4.457   -3.452  -4.019  1.00 0.00 ? 9  LEU A H    9  
ATOM 9553  H HA   . LEU A 1 8  ? 2.698   -4.254  -1.808  1.00 0.00 ? 9  LEU A HA   9  
ATOM 9554  H HB2  . LEU A 1 8  ? 1.328   -5.751  -2.987  1.00 0.00 ? 9  LEU A HB2  9  
ATOM 9555  H HB3  . LEU A 1 8  ? 1.335   -4.299  -3.988  1.00 0.00 ? 9  LEU A HB3  9  
ATOM 9556  H HG   . LEU A 1 8  ? 2.927   -6.835  -4.394  1.00 0.00 ? 9  LEU A HG   9  
ATOM 9557  H HD11 . LEU A 1 8  ? 0.613   -6.756  -5.268  1.00 0.00 ? 9  LEU A HD11 9  
ATOM 9558  H HD12 . LEU A 1 8  ? 1.010   -5.287  -6.160  1.00 0.00 ? 9  LEU A HD12 9  
ATOM 9559  H HD13 . LEU A 1 8  ? 1.798   -6.810  -6.573  1.00 0.00 ? 9  LEU A HD13 9  
ATOM 9560  H HD21 . LEU A 1 8  ? 3.294   -4.052  -5.473  1.00 0.00 ? 9  LEU A HD21 9  
ATOM 9561  H HD22 . LEU A 1 8  ? 4.507   -5.160  -4.837  1.00 0.00 ? 9  LEU A HD22 9  
ATOM 9562  H HD23 . LEU A 1 8  ? 3.790   -5.450  -6.422  1.00 0.00 ? 9  LEU A HD23 9  
ATOM 9563  N N    . SER A 1 9  ? 3.700   -6.757  -2.211  1.00 0.00 ? 10 SER A N    9  
ATOM 9564  C CA   . SER A 1 9  ? 4.638   -7.885  -1.950  1.00 0.00 ? 10 SER A CA   9  
ATOM 9565  C C    . SER A 1 9  ? 4.891   -8.690  -3.228  1.00 0.00 ? 10 SER A C    9  
ATOM 9566  O O    . SER A 1 9  ? 4.073   -8.745  -4.133  1.00 0.00 ? 10 SER A O    9  
ATOM 9567  C CB   . SER A 1 9  ? 4.040   -8.803  -0.883  1.00 0.00 ? 10 SER A CB   9  
ATOM 9568  O OG   . SER A 1 9  ? 2.851   -8.216  -0.371  1.00 0.00 ? 10 SER A OG   9  
ATOM 9569  H H    . SER A 1 9  ? 2.735   -6.877  -2.112  1.00 0.00 ? 10 SER A H    9  
ATOM 9570  H HA   . SER A 1 9  ? 5.575   -7.489  -1.588  1.00 0.00 ? 10 SER A HA   9  
ATOM 9571  H HB2  . SER A 1 9  ? 3.803   -9.759  -1.320  1.00 0.00 ? 10 SER A HB2  9  
ATOM 9572  H HB3  . SER A 1 9  ? 4.758   -8.943  -0.086  1.00 0.00 ? 10 SER A HB3  9  
ATOM 9573  H HG   . SER A 1 9  ? 2.106   -8.733  -0.683  1.00 0.00 ? 10 SER A HG   9  
ATOM 9574  N N    . ALA A 1 10 ? 6.028   -9.329  -3.296  1.00 0.00 ? 11 ALA A N    9  
ATOM 9575  C CA   . ALA A 1 10 ? 6.362   -10.149 -4.490  1.00 0.00 ? 11 ALA A CA   9  
ATOM 9576  C C    . ALA A 1 10 ? 5.323   -11.259 -4.632  1.00 0.00 ? 11 ALA A C    9  
ATOM 9577  O O    . ALA A 1 10 ? 4.967   -11.658 -5.723  1.00 0.00 ? 11 ALA A O    9  
ATOM 9578  C CB   . ALA A 1 10 ? 7.748   -10.767 -4.306  1.00 0.00 ? 11 ALA A CB   9  
ATOM 9579  H H    . ALA A 1 10 ? 6.662   -9.274  -2.550  1.00 0.00 ? 11 ALA A H    9  
ATOM 9580  H HA   . ALA A 1 10 ? 6.355   -9.528  -5.372  1.00 0.00 ? 11 ALA A HA   9  
ATOM 9581  H HB1  . ALA A 1 10 ? 8.241   -10.302 -3.466  1.00 0.00 ? 11 ALA A HB1  9  
ATOM 9582  H HB2  . ALA A 1 10 ? 7.649   -11.826 -4.123  1.00 0.00 ? 11 ALA A HB2  9  
ATOM 9583  H HB3  . ALA A 1 10 ? 8.332   -10.610 -5.198  1.00 0.00 ? 11 ALA A HB3  9  
ATOM 9584  N N    . TYR A 1 11 ? 4.826   -11.755 -3.531  1.00 0.00 ? 12 TYR A N    9  
ATOM 9585  C CA   . TYR A 1 11 ? 3.805   -12.826 -3.588  1.00 0.00 ? 12 TYR A CA   9  
ATOM 9586  C C    . TYR A 1 11 ? 2.588   -12.303 -4.351  1.00 0.00 ? 12 TYR A C    9  
ATOM 9587  O O    . TYR A 1 11 ? 1.890   -13.043 -5.014  1.00 0.00 ? 12 TYR A O    9  
ATOM 9588  C CB   . TYR A 1 11 ? 3.415   -13.189 -2.158  1.00 0.00 ? 12 TYR A CB   9  
ATOM 9589  C CG   . TYR A 1 11 ? 2.142   -13.996 -2.171  1.00 0.00 ? 12 TYR A CG   9  
ATOM 9590  C CD1  . TYR A 1 11 ? 2.067   -15.161 -2.940  1.00 0.00 ? 12 TYR A CD1  9  
ATOM 9591  C CD2  . TYR A 1 11 ? 1.038   -13.579 -1.420  1.00 0.00 ? 12 TYR A CD2  9  
ATOM 9592  C CE1  . TYR A 1 11 ? 0.890   -15.913 -2.958  1.00 0.00 ? 12 TYR A CE1  9  
ATOM 9593  C CE2  . TYR A 1 11 ? -0.142  -14.330 -1.438  1.00 0.00 ? 12 TYR A CE2  9  
ATOM 9594  C CZ   . TYR A 1 11 ? -0.216  -15.498 -2.207  1.00 0.00 ? 12 TYR A CZ   9  
ATOM 9595  O OH   . TYR A 1 11 ? -1.381  -16.239 -2.226  1.00 0.00 ? 12 TYR A OH   9  
ATOM 9596  H H    . TYR A 1 11 ? 5.118   -11.413 -2.660  1.00 0.00 ? 12 TYR A H    9  
ATOM 9597  H HA   . TYR A 1 11 ? 4.206   -13.695 -4.090  1.00 0.00 ? 12 TYR A HA   9  
ATOM 9598  H HB2  . TYR A 1 11 ? 4.207   -13.769 -1.710  1.00 0.00 ? 12 TYR A HB2  9  
ATOM 9599  H HB3  . TYR A 1 11 ? 3.267   -12.283 -1.591  1.00 0.00 ? 12 TYR A HB3  9  
ATOM 9600  H HD1  . TYR A 1 11 ? 2.920   -15.481 -3.519  1.00 0.00 ? 12 TYR A HD1  9  
ATOM 9601  H HD2  . TYR A 1 11 ? 1.097   -12.678 -0.827  1.00 0.00 ? 12 TYR A HD2  9  
ATOM 9602  H HE1  . TYR A 1 11 ? 0.837   -16.812 -3.551  1.00 0.00 ? 12 TYR A HE1  9  
ATOM 9603  H HE2  . TYR A 1 11 ? -0.994  -14.009 -0.858  1.00 0.00 ? 12 TYR A HE2  9  
ATOM 9604  H HH   . TYR A 1 11 ? -1.691  -16.328 -1.321  1.00 0.00 ? 12 TYR A HH   9  
ATOM 9605  N N    . MET A 1 12 ? 2.337   -11.025 -4.264  1.00 0.00 ? 13 MET A N    9  
ATOM 9606  C CA   . MET A 1 12 ? 1.179   -10.443 -4.984  1.00 0.00 ? 13 MET A CA   9  
ATOM 9607  C C    . MET A 1 12 ? 1.469   -10.443 -6.484  1.00 0.00 ? 13 MET A C    9  
ATOM 9608  O O    . MET A 1 12 ? 0.653   -10.865 -7.280  1.00 0.00 ? 13 MET A O    9  
ATOM 9609  C CB   . MET A 1 12 ? 0.960   -9.009  -4.503  1.00 0.00 ? 13 MET A CB   9  
ATOM 9610  C CG   . MET A 1 12 ? 0.999   -8.964  -2.972  1.00 0.00 ? 13 MET A CG   9  
ATOM 9611  S SD   . MET A 1 12 ? -0.048  -10.276 -2.292  1.00 0.00 ? 13 MET A SD   9  
ATOM 9612  C CE   . MET A 1 12 ? -1.645  -9.537  -2.714  1.00 0.00 ? 13 MET A CE   9  
ATOM 9613  H H    . MET A 1 12 ? 2.915   -10.447 -3.728  1.00 0.00 ? 13 MET A H    9  
ATOM 9614  H HA   . MET A 1 12 ? 0.295   -11.030 -4.785  1.00 0.00 ? 13 MET A HA   9  
ATOM 9615  H HB2  . MET A 1 12 ? 1.738   -8.374  -4.903  1.00 0.00 ? 13 MET A HB2  9  
ATOM 9616  H HB3  . MET A 1 12 ? 0.002   -8.661  -4.846  1.00 0.00 ? 13 MET A HB3  9  
ATOM 9617  H HG2  . MET A 1 12 ? 2.015   -9.104  -2.635  1.00 0.00 ? 13 MET A HG2  9  
ATOM 9618  H HG3  . MET A 1 12 ? 0.638   -8.004  -2.633  1.00 0.00 ? 13 MET A HG3  9  
ATOM 9619  H HE1  . MET A 1 12 ? -1.571  -9.047  -3.676  1.00 0.00 ? 13 MET A HE1  9  
ATOM 9620  H HE2  . MET A 1 12 ? -2.397  -10.308 -2.764  1.00 0.00 ? 13 MET A HE2  9  
ATOM 9621  H HE3  . MET A 1 12 ? -1.918  -8.815  -1.957  1.00 0.00 ? 13 MET A HE3  9  
ATOM 9622  N N    . LEU A 1 13 ? 2.626   -9.981  -6.881  1.00 0.00 ? 14 LEU A N    9  
ATOM 9623  C CA   . LEU A 1 13 ? 2.944   -9.973  -8.341  1.00 0.00 ? 14 LEU A CA   9  
ATOM 9624  C C    . LEU A 1 13 ? 2.632   -11.349 -8.921  1.00 0.00 ? 14 LEU A C    9  
ATOM 9625  O O    . LEU A 1 13 ? 1.968   -11.478 -9.930  1.00 0.00 ? 14 LEU A O    9  
ATOM 9626  C CB   . LEU A 1 13 ? 4.428   -9.666  -8.574  1.00 0.00 ? 14 LEU A CB   9  
ATOM 9627  C CG   . LEU A 1 13 ? 4.926   -8.648  -7.546  1.00 0.00 ? 14 LEU A CG   9  
ATOM 9628  C CD1  . LEU A 1 13 ? 6.301   -8.122  -7.970  1.00 0.00 ? 14 LEU A CD1  9  
ATOM 9629  C CD2  . LEU A 1 13 ? 3.943   -7.482  -7.477  1.00 0.00 ? 14 LEU A CD2  9  
ATOM 9630  H H    . LEU A 1 13 ? 3.276   -9.645  -6.224  1.00 0.00 ? 14 LEU A H    9  
ATOM 9631  H HA   . LEU A 1 13 ? 2.339   -9.228  -8.838  1.00 0.00 ? 14 LEU A HA   9  
ATOM 9632  H HB2  . LEU A 1 13 ? 5.003   -10.582 -8.497  1.00 0.00 ? 14 LEU A HB2  9  
ATOM 9633  H HB3  . LEU A 1 13 ? 4.551   -9.256  -9.565  1.00 0.00 ? 14 LEU A HB3  9  
ATOM 9634  H HG   . LEU A 1 13 ? 5.002   -9.118  -6.578  1.00 0.00 ? 14 LEU A HG   9  
ATOM 9635  H HD11 . LEU A 1 13 ? 6.402   -8.205  -9.043  1.00 0.00 ? 14 LEU A HD11 9  
ATOM 9636  H HD12 . LEU A 1 13 ? 6.401   -7.083  -7.677  1.00 0.00 ? 14 LEU A HD12 9  
ATOM 9637  H HD13 . LEU A 1 13 ? 7.072   -8.707  -7.490  1.00 0.00 ? 14 LEU A HD13 9  
ATOM 9638  H HD21 . LEU A 1 13 ? 3.126   -7.657  -8.162  1.00 0.00 ? 14 LEU A HD21 9  
ATOM 9639  H HD22 . LEU A 1 13 ? 3.557   -7.395  -6.472  1.00 0.00 ? 14 LEU A HD22 9  
ATOM 9640  H HD23 . LEU A 1 13 ? 4.451   -6.569  -7.750  1.00 0.00 ? 14 LEU A HD23 9  
ATOM 9641  N N    . TRP A 1 14 ? 3.110   -12.382 -8.285  1.00 0.00 ? 15 TRP A N    9  
ATOM 9642  C CA   . TRP A 1 14 ? 2.851   -13.758 -8.788  1.00 0.00 ? 15 TRP A CA   9  
ATOM 9643  C C    . TRP A 1 14 ? 1.342   -13.993 -8.881  1.00 0.00 ? 15 TRP A C    9  
ATOM 9644  O O    . TRP A 1 14 ? 0.835   -14.441 -9.890  1.00 0.00 ? 15 TRP A O    9  
ATOM 9645  C CB   . TRP A 1 14 ? 3.471   -14.767 -7.820  1.00 0.00 ? 15 TRP A CB   9  
ATOM 9646  C CG   . TRP A 1 14 ? 3.124   -16.152 -8.256  1.00 0.00 ? 15 TRP A CG   9  
ATOM 9647  C CD1  . TRP A 1 14 ? 3.727   -16.822 -9.263  1.00 0.00 ? 15 TRP A CD1  9  
ATOM 9648  C CD2  . TRP A 1 14 ? 2.108   -17.046 -7.717  1.00 0.00 ? 15 TRP A CD2  9  
ATOM 9649  N NE1  . TRP A 1 14 ? 3.144   -18.071 -9.378  1.00 0.00 ? 15 TRP A NE1  9  
ATOM 9650  C CE2  . TRP A 1 14 ? 2.141   -18.256 -8.447  1.00 0.00 ? 15 TRP A CE2  9  
ATOM 9651  C CE3  . TRP A 1 14 ? 1.172   -16.922 -6.675  1.00 0.00 ? 15 TRP A CE3  9  
ATOM 9652  C CZ2  . TRP A 1 14 ? 1.272   -19.309 -8.153  1.00 0.00 ? 15 TRP A CZ2  9  
ATOM 9653  C CZ3  . TRP A 1 14 ? 0.297   -17.978 -6.377  1.00 0.00 ? 15 TRP A CZ3  9  
ATOM 9654  C CH2  . TRP A 1 14 ? 0.346   -19.170 -7.115  1.00 0.00 ? 15 TRP A CH2  9  
ATOM 9655  H H    . TRP A 1 14 ? 3.644   -12.250 -7.473  1.00 0.00 ? 15 TRP A H    9  
ATOM 9656  H HA   . TRP A 1 14 ? 3.296   -13.875 -9.763  1.00 0.00 ? 15 TRP A HA   9  
ATOM 9657  H HB2  . TRP A 1 14 ? 4.544   -14.649 -7.816  1.00 0.00 ? 15 TRP A HB2  9  
ATOM 9658  H HB3  . TRP A 1 14 ? 3.087   -14.596 -6.825  1.00 0.00 ? 15 TRP A HB3  9  
ATOM 9659  H HD1  . TRP A 1 14 ? 4.531   -16.443 -9.875  1.00 0.00 ? 15 TRP A HD1  9  
ATOM 9660  H HE1  . TRP A 1 14 ? 3.396   -18.754 -10.032 1.00 0.00 ? 15 TRP A HE1  9  
ATOM 9661  H HE3  . TRP A 1 14 ? 1.126   -16.007 -6.101  1.00 0.00 ? 15 TRP A HE3  9  
ATOM 9662  H HZ2  . TRP A 1 14 ? 1.314   -20.225 -8.724  1.00 0.00 ? 15 TRP A HZ2  9  
ATOM 9663  H HZ3  . TRP A 1 14 ? -0.417  -17.871 -5.574  1.00 0.00 ? 15 TRP A HZ3  9  
ATOM 9664  H HH2  . TRP A 1 14 ? -0.329  -19.980 -6.880  1.00 0.00 ? 15 TRP A HH2  9  
ATOM 9665  N N    . LEU A 1 15 ? 0.621   -13.695 -7.835  1.00 0.00 ? 16 LEU A N    9  
ATOM 9666  C CA   . LEU A 1 15 ? -0.854  -13.902 -7.860  1.00 0.00 ? 16 LEU A CA   9  
ATOM 9667  C C    . LEU A 1 15 ? -1.465  -13.139 -9.038  1.00 0.00 ? 16 LEU A C    9  
ATOM 9668  O O    . LEU A 1 15 ? -2.505  -13.501 -9.551  1.00 0.00 ? 16 LEU A O    9  
ATOM 9669  C CB   . LEU A 1 15 ? -1.455  -13.386 -6.551  1.00 0.00 ? 16 LEU A CB   9  
ATOM 9670  C CG   . LEU A 1 15 ? -0.868  -14.173 -5.379  1.00 0.00 ? 16 LEU A CG   9  
ATOM 9671  C CD1  . LEU A 1 15 ? -1.076  -13.388 -4.082  1.00 0.00 ? 16 LEU A CD1  9  
ATOM 9672  C CD2  . LEU A 1 15 ? -1.572  -15.527 -5.274  1.00 0.00 ? 16 LEU A CD2  9  
ATOM 9673  H H    . LEU A 1 15 ? 1.050   -13.336 -7.031  1.00 0.00 ? 16 LEU A H    9  
ATOM 9674  H HA   . LEU A 1 15 ? -1.068  -14.955 -7.963  1.00 0.00 ? 16 LEU A HA   9  
ATOM 9675  H HB2  . LEU A 1 15 ? -1.220  -12.339 -6.436  1.00 0.00 ? 16 LEU A HB2  9  
ATOM 9676  H HB3  . LEU A 1 15 ? -2.526  -13.517 -6.570  1.00 0.00 ? 16 LEU A HB3  9  
ATOM 9677  H HG   . LEU A 1 15 ? 0.189   -14.326 -5.541  1.00 0.00 ? 16 LEU A HG   9  
ATOM 9678  H HD11 . LEU A 1 15 ? -1.580  -12.459 -4.302  1.00 0.00 ? 16 LEU A HD11 9  
ATOM 9679  H HD12 . LEU A 1 15 ? -1.675  -13.971 -3.401  1.00 0.00 ? 16 LEU A HD12 9  
ATOM 9680  H HD13 . LEU A 1 15 ? -0.117  -13.179 -3.631  1.00 0.00 ? 16 LEU A HD13 9  
ATOM 9681  H HD21 . LEU A 1 15 ? -1.694  -15.946 -6.262  1.00 0.00 ? 16 LEU A HD21 9  
ATOM 9682  H HD22 . LEU A 1 15 ? -0.978  -16.196 -4.670  1.00 0.00 ? 16 LEU A HD22 9  
ATOM 9683  H HD23 . LEU A 1 15 ? -2.541  -15.394 -4.816  1.00 0.00 ? 16 LEU A HD23 9  
ATOM 9684  N N    . ASN A 1 16 ? -0.830  -12.083 -9.469  1.00 0.00 ? 17 ASN A N    9  
ATOM 9685  C CA   . ASN A 1 16 ? -1.374  -11.300 -10.609 1.00 0.00 ? 17 ASN A CA   9  
ATOM 9686  C C    . ASN A 1 16 ? -1.022  -11.991 -11.927 1.00 0.00 ? 17 ASN A C    9  
ATOM 9687  O O    . ASN A 1 16 ? -1.789  -11.978 -12.869 1.00 0.00 ? 17 ASN A O    9  
ATOM 9688  C CB   . ASN A 1 16 ? -0.768  -9.908  -10.589 1.00 0.00 ? 17 ASN A CB   9  
ATOM 9689  C CG   . ASN A 1 16 ? -0.665  -9.411  -9.146  1.00 0.00 ? 17 ASN A CG   9  
ATOM 9690  O OD1  . ASN A 1 16 ? -1.353  -9.900  -8.272  1.00 0.00 ? 17 ASN A OD1  9  
ATOM 9691  N ND2  . ASN A 1 16 ? 0.171   -8.452  -8.856  1.00 0.00 ? 17 ASN A ND2  9  
ATOM 9692  H H    . ASN A 1 16 ? 0.006   -11.804 -9.045  1.00 0.00 ? 17 ASN A H    9  
ATOM 9693  H HA   . ASN A 1 16 ? -2.441  -11.216 -10.519 1.00 0.00 ? 17 ASN A HA   9  
ATOM 9694  H HB2  . ASN A 1 16 ? 0.214   -9.939  -11.032 1.00 0.00 ? 17 ASN A HB2  9  
ATOM 9695  H HB3  . ASN A 1 16 ? -1.403  -9.247  -11.151 1.00 0.00 ? 17 ASN A HB3  9  
ATOM 9696  H HD21 . ASN A 1 16 ? 0.727   -8.057  -9.560  1.00 0.00 ? 17 ASN A HD21 9  
ATOM 9697  H HD22 . ASN A 1 16 ? 0.244   -8.125  -7.934  1.00 0.00 ? 17 ASN A HD22 9  
ATOM 9698  N N    . SER A 1 17 ? 0.131   -12.594 -12.000 1.00 0.00 ? 18 SER A N    9  
ATOM 9699  C CA   . SER A 1 17 ? 0.533   -13.287 -13.255 1.00 0.00 ? 18 SER A CA   9  
ATOM 9700  C C    . SER A 1 17 ? 0.000   -14.720 -13.246 1.00 0.00 ? 18 SER A C    9  
ATOM 9701  O O    . SER A 1 17 ? 0.113   -15.439 -14.219 1.00 0.00 ? 18 SER A O    9  
ATOM 9702  C CB   . SER A 1 17 ? 2.052   -13.316 -13.357 1.00 0.00 ? 18 SER A CB   9  
ATOM 9703  O OG   . SER A 1 17 ? 2.547   -14.454 -12.664 1.00 0.00 ? 18 SER A OG   9  
ATOM 9704  H H    . SER A 1 17 ? 0.734   -12.593 -11.227 1.00 0.00 ? 18 SER A H    9  
ATOM 9705  H HA   . SER A 1 17 ? 0.133   -12.758 -14.105 1.00 0.00 ? 18 SER A HA   9  
ATOM 9706  H HB2  . SER A 1 17 ? 2.336   -13.376 -14.393 1.00 0.00 ? 18 SER A HB2  9  
ATOM 9707  H HB3  . SER A 1 17 ? 2.456   -12.411 -12.926 1.00 0.00 ? 18 SER A HB3  9  
ATOM 9708  H HG   . SER A 1 17 ? 2.191   -14.437 -11.773 1.00 0.00 ? 18 SER A HG   9  
ATOM 9709  N N    . ALA A 1 18 ? -0.577  -15.146 -12.155 1.00 0.00 ? 19 ALA A N    9  
ATOM 9710  C CA   . ALA A 1 18 ? -1.108  -16.535 -12.094 1.00 0.00 ? 19 ALA A CA   9  
ATOM 9711  C C    . ALA A 1 18 ? -2.623  -16.503 -11.906 1.00 0.00 ? 19 ALA A C    9  
ATOM 9712  O O    . ALA A 1 18 ? -3.275  -17.520 -11.938 1.00 0.00 ? 19 ALA A O    9  
ATOM 9713  C CB   . ALA A 1 18 ? -0.476  -17.279 -10.914 1.00 0.00 ? 19 ALA A CB   9  
ATOM 9714  H H    . ALA A 1 18 ? -0.657  -14.554 -11.378 1.00 0.00 ? 19 ALA A H    9  
ATOM 9715  H HA   . ALA A 1 18 ? -0.870  -17.052 -13.012 1.00 0.00 ? 19 ALA A HA   9  
ATOM 9716  H HB1  . ALA A 1 18 ? -0.422  -16.619 -10.061 1.00 0.00 ? 19 ALA A HB1  9  
ATOM 9717  H HB2  . ALA A 1 18 ? -1.083  -18.139 -10.666 1.00 0.00 ? 19 ALA A HB2  9  
ATOM 9718  H HB3  . ALA A 1 18 ? 0.517   -17.604 -11.184 1.00 0.00 ? 19 ALA A HB3  9  
ATOM 9719  N N    . ARG A 1 19 ? -3.194  -15.348 -11.702 1.00 0.00 ? 20 ARG A N    9  
ATOM 9720  C CA   . ARG A 1 19 ? -4.670  -15.283 -11.504 1.00 0.00 ? 20 ARG A CA   9  
ATOM 9721  C C    . ARG A 1 19 ? -5.386  -15.810 -12.745 1.00 0.00 ? 20 ARG A C    9  
ATOM 9722  O O    . ARG A 1 19 ? -6.376  -16.507 -12.649 1.00 0.00 ? 20 ARG A O    9  
ATOM 9723  C CB   . ARG A 1 19 ? -5.094  -13.836 -11.241 1.00 0.00 ? 20 ARG A CB   9  
ATOM 9724  C CG   . ARG A 1 19 ? -5.621  -13.711 -9.811  1.00 0.00 ? 20 ARG A CG   9  
ATOM 9725  C CD   . ARG A 1 19 ? -6.188  -12.306 -9.597  1.00 0.00 ? 20 ARG A CD   9  
ATOM 9726  N NE   . ARG A 1 19 ? -6.853  -12.238 -8.263  1.00 0.00 ? 20 ARG A NE   9  
ATOM 9727  C CZ   . ARG A 1 19 ? -8.140  -12.436 -8.165  1.00 0.00 ? 20 ARG A CZ   9  
ATOM 9728  N NH1  . ARG A 1 19 ? -8.952  -11.899 -9.033  1.00 0.00 ? 20 ARG A NH1  9  
ATOM 9729  N NH2  . ARG A 1 19 ? -8.614  -13.171 -7.197  1.00 0.00 ? 20 ARG A NH2  9  
ATOM 9730  H H    . ARG A 1 19 ? -2.655  -14.529 -11.672 1.00 0.00 ? 20 ARG A H    9  
ATOM 9731  H HA   . ARG A 1 19 ? -4.939  -15.896 -10.658 1.00 0.00 ? 20 ARG A HA   9  
ATOM 9732  H HB2  . ARG A 1 19 ? -4.243  -13.182 -11.373 1.00 0.00 ? 20 ARG A HB2  9  
ATOM 9733  H HB3  . ARG A 1 19 ? -5.872  -13.558 -11.935 1.00 0.00 ? 20 ARG A HB3  9  
ATOM 9734  H HG2  . ARG A 1 19 ? -6.397  -14.442 -9.647  1.00 0.00 ? 20 ARG A HG2  9  
ATOM 9735  H HG3  . ARG A 1 19 ? -4.813  -13.880 -9.114  1.00 0.00 ? 20 ARG A HG3  9  
ATOM 9736  H HD2  . ARG A 1 19 ? -5.386  -11.583 -9.636  1.00 0.00 ? 20 ARG A HD2  9  
ATOM 9737  H HD3  . ARG A 1 19 ? -6.908  -12.088 -10.370 1.00 0.00 ? 20 ARG A HD3  9  
ATOM 9738  H HE   . ARG A 1 19 ? -6.324  -12.043 -7.462  1.00 0.00 ? 20 ARG A HE   9  
ATOM 9739  H HH11 . ARG A 1 19 ? -8.589  -11.335 -9.775  1.00 0.00 ? 20 ARG A HH11 9  
ATOM 9740  H HH12 . ARG A 1 19 ? -9.937  -12.052 -8.956  1.00 0.00 ? 20 ARG A HH12 9  
ATOM 9741  H HH21 . ARG A 1 19 ? -7.994  -13.584 -6.530  1.00 0.00 ? 20 ARG A HH21 9  
ATOM 9742  H HH22 . ARG A 1 19 ? -9.600  -13.323 -7.122  1.00 0.00 ? 20 ARG A HH22 9  
ATOM 9743  N N    . GLU A 1 20 ? -4.901  -15.491 -13.911 1.00 0.00 ? 21 GLU A N    9  
ATOM 9744  C CA   . GLU A 1 20 ? -5.570  -15.987 -15.144 1.00 0.00 ? 21 GLU A CA   9  
ATOM 9745  C C    . GLU A 1 20 ? -5.246  -17.466 -15.336 1.00 0.00 ? 21 GLU A C    9  
ATOM 9746  O O    . GLU A 1 20 ? -6.118  -18.280 -15.564 1.00 0.00 ? 21 GLU A O    9  
ATOM 9747  C CB   . GLU A 1 20 ? -5.078  -15.191 -16.356 1.00 0.00 ? 21 GLU A CB   9  
ATOM 9748  C CG   . GLU A 1 20 ? -6.241  -14.955 -17.321 1.00 0.00 ? 21 GLU A CG   9  
ATOM 9749  C CD   . GLU A 1 20 ? -6.007  -13.658 -18.097 1.00 0.00 ? 21 GLU A CD   9  
ATOM 9750  O OE1  . GLU A 1 20 ? -4.995  -13.022 -17.856 1.00 0.00 ? 21 GLU A OE1  9  
ATOM 9751  O OE2  . GLU A 1 20 ? -6.843  -13.324 -18.920 1.00 0.00 ? 21 GLU A OE2  9  
ATOM 9752  H H    . GLU A 1 20 ? -4.101  -14.929 -13.975 1.00 0.00 ? 21 GLU A H    9  
ATOM 9753  H HA   . GLU A 1 20 ? -6.636  -15.870 -15.042 1.00 0.00 ? 21 GLU A HA   9  
ATOM 9754  H HB2  . GLU A 1 20 ? -4.684  -14.241 -16.025 1.00 0.00 ? 21 GLU A HB2  9  
ATOM 9755  H HB3  . GLU A 1 20 ? -4.301  -15.747 -16.860 1.00 0.00 ? 21 GLU A HB3  9  
ATOM 9756  H HG2  . GLU A 1 20 ? -6.308  -15.783 -18.012 1.00 0.00 ? 21 GLU A HG2  9  
ATOM 9757  H HG3  . GLU A 1 20 ? -7.162  -14.877 -16.763 1.00 0.00 ? 21 GLU A HG3  9  
ATOM 9758  N N    . SER A 1 21 ? -3.998  -17.821 -15.240 1.00 0.00 ? 22 SER A N    9  
ATOM 9759  C CA   . SER A 1 21 ? -3.618  -19.249 -15.411 1.00 0.00 ? 22 SER A CA   9  
ATOM 9760  C C    . SER A 1 21 ? -4.081  -20.042 -14.188 1.00 0.00 ? 22 SER A C    9  
ATOM 9761  O O    . SER A 1 21 ? -4.012  -21.254 -14.163 1.00 0.00 ? 22 SER A O    9  
ATOM 9762  C CB   . SER A 1 21 ? -2.100  -19.362 -15.555 1.00 0.00 ? 22 SER A CB   9  
ATOM 9763  O OG   . SER A 1 21 ? -1.476  -18.834 -14.392 1.00 0.00 ? 22 SER A OG   9  
ATOM 9764  H H    . SER A 1 21 ? -3.312  -17.147 -15.052 1.00 0.00 ? 22 SER A H    9  
ATOM 9765  H HA   . SER A 1 21 ? -4.096  -19.644 -16.296 1.00 0.00 ? 22 SER A HA   9  
ATOM 9766  H HB2  . SER A 1 21 ? -1.823  -20.396 -15.668 1.00 0.00 ? 22 SER A HB2  9  
ATOM 9767  H HB3  . SER A 1 21 ? -1.781  -18.808 -16.429 1.00 0.00 ? 22 SER A HB3  9  
ATOM 9768  H HG   . SER A 1 21 ? -0.774  -19.434 -14.133 1.00 0.00 ? 22 SER A HG   9  
ATOM 9769  N N    . ILE A 1 22 ? -4.566  -19.370 -13.177 1.00 0.00 ? 23 ILE A N    9  
ATOM 9770  C CA   . ILE A 1 22 ? -5.043  -20.091 -11.966 1.00 0.00 ? 23 ILE A CA   9  
ATOM 9771  C C    . ILE A 1 22 ? -6.518  -20.443 -12.156 1.00 0.00 ? 23 ILE A C    9  
ATOM 9772  O O    . ILE A 1 22 ? -6.933  -21.562 -11.928 1.00 0.00 ? 23 ILE A O    9  
ATOM 9773  C CB   . ILE A 1 22 ? -4.866  -19.192 -10.731 1.00 0.00 ? 23 ILE A CB   9  
ATOM 9774  C CG1  . ILE A 1 22 ? -3.453  -19.377 -10.170 1.00 0.00 ? 23 ILE A CG1  9  
ATOM 9775  C CG2  . ILE A 1 22 ? -5.883  -19.564 -9.647  1.00 0.00 ? 23 ILE A CG2  9  
ATOM 9776  C CD1  . ILE A 1 22 ? -3.187  -18.323 -9.094  1.00 0.00 ? 23 ILE A CD1  9  
ATOM 9777  H H    . ILE A 1 22 ? -4.625  -18.391 -13.220 1.00 0.00 ? 23 ILE A H    9  
ATOM 9778  H HA   . ILE A 1 22 ? -4.472  -20.999 -11.836 1.00 0.00 ? 23 ILE A HA   9  
ATOM 9779  H HB   . ILE A 1 22 ? -5.010  -18.161 -11.014 1.00 0.00 ? 23 ILE A HB   9  
ATOM 9780  H HG12 . ILE A 1 22 ? -3.367  -20.363 -9.736  1.00 0.00 ? 23 ILE A HG12 9  
ATOM 9781  H HG13 . ILE A 1 22 ? -2.731  -19.270 -10.964 1.00 0.00 ? 23 ILE A HG13 9  
ATOM 9782  H HG21 . ILE A 1 22 ? -6.883  -19.509 -10.055 1.00 0.00 ? 23 ILE A HG21 9  
ATOM 9783  H HG22 . ILE A 1 22 ? -5.687  -20.568 -9.301  1.00 0.00 ? 23 ILE A HG22 9  
ATOM 9784  H HG23 . ILE A 1 22 ? -5.791  -18.875 -8.820  1.00 0.00 ? 23 ILE A HG23 9  
ATOM 9785  H HD11 . ILE A 1 22 ? -4.016  -18.299 -8.402  1.00 0.00 ? 23 ILE A HD11 9  
ATOM 9786  H HD12 . ILE A 1 22 ? -2.280  -18.572 -8.561  1.00 0.00 ? 23 ILE A HD12 9  
ATOM 9787  H HD13 . ILE A 1 22 ? -3.078  -17.353 -9.558  1.00 0.00 ? 23 ILE A HD13 9  
ATOM 9788  N N    . LYS A 1 23 ? -7.315  -19.497 -12.565 1.00 0.00 ? 24 LYS A N    9  
ATOM 9789  C CA   . LYS A 1 23 ? -8.751  -19.782 -12.756 1.00 0.00 ? 24 LYS A CA   9  
ATOM 9790  C C    . LYS A 1 23 ? -8.925  -20.799 -13.891 1.00 0.00 ? 24 LYS A C    9  
ATOM 9791  O O    . LYS A 1 23 ? -9.922  -21.489 -13.974 1.00 0.00 ? 24 LYS A O    9  
ATOM 9792  C CB   . LYS A 1 23 ? -9.457  -18.468 -13.084 1.00 0.00 ? 24 LYS A CB   9  
ATOM 9793  C CG   . LYS A 1 23 ? -9.367  -18.190 -14.580 1.00 0.00 ? 24 LYS A CG   9  
ATOM 9794  C CD   . LYS A 1 23 ? -9.422  -16.682 -14.825 1.00 0.00 ? 24 LYS A CD   9  
ATOM 9795  C CE   . LYS A 1 23 ? -10.881 -16.228 -14.897 1.00 0.00 ? 24 LYS A CE   9  
ATOM 9796  N NZ   . LYS A 1 23 ? -11.356 -16.308 -16.307 1.00 0.00 ? 24 LYS A NZ   9  
ATOM 9797  H H    . LYS A 1 23 ? -6.972  -18.591 -12.743 1.00 0.00 ? 24 LYS A H    9  
ATOM 9798  H HA   . LYS A 1 23 ? -9.156  -20.186 -11.846 1.00 0.00 ? 24 LYS A HA   9  
ATOM 9799  H HB2  . LYS A 1 23 ? -10.493 -18.526 -12.784 1.00 0.00 ? 24 LYS A HB2  9  
ATOM 9800  H HB3  . LYS A 1 23 ? -8.966  -17.669 -12.546 1.00 0.00 ? 24 LYS A HB3  9  
ATOM 9801  H HG2  . LYS A 1 23 ? -8.436  -18.588 -14.955 1.00 0.00 ? 24 LYS A HG2  9  
ATOM 9802  H HG3  . LYS A 1 23 ? -10.193 -18.669 -15.082 1.00 0.00 ? 24 LYS A HG3  9  
ATOM 9803  H HD2  . LYS A 1 23 ? -8.924  -16.168 -14.015 1.00 0.00 ? 24 LYS A HD2  9  
ATOM 9804  H HD3  . LYS A 1 23 ? -8.928  -16.450 -15.756 1.00 0.00 ? 24 LYS A HD3  9  
ATOM 9805  H HE2  . LYS A 1 23 ? -11.489 -16.869 -14.275 1.00 0.00 ? 24 LYS A HE2  9  
ATOM 9806  H HE3  . LYS A 1 23 ? -10.958 -15.210 -14.548 1.00 0.00 ? 24 LYS A HE3  9  
ATOM 9807  H HZ1  . LYS A 1 23 ? -10.556 -16.539 -16.929 1.00 0.00 ? 24 LYS A HZ1  9  
ATOM 9808  H HZ2  . LYS A 1 23 ? -12.081 -17.049 -16.387 1.00 0.00 ? 24 LYS A HZ2  9  
ATOM 9809  H HZ3  . LYS A 1 23 ? -11.763 -15.392 -16.587 1.00 0.00 ? 24 LYS A HZ3  9  
ATOM 9810  N N    . ARG A 1 24 ? -7.959  -20.895 -14.766 1.00 0.00 ? 25 ARG A N    9  
ATOM 9811  C CA   . ARG A 1 24 ? -8.066  -21.861 -15.892 1.00 0.00 ? 25 ARG A CA   9  
ATOM 9812  C C    . ARG A 1 24 ? -7.441  -23.199 -15.484 1.00 0.00 ? 25 ARG A C    9  
ATOM 9813  O O    . ARG A 1 24 ? -7.893  -24.253 -15.885 1.00 0.00 ? 25 ARG A O    9  
ATOM 9814  C CB   . ARG A 1 24 ? -7.329  -21.304 -17.114 1.00 0.00 ? 25 ARG A CB   9  
ATOM 9815  C CG   . ARG A 1 24 ? -8.015  -20.019 -17.585 1.00 0.00 ? 25 ARG A CG   9  
ATOM 9816  C CD   . ARG A 1 24 ? -8.161  -20.033 -19.101 1.00 0.00 ? 25 ARG A CD   9  
ATOM 9817  N NE   . ARG A 1 24 ? -8.611  -21.381 -19.552 1.00 0.00 ? 25 ARG A NE   9  
ATOM 9818  C CZ   . ARG A 1 24 ? -8.502  -21.719 -20.808 1.00 0.00 ? 25 ARG A CZ   9  
ATOM 9819  N NH1  . ARG A 1 24 ? -9.038  -20.974 -21.735 1.00 0.00 ? 25 ARG A NH1  9  
ATOM 9820  N NH2  . ARG A 1 24 ? -7.856  -22.806 -21.135 1.00 0.00 ? 25 ARG A NH2  9  
ATOM 9821  H H    . ARG A 1 24 ? -7.165  -20.329 -14.684 1.00 0.00 ? 25 ARG A H    9  
ATOM 9822  H HA   . ARG A 1 24 ? -9.105  -22.009 -16.138 1.00 0.00 ? 25 ARG A HA   9  
ATOM 9823  H HB2  . ARG A 1 24 ? -6.304  -21.090 -16.847 1.00 0.00 ? 25 ARG A HB2  9  
ATOM 9824  H HB3  . ARG A 1 24 ? -7.347  -22.034 -17.908 1.00 0.00 ? 25 ARG A HB3  9  
ATOM 9825  H HG2  . ARG A 1 24 ? -8.992  -19.942 -17.136 1.00 0.00 ? 25 ARG A HG2  9  
ATOM 9826  H HG3  . ARG A 1 24 ? -7.419  -19.168 -17.300 1.00 0.00 ? 25 ARG A HG3  9  
ATOM 9827  H HD2  . ARG A 1 24 ? -8.889  -19.294 -19.390 1.00 0.00 ? 25 ARG A HD2  9  
ATOM 9828  H HD3  . ARG A 1 24 ? -7.210  -19.798 -19.551 1.00 0.00 ? 25 ARG A HD3  9  
ATOM 9829  H HE   . ARG A 1 24 ? -8.989  -22.012 -18.906 1.00 0.00 ? 25 ARG A HE   9  
ATOM 9830  H HH11 . ARG A 1 24 ? -9.532  -20.142 -21.485 1.00 0.00 ? 25 ARG A HH11 9  
ATOM 9831  H HH12 . ARG A 1 24 ? -8.954  -21.236 -22.697 1.00 0.00 ? 25 ARG A HH12 9  
ATOM 9832  H HH21 . ARG A 1 24 ? -7.446  -23.376 -20.424 1.00 0.00 ? 25 ARG A HH21 9  
ATOM 9833  H HH22 . ARG A 1 24 ? -7.773  -23.067 -22.097 1.00 0.00 ? 25 ARG A HH22 9  
ATOM 9834  N N    . GLU A 1 25 ? -6.403  -23.165 -14.693 1.00 0.00 ? 26 GLU A N    9  
ATOM 9835  C CA   . GLU A 1 25 ? -5.751  -24.434 -14.264 1.00 0.00 ? 26 GLU A CA   9  
ATOM 9836  C C    . GLU A 1 25 ? -6.463  -24.989 -13.027 1.00 0.00 ? 26 GLU A C    9  
ATOM 9837  O O    . GLU A 1 25 ? -5.963  -25.868 -12.354 1.00 0.00 ? 26 GLU A O    9  
ATOM 9838  C CB   . GLU A 1 25 ? -4.277  -24.166 -13.934 1.00 0.00 ? 26 GLU A CB   9  
ATOM 9839  C CG   . GLU A 1 25 ? -4.168  -23.471 -12.574 1.00 0.00 ? 26 GLU A CG   9  
ATOM 9840  C CD   . GLU A 1 25 ? -2.815  -22.767 -12.469 1.00 0.00 ? 26 GLU A CD   9  
ATOM 9841  O OE1  . GLU A 1 25 ? -2.137  -22.674 -13.479 1.00 0.00 ? 26 GLU A OE1  9  
ATOM 9842  O OE2  . GLU A 1 25 ? -2.479  -22.329 -11.380 1.00 0.00 ? 26 GLU A OE2  9  
ATOM 9843  H H    . GLU A 1 25 ? -6.050  -22.306 -14.383 1.00 0.00 ? 26 GLU A H    9  
ATOM 9844  H HA   . GLU A 1 25 ? -5.812  -25.154 -15.065 1.00 0.00 ? 26 GLU A HA   9  
ATOM 9845  H HB2  . GLU A 1 25 ? -3.741  -25.104 -13.902 1.00 0.00 ? 26 GLU A HB2  9  
ATOM 9846  H HB3  . GLU A 1 25 ? -3.848  -23.533 -14.695 1.00 0.00 ? 26 GLU A HB3  9  
ATOM 9847  H HG2  . GLU A 1 25 ? -4.962  -22.744 -12.476 1.00 0.00 ? 26 GLU A HG2  9  
ATOM 9848  H HG3  . GLU A 1 25 ? -4.252  -24.204 -11.786 1.00 0.00 ? 26 GLU A HG3  9  
ATOM 9849  N N    . ASN A 1 26 ? -7.624  -24.482 -12.721 1.00 0.00 ? 27 ASN A N    9  
ATOM 9850  C CA   . ASN A 1 26 ? -8.360  -24.982 -11.525 1.00 0.00 ? 27 ASN A CA   9  
ATOM 9851  C C    . ASN A 1 26 ? -9.757  -25.447 -11.935 1.00 0.00 ? 27 ASN A C    9  
ATOM 9852  O O    . ASN A 1 26 ? -10.268 -25.049 -12.962 1.00 0.00 ? 27 ASN A O    9  
ATOM 9853  C CB   . ASN A 1 26 ? -8.480  -23.859 -10.492 1.00 0.00 ? 27 ASN A CB   9  
ATOM 9854  C CG   . ASN A 1 26 ? -7.153  -23.703 -9.749  1.00 0.00 ? 27 ASN A CG   9  
ATOM 9855  O OD1  . ASN A 1 26 ? -6.498  -24.679 -9.441  1.00 0.00 ? 27 ASN A OD1  9  
ATOM 9856  N ND2  . ASN A 1 26 ? -6.728  -22.508 -9.444  1.00 0.00 ? 27 ASN A ND2  9  
ATOM 9857  H H    . ASN A 1 26 ? -8.012  -23.772 -13.275 1.00 0.00 ? 27 ASN A H    9  
ATOM 9858  H HA   . ASN A 1 26 ? -7.825  -25.813 -11.090 1.00 0.00 ? 27 ASN A HA   9  
ATOM 9859  H HB2  . ASN A 1 26 ? -8.723  -22.933 -10.995 1.00 0.00 ? 27 ASN A HB2  9  
ATOM 9860  H HB3  . ASN A 1 26 ? -9.260  -24.102 -9.787  1.00 0.00 ? 27 ASN A HB3  9  
ATOM 9861  H HD21 . ASN A 1 26 ? -7.257  -21.722 -9.693  1.00 0.00 ? 27 ASN A HD21 9  
ATOM 9862  H HD22 . ASN A 1 26 ? -5.877  -22.397 -8.971  1.00 0.00 ? 27 ASN A HD22 9  
ATOM 9863  N N    . PRO A 1 27 ? -10.329 -26.278 -11.106 1.00 0.00 ? 28 PRO A N    9  
ATOM 9864  C CA   . PRO A 1 27 ? -11.670 -26.832 -11.329 1.00 0.00 ? 28 PRO A CA   9  
ATOM 9865  C C    . PRO A 1 27 ? -12.744 -25.813 -10.954 1.00 0.00 ? 28 PRO A C    9  
ATOM 9866  O O    . PRO A 1 27 ? -13.405 -25.949 -9.944  1.00 0.00 ? 28 PRO A O    9  
ATOM 9867  C CB   . PRO A 1 27 ? -11.728 -28.030 -10.397 1.00 0.00 ? 28 PRO A CB   9  
ATOM 9868  C CG   . PRO A 1 27 ? -10.674 -27.784 -9.311  1.00 0.00 ? 28 PRO A CG   9  
ATOM 9869  C CD   . PRO A 1 27 ? -9.688  -26.745 -9.864  1.00 0.00 ? 28 PRO A CD   9  
ATOM 9870  H HA   . PRO A 1 27 ? -11.778 -27.161 -12.331 1.00 0.00 ? 28 PRO A HA   9  
ATOM 9871  H HB2  . PRO A 1 27 ? -12.710 -28.100 -9.950  1.00 0.00 ? 28 PRO A HB2  9  
ATOM 9872  H HB3  . PRO A 1 27 ? -11.491 -28.932 -10.936 1.00 0.00 ? 28 PRO A HB3  9  
ATOM 9873  H HG2  . PRO A 1 27 ? -11.152 -27.407 -8.426  1.00 0.00 ? 28 PRO A HG2  9  
ATOM 9874  H HG3  . PRO A 1 27 ? -10.156 -28.697 -9.102  1.00 0.00 ? 28 PRO A HG3  9  
ATOM 9875  H HD2  . PRO A 1 27 ? -9.567  -25.929 -9.166  1.00 0.00 ? 28 PRO A HD2  9  
ATOM 9876  H HD3  . PRO A 1 27 ? -8.736  -27.203 -10.085 1.00 0.00 ? 28 PRO A HD3  9  
ATOM 9877  N N    . GLY A 1 28 ? -12.920 -24.784 -11.741 1.00 0.00 ? 29 GLY A N    9  
ATOM 9878  C CA   . GLY A 1 28 ? -13.944 -23.762 -11.389 1.00 0.00 ? 29 GLY A CA   9  
ATOM 9879  C C    . GLY A 1 28 ? -13.793 -23.437 -9.906  1.00 0.00 ? 29 GLY A C    9  
ATOM 9880  O O    . GLY A 1 28 ? -14.737 -23.075 -9.232  1.00 0.00 ? 29 GLY A O    9  
ATOM 9881  H H    . GLY A 1 28 ? -12.372 -24.679 -12.548 1.00 0.00 ? 29 GLY A H    9  
ATOM 9882  H HA2  . GLY A 1 28 ? -13.788 -22.870 -11.981 1.00 0.00 ? 29 GLY A HA2  9  
ATOM 9883  H HA3  . GLY A 1 28 ? -14.932 -24.154 -11.573 1.00 0.00 ? 29 GLY A HA3  9  
ATOM 9884  N N    . ILE A 1 29 ? -12.598 -23.588 -9.398  1.00 0.00 ? 30 ILE A N    9  
ATOM 9885  C CA   . ILE A 1 29 ? -12.339 -23.320 -7.963  1.00 0.00 ? 30 ILE A CA   9  
ATOM 9886  C C    . ILE A 1 29 ? -13.125 -22.094 -7.501  1.00 0.00 ? 30 ILE A C    9  
ATOM 9887  O O    . ILE A 1 29 ? -13.566 -21.289 -8.296  1.00 0.00 ? 30 ILE A O    9  
ATOM 9888  C CB   . ILE A 1 29 ? -10.848 -23.096 -7.781  1.00 0.00 ? 30 ILE A CB   9  
ATOM 9889  C CG1  . ILE A 1 29 ? -10.528 -22.927 -6.300  1.00 0.00 ? 30 ILE A CG1  9  
ATOM 9890  C CG2  . ILE A 1 29 ? -10.453 -21.846 -8.538  1.00 0.00 ? 30 ILE A CG2  9  
ATOM 9891  C CD1  . ILE A 1 29 ? -9.012  -22.947 -6.104  1.00 0.00 ? 30 ILE A CD1  9  
ATOM 9892  H H    . ILE A 1 29 ? -11.860 -23.892 -9.969  1.00 0.00 ? 30 ILE A H    9  
ATOM 9893  H HA   . ILE A 1 29 ? -12.634 -24.165 -7.387  1.00 0.00 ? 30 ILE A HA   9  
ATOM 9894  H HB   . ILE A 1 29 ? -10.309 -23.944 -8.180  1.00 0.00 ? 30 ILE A HB   9  
ATOM 9895  H HG12 . ILE A 1 29 ? -10.927 -21.986 -5.954  1.00 0.00 ? 30 ILE A HG12 9  
ATOM 9896  H HG13 . ILE A 1 29 ? -10.973 -23.736 -5.740  1.00 0.00 ? 30 ILE A HG13 9  
ATOM 9897  H HG21 . ILE A 1 29 ? -11.292 -21.173 -8.558  1.00 0.00 ? 30 ILE A HG21 9  
ATOM 9898  H HG22 . ILE A 1 29 ? -9.616  -21.374 -8.045  1.00 0.00 ? 30 ILE A HG22 9  
ATOM 9899  H HG23 . ILE A 1 29 ? -10.183 -22.114 -9.545  1.00 0.00 ? 30 ILE A HG23 9  
ATOM 9900  H HD11 . ILE A 1 29 ? -8.536  -23.297 -7.009  1.00 0.00 ? 30 ILE A HD11 9  
ATOM 9901  H HD12 . ILE A 1 29 ? -8.665  -21.949 -5.878  1.00 0.00 ? 30 ILE A HD12 9  
ATOM 9902  H HD13 . ILE A 1 29 ? -8.763  -23.609 -5.287  1.00 0.00 ? 30 ILE A HD13 9  
ATOM 9903  N N    . LYS A 1 30 ? -13.310 -21.950 -6.218  1.00 0.00 ? 31 LYS A N    9  
ATOM 9904  C CA   . LYS A 1 30 ? -14.077 -20.780 -5.706  1.00 0.00 ? 31 LYS A CA   9  
ATOM 9905  C C    . LYS A 1 30 ? -13.225 -19.516 -5.817  1.00 0.00 ? 31 LYS A C    9  
ATOM 9906  O O    . LYS A 1 30 ? -12.032 -19.536 -5.592  1.00 0.00 ? 31 LYS A O    9  
ATOM 9907  C CB   . LYS A 1 30 ? -14.452 -21.017 -4.245  1.00 0.00 ? 31 LYS A CB   9  
ATOM 9908  C CG   . LYS A 1 30 ? -15.917 -21.450 -4.158  1.00 0.00 ? 31 LYS A CG   9  
ATOM 9909  C CD   . LYS A 1 30 ? -15.990 -22.967 -3.975  1.00 0.00 ? 31 LYS A CD   9  
ATOM 9910  C CE   . LYS A 1 30 ? -16.026 -23.647 -5.346  1.00 0.00 ? 31 LYS A CE   9  
ATOM 9911  N NZ   . LYS A 1 30 ? -15.029 -24.755 -5.382  1.00 0.00 ? 31 LYS A NZ   9  
ATOM 9912  H H    . LYS A 1 30 ? -12.949 -22.615 -5.592  1.00 0.00 ? 31 LYS A H    9  
ATOM 9913  H HA   . LYS A 1 30 ? -14.976 -20.660 -6.290  1.00 0.00 ? 31 LYS A HA   9  
ATOM 9914  H HB2  . LYS A 1 30 ? -13.822 -21.791 -3.835  1.00 0.00 ? 31 LYS A HB2  9  
ATOM 9915  H HB3  . LYS A 1 30 ? -14.314 -20.105 -3.685  1.00 0.00 ? 31 LYS A HB3  9  
ATOM 9916  H HG2  . LYS A 1 30 ? -16.387 -20.961 -3.316  1.00 0.00 ? 31 LYS A HG2  9  
ATOM 9917  H HG3  . LYS A 1 30 ? -16.429 -21.174 -5.067  1.00 0.00 ? 31 LYS A HG3  9  
ATOM 9918  H HD2  . LYS A 1 30 ? -15.123 -23.306 -3.426  1.00 0.00 ? 31 LYS A HD2  9  
ATOM 9919  H HD3  . LYS A 1 30 ? -16.885 -23.220 -3.427  1.00 0.00 ? 31 LYS A HD3  9  
ATOM 9920  H HE2  . LYS A 1 30 ? -17.013 -24.047 -5.523  1.00 0.00 ? 31 LYS A HE2  9  
ATOM 9921  H HE3  . LYS A 1 30 ? -15.788 -22.924 -6.112  1.00 0.00 ? 31 LYS A HE3  9  
ATOM 9922  H HZ1  . LYS A 1 30 ? -14.642 -24.905 -4.429  1.00 0.00 ? 31 LYS A HZ1  9  
ATOM 9923  H HZ2  . LYS A 1 30 ? -15.490 -25.628 -5.707  1.00 0.00 ? 31 LYS A HZ2  9  
ATOM 9924  H HZ3  . LYS A 1 30 ? -14.257 -24.505 -6.035  1.00 0.00 ? 31 LYS A HZ3  9  
ATOM 9925  N N    . VAL A 1 31 ? -13.831 -18.415 -6.164  1.00 0.00 ? 32 VAL A N    9  
ATOM 9926  C CA   . VAL A 1 31 ? -13.071 -17.152 -6.291  1.00 0.00 ? 32 VAL A CA   9  
ATOM 9927  C C    . VAL A 1 31 ? -12.535 -16.748 -4.909  1.00 0.00 ? 32 VAL A C    9  
ATOM 9928  O O    . VAL A 1 31 ? -11.637 -15.938 -4.794  1.00 0.00 ? 32 VAL A O    9  
ATOM 9929  C CB   . VAL A 1 31 ? -13.987 -16.062 -6.873  1.00 0.00 ? 32 VAL A CB   9  
ATOM 9930  C CG1  . VAL A 1 31 ? -15.428 -16.335 -6.480  1.00 0.00 ? 32 VAL A CG1  9  
ATOM 9931  C CG2  . VAL A 1 31 ? -13.587 -14.696 -6.341  1.00 0.00 ? 32 VAL A CG2  9  
ATOM 9932  H H    . VAL A 1 31 ? -14.786 -18.418 -6.342  1.00 0.00 ? 32 VAL A H    9  
ATOM 9933  H HA   . VAL A 1 31 ? -12.253 -17.307 -6.958  1.00 0.00 ? 32 VAL A HA   9  
ATOM 9934  H HB   . VAL A 1 31 ? -13.906 -16.070 -7.949  1.00 0.00 ? 32 VAL A HB   9  
ATOM 9935  H HG11 . VAL A 1 31 ? -15.440 -16.824 -5.521  1.00 0.00 ? 32 VAL A HG11 9  
ATOM 9936  H HG12 . VAL A 1 31 ? -15.973 -15.408 -6.424  1.00 0.00 ? 32 VAL A HG12 9  
ATOM 9937  H HG13 . VAL A 1 31 ? -15.877 -16.980 -7.219  1.00 0.00 ? 32 VAL A HG13 9  
ATOM 9938  H HG21 . VAL A 1 31 ? -12.538 -14.532 -6.529  1.00 0.00 ? 32 VAL A HG21 9  
ATOM 9939  H HG22 . VAL A 1 31 ? -14.170 -13.935 -6.832  1.00 0.00 ? 32 VAL A HG22 9  
ATOM 9940  H HG23 . VAL A 1 31 ? -13.774 -14.671 -5.280  1.00 0.00 ? 32 VAL A HG23 9  
ATOM 9941  N N    . THR A 1 32 ? -13.077 -17.311 -3.863  1.00 0.00 ? 33 THR A N    9  
ATOM 9942  C CA   . THR A 1 32 ? -12.595 -16.963 -2.496  1.00 0.00 ? 33 THR A CA   9  
ATOM 9943  C C    . THR A 1 32 ? -11.508 -17.952 -2.073  1.00 0.00 ? 33 THR A C    9  
ATOM 9944  O O    . THR A 1 32 ? -10.745 -17.700 -1.161  1.00 0.00 ? 33 THR A O    9  
ATOM 9945  C CB   . THR A 1 32 ? -13.761 -17.039 -1.507  1.00 0.00 ? 33 THR A CB   9  
ATOM 9946  O OG1  . THR A 1 32 ? -14.513 -18.218 -1.755  1.00 0.00 ? 33 THR A OG1  9  
ATOM 9947  C CG2  . THR A 1 32 ? -14.662 -15.814 -1.674  1.00 0.00 ? 33 THR A CG2  9  
ATOM 9948  H H    . THR A 1 32 ? -13.798 -17.965 -3.977  1.00 0.00 ? 33 THR A H    9  
ATOM 9949  H HA   . THR A 1 32 ? -12.190 -15.962 -2.501  1.00 0.00 ? 33 THR A HA   9  
ATOM 9950  H HB   . THR A 1 32 ? -13.378 -17.062 -0.499  1.00 0.00 ? 33 THR A HB   9  
ATOM 9951  H HG1  . THR A 1 32 ? -15.248 -17.988 -2.329  1.00 0.00 ? 33 THR A HG1  9  
ATOM 9952  H HG21 . THR A 1 32 ? -14.102 -15.015 -2.139  1.00 0.00 ? 33 THR A HG21 9  
ATOM 9953  H HG22 . THR A 1 32 ? -15.507 -16.070 -2.296  1.00 0.00 ? 33 THR A HG22 9  
ATOM 9954  H HG23 . THR A 1 32 ? -15.013 -15.490 -0.705  1.00 0.00 ? 33 THR A HG23 9  
ATOM 9955  N N    . GLU A 1 33 ? -11.428 -19.079 -2.729  1.00 0.00 ? 34 GLU A N    9  
ATOM 9956  C CA   . GLU A 1 33 ? -10.393 -20.081 -2.367  1.00 0.00 ? 34 GLU A CA   9  
ATOM 9957  C C    . GLU A 1 33 ? -9.221  -19.954 -3.351  1.00 0.00 ? 34 GLU A C    9  
ATOM 9958  O O    . GLU A 1 33 ? -8.144  -20.470 -3.124  1.00 0.00 ? 34 GLU A O    9  
ATOM 9959  C CB   . GLU A 1 33 ? -11.033 -21.489 -2.415  1.00 0.00 ? 34 GLU A CB   9  
ATOM 9960  C CG   . GLU A 1 33 ? -10.323 -22.393 -3.425  1.00 0.00 ? 34 GLU A CG   9  
ATOM 9961  C CD   . GLU A 1 33 ? -9.018  -22.913 -2.820  1.00 0.00 ? 34 GLU A CD   9  
ATOM 9962  O OE1  . GLU A 1 33 ? -9.066  -23.441 -1.721  1.00 0.00 ? 34 GLU A OE1  9  
ATOM 9963  O OE2  . GLU A 1 33 ? -7.992  -22.774 -3.466  1.00 0.00 ? 34 GLU A OE2  9  
ATOM 9964  H H    . GLU A 1 33 ? -12.050 -19.266 -3.462  1.00 0.00 ? 34 GLU A H    9  
ATOM 9965  H HA   . GLU A 1 33 ? -10.040 -19.881 -1.365  1.00 0.00 ? 34 GLU A HA   9  
ATOM 9966  H HB2  . GLU A 1 33 ? -10.975 -21.938 -1.436  1.00 0.00 ? 34 GLU A HB2  9  
ATOM 9967  H HB3  . GLU A 1 33 ? -12.073 -21.395 -2.701  1.00 0.00 ? 34 GLU A HB3  9  
ATOM 9968  H HG2  . GLU A 1 33 ? -10.965 -23.226 -3.674  1.00 0.00 ? 34 GLU A HG2  9  
ATOM 9969  H HG3  . GLU A 1 33 ? -10.106 -21.828 -4.315  1.00 0.00 ? 34 GLU A HG3  9  
ATOM 9970  N N    . VAL A 1 34 ? -9.433  -19.273 -4.444  1.00 0.00 ? 35 VAL A N    9  
ATOM 9971  C CA   . VAL A 1 34 ? -8.350  -19.111 -5.452  1.00 0.00 ? 35 VAL A CA   9  
ATOM 9972  C C    . VAL A 1 34 ? -7.111  -18.512 -4.779  1.00 0.00 ? 35 VAL A C    9  
ATOM 9973  O O    . VAL A 1 34 ? -5.990  -18.838 -5.117  1.00 0.00 ? 35 VAL A O    9  
ATOM 9974  C CB   . VAL A 1 34 ? -8.843  -18.178 -6.559  1.00 0.00 ? 35 VAL A CB   9  
ATOM 9975  C CG1  . VAL A 1 34 ? -7.655  -17.632 -7.356  1.00 0.00 ? 35 VAL A CG1  9  
ATOM 9976  C CG2  . VAL A 1 34 ? -9.772  -18.951 -7.498  1.00 0.00 ? 35 VAL A CG2  9  
ATOM 9977  H H    . VAL A 1 34 ? -10.311 -18.870 -4.606  1.00 0.00 ? 35 VAL A H    9  
ATOM 9978  H HA   . VAL A 1 34 ? -8.107  -20.068 -5.877  1.00 0.00 ? 35 VAL A HA   9  
ATOM 9979  H HB   . VAL A 1 34 ? -9.383  -17.361 -6.113  1.00 0.00 ? 35 VAL A HB   9  
ATOM 9980  H HG11 . VAL A 1 34 ? -6.860  -18.364 -7.363  1.00 0.00 ? 35 VAL A HG11 9  
ATOM 9981  H HG12 . VAL A 1 34 ? -7.964  -17.425 -8.370  1.00 0.00 ? 35 VAL A HG12 9  
ATOM 9982  H HG13 . VAL A 1 34 ? -7.301  -16.721 -6.894  1.00 0.00 ? 35 VAL A HG13 9  
ATOM 9983  H HG21 . VAL A 1 34 ? -10.376 -19.637 -6.923  1.00 0.00 ? 35 VAL A HG21 9  
ATOM 9984  H HG22 . VAL A 1 34 ? -10.415 -18.257 -8.019  1.00 0.00 ? 35 VAL A HG22 9  
ATOM 9985  H HG23 . VAL A 1 34 ? -9.182  -19.503 -8.215  1.00 0.00 ? 35 VAL A HG23 9  
ATOM 9986  N N    . ALA A 1 35 ? -7.306  -17.634 -3.835  1.00 0.00 ? 36 ALA A N    9  
ATOM 9987  C CA   . ALA A 1 35 ? -6.145  -17.007 -3.144  1.00 0.00 ? 36 ALA A CA   9  
ATOM 9988  C C    . ALA A 1 35 ? -5.587  -17.967 -2.091  1.00 0.00 ? 36 ALA A C    9  
ATOM 9989  O O    . ALA A 1 35 ? -4.424  -17.914 -1.745  1.00 0.00 ? 36 ALA A O    9  
ATOM 9990  C CB   . ALA A 1 35 ? -6.595  -15.712 -2.464  1.00 0.00 ? 36 ALA A CB   9  
ATOM 9991  H H    . ALA A 1 35 ? -8.219  -17.384 -3.584  1.00 0.00 ? 36 ALA A H    9  
ATOM 9992  H HA   . ALA A 1 35 ? -5.376  -16.782 -3.868  1.00 0.00 ? 36 ALA A HA   9  
ATOM 9993  H HB1  . ALA A 1 35 ? -7.138  -15.103 -3.171  1.00 0.00 ? 36 ALA A HB1  9  
ATOM 9994  H HB2  . ALA A 1 35 ? -7.234  -15.949 -1.626  1.00 0.00 ? 36 ALA A HB2  9  
ATOM 9995  H HB3  . ALA A 1 35 ? -5.729  -15.169 -2.113  1.00 0.00 ? 36 ALA A HB3  9  
ATOM 9996  N N    . LYS A 1 36 ? -6.405  -18.843 -1.575  1.00 0.00 ? 37 LYS A N    9  
ATOM 9997  C CA   . LYS A 1 36 ? -5.917  -19.798 -0.547  1.00 0.00 ? 37 LYS A CA   9  
ATOM 9998  C C    . LYS A 1 36 ? -4.837  -20.697 -1.153  1.00 0.00 ? 37 LYS A C    9  
ATOM 9999  O O    . LYS A 1 36 ? -3.741  -20.805 -0.639  1.00 0.00 ? 37 LYS A O    9  
ATOM 10000 C CB   . LYS A 1 36 ? -7.100  -20.625 -0.056  1.00 0.00 ? 37 LYS A CB   9  
ATOM 10001 C CG   . LYS A 1 36 ? -6.625  -21.975 0.491   1.00 0.00 ? 37 LYS A CG   9  
ATOM 10002 C CD   . LYS A 1 36 ? -5.719  -21.743 1.702   1.00 0.00 ? 37 LYS A CD   9  
ATOM 10003 C CE   . LYS A 1 36 ? -6.492  -22.055 2.985   1.00 0.00 ? 37 LYS A CE   9  
ATOM 10004 N NZ   . LYS A 1 36 ? -7.514  -20.996 3.223   1.00 0.00 ? 37 LYS A NZ   9  
ATOM 10005 H H    . LYS A 1 36 ? -7.342  -18.874 -1.863  1.00 0.00 ? 37 LYS A H    9  
ATOM 10006 H HA   . LYS A 1 36 ? -5.509  -19.250 0.282   1.00 0.00 ? 37 LYS A HA   9  
ATOM 10007 H HB2  . LYS A 1 36 ? -7.595  -20.077 0.728   1.00 0.00 ? 37 LYS A HB2  9  
ATOM 10008 H HB3  . LYS A 1 36 ? -7.785  -20.784 -0.873  1.00 0.00 ? 37 LYS A HB3  9  
ATOM 10009 H HG2  . LYS A 1 36 ? -7.480  -22.565 0.787   1.00 0.00 ? 37 LYS A HG2  9  
ATOM 10010 H HG3  . LYS A 1 36 ? -6.072  -22.500 -0.273  1.00 0.00 ? 37 LYS A HG3  9  
ATOM 10011 H HD2  . LYS A 1 36 ? -4.856  -22.388 1.635   1.00 0.00 ? 37 LYS A HD2  9  
ATOM 10012 H HD3  . LYS A 1 36 ? -5.400  -20.712 1.719   1.00 0.00 ? 37 LYS A HD3  9  
ATOM 10013 H HE2  . LYS A 1 36 ? -6.983  -23.013 2.885   1.00 0.00 ? 37 LYS A HE2  9  
ATOM 10014 H HE3  . LYS A 1 36 ? -5.807  -22.088 3.819   1.00 0.00 ? 37 LYS A HE3  9  
ATOM 10015 H HZ1  . LYS A 1 36 ? -7.051  -20.064 3.218   1.00 0.00 ? 37 LYS A HZ1  9  
ATOM 10016 H HZ2  . LYS A 1 36 ? -8.232  -21.031 2.472   1.00 0.00 ? 37 LYS A HZ2  9  
ATOM 10017 H HZ3  . LYS A 1 36 ? -7.970  -21.154 4.143   1.00 0.00 ? 37 LYS A HZ3  9  
ATOM 10018 N N    . ARG A 1 37 ? -5.139  -21.341 -2.243  1.00 0.00 ? 38 ARG A N    9  
ATOM 10019 C CA   . ARG A 1 37 ? -4.136  -22.234 -2.888  1.00 0.00 ? 38 ARG A CA   9  
ATOM 10020 C C    . ARG A 1 37 ? -2.999  -21.390 -3.469  1.00 0.00 ? 38 ARG A C    9  
ATOM 10021 O O    . ARG A 1 37 ? -1.877  -21.838 -3.584  1.00 0.00 ? 38 ARG A O    9  
ATOM 10022 C CB   . ARG A 1 37 ? -4.813  -23.024 -4.011  1.00 0.00 ? 38 ARG A CB   9  
ATOM 10023 C CG   . ARG A 1 37 ? -4.667  -24.524 -3.743  1.00 0.00 ? 38 ARG A CG   9  
ATOM 10024 C CD   . ARG A 1 37 ? -5.423  -24.894 -2.465  1.00 0.00 ? 38 ARG A CD   9  
ATOM 10025 N NE   . ARG A 1 37 ? -5.859  -26.318 -2.543  1.00 0.00 ? 38 ARG A NE   9  
ATOM 10026 C CZ   . ARG A 1 37 ? -6.401  -26.894 -1.506  1.00 0.00 ? 38 ARG A CZ   9  
ATOM 10027 N NH1  . ARG A 1 37 ? -5.948  -26.644 -0.307  1.00 0.00 ? 38 ARG A NH1  9  
ATOM 10028 N NH2  . ARG A 1 37 ? -7.397  -27.722 -1.667  1.00 0.00 ? 38 ARG A NH2  9  
ATOM 10029 H H    . ARG A 1 37 ? -6.028  -21.237 -2.639  1.00 0.00 ? 38 ARG A H    9  
ATOM 10030 H HA   . ARG A 1 37 ? -3.738  -22.920 -2.154  1.00 0.00 ? 38 ARG A HA   9  
ATOM 10031 H HB2  . ARG A 1 37 ? -5.861  -22.764 -4.051  1.00 0.00 ? 38 ARG A HB2  9  
ATOM 10032 H HB3  . ARG A 1 37 ? -4.346  -22.782 -4.954  1.00 0.00 ? 38 ARG A HB3  9  
ATOM 10033 H HG2  . ARG A 1 37 ? -5.075  -25.080 -4.575  1.00 0.00 ? 38 ARG A HG2  9  
ATOM 10034 H HG3  . ARG A 1 37 ? -3.623  -24.769 -3.623  1.00 0.00 ? 38 ARG A HG3  9  
ATOM 10035 H HD2  . ARG A 1 37 ? -4.775  -24.762 -1.611  1.00 0.00 ? 38 ARG A HD2  9  
ATOM 10036 H HD3  . ARG A 1 37 ? -6.290  -24.258 -2.361  1.00 0.00 ? 38 ARG A HD3  9  
ATOM 10037 H HE   . ARG A 1 37 ? -5.736  -26.821 -3.375  1.00 0.00 ? 38 ARG A HE   9  
ATOM 10038 H HH11 . ARG A 1 37 ? -5.185  -26.011 -0.182  1.00 0.00 ? 38 ARG A HH11 9  
ATOM 10039 H HH12 . ARG A 1 37 ? -6.366  -27.087 0.487   1.00 0.00 ? 38 ARG A HH12 9  
ATOM 10040 H HH21 . ARG A 1 37 ? -7.744  -27.914 -2.585  1.00 0.00 ? 38 ARG A HH21 9  
ATOM 10041 H HH22 . ARG A 1 37 ? -7.813  -28.165 -0.873  1.00 0.00 ? 38 ARG A HH22 9  
ATOM 10042 N N    . GLY A 1 38 ? -3.280  -20.169 -3.831  1.00 0.00 ? 39 GLY A N    9  
ATOM 10043 C CA   . GLY A 1 38 ? -2.213  -19.298 -4.401  1.00 0.00 ? 39 GLY A CA   9  
ATOM 10044 C C    . GLY A 1 38 ? -1.058  -19.186 -3.404  1.00 0.00 ? 39 GLY A C    9  
ATOM 10045 O O    . GLY A 1 38 ? 0.044   -18.814 -3.754  1.00 0.00 ? 39 GLY A O    9  
ATOM 10046 H H    . GLY A 1 38 ? -4.191  -19.825 -3.729  1.00 0.00 ? 39 GLY A H    9  
ATOM 10047 H HA2  . GLY A 1 38 ? -1.853  -19.729 -5.325  1.00 0.00 ? 39 GLY A HA2  9  
ATOM 10048 H HA3  . GLY A 1 38 ? -2.614  -18.315 -4.594  1.00 0.00 ? 39 GLY A HA3  9  
ATOM 10049 N N    . GLY A 1 39 ? -1.303  -19.502 -2.162  1.00 0.00 ? 40 GLY A N    9  
ATOM 10050 C CA   . GLY A 1 39 ? -0.220  -19.412 -1.144  1.00 0.00 ? 40 GLY A CA   9  
ATOM 10051 C C    . GLY A 1 39 ? 0.645   -20.672 -1.200  1.00 0.00 ? 40 GLY A C    9  
ATOM 10052 O O    . GLY A 1 39 ? 1.840   -20.624 -0.985  1.00 0.00 ? 40 GLY A O    9  
ATOM 10053 H H    . GLY A 1 39 ? -2.199  -19.799 -1.899  1.00 0.00 ? 40 GLY A H    9  
ATOM 10054 H HA2  . GLY A 1 39 ? 0.391   -18.543 -1.345  1.00 0.00 ? 40 GLY A HA2  9  
ATOM 10055 H HA3  . GLY A 1 39 ? -0.657  -19.325 -0.161  1.00 0.00 ? 40 GLY A HA3  9  
ATOM 10056 N N    . GLU A 1 40 ? 0.053   -21.799 -1.487  1.00 0.00 ? 41 GLU A N    9  
ATOM 10057 C CA   . GLU A 1 40 ? 0.846   -23.058 -1.553  1.00 0.00 ? 41 GLU A CA   9  
ATOM 10058 C C    . GLU A 1 40 ? 1.735   -23.042 -2.804  1.00 0.00 ? 41 GLU A C    9  
ATOM 10059 O O    . GLU A 1 40 ? 2.891   -23.415 -2.762  1.00 0.00 ? 41 GLU A O    9  
ATOM 10060 C CB   . GLU A 1 40 ? -0.106  -24.260 -1.585  1.00 0.00 ? 41 GLU A CB   9  
ATOM 10061 C CG   . GLU A 1 40 ? -0.516  -24.589 -3.027  1.00 0.00 ? 41 GLU A CG   9  
ATOM 10062 C CD   . GLU A 1 40 ? -1.458  -25.795 -3.029  1.00 0.00 ? 41 GLU A CD   9  
ATOM 10063 O OE1  . GLU A 1 40 ? -1.808  -26.252 -1.954  1.00 0.00 ? 41 GLU A OE1  9  
ATOM 10064 O OE2  . GLU A 1 40 ? -1.815  -26.240 -4.108  1.00 0.00 ? 41 GLU A OE2  9  
ATOM 10065 H H    . GLU A 1 40 ? -0.912  -21.818 -1.656  1.00 0.00 ? 41 GLU A H    9  
ATOM 10066 H HA   . GLU A 1 40 ? 1.469   -23.132 -0.676  1.00 0.00 ? 41 GLU A HA   9  
ATOM 10067 H HB2  . GLU A 1 40 ? 0.391   -25.111 -1.150  1.00 0.00 ? 41 GLU A HB2  9  
ATOM 10068 H HB3  . GLU A 1 40 ? -0.989  -24.028 -1.008  1.00 0.00 ? 41 GLU A HB3  9  
ATOM 10069 H HG2  . GLU A 1 40 ? -1.018  -23.738 -3.461  1.00 0.00 ? 41 GLU A HG2  9  
ATOM 10070 H HG3  . GLU A 1 40 ? 0.365   -24.821 -3.606  1.00 0.00 ? 41 GLU A HG3  9  
ATOM 10071 N N    . LEU A 1 41 ? 1.199   -22.614 -3.914  1.00 0.00 ? 42 LEU A N    9  
ATOM 10072 C CA   . LEU A 1 41 ? 2.003   -22.572 -5.170  1.00 0.00 ? 42 LEU A CA   9  
ATOM 10073 C C    . LEU A 1 41 ? 3.121   -21.540 -5.035  1.00 0.00 ? 42 LEU A C    9  
ATOM 10074 O O    . LEU A 1 41 ? 4.252   -21.781 -5.406  1.00 0.00 ? 42 LEU A O    9  
ATOM 10075 C CB   . LEU A 1 41 ? 1.096   -22.178 -6.335  1.00 0.00 ? 42 LEU A CB   9  
ATOM 10076 C CG   . LEU A 1 41 ? 0.543   -23.436 -7.003  1.00 0.00 ? 42 LEU A CG   9  
ATOM 10077 C CD1  . LEU A 1 41 ? -0.282  -23.034 -8.227  1.00 0.00 ? 42 LEU A CD1  9  
ATOM 10078 C CD2  . LEU A 1 41 ? 1.704   -24.331 -7.442  1.00 0.00 ? 42 LEU A CD2  9  
ATOM 10079 H H    . LEU A 1 41 ? 0.265   -22.320 -3.925  1.00 0.00 ? 42 LEU A H    9  
ATOM 10080 H HA   . LEU A 1 41 ? 2.430   -23.546 -5.358  1.00 0.00 ? 42 LEU A HA   9  
ATOM 10081 H HB2  . LEU A 1 41 ? 0.277   -21.578 -5.966  1.00 0.00 ? 42 LEU A HB2  9  
ATOM 10082 H HB3  . LEU A 1 41 ? 1.663   -21.610 -7.057  1.00 0.00 ? 42 LEU A HB3  9  
ATOM 10083 H HG   . LEU A 1 41 ? -0.085  -23.969 -6.304  1.00 0.00 ? 42 LEU A HG   9  
ATOM 10084 H HD11 . LEU A 1 41 ? -1.074  -22.365 -7.924  1.00 0.00 ? 42 LEU A HD11 9  
ATOM 10085 H HD12 . LEU A 1 41 ? 0.356   -22.537 -8.943  1.00 0.00 ? 42 LEU A HD12 9  
ATOM 10086 H HD13 . LEU A 1 41 ? -0.711  -23.917 -8.678  1.00 0.00 ? 42 LEU A HD13 9  
ATOM 10087 H HD21 . LEU A 1 41 ? 2.631   -23.783 -7.360  1.00 0.00 ? 42 LEU A HD21 9  
ATOM 10088 H HD22 . LEU A 1 41 ? 1.745   -25.204 -6.807  1.00 0.00 ? 42 LEU A HD22 9  
ATOM 10089 H HD23 . LEU A 1 41 ? 1.556   -24.637 -8.467  1.00 0.00 ? 42 LEU A HD23 9  
ATOM 10090 N N    . TRP A 1 42 ? 2.812   -20.385 -4.512  1.00 0.00 ? 43 TRP A N    9  
ATOM 10091 C CA   . TRP A 1 42 ? 3.852   -19.330 -4.359  1.00 0.00 ? 43 TRP A CA   9  
ATOM 10092 C C    . TRP A 1 42 ? 5.061   -19.898 -3.606  1.00 0.00 ? 43 TRP A C    9  
ATOM 10093 O O    . TRP A 1 42 ? 6.187   -19.510 -3.841  1.00 0.00 ? 43 TRP A O    9  
ATOM 10094 C CB   . TRP A 1 42 ? 3.256   -18.152 -3.579  1.00 0.00 ? 43 TRP A CB   9  
ATOM 10095 C CG   . TRP A 1 42 ? 4.352   -17.267 -3.078  1.00 0.00 ? 43 TRP A CG   9  
ATOM 10096 C CD1  . TRP A 1 42 ? 4.822   -17.259 -1.811  1.00 0.00 ? 43 TRP A CD1  9  
ATOM 10097 C CD2  . TRP A 1 42 ? 5.118   -16.267 -3.807  1.00 0.00 ? 43 TRP A CD2  9  
ATOM 10098 N NE1  . TRP A 1 42 ? 5.831   -16.319 -1.715  1.00 0.00 ? 43 TRP A NE1  9  
ATOM 10099 C CE2  . TRP A 1 42 ? 6.051   -15.680 -2.919  1.00 0.00 ? 43 TRP A CE2  9  
ATOM 10100 C CE3  . TRP A 1 42 ? 5.095   -15.818 -5.139  1.00 0.00 ? 43 TRP A CE3  9  
ATOM 10101 C CZ2  . TRP A 1 42 ? 6.931   -14.681 -3.340  1.00 0.00 ? 43 TRP A CZ2  9  
ATOM 10102 C CZ3  . TRP A 1 42 ? 5.979   -14.813 -5.565  1.00 0.00 ? 43 TRP A CZ3  9  
ATOM 10103 C CH2  . TRP A 1 42 ? 6.895   -14.245 -4.668  1.00 0.00 ? 43 TRP A CH2  9  
ATOM 10104 H H    . TRP A 1 42 ? 1.892   -20.210 -4.225  1.00 0.00 ? 43 TRP A H    9  
ATOM 10105 H HA   . TRP A 1 42 ? 4.166   -18.990 -5.335  1.00 0.00 ? 43 TRP A HA   9  
ATOM 10106 H HB2  . TRP A 1 42 ? 2.606   -17.585 -4.230  1.00 0.00 ? 43 TRP A HB2  9  
ATOM 10107 H HB3  . TRP A 1 42 ? 2.686   -18.527 -2.742  1.00 0.00 ? 43 TRP A HB3  9  
ATOM 10108 H HD1  . TRP A 1 42 ? 4.466   -17.886 -1.008  1.00 0.00 ? 43 TRP A HD1  9  
ATOM 10109 H HE1  . TRP A 1 42 ? 6.340   -16.116 -0.901  1.00 0.00 ? 43 TRP A HE1  9  
ATOM 10110 H HE3  . TRP A 1 42 ? 4.394   -16.247 -5.838  1.00 0.00 ? 43 TRP A HE3  9  
ATOM 10111 H HZ2  . TRP A 1 42 ? 7.635   -14.248 -2.643  1.00 0.00 ? 43 TRP A HZ2  9  
ATOM 10112 H HZ3  . TRP A 1 42 ? 5.952   -14.476 -6.590  1.00 0.00 ? 43 TRP A HZ3  9  
ATOM 10113 H HH2  . TRP A 1 42 ? 7.572   -13.474 -5.003  1.00 0.00 ? 43 TRP A HH2  9  
ATOM 10114 N N    . ARG A 1 43 ? 4.838   -20.807 -2.697  1.00 0.00 ? 44 ARG A N    9  
ATOM 10115 C CA   . ARG A 1 43 ? 5.979   -21.385 -1.929  1.00 0.00 ? 44 ARG A CA   9  
ATOM 10116 C C    . ARG A 1 43 ? 6.776   -22.344 -2.818  1.00 0.00 ? 44 ARG A C    9  
ATOM 10117 O O    . ARG A 1 43 ? 7.983   -22.438 -2.716  1.00 0.00 ? 44 ARG A O    9  
ATOM 10118 C CB   . ARG A 1 43 ? 5.442   -22.148 -0.716  1.00 0.00 ? 44 ARG A CB   9  
ATOM 10119 C CG   . ARG A 1 43 ? 6.026   -21.547 0.563   1.00 0.00 ? 44 ARG A CG   9  
ATOM 10120 C CD   . ARG A 1 43 ? 5.609   -22.399 1.763   1.00 0.00 ? 44 ARG A CD   9  
ATOM 10121 N NE   . ARG A 1 43 ? 5.854   -21.642 3.023   1.00 0.00 ? 44 ARG A NE   9  
ATOM 10122 C CZ   . ARG A 1 43 ? 7.059   -21.576 3.521   1.00 0.00 ? 44 ARG A CZ   9  
ATOM 10123 N NH1  . ARG A 1 43 ? 7.955   -20.813 2.961   1.00 0.00 ? 44 ARG A NH1  9  
ATOM 10124 N NH2  . ARG A 1 43 ? 7.366   -22.276 4.580   1.00 0.00 ? 44 ARG A NH2  9  
ATOM 10125 H H    . ARG A 1 43 ? 3.923   -21.106 -2.514  1.00 0.00 ? 44 ARG A H    9  
ATOM 10126 H HA   . ARG A 1 43 ? 6.624   -20.587 -1.594  1.00 0.00 ? 44 ARG A HA   9  
ATOM 10127 H HB2  . ARG A 1 43 ? 4.365   -22.073 -0.690  1.00 0.00 ? 44 ARG A HB2  9  
ATOM 10128 H HB3  . ARG A 1 43 ? 5.730   -23.186 -0.787  1.00 0.00 ? 44 ARG A HB3  9  
ATOM 10129 H HG2  . ARG A 1 43 ? 7.105   -21.528 0.491   1.00 0.00 ? 44 ARG A HG2  9  
ATOM 10130 H HG3  . ARG A 1 43 ? 5.656   -20.541 0.691   1.00 0.00 ? 44 ARG A HG3  9  
ATOM 10131 H HD2  . ARG A 1 43 ? 4.558   -22.638 1.685   1.00 0.00 ? 44 ARG A HD2  9  
ATOM 10132 H HD3  . ARG A 1 43 ? 6.185   -23.312 1.773   1.00 0.00 ? 44 ARG A HD3  9  
ATOM 10133 H HE   . ARG A 1 43 ? 5.110   -21.193 3.476   1.00 0.00 ? 44 ARG A HE   9  
ATOM 10134 H HH11 . ARG A 1 43 ? 7.719   -20.278 2.150   1.00 0.00 ? 44 ARG A HH11 9  
ATOM 10135 H HH12 . ARG A 1 43 ? 8.879   -20.762 3.342   1.00 0.00 ? 44 ARG A HH12 9  
ATOM 10136 H HH21 . ARG A 1 43 ? 6.678   -22.862 5.008   1.00 0.00 ? 44 ARG A HH21 9  
ATOM 10137 H HH22 . ARG A 1 43 ? 8.289   -22.225 4.962   1.00 0.00 ? 44 ARG A HH22 9  
ATOM 10138 N N    . ALA A 1 44 ? 6.112   -23.066 -3.678  1.00 0.00 ? 45 ALA A N    9  
ATOM 10139 C CA   . ALA A 1 44 ? 6.833   -24.028 -4.559  1.00 0.00 ? 45 ALA A CA   9  
ATOM 10140 C C    . ALA A 1 44 ? 6.777   -23.551 -6.008  1.00 0.00 ? 45 ALA A C    9  
ATOM 10141 O O    . ALA A 1 44 ? 6.979   -24.312 -6.933  1.00 0.00 ? 45 ALA A O    9  
ATOM 10142 C CB   . ALA A 1 44 ? 6.152   -25.386 -4.466  1.00 0.00 ? 45 ALA A CB   9  
ATOM 10143 H H    . ALA A 1 44 ? 5.138   -22.983 -3.739  1.00 0.00 ? 45 ALA A H    9  
ATOM 10144 H HA   . ALA A 1 44 ? 7.861   -24.116 -4.243  1.00 0.00 ? 45 ALA A HA   9  
ATOM 10145 H HB1  . ALA A 1 44 ? 5.559   -25.424 -3.566  1.00 0.00 ? 45 ALA A HB1  9  
ATOM 10146 H HB2  . ALA A 1 44 ? 5.514   -25.518 -5.325  1.00 0.00 ? 45 ALA A HB2  9  
ATOM 10147 H HB3  . ALA A 1 44 ? 6.898   -26.163 -4.443  1.00 0.00 ? 45 ALA A HB3  9  
ATOM 10148 N N    . MET A 1 45 ? 6.501   -22.301 -6.211  1.00 0.00 ? 46 MET A N    9  
ATOM 10149 C CA   . MET A 1 45 ? 6.426   -21.772 -7.596  1.00 0.00 ? 46 MET A CA   9  
ATOM 10150 C C    . MET A 1 45 ? 7.801   -21.904 -8.257  1.00 0.00 ? 46 MET A C    9  
ATOM 10151 O O    . MET A 1 45 ? 8.204   -22.977 -8.659  1.00 0.00 ? 46 MET A O    9  
ATOM 10152 C CB   . MET A 1 45 ? 5.991   -20.300 -7.547  1.00 0.00 ? 46 MET A CB   9  
ATOM 10153 C CG   . MET A 1 45 ? 5.911   -19.734 -8.969  1.00 0.00 ? 46 MET A CG   9  
ATOM 10154 S SD   . MET A 1 45 ? 6.795   -18.152 -9.058  1.00 0.00 ? 46 MET A SD   9  
ATOM 10155 C CE   . MET A 1 45 ? 6.147   -17.416 -7.535  1.00 0.00 ? 46 MET A CE   9  
ATOM 10156 H H    . MET A 1 45 ? 6.342   -21.710 -5.453  1.00 0.00 ? 46 MET A H    9  
ATOM 10157 H HA   . MET A 1 45 ? 5.701   -22.342 -8.157  1.00 0.00 ? 46 MET A HA   9  
ATOM 10158 H HB2  . MET A 1 45 ? 5.022   -20.228 -7.077  1.00 0.00 ? 46 MET A HB2  9  
ATOM 10159 H HB3  . MET A 1 45 ? 6.709   -19.732 -6.976  1.00 0.00 ? 46 MET A HB3  9  
ATOM 10160 H HG2  . MET A 1 45 ? 6.359   -20.434 -9.659  1.00 0.00 ? 46 MET A HG2  9  
ATOM 10161 H HG3  . MET A 1 45 ? 4.875   -19.582 -9.235  1.00 0.00 ? 46 MET A HG3  9  
ATOM 10162 H HE1  . MET A 1 45 ? 5.077   -17.546 -7.497  1.00 0.00 ? 46 MET A HE1  9  
ATOM 10163 H HE2  . MET A 1 45 ? 6.596   -17.904 -6.681  1.00 0.00 ? 46 MET A HE2  9  
ATOM 10164 H HE3  . MET A 1 45 ? 6.383   -16.359 -7.518  1.00 0.00 ? 46 MET A HE3  9  
ATOM 10165 N N    . LYS A 1 46 ? 8.517   -20.825 -8.384  1.00 0.00 ? 47 LYS A N    9  
ATOM 10166 C CA   . LYS A 1 46 ? 9.846   -20.877 -9.024  1.00 0.00 ? 47 LYS A CA   9  
ATOM 10167 C C    . LYS A 1 46 ? 10.873  -20.209 -8.111  1.00 0.00 ? 47 LYS A C    9  
ATOM 10168 O O    . LYS A 1 46 ? 11.730  -20.853 -7.541  1.00 0.00 ? 47 LYS A O    9  
ATOM 10169 C CB   . LYS A 1 46 ? 9.743   -20.104 -10.324 1.00 0.00 ? 47 LYS A CB   9  
ATOM 10170 C CG   . LYS A 1 46 ? 9.656   -21.082 -11.497 1.00 0.00 ? 47 LYS A CG   9  
ATOM 10171 C CD   . LYS A 1 46 ? 10.376  -20.493 -12.713 1.00 0.00 ? 47 LYS A CD   9  
ATOM 10172 C CE   . LYS A 1 46 ? 9.345   -20.059 -13.757 1.00 0.00 ? 47 LYS A CE   9  
ATOM 10173 N NZ   . LYS A 1 46 ? 9.661   -18.681 -14.227 1.00 0.00 ? 47 LYS A NZ   9  
ATOM 10174 H H    . LYS A 1 46 ? 8.177   -19.972 -8.074  1.00 0.00 ? 47 LYS A H    9  
ATOM 10175 H HA   . LYS A 1 46 ? 10.124  -21.897 -9.221  1.00 0.00 ? 47 LYS A HA   9  
ATOM 10176 H HB2  . LYS A 1 46 ? 8.847   -19.497 -10.281 1.00 0.00 ? 47 LYS A HB2  9  
ATOM 10177 H HB3  . LYS A 1 46 ? 10.608  -19.469 -10.439 1.00 0.00 ? 47 LYS A HB3  9  
ATOM 10178 H HG2  . LYS A 1 46 ? 10.124  -22.016 -11.220 1.00 0.00 ? 47 LYS A HG2  9  
ATOM 10179 H HG3  . LYS A 1 46 ? 8.620   -21.256 -11.745 1.00 0.00 ? 47 LYS A HG3  9  
ATOM 10180 H HD2  . LYS A 1 46 ? 10.961  -19.638 -12.405 1.00 0.00 ? 47 LYS A HD2  9  
ATOM 10181 H HD3  . LYS A 1 46 ? 11.027  -21.239 -13.142 1.00 0.00 ? 47 LYS A HD3  9  
ATOM 10182 H HE2  . LYS A 1 46 ? 9.372   -20.741 -14.594 1.00 0.00 ? 47 LYS A HE2  9  
ATOM 10183 H HE3  . LYS A 1 46 ? 8.359   -20.071 -13.315 1.00 0.00 ? 47 LYS A HE3  9  
ATOM 10184 H HZ1  . LYS A 1 46 ? 10.547  -18.358 -13.785 1.00 0.00 ? 47 LYS A HZ1  9  
ATOM 10185 H HZ2  . LYS A 1 46 ? 9.770   -18.683 -15.261 1.00 0.00 ? 47 LYS A HZ2  9  
ATOM 10186 H HZ3  . LYS A 1 46 ? 8.888   -18.039 -13.964 1.00 0.00 ? 47 LYS A HZ3  9  
ATOM 10187 N N    . ASP A 1 47 ? 10.784  -18.915 -7.969  1.00 0.00 ? 48 ASP A N    9  
ATOM 10188 C CA   . ASP A 1 47 ? 11.741  -18.185 -7.095  1.00 0.00 ? 48 ASP A CA   9  
ATOM 10189 C C    . ASP A 1 47 ? 11.080  -16.897 -6.603  1.00 0.00 ? 48 ASP A C    9  
ATOM 10190 O O    . ASP A 1 47 ? 10.455  -16.183 -7.361  1.00 0.00 ? 48 ASP A O    9  
ATOM 10191 C CB   . ASP A 1 47 ? 13.002  -17.842 -7.890  1.00 0.00 ? 48 ASP A CB   9  
ATOM 10192 C CG   . ASP A 1 47 ? 14.211  -18.523 -7.245  1.00 0.00 ? 48 ASP A CG   9  
ATOM 10193 O OD1  . ASP A 1 47 ? 14.318  -19.732 -7.365  1.00 0.00 ? 48 ASP A OD1  9  
ATOM 10194 O OD2  . ASP A 1 47 ? 15.008  -17.823 -6.644  1.00 0.00 ? 48 ASP A OD2  9  
ATOM 10195 H H    . ASP A 1 47 ? 10.080  -18.421 -8.439  1.00 0.00 ? 48 ASP A H    9  
ATOM 10196 H HA   . ASP A 1 47 ? 12.003  -18.805 -6.248  1.00 0.00 ? 48 ASP A HA   9  
ATOM 10197 H HB2  . ASP A 1 47 ? 12.891  -18.189 -8.907  1.00 0.00 ? 48 ASP A HB2  9  
ATOM 10198 H HB3  . ASP A 1 47 ? 13.149  -16.774 -7.888  1.00 0.00 ? 48 ASP A HB3  9  
ATOM 10199 N N    . LYS A 1 48 ? 11.203  -16.596 -5.340  1.00 0.00 ? 49 LYS A N    9  
ATOM 10200 C CA   . LYS A 1 48 ? 10.570  -15.358 -4.807  1.00 0.00 ? 49 LYS A CA   9  
ATOM 10201 C C    . LYS A 1 48 ? 11.444  -14.146 -5.131  1.00 0.00 ? 49 LYS A C    9  
ATOM 10202 O O    . LYS A 1 48 ? 11.148  -13.038 -4.736  1.00 0.00 ? 49 LYS A O    9  
ATOM 10203 C CB   . LYS A 1 48 ? 10.411  -15.480 -3.292  1.00 0.00 ? 49 LYS A CB   9  
ATOM 10204 C CG   . LYS A 1 48 ? 9.445   -16.622 -2.974  1.00 0.00 ? 49 LYS A CG   9  
ATOM 10205 C CD   . LYS A 1 48 ? 10.147  -17.648 -2.081  1.00 0.00 ? 49 LYS A CD   9  
ATOM 10206 C CE   . LYS A 1 48 ? 10.401  -17.038 -0.702  1.00 0.00 ? 49 LYS A CE   9  
ATOM 10207 N NZ   . LYS A 1 48 ? 11.181  -17.998 0.129   1.00 0.00 ? 49 LYS A NZ   9  
ATOM 10208 H H    . LYS A 1 48 ? 11.706  -17.187 -4.742  1.00 0.00 ? 49 LYS A H    9  
ATOM 10209 H HA   . LYS A 1 48 ? 9.597   -15.229 -5.260  1.00 0.00 ? 49 LYS A HA   9  
ATOM 10210 H HB2  . LYS A 1 48 ? 11.373  -15.684 -2.845  1.00 0.00 ? 49 LYS A HB2  9  
ATOM 10211 H HB3  . LYS A 1 48 ? 10.017  -14.557 -2.895  1.00 0.00 ? 49 LYS A HB3  9  
ATOM 10212 H HG2  . LYS A 1 48 ? 8.580   -16.229 -2.462  1.00 0.00 ? 49 LYS A HG2  9  
ATOM 10213 H HG3  . LYS A 1 48 ? 9.137   -17.098 -3.892  1.00 0.00 ? 49 LYS A HG3  9  
ATOM 10214 H HD2  . LYS A 1 48 ? 9.521   -18.523 -1.979  1.00 0.00 ? 49 LYS A HD2  9  
ATOM 10215 H HD3  . LYS A 1 48 ? 11.088  -17.931 -2.527  1.00 0.00 ? 49 LYS A HD3  9  
ATOM 10216 H HE2  . LYS A 1 48 ? 10.960  -16.120 -0.812  1.00 0.00 ? 49 LYS A HE2  9  
ATOM 10217 H HE3  . LYS A 1 48 ? 9.456   -16.829 -0.220  1.00 0.00 ? 49 LYS A HE3  9  
ATOM 10218 H HZ1  . LYS A 1 48 ? 10.918  -18.971 -0.130  1.00 0.00 ? 49 LYS A HZ1  9  
ATOM 10219 H HZ2  . LYS A 1 48 ? 12.196  -17.857 -0.040  1.00 0.00 ? 49 LYS A HZ2  9  
ATOM 10220 H HZ3  . LYS A 1 48 ? 10.972  -17.837 1.134   1.00 0.00 ? 49 LYS A HZ3  9  
ATOM 10221 N N    . SER A 1 49 ? 12.519  -14.343 -5.843  1.00 0.00 ? 50 SER A N    9  
ATOM 10222 C CA   . SER A 1 49 ? 13.404  -13.195 -6.185  1.00 0.00 ? 50 SER A CA   9  
ATOM 10223 C C    . SER A 1 49 ? 12.949  -12.575 -7.506  1.00 0.00 ? 50 SER A C    9  
ATOM 10224 O O    . SER A 1 49 ? 13.295  -11.457 -7.837  1.00 0.00 ? 50 SER A O    9  
ATOM 10225 C CB   . SER A 1 49 ? 14.846  -13.684 -6.316  1.00 0.00 ? 50 SER A CB   9  
ATOM 10226 O OG   . SER A 1 49 ? 15.271  -14.225 -5.072  1.00 0.00 ? 50 SER A OG   9  
ATOM 10227 H H    . SER A 1 49 ? 12.745  -15.242 -6.154  1.00 0.00 ? 50 SER A H    9  
ATOM 10228 H HA   . SER A 1 49 ? 13.342  -12.456 -5.402  1.00 0.00 ? 50 SER A HA   9  
ATOM 10229 H HB2  . SER A 1 49 ? 14.902  -14.448 -7.073  1.00 0.00 ? 50 SER A HB2  9  
ATOM 10230 H HB3  . SER A 1 49 ? 15.483  -12.855 -6.595  1.00 0.00 ? 50 SER A HB3  9  
ATOM 10231 H HG   . SER A 1 49 ? 14.753  -15.015 -4.901  1.00 0.00 ? 50 SER A HG   9  
ATOM 10232 N N    . GLU A 1 50 ? 12.169  -13.291 -8.262  1.00 0.00 ? 51 GLU A N    9  
ATOM 10233 C CA   . GLU A 1 50 ? 11.685  -12.746 -9.557  1.00 0.00 ? 51 GLU A CA   9  
ATOM 10234 C C    . GLU A 1 50 ? 10.775  -11.546 -9.290  1.00 0.00 ? 51 GLU A C    9  
ATOM 10235 O O    . GLU A 1 50 ? 11.006  -10.448 -9.759  1.00 0.00 ? 51 GLU A O    9  
ATOM 10236 C CB   . GLU A 1 50 ? 10.916  -13.831 -10.290 1.00 0.00 ? 51 GLU A CB   9  
ATOM 10237 C CG   . GLU A 1 50 ? 9.991   -13.211 -11.344 1.00 0.00 ? 51 GLU A CG   9  
ATOM 10238 C CD   . GLU A 1 50 ? 9.428   -14.314 -12.243 1.00 0.00 ? 51 GLU A CD   9  
ATOM 10239 O OE1  . GLU A 1 50 ? 9.494   -15.466 -11.847 1.00 0.00 ? 51 GLU A OE1  9  
ATOM 10240 O OE2  . GLU A 1 50 ? 8.943   -13.988 -13.313 1.00 0.00 ? 51 GLU A OE2  9  
ATOM 10241 H H    . GLU A 1 50 ? 11.897  -14.187 -7.976  1.00 0.00 ? 51 GLU A H    9  
ATOM 10242 H HA   . GLU A 1 50 ? 12.521  -12.453 -10.160 1.00 0.00 ? 51 GLU A HA   9  
ATOM 10243 H HB2  . GLU A 1 50 ? 11.632  -14.466 -10.777 1.00 0.00 ? 51 GLU A HB2  9  
ATOM 10244 H HB3  . GLU A 1 50 ? 10.333  -14.403 -9.584  1.00 0.00 ? 51 GLU A HB3  9  
ATOM 10245 H HG2  . GLU A 1 50 ? 9.177   -12.699 -10.850 1.00 0.00 ? 51 GLU A HG2  9  
ATOM 10246 H HG3  . GLU A 1 50 ? 10.548  -12.509 -11.944 1.00 0.00 ? 51 GLU A HG3  9  
ATOM 10247 N N    . TRP A 1 51 ? 9.736   -11.760 -8.539  1.00 0.00 ? 52 TRP A N    9  
ATOM 10248 C CA   . TRP A 1 51 ? 8.792   -10.661 -8.234  1.00 0.00 ? 52 TRP A CA   9  
ATOM 10249 C C    . TRP A 1 51 ? 9.394   -9.720  -7.206  1.00 0.00 ? 52 TRP A C    9  
ATOM 10250 O O    . TRP A 1 51 ? 9.145   -8.541  -7.233  1.00 0.00 ? 52 TRP A O    9  
ATOM 10251 C CB   . TRP A 1 51 ? 7.519   -11.256 -7.665  1.00 0.00 ? 52 TRP A CB   9  
ATOM 10252 C CG   . TRP A 1 51 ? 7.140   -12.427 -8.470  1.00 0.00 ? 52 TRP A CG   9  
ATOM 10253 C CD1  . TRP A 1 51 ? 7.479   -13.677 -8.175  1.00 0.00 ? 52 TRP A CD1  9  
ATOM 10254 C CD2  . TRP A 1 51 ? 6.359   -12.474 -9.685  1.00 0.00 ? 52 TRP A CD2  9  
ATOM 10255 N NE1  . TRP A 1 51 ? 6.943   -14.521 -9.128  1.00 0.00 ? 52 TRP A NE1  9  
ATOM 10256 C CE2  . TRP A 1 51 ? 6.237   -13.818 -10.088 1.00 0.00 ? 52 TRP A CE2  9  
ATOM 10257 C CE3  . TRP A 1 51 ? 5.749   -11.486 -10.461 1.00 0.00 ? 52 TRP A CE3  9  
ATOM 10258 C CZ2  . TRP A 1 51 ? 5.523   -14.172 -11.235 1.00 0.00 ? 52 TRP A CZ2  9  
ATOM 10259 C CZ3  . TRP A 1 51 ? 5.033   -11.825 -11.606 1.00 0.00 ? 52 TRP A CZ3  9  
ATOM 10260 C CH2  . TRP A 1 51 ? 4.914   -13.169 -11.997 1.00 0.00 ? 52 TRP A CH2  9  
ATOM 10261 H H    . TRP A 1 51 ? 9.570   -12.654 -8.177  1.00 0.00 ? 52 TRP A H    9  
ATOM 10262 H HA   . TRP A 1 51 ? 8.560   -10.117 -9.137  1.00 0.00 ? 52 TRP A HA   9  
ATOM 10263 H HB2  . TRP A 1 51 ? 7.685   -11.561 -6.644  1.00 0.00 ? 52 TRP A HB2  9  
ATOM 10264 H HB3  . TRP A 1 51 ? 6.734   -10.540 -7.701  1.00 0.00 ? 52 TRP A HB3  9  
ATOM 10265 H HD1  . TRP A 1 51 ? 8.072   -13.960 -7.327  1.00 0.00 ? 52 TRP A HD1  9  
ATOM 10266 H HE1  . TRP A 1 51 ? 7.037   -15.488 -9.137  1.00 0.00 ? 52 TRP A HE1  9  
ATOM 10267 H HE3  . TRP A 1 51 ? 5.842   -10.450 -10.177 1.00 0.00 ? 52 TRP A HE3  9  
ATOM 10268 H HZ2  . TRP A 1 51 ? 5.438   -15.208 -11.527 1.00 0.00 ? 52 TRP A HZ2  9  
ATOM 10269 H HZ3  . TRP A 1 51 ? 4.562   -11.048 -12.178 1.00 0.00 ? 52 TRP A HZ3  9  
ATOM 10270 H HH2  . TRP A 1 51 ? 4.359   -13.426 -12.887 1.00 0.00 ? 52 TRP A HH2  9  
ATOM 10271 N N    . GLU A 1 52 ? 10.170  -10.215 -6.287  1.00 0.00 ? 53 GLU A N    9  
ATOM 10272 C CA   . GLU A 1 52 ? 10.748  -9.290  -5.273  1.00 0.00 ? 53 GLU A CA   9  
ATOM 10273 C C    . GLU A 1 52 ? 11.433  -8.134  -6.001  1.00 0.00 ? 53 GLU A C    9  
ATOM 10274 O O    . GLU A 1 52 ? 11.199  -6.977  -5.714  1.00 0.00 ? 53 GLU A O    9  
ATOM 10275 C CB   . GLU A 1 52 ? 11.748  -10.039 -4.380  1.00 0.00 ? 53 GLU A CB   9  
ATOM 10276 C CG   . GLU A 1 52 ? 13.122  -10.097 -5.043  1.00 0.00 ? 53 GLU A CG   9  
ATOM 10277 C CD   . GLU A 1 52 ? 14.125  -10.732 -4.077  1.00 0.00 ? 53 GLU A CD   9  
ATOM 10278 O OE1  . GLU A 1 52 ? 13.713  -11.570 -3.293  1.00 0.00 ? 53 GLU A OE1  9  
ATOM 10279 O OE2  . GLU A 1 52 ? 15.289  -10.370 -4.141  1.00 0.00 ? 53 GLU A OE2  9  
ATOM 10280 H H    . GLU A 1 52 ? 10.362  -11.184 -6.261  1.00 0.00 ? 53 GLU A H    9  
ATOM 10281 H HA   . GLU A 1 52 ? 9.949   -8.891  -4.665  1.00 0.00 ? 53 GLU A HA   9  
ATOM 10282 H HB2  . GLU A 1 52 ? 11.832  -9.531  -3.435  1.00 0.00 ? 53 GLU A HB2  9  
ATOM 10283 H HB3  . GLU A 1 52 ? 11.395  -11.042 -4.220  1.00 0.00 ? 53 GLU A HB3  9  
ATOM 10284 H HG2  . GLU A 1 52 ? 13.053  -10.689 -5.942  1.00 0.00 ? 53 GLU A HG2  9  
ATOM 10285 H HG3  . GLU A 1 52 ? 13.448  -9.099  -5.287  1.00 0.00 ? 53 GLU A HG3  9  
ATOM 10286 N N    . ALA A 1 53 ? 12.268  -8.443  -6.949  1.00 0.00 ? 54 ALA A N    9  
ATOM 10287 C CA   . ALA A 1 53 ? 12.959  -7.365  -7.708  1.00 0.00 ? 54 ALA A CA   9  
ATOM 10288 C C    . ALA A 1 53 ? 11.923  -6.586  -8.521  1.00 0.00 ? 54 ALA A C    9  
ATOM 10289 O O    . ALA A 1 53 ? 12.012  -5.384  -8.676  1.00 0.00 ? 54 ALA A O    9  
ATOM 10290 C CB   . ALA A 1 53 ? 13.993  -7.985  -8.652  1.00 0.00 ? 54 ALA A CB   9  
ATOM 10291 H H    . ALA A 1 53 ? 12.434  -9.387  -7.163  1.00 0.00 ? 54 ALA A H    9  
ATOM 10292 H HA   . ALA A 1 53 ? 13.452  -6.697  -7.018  1.00 0.00 ? 54 ALA A HA   9  
ATOM 10293 H HB1  . ALA A 1 53 ? 14.249  -8.975  -8.304  1.00 0.00 ? 54 ALA A HB1  9  
ATOM 10294 H HB2  . ALA A 1 53 ? 13.579  -8.048  -9.647  1.00 0.00 ? 54 ALA A HB2  9  
ATOM 10295 H HB3  . ALA A 1 53 ? 14.880  -7.369  -8.669  1.00 0.00 ? 54 ALA A HB3  9  
ATOM 10296 N N    . LYS A 1 54 ? 10.941  -7.269  -9.039  1.00 0.00 ? 55 LYS A N    9  
ATOM 10297 C CA   . LYS A 1 54 ? 9.889   -6.584  -9.847  1.00 0.00 ? 55 LYS A CA   9  
ATOM 10298 C C    . LYS A 1 54 ? 9.189   -5.510  -9.012  1.00 0.00 ? 55 LYS A C    9  
ATOM 10299 O O    . LYS A 1 54 ? 8.824   -4.463  -9.509  1.00 0.00 ? 55 LYS A O    9  
ATOM 10300 C CB   . LYS A 1 54 ? 8.853   -7.613  -10.293 1.00 0.00 ? 55 LYS A CB   9  
ATOM 10301 C CG   . LYS A 1 54 ? 9.434   -8.466  -11.421 1.00 0.00 ? 55 LYS A CG   9  
ATOM 10302 C CD   . LYS A 1 54 ? 9.295   -7.717  -12.747 1.00 0.00 ? 55 LYS A CD   9  
ATOM 10303 C CE   . LYS A 1 54 ? 10.442  -8.112  -13.679 1.00 0.00 ? 55 LYS A CE   9  
ATOM 10304 N NZ   . LYS A 1 54 ? 10.177  -9.464  -14.249 1.00 0.00 ? 55 LYS A NZ   9  
ATOM 10305 H H    . LYS A 1 54 ? 10.895  -8.241  -8.899  1.00 0.00 ? 55 LYS A H    9  
ATOM 10306 H HA   . LYS A 1 54 ? 10.339  -6.129  -10.715 1.00 0.00 ? 55 LYS A HA   9  
ATOM 10307 H HB2  . LYS A 1 54 ? 8.596   -8.244  -9.453  1.00 0.00 ? 55 LYS A HB2  9  
ATOM 10308 H HB3  . LYS A 1 54 ? 7.969   -7.104  -10.645 1.00 0.00 ? 55 LYS A HB3  9  
ATOM 10309 H HG2  . LYS A 1 54 ? 10.479  -8.659  -11.223 1.00 0.00 ? 55 LYS A HG2  9  
ATOM 10310 H HG3  . LYS A 1 54 ? 8.899   -9.401  -11.480 1.00 0.00 ? 55 LYS A HG3  9  
ATOM 10311 H HD2  . LYS A 1 54 ? 8.351   -7.973  -13.207 1.00 0.00 ? 55 LYS A HD2  9  
ATOM 10312 H HD3  . LYS A 1 54 ? 9.331   -6.654  -12.565 1.00 0.00 ? 55 LYS A HD3  9  
ATOM 10313 H HE2  . LYS A 1 54 ? 10.518  -7.392  -14.481 1.00 0.00 ? 55 LYS A HE2  9  
ATOM 10314 H HE3  . LYS A 1 54 ? 11.367  -8.130  -13.122 1.00 0.00 ? 55 LYS A HE3  9  
ATOM 10315 H HZ1  . LYS A 1 54 ? 9.267   -9.819  -13.888 1.00 0.00 ? 55 LYS A HZ1  9  
ATOM 10316 H HZ2  . LYS A 1 54 ? 10.139  -9.403  -15.286 1.00 0.00 ? 55 LYS A HZ2  9  
ATOM 10317 H HZ3  . LYS A 1 54 ? 10.939  -10.112 -13.970 1.00 0.00 ? 55 LYS A HZ3  9  
ATOM 10318 N N    . ALA A 1 55 ? 8.988   -5.766  -7.752  1.00 0.00 ? 56 ALA A N    9  
ATOM 10319 C CA   . ALA A 1 55 ? 8.300   -4.768  -6.890  1.00 0.00 ? 56 ALA A CA   9  
ATOM 10320 C C    . ALA A 1 55 ? 9.181   -3.525  -6.759  1.00 0.00 ? 56 ALA A C    9  
ATOM 10321 O O    . ALA A 1 55 ? 8.701   -2.411  -6.696  1.00 0.00 ? 56 ALA A O    9  
ATOM 10322 C CB   . ALA A 1 55 ? 8.059   -5.369  -5.505  1.00 0.00 ? 56 ALA A CB   9  
ATOM 10323 H H    . ALA A 1 55 ? 9.285   -6.613  -7.373  1.00 0.00 ? 56 ALA A H    9  
ATOM 10324 H HA   . ALA A 1 55 ? 7.352   -4.504  -7.338  1.00 0.00 ? 56 ALA A HA   9  
ATOM 10325 H HB1  . ALA A 1 55 ? 7.489   -6.282  -5.603  1.00 0.00 ? 56 ALA A HB1  9  
ATOM 10326 H HB2  . ALA A 1 55 ? 9.008   -5.585  -5.036  1.00 0.00 ? 56 ALA A HB2  9  
ATOM 10327 H HB3  . ALA A 1 55 ? 7.510   -4.665  -4.898  1.00 0.00 ? 56 ALA A HB3  9  
ATOM 10328 N N    . ALA A 1 56 ? 10.472  -3.713  -6.720  1.00 0.00 ? 57 ALA A N    9  
ATOM 10329 C CA   . ALA A 1 56 ? 11.398  -2.555  -6.595  1.00 0.00 ? 57 ALA A CA   9  
ATOM 10330 C C    . ALA A 1 56 ? 11.018  -1.489  -7.623  1.00 0.00 ? 57 ALA A C    9  
ATOM 10331 O O    . ALA A 1 56 ? 10.898  -0.322  -7.310  1.00 0.00 ? 57 ALA A O    9  
ATOM 10332 C CB   . ALA A 1 56 ? 12.831  -3.025  -6.853  1.00 0.00 ? 57 ALA A CB   9  
ATOM 10333 H H    . ALA A 1 56 ? 10.834  -4.622  -6.775  1.00 0.00 ? 57 ALA A H    9  
ATOM 10334 H HA   . ALA A 1 56 ? 11.327  -2.139  -5.600  1.00 0.00 ? 57 ALA A HA   9  
ATOM 10335 H HB1  . ALA A 1 56 ? 12.895  -3.451  -7.844  1.00 0.00 ? 57 ALA A HB1  9  
ATOM 10336 H HB2  . ALA A 1 56 ? 13.506  -2.186  -6.778  1.00 0.00 ? 57 ALA A HB2  9  
ATOM 10337 H HB3  . ALA A 1 56 ? 13.102  -3.772  -6.121  1.00 0.00 ? 57 ALA A HB3  9  
ATOM 10338 N N    . LYS A 1 57 ? 10.829  -1.885  -8.851  1.00 0.00 ? 58 LYS A N    9  
ATOM 10339 C CA   . LYS A 1 57 ? 10.457  -0.896  -9.903  1.00 0.00 ? 58 LYS A CA   9  
ATOM 10340 C C    . LYS A 1 57 ? 9.298   -0.032  -9.405  1.00 0.00 ? 58 LYS A C    9  
ATOM 10341 O O    . LYS A 1 57 ? 9.418   1.170   -9.305  1.00 0.00 ? 58 LYS A O    9  
ATOM 10342 C CB   . LYS A 1 57 ? 10.042  -1.634  -11.177 1.00 0.00 ? 58 LYS A CB   9  
ATOM 10343 C CG   . LYS A 1 57 ? 9.513   -0.629  -12.202 1.00 0.00 ? 58 LYS A CG   9  
ATOM 10344 C CD   . LYS A 1 57 ? 10.557  -0.421  -13.301 1.00 0.00 ? 58 LYS A CD   9  
ATOM 10345 C CE   . LYS A 1 57 ? 10.755  1.077   -13.543 1.00 0.00 ? 58 LYS A CE   9  
ATOM 10346 N NZ   . LYS A 1 57 ? 10.000  1.489   -14.760 1.00 0.00 ? 58 LYS A NZ   9  
ATOM 10347 H H    . LYS A 1 57 ? 10.932  -2.832  -9.082  1.00 0.00 ? 58 LYS A H    9  
ATOM 10348 H HA   . LYS A 1 57 ? 11.308  -0.261  -10.114 1.00 0.00 ? 58 LYS A HA   9  
ATOM 10349 H HB2  . LYS A 1 57 ? 10.897  -2.152  -11.587 1.00 0.00 ? 58 LYS A HB2  9  
ATOM 10350 H HB3  . LYS A 1 57 ? 9.266   -2.348  -10.943 1.00 0.00 ? 58 LYS A HB3  9  
ATOM 10351 H HG2  . LYS A 1 57 ? 8.600   -1.008  -12.640 1.00 0.00 ? 58 LYS A HG2  9  
ATOM 10352 H HG3  . LYS A 1 57 ? 9.315   0.313   -11.715 1.00 0.00 ? 58 LYS A HG3  9  
ATOM 10353 H HD2  . LYS A 1 57 ? 11.494  -0.865  -12.995 1.00 0.00 ? 58 LYS A HD2  9  
ATOM 10354 H HD3  . LYS A 1 57 ? 10.218  -0.889  -14.214 1.00 0.00 ? 58 LYS A HD3  9  
ATOM 10355 H HE2  . LYS A 1 57 ? 10.391  1.630   -12.689 1.00 0.00 ? 58 LYS A HE2  9  
ATOM 10356 H HE3  . LYS A 1 57 ? 11.806  1.284   -13.684 1.00 0.00 ? 58 LYS A HE3  9  
ATOM 10357 H HZ1  . LYS A 1 57 ? 10.141  0.784   -15.509 1.00 0.00 ? 58 LYS A HZ1  9  
ATOM 10358 H HZ2  . LYS A 1 57 ? 8.986   1.555   -14.533 1.00 0.00 ? 58 LYS A HZ2  9  
ATOM 10359 H HZ3  . LYS A 1 57 ? 10.344  2.413   -15.086 1.00 0.00 ? 58 LYS A HZ3  9  
ATOM 10360 N N    . ALA A 1 58 ? 8.178   -0.625  -9.088  1.00 0.00 ? 59 ALA A N    9  
ATOM 10361 C CA   . ALA A 1 58 ? 7.032   0.194   -8.598  1.00 0.00 ? 59 ALA A CA   9  
ATOM 10362 C C    . ALA A 1 58 ? 7.488   1.030   -7.410  1.00 0.00 ? 59 ALA A C    9  
ATOM 10363 O O    . ALA A 1 58 ? 6.987   2.099   -7.174  1.00 0.00 ? 59 ALA A O    9  
ATOM 10364 C CB   . ALA A 1 58 ? 5.880   -0.709  -8.144  1.00 0.00 ? 59 ALA A CB   9  
ATOM 10365 H H    . ALA A 1 58 ? 8.092   -1.598  -9.171  1.00 0.00 ? 59 ALA A H    9  
ATOM 10366 H HA   . ALA A 1 58 ? 6.690   0.849   -9.388  1.00 0.00 ? 59 ALA A HA   9  
ATOM 10367 H HB1  . ALA A 1 58 ? 6.271   -1.668  -7.841  1.00 0.00 ? 59 ALA A HB1  9  
ATOM 10368 H HB2  . ALA A 1 58 ? 5.366   -0.246  -7.305  1.00 0.00 ? 59 ALA A HB2  9  
ATOM 10369 H HB3  . ALA A 1 58 ? 5.185   -0.845  -8.960  1.00 0.00 ? 59 ALA A HB3  9  
ATOM 10370 N N    . LYS A 1 59 ? 8.432   0.546   -6.655  1.00 0.00 ? 60 LYS A N    9  
ATOM 10371 C CA   . LYS A 1 59 ? 8.912   1.302   -5.476  1.00 0.00 ? 60 LYS A CA   9  
ATOM 10372 C C    . LYS A 1 59 ? 9.504   2.630   -5.917  1.00 0.00 ? 60 LYS A C    9  
ATOM 10373 O O    . LYS A 1 59 ? 9.244   3.660   -5.337  1.00 0.00 ? 60 LYS A O    9  
ATOM 10374 C CB   . LYS A 1 59 ? 9.994   0.476   -4.805  1.00 0.00 ? 60 LYS A CB   9  
ATOM 10375 C CG   . LYS A 1 59 ? 9.678   0.312   -3.316  1.00 0.00 ? 60 LYS A CG   9  
ATOM 10376 C CD   . LYS A 1 59 ? 10.901  -0.251  -2.588  1.00 0.00 ? 60 LYS A CD   9  
ATOM 10377 C CE   . LYS A 1 59 ? 10.952  0.314   -1.167  1.00 0.00 ? 60 LYS A CE   9  
ATOM 10378 N NZ   . LYS A 1 59 ? 11.833  -0.541  -0.320  1.00 0.00 ? 60 LYS A NZ   9  
ATOM 10379 H H    . LYS A 1 59 ? 8.831   -0.323  -6.858  1.00 0.00 ? 60 LYS A H    9  
ATOM 10380 H HA   . LYS A 1 59 ? 8.099   1.475   -4.793  1.00 0.00 ? 60 LYS A HA   9  
ATOM 10381 H HB2  . LYS A 1 59 ? 10.041  -0.489  -5.282  1.00 0.00 ? 60 LYS A HB2  9  
ATOM 10382 H HB3  . LYS A 1 59 ? 10.936  0.971   -4.924  1.00 0.00 ? 60 LYS A HB3  9  
ATOM 10383 H HG2  . LYS A 1 59 ? 9.420   1.274   -2.896  1.00 0.00 ? 60 LYS A HG2  9  
ATOM 10384 H HG3  . LYS A 1 59 ? 8.847   -0.367  -3.196  1.00 0.00 ? 60 LYS A HG3  9  
ATOM 10385 H HD2  . LYS A 1 59 ? 10.832  -1.328  -2.547  1.00 0.00 ? 60 LYS A HD2  9  
ATOM 10386 H HD3  . LYS A 1 59 ? 11.797  0.032   -3.118  1.00 0.00 ? 60 LYS A HD3  9  
ATOM 10387 H HE2  . LYS A 1 59 ? 11.344  1.319   -1.193  1.00 0.00 ? 60 LYS A HE2  9  
ATOM 10388 H HE3  . LYS A 1 59 ? 9.957   0.327   -0.750  1.00 0.00 ? 60 LYS A HE3  9  
ATOM 10389 H HZ1  . LYS A 1 59 ? 12.711  -0.751  -0.835  1.00 0.00 ? 60 LYS A HZ1  9  
ATOM 10390 H HZ2  . LYS A 1 59 ? 12.063  -0.036  0.559   1.00 0.00 ? 60 LYS A HZ2  9  
ATOM 10391 H HZ3  . LYS A 1 59 ? 11.341  -1.429  -0.093  1.00 0.00 ? 60 LYS A HZ3  9  
ATOM 10392 N N    . ASP A 1 60 ? 10.314  2.609   -6.924  1.00 0.00 ? 61 ASP A N    9  
ATOM 10393 C CA   . ASP A 1 60 ? 10.938  3.877   -7.396  1.00 0.00 ? 61 ASP A CA   9  
ATOM 10394 C C    . ASP A 1 60 ? 9.885   4.747   -8.092  1.00 0.00 ? 61 ASP A C    9  
ATOM 10395 O O    . ASP A 1 60 ? 9.780   5.930   -7.840  1.00 0.00 ? 61 ASP A O    9  
ATOM 10396 C CB   . ASP A 1 60 ? 12.075  3.549   -8.370  1.00 0.00 ? 61 ASP A CB   9  
ATOM 10397 C CG   . ASP A 1 60 ? 12.475  4.807   -9.142  1.00 0.00 ? 61 ASP A CG   9  
ATOM 10398 O OD1  . ASP A 1 60 ? 12.420  5.877   -8.559  1.00 0.00 ? 61 ASP A OD1  9  
ATOM 10399 O OD2  . ASP A 1 60 ? 12.830  4.680   -10.303 1.00 0.00 ? 61 ASP A OD2  9  
ATOM 10400 H H    . ASP A 1 60 ? 10.523  1.755   -7.362  1.00 0.00 ? 61 ASP A H    9  
ATOM 10401 H HA   . ASP A 1 60 ? 11.329  4.416   -6.547  1.00 0.00 ? 61 ASP A HA   9  
ATOM 10402 H HB2  . ASP A 1 60 ? 12.926  3.181   -7.814  1.00 0.00 ? 61 ASP A HB2  9  
ATOM 10403 H HB3  . ASP A 1 60 ? 11.745  2.788   -9.066  1.00 0.00 ? 61 ASP A HB3  9  
ATOM 10404 N N    . ASP A 1 61 ? 9.108   4.173   -8.965  1.00 0.00 ? 62 ASP A N    9  
ATOM 10405 C CA   . ASP A 1 61 ? 8.065   4.968   -9.672  1.00 0.00 ? 62 ASP A CA   9  
ATOM 10406 C C    . ASP A 1 61 ? 6.921   5.280   -8.707  1.00 0.00 ? 62 ASP A C    9  
ATOM 10407 O O    . ASP A 1 61 ? 6.027   6.044   -9.013  1.00 0.00 ? 62 ASP A O    9  
ATOM 10408 C CB   . ASP A 1 61 ? 7.518   4.148   -10.839 1.00 0.00 ? 62 ASP A CB   9  
ATOM 10409 C CG   . ASP A 1 61 ? 8.435   4.304   -12.054 1.00 0.00 ? 62 ASP A CG   9  
ATOM 10410 O OD1  . ASP A 1 61 ? 9.577   4.692   -11.866 1.00 0.00 ? 62 ASP A OD1  9  
ATOM 10411 O OD2  . ASP A 1 61 ? 7.979   4.034   -13.153 1.00 0.00 ? 62 ASP A OD2  9  
ATOM 10412 H H    . ASP A 1 61 ? 9.207   3.220   -9.156  1.00 0.00 ? 62 ASP A H    9  
ATOM 10413 H HA   . ASP A 1 61 ? 8.493   5.888   -10.042 1.00 0.00 ? 62 ASP A HA   9  
ATOM 10414 H HB2  . ASP A 1 61 ? 7.470   3.107   -10.550 1.00 0.00 ? 62 ASP A HB2  9  
ATOM 10415 H HB3  . ASP A 1 61 ? 6.528   4.498   -11.089 1.00 0.00 ? 62 ASP A HB3  9  
ATOM 10416 N N    . TYR A 1 62 ? 6.927   4.675   -7.555  1.00 0.00 ? 63 TYR A N    9  
ATOM 10417 C CA   . TYR A 1 62 ? 5.828   4.911   -6.582  1.00 0.00 ? 63 TYR A CA   9  
ATOM 10418 C C    . TYR A 1 62 ? 6.215   6.006   -5.586  1.00 0.00 ? 63 TYR A C    9  
ATOM 10419 O O    . TYR A 1 62 ? 5.450   6.903   -5.317  1.00 0.00 ? 63 TYR A O    9  
ATOM 10420 C CB   . TYR A 1 62 ? 5.565   3.615   -5.839  1.00 0.00 ? 63 TYR A CB   9  
ATOM 10421 C CG   . TYR A 1 62 ? 4.636   3.866   -4.699  1.00 0.00 ? 63 TYR A CG   9  
ATOM 10422 C CD1  . TYR A 1 62 ? 3.311   4.228   -4.944  1.00 0.00 ? 63 TYR A CD1  9  
ATOM 10423 C CD2  . TYR A 1 62 ? 5.098   3.715   -3.397  1.00 0.00 ? 63 TYR A CD2  9  
ATOM 10424 C CE1  . TYR A 1 62 ? 2.440   4.439   -3.876  1.00 0.00 ? 63 TYR A CE1  9  
ATOM 10425 C CE2  . TYR A 1 62 ? 4.232   3.926   -2.322  1.00 0.00 ? 63 TYR A CE2  9  
ATOM 10426 C CZ   . TYR A 1 62 ? 2.898   4.285   -2.559  1.00 0.00 ? 63 TYR A CZ   9  
ATOM 10427 O OH   . TYR A 1 62 ? 2.040   4.492   -1.499  1.00 0.00 ? 63 TYR A OH   9  
ATOM 10428 H H    . TYR A 1 62 ? 7.646   4.045   -7.333  1.00 0.00 ? 63 TYR A H    9  
ATOM 10429 H HA   . TYR A 1 62 ? 4.935   5.204   -7.110  1.00 0.00 ? 63 TYR A HA   9  
ATOM 10430 H HB2  . TYR A 1 62 ? 5.119   2.899   -6.513  1.00 0.00 ? 63 TYR A HB2  9  
ATOM 10431 H HB3  . TYR A 1 62 ? 6.497   3.223   -5.461  1.00 0.00 ? 63 TYR A HB3  9  
ATOM 10432 H HD1  . TYR A 1 62 ? 2.962   4.344   -5.960  1.00 0.00 ? 63 TYR A HD1  9  
ATOM 10433 H HD2  . TYR A 1 62 ? 6.132   3.446   -3.222  1.00 0.00 ? 63 TYR A HD2  9  
ATOM 10434 H HE1  . TYR A 1 62 ? 1.417   4.720   -4.068  1.00 0.00 ? 63 TYR A HE1  9  
ATOM 10435 H HE2  . TYR A 1 62 ? 4.589   3.796   -1.314  1.00 0.00 ? 63 TYR A HE2  9  
ATOM 10436 H HH   . TYR A 1 62 ? 2.567   4.726   -0.731  1.00 0.00 ? 63 TYR A HH   9  
ATOM 10437 N N    . ASP A 1 63 ? 7.391   5.945   -5.035  1.00 0.00 ? 64 ASP A N    9  
ATOM 10438 C CA   . ASP A 1 63 ? 7.804   6.991   -4.065  1.00 0.00 ? 64 ASP A CA   9  
ATOM 10439 C C    . ASP A 1 63 ? 8.030   8.285   -4.824  1.00 0.00 ? 64 ASP A C    9  
ATOM 10440 O O    . ASP A 1 63 ? 7.911   9.373   -4.296  1.00 0.00 ? 64 ASP A O    9  
ATOM 10441 C CB   . ASP A 1 63 ? 9.094   6.569   -3.402  1.00 0.00 ? 64 ASP A CB   9  
ATOM 10442 C CG   . ASP A 1 63 ? 9.216   7.239   -2.032  1.00 0.00 ? 64 ASP A CG   9  
ATOM 10443 O OD1  . ASP A 1 63 ? 8.971   8.432   -1.953  1.00 0.00 ? 64 ASP A OD1  9  
ATOM 10444 O OD2  . ASP A 1 63 ? 9.553   6.548   -1.086  1.00 0.00 ? 64 ASP A OD2  9  
ATOM 10445 H H    . ASP A 1 63 ? 8.002   5.219   -5.259  1.00 0.00 ? 64 ASP A H    9  
ATOM 10446 H HA   . ASP A 1 63 ? 7.049   7.118   -3.318  1.00 0.00 ? 64 ASP A HA   9  
ATOM 10447 H HB2  . ASP A 1 63 ? 9.076   5.509   -3.287  1.00 0.00 ? 64 ASP A HB2  9  
ATOM 10448 H HB3  . ASP A 1 63 ? 9.927   6.856   -4.020  1.00 0.00 ? 64 ASP A HB3  9  
ATOM 10449 N N    . ARG A 1 64 ? 8.377   8.158   -6.068  1.00 0.00 ? 65 ARG A N    9  
ATOM 10450 C CA   . ARG A 1 64 ? 8.645   9.355   -6.902  1.00 0.00 ? 65 ARG A CA   9  
ATOM 10451 C C    . ARG A 1 64 ? 7.354   9.862   -7.555  1.00 0.00 ? 65 ARG A C    9  
ATOM 10452 O O    . ARG A 1 64 ? 7.139   11.051  -7.682  1.00 0.00 ? 65 ARG A O    9  
ATOM 10453 C CB   . ARG A 1 64 ? 9.651   8.985   -7.993  1.00 0.00 ? 65 ARG A CB   9  
ATOM 10454 C CG   . ARG A 1 64 ? 10.507  10.204  -8.338  1.00 0.00 ? 65 ARG A CG   9  
ATOM 10455 C CD   . ARG A 1 64 ? 11.941  9.753   -8.620  1.00 0.00 ? 65 ARG A CD   9  
ATOM 10456 N NE   . ARG A 1 64 ? 12.810  10.110  -7.464  1.00 0.00 ? 65 ARG A NE   9  
ATOM 10457 C CZ   . ARG A 1 64 ? 12.918  11.355  -7.088  1.00 0.00 ? 65 ARG A CZ   9  
ATOM 10458 N NH1  . ARG A 1 64 ? 12.427  12.308  -7.833  1.00 0.00 ? 65 ARG A NH1  9  
ATOM 10459 N NH2  . ARG A 1 64 ? 13.517  11.648  -5.966  1.00 0.00 ? 65 ARG A NH2  9  
ATOM 10460 H H    . ARG A 1 64 ? 8.480   7.260   -6.448  1.00 0.00 ? 65 ARG A H    9  
ATOM 10461 H HA   . ARG A 1 64 ? 9.060   10.125  -6.283  1.00 0.00 ? 65 ARG A HA   9  
ATOM 10462 H HB2  . ARG A 1 64 ? 10.288  8.187   -7.639  1.00 0.00 ? 65 ARG A HB2  9  
ATOM 10463 H HB3  . ARG A 1 64 ? 9.121   8.658   -8.875  1.00 0.00 ? 65 ARG A HB3  9  
ATOM 10464 H HG2  . ARG A 1 64 ? 10.102  10.693  -9.213  1.00 0.00 ? 65 ARG A HG2  9  
ATOM 10465 H HG3  . ARG A 1 64 ? 10.506  10.891  -7.506  1.00 0.00 ? 65 ARG A HG3  9  
ATOM 10466 H HD2  . ARG A 1 64 ? 11.960  8.683   -8.768  1.00 0.00 ? 65 ARG A HD2  9  
ATOM 10467 H HD3  . ARG A 1 64 ? 12.305  10.246  -9.509  1.00 0.00 ? 65 ARG A HD3  9  
ATOM 10468 H HE   . ARG A 1 64 ? 13.301  9.409   -6.984  1.00 0.00 ? 65 ARG A HE   9  
ATOM 10469 H HH11 . ARG A 1 64 ? 11.967  12.085  -8.693  1.00 0.00 ? 65 ARG A HH11 9  
ATOM 10470 H HH12 . ARG A 1 64 ? 12.512  13.262  -7.544  1.00 0.00 ? 65 ARG A HH12 9  
ATOM 10471 H HH21 . ARG A 1 64 ? 13.892  10.919  -5.394  1.00 0.00 ? 65 ARG A HH21 9  
ATOM 10472 H HH22 . ARG A 1 64 ? 13.600  12.602  -5.679  1.00 0.00 ? 65 ARG A HH22 9  
ATOM 10473 N N    . ALA A 1 65 ? 6.509   8.972   -7.993  1.00 0.00 ? 66 ALA A N    9  
ATOM 10474 C CA   . ALA A 1 65 ? 5.246   9.406   -8.665  1.00 0.00 ? 66 ALA A CA   9  
ATOM 10475 C C    . ALA A 1 65 ? 4.192   9.810   -7.638  1.00 0.00 ? 66 ALA A C    9  
ATOM 10476 O O    . ALA A 1 65 ? 3.332   10.612  -7.926  1.00 0.00 ? 66 ALA A O    9  
ATOM 10477 C CB   . ALA A 1 65 ? 4.706   8.258   -9.520  1.00 0.00 ? 66 ALA A CB   9  
ATOM 10478 H H    . ALA A 1 65 ? 6.712   8.021   -7.899  1.00 0.00 ? 66 ALA A H    9  
ATOM 10479 H HA   . ALA A 1 65 ? 5.452   10.257  -9.299  1.00 0.00 ? 66 ALA A HA   9  
ATOM 10480 H HB1  . ALA A 1 65 ? 5.481   7.911   -10.186 1.00 0.00 ? 66 ALA A HB1  9  
ATOM 10481 H HB2  . ALA A 1 65 ? 4.394   7.448   -8.877  1.00 0.00 ? 66 ALA A HB2  9  
ATOM 10482 H HB3  . ALA A 1 65 ? 3.863   8.605   -10.097 1.00 0.00 ? 66 ALA A HB3  9  
ATOM 10483 N N    . VAL A 1 66 ? 4.237   9.285   -6.446  1.00 0.00 ? 67 VAL A N    9  
ATOM 10484 C CA   . VAL A 1 66 ? 3.217   9.691   -5.452  1.00 0.00 ? 67 VAL A CA   9  
ATOM 10485 C C    . VAL A 1 66 ? 3.447   11.150  -5.104  1.00 0.00 ? 67 VAL A C    9  
ATOM 10486 O O    . VAL A 1 66 ? 2.528   11.910  -4.977  1.00 0.00 ? 67 VAL A O    9  
ATOM 10487 C CB   . VAL A 1 66 ? 3.323   8.867   -4.192  1.00 0.00 ? 67 VAL A CB   9  
ATOM 10488 C CG1  . VAL A 1 66 ? 3.076   7.394   -4.501  1.00 0.00 ? 67 VAL A CG1  9  
ATOM 10489 C CG2  . VAL A 1 66 ? 4.700   9.068   -3.620  1.00 0.00 ? 67 VAL A CG2  9  
ATOM 10490 H H    . VAL A 1 66 ? 4.931   8.646   -6.210  1.00 0.00 ? 67 VAL A H    9  
ATOM 10491 H HA   . VAL A 1 66 ? 2.248   9.568   -5.869  1.00 0.00 ? 67 VAL A HA   9  
ATOM 10492 H HB   . VAL A 1 66 ? 2.595   9.215   -3.489  1.00 0.00 ? 67 VAL A HB   9  
ATOM 10493 H HG11 . VAL A 1 66 ? 3.134   7.238   -5.568  1.00 0.00 ? 67 VAL A HG11 9  
ATOM 10494 H HG12 . VAL A 1 66 ? 3.820   6.792   -4.004  1.00 0.00 ? 67 VAL A HG12 9  
ATOM 10495 H HG13 . VAL A 1 66 ? 2.093   7.118   -4.150  1.00 0.00 ? 67 VAL A HG13 9  
ATOM 10496 H HG21 . VAL A 1 66 ? 5.404   9.137   -4.430  1.00 0.00 ? 67 VAL A HG21 9  
ATOM 10497 H HG22 . VAL A 1 66 ? 4.706   9.987   -3.057  1.00 0.00 ? 67 VAL A HG22 9  
ATOM 10498 H HG23 . VAL A 1 66 ? 4.951   8.240   -2.979  1.00 0.00 ? 67 VAL A HG23 9  
ATOM 10499 N N    . LYS A 1 67 ? 4.679   11.540  -4.952  1.00 0.00 ? 68 LYS A N    9  
ATOM 10500 C CA   . LYS A 1 67 ? 4.974   12.965  -4.621  1.00 0.00 ? 68 LYS A CA   9  
ATOM 10501 C C    . LYS A 1 67 ? 4.205   13.861  -5.595  1.00 0.00 ? 68 LYS A C    9  
ATOM 10502 O O    . LYS A 1 67 ? 3.665   14.882  -5.223  1.00 0.00 ? 68 LYS A O    9  
ATOM 10503 C CB   . LYS A 1 67 ? 6.475   13.227  -4.755  1.00 0.00 ? 68 LYS A CB   9  
ATOM 10504 C CG   . LYS A 1 67 ? 7.231   12.392  -3.718  1.00 0.00 ? 68 LYS A CG   9  
ATOM 10505 C CD   . LYS A 1 67 ? 8.632   12.971  -3.516  1.00 0.00 ? 68 LYS A CD   9  
ATOM 10506 C CE   . LYS A 1 67 ? 9.117   12.655  -2.100  1.00 0.00 ? 68 LYS A CE   9  
ATOM 10507 N NZ   . LYS A 1 67 ? 8.561   13.660  -1.151  1.00 0.00 ? 68 LYS A NZ   9  
ATOM 10508 H H    . LYS A 1 67 ? 5.408   10.897  -5.060  1.00 0.00 ? 68 LYS A H    9  
ATOM 10509 H HA   . LYS A 1 67 ? 4.657   13.173  -3.610  1.00 0.00 ? 68 LYS A HA   9  
ATOM 10510 H HB2  . LYS A 1 67 ? 6.802   12.953  -5.747  1.00 0.00 ? 68 LYS A HB2  9  
ATOM 10511 H HB3  . LYS A 1 67 ? 6.674   14.274  -4.586  1.00 0.00 ? 68 LYS A HB3  9  
ATOM 10512 H HG2  . LYS A 1 67 ? 6.694   12.413  -2.780  1.00 0.00 ? 68 LYS A HG2  9  
ATOM 10513 H HG3  . LYS A 1 67 ? 7.311   11.374  -4.066  1.00 0.00 ? 68 LYS A HG3  9  
ATOM 10514 H HD2  . LYS A 1 67 ? 9.309   12.535  -4.236  1.00 0.00 ? 68 LYS A HD2  9  
ATOM 10515 H HD3  . LYS A 1 67 ? 8.602   14.041  -3.653  1.00 0.00 ? 68 LYS A HD3  9  
ATOM 10516 H HE2  . LYS A 1 67 ? 8.781   11.668  -1.818  1.00 0.00 ? 68 LYS A HE2  9  
ATOM 10517 H HE3  . LYS A 1 67 ? 10.196  12.689  -2.073  1.00 0.00 ? 68 LYS A HE3  9  
ATOM 10518 H HZ1  . LYS A 1 67 ? 8.859   14.613  -1.443  1.00 0.00 ? 68 LYS A HZ1  9  
ATOM 10519 H HZ2  . LYS A 1 67 ? 7.524   13.603  -1.153  1.00 0.00 ? 68 LYS A HZ2  9  
ATOM 10520 H HZ3  . LYS A 1 67 ? 8.915   13.465  -0.193  1.00 0.00 ? 68 LYS A HZ3  9  
ATOM 10521 N N    . GLU A 1 68 ? 4.131   13.461  -6.836  1.00 0.00 ? 69 GLU A N    9  
ATOM 10522 C CA   . GLU A 1 68 ? 3.374   14.247  -7.844  1.00 0.00 ? 69 GLU A CA   9  
ATOM 10523 C C    . GLU A 1 68 ? 1.896   14.130  -7.469  1.00 0.00 ? 69 GLU A C    9  
ATOM 10524 O O    . GLU A 1 68 ? 1.176   15.094  -7.303  1.00 0.00 ? 69 GLU A O    9  
ATOM 10525 C CB   . GLU A 1 68 ? 3.662   13.608  -9.219  1.00 0.00 ? 69 GLU A CB   9  
ATOM 10526 C CG   . GLU A 1 68 ? 2.379   13.091  -9.872  1.00 0.00 ? 69 GLU A CG   9  
ATOM 10527 C CD   . GLU A 1 68 ? 2.635   12.817  -11.356 1.00 0.00 ? 69 GLU A CD   9  
ATOM 10528 O OE1  . GLU A 1 68 ? 2.648   13.769  -12.119 1.00 0.00 ? 69 GLU A OE1  9  
ATOM 10529 O OE2  . GLU A 1 68 ? 2.814   11.661  -11.703 1.00 0.00 ? 69 GLU A OE2  9  
ATOM 10530 H H    . GLU A 1 68 ? 4.553   12.618  -7.104  1.00 0.00 ? 69 GLU A H    9  
ATOM 10531 H HA   . GLU A 1 68 ? 3.688   15.280  -7.833  1.00 0.00 ? 69 GLU A HA   9  
ATOM 10532 H HB2  . GLU A 1 68 ? 4.126   14.336  -9.866  1.00 0.00 ? 69 GLU A HB2  9  
ATOM 10533 H HB3  . GLU A 1 68 ? 4.337   12.769  -9.076  1.00 0.00 ? 69 GLU A HB3  9  
ATOM 10534 H HG2  . GLU A 1 68 ? 2.080   12.177  -9.380  1.00 0.00 ? 69 GLU A HG2  9  
ATOM 10535 H HG3  . GLU A 1 68 ? 1.599   13.829  -9.770  1.00 0.00 ? 69 GLU A HG3  9  
ATOM 10536 N N    . PHE A 1 69 ? 1.491   12.914  -7.308  1.00 0.00 ? 70 PHE A N    9  
ATOM 10537 C CA   . PHE A 1 69 ? 0.105   12.569  -6.900  1.00 0.00 ? 70 PHE A CA   9  
ATOM 10538 C C    . PHE A 1 69 ? -0.293  13.330  -5.636  1.00 0.00 ? 70 PHE A C    9  
ATOM 10539 O O    . PHE A 1 69 ? -1.456  13.543  -5.361  1.00 0.00 ? 70 PHE A O    9  
ATOM 10540 C CB   . PHE A 1 69 ? 0.143   11.107  -6.554  1.00 0.00 ? 70 PHE A CB   9  
ATOM 10541 C CG   . PHE A 1 69 ? -0.997  10.786  -5.666  1.00 0.00 ? 70 PHE A CG   9  
ATOM 10542 C CD1  . PHE A 1 69 ? -2.236  10.563  -6.224  1.00 0.00 ? 70 PHE A CD1  9  
ATOM 10543 C CD2  . PHE A 1 69 ? -0.801  10.745  -4.294  1.00 0.00 ? 70 PHE A CD2  9  
ATOM 10544 C CE1  . PHE A 1 69 ? -3.324  10.284  -5.403  1.00 0.00 ? 70 PHE A CE1  9  
ATOM 10545 C CE2  . PHE A 1 69 ? -1.882  10.464  -3.453  1.00 0.00 ? 70 PHE A CE2  9  
ATOM 10546 C CZ   . PHE A 1 69 ? -3.151  10.230  -4.010  1.00 0.00 ? 70 PHE A CZ   9  
ATOM 10547 H H    . PHE A 1 69 ? 2.138   12.191  -7.439  1.00 0.00 ? 70 PHE A H    9  
ATOM 10548 H HA   . PHE A 1 69 ? -0.609  12.720  -7.690  1.00 0.00 ? 70 PHE A HA   9  
ATOM 10549 H HB2  . PHE A 1 69 ? 0.074   10.527  -7.455  1.00 0.00 ? 70 PHE A HB2  9  
ATOM 10550 H HB3  . PHE A 1 69 ? 1.064   10.903  -6.035  1.00 0.00 ? 70 PHE A HB3  9  
ATOM 10551 H HD1  . PHE A 1 69 ? -2.347  10.609  -7.296  1.00 0.00 ? 70 PHE A HD1  9  
ATOM 10552 H HD2  . PHE A 1 69 ? 0.191   10.940  -3.886  1.00 0.00 ? 70 PHE A HD2  9  
ATOM 10553 H HE1  . PHE A 1 69 ? -4.291  10.116  -5.840  1.00 0.00 ? 70 PHE A HE1  9  
ATOM 10554 H HE2  . PHE A 1 69 ? -1.742  10.425  -2.385  1.00 0.00 ? 70 PHE A HE2  9  
ATOM 10555 H HZ   . PHE A 1 69 ? -3.992  10.013  -3.367  1.00 0.00 ? 70 PHE A HZ   9  
ATOM 10556 N N    . GLU A 1 70 ? 0.667   13.691  -4.849  1.00 0.00 ? 71 GLU A N    9  
ATOM 10557 C CA   . GLU A 1 70 ? 0.362   14.381  -3.575  1.00 0.00 ? 71 GLU A CA   9  
ATOM 10558 C C    . GLU A 1 70 ? 0.510   15.879  -3.796  1.00 0.00 ? 71 GLU A C    9  
ATOM 10559 O O    . GLU A 1 70 ? -0.036  16.698  -3.083  1.00 0.00 ? 71 GLU A O    9  
ATOM 10560 C CB   . GLU A 1 70 ? 1.349   13.912  -2.501  1.00 0.00 ? 71 GLU A CB   9  
ATOM 10561 C CG   . GLU A 1 70 ? 1.201   12.400  -2.293  1.00 0.00 ? 71 GLU A CG   9  
ATOM 10562 C CD   . GLU A 1 70 ? 1.702   12.023  -0.898  1.00 0.00 ? 71 GLU A CD   9  
ATOM 10563 O OE1  . GLU A 1 70 ? 1.954   12.924  -0.117  1.00 0.00 ? 71 GLU A OE1  9  
ATOM 10564 O OE2  . GLU A 1 70 ? 1.825   10.837  -0.635  1.00 0.00 ? 71 GLU A OE2  9  
ATOM 10565 H H    . GLU A 1 70 ? 1.590   13.493  -5.088  1.00 0.00 ? 71 GLU A H    9  
ATOM 10566 H HA   . GLU A 1 70 ? -0.645  14.135  -3.272  1.00 0.00 ? 71 GLU A HA   9  
ATOM 10567 H HB2  . GLU A 1 70 ? 2.357   14.137  -2.815  1.00 0.00 ? 71 GLU A HB2  9  
ATOM 10568 H HB3  . GLU A 1 70 ? 1.139   14.422  -1.572  1.00 0.00 ? 71 GLU A HB3  9  
ATOM 10569 H HG2  . GLU A 1 70 ? 0.161   12.124  -2.391  1.00 0.00 ? 71 GLU A HG2  9  
ATOM 10570 H HG3  . GLU A 1 70 ? 1.783   11.872  -3.035  1.00 0.00 ? 71 GLU A HG3  9  
ATOM 10571 N N    . ALA A 1 71 ? 1.259   16.222  -4.796  1.00 0.00 ? 72 ALA A N    9  
ATOM 10572 C CA   . ALA A 1 71 ? 1.498   17.643  -5.131  1.00 0.00 ? 72 ALA A CA   9  
ATOM 10573 C C    . ALA A 1 71 ? 0.210   18.276  -5.664  1.00 0.00 ? 72 ALA A C    9  
ATOM 10574 O O    . ALA A 1 71 ? 0.146   19.467  -5.903  1.00 0.00 ? 72 ALA A O    9  
ATOM 10575 C CB   . ALA A 1 71 ? 2.577   17.676  -6.205  1.00 0.00 ? 72 ALA A CB   9  
ATOM 10576 H H    . ALA A 1 71 ? 1.681   15.526  -5.341  1.00 0.00 ? 72 ALA A H    9  
ATOM 10577 H HA   . ALA A 1 71 ? 1.837   18.176  -4.257  1.00 0.00 ? 72 ALA A HA   9  
ATOM 10578 H HB1  . ALA A 1 71 ? 2.869   16.656  -6.435  1.00 0.00 ? 72 ALA A HB1  9  
ATOM 10579 H HB2  . ALA A 1 71 ? 2.191   18.154  -7.093  1.00 0.00 ? 72 ALA A HB2  9  
ATOM 10580 H HB3  . ALA A 1 71 ? 3.433   18.223  -5.841  1.00 0.00 ? 72 ALA A HB3  9  
ATOM 10581 N N    . ASN A 1 72 ? -0.815  17.491  -5.853  1.00 0.00 ? 73 ASN A N    9  
ATOM 10582 C CA   . ASN A 1 72 ? -2.096  18.050  -6.371  1.00 0.00 ? 73 ASN A CA   9  
ATOM 10583 C C    . ASN A 1 72 ? -3.109  18.144  -5.229  1.00 0.00 ? 73 ASN A C    9  
ATOM 10584 O O    . ASN A 1 72 ? -3.920  17.261  -5.034  1.00 0.00 ? 73 ASN A O    9  
ATOM 10585 C CB   . ASN A 1 72 ? -2.644  17.131  -7.465  1.00 0.00 ? 73 ASN A CB   9  
ATOM 10586 C CG   . ASN A 1 72 ? -3.150  17.967  -8.633  1.00 0.00 ? 73 ASN A CG   9  
ATOM 10587 O OD1  . ASN A 1 72 ? -2.807  19.125  -8.765  1.00 0.00 ? 73 ASN A OD1  9  
ATOM 10588 N ND2  . ASN A 1 72 ? -3.960  17.422  -9.493  1.00 0.00 ? 73 ASN A ND2  9  
ATOM 10589 H H    . ASN A 1 72 ? -0.742  16.535  -5.656  1.00 0.00 ? 73 ASN A H    9  
ATOM 10590 H HA   . ASN A 1 72 ? -1.920  19.034  -6.780  1.00 0.00 ? 73 ASN A HA   9  
ATOM 10591 H HB2  . ASN A 1 72 ? -1.862  16.472  -7.810  1.00 0.00 ? 73 ASN A HB2  9  
ATOM 10592 H HB3  . ASN A 1 72 ? -3.460  16.546  -7.071  1.00 0.00 ? 73 ASN A HB3  9  
ATOM 10593 H HD21 . ASN A 1 72 ? -4.237  16.488  -9.384  1.00 0.00 ? 73 ASN A HD21 9  
ATOM 10594 H HD22 . ASN A 1 72 ? -4.291  17.944  -10.245 1.00 0.00 ? 73 ASN A HD22 9  
ATOM 10595 N N    . GLY A 1 73 ? -3.071  19.207  -4.473  1.00 0.00 ? 74 GLY A N    9  
ATOM 10596 C CA   . GLY A 1 73 ? -4.034  19.354  -3.345  1.00 0.00 ? 74 GLY A CA   9  
ATOM 10597 C C    . GLY A 1 73 ? -5.375  19.857  -3.883  1.00 0.00 ? 74 GLY A C    9  
ATOM 10598 O O    . GLY A 1 73 ? -5.829  20.889  -3.417  1.00 0.00 ? 74 GLY A O    9  
ATOM 10599 O OXT  . GLY A 1 73 ? -5.927  19.201  -4.752  1.00 0.00 ? 74 GLY A OXT  9  
ATOM 10600 H H    . GLY A 1 73 ? -2.409  19.908  -4.646  1.00 0.00 ? 74 GLY A H    9  
ATOM 10601 H HA2  . GLY A 1 73 ? -4.174  18.396  -2.864  1.00 0.00 ? 74 GLY A HA2  9  
ATOM 10602 H HA3  . GLY A 1 73 ? -3.648  20.064  -2.631  1.00 0.00 ? 74 GLY A HA3  9  
ATOM 10603 N N    . SER A 1 1  ? 0.305   12.304  -13.293 1.00 0.00 ? 2  SER A N    10 
ATOM 10604 C CA   . SER A 1 1  ? 0.383   11.132  -12.377 1.00 0.00 ? 2  SER A CA   10 
ATOM 10605 C C    . SER A 1 1  ? 0.786   11.609  -10.979 1.00 0.00 ? 2  SER A C    10 
ATOM 10606 O O    . SER A 1 1  ? 1.940   11.878  -10.715 1.00 0.00 ? 2  SER A O    10 
ATOM 10607 C CB   . SER A 1 1  ? 1.427   10.146  -12.902 1.00 0.00 ? 2  SER A CB   10 
ATOM 10608 O OG   . SER A 1 1  ? 1.680   10.417  -14.275 1.00 0.00 ? 2  SER A OG   10 
ATOM 10609 H H    . SER A 1 1  ? 1.109   12.621  -13.753 1.00 0.00 ? 2  SER A H    10 
ATOM 10610 H HA   . SER A 1 1  ? -0.581  10.647  -12.328 1.00 0.00 ? 2  SER A HA   10 
ATOM 10611 H HB2  . SER A 1 1  ? 2.341   10.254  -12.344 1.00 0.00 ? 2  SER A HB2  10 
ATOM 10612 H HB3  . SER A 1 1  ? 1.056   9.135   -12.786 1.00 0.00 ? 2  SER A HB3  10 
ATOM 10613 H HG   . SER A 1 1  ? 2.576   10.136  -14.472 1.00 0.00 ? 2  SER A HG   10 
ATOM 10614 N N    . ASP A 1 2  ? -0.156  11.718  -10.082 1.00 0.00 ? 3  ASP A N    10 
ATOM 10615 C CA   . ASP A 1 2  ? 0.176   12.181  -8.705  1.00 0.00 ? 3  ASP A CA   10 
ATOM 10616 C C    . ASP A 1 2  ? 0.448   10.972  -7.805  1.00 0.00 ? 3  ASP A C    10 
ATOM 10617 O O    . ASP A 1 2  ? 1.554   10.474  -7.737  1.00 0.00 ? 3  ASP A O    10 
ATOM 10618 C CB   . ASP A 1 2  ? -0.996  12.989  -8.141  1.00 0.00 ? 3  ASP A CB   10 
ATOM 10619 C CG   . ASP A 1 2  ? -0.857  14.454  -8.559  1.00 0.00 ? 3  ASP A CG   10 
ATOM 10620 O OD1  . ASP A 1 2  ? -0.217  15.199  -7.835  1.00 0.00 ? 3  ASP A OD1  10 
ATOM 10621 O OD2  . ASP A 1 2  ? -1.395  14.807  -9.596  1.00 0.00 ? 3  ASP A OD2  10 
ATOM 10622 H H    . ASP A 1 2  ? -1.083  11.498  -10.315 1.00 0.00 ? 3  ASP A H    10 
ATOM 10623 H HA   . ASP A 1 2  ? 1.057   12.806  -8.740  1.00 0.00 ? 3  ASP A HA   10 
ATOM 10624 H HB2  . ASP A 1 2  ? -1.924  12.591  -8.525  1.00 0.00 ? 3  ASP A HB2  10 
ATOM 10625 H HB3  . ASP A 1 2  ? -0.994  12.923  -7.063  1.00 0.00 ? 3  ASP A HB3  10 
ATOM 10626 N N    . LYS A 1 3  ? -0.550  10.498  -7.109  1.00 0.00 ? 4  LYS A N    10 
ATOM 10627 C CA   . LYS A 1 3  ? -0.343  9.325   -6.212  1.00 0.00 ? 4  LYS A CA   10 
ATOM 10628 C C    . LYS A 1 3  ? 0.336   8.193   -6.995  1.00 0.00 ? 4  LYS A C    10 
ATOM 10629 O O    . LYS A 1 3  ? 0.003   7.947   -8.138  1.00 0.00 ? 4  LYS A O    10 
ATOM 10630 C CB   . LYS A 1 3  ? -1.697  8.845   -5.683  1.00 0.00 ? 4  LYS A CB   10 
ATOM 10631 C CG   . LYS A 1 3  ? -1.476  7.830   -4.559  1.00 0.00 ? 4  LYS A CG   10 
ATOM 10632 C CD   . LYS A 1 3  ? -2.821  7.470   -3.922  1.00 0.00 ? 4  LYS A CD   10 
ATOM 10633 C CE   . LYS A 1 3  ? -3.300  8.630   -3.046  1.00 0.00 ? 4  LYS A CE   10 
ATOM 10634 N NZ   . LYS A 1 3  ? -2.624  8.563   -1.720  1.00 0.00 ? 4  LYS A NZ   10 
ATOM 10635 H H    . LYS A 1 3  ? -1.435  10.914  -7.174  1.00 0.00 ? 4  LYS A H    10 
ATOM 10636 H HA   . LYS A 1 3  ? 0.282   9.619   -5.384  1.00 0.00 ? 4  LYS A HA   10 
ATOM 10637 H HB2  . LYS A 1 3  ? -2.254  9.688   -5.302  1.00 0.00 ? 4  LYS A HB2  10 
ATOM 10638 H HB3  . LYS A 1 3  ? -2.252  8.378   -6.482  1.00 0.00 ? 4  LYS A HB3  10 
ATOM 10639 H HG2  . LYS A 1 3  ? -1.019  6.939   -4.964  1.00 0.00 ? 4  LYS A HG2  10 
ATOM 10640 H HG3  . LYS A 1 3  ? -0.829  8.259   -3.808  1.00 0.00 ? 4  LYS A HG3  10 
ATOM 10641 H HD2  . LYS A 1 3  ? -3.548  7.280   -4.699  1.00 0.00 ? 4  LYS A HD2  10 
ATOM 10642 H HD3  . LYS A 1 3  ? -2.706  6.586   -3.313  1.00 0.00 ? 4  LYS A HD3  10 
ATOM 10643 H HE2  . LYS A 1 3  ? -3.060  9.567   -3.526  1.00 0.00 ? 4  LYS A HE2  10 
ATOM 10644 H HE3  . LYS A 1 3  ? -4.369  8.560   -2.909  1.00 0.00 ? 4  LYS A HE3  10 
ATOM 10645 H HZ1  . LYS A 1 3  ? -1.625  8.308   -1.852  1.00 0.00 ? 4  LYS A HZ1  10 
ATOM 10646 H HZ2  . LYS A 1 3  ? -2.684  9.490   -1.253  1.00 0.00 ? 4  LYS A HZ2  10 
ATOM 10647 H HZ3  . LYS A 1 3  ? -3.092  7.845   -1.130  1.00 0.00 ? 4  LYS A HZ3  10 
ATOM 10648 N N    . PRO A 1 4  ? 1.270   7.534   -6.353  1.00 0.00 ? 5  PRO A N    10 
ATOM 10649 C CA   . PRO A 1 4  ? 2.018   6.421   -6.957  1.00 0.00 ? 5  PRO A CA   10 
ATOM 10650 C C    . PRO A 1 4  ? 1.185   5.142   -6.972  1.00 0.00 ? 5  PRO A C    10 
ATOM 10651 O O    . PRO A 1 4  ? 0.179   5.032   -6.301  1.00 0.00 ? 5  PRO A O    10 
ATOM 10652 C CB   . PRO A 1 4  ? 3.231   6.263   -6.064  1.00 0.00 ? 5  PRO A CB   10 
ATOM 10653 C CG   . PRO A 1 4  ? 2.855   6.887   -4.714  1.00 0.00 ? 5  PRO A CG   10 
ATOM 10654 C CD   . PRO A 1 4  ? 1.671   7.835   -4.969  1.00 0.00 ? 5  PRO A CD   10 
ATOM 10655 H HA   . PRO A 1 4  ? 2.343   6.674   -7.932  1.00 0.00 ? 5  PRO A HA   10 
ATOM 10656 H HB2  . PRO A 1 4  ? 3.467   5.215   -5.944  1.00 0.00 ? 5  PRO A HB2  10 
ATOM 10657 H HB3  . PRO A 1 4  ? 4.070   6.789   -6.489  1.00 0.00 ? 5  PRO A HB3  10 
ATOM 10658 H HG2  . PRO A 1 4  ? 2.570   6.113   -4.028  1.00 0.00 ? 5  PRO A HG2  10 
ATOM 10659 H HG3  . PRO A 1 4  ? 3.687   7.444   -4.331  1.00 0.00 ? 5  PRO A HG3  10 
ATOM 10660 H HD2  . PRO A 1 4  ? 0.863   7.624   -4.281  1.00 0.00 ? 5  PRO A HD2  10 
ATOM 10661 H HD3  . PRO A 1 4  ? 1.982   8.865   -4.887  1.00 0.00 ? 5  PRO A HD3  10 
ATOM 10662 N N    . LYS A 1 5  ? 1.602   4.176   -7.736  1.00 0.00 ? 6  LYS A N    10 
ATOM 10663 C CA   . LYS A 1 5  ? 0.840   2.898   -7.799  1.00 0.00 ? 6  LYS A CA   10 
ATOM 10664 C C    . LYS A 1 5  ? 1.225   2.015   -6.613  1.00 0.00 ? 6  LYS A C    10 
ATOM 10665 O O    . LYS A 1 5  ? 1.981   1.077   -6.750  1.00 0.00 ? 6  LYS A O    10 
ATOM 10666 C CB   . LYS A 1 5  ? 1.146   2.178   -9.107  1.00 0.00 ? 6  LYS A CB   10 
ATOM 10667 C CG   . LYS A 1 5  ? 2.620   1.773   -9.147  1.00 0.00 ? 6  LYS A CG   10 
ATOM 10668 C CD   . LYS A 1 5  ? 3.086   1.701   -10.603 1.00 0.00 ? 6  LYS A CD   10 
ATOM 10669 C CE   . LYS A 1 5  ? 3.607   0.295   -10.904 1.00 0.00 ? 6  LYS A CE   10 
ATOM 10670 N NZ   . LYS A 1 5  ? 4.712   0.377   -11.900 1.00 0.00 ? 6  LYS A NZ   10 
ATOM 10671 H H    . LYS A 1 5  ? 2.417   4.293   -8.266  1.00 0.00 ? 6  LYS A H    10 
ATOM 10672 H HA   . LYS A 1 5  ? -0.215  3.109   -7.754  1.00 0.00 ? 6  LYS A HA   10 
ATOM 10673 H HB2  . LYS A 1 5  ? 0.525   1.299   -9.179  1.00 0.00 ? 6  LYS A HB2  10 
ATOM 10674 H HB3  . LYS A 1 5  ? 0.932   2.838   -9.932  1.00 0.00 ? 6  LYS A HB3  10 
ATOM 10675 H HG2  . LYS A 1 5  ? 3.210   2.503   -8.613  1.00 0.00 ? 6  LYS A HG2  10 
ATOM 10676 H HG3  . LYS A 1 5  ? 2.740   0.804   -8.686  1.00 0.00 ? 6  LYS A HG3  10 
ATOM 10677 H HD2  . LYS A 1 5  ? 2.256   1.928   -11.257 1.00 0.00 ? 6  LYS A HD2  10 
ATOM 10678 H HD3  . LYS A 1 5  ? 3.877   2.418   -10.763 1.00 0.00 ? 6  LYS A HD3  10 
ATOM 10679 H HE2  . LYS A 1 5  ? 3.974   -0.155  -9.995  1.00 0.00 ? 6  LYS A HE2  10 
ATOM 10680 H HE3  . LYS A 1 5  ? 2.804   -0.307  -11.307 1.00 0.00 ? 6  LYS A HE3  10 
ATOM 10681 H HZ1  . LYS A 1 5  ? 4.983   1.373   -12.035 1.00 0.00 ? 6  LYS A HZ1  10 
ATOM 10682 H HZ2  . LYS A 1 5  ? 5.531   -0.162  -11.555 1.00 0.00 ? 6  LYS A HZ2  10 
ATOM 10683 H HZ3  . LYS A 1 5  ? 4.394   -0.022  -12.806 1.00 0.00 ? 6  LYS A HZ3  10 
ATOM 10684 N N    . ARG A 1 6  ? 0.700   2.346   -5.458  1.00 0.00 ? 7  ARG A N    10 
ATOM 10685 C CA   . ARG A 1 6  ? 0.975   1.599   -4.188  1.00 0.00 ? 7  ARG A CA   10 
ATOM 10686 C C    . ARG A 1 6  ? 1.854   0.346   -4.399  1.00 0.00 ? 7  ARG A C    10 
ATOM 10687 O O    . ARG A 1 6  ? 1.525   -0.528  -5.176  1.00 0.00 ? 7  ARG A O    10 
ATOM 10688 C CB   . ARG A 1 6  ? -0.354  1.172   -3.562  1.00 0.00 ? 7  ARG A CB   10 
ATOM 10689 C CG   . ARG A 1 6  ? -1.071  0.196   -4.499  1.00 0.00 ? 7  ARG A CG   10 
ATOM 10690 C CD   . ARG A 1 6  ? -2.510  -0.007  -4.022  1.00 0.00 ? 7  ARG A CD   10 
ATOM 10691 N NE   . ARG A 1 6  ? -3.347  -0.486  -5.158  1.00 0.00 ? 7  ARG A NE   10 
ATOM 10692 C CZ   . ARG A 1 6  ? -4.490  0.090   -5.415  1.00 0.00 ? 7  ARG A CZ   10 
ATOM 10693 N NH1  . ARG A 1 6  ? -5.194  0.604   -4.444  1.00 0.00 ? 7  ARG A NH1  10 
ATOM 10694 N NH2  . ARG A 1 6  ? -4.930  0.149   -6.642  1.00 0.00 ? 7  ARG A NH2  10 
ATOM 10695 H H    . ARG A 1 6  ? 0.110   3.125   -5.419  1.00 0.00 ? 7  ARG A H    10 
ATOM 10696 H HA   . ARG A 1 6  ? 1.475   2.275   -3.508  1.00 0.00 ? 7  ARG A HA   10 
ATOM 10697 H HB2  . ARG A 1 6  ? -0.166  0.690   -2.614  1.00 0.00 ? 7  ARG A HB2  10 
ATOM 10698 H HB3  . ARG A 1 6  ? -0.975  2.041   -3.407  1.00 0.00 ? 7  ARG A HB3  10 
ATOM 10699 H HG2  . ARG A 1 6  ? -1.075  0.599   -5.501  1.00 0.00 ? 7  ARG A HG2  10 
ATOM 10700 H HG3  . ARG A 1 6  ? -0.554  -0.752  -4.494  1.00 0.00 ? 7  ARG A HG3  10 
ATOM 10701 H HD2  . ARG A 1 6  ? -2.526  -0.740  -3.228  1.00 0.00 ? 7  ARG A HD2  10 
ATOM 10702 H HD3  . ARG A 1 6  ? -2.903  0.931   -3.655  1.00 0.00 ? 7  ARG A HD3  10 
ATOM 10703 H HE   . ARG A 1 6  ? -3.038  -1.232  -5.713  1.00 0.00 ? 7  ARG A HE   10 
ATOM 10704 H HH11 . ARG A 1 6  ? -4.858  0.557   -3.502  1.00 0.00 ? 7  ARG A HH11 10 
ATOM 10705 H HH12 . ARG A 1 6  ? -6.069  1.046   -4.640  1.00 0.00 ? 7  ARG A HH12 10 
ATOM 10706 H HH21 . ARG A 1 6  ? -4.392  -0.247  -7.386  1.00 0.00 ? 7  ARG A HH21 10 
ATOM 10707 H HH22 . ARG A 1 6  ? -5.805  0.590   -6.839  1.00 0.00 ? 7  ARG A HH22 10 
ATOM 10708 N N    . PRO A 1 7  ? 2.942   0.308   -3.667  1.00 0.00 ? 8  PRO A N    10 
ATOM 10709 C CA   . PRO A 1 7  ? 3.916   -0.796  -3.693  1.00 0.00 ? 8  PRO A CA   10 
ATOM 10710 C C    . PRO A 1 7  ? 3.371   -1.998  -2.916  1.00 0.00 ? 8  PRO A C    10 
ATOM 10711 O O    . PRO A 1 7  ? 2.564   -1.854  -2.019  1.00 0.00 ? 8  PRO A O    10 
ATOM 10712 C CB   . PRO A 1 7  ? 5.152   -0.189  -3.008  1.00 0.00 ? 8  PRO A CB   10 
ATOM 10713 C CG   . PRO A 1 7  ? 4.634   0.994   -2.147  1.00 0.00 ? 8  PRO A CG   10 
ATOM 10714 C CD   . PRO A 1 7  ? 3.290   1.389   -2.738  1.00 0.00 ? 8  PRO A CD   10 
ATOM 10715 H HA   . PRO A 1 7  ? 4.153   -1.074  -4.707  1.00 0.00 ? 8  PRO A HA   10 
ATOM 10716 H HB2  . PRO A 1 7  ? 5.630   -0.930  -2.381  1.00 0.00 ? 8  PRO A HB2  10 
ATOM 10717 H HB3  . PRO A 1 7  ? 5.846   0.178   -3.748  1.00 0.00 ? 8  PRO A HB3  10 
ATOM 10718 H HG2  . PRO A 1 7  ? 4.509   0.687   -1.121  1.00 0.00 ? 8  PRO A HG2  10 
ATOM 10719 H HG3  . PRO A 1 7  ? 5.300   1.841   -2.203  1.00 0.00 ? 8  PRO A HG3  10 
ATOM 10720 H HD2  . PRO A 1 7  ? 2.544   1.481   -1.966  1.00 0.00 ? 8  PRO A HD2  10 
ATOM 10721 H HD3  . PRO A 1 7  ? 3.378   2.300   -3.288  1.00 0.00 ? 8  PRO A HD3  10 
ATOM 10722 N N    . LEU A 1 8  ? 3.795   -3.184  -3.260  1.00 0.00 ? 9  LEU A N    10 
ATOM 10723 C CA   . LEU A 1 8  ? 3.281   -4.389  -2.543  1.00 0.00 ? 9  LEU A CA   10 
ATOM 10724 C C    . LEU A 1 8  ? 4.358   -5.475  -2.462  1.00 0.00 ? 9  LEU A C    10 
ATOM 10725 O O    . LEU A 1 8  ? 5.480   -5.307  -2.896  1.00 0.00 ? 9  LEU A O    10 
ATOM 10726 C CB   . LEU A 1 8  ? 2.012   -4.906  -3.251  1.00 0.00 ? 9  LEU A CB   10 
ATOM 10727 C CG   . LEU A 1 8  ? 2.327   -6.112  -4.136  1.00 0.00 ? 9  LEU A CG   10 
ATOM 10728 C CD1  . LEU A 1 8  ? 1.088   -6.490  -4.944  1.00 0.00 ? 9  LEU A CD1  10 
ATOM 10729 C CD2  . LEU A 1 8  ? 3.467   -5.751  -5.079  1.00 0.00 ? 9  LEU A CD2  10 
ATOM 10730 H H    . LEU A 1 8  ? 4.439   -3.279  -3.991  1.00 0.00 ? 9  LEU A H    10 
ATOM 10731 H HA   . LEU A 1 8  ? 3.020   -4.119  -1.543  1.00 0.00 ? 9  LEU A HA   10 
ATOM 10732 H HB2  . LEU A 1 8  ? 1.284   -5.193  -2.508  1.00 0.00 ? 9  LEU A HB2  10 
ATOM 10733 H HB3  . LEU A 1 8  ? 1.601   -4.116  -3.862  1.00 0.00 ? 9  LEU A HB3  10 
ATOM 10734 H HG   . LEU A 1 8  ? 2.618   -6.944  -3.516  1.00 0.00 ? 9  LEU A HG   10 
ATOM 10735 H HD11 . LEU A 1 8  ? 0.717   -5.619  -5.462  1.00 0.00 ? 9  LEU A HD11 10 
ATOM 10736 H HD12 . LEU A 1 8  ? 1.346   -7.254  -5.662  1.00 0.00 ? 9  LEU A HD12 10 
ATOM 10737 H HD13 . LEU A 1 8  ? 0.326   -6.864  -4.276  1.00 0.00 ? 9  LEU A HD13 10 
ATOM 10738 H HD21 . LEU A 1 8  ? 3.979   -4.884  -4.693  1.00 0.00 ? 9  LEU A HD21 10 
ATOM 10739 H HD22 . LEU A 1 8  ? 4.158   -6.578  -5.139  1.00 0.00 ? 9  LEU A HD22 10 
ATOM 10740 H HD23 . LEU A 1 8  ? 3.074   -5.535  -6.060  1.00 0.00 ? 9  LEU A HD23 10 
ATOM 10741 N N    . SER A 1 9  ? 4.001   -6.579  -1.881  1.00 0.00 ? 10 SER A N    10 
ATOM 10742 C CA   . SER A 1 9  ? 4.962   -7.711  -1.716  1.00 0.00 ? 10 SER A CA   10 
ATOM 10743 C C    . SER A 1 9  ? 5.117   -8.507  -3.020  1.00 0.00 ? 10 SER A C    10 
ATOM 10744 O O    . SER A 1 9  ? 4.241   -8.533  -3.876  1.00 0.00 ? 10 SER A O    10 
ATOM 10745 C CB   . SER A 1 9  ? 4.451   -8.644  -0.618  1.00 0.00 ? 10 SER A CB   10 
ATOM 10746 O OG   . SER A 1 9  ? 4.550   -7.990  0.640   1.00 0.00 ? 10 SER A OG   10 
ATOM 10747 H H    . SER A 1 9  ? 3.090   -6.655  -1.534  1.00 0.00 ? 10 SER A H    10 
ATOM 10748 H HA   . SER A 1 9  ? 5.926   -7.320  -1.424  1.00 0.00 ? 10 SER A HA   10 
ATOM 10749 H HB2  . SER A 1 9  ? 3.420   -8.894  -0.806  1.00 0.00 ? 10 SER A HB2  10 
ATOM 10750 H HB3  . SER A 1 9  ? 5.043   -9.550  -0.612  1.00 0.00 ? 10 SER A HB3  10 
ATOM 10751 H HG   . SER A 1 9  ? 3.737   -8.154  1.124   1.00 0.00 ? 10 SER A HG   10 
ATOM 10752 N N    . ALA A 1 10 ? 6.233   -9.172  -3.166  1.00 0.00 ? 11 ALA A N    10 
ATOM 10753 C CA   . ALA A 1 10 ? 6.476   -9.986  -4.390  1.00 0.00 ? 11 ALA A CA   10 
ATOM 10754 C C    . ALA A 1 10 ? 5.440   -11.107 -4.465  1.00 0.00 ? 11 ALA A C    10 
ATOM 10755 O O    . ALA A 1 10 ? 4.846   -11.350 -5.497  1.00 0.00 ? 11 ALA A O    10 
ATOM 10756 C CB   . ALA A 1 10 ? 7.877   -10.592 -4.326  1.00 0.00 ? 11 ALA A CB   10 
ATOM 10757 H H    . ALA A 1 10 ? 6.912   -9.142  -2.460  1.00 0.00 ? 11 ALA A H    10 
ATOM 10758 H HA   . ALA A 1 10 ? 6.396   -9.357  -5.261  1.00 0.00 ? 11 ALA A HA   10 
ATOM 10759 H HB1  . ALA A 1 10 ? 8.452   -10.091 -3.561  1.00 0.00 ? 11 ALA A HB1  10 
ATOM 10760 H HB2  . ALA A 1 10 ? 7.805   -11.644 -4.092  1.00 0.00 ? 11 ALA A HB2  10 
ATOM 10761 H HB3  . ALA A 1 10 ? 8.366   -10.469 -5.281  1.00 0.00 ? 11 ALA A HB3  10 
ATOM 10762 N N    . TYR A 1 11 ? 5.210   -11.787 -3.376  1.00 0.00 ? 12 TYR A N    10 
ATOM 10763 C CA   . TYR A 1 11 ? 4.209   -12.880 -3.376  1.00 0.00 ? 12 TYR A CA   10 
ATOM 10764 C C    . TYR A 1 11 ? 2.930   -12.379 -4.050  1.00 0.00 ? 12 TYR A C    10 
ATOM 10765 O O    . TYR A 1 11 ? 2.192   -13.136 -4.648  1.00 0.00 ? 12 TYR A O    10 
ATOM 10766 C CB   . TYR A 1 11 ? 3.929   -13.263 -1.925  1.00 0.00 ? 12 TYR A CB   10 
ATOM 10767 C CG   . TYR A 1 11 ? 2.653   -14.063 -1.834  1.00 0.00 ? 12 TYR A CG   10 
ATOM 10768 C CD1  . TYR A 1 11 ? 2.360   -15.023 -2.809  1.00 0.00 ? 12 TYR A CD1  10 
ATOM 10769 C CD2  . TYR A 1 11 ? 1.765   -13.843 -0.776  1.00 0.00 ? 12 TYR A CD2  10 
ATOM 10770 C CE1  . TYR A 1 11 ? 1.176   -15.764 -2.724  1.00 0.00 ? 12 TYR A CE1  10 
ATOM 10771 C CE2  . TYR A 1 11 ? 0.581   -14.583 -0.692  1.00 0.00 ? 12 TYR A CE2  10 
ATOM 10772 C CZ   . TYR A 1 11 ? 0.286   -15.544 -1.666  1.00 0.00 ? 12 TYR A CZ   10 
ATOM 10773 O OH   . TYR A 1 11 ? -0.882  -16.276 -1.583  1.00 0.00 ? 12 TYR A OH   10 
ATOM 10774 H H    . TYR A 1 11 ? 5.688   -11.573 -2.548  1.00 0.00 ? 12 TYR A H    10 
ATOM 10775 H HA   . TYR A 1 11 ? 4.595   -13.735 -3.911  1.00 0.00 ? 12 TYR A HA   10 
ATOM 10776 H HB2  . TYR A 1 11 ? 4.753   -13.853 -1.549  1.00 0.00 ? 12 TYR A HB2  10 
ATOM 10777 H HB3  . TYR A 1 11 ? 3.838   -12.363 -1.335  1.00 0.00 ? 12 TYR A HB3  10 
ATOM 10778 H HD1  . TYR A 1 11 ? 3.045   -15.191 -3.625  1.00 0.00 ? 12 TYR A HD1  10 
ATOM 10779 H HD2  . TYR A 1 11 ? 1.992   -13.102 -0.025  1.00 0.00 ? 12 TYR A HD2  10 
ATOM 10780 H HE1  . TYR A 1 11 ? 0.951   -16.504 -3.476  1.00 0.00 ? 12 TYR A HE1  10 
ATOM 10781 H HE2  . TYR A 1 11 ? -0.104  -14.412 0.124   1.00 0.00 ? 12 TYR A HE2  10 
ATOM 10782 H HH   . TYR A 1 11 ? -0.764  -16.946 -0.906  1.00 0.00 ? 12 TYR A HH   10 
ATOM 10783 N N    . MET A 1 12 ? 2.671   -11.104 -3.961  1.00 0.00 ? 13 MET A N    10 
ATOM 10784 C CA   . MET A 1 12 ? 1.453   -10.544 -4.597  1.00 0.00 ? 13 MET A CA   10 
ATOM 10785 C C    . MET A 1 12 ? 1.659   -10.468 -6.111  1.00 0.00 ? 13 MET A C    10 
ATOM 10786 O O    . MET A 1 12 ? 0.813   -10.881 -6.880  1.00 0.00 ? 13 MET A O    10 
ATOM 10787 C CB   . MET A 1 12 ? 1.205   -9.144  -4.047  1.00 0.00 ? 13 MET A CB   10 
ATOM 10788 C CG   . MET A 1 12 ? 0.953   -9.219  -2.540  1.00 0.00 ? 13 MET A CG   10 
ATOM 10789 S SD   . MET A 1 12 ? -0.658  -9.985  -2.235  1.00 0.00 ? 13 MET A SD   10 
ATOM 10790 C CE   . MET A 1 12 ? -0.900  -9.340  -0.562  1.00 0.00 ? 13 MET A CE   10 
ATOM 10791 H H    . MET A 1 12 ? 3.280   -10.510 -3.478  1.00 0.00 ? 13 MET A H    10 
ATOM 10792 H HA   . MET A 1 12 ? 0.606   -11.176 -4.377  1.00 0.00 ? 13 MET A HA   10 
ATOM 10793 H HB2  . MET A 1 12 ? 2.070   -8.528  -4.237  1.00 0.00 ? 13 MET A HB2  10 
ATOM 10794 H HB3  . MET A 1 12 ? 0.347   -8.716  -4.531  1.00 0.00 ? 13 MET A HB3  10 
ATOM 10795 H HG2  . MET A 1 12 ? 1.727   -9.811  -2.073  1.00 0.00 ? 13 MET A HG2  10 
ATOM 10796 H HG3  . MET A 1 12 ? 0.961   -8.223  -2.123  1.00 0.00 ? 13 MET A HG3  10 
ATOM 10797 H HE1  . MET A 1 12 ? -0.155  -8.583  -0.358  1.00 0.00 ? 13 MET A HE1  10 
ATOM 10798 H HE2  . MET A 1 12 ? -1.883  -8.904  -0.481  1.00 0.00 ? 13 MET A HE2  10 
ATOM 10799 H HE3  . MET A 1 12 ? -0.806  -10.147 0.151   1.00 0.00 ? 13 MET A HE3  10 
ATOM 10800 N N    . LEU A 1 13 ? 2.775   -9.944  -6.553  1.00 0.00 ? 14 LEU A N    10 
ATOM 10801 C CA   . LEU A 1 13 ? 3.003   -9.858  -8.030  1.00 0.00 ? 14 LEU A CA   10 
ATOM 10802 C C    . LEU A 1 13 ? 2.657   -11.200 -8.665  1.00 0.00 ? 14 LEU A C    10 
ATOM 10803 O O    . LEU A 1 13 ? 1.948   -11.271 -9.650  1.00 0.00 ? 14 LEU A O    10 
ATOM 10804 C CB   . LEU A 1 13 ? 4.469   -9.526  -8.339  1.00 0.00 ? 14 LEU A CB   10 
ATOM 10805 C CG   . LEU A 1 13 ? 4.975   -8.454  -7.372  1.00 0.00 ? 14 LEU A CG   10 
ATOM 10806 C CD1  . LEU A 1 13 ? 6.354   -7.957  -7.819  1.00 0.00 ? 14 LEU A CD1  10 
ATOM 10807 C CD2  . LEU A 1 13 ? 3.991   -7.284  -7.364  1.00 0.00 ? 14 LEU A CD2  10 
ATOM 10808 H H    . LEU A 1 13 ? 3.452   -9.614  -5.920  1.00 0.00 ? 14 LEU A H    10 
ATOM 10809 H HA   . LEU A 1 13 ? 2.365   -9.091  -8.446  1.00 0.00 ? 14 LEU A HA   10 
ATOM 10810 H HB2  . LEU A 1 13 ? 5.073   -10.425 -8.251  1.00 0.00 ? 14 LEU A HB2  10 
ATOM 10811 H HB3  . LEU A 1 13 ? 4.540   -9.153  -9.350  1.00 0.00 ? 14 LEU A HB3  10 
ATOM 10812 H HG   . LEU A 1 13 ? 5.048   -8.871  -6.381  1.00 0.00 ? 14 LEU A HG   10 
ATOM 10813 H HD11 . LEU A 1 13 ? 6.396   -7.939  -8.898  1.00 0.00 ? 14 LEU A HD11 10 
ATOM 10814 H HD12 . LEU A 1 13 ? 6.524   -6.958  -7.434  1.00 0.00 ? 14 LEU A HD12 10 
ATOM 10815 H HD13 . LEU A 1 13 ? 7.116   -8.623  -7.440  1.00 0.00 ? 14 LEU A HD13 10 
ATOM 10816 H HD21 . LEU A 1 13 ? 3.547   -7.181  -8.342  1.00 0.00 ? 14 LEU A HD21 10 
ATOM 10817 H HD22 . LEU A 1 13 ? 3.216   -7.472  -6.636  1.00 0.00 ? 14 LEU A HD22 10 
ATOM 10818 H HD23 . LEU A 1 13 ? 4.515   -6.374  -7.106  1.00 0.00 ? 14 LEU A HD23 10 
ATOM 10819 N N    . TRP A 1 14 ? 3.153   -12.266 -8.107  1.00 0.00 ? 15 TRP A N    10 
ATOM 10820 C CA   . TRP A 1 14 ? 2.859   -13.610 -8.672  1.00 0.00 ? 15 TRP A CA   10 
ATOM 10821 C C    . TRP A 1 14 ? 1.354   -13.881 -8.593  1.00 0.00 ? 15 TRP A C    10 
ATOM 10822 O O    . TRP A 1 14 ? 0.757   -14.393 -9.519  1.00 0.00 ? 15 TRP A O    10 
ATOM 10823 C CB   . TRP A 1 14 ? 3.618   -14.675 -7.878  1.00 0.00 ? 15 TRP A CB   10 
ATOM 10824 C CG   . TRP A 1 14 ? 3.165   -16.030 -8.312  1.00 0.00 ? 15 TRP A CG   10 
ATOM 10825 C CD1  . TRP A 1 14 ? 3.671   -16.720 -9.360  1.00 0.00 ? 15 TRP A CD1  10 
ATOM 10826 C CD2  . TRP A 1 14 ? 2.123   -16.863 -7.735  1.00 0.00 ? 15 TRP A CD2  10 
ATOM 10827 N NE1  . TRP A 1 14 ? 3.003   -17.927 -9.461  1.00 0.00 ? 15 TRP A NE1  10 
ATOM 10828 C CE2  . TRP A 1 14 ? 2.039   -18.062 -8.481  1.00 0.00 ? 15 TRP A CE2  10 
ATOM 10829 C CE3  . TRP A 1 14 ? 1.251   -16.696 -6.646  1.00 0.00 ? 15 TRP A CE3  10 
ATOM 10830 C CZ2  . TRP A 1 14 ? 1.119   -19.060 -8.156  1.00 0.00 ? 15 TRP A CZ2  10 
ATOM 10831 C CZ3  . TRP A 1 14 ? 0.325   -17.697 -6.316  1.00 0.00 ? 15 TRP A CZ3  10 
ATOM 10832 C CH2  . TRP A 1 14 ? 0.259   -18.877 -7.070  1.00 0.00 ? 15 TRP A CH2  10 
ATOM 10833 H H    . TRP A 1 14 ? 3.722   -12.182 -7.312  1.00 0.00 ? 15 TRP A H    10 
ATOM 10834 H HA   . TRP A 1 14 ? 3.174   -13.640 -9.705  1.00 0.00 ? 15 TRP A HA   10 
ATOM 10835 H HB2  . TRP A 1 14 ? 4.678   -14.572 -8.059  1.00 0.00 ? 15 TRP A HB2  10 
ATOM 10836 H HB3  . TRP A 1 14 ? 3.419   -14.549 -6.824  1.00 0.00 ? 15 TRP A HB3  10 
ATOM 10837 H HD1  . TRP A 1 14 ? 4.465   -16.384 -10.010 1.00 0.00 ? 15 TRP A HD1  10 
ATOM 10838 H HE1  . TRP A 1 14 ? 3.177   -18.616 -10.137 1.00 0.00 ? 15 TRP A HE1  10 
ATOM 10839 H HE3  . TRP A 1 14 ? 1.295   -15.791 -6.059  1.00 0.00 ? 15 TRP A HE3  10 
ATOM 10840 H HZ2  . TRP A 1 14 ? 1.072   -19.967 -8.741  1.00 0.00 ? 15 TRP A HZ2  10 
ATOM 10841 H HZ3  . TRP A 1 14 ? -0.340  -17.555 -5.477  1.00 0.00 ? 15 TRP A HZ3  10 
ATOM 10842 H HH2  . TRP A 1 14 ? -0.457  -19.643 -6.813  1.00 0.00 ? 15 TRP A HH2  10 
ATOM 10843 N N    . LEU A 1 15 ? 0.732   -13.540 -7.495  1.00 0.00 ? 16 LEU A N    10 
ATOM 10844 C CA   . LEU A 1 15 ? -0.734  -13.781 -7.365  1.00 0.00 ? 16 LEU A CA   10 
ATOM 10845 C C    . LEU A 1 15 ? -1.479  -13.062 -8.494  1.00 0.00 ? 16 LEU A C    10 
ATOM 10846 O O    . LEU A 1 15 ? -2.560  -13.456 -8.882  1.00 0.00 ? 16 LEU A O    10 
ATOM 10847 C CB   . LEU A 1 15 ? -1.219  -13.246 -6.017  1.00 0.00 ? 16 LEU A CB   10 
ATOM 10848 C CG   . LEU A 1 15 ? -0.676  -14.129 -4.895  1.00 0.00 ? 16 LEU A CG   10 
ATOM 10849 C CD1  . LEU A 1 15 ? -0.546  -13.305 -3.613  1.00 0.00 ? 16 LEU A CD1  10 
ATOM 10850 C CD2  . LEU A 1 15 ? -1.637  -15.296 -4.657  1.00 0.00 ? 16 LEU A CD2  10 
ATOM 10851 H H    . LEU A 1 15 ? 1.227   -13.127 -6.755  1.00 0.00 ? 16 LEU A H    10 
ATOM 10852 H HA   . LEU A 1 15 ? -0.931  -14.841 -7.424  1.00 0.00 ? 16 LEU A HA   10 
ATOM 10853 H HB2  . LEU A 1 15 ? -0.868  -12.234 -5.884  1.00 0.00 ? 16 LEU A HB2  10 
ATOM 10854 H HB3  . LEU A 1 15 ? -2.299  -13.259 -5.992  1.00 0.00 ? 16 LEU A HB3  10 
ATOM 10855 H HG   . LEU A 1 15 ? 0.293   -14.510 -5.176  1.00 0.00 ? 16 LEU A HG   10 
ATOM 10856 H HD11 . LEU A 1 15 ? -1.051  -12.359 -3.741  1.00 0.00 ? 16 LEU A HD11 10 
ATOM 10857 H HD12 . LEU A 1 15 ? -0.991  -13.843 -2.790  1.00 0.00 ? 16 LEU A HD12 10 
ATOM 10858 H HD13 . LEU A 1 15 ? 0.500   -13.129 -3.406  1.00 0.00 ? 16 LEU A HD13 10 
ATOM 10859 H HD21 . LEU A 1 15 ? -2.056  -15.615 -5.601  1.00 0.00 ? 16 LEU A HD21 10 
ATOM 10860 H HD22 . LEU A 1 15 ? -1.100  -16.118 -4.206  1.00 0.00 ? 16 LEU A HD22 10 
ATOM 10861 H HD23 . LEU A 1 15 ? -2.432  -14.981 -3.998  1.00 0.00 ? 16 LEU A HD23 10 
ATOM 10862 N N    . ASN A 1 16 ? -0.917  -12.008 -9.020  1.00 0.00 ? 17 ASN A N    10 
ATOM 10863 C CA   . ASN A 1 16 ? -1.603  -11.273 -10.112 1.00 0.00 ? 17 ASN A CA   10 
ATOM 10864 C C    . ASN A 1 16 ? -1.334  -11.954 -11.452 1.00 0.00 ? 17 ASN A C    10 
ATOM 10865 O O    . ASN A 1 16 ? -2.232  -12.156 -12.246 1.00 0.00 ? 17 ASN A O    10 
ATOM 10866 C CB   . ASN A 1 16 ? -1.088  -9.846  -10.150 1.00 0.00 ? 17 ASN A CB   10 
ATOM 10867 C CG   . ASN A 1 16 ? -0.887  -9.332  -8.723  1.00 0.00 ? 17 ASN A CG   10 
ATOM 10868 O OD1  . ASN A 1 16 ? -1.679  -9.612  -7.845  1.00 0.00 ? 17 ASN A OD1  10 
ATOM 10869 N ND2  . ASN A 1 16 ? 0.148   -8.583  -8.454  1.00 0.00 ? 17 ASN A ND2  10 
ATOM 10870 H H    . ASN A 1 16 ? -0.045  -11.696 -8.696  1.00 0.00 ? 17 ASN A H    10 
ATOM 10871 H HA   . ASN A 1 16 ? -2.661  -11.257 -9.930  1.00 0.00 ? 17 ASN A HA   10 
ATOM 10872 H HB2  . ASN A 1 16 ? -0.149  -9.820  -10.679 1.00 0.00 ? 17 ASN A HB2  10 
ATOM 10873 H HB3  . ASN A 1 16 ? -1.811  -9.231  -10.654 1.00 0.00 ? 17 ASN A HB3  10 
ATOM 10874 H HD21 . ASN A 1 16 ? 0.786   -8.356  -9.162  1.00 0.00 ? 17 ASN A HD21 10 
ATOM 10875 H HD22 . ASN A 1 16 ? 0.288   -8.250  -7.543  1.00 0.00 ? 17 ASN A HD22 10 
ATOM 10876 N N    . SER A 1 17 ? -0.109  -12.311 -11.716 1.00 0.00 ? 18 SER A N    10 
ATOM 10877 C CA   . SER A 1 17 ? 0.201   -12.979 -13.009 1.00 0.00 ? 18 SER A CA   10 
ATOM 10878 C C    . SER A 1 17 ? -0.220  -14.451 -12.939 1.00 0.00 ? 18 SER A C    10 
ATOM 10879 O O    . SER A 1 17 ? -0.008  -15.210 -13.863 1.00 0.00 ? 18 SER A O    10 
ATOM 10880 C CB   . SER A 1 17 ? 1.698   -12.874 -13.289 1.00 0.00 ? 18 SER A CB   10 
ATOM 10881 O OG   . SER A 1 17 ? 2.248   -14.173 -13.470 1.00 0.00 ? 18 SER A OG   10 
ATOM 10882 H H    . SER A 1 17 ? 0.603   -12.142 -11.065 1.00 0.00 ? 18 SER A H    10 
ATOM 10883 H HA   . SER A 1 17 ? -0.338  -12.488 -13.803 1.00 0.00 ? 18 SER A HA   10 
ATOM 10884 H HB2  . SER A 1 17 ? 1.849   -12.299 -14.185 1.00 0.00 ? 18 SER A HB2  10 
ATOM 10885 H HB3  . SER A 1 17 ? 2.184   -12.377 -12.460 1.00 0.00 ? 18 SER A HB3  10 
ATOM 10886 H HG   . SER A 1 17 ? 2.597   -14.226 -14.362 1.00 0.00 ? 18 SER A HG   10 
ATOM 10887 N N    . ALA A 1 18 ? -0.815  -14.858 -11.851 1.00 0.00 ? 19 ALA A N    10 
ATOM 10888 C CA   . ALA A 1 18 ? -1.249  -16.278 -11.729 1.00 0.00 ? 19 ALA A CA   10 
ATOM 10889 C C    . ALA A 1 18 ? -2.774  -16.348 -11.658 1.00 0.00 ? 19 ALA A C    10 
ATOM 10890 O O    . ALA A 1 18 ? -3.346  -17.412 -11.603 1.00 0.00 ? 19 ALA A O    10 
ATOM 10891 C CB   . ALA A 1 18 ? -0.660  -16.888 -10.455 1.00 0.00 ? 19 ALA A CB   10 
ATOM 10892 H H    . ALA A 1 18 ? -0.980  -14.233 -11.116 1.00 0.00 ? 19 ALA A H    10 
ATOM 10893 H HA   . ALA A 1 18 ? -0.902  -16.835 -12.588 1.00 0.00 ? 19 ALA A HA   10 
ATOM 10894 H HB1  . ALA A 1 18 ? -0.740  -16.178 -9.644  1.00 0.00 ? 19 ALA A HB1  10 
ATOM 10895 H HB2  . ALA A 1 18 ? -1.206  -17.787 -10.201 1.00 0.00 ? 19 ALA A HB2  10 
ATOM 10896 H HB3  . ALA A 1 18 ? 0.380   -17.133 -10.618 1.00 0.00 ? 19 ALA A HB3  10 
ATOM 10897 N N    . ARG A 1 19 ? -3.439  -15.227 -11.645 1.00 0.00 ? 20 ARG A N    10 
ATOM 10898 C CA   . ARG A 1 19 ? -4.928  -15.257 -11.564 1.00 0.00 ? 20 ARG A CA   10 
ATOM 10899 C C    . ARG A 1 19 ? -5.508  -16.038 -12.744 1.00 0.00 ? 20 ARG A C    10 
ATOM 10900 O O    . ARG A 1 19 ? -6.088  -17.092 -12.573 1.00 0.00 ? 20 ARG A O    10 
ATOM 10901 C CB   . ARG A 1 19 ? -5.469  -13.826 -11.587 1.00 0.00 ? 20 ARG A CB   10 
ATOM 10902 C CG   . ARG A 1 19 ? -6.700  -13.730 -10.682 1.00 0.00 ? 20 ARG A CG   10 
ATOM 10903 C CD   . ARG A 1 19 ? -7.452  -12.433 -10.985 1.00 0.00 ? 20 ARG A CD   10 
ATOM 10904 N NE   . ARG A 1 19 ? -8.816  -12.500 -10.389 1.00 0.00 ? 20 ARG A NE   10 
ATOM 10905 C CZ   . ARG A 1 19 ? -9.655  -11.517 -10.570 1.00 0.00 ? 20 ARG A CZ   10 
ATOM 10906 N NH1  . ARG A 1 19 ? -9.575  -10.782 -11.647 1.00 0.00 ? 20 ARG A NH1  10 
ATOM 10907 N NH2  . ARG A 1 19 ? -10.572 -11.267 -9.676  1.00 0.00 ? 20 ARG A NH2  10 
ATOM 10908 H H    . ARG A 1 19 ? -2.963  -14.367 -11.678 1.00 0.00 ? 20 ARG A H    10 
ATOM 10909 H HA   . ARG A 1 19 ? -5.223  -15.739 -10.646 1.00 0.00 ? 20 ARG A HA   10 
ATOM 10910 H HB2  . ARG A 1 19 ? -4.707  -13.147 -11.233 1.00 0.00 ? 20 ARG A HB2  10 
ATOM 10911 H HB3  . ARG A 1 19 ? -5.746  -13.562 -12.596 1.00 0.00 ? 20 ARG A HB3  10 
ATOM 10912 H HG2  . ARG A 1 19 ? -7.347  -14.575 -10.865 1.00 0.00 ? 20 ARG A HG2  10 
ATOM 10913 H HG3  . ARG A 1 19 ? -6.388  -13.730 -9.648  1.00 0.00 ? 20 ARG A HG3  10 
ATOM 10914 H HD2  . ARG A 1 19 ? -6.915  -11.597 -10.563 1.00 0.00 ? 20 ARG A HD2  10 
ATOM 10915 H HD3  . ARG A 1 19 ? -7.533  -12.305 -12.054 1.00 0.00 ? 20 ARG A HD3  10 
ATOM 10916 H HE   . ARG A 1 19 ? -9.084  -13.281 -9.862  1.00 0.00 ? 20 ARG A HE   10 
ATOM 10917 H HH11 . ARG A 1 19 ? -8.871  -10.972 -12.330 1.00 0.00 ? 20 ARG A HH11 10 
ATOM 10918 H HH12 . ARG A 1 19 ? -10.218 -10.030 -11.787 1.00 0.00 ? 20 ARG A HH12 10 
ATOM 10919 H HH21 . ARG A 1 19 ? -10.632 -11.829 -8.851  1.00 0.00 ? 20 ARG A HH21 10 
ATOM 10920 H HH22 . ARG A 1 19 ? -11.215 -10.514 -9.816  1.00 0.00 ? 20 ARG A HH22 10 
ATOM 10921 N N    . GLU A 1 20 ? -5.369  -15.532 -13.936 1.00 0.00 ? 21 GLU A N    10 
ATOM 10922 C CA   . GLU A 1 20 ? -5.927  -16.251 -15.114 1.00 0.00 ? 21 GLU A CA   10 
ATOM 10923 C C    . GLU A 1 20 ? -5.224  -17.597 -15.270 1.00 0.00 ? 21 GLU A C    10 
ATOM 10924 O O    . GLU A 1 20 ? -5.830  -18.588 -15.631 1.00 0.00 ? 21 GLU A O    10 
ATOM 10925 C CB   . GLU A 1 20 ? -5.712  -15.410 -16.370 1.00 0.00 ? 21 GLU A CB   10 
ATOM 10926 C CG   . GLU A 1 20 ? -6.317  -14.019 -16.160 1.00 0.00 ? 21 GLU A CG   10 
ATOM 10927 C CD   . GLU A 1 20 ? -5.994  -13.133 -17.365 1.00 0.00 ? 21 GLU A CD   10 
ATOM 10928 O OE1  . GLU A 1 20 ? -5.374  -13.629 -18.290 1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10929 O OE2  . GLU A 1 20 ? -6.373  -11.974 -17.340 1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10930 H H    . GLU A 1 20 ? -4.905  -14.677 -14.056 1.00 0.00 ? 21 GLU A H    10 
ATOM 10931 H HA   . GLU A 1 20 ? -6.982  -16.416 -14.965 1.00 0.00 ? 21 GLU A HA   10 
ATOM 10932 H HB2  . GLU A 1 20 ? -4.652  -15.318 -16.564 1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10933 H HB3  . GLU A 1 20 ? -6.193  -15.887 -17.210 1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10934 H HG2  . GLU A 1 20 ? -7.388  -14.106 -16.053 1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10935 H HG3  . GLU A 1 20 ? -5.901  -13.576 -15.268 1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10936 N N    . SER A 1 21 ? -3.952  -17.643 -15.002 1.00 0.00 ? 22 SER A N    10 
ATOM 10937 C CA   . SER A 1 21 ? -3.212  -18.929 -15.135 1.00 0.00 ? 22 SER A CA   10 
ATOM 10938 C C    . SER A 1 21 ? -3.589  -19.857 -13.979 1.00 0.00 ? 22 SER A C    10 
ATOM 10939 O O    . SER A 1 21 ? -3.290  -21.035 -13.995 1.00 0.00 ? 22 SER A O    10 
ATOM 10940 C CB   . SER A 1 21 ? -1.706  -18.661 -15.109 1.00 0.00 ? 22 SER A CB   10 
ATOM 10941 O OG   . SER A 1 21 ? -1.016  -19.816 -15.568 1.00 0.00 ? 22 SER A OG   10 
ATOM 10942 H H    . SER A 1 21 ? -3.484  -16.833 -14.712 1.00 0.00 ? 22 SER A H    10 
ATOM 10943 H HA   . SER A 1 21 ? -3.479  -19.400 -16.069 1.00 0.00 ? 22 SER A HA   10 
ATOM 10944 H HB2  . SER A 1 21 ? -1.476  -17.831 -15.755 1.00 0.00 ? 22 SER A HB2  10 
ATOM 10945 H HB3  . SER A 1 21 ? -1.401  -18.424 -14.099 1.00 0.00 ? 22 SER A HB3  10 
ATOM 10946 H HG   . SER A 1 21 ? -1.336  -20.022 -16.451 1.00 0.00 ? 22 SER A HG   10 
ATOM 10947 N N    . ILE A 1 22 ? -4.257  -19.345 -12.983 1.00 0.00 ? 23 ILE A N    10 
ATOM 10948 C CA   . ILE A 1 22 ? -4.662  -20.208 -11.842 1.00 0.00 ? 23 ILE A CA   10 
ATOM 10949 C C    . ILE A 1 22 ? -6.015  -20.838 -12.174 1.00 0.00 ? 23 ILE A C    10 
ATOM 10950 O O    . ILE A 1 22 ? -6.196  -22.034 -12.068 1.00 0.00 ? 23 ILE A O    10 
ATOM 10951 C CB   . ILE A 1 22 ? -4.752  -19.351 -10.563 1.00 0.00 ? 23 ILE A CB   10 
ATOM 10952 C CG1  . ILE A 1 22 ? -3.377  -19.316 -9.891  1.00 0.00 ? 23 ILE A CG1  10 
ATOM 10953 C CG2  . ILE A 1 22 ? -5.766  -19.934 -9.573  1.00 0.00 ? 23 ILE A CG2  10 
ATOM 10954 C CD1  . ILE A 1 22 ? -3.361  -18.229 -8.814  1.00 0.00 ? 23 ILE A CD1  10 
ATOM 10955 H H    . ILE A 1 22 ? -4.503  -18.393 -12.990 1.00 0.00 ? 23 ILE A H    10 
ATOM 10956 H HA   . ILE A 1 22 ? -3.931  -20.991 -11.701 1.00 0.00 ? 23 ILE A HA   10 
ATOM 10957 H HB   . ILE A 1 22 ? -5.047  -18.347 -10.826 1.00 0.00 ? 23 ILE A HB   10 
ATOM 10958 H HG12 . ILE A 1 22 ? -3.175  -20.275 -9.437  1.00 0.00 ? 23 ILE A HG12 10 
ATOM 10959 H HG13 . ILE A 1 22 ? -2.619  -19.101 -10.628 1.00 0.00 ? 23 ILE A HG13 10 
ATOM 10960 H HG21 . ILE A 1 22 ? -6.674  -20.212 -10.092 1.00 0.00 ? 23 ILE A HG21 10 
ATOM 10961 H HG22 . ILE A 1 22 ? -5.340  -20.802 -9.096  1.00 0.00 ? 23 ILE A HG22 10 
ATOM 10962 H HG23 . ILE A 1 22 ? -5.995  -19.192 -8.822  1.00 0.00 ? 23 ILE A HG23 10 
ATOM 10963 H HD11 . ILE A 1 22 ? -3.994  -17.409 -9.120  1.00 0.00 ? 23 ILE A HD11 10 
ATOM 10964 H HD12 . ILE A 1 22 ? -3.728  -18.639 -7.884  1.00 0.00 ? 23 ILE A HD12 10 
ATOM 10965 H HD13 . ILE A 1 22 ? -2.351  -17.873 -8.678  1.00 0.00 ? 23 ILE A HD13 10 
ATOM 10966 N N    . LYS A 1 23 ? -6.965  -20.041 -12.578 1.00 0.00 ? 24 LYS A N    10 
ATOM 10967 C CA   . LYS A 1 23 ? -8.299  -20.589 -12.912 1.00 0.00 ? 24 LYS A CA   10 
ATOM 10968 C C    . LYS A 1 23 ? -8.193  -21.552 -14.104 1.00 0.00 ? 24 LYS A C    10 
ATOM 10969 O O    . LYS A 1 23 ? -9.042  -22.397 -14.303 1.00 0.00 ? 24 LYS A O    10 
ATOM 10970 C CB   . LYS A 1 23 ? -9.226  -19.416 -13.238 1.00 0.00 ? 24 LYS A CB   10 
ATOM 10971 C CG   . LYS A 1 23 ? -9.130  -19.068 -14.722 1.00 0.00 ? 24 LYS A CG   10 
ATOM 10972 C CD   . LYS A 1 23 ? -10.052 -17.887 -15.037 1.00 0.00 ? 24 LYS A CD   10 
ATOM 10973 C CE   . LYS A 1 23 ? -10.169 -17.721 -16.553 1.00 0.00 ? 24 LYS A CE   10 
ATOM 10974 N NZ   . LYS A 1 23 ? -9.105  -16.796 -17.034 1.00 0.00 ? 24 LYS A NZ   10 
ATOM 10975 H H    . LYS A 1 23 ? -6.803  -19.077 -12.660 1.00 0.00 ? 24 LYS A H    10 
ATOM 10976 H HA   . LYS A 1 23 ? -8.685  -21.117 -12.060 1.00 0.00 ? 24 LYS A HA   10 
ATOM 10977 H HB2  . LYS A 1 23 ? -10.244 -19.681 -12.992 1.00 0.00 ? 24 LYS A HB2  10 
ATOM 10978 H HB3  . LYS A 1 23 ? -8.921  -18.561 -12.652 1.00 0.00 ? 24 LYS A HB3  10 
ATOM 10979 H HG2  . LYS A 1 23 ? -8.110  -18.806 -14.959 1.00 0.00 ? 24 LYS A HG2  10 
ATOM 10980 H HG3  . LYS A 1 23 ? -9.427  -19.924 -15.307 1.00 0.00 ? 24 LYS A HG3  10 
ATOM 10981 H HD2  . LYS A 1 23 ? -11.030 -18.073 -14.617 1.00 0.00 ? 24 LYS A HD2  10 
ATOM 10982 H HD3  . LYS A 1 23 ? -9.642  -16.986 -14.608 1.00 0.00 ? 24 LYS A HD3  10 
ATOM 10983 H HE2  . LYS A 1 23 ? -10.054 -18.683 -17.030 1.00 0.00 ? 24 LYS A HE2  10 
ATOM 10984 H HE3  . LYS A 1 23 ? -11.138 -17.313 -16.797 1.00 0.00 ? 24 LYS A HE3  10 
ATOM 10985 H HZ1  . LYS A 1 23 ? -8.844  -16.142 -16.270 1.00 0.00 ? 24 LYS A HZ1  10 
ATOM 10986 H HZ2  . LYS A 1 23 ? -8.269  -17.348 -17.320 1.00 0.00 ? 24 LYS A HZ2  10 
ATOM 10987 H HZ3  . LYS A 1 23 ? -9.458  -16.253 -17.847 1.00 0.00 ? 24 LYS A HZ3  10 
ATOM 10988 N N    . ARG A 1 24 ? -7.164  -21.428 -14.901 1.00 0.00 ? 25 ARG A N    10 
ATOM 10989 C CA   . ARG A 1 24 ? -7.025  -22.335 -16.077 1.00 0.00 ? 25 ARG A CA   10 
ATOM 10990 C C    . ARG A 1 24 ? -6.712  -23.758 -15.603 1.00 0.00 ? 25 ARG A C    10 
ATOM 10991 O O    . ARG A 1 24 ? -7.089  -24.726 -16.232 1.00 0.00 ? 25 ARG A O    10 
ATOM 10992 C CB   . ARG A 1 24 ? -5.897  -21.832 -16.987 1.00 0.00 ? 25 ARG A CB   10 
ATOM 10993 C CG   . ARG A 1 24 ? -4.538  -22.175 -16.373 1.00 0.00 ? 25 ARG A CG   10 
ATOM 10994 C CD   . ARG A 1 24 ? -4.002  -23.450 -16.999 1.00 0.00 ? 25 ARG A CD   10 
ATOM 10995 N NE   . ARG A 1 24 ? -2.650  -23.199 -17.575 1.00 0.00 ? 25 ARG A NE   10 
ATOM 10996 C CZ   . ARG A 1 24 ? -2.089  -24.093 -18.343 1.00 0.00 ? 25 ARG A CZ   10 
ATOM 10997 N NH1  . ARG A 1 24 ? -1.418  -25.079 -17.816 1.00 0.00 ? 25 ARG A NH1  10 
ATOM 10998 N NH2  . ARG A 1 24 ? -2.200  -24.001 -19.641 1.00 0.00 ? 25 ARG A NH2  10 
ATOM 10999 H H    . ARG A 1 24 ? -6.488  -20.736 -14.732 1.00 0.00 ? 25 ARG A H    10 
ATOM 11000 H HA   . ARG A 1 24 ? -7.952  -22.343 -16.632 1.00 0.00 ? 25 ARG A HA   10 
ATOM 11001 H HB2  . ARG A 1 24 ? -5.982  -22.301 -17.957 1.00 0.00 ? 25 ARG A HB2  10 
ATOM 11002 H HB3  . ARG A 1 24 ? -5.978  -20.761 -17.099 1.00 0.00 ? 25 ARG A HB3  10 
ATOM 11003 H HG2  . ARG A 1 24 ? -3.844  -21.370 -16.549 1.00 0.00 ? 25 ARG A HG2  10 
ATOM 11004 H HG3  . ARG A 1 24 ? -4.648  -22.331 -15.314 1.00 0.00 ? 25 ARG A HG3  10 
ATOM 11005 H HD2  . ARG A 1 24 ? -3.934  -24.205 -16.235 1.00 0.00 ? 25 ARG A HD2  10 
ATOM 11006 H HD3  . ARG A 1 24 ? -4.672  -23.779 -17.776 1.00 0.00 ? 25 ARG A HD3  10 
ATOM 11007 H HE   . ARG A 1 24 ? -2.181  -22.361 -17.375 1.00 0.00 ? 25 ARG A HE   10 
ATOM 11008 H HH11 . ARG A 1 24 ? -1.332  -25.151 -16.823 1.00 0.00 ? 25 ARG A HH11 10 
ATOM 11009 H HH12 . ARG A 1 24 ? -0.989  -25.763 -18.406 1.00 0.00 ? 25 ARG A HH12 10 
ATOM 11010 H HH21 . ARG A 1 24 ? -2.715  -23.246 -20.047 1.00 0.00 ? 25 ARG A HH21 10 
ATOM 11011 H HH22 . ARG A 1 24 ? -1.770  -24.687 -20.229 1.00 0.00 ? 25 ARG A HH22 10 
ATOM 11012 N N    . GLU A 1 25 ? -6.019  -23.893 -14.506 1.00 0.00 ? 26 GLU A N    10 
ATOM 11013 C CA   . GLU A 1 25 ? -5.679  -25.250 -14.004 1.00 0.00 ? 26 GLU A CA   10 
ATOM 11014 C C    . GLU A 1 25 ? -6.571  -25.600 -12.811 1.00 0.00 ? 26 GLU A C    10 
ATOM 11015 O O    . GLU A 1 25 ? -6.195  -26.373 -11.952 1.00 0.00 ? 26 GLU A O    10 
ATOM 11016 C CB   . GLU A 1 25 ? -4.211  -25.268 -13.576 1.00 0.00 ? 26 GLU A CB   10 
ATOM 11017 C CG   . GLU A 1 25 ? -4.051  -24.536 -12.240 1.00 0.00 ? 26 GLU A CG   10 
ATOM 11018 C CD   . GLU A 1 25 ? -2.577  -24.190 -12.021 1.00 0.00 ? 26 GLU A CD   10 
ATOM 11019 O OE1  . GLU A 1 25 ? -1.992  -23.587 -12.906 1.00 0.00 ? 26 GLU A OE1  10 
ATOM 11020 O OE2  . GLU A 1 25 ? -2.057  -24.537 -10.972 1.00 0.00 ? 26 GLU A OE2  10 
ATOM 11021 H H    . GLU A 1 25 ? -5.716  -23.106 -14.015 1.00 0.00 ? 26 GLU A H    10 
ATOM 11022 H HA   . GLU A 1 25 ? -5.832  -25.968 -14.791 1.00 0.00 ? 26 GLU A HA   10 
ATOM 11023 H HB2  . GLU A 1 25 ? -3.879  -26.290 -13.471 1.00 0.00 ? 26 GLU A HB2  10 
ATOM 11024 H HB3  . GLU A 1 25 ? -3.617  -24.770 -14.327 1.00 0.00 ? 26 GLU A HB3  10 
ATOM 11025 H HG2  . GLU A 1 25 ? -4.636  -23.628 -12.255 1.00 0.00 ? 26 GLU A HG2  10 
ATOM 11026 H HG3  . GLU A 1 25 ? -4.393  -25.173 -11.439 1.00 0.00 ? 26 GLU A HG3  10 
ATOM 11027 N N    . ASN A 1 26 ? -7.745  -25.038 -12.745 1.00 0.00 ? 27 ASN A N    10 
ATOM 11028 C CA   . ASN A 1 26 ? -8.644  -25.345 -11.601 1.00 0.00 ? 27 ASN A CA   10 
ATOM 11029 C C    . ASN A 1 26 ? -10.063 -25.610 -12.110 1.00 0.00 ? 27 ASN A C    10 
ATOM 11030 O O    . ASN A 1 26 ? -10.467 -25.083 -13.127 1.00 0.00 ? 27 ASN A O    10 
ATOM 11031 C CB   . ASN A 1 26 ? -8.650  -24.163 -10.632 1.00 0.00 ? 27 ASN A CB   10 
ATOM 11032 C CG   . ASN A 1 26 ? -7.208  -23.833 -10.245 1.00 0.00 ? 27 ASN A CG   10 
ATOM 11033 O OD1  . ASN A 1 26 ? -6.341  -24.681 -10.311 1.00 0.00 ? 27 ASN A OD1  10 
ATOM 11034 N ND2  . ASN A 1 26 ? -6.910  -22.631 -9.846  1.00 0.00 ? 27 ASN A ND2  10 
ATOM 11035 H H    . ASN A 1 26 ? -8.033  -24.413 -13.442 1.00 0.00 ? 27 ASN A H    10 
ATOM 11036 H HA   . ASN A 1 26 ? -8.284  -26.225 -11.088 1.00 0.00 ? 27 ASN A HA   10 
ATOM 11037 H HB2  . ASN A 1 26 ? -9.103  -23.306 -11.108 1.00 0.00 ? 27 ASN A HB2  10 
ATOM 11038 H HB3  . ASN A 1 26 ? -9.209  -24.423 -9.745  1.00 0.00 ? 27 ASN A HB3  10 
ATOM 11039 H HD21 . ASN A 1 26 ? -7.607  -21.944 -9.792  1.00 0.00 ? 27 ASN A HD21 10 
ATOM 11040 H HD22 . ASN A 1 26 ? -5.986  -22.413 -9.605  1.00 0.00 ? 27 ASN A HD22 10 
ATOM 11041 N N    . PRO A 1 27 ? -10.769 -26.432 -11.379 1.00 0.00 ? 28 PRO A N    10 
ATOM 11042 C CA   . PRO A 1 27 ? -12.149 -26.816 -11.710 1.00 0.00 ? 28 PRO A CA   10 
ATOM 11043 C C    . PRO A 1 27 ? -13.128 -25.699 -11.356 1.00 0.00 ? 28 PRO A C    10 
ATOM 11044 O O    . PRO A 1 27 ? -13.878 -25.807 -10.406 1.00 0.00 ? 28 PRO A O    10 
ATOM 11045 C CB   . PRO A 1 27 ? -12.403 -28.040 -10.847 1.00 0.00 ? 28 PRO A CB   10 
ATOM 11046 C CG   . PRO A 1 27 ? -11.398 -27.970 -9.692  1.00 0.00 ? 28 PRO A CG   10 
ATOM 11047 C CD   . PRO A 1 27 ? -10.254 -27.054 -10.148 1.00 0.00 ? 28 PRO A CD   10 
ATOM 11048 H HA   . PRO A 1 27 ? -12.227 -27.086 -12.732 1.00 0.00 ? 28 PRO A HA   10 
ATOM 11049 H HB2  . PRO A 1 27 ? -13.414 -28.013 -10.461 1.00 0.00 ? 28 PRO A HB2  10 
ATOM 11050 H HB3  . PRO A 1 27 ? -12.241 -28.939 -11.418 1.00 0.00 ? 28 PRO A HB3  10 
ATOM 11051 H HG2  . PRO A 1 27 ? -11.877 -27.559 -8.823  1.00 0.00 ? 28 PRO A HG2  10 
ATOM 11052 H HG3  . PRO A 1 27 ? -11.017 -28.950 -9.488  1.00 0.00 ? 28 PRO A HG3  10 
ATOM 11053 H HD2  . PRO A 1 27 ? -10.047 -26.304 -9.397  1.00 0.00 ? 28 PRO A HD2  10 
ATOM 11054 H HD3  . PRO A 1 27 ? -9.369  -27.632 -10.365 1.00 0.00 ? 28 PRO A HD3  10 
ATOM 11055 N N    . GLY A 1 28 ? -13.125 -24.623 -12.098 1.00 0.00 ? 29 GLY A N    10 
ATOM 11056 C CA   . GLY A 1 28 ? -14.055 -23.506 -11.774 1.00 0.00 ? 29 GLY A CA   10 
ATOM 11057 C C    . GLY A 1 28 ? -13.997 -23.268 -10.269 1.00 0.00 ? 29 GLY A C    10 
ATOM 11058 O O    . GLY A 1 28 ? -14.948 -22.831 -9.653  1.00 0.00 ? 29 GLY A O    10 
ATOM 11059 H H    . GLY A 1 28 ? -12.508 -24.548 -12.856 1.00 0.00 ? 29 GLY A H    10 
ATOM 11060 H HA2  . GLY A 1 28 ? -13.751 -22.612 -12.302 1.00 0.00 ? 29 GLY A HA2  10 
ATOM 11061 H HA3  . GLY A 1 28 ? -15.062 -23.774 -12.056 1.00 0.00 ? 29 GLY A HA3  10 
ATOM 11062 N N    . ILE A 1 29 ? -12.874 -23.575 -9.678  1.00 0.00 ? 30 ILE A N    10 
ATOM 11063 C CA   . ILE A 1 29 ? -12.713 -23.401 -8.218  1.00 0.00 ? 30 ILE A CA   10 
ATOM 11064 C C    . ILE A 1 29 ? -13.370 -22.097 -7.765  1.00 0.00 ? 30 ILE A C    10 
ATOM 11065 O O    . ILE A 1 29 ? -13.489 -21.152 -8.521  1.00 0.00 ? 30 ILE A O    10 
ATOM 11066 C CB   . ILE A 1 29 ? -11.228 -23.380 -7.907  1.00 0.00 ? 30 ILE A CB   10 
ATOM 11067 C CG1  . ILE A 1 29 ? -11.013 -23.270 -6.397  1.00 0.00 ? 30 ILE A CG1  10 
ATOM 11068 C CG2  . ILE A 1 29 ? -10.616 -22.184 -8.603  1.00 0.00 ? 30 ILE A CG2  10 
ATOM 11069 C CD1  . ILE A 1 29 ? -9.546  -23.555 -6.075  1.00 0.00 ? 30 ILE A CD1  10 
ATOM 11070 H H    . ILE A 1 29 ? -12.129 -23.934 -10.204 1.00 0.00 ? 30 ILE A H    10 
ATOM 11071 H HA   . ILE A 1 29 ? -13.162 -24.224 -7.714  1.00 0.00 ? 30 ILE A HA   10 
ATOM 11072 H HB   . ILE A 1 29 ? -10.772 -24.285 -8.280  1.00 0.00 ? 30 ILE A HB   10 
ATOM 11073 H HG12 . ILE A 1 29 ? -11.270 -22.273 -6.068  1.00 0.00 ? 30 ILE A HG12 10 
ATOM 11074 H HG13 . ILE A 1 29 ? -11.637 -23.991 -5.891  1.00 0.00 ? 30 ILE A HG13 10 
ATOM 11075 H HG21 . ILE A 1 29 ? -11.394 -21.472 -8.814  1.00 0.00 ? 30 ILE A HG21 10 
ATOM 11076 H HG22 . ILE A 1 29 ? -9.872  -21.736 -7.966  1.00 0.00 ? 30 ILE A HG22 10 
ATOM 11077 H HG23 . ILE A 1 29 ? -10.163 -22.505 -9.527  1.00 0.00 ? 30 ILE A HG23 10 
ATOM 11078 H HD11 . ILE A 1 29 ? -9.215  -24.418 -6.635  1.00 0.00 ? 30 ILE A HD11 10 
ATOM 11079 H HD12 . ILE A 1 29 ? -8.945  -22.699 -6.344  1.00 0.00 ? 30 ILE A HD12 10 
ATOM 11080 H HD13 . ILE A 1 29 ? -9.440  -23.751 -5.017  1.00 0.00 ? 30 ILE A HD13 10 
ATOM 11081 N N    . LYS A 1 30 ? -13.805 -22.041 -6.538  1.00 0.00 ? 31 LYS A N    10 
ATOM 11082 C CA   . LYS A 1 30 ? -14.461 -20.807 -6.030  1.00 0.00 ? 31 LYS A CA   10 
ATOM 11083 C C    . LYS A 1 30 ? -13.424 -19.694 -5.878  1.00 0.00 ? 31 LYS A C    10 
ATOM 11084 O O    . LYS A 1 30 ? -12.260 -19.946 -5.639  1.00 0.00 ? 31 LYS A O    10 
ATOM 11085 C CB   . LYS A 1 30 ? -15.095 -21.102 -4.675  1.00 0.00 ? 31 LYS A CB   10 
ATOM 11086 C CG   . LYS A 1 30 ? -15.801 -22.459 -4.723  1.00 0.00 ? 31 LYS A CG   10 
ATOM 11087 C CD   . LYS A 1 30 ? -16.685 -22.532 -5.971  1.00 0.00 ? 31 LYS A CD   10 
ATOM 11088 C CE   . LYS A 1 30 ? -17.850 -23.491 -5.717  1.00 0.00 ? 31 LYS A CE   10 
ATOM 11089 N NZ   . LYS A 1 30 ? -17.644 -24.742 -6.500  1.00 0.00 ? 31 LYS A NZ   10 
ATOM 11090 H H    . LYS A 1 30 ? -13.704 -22.814 -5.947  1.00 0.00 ? 31 LYS A H    10 
ATOM 11091 H HA   . LYS A 1 30 ? -15.225 -20.498 -6.719  1.00 0.00 ? 31 LYS A HA   10 
ATOM 11092 H HB2  . LYS A 1 30 ? -14.327 -21.120 -3.921  1.00 0.00 ? 31 LYS A HB2  10 
ATOM 11093 H HB3  . LYS A 1 30 ? -15.811 -20.335 -4.441  1.00 0.00 ? 31 LYS A HB3  10 
ATOM 11094 H HG2  . LYS A 1 30 ? -15.064 -23.246 -4.757  1.00 0.00 ? 31 LYS A HG2  10 
ATOM 11095 H HG3  . LYS A 1 30 ? -16.415 -22.576 -3.844  1.00 0.00 ? 31 LYS A HG3  10 
ATOM 11096 H HD2  . LYS A 1 30 ? -17.070 -21.548 -6.199  1.00 0.00 ? 31 LYS A HD2  10 
ATOM 11097 H HD3  . LYS A 1 30 ? -16.101 -22.892 -6.805  1.00 0.00 ? 31 LYS A HD3  10 
ATOM 11098 H HE2  . LYS A 1 30 ? -17.898 -23.729 -4.663  1.00 0.00 ? 31 LYS A HE2  10 
ATOM 11099 H HE3  . LYS A 1 30 ? -18.775 -23.022 -6.021  1.00 0.00 ? 31 LYS A HE3  10 
ATOM 11100 H HZ1  . LYS A 1 30 ? -16.818 -24.629 -7.121  1.00 0.00 ? 31 LYS A HZ1  10 
ATOM 11101 H HZ2  . LYS A 1 30 ? -17.482 -25.535 -5.850  1.00 0.00 ? 31 LYS A HZ2  10 
ATOM 11102 H HZ3  . LYS A 1 30 ? -18.490 -24.932 -7.078  1.00 0.00 ? 31 LYS A HZ3  10 
ATOM 11103 N N    . VAL A 1 31 ? -13.838 -18.462 -6.010  1.00 0.00 ? 32 VAL A N    10 
ATOM 11104 C CA   . VAL A 1 31 ? -12.884 -17.341 -5.867  1.00 0.00 ? 32 VAL A CA   10 
ATOM 11105 C C    . VAL A 1 31 ? -12.440 -17.254 -4.405  1.00 0.00 ? 32 VAL A C    10 
ATOM 11106 O O    . VAL A 1 31 ? -11.365 -16.777 -4.100  1.00 0.00 ? 32 VAL A O    10 
ATOM 11107 C CB   . VAL A 1 31 ? -13.565 -16.043 -6.307  1.00 0.00 ? 32 VAL A CB   10 
ATOM 11108 C CG1  . VAL A 1 31 ? -15.023 -16.080 -5.893  1.00 0.00 ? 32 VAL A CG1  10 
ATOM 11109 C CG2  . VAL A 1 31 ? -12.897 -14.857 -5.637  1.00 0.00 ? 32 VAL A CG2  10 
ATOM 11110 H H    . VAL A 1 31 ? -14.772 -18.276 -6.197  1.00 0.00 ? 32 VAL A H    10 
ATOM 11111 H HA   . VAL A 1 31 ? -12.039 -17.519 -6.491  1.00 0.00 ? 32 VAL A HA   10 
ATOM 11112 H HB   . VAL A 1 31 ? -13.495 -15.945 -7.379  1.00 0.00 ? 32 VAL A HB   10 
ATOM 11113 H HG11 . VAL A 1 31 ? -15.142 -16.812 -5.112  1.00 0.00 ? 32 VAL A HG11 10 
ATOM 11114 H HG12 . VAL A 1 31 ? -15.323 -15.109 -5.533  1.00 0.00 ? 32 VAL A HG12 10 
ATOM 11115 H HG13 . VAL A 1 31 ? -15.627 -16.358 -6.741  1.00 0.00 ? 32 VAL A HG13 10 
ATOM 11116 H HG21 . VAL A 1 31 ? -11.830 -14.933 -5.759  1.00 0.00 ? 32 VAL A HG21 10 
ATOM 11117 H HG22 . VAL A 1 31 ? -13.252 -13.945 -6.086  1.00 0.00 ? 32 VAL A HG22 10 
ATOM 11118 H HG23 . VAL A 1 31 ? -13.144 -14.868 -4.588  1.00 0.00 ? 32 VAL A HG23 10 
ATOM 11119 N N    . THR A 1 32 ? -13.260 -17.716 -3.502  1.00 0.00 ? 33 THR A N    10 
ATOM 11120 C CA   . THR A 1 32 ? -12.887 -17.669 -2.062  1.00 0.00 ? 33 THR A CA   10 
ATOM 11121 C C    . THR A 1 32 ? -11.794 -18.706 -1.794  1.00 0.00 ? 33 THR A C    10 
ATOM 11122 O O    . THR A 1 32 ? -11.129 -18.676 -0.778  1.00 0.00 ? 33 THR A O    10 
ATOM 11123 C CB   . THR A 1 32 ? -14.116 -17.987 -1.206  1.00 0.00 ? 33 THR A CB   10 
ATOM 11124 O OG1  . THR A 1 32 ? -14.766 -19.140 -1.725  1.00 0.00 ? 33 THR A OG1  10 
ATOM 11125 C CG2  . THR A 1 32 ? -15.082 -16.800 -1.232  1.00 0.00 ? 33 THR A CG2  10 
ATOM 11126 H H    . THR A 1 32 ? -14.120 -18.101 -3.772  1.00 0.00 ? 33 THR A H    10 
ATOM 11127 H HA   . THR A 1 32 ? -12.519 -16.684 -1.815  1.00 0.00 ? 33 THR A HA   10 
ATOM 11128 H HB   . THR A 1 32 ? -13.809 -18.174 -0.188  1.00 0.00 ? 33 THR A HB   10 
ATOM 11129 H HG1  . THR A 1 32 ? -14.125 -19.853 -1.754  1.00 0.00 ? 33 THR A HG1  10 
ATOM 11130 H HG21 . THR A 1 32 ? -15.029 -16.315 -2.195  1.00 0.00 ? 33 THR A HG21 10 
ATOM 11131 H HG22 . THR A 1 32 ? -16.089 -17.153 -1.061  1.00 0.00 ? 33 THR A HG22 10 
ATOM 11132 H HG23 . THR A 1 32 ? -14.810 -16.097 -0.458  1.00 0.00 ? 33 THR A HG23 10 
ATOM 11133 N N    . GLU A 1 33 ? -11.604 -19.622 -2.705  1.00 0.00 ? 34 GLU A N    10 
ATOM 11134 C CA   . GLU A 1 33 ? -10.556 -20.662 -2.517  1.00 0.00 ? 34 GLU A CA   10 
ATOM 11135 C C    . GLU A 1 33 ? -9.456  -20.466 -3.563  1.00 0.00 ? 34 GLU A C    10 
ATOM 11136 O O    . GLU A 1 33 ? -8.406  -21.073 -3.496  1.00 0.00 ? 34 GLU A O    10 
ATOM 11137 C CB   . GLU A 1 33 ? -11.177 -22.050 -2.690  1.00 0.00 ? 34 GLU A CB   10 
ATOM 11138 C CG   . GLU A 1 33 ? -12.315 -22.232 -1.685  1.00 0.00 ? 34 GLU A CG   10 
ATOM 11139 C CD   . GLU A 1 33 ? -12.704 -23.711 -1.619  1.00 0.00 ? 34 GLU A CD   10 
ATOM 11140 O OE1  . GLU A 1 33 ? -11.893 -24.496 -1.156  1.00 0.00 ? 34 GLU A OE1  10 
ATOM 11141 O OE2  . GLU A 1 33 ? -13.805 -24.032 -2.033  1.00 0.00 ? 34 GLU A OE2  10 
ATOM 11142 H H    . GLU A 1 33 ? -12.153 -19.622 -3.518  1.00 0.00 ? 34 GLU A H    10 
ATOM 11143 H HA   . GLU A 1 33 ? -10.134 -20.575 -1.527  1.00 0.00 ? 34 GLU A HA   10 
ATOM 11144 H HB2  . GLU A 1 33 ? -11.564 -22.148 -3.695  1.00 0.00 ? 34 GLU A HB2  10 
ATOM 11145 H HB3  . GLU A 1 33 ? -10.424 -22.805 -2.519  1.00 0.00 ? 34 GLU A HB3  10 
ATOM 11146 H HG2  . GLU A 1 33 ? -11.990 -21.900 -0.708  1.00 0.00 ? 34 GLU A HG2  10 
ATOM 11147 H HG3  . GLU A 1 33 ? -13.169 -21.651 -1.997  1.00 0.00 ? 34 GLU A HG3  10 
ATOM 11148 N N    . VAL A 1 34 ? -9.691  -19.624 -4.532  1.00 0.00 ? 35 VAL A N    10 
ATOM 11149 C CA   . VAL A 1 34 ? -8.664  -19.390 -5.585  1.00 0.00 ? 35 VAL A CA   10 
ATOM 11150 C C    . VAL A 1 34 ? -7.472  -18.643 -4.984  1.00 0.00 ? 35 VAL A C    10 
ATOM 11151 O O    . VAL A 1 34 ? -6.330  -18.951 -5.262  1.00 0.00 ? 35 VAL A O    10 
ATOM 11152 C CB   . VAL A 1 34 ? -9.280  -18.561 -6.711  1.00 0.00 ? 35 VAL A CB   10 
ATOM 11153 C CG1  . VAL A 1 34 ? -8.175  -17.988 -7.601  1.00 0.00 ? 35 VAL A CG1  10 
ATOM 11154 C CG2  . VAL A 1 34 ? -10.199 -19.449 -7.552  1.00 0.00 ? 35 VAL A CG2  10 
ATOM 11155 H H    . VAL A 1 34 ? -10.546 -19.145 -4.569  1.00 0.00 ? 35 VAL A H    10 
ATOM 11156 H HA   . VAL A 1 34 ? -8.335  -20.333 -5.978  1.00 0.00 ? 35 VAL A HA   10 
ATOM 11157 H HB   . VAL A 1 34 ? -9.851  -17.756 -6.284  1.00 0.00 ? 35 VAL A HB   10 
ATOM 11158 H HG11 . VAL A 1 34 ? -7.341  -18.673 -7.626  1.00 0.00 ? 35 VAL A HG11 10 
ATOM 11159 H HG12 . VAL A 1 34 ? -8.556  -17.846 -8.603  1.00 0.00 ? 35 VAL A HG12 10 
ATOM 11160 H HG13 . VAL A 1 34 ? -7.849  -17.038 -7.204  1.00 0.00 ? 35 VAL A HG13 10 
ATOM 11161 H HG21 . VAL A 1 34 ? -10.548 -20.277 -6.953  1.00 0.00 ? 35 VAL A HG21 10 
ATOM 11162 H HG22 . VAL A 1 34 ? -11.044 -18.870 -7.894  1.00 0.00 ? 35 VAL A HG22 10 
ATOM 11163 H HG23 . VAL A 1 34 ? -9.654  -19.827 -8.405  1.00 0.00 ? 35 VAL A HG23 10 
ATOM 11164 N N    . ALA A 1 35 ? -7.729  -17.663 -4.165  1.00 0.00 ? 36 ALA A N    10 
ATOM 11165 C CA   . ALA A 1 35 ? -6.613  -16.893 -3.548  1.00 0.00 ? 36 ALA A CA   10 
ATOM 11166 C C    . ALA A 1 35 ? -6.047  -17.674 -2.360  1.00 0.00 ? 36 ALA A C    10 
ATOM 11167 O O    . ALA A 1 35 ? -4.874  -17.589 -2.051  1.00 0.00 ? 36 ALA A O    10 
ATOM 11168 C CB   . ALA A 1 35 ? -7.135  -15.537 -3.065  1.00 0.00 ? 36 ALA A CB   10 
ATOM 11169 H H    . ALA A 1 35 ? -8.657  -17.433 -3.960  1.00 0.00 ? 36 ALA A H    10 
ATOM 11170 H HA   . ALA A 1 35 ? -5.837  -16.738 -4.282  1.00 0.00 ? 36 ALA A HA   10 
ATOM 11171 H HB1  . ALA A 1 35 ? -8.212  -15.570 -2.998  1.00 0.00 ? 36 ALA A HB1  10 
ATOM 11172 H HB2  . ALA A 1 35 ? -6.719  -15.318 -2.094  1.00 0.00 ? 36 ALA A HB2  10 
ATOM 11173 H HB3  . ALA A 1 35 ? -6.840  -14.769 -3.764  1.00 0.00 ? 36 ALA A HB3  10 
ATOM 11174 N N    . LYS A 1 36 ? -6.869  -18.433 -1.693  1.00 0.00 ? 37 LYS A N    10 
ATOM 11175 C CA   . LYS A 1 36 ? -6.385  -19.217 -0.527  1.00 0.00 ? 37 LYS A CA   10 
ATOM 11176 C C    . LYS A 1 36 ? -5.260  -20.158 -0.972  1.00 0.00 ? 37 LYS A C    10 
ATOM 11177 O O    . LYS A 1 36 ? -4.209  -20.220 -0.365  1.00 0.00 ? 37 LYS A O    10 
ATOM 11178 C CB   . LYS A 1 36 ? -7.559  -20.007 0.043   1.00 0.00 ? 37 LYS A CB   10 
ATOM 11179 C CG   . LYS A 1 36 ? -7.070  -21.272 0.760   1.00 0.00 ? 37 LYS A CG   10 
ATOM 11180 C CD   . LYS A 1 36 ? -6.109  -20.879 1.884   1.00 0.00 ? 37 LYS A CD   10 
ATOM 11181 C CE   . LYS A 1 36 ? -6.855  -20.048 2.928   1.00 0.00 ? 37 LYS A CE   10 
ATOM 11182 N NZ   . LYS A 1 36 ? -6.299  -20.335 4.282   1.00 0.00 ? 37 LYS A NZ   10 
ATOM 11183 H H    . LYS A 1 36 ? -7.812  -18.490 -1.956  1.00 0.00 ? 37 LYS A H    10 
ATOM 11184 H HA   . LYS A 1 36 ? -6.018  -18.547 0.227   1.00 0.00 ? 37 LYS A HA   10 
ATOM 11185 H HB2  . LYS A 1 36 ? -8.083  -19.380 0.743   1.00 0.00 ? 37 LYS A HB2  10 
ATOM 11186 H HB3  . LYS A 1 36 ? -8.225  -20.281 -0.762  1.00 0.00 ? 37 LYS A HB3  10 
ATOM 11187 H HG2  . LYS A 1 36 ? -7.916  -21.799 1.176   1.00 0.00 ? 37 LYS A HG2  10 
ATOM 11188 H HG3  . LYS A 1 36 ? -6.557  -21.910 0.056   1.00 0.00 ? 37 LYS A HG3  10 
ATOM 11189 H HD2  . LYS A 1 36 ? -5.715  -21.773 2.348   1.00 0.00 ? 37 LYS A HD2  10 
ATOM 11190 H HD3  . LYS A 1 36 ? -5.296  -20.297 1.476   1.00 0.00 ? 37 LYS A HD3  10 
ATOM 11191 H HE2  . LYS A 1 36 ? -6.734  -18.997 2.705   1.00 0.00 ? 37 LYS A HE2  10 
ATOM 11192 H HE3  . LYS A 1 36 ? -7.905  -20.302 2.908   1.00 0.00 ? 37 LYS A HE3  10 
ATOM 11193 H HZ1  . LYS A 1 36 ? -5.581  -21.083 4.210   1.00 0.00 ? 37 LYS A HZ1  10 
ATOM 11194 H HZ2  . LYS A 1 36 ? -5.863  -19.474 4.668   1.00 0.00 ? 37 LYS A HZ2  10 
ATOM 11195 H HZ3  . LYS A 1 36 ? -7.066  -20.649 4.911   1.00 0.00 ? 37 LYS A HZ3  10 
ATOM 11196 N N    . ARG A 1 37 ? -5.477  -20.891 -2.026  1.00 0.00 ? 38 ARG A N    10 
ATOM 11197 C CA   . ARG A 1 37 ? -4.429  -21.832 -2.514  1.00 0.00 ? 38 ARG A CA   10 
ATOM 11198 C C    . ARG A 1 37 ? -3.298  -21.044 -3.182  1.00 0.00 ? 38 ARG A C    10 
ATOM 11199 O O    . ARG A 1 37 ? -2.181  -21.509 -3.280  1.00 0.00 ? 38 ARG A O    10 
ATOM 11200 C CB   . ARG A 1 37 ? -5.053  -22.789 -3.533  1.00 0.00 ? 38 ARG A CB   10 
ATOM 11201 C CG   . ARG A 1 37 ? -5.192  -24.181 -2.912  1.00 0.00 ? 38 ARG A CG   10 
ATOM 11202 C CD   . ARG A 1 37 ? -6.372  -24.189 -1.937  1.00 0.00 ? 38 ARG A CD   10 
ATOM 11203 N NE   . ARG A 1 37 ? -6.397  -25.482 -1.196  1.00 0.00 ? 38 ARG A NE   10 
ATOM 11204 C CZ   . ARG A 1 37 ? -7.494  -26.187 -1.149  1.00 0.00 ? 38 ARG A CZ   10 
ATOM 11205 N NH1  . ARG A 1 37 ? -8.428  -25.886 -0.289  1.00 0.00 ? 38 ARG A NH1  10 
ATOM 11206 N NH2  . ARG A 1 37 ? -7.655  -27.195 -1.962  1.00 0.00 ? 38 ARG A NH2  10 
ATOM 11207 H H    . ARG A 1 37 ? -6.333  -20.825 -2.497  1.00 0.00 ? 38 ARG A H    10 
ATOM 11208 H HA   . ARG A 1 37 ? -4.034  -22.397 -1.683  1.00 0.00 ? 38 ARG A HA   10 
ATOM 11209 H HB2  . ARG A 1 37 ? -6.029  -22.422 -3.815  1.00 0.00 ? 38 ARG A HB2  10 
ATOM 11210 H HB3  . ARG A 1 37 ? -4.423  -22.846 -4.406  1.00 0.00 ? 38 ARG A HB3  10 
ATOM 11211 H HG2  . ARG A 1 37 ? -5.364  -24.908 -3.694  1.00 0.00 ? 38 ARG A HG2  10 
ATOM 11212 H HG3  . ARG A 1 37 ? -4.286  -24.431 -2.380  1.00 0.00 ? 38 ARG A HG3  10 
ATOM 11213 H HD2  . ARG A 1 37 ? -6.265  -23.375 -1.237  1.00 0.00 ? 38 ARG A HD2  10 
ATOM 11214 H HD3  . ARG A 1 37 ? -7.294  -24.072 -2.488  1.00 0.00 ? 38 ARG A HD3  10 
ATOM 11215 H HE   . ARG A 1 37 ? -5.589  -25.801 -0.743  1.00 0.00 ? 38 ARG A HE   10 
ATOM 11216 H HH11 . ARG A 1 37 ? -8.303  -25.114 0.335   1.00 0.00 ? 38 ARG A HH11 10 
ATOM 11217 H HH12 . ARG A 1 37 ? -9.269  -26.426 -0.254  1.00 0.00 ? 38 ARG A HH12 10 
ATOM 11218 H HH21 . ARG A 1 37 ? -6.937  -27.428 -2.620  1.00 0.00 ? 38 ARG A HH21 10 
ATOM 11219 H HH22 . ARG A 1 37 ? -8.495  -27.736 -1.926  1.00 0.00 ? 38 ARG A HH22 10 
ATOM 11220 N N    . GLY A 1 38 ? -3.578  -19.857 -3.643  1.00 0.00 ? 39 GLY A N    10 
ATOM 11221 C CA   . GLY A 1 38 ? -2.516  -19.046 -4.305  1.00 0.00 ? 39 GLY A CA   10 
ATOM 11222 C C    . GLY A 1 38 ? -1.241  -19.071 -3.460  1.00 0.00 ? 39 GLY A C    10 
ATOM 11223 O O    . GLY A 1 38 ? -0.143  -18.992 -3.973  1.00 0.00 ? 39 GLY A O    10 
ATOM 11224 H H    . GLY A 1 38 ? -4.486  -19.498 -3.557  1.00 0.00 ? 39 GLY A H    10 
ATOM 11225 H HA2  . GLY A 1 38 ? -2.310  -19.457 -5.283  1.00 0.00 ? 39 GLY A HA2  10 
ATOM 11226 H HA3  . GLY A 1 38 ? -2.855  -18.026 -4.408  1.00 0.00 ? 39 GLY A HA3  10 
ATOM 11227 N N    . GLY A 1 39 ? -1.374  -19.175 -2.166  1.00 0.00 ? 40 GLY A N    10 
ATOM 11228 C CA   . GLY A 1 39 ? -0.165  -19.199 -1.292  1.00 0.00 ? 40 GLY A CA   10 
ATOM 11229 C C    . GLY A 1 39 ? 0.620   -20.492 -1.522  1.00 0.00 ? 40 GLY A C    10 
ATOM 11230 O O    . GLY A 1 39 ? 1.807   -20.471 -1.778  1.00 0.00 ? 40 GLY A O    10 
ATOM 11231 H H    . GLY A 1 39 ? -2.268  -19.235 -1.769  1.00 0.00 ? 40 GLY A H    10 
ATOM 11232 H HA2  . GLY A 1 39 ? 0.463   -18.350 -1.526  1.00 0.00 ? 40 GLY A HA2  10 
ATOM 11233 H HA3  . GLY A 1 39 ? -0.469  -19.147 -0.258  1.00 0.00 ? 40 GLY A HA3  10 
ATOM 11234 N N    . GLU A 1 40 ? -0.032  -21.618 -1.425  1.00 0.00 ? 41 GLU A N    10 
ATOM 11235 C CA   . GLU A 1 40 ? 0.679   -22.913 -1.630  1.00 0.00 ? 41 GLU A CA   10 
ATOM 11236 C C    . GLU A 1 40 ? 1.554   -22.838 -2.887  1.00 0.00 ? 41 GLU A C    10 
ATOM 11237 O O    . GLU A 1 40 ? 2.704   -23.228 -2.879  1.00 0.00 ? 41 GLU A O    10 
ATOM 11238 C CB   . GLU A 1 40 ? -0.352  -24.042 -1.759  1.00 0.00 ? 41 GLU A CB   10 
ATOM 11239 C CG   . GLU A 1 40 ? -0.759  -24.244 -3.225  1.00 0.00 ? 41 GLU A CG   10 
ATOM 11240 C CD   . GLU A 1 40 ? -1.756  -25.397 -3.327  1.00 0.00 ? 41 GLU A CD   10 
ATOM 11241 O OE1  . GLU A 1 40 ? -1.642  -26.324 -2.542  1.00 0.00 ? 41 GLU A OE1  10 
ATOM 11242 O OE2  . GLU A 1 40 ? -2.618  -25.334 -4.188  1.00 0.00 ? 41 GLU A OE2  10 
ATOM 11243 H H    . GLU A 1 40 ? -0.988  -21.613 -1.213  1.00 0.00 ? 41 GLU A H    10 
ATOM 11244 H HA   . GLU A 1 40 ? 1.304   -23.111 -0.775  1.00 0.00 ? 41 GLU A HA   10 
ATOM 11245 H HB2  . GLU A 1 40 ? 0.081   -24.954 -1.378  1.00 0.00 ? 41 GLU A HB2  10 
ATOM 11246 H HB3  . GLU A 1 40 ? -1.227  -23.792 -1.178  1.00 0.00 ? 41 GLU A HB3  10 
ATOM 11247 H HG2  . GLU A 1 40 ? -1.214  -23.340 -3.599  1.00 0.00 ? 41 GLU A HG2  10 
ATOM 11248 H HG3  . GLU A 1 40 ? 0.118   -24.476 -3.812  1.00 0.00 ? 41 GLU A HG3  10 
ATOM 11249 N N    . LEU A 1 41 ? 1.012   -22.349 -3.969  1.00 0.00 ? 42 LEU A N    10 
ATOM 11250 C CA   . LEU A 1 41 ? 1.800   -22.259 -5.231  1.00 0.00 ? 42 LEU A CA   10 
ATOM 11251 C C    . LEU A 1 41 ? 2.951   -21.264 -5.064  1.00 0.00 ? 42 LEU A C    10 
ATOM 11252 O O    . LEU A 1 41 ? 4.077   -21.543 -5.413  1.00 0.00 ? 42 LEU A O    10 
ATOM 11253 C CB   . LEU A 1 41 ? 0.886   -21.783 -6.360  1.00 0.00 ? 42 LEU A CB   10 
ATOM 11254 C CG   . LEU A 1 41 ? 0.305   -22.988 -7.098  1.00 0.00 ? 42 LEU A CG   10 
ATOM 11255 C CD1  . LEU A 1 41 ? -0.666  -22.500 -8.174  1.00 0.00 ? 42 LEU A CD1  10 
ATOM 11256 C CD2  . LEU A 1 41 ? 1.439   -23.781 -7.756  1.00 0.00 ? 42 LEU A CD2  10 
ATOM 11257 H H    . LEU A 1 41 ? 0.079   -22.048 -3.955  1.00 0.00 ? 42 LEU A H    10 
ATOM 11258 H HA   . LEU A 1 41 ? 2.198   -23.232 -5.475  1.00 0.00 ? 42 LEU A HA   10 
ATOM 11259 H HB2  . LEU A 1 41 ? 0.082   -21.194 -5.945  1.00 0.00 ? 42 LEU A HB2  10 
ATOM 11260 H HB3  . LEU A 1 41 ? 1.453   -21.179 -7.053  1.00 0.00 ? 42 LEU A HB3  10 
ATOM 11261 H HG   . LEU A 1 41 ? -0.221  -23.620 -6.397  1.00 0.00 ? 42 LEU A HG   10 
ATOM 11262 H HD11 . LEU A 1 41 ? -1.303  -21.732 -7.761  1.00 0.00 ? 42 LEU A HD11 10 
ATOM 11263 H HD12 . LEU A 1 41 ? -0.107  -22.095 -9.006  1.00 0.00 ? 42 LEU A HD12 10 
ATOM 11264 H HD13 . LEU A 1 41 ? -1.273  -23.326 -8.515  1.00 0.00 ? 42 LEU A HD13 10 
ATOM 11265 H HD21 . LEU A 1 41 ? 2.382   -23.491 -7.319  1.00 0.00 ? 42 LEU A HD21 10 
ATOM 11266 H HD22 . LEU A 1 41 ? 1.277   -24.837 -7.598  1.00 0.00 ? 42 LEU A HD22 10 
ATOM 11267 H HD23 . LEU A 1 41 ? 1.454   -23.573 -8.816  1.00 0.00 ? 42 LEU A HD23 10 
ATOM 11268 N N    . TRP A 1 42 ? 2.674   -20.100 -4.548  1.00 0.00 ? 43 TRP A N    10 
ATOM 11269 C CA   . TRP A 1 42 ? 3.751   -19.082 -4.378  1.00 0.00 ? 43 TRP A CA   10 
ATOM 11270 C C    . TRP A 1 42 ? 5.017   -19.736 -3.806  1.00 0.00 ? 43 TRP A C    10 
ATOM 11271 O O    . TRP A 1 42 ? 6.073   -19.689 -4.405  1.00 0.00 ? 43 TRP A O    10 
ATOM 11272 C CB   . TRP A 1 42 ? 3.260   -17.987 -3.427  1.00 0.00 ? 43 TRP A CB   10 
ATOM 11273 C CG   . TRP A 1 42 ? 4.413   -17.138 -2.994  1.00 0.00 ? 43 TRP A CG   10 
ATOM 11274 C CD1  . TRP A 1 42 ? 4.958   -17.146 -1.758  1.00 0.00 ? 43 TRP A CD1  10 
ATOM 11275 C CD2  . TRP A 1 42 ? 5.166   -16.162 -3.768  1.00 0.00 ? 43 TRP A CD2  10 
ATOM 11276 N NE1  . TRP A 1 42 ? 6.002   -16.239 -1.723  1.00 0.00 ? 43 TRP A NE1  10 
ATOM 11277 C CE2  . TRP A 1 42 ? 6.169   -15.605 -2.938  1.00 0.00 ? 43 TRP A CE2  10 
ATOM 11278 C CE3  . TRP A 1 42 ? 5.080   -15.708 -5.096  1.00 0.00 ? 43 TRP A CE3  10 
ATOM 11279 C CZ2  . TRP A 1 42 ? 7.054   -14.634 -3.410  1.00 0.00 ? 43 TRP A CZ2  10 
ATOM 11280 C CZ3  . TRP A 1 42 ? 5.968   -14.731 -5.574  1.00 0.00 ? 43 TRP A CZ3  10 
ATOM 11281 C CH2  . TRP A 1 42 ? 6.953   -14.196 -4.732  1.00 0.00 ? 43 TRP A CH2  10 
ATOM 11282 H H    . TRP A 1 42 ? 1.755   -19.888 -4.283  1.00 0.00 ? 43 TRP A H    10 
ATOM 11283 H HA   . TRP A 1 42 ? 3.980   -18.644 -5.337  1.00 0.00 ? 43 TRP A HA   10 
ATOM 11284 H HB2  . TRP A 1 42 ? 2.533   -17.373 -3.935  1.00 0.00 ? 43 TRP A HB2  10 
ATOM 11285 H HB3  . TRP A 1 42 ? 2.803   -18.443 -2.560  1.00 0.00 ? 43 TRP A HB3  10 
ATOM 11286 H HD1  . TRP A 1 42 ? 4.632   -17.764 -0.933  1.00 0.00 ? 43 TRP A HD1  10 
ATOM 11287 H HE1  . TRP A 1 42 ? 6.564   -16.054 -0.942  1.00 0.00 ? 43 TRP A HE1  10 
ATOM 11288 H HE3  . TRP A 1 42 ? 4.325   -16.115 -5.753  1.00 0.00 ? 43 TRP A HE3  10 
ATOM 11289 H HZ2  . TRP A 1 42 ? 7.811   -14.224 -2.756  1.00 0.00 ? 43 TRP A HZ2  10 
ATOM 11290 H HZ3  . TRP A 1 42 ? 5.891   -14.390 -6.596  1.00 0.00 ? 43 TRP A HZ3  10 
ATOM 11291 H HH2  . TRP A 1 42 ? 7.633   -13.444 -5.105  1.00 0.00 ? 43 TRP A HH2  10 
ATOM 11292 N N    . ARG A 1 43 ? 4.925   -20.328 -2.647  1.00 0.00 ? 44 ARG A N    10 
ATOM 11293 C CA   . ARG A 1 43 ? 6.130   -20.962 -2.032  1.00 0.00 ? 44 ARG A CA   10 
ATOM 11294 C C    . ARG A 1 43 ? 6.616   -22.137 -2.888  1.00 0.00 ? 44 ARG A C    10 
ATOM 11295 O O    . ARG A 1 43 ? 7.773   -22.506 -2.845  1.00 0.00 ? 44 ARG A O    10 
ATOM 11296 C CB   . ARG A 1 43 ? 5.773   -21.473 -0.635  1.00 0.00 ? 44 ARG A CB   10 
ATOM 11297 C CG   . ARG A 1 43 ? 7.042   -21.570 0.213   1.00 0.00 ? 44 ARG A CG   10 
ATOM 11298 C CD   . ARG A 1 43 ? 6.672   -21.988 1.637   1.00 0.00 ? 44 ARG A CD   10 
ATOM 11299 N NE   . ARG A 1 43 ? 6.884   -20.840 2.563   1.00 0.00 ? 44 ARG A NE   10 
ATOM 11300 C CZ   . ARG A 1 43 ? 7.168   -21.058 3.817   1.00 0.00 ? 44 ARG A CZ   10 
ATOM 11301 N NH1  . ARG A 1 43 ? 6.579   -22.028 4.460   1.00 0.00 ? 44 ARG A NH1  10 
ATOM 11302 N NH2  . ARG A 1 43 ? 8.042   -20.305 4.427   1.00 0.00 ? 44 ARG A NH2  10 
ATOM 11303 H H    . ARG A 1 43 ? 4.068   -20.344 -2.172  1.00 0.00 ? 44 ARG A H    10 
ATOM 11304 H HA   . ARG A 1 43 ? 6.917   -20.228 -1.951  1.00 0.00 ? 44 ARG A HA   10 
ATOM 11305 H HB2  . ARG A 1 43 ? 5.077   -20.790 -0.169  1.00 0.00 ? 44 ARG A HB2  10 
ATOM 11306 H HB3  . ARG A 1 43 ? 5.320   -22.451 -0.713  1.00 0.00 ? 44 ARG A HB3  10 
ATOM 11307 H HG2  . ARG A 1 43 ? 7.708   -22.302 -0.218  1.00 0.00 ? 44 ARG A HG2  10 
ATOM 11308 H HG3  . ARG A 1 43 ? 7.531   -20.609 0.239   1.00 0.00 ? 44 ARG A HG3  10 
ATOM 11309 H HD2  . ARG A 1 43 ? 5.634   -22.287 1.666   1.00 0.00 ? 44 ARG A HD2  10 
ATOM 11310 H HD3  . ARG A 1 43 ? 7.294   -22.817 1.942   1.00 0.00 ? 44 ARG A HD3  10 
ATOM 11311 H HE   . ARG A 1 43 ? 6.810   -19.921 2.229   1.00 0.00 ? 44 ARG A HE   10 
ATOM 11312 H HH11 . ARG A 1 43 ? 5.911   -22.605 3.992   1.00 0.00 ? 44 ARG A HH11 10 
ATOM 11313 H HH12 . ARG A 1 43 ? 6.797   -22.195 5.422   1.00 0.00 ? 44 ARG A HH12 10 
ATOM 11314 H HH21 . ARG A 1 43 ? 8.493   -19.561 3.934   1.00 0.00 ? 44 ARG A HH21 10 
ATOM 11315 H HH22 . ARG A 1 43 ? 8.260   -20.472 5.389   1.00 0.00 ? 44 ARG A HH22 10 
ATOM 11316 N N    . ALA A 1 44 ? 5.746   -22.737 -3.650  1.00 0.00 ? 45 ALA A N    10 
ATOM 11317 C CA   . ALA A 1 44 ? 6.162   -23.897 -4.489  1.00 0.00 ? 45 ALA A CA   10 
ATOM 11318 C C    . ALA A 1 44 ? 6.217   -23.489 -5.962  1.00 0.00 ? 45 ALA A C    10 
ATOM 11319 O O    . ALA A 1 44 ? 6.241   -24.321 -6.847  1.00 0.00 ? 45 ALA A O    10 
ATOM 11320 C CB   . ALA A 1 44 ? 5.140   -25.014 -4.323  1.00 0.00 ? 45 ALA A CB   10 
ATOM 11321 H H    . ALA A 1 44 ? 4.814   -22.434 -3.662  1.00 0.00 ? 45 ALA A H    10 
ATOM 11322 H HA   . ALA A 1 44 ? 7.134   -24.246 -4.171  1.00 0.00 ? 45 ALA A HA   10 
ATOM 11323 H HB1  . ALA A 1 44 ? 5.090   -25.303 -3.285  1.00 0.00 ? 45 ALA A HB1  10 
ATOM 11324 H HB2  . ALA A 1 44 ? 4.175   -24.657 -4.646  1.00 0.00 ? 45 ALA A HB2  10 
ATOM 11325 H HB3  . ALA A 1 44 ? 5.433   -25.862 -4.922  1.00 0.00 ? 45 ALA A HB3  10 
ATOM 11326 N N    . MET A 1 45 ? 6.231   -22.217 -6.232  1.00 0.00 ? 46 MET A N    10 
ATOM 11327 C CA   . MET A 1 45 ? 6.275   -21.752 -7.643  1.00 0.00 ? 46 MET A CA   10 
ATOM 11328 C C    . MET A 1 45 ? 7.681   -21.984 -8.207  1.00 0.00 ? 46 MET A C    10 
ATOM 11329 O O    . MET A 1 45 ? 8.076   -23.104 -8.467  1.00 0.00 ? 46 MET A O    10 
ATOM 11330 C CB   . MET A 1 45 ? 5.922   -20.259 -7.684  1.00 0.00 ? 46 MET A CB   10 
ATOM 11331 C CG   . MET A 1 45 ? 5.962   -19.751 -9.127  1.00 0.00 ? 46 MET A CG   10 
ATOM 11332 S SD   . MET A 1 45 ? 6.818   -18.154 -9.193  1.00 0.00 ? 46 MET A SD   10 
ATOM 11333 C CE   . MET A 1 45 ? 6.167   -17.463 -7.650  1.00 0.00 ? 46 MET A CE   10 
ATOM 11334 H H    . MET A 1 45 ? 6.207   -21.567 -5.505  1.00 0.00 ? 46 MET A H    10 
ATOM 11335 H HA   . MET A 1 45 ? 5.557   -22.307 -8.228  1.00 0.00 ? 46 MET A HA   10 
ATOM 11336 H HB2  . MET A 1 45 ? 4.932   -20.114 -7.278  1.00 0.00 ? 46 MET A HB2  10 
ATOM 11337 H HB3  . MET A 1 45 ? 6.637   -19.708 -7.092  1.00 0.00 ? 46 MET A HB3  10 
ATOM 11338 H HG2  . MET A 1 45 ? 6.484   -20.464 -9.746  1.00 0.00 ? 46 MET A HG2  10 
ATOM 11339 H HG3  . MET A 1 45 ? 4.952   -19.631 -9.493  1.00 0.00 ? 46 MET A HG3  10 
ATOM 11340 H HE1  . MET A 1 45 ? 5.117   -17.708 -7.561  1.00 0.00 ? 46 MET A HE1  10 
ATOM 11341 H HE2  . MET A 1 45 ? 6.711   -17.875 -6.812  1.00 0.00 ? 46 MET A HE2  10 
ATOM 11342 H HE3  . MET A 1 45 ? 6.285   -16.390 -7.656  1.00 0.00 ? 46 MET A HE3  10 
ATOM 11343 N N    . LYS A 1 46 ? 8.435   -20.941 -8.404  1.00 0.00 ? 47 LYS A N    10 
ATOM 11344 C CA   . LYS A 1 46 ? 9.800   -21.088 -8.951  1.00 0.00 ? 47 LYS A CA   10 
ATOM 11345 C C    . LYS A 1 46 ? 10.800  -20.496 -7.959  1.00 0.00 ? 47 LYS A C    10 
ATOM 11346 O O    . LYS A 1 46 ? 11.619  -21.188 -7.389  1.00 0.00 ? 47 LYS A O    10 
ATOM 11347 C CB   . LYS A 1 46 ? 9.858   -20.306 -10.252 1.00 0.00 ? 47 LYS A CB   10 
ATOM 11348 C CG   . LYS A 1 46 ? 9.772   -21.266 -11.439 1.00 0.00 ? 47 LYS A CG   10 
ATOM 11349 C CD   . LYS A 1 46 ? 11.158  -21.846 -11.729 1.00 0.00 ? 47 LYS A CD   10 
ATOM 11350 C CE   . LYS A 1 46 ? 11.133  -22.580 -13.070 1.00 0.00 ? 47 LYS A CE   10 
ATOM 11351 N NZ   . LYS A 1 46 ? 11.396  -24.029 -12.847 1.00 0.00 ? 47 LYS A NZ   10 
ATOM 11352 H H    . LYS A 1 46 ? 8.105   -20.052 -8.201  1.00 0.00 ? 47 LYS A H    10 
ATOM 11353 H HA   . LYS A 1 46 ? 10.019  -22.127 -9.133  1.00 0.00 ? 47 LYS A HA   10 
ATOM 11354 H HB2  . LYS A 1 46 ? 9.021   -19.621 -10.272 1.00 0.00 ? 47 LYS A HB2  10 
ATOM 11355 H HB3  . LYS A 1 46 ? 10.782  -19.749 -10.300 1.00 0.00 ? 47 LYS A HB3  10 
ATOM 11356 H HG2  . LYS A 1 46 ? 9.086   -22.068 -11.205 1.00 0.00 ? 47 LYS A HG2  10 
ATOM 11357 H HG3  . LYS A 1 46 ? 9.419   -20.733 -12.308 1.00 0.00 ? 47 LYS A HG3  10 
ATOM 11358 H HD2  . LYS A 1 46 ? 11.882  -21.045 -11.767 1.00 0.00 ? 47 LYS A HD2  10 
ATOM 11359 H HD3  . LYS A 1 46 ? 11.428  -22.539 -10.946 1.00 0.00 ? 47 LYS A HD3  10 
ATOM 11360 H HE2  . LYS A 1 46 ? 10.165  -22.456 -13.531 1.00 0.00 ? 47 LYS A HE2  10 
ATOM 11361 H HE3  . LYS A 1 46 ? 11.895  -22.172 -13.718 1.00 0.00 ? 47 LYS A HE3  10 
ATOM 11362 H HZ1  . LYS A 1 46 ? 10.897  -24.344 -11.990 1.00 0.00 ? 47 LYS A HZ1  10 
ATOM 11363 H HZ2  . LYS A 1 46 ? 11.057  -24.573 -13.666 1.00 0.00 ? 47 LYS A HZ2  10 
ATOM 11364 H HZ3  . LYS A 1 46 ? 12.417  -24.183 -12.730 1.00 0.00 ? 47 LYS A HZ3  10 
ATOM 11365 N N    . ASP A 1 47 ? 10.723  -19.211 -7.752  1.00 0.00 ? 48 ASP A N    10 
ATOM 11366 C CA   . ASP A 1 47 ? 11.648  -18.540 -6.799  1.00 0.00 ? 48 ASP A CA   10 
ATOM 11367 C C    . ASP A 1 47 ? 11.026  -17.206 -6.378  1.00 0.00 ? 48 ASP A C    10 
ATOM 11368 O O    . ASP A 1 47 ? 9.839   -16.995 -6.529  1.00 0.00 ? 48 ASP A O    10 
ATOM 11369 C CB   . ASP A 1 47 ? 12.997  -18.296 -7.479  1.00 0.00 ? 48 ASP A CB   10 
ATOM 11370 C CG   . ASP A 1 47 ? 13.661  -19.638 -7.792  1.00 0.00 ? 48 ASP A CG   10 
ATOM 11371 O OD1  . ASP A 1 47 ? 13.825  -20.425 -6.874  1.00 0.00 ? 48 ASP A OD1  10 
ATOM 11372 O OD2  . ASP A 1 47 ? 13.995  -19.857 -8.945  1.00 0.00 ? 48 ASP A OD2  10 
ATOM 11373 H H    . ASP A 1 47 ? 10.047  -18.683 -8.225  1.00 0.00 ? 48 ASP A H    10 
ATOM 11374 H HA   . ASP A 1 47 ? 11.786  -19.165 -5.928  1.00 0.00 ? 48 ASP A HA   10 
ATOM 11375 H HB2  . ASP A 1 47 ? 12.843  -17.746 -8.396  1.00 0.00 ? 48 ASP A HB2  10 
ATOM 11376 H HB3  . ASP A 1 47 ? 13.635  -17.726 -6.820  1.00 0.00 ? 48 ASP A HB3  10 
ATOM 11377 N N    . LYS A 1 48 ? 11.806  -16.306 -5.849  1.00 0.00 ? 49 LYS A N    10 
ATOM 11378 C CA   . LYS A 1 48 ? 11.235  -14.996 -5.423  1.00 0.00 ? 49 LYS A CA   10 
ATOM 11379 C C    . LYS A 1 48 ? 12.046  -13.844 -6.024  1.00 0.00 ? 49 LYS A C    10 
ATOM 11380 O O    . LYS A 1 48 ? 11.623  -12.706 -6.009  1.00 0.00 ? 49 LYS A O    10 
ATOM 11381 C CB   . LYS A 1 48 ? 11.271  -14.907 -3.896  1.00 0.00 ? 49 LYS A CB   10 
ATOM 11382 C CG   . LYS A 1 48 ? 10.514  -16.098 -3.304  1.00 0.00 ? 49 LYS A CG   10 
ATOM 11383 C CD   . LYS A 1 48 ? 10.290  -15.870 -1.810  1.00 0.00 ? 49 LYS A CD   10 
ATOM 11384 C CE   . LYS A 1 48 ? 11.641  -15.768 -1.100  1.00 0.00 ? 49 LYS A CE   10 
ATOM 11385 N NZ   . LYS A 1 48 ? 11.676  -16.729 0.038   1.00 0.00 ? 49 LYS A NZ   10 
ATOM 11386 H H    . LYS A 1 48 ? 12.760  -16.491 -5.728  1.00 0.00 ? 49 LYS A H    10 
ATOM 11387 H HA   . LYS A 1 48 ? 10.212  -14.926 -5.759  1.00 0.00 ? 49 LYS A HA   10 
ATOM 11388 H HB2  . LYS A 1 48 ? 12.297  -14.925 -3.559  1.00 0.00 ? 49 LYS A HB2  10 
ATOM 11389 H HB3  . LYS A 1 48 ? 10.800  -13.989 -3.578  1.00 0.00 ? 49 LYS A HB3  10 
ATOM 11390 H HG2  . LYS A 1 48 ? 9.560   -16.199 -3.801  1.00 0.00 ? 49 LYS A HG2  10 
ATOM 11391 H HG3  . LYS A 1 48 ? 11.093  -16.997 -3.448  1.00 0.00 ? 49 LYS A HG3  10 
ATOM 11392 H HD2  . LYS A 1 48 ? 9.735   -14.955 -1.664  1.00 0.00 ? 49 LYS A HD2  10 
ATOM 11393 H HD3  . LYS A 1 48 ? 9.733   -16.699 -1.401  1.00 0.00 ? 49 LYS A HD3  10 
ATOM 11394 H HE2  . LYS A 1 48 ? 12.433  -16.004 -1.795  1.00 0.00 ? 49 LYS A HE2  10 
ATOM 11395 H HE3  . LYS A 1 48 ? 11.777  -14.763 -0.727  1.00 0.00 ? 49 LYS A HE3  10 
ATOM 11396 H HZ1  . LYS A 1 48 ? 10.770  -16.698 0.547   1.00 0.00 ? 49 LYS A HZ1  10 
ATOM 11397 H HZ2  . LYS A 1 48 ? 11.834  -17.691 -0.325  1.00 0.00 ? 49 LYS A HZ2  10 
ATOM 11398 H HZ3  . LYS A 1 48 ? 12.449  -16.470 0.686   1.00 0.00 ? 49 LYS A HZ3  10 
ATOM 11399 N N    . SER A 1 49 ? 13.205  -14.125 -6.552  1.00 0.00 ? 50 SER A N    10 
ATOM 11400 C CA   . SER A 1 49 ? 14.034  -13.040 -7.148  1.00 0.00 ? 50 SER A CA   10 
ATOM 11401 C C    . SER A 1 49 ? 13.297  -12.427 -8.342  1.00 0.00 ? 50 SER A C    10 
ATOM 11402 O O    . SER A 1 49 ? 13.527  -11.291 -8.710  1.00 0.00 ? 50 SER A O    10 
ATOM 11403 C CB   . SER A 1 49 ? 15.365  -13.622 -7.619  1.00 0.00 ? 50 SER A CB   10 
ATOM 11404 O OG   . SER A 1 49 ? 15.216  -14.130 -8.938  1.00 0.00 ? 50 SER A OG   10 
ATOM 11405 H H    . SER A 1 49 ? 13.533  -15.047 -6.555  1.00 0.00 ? 50 SER A H    10 
ATOM 11406 H HA   . SER A 1 49 ? 14.215  -12.277 -6.406  1.00 0.00 ? 50 SER A HA   10 
ATOM 11407 H HB2  . SER A 1 49 ? 16.118  -12.851 -7.620  1.00 0.00 ? 50 SER A HB2  10 
ATOM 11408 H HB3  . SER A 1 49 ? 15.667  -14.416 -6.948  1.00 0.00 ? 50 SER A HB3  10 
ATOM 11409 H HG   . SER A 1 49 ? 14.781  -14.984 -8.880  1.00 0.00 ? 50 SER A HG   10 
ATOM 11410 N N    . GLU A 1 50 ? 12.411  -13.169 -8.949  1.00 0.00 ? 51 GLU A N    10 
ATOM 11411 C CA   . GLU A 1 50 ? 11.660  -12.641 -10.113 1.00 0.00 ? 51 GLU A CA   10 
ATOM 11412 C C    . GLU A 1 50 ? 10.782  -11.473 -9.681  1.00 0.00 ? 51 GLU A C    10 
ATOM 11413 O O    . GLU A 1 50 ? 11.008  -10.336 -10.050 1.00 0.00 ? 51 GLU A O    10 
ATOM 11414 C CB   . GLU A 1 50 ? 10.787  -13.738 -10.671 1.00 0.00 ? 51 GLU A CB   10 
ATOM 11415 C CG   . GLU A 1 50 ? 11.544  -15.066 -10.646 1.00 0.00 ? 51 GLU A CG   10 
ATOM 11416 C CD   . GLU A 1 50 ? 11.132  -15.911 -11.853 1.00 0.00 ? 51 GLU A CD   10 
ATOM 11417 O OE1  . GLU A 1 50 ? 10.011  -16.391 -11.860 1.00 0.00 ? 51 GLU A OE1  10 
ATOM 11418 O OE2  . GLU A 1 50 ? 11.944  -16.061 -12.750 1.00 0.00 ? 51 GLU A OE2  10 
ATOM 11419 H H    . GLU A 1 50 ? 12.232  -14.078 -8.635  1.00 0.00 ? 51 GLU A H    10 
ATOM 11420 H HA   . GLU A 1 50 ? 12.337  -12.322 -10.882 1.00 0.00 ? 51 GLU A HA   10 
ATOM 11421 H HB2  . GLU A 1 50 ? 9.889   -13.818 -10.077 1.00 0.00 ? 51 GLU A HB2  10 
ATOM 11422 H HB3  . GLU A 1 50 ? 10.541  -13.485 -11.684 1.00 0.00 ? 51 GLU A HB3  10 
ATOM 11423 H HG2  . GLU A 1 50 ? 12.606  -14.875 -10.683 1.00 0.00 ? 51 GLU A HG2  10 
ATOM 11424 H HG3  . GLU A 1 50 ? 11.306  -15.599 -9.738  1.00 0.00 ? 51 GLU A HG3  10 
ATOM 11425 N N    . TRP A 1 51 ? 9.777   -11.750 -8.904  1.00 0.00 ? 52 TRP A N    10 
ATOM 11426 C CA   . TRP A 1 51 ? 8.869   -10.670 -8.443  1.00 0.00 ? 52 TRP A CA   10 
ATOM 11427 C C    . TRP A 1 51 ? 9.620   -9.727  -7.522  1.00 0.00 ? 52 TRP A C    10 
ATOM 11428 O O    . TRP A 1 51 ? 9.657   -8.544  -7.748  1.00 0.00 ? 52 TRP A O    10 
ATOM 11429 C CB   . TRP A 1 51 ? 7.716   -11.291 -7.675  1.00 0.00 ? 52 TRP A CB   10 
ATOM 11430 C CG   . TRP A 1 51 ? 7.163   -12.406 -8.461  1.00 0.00 ? 52 TRP A CG   10 
ATOM 11431 C CD1  . TRP A 1 51 ? 7.421   -13.687 -8.221  1.00 0.00 ? 52 TRP A CD1  10 
ATOM 11432 C CD2  . TRP A 1 51 ? 6.270   -12.362 -9.598  1.00 0.00 ? 52 TRP A CD2  10 
ATOM 11433 N NE1  . TRP A 1 51 ? 6.737   -14.462 -9.137  1.00 0.00 ? 52 TRP A NE1  10 
ATOM 11434 C CE2  . TRP A 1 51 ? 6.007   -13.683 -10.013 1.00 0.00 ? 52 TRP A CE2  10 
ATOM 11435 C CE3  . TRP A 1 51 ? 5.668   -11.312 -10.297 1.00 0.00 ? 52 TRP A CE3  10 
ATOM 11436 C CZ2  . TRP A 1 51 ? 5.168   -13.955 -11.094 1.00 0.00 ? 52 TRP A CZ2  10 
ATOM 11437 C CZ3  . TRP A 1 51 ? 4.826   -11.572 -11.378 1.00 0.00 ? 52 TRP A CZ3  10 
ATOM 11438 C CH2  . TRP A 1 51 ? 4.572   -12.894 -11.779 1.00 0.00 ? 52 TRP A CH2  10 
ATOM 11439 H H    . TRP A 1 51 ? 9.617   -12.673 -8.623  1.00 0.00 ? 52 TRP A H    10 
ATOM 11440 H HA   . TRP A 1 51 ? 8.487   -10.126 -9.293  1.00 0.00 ? 52 TRP A HA   10 
ATOM 11441 H HB2  . TRP A 1 51 ? 8.069   -11.660 -6.724  1.00 0.00 ? 52 TRP A HB2  10 
ATOM 11442 H HB3  . TRP A 1 51 ? 6.951   -10.566 -7.514  1.00 0.00 ? 52 TRP A HB3  10 
ATOM 11443 H HD1  . TRP A 1 51 ? 8.058   -14.040 -7.437  1.00 0.00 ? 52 TRP A HD1  10 
ATOM 11444 H HE1  . TRP A 1 51 ? 6.755   -15.433 -9.175  1.00 0.00 ? 52 TRP A HE1  10 
ATOM 11445 H HE3  . TRP A 1 51 ? 5.862   -10.294 -10.002 1.00 0.00 ? 52 TRP A HE3  10 
ATOM 11446 H HZ2  . TRP A 1 51 ? 4.979   -14.976 -11.394 1.00 0.00 ? 52 TRP A HZ2  10 
ATOM 11447 H HZ3  . TRP A 1 51 ? 4.366   -10.750 -11.894 1.00 0.00 ? 52 TRP A HZ3  10 
ATOM 11448 H HH2  . TRP A 1 51 ? 3.920   -13.088 -12.616 1.00 0.00 ? 52 TRP A HH2  10 
ATOM 11449 N N    . GLU A 1 52 ? 10.201  -10.245 -6.477  1.00 0.00 ? 53 GLU A N    10 
ATOM 11450 C CA   . GLU A 1 52 ? 10.944  -9.366  -5.520  1.00 0.00 ? 53 GLU A CA   10 
ATOM 11451 C C    . GLU A 1 52 ? 11.679  -8.256  -6.279  1.00 0.00 ? 53 GLU A C    10 
ATOM 11452 O O    . GLU A 1 52 ? 11.583  -7.094  -5.936  1.00 0.00 ? 53 GLU A O    10 
ATOM 11453 C CB   . GLU A 1 52 ? 11.954  -10.201 -4.729  1.00 0.00 ? 53 GLU A CB   10 
ATOM 11454 C CG   . GLU A 1 52 ? 11.225  -10.989 -3.640  1.00 0.00 ? 53 GLU A CG   10 
ATOM 11455 C CD   . GLU A 1 52 ? 11.651  -10.471 -2.265  1.00 0.00 ? 53 GLU A CD   10 
ATOM 11456 O OE1  . GLU A 1 52 ? 11.488  -9.287  -2.023  1.00 0.00 ? 53 GLU A OE1  10 
ATOM 11457 O OE2  . GLU A 1 52 ? 12.134  -11.269 -1.478  1.00 0.00 ? 53 GLU A OE2  10 
ATOM 11458 H H    . GLU A 1 52 ? 10.136  -11.215 -6.314  1.00 0.00 ? 53 GLU A H    10 
ATOM 11459 H HA   . GLU A 1 52 ? 10.239  -8.914  -4.837  1.00 0.00 ? 53 GLU A HA   10 
ATOM 11460 H HB2  . GLU A 1 52 ? 12.455  -10.886 -5.398  1.00 0.00 ? 53 GLU A HB2  10 
ATOM 11461 H HB3  . GLU A 1 52 ? 12.681  -9.547  -4.272  1.00 0.00 ? 53 GLU A HB3  10 
ATOM 11462 H HG2  . GLU A 1 52 ? 10.157  -10.864 -3.758  1.00 0.00 ? 53 GLU A HG2  10 
ATOM 11463 H HG3  . GLU A 1 52 ? 11.476  -12.036 -3.722  1.00 0.00 ? 53 GLU A HG3  10 
ATOM 11464 N N    . ALA A 1 53 ? 12.406  -8.593  -7.308  1.00 0.00 ? 54 ALA A N    10 
ATOM 11465 C CA   . ALA A 1 53 ? 13.129  -7.539  -8.077  1.00 0.00 ? 54 ALA A CA   10 
ATOM 11466 C C    . ALA A 1 53 ? 12.108  -6.613  -8.741  1.00 0.00 ? 54 ALA A C    10 
ATOM 11467 O O    . ALA A 1 53 ? 12.261  -5.408  -8.757  1.00 0.00 ? 54 ALA A O    10 
ATOM 11468 C CB   . ALA A 1 53 ? 13.999  -8.191  -9.152  1.00 0.00 ? 54 ALA A CB   10 
ATOM 11469 H H    . ALA A 1 53 ? 12.473  -9.534  -7.580  1.00 0.00 ? 54 ALA A H    10 
ATOM 11470 H HA   . ALA A 1 53 ? 13.750  -6.966  -7.406  1.00 0.00 ? 54 ALA A HA   10 
ATOM 11471 H HB1  . ALA A 1 53 ? 13.597  -9.162  -9.401  1.00 0.00 ? 54 ALA A HB1  10 
ATOM 11472 H HB2  . ALA A 1 53 ? 14.006  -7.568  -10.035 1.00 0.00 ? 54 ALA A HB2  10 
ATOM 11473 H HB3  . ALA A 1 53 ? 15.007  -8.302  -8.782  1.00 0.00 ? 54 ALA A HB3  10 
ATOM 11474 N N    . LYS A 1 54 ? 11.073  -7.176  -9.296  1.00 0.00 ? 55 LYS A N    10 
ATOM 11475 C CA   . LYS A 1 54 ? 10.033  -6.348  -9.974  1.00 0.00 ? 55 LYS A CA   10 
ATOM 11476 C C    . LYS A 1 54 ? 9.425   -5.339  -8.995  1.00 0.00 ? 55 LYS A C    10 
ATOM 11477 O O    . LYS A 1 54 ? 9.146   -4.211  -9.351  1.00 0.00 ? 55 LYS A O    10 
ATOM 11478 C CB   . LYS A 1 54 ? 8.928   -7.261  -10.504 1.00 0.00 ? 55 LYS A CB   10 
ATOM 11479 C CG   . LYS A 1 54 ? 8.024   -6.467  -11.448 1.00 0.00 ? 55 LYS A CG   10 
ATOM 11480 C CD   . LYS A 1 54 ? 8.268   -6.921  -12.887 1.00 0.00 ? 55 LYS A CD   10 
ATOM 11481 C CE   . LYS A 1 54 ? 7.300   -8.052  -13.235 1.00 0.00 ? 55 LYS A CE   10 
ATOM 11482 N NZ   . LYS A 1 54 ? 5.899   -7.590  -13.027 1.00 0.00 ? 55 LYS A NZ   10 
ATOM 11483 H H    . LYS A 1 54 ? 10.984  -8.151  -9.276  1.00 0.00 ? 55 LYS A H    10 
ATOM 11484 H HA   . LYS A 1 54 ? 10.482  -5.817  -10.797 1.00 0.00 ? 55 LYS A HA   10 
ATOM 11485 H HB2  . LYS A 1 54 ? 9.369   -8.090  -11.039 1.00 0.00 ? 55 LYS A HB2  10 
ATOM 11486 H HB3  . LYS A 1 54 ? 8.342   -7.634  -9.678  1.00 0.00 ? 55 LYS A HB3  10 
ATOM 11487 H HG2  . LYS A 1 54 ? 6.989   -6.639  -11.185 1.00 0.00 ? 55 LYS A HG2  10 
ATOM 11488 H HG3  . LYS A 1 54 ? 8.247   -5.415  -11.362 1.00 0.00 ? 55 LYS A HG3  10 
ATOM 11489 H HD2  . LYS A 1 54 ? 8.109   -6.090  -13.558 1.00 0.00 ? 55 LYS A HD2  10 
ATOM 11490 H HD3  . LYS A 1 54 ? 9.283   -7.275  -12.985 1.00 0.00 ? 55 LYS A HD3  10 
ATOM 11491 H HE2  . LYS A 1 54 ? 7.436   -8.336  -14.268 1.00 0.00 ? 55 LYS A HE2  10 
ATOM 11492 H HE3  . LYS A 1 54 ? 7.498   -8.903  -12.599 1.00 0.00 ? 55 LYS A HE3  10 
ATOM 11493 H HZ1  . LYS A 1 54 ? 5.814   -6.596  -13.319 1.00 0.00 ? 55 LYS A HZ1  10 
ATOM 11494 H HZ2  . LYS A 1 54 ? 5.254   -8.176  -13.595 1.00 0.00 ? 55 LYS A HZ2  10 
ATOM 11495 H HZ3  . LYS A 1 54 ? 5.652   -7.675  -12.021 1.00 0.00 ? 55 LYS A HZ3  10 
ATOM 11496 N N    . ALA A 1 55 ? 9.207   -5.727  -7.768  1.00 0.00 ? 56 ALA A N    10 
ATOM 11497 C CA   . ALA A 1 55 ? 8.611   -4.782  -6.789  1.00 0.00 ? 56 ALA A CA   10 
ATOM 11498 C C    . ALA A 1 55 ? 9.528   -3.569  -6.662  1.00 0.00 ? 56 ALA A C    10 
ATOM 11499 O O    . ALA A 1 55 ? 9.084   -2.453  -6.482  1.00 0.00 ? 56 ALA A O    10 
ATOM 11500 C CB   . ALA A 1 55 ? 8.475   -5.468  -5.429  1.00 0.00 ? 56 ALA A CB   10 
ATOM 11501 H H    . ALA A 1 55 ? 9.434   -6.633  -7.494  1.00 0.00 ? 56 ALA A H    10 
ATOM 11502 H HA   . ALA A 1 55 ? 7.635   -4.470  -7.138  1.00 0.00 ? 56 ALA A HA   10 
ATOM 11503 H HB1  . ALA A 1 55 ? 8.004   -6.432  -5.559  1.00 0.00 ? 56 ALA A HB1  10 
ATOM 11504 H HB2  . ALA A 1 55 ? 9.454   -5.602  -4.993  1.00 0.00 ? 56 ALA A HB2  10 
ATOM 11505 H HB3  . ALA A 1 55 ? 7.871   -4.856  -4.776  1.00 0.00 ? 56 ALA A HB3  10 
ATOM 11506 N N    . ALA A 1 56 ? 10.810  -3.785  -6.765  1.00 0.00 ? 57 ALA A N    10 
ATOM 11507 C CA   . ALA A 1 56 ? 11.768  -2.654  -6.666  1.00 0.00 ? 57 ALA A CA   10 
ATOM 11508 C C    . ALA A 1 56 ? 11.294  -1.523  -7.576  1.00 0.00 ? 57 ALA A C    10 
ATOM 11509 O O    . ALA A 1 56 ? 11.276  -0.371  -7.197  1.00 0.00 ? 57 ALA A O    10 
ATOM 11510 C CB   . ALA A 1 56 ? 13.149  -3.122  -7.125  1.00 0.00 ? 57 ALA A CB   10 
ATOM 11511 H H    . ALA A 1 56 ? 11.141  -4.695  -6.918  1.00 0.00 ? 57 ALA A H    10 
ATOM 11512 H HA   . ALA A 1 56 ? 11.820  -2.306  -5.645  1.00 0.00 ? 57 ALA A HA   10 
ATOM 11513 H HB1  . ALA A 1 56 ? 13.312  -4.139  -6.801  1.00 0.00 ? 57 ALA A HB1  10 
ATOM 11514 H HB2  . ALA A 1 56 ? 13.200  -3.076  -8.204  1.00 0.00 ? 57 ALA A HB2  10 
ATOM 11515 H HB3  . ALA A 1 56 ? 13.907  -2.482  -6.700  1.00 0.00 ? 57 ALA A HB3  10 
ATOM 11516 N N    . LYS A 1 57 ? 10.915  -1.850  -8.780  1.00 0.00 ? 58 LYS A N    10 
ATOM 11517 C CA   . LYS A 1 57 ? 10.446  -0.804  -9.732  1.00 0.00 ? 58 LYS A CA   10 
ATOM 11518 C C    . LYS A 1 57 ? 9.444   0.124   -9.043  1.00 0.00 ? 58 LYS A C    10 
ATOM 11519 O O    . LYS A 1 57 ? 9.689   1.303   -8.889  1.00 0.00 ? 58 LYS A O    10 
ATOM 11520 C CB   . LYS A 1 57 ? 9.774   -1.474  -10.932 1.00 0.00 ? 58 LYS A CB   10 
ATOM 11521 C CG   . LYS A 1 57 ? 10.499  -1.067  -12.217 1.00 0.00 ? 58 LYS A CG   10 
ATOM 11522 C CD   . LYS A 1 57 ? 9.689   0.009   -12.942 1.00 0.00 ? 58 LYS A CD   10 
ATOM 11523 C CE   . LYS A 1 57 ? 9.937   -0.092  -14.448 1.00 0.00 ? 58 LYS A CE   10 
ATOM 11524 N NZ   . LYS A 1 57 ? 9.466   1.156   -15.114 1.00 0.00 ? 58 LYS A NZ   10 
ATOM 11525 H H    . LYS A 1 57 ? 10.947  -2.788  -9.061  1.00 0.00 ? 58 LYS A H    10 
ATOM 11526 H HA   . LYS A 1 57 ? 11.292  -0.224  -10.072 1.00 0.00 ? 58 LYS A HA   10 
ATOM 11527 H HB2  . LYS A 1 57 ? 9.820   -2.547  -10.817 1.00 0.00 ? 58 LYS A HB2  10 
ATOM 11528 H HB3  . LYS A 1 57 ? 8.743   -1.161  -10.990 1.00 0.00 ? 58 LYS A HB3  10 
ATOM 11529 H HG2  . LYS A 1 57 ? 11.477  -0.677  -11.970 1.00 0.00 ? 58 LYS A HG2  10 
ATOM 11530 H HG3  . LYS A 1 57 ? 10.606  -1.928  -12.858 1.00 0.00 ? 58 LYS A HG3  10 
ATOM 11531 H HD2  . LYS A 1 57 ? 8.638   -0.132  -12.739 1.00 0.00 ? 58 LYS A HD2  10 
ATOM 11532 H HD3  . LYS A 1 57 ? 9.995   0.985   -12.595 1.00 0.00 ? 58 LYS A HD3  10 
ATOM 11533 H HE2  . LYS A 1 57 ? 10.994  -0.221  -14.631 1.00 0.00 ? 58 LYS A HE2  10 
ATOM 11534 H HE3  . LYS A 1 57 ? 9.397   -0.938  -14.846 1.00 0.00 ? 58 LYS A HE3  10 
ATOM 11535 H HZ1  . LYS A 1 57 ? 9.874   1.981   -14.631 1.00 0.00 ? 58 LYS A HZ1  10 
ATOM 11536 H HZ2  . LYS A 1 57 ? 9.768   1.154   -16.107 1.00 0.00 ? 58 LYS A HZ2  10 
ATOM 11537 H HZ3  . LYS A 1 57 ? 8.428   1.203   -15.065 1.00 0.00 ? 58 LYS A HZ3  10 
ATOM 11538 N N    . ALA A 1 58 ? 8.315   -0.388  -8.629  1.00 0.00 ? 59 ALA A N    10 
ATOM 11539 C CA   . ALA A 1 58 ? 7.316   0.494   -7.959  1.00 0.00 ? 59 ALA A CA   10 
ATOM 11540 C C    . ALA A 1 58 ? 8.011   1.281   -6.852  1.00 0.00 ? 59 ALA A C    10 
ATOM 11541 O O    . ALA A 1 58 ? 7.649   2.396   -6.550  1.00 0.00 ? 59 ALA A O    10 
ATOM 11542 C CB   . ALA A 1 58 ? 6.194   -0.352  -7.349  1.00 0.00 ? 59 ALA A CB   10 
ATOM 11543 H H    . ALA A 1 58 ? 8.125   -1.342  -8.761  1.00 0.00 ? 59 ALA A H    10 
ATOM 11544 H HA   . ALA A 1 58 ? 6.902   1.183   -8.681  1.00 0.00 ? 59 ALA A HA   10 
ATOM 11545 H HB1  . ALA A 1 58 ? 6.583   -1.322  -7.076  1.00 0.00 ? 59 ALA A HB1  10 
ATOM 11546 H HB2  . ALA A 1 58 ? 5.808   0.143   -6.468  1.00 0.00 ? 59 ALA A HB2  10 
ATOM 11547 H HB3  . ALA A 1 58 ? 5.401   -0.472  -8.072  1.00 0.00 ? 59 ALA A HB3  10 
ATOM 11548 N N    . LYS A 1 59 ? 9.015   0.709   -6.252  1.00 0.00 ? 60 LYS A N    10 
ATOM 11549 C CA   . LYS A 1 59 ? 9.740   1.415   -5.175  1.00 0.00 ? 60 LYS A CA   10 
ATOM 11550 C C    . LYS A 1 59 ? 10.334  2.704   -5.726  1.00 0.00 ? 60 LYS A C    10 
ATOM 11551 O O    . LYS A 1 59 ? 10.078  3.783   -5.235  1.00 0.00 ? 60 LYS A O    10 
ATOM 11552 C CB   . LYS A 1 59 ? 10.864  0.513   -4.692  1.00 0.00 ? 60 LYS A CB   10 
ATOM 11553 C CG   . LYS A 1 59 ? 10.876  0.473   -3.162  1.00 0.00 ? 60 LYS A CG   10 
ATOM 11554 C CD   . LYS A 1 59 ? 12.303  0.680   -2.653  1.00 0.00 ? 60 LYS A CD   10 
ATOM 11555 C CE   . LYS A 1 59 ? 12.307  1.769   -1.578  1.00 0.00 ? 60 LYS A CE   10 
ATOM 11556 N NZ   . LYS A 1 59 ? 13.562  1.676   -0.780  1.00 0.00 ? 60 LYS A NZ   10 
ATOM 11557 H H    . LYS A 1 59 ? 9.301   -0.188  -6.515  1.00 0.00 ? 60 LYS A H    10 
ATOM 11558 H HA   . LYS A 1 59 ? 9.068   1.635   -4.359  1.00 0.00 ? 60 LYS A HA   10 
ATOM 11559 H HB2  . LYS A 1 59 ? 10.712  -0.479  -5.084  1.00 0.00 ? 60 LYS A HB2  10 
ATOM 11560 H HB3  . LYS A 1 59 ? 11.799  0.894   -5.052  1.00 0.00 ? 60 LYS A HB3  10 
ATOM 11561 H HG2  . LYS A 1 59 ? 10.238  1.257   -2.778  1.00 0.00 ? 60 LYS A HG2  10 
ATOM 11562 H HG3  . LYS A 1 59 ? 10.511  -0.485  -2.825  1.00 0.00 ? 60 LYS A HG3  10 
ATOM 11563 H HD2  . LYS A 1 59 ? 12.672  -0.245  -2.233  1.00 0.00 ? 60 LYS A HD2  10 
ATOM 11564 H HD3  . LYS A 1 59 ? 12.939  0.983   -3.472  1.00 0.00 ? 60 LYS A HD3  10 
ATOM 11565 H HE2  . LYS A 1 59 ? 12.249  2.739   -2.049  1.00 0.00 ? 60 LYS A HE2  10 
ATOM 11566 H HE3  . LYS A 1 59 ? 11.455  1.634   -0.927  1.00 0.00 ? 60 LYS A HE3  10 
ATOM 11567 H HZ1  . LYS A 1 59 ? 14.071  0.805   -1.035  1.00 0.00 ? 60 LYS A HZ1  10 
ATOM 11568 H HZ2  . LYS A 1 59 ? 14.162  2.501   -0.980  1.00 0.00 ? 60 LYS A HZ2  10 
ATOM 11569 H HZ3  . LYS A 1 59 ? 13.328  1.658   0.232   1.00 0.00 ? 60 LYS A HZ3  10 
ATOM 11570 N N    . ASP A 1 60 ? 11.137  2.592   -6.743  1.00 0.00 ? 61 ASP A N    10 
ATOM 11571 C CA   . ASP A 1 60 ? 11.769  3.803   -7.336  1.00 0.00 ? 61 ASP A CA   10 
ATOM 11572 C C    . ASP A 1 60 ? 10.690  4.792   -7.786  1.00 0.00 ? 61 ASP A C    10 
ATOM 11573 O O    . ASP A 1 60 ? 10.752  5.967   -7.483  1.00 0.00 ? 61 ASP A O    10 
ATOM 11574 C CB   . ASP A 1 60 ? 12.620  3.390   -8.540  1.00 0.00 ? 61 ASP A CB   10 
ATOM 11575 C CG   . ASP A 1 60 ? 13.879  2.672   -8.050  1.00 0.00 ? 61 ASP A CG   10 
ATOM 11576 O OD1  . ASP A 1 60 ? 14.356  3.018   -6.983  1.00 0.00 ? 61 ASP A OD1  10 
ATOM 11577 O OD2  . ASP A 1 60 ? 14.343  1.787   -8.751  1.00 0.00 ? 61 ASP A OD2  10 
ATOM 11578 H H    . ASP A 1 60 ? 11.331  1.703   -7.111  1.00 0.00 ? 61 ASP A H    10 
ATOM 11579 H HA   . ASP A 1 60 ? 12.399  4.275   -6.597  1.00 0.00 ? 61 ASP A HA   10 
ATOM 11580 H HB2  . ASP A 1 60 ? 12.048  2.726   -9.174  1.00 0.00 ? 61 ASP A HB2  10 
ATOM 11581 H HB3  . ASP A 1 60 ? 12.904  4.268   -9.100  1.00 0.00 ? 61 ASP A HB3  10 
ATOM 11582 N N    . ASP A 1 61 ? 9.705   4.333   -8.509  1.00 0.00 ? 62 ASP A N    10 
ATOM 11583 C CA   . ASP A 1 61 ? 8.631   5.256   -8.975  1.00 0.00 ? 62 ASP A CA   10 
ATOM 11584 C C    . ASP A 1 61 ? 7.773   5.684   -7.785  1.00 0.00 ? 62 ASP A C    10 
ATOM 11585 O O    . ASP A 1 61 ? 6.968   6.587   -7.879  1.00 0.00 ? 62 ASP A O    10 
ATOM 11586 C CB   . ASP A 1 61 ? 7.751   4.535   -9.996  1.00 0.00 ? 62 ASP A CB   10 
ATOM 11587 C CG   . ASP A 1 61 ? 8.411   4.600   -11.374 1.00 0.00 ? 62 ASP A CG   10 
ATOM 11588 O OD1  . ASP A 1 61 ? 8.952   5.644   -11.701 1.00 0.00 ? 62 ASP A OD1  10 
ATOM 11589 O OD2  . ASP A 1 61 ? 8.364   3.606   -12.079 1.00 0.00 ? 62 ASP A OD2  10 
ATOM 11590 H H    . ASP A 1 61 ? 9.671   3.384   -8.746  1.00 0.00 ? 62 ASP A H    10 
ATOM 11591 H HA   . ASP A 1 61 ? 9.076   6.128   -9.433  1.00 0.00 ? 62 ASP A HA   10 
ATOM 11592 H HB2  . ASP A 1 61 ? 7.631   3.503   -9.698  1.00 0.00 ? 62 ASP A HB2  10 
ATOM 11593 H HB3  . ASP A 1 61 ? 6.785   5.014   -10.039 1.00 0.00 ? 62 ASP A HB3  10 
ATOM 11594 N N    . TYR A 1 62 ? 7.929   5.032   -6.671  1.00 0.00 ? 63 TYR A N    10 
ATOM 11595 C CA   . TYR A 1 62 ? 7.119   5.381   -5.474  1.00 0.00 ? 63 TYR A CA   10 
ATOM 11596 C C    . TYR A 1 62 ? 7.793   6.500   -4.678  1.00 0.00 ? 63 TYR A C    10 
ATOM 11597 O O    . TYR A 1 62 ? 7.138   7.379   -4.157  1.00 0.00 ? 63 TYR A O    10 
ATOM 11598 C CB   . TYR A 1 62 ? 6.972   4.132   -4.611  1.00 0.00 ? 63 TYR A CB   10 
ATOM 11599 C CG   . TYR A 1 62 ? 6.167   4.448   -3.401  1.00 0.00 ? 63 TYR A CG   10 
ATOM 11600 C CD1  . TYR A 1 62 ? 6.653   5.310   -2.415  1.00 0.00 ? 63 TYR A CD1  10 
ATOM 11601 C CD2  . TYR A 1 62 ? 4.930   3.859   -3.266  1.00 0.00 ? 63 TYR A CD2  10 
ATOM 11602 C CE1  . TYR A 1 62 ? 5.876   5.574   -1.285  1.00 0.00 ? 63 TYR A CE1  10 
ATOM 11603 C CE2  . TYR A 1 62 ? 4.152   4.110   -2.149  1.00 0.00 ? 63 TYR A CE2  10 
ATOM 11604 C CZ   . TYR A 1 62 ? 4.620   4.967   -1.146  1.00 0.00 ? 63 TYR A CZ   10 
ATOM 11605 O OH   . TYR A 1 62 ? 3.847   5.222   -0.032  1.00 0.00 ? 63 TYR A OH   10 
ATOM 11606 H H    . TYR A 1 62 ? 8.576   4.298   -6.623  1.00 0.00 ? 63 TYR A H    10 
ATOM 11607 H HA   . TYR A 1 62 ? 6.139   5.711   -5.780  1.00 0.00 ? 63 TYR A HA   10 
ATOM 11608 H HB2  . TYR A 1 62 ? 6.465   3.368   -5.177  1.00 0.00 ? 63 TYR A HB2  10 
ATOM 11609 H HB3  . TYR A 1 62 ? 7.932   3.768   -4.310  1.00 0.00 ? 63 TYR A HB3  10 
ATOM 11610 H HD1  . TYR A 1 62 ? 7.627   5.766   -2.522  1.00 0.00 ? 63 TYR A HD1  10 
ATOM 11611 H HD2  . TYR A 1 62 ? 4.562   3.201   -4.042  1.00 0.00 ? 63 TYR A HD2  10 
ATOM 11612 H HE1  . TYR A 1 62 ? 6.242   6.240   -0.525  1.00 0.00 ? 63 TYR A HE1  10 
ATOM 11613 H HE2  . TYR A 1 62 ? 3.200   3.622   -2.057  1.00 0.00 ? 63 TYR A HE2  10 
ATOM 11614 H HH   . TYR A 1 62 ? 3.079   4.645   -0.067  1.00 0.00 ? 63 TYR A HH   10 
ATOM 11615 N N    . ASP A 1 63 ? 9.091   6.483   -4.577  1.00 0.00 ? 64 ASP A N    10 
ATOM 11616 C CA   . ASP A 1 63 ? 9.785   7.553   -3.814  1.00 0.00 ? 64 ASP A CA   10 
ATOM 11617 C C    . ASP A 1 63 ? 9.853   8.804   -4.673  1.00 0.00 ? 64 ASP A C    10 
ATOM 11618 O O    . ASP A 1 63 ? 9.805   9.918   -4.191  1.00 0.00 ? 64 ASP A O    10 
ATOM 11619 C CB   . ASP A 1 63 ? 11.188  7.096   -3.480  1.00 0.00 ? 64 ASP A CB   10 
ATOM 11620 C CG   . ASP A 1 63 ? 11.687  7.832   -2.235  1.00 0.00 ? 64 ASP A CG   10 
ATOM 11621 O OD1  . ASP A 1 63 ? 10.878  8.479   -1.590  1.00 0.00 ? 64 ASP A OD1  10 
ATOM 11622 O OD2  . ASP A 1 63 ? 12.868  7.736   -1.947  1.00 0.00 ? 64 ASP A OD2  10 
ATOM 11623 H H    . ASP A 1 63 ? 9.609   5.775   -5.004  1.00 0.00 ? 64 ASP A H    10 
ATOM 11624 H HA   . ASP A 1 63 ? 9.257   7.750   -2.906  1.00 0.00 ? 64 ASP A HA   10 
ATOM 11625 H HB2  . ASP A 1 63 ? 11.160  6.044   -3.288  1.00 0.00 ? 64 ASP A HB2  10 
ATOM 11626 H HB3  . ASP A 1 63 ? 11.843  7.301   -4.308  1.00 0.00 ? 64 ASP A HB3  10 
ATOM 11627 N N    . ARG A 1 64 ? 9.972   8.612   -5.950  1.00 0.00 ? 65 ARG A N    10 
ATOM 11628 C CA   . ARG A 1 64 ? 10.057  9.766   -6.879  1.00 0.00 ? 65 ARG A CA   10 
ATOM 11629 C C    . ARG A 1 64 ? 8.657   10.288  -7.205  1.00 0.00 ? 65 ARG A C    10 
ATOM 11630 O O    . ARG A 1 64 ? 8.443   11.477  -7.337  1.00 0.00 ? 65 ARG A O    10 
ATOM 11631 C CB   . ARG A 1 64 ? 10.737  9.317   -8.171  1.00 0.00 ? 65 ARG A CB   10 
ATOM 11632 C CG   . ARG A 1 64 ? 10.707  10.456  -9.190  1.00 0.00 ? 65 ARG A CG   10 
ATOM 11633 C CD   . ARG A 1 64 ? 9.967   9.994   -10.448 1.00 0.00 ? 65 ARG A CD   10 
ATOM 11634 N NE   . ARG A 1 64 ? 10.718  10.440  -11.654 1.00 0.00 ? 65 ARG A NE   10 
ATOM 11635 C CZ   . ARG A 1 64 ? 11.165  9.558   -12.506 1.00 0.00 ? 65 ARG A CZ   10 
ATOM 11636 N NH1  . ARG A 1 64 ? 10.414  9.176   -13.502 1.00 0.00 ? 65 ARG A NH1  10 
ATOM 11637 N NH2  . ARG A 1 64 ? 12.363  9.062   -12.361 1.00 0.00 ? 65 ARG A NH2  10 
ATOM 11638 H H    . ARG A 1 64 ? 10.017  7.697   -6.299  1.00 0.00 ? 65 ARG A H    10 
ATOM 11639 H HA   . ARG A 1 64 ? 10.637  10.546  -6.422  1.00 0.00 ? 65 ARG A HA   10 
ATOM 11640 H HB2  . ARG A 1 64 ? 11.760  9.043   -7.963  1.00 0.00 ? 65 ARG A HB2  10 
ATOM 11641 H HB3  . ARG A 1 64 ? 10.209  8.464   -8.573  1.00 0.00 ? 65 ARG A HB3  10 
ATOM 11642 H HG2  . ARG A 1 64 ? 10.197  11.309  -8.764  1.00 0.00 ? 65 ARG A HG2  10 
ATOM 11643 H HG3  . ARG A 1 64 ? 11.716  10.733  -9.450  1.00 0.00 ? 65 ARG A HG3  10 
ATOM 11644 H HD2  . ARG A 1 64 ? 9.894   8.917   -10.446 1.00 0.00 ? 65 ARG A HD2  10 
ATOM 11645 H HD3  . ARG A 1 64 ? 8.977   10.423  -10.461 1.00 0.00 ? 65 ARG A HD3  10 
ATOM 11646 H HE   . ARG A 1 64 ? 10.876  11.393  -11.809 1.00 0.00 ? 65 ARG A HE   10 
ATOM 11647 H HH11 . ARG A 1 64 ? 9.497   9.560   -13.612 1.00 0.00 ? 65 ARG A HH11 10 
ATOM 11648 H HH12 . ARG A 1 64 ? 10.755  8.500   -14.154 1.00 0.00 ? 65 ARG A HH12 10 
ATOM 11649 H HH21 . ARG A 1 64 ? 12.938  9.357   -11.599 1.00 0.00 ? 65 ARG A HH21 10 
ATOM 11650 H HH22 . ARG A 1 64 ? 12.705  8.385   -13.013 1.00 0.00 ? 65 ARG A HH22 10 
ATOM 11651 N N    . ALA A 1 65 ? 7.705   9.410   -7.355  1.00 0.00 ? 66 ALA A N    10 
ATOM 11652 C CA   . ALA A 1 65 ? 6.324   9.859   -7.699  1.00 0.00 ? 66 ALA A CA   10 
ATOM 11653 C C    . ALA A 1 65 ? 5.664   10.542  -6.502  1.00 0.00 ? 66 ALA A C    10 
ATOM 11654 O O    . ALA A 1 65 ? 4.791   11.365  -6.668  1.00 0.00 ? 66 ALA A O    10 
ATOM 11655 C CB   . ALA A 1 65 ? 5.486   8.653   -8.118  1.00 0.00 ? 66 ALA A CB   10 
ATOM 11656 H H    . ALA A 1 65 ? 7.902   8.452   -7.259  1.00 0.00 ? 66 ALA A H    10 
ATOM 11657 H HA   . ALA A 1 65 ? 6.373   10.565  -8.519  1.00 0.00 ? 66 ALA A HA   10 
ATOM 11658 H HB1  . ALA A 1 65 ? 5.443   7.946   -7.304  1.00 0.00 ? 66 ALA A HB1  10 
ATOM 11659 H HB2  . ALA A 1 65 ? 4.487   8.978   -8.367  1.00 0.00 ? 66 ALA A HB2  10 
ATOM 11660 H HB3  . ALA A 1 65 ? 5.937   8.183   -8.981  1.00 0.00 ? 66 ALA A HB3  10 
ATOM 11661 N N    . VAL A 1 66 ? 6.058   10.223  -5.300  1.00 0.00 ? 67 VAL A N    10 
ATOM 11662 C CA   . VAL A 1 66 ? 5.423   10.890  -4.137  1.00 0.00 ? 67 VAL A CA   10 
ATOM 11663 C C    . VAL A 1 66 ? 5.822   12.359  -4.130  1.00 0.00 ? 67 VAL A C    10 
ATOM 11664 O O    . VAL A 1 66 ? 5.040   13.214  -3.810  1.00 0.00 ? 67 VAL A O    10 
ATOM 11665 C CB   . VAL A 1 66 ? 5.888   10.269  -2.848  1.00 0.00 ? 67 VAL A CB   10 
ATOM 11666 C CG1  . VAL A 1 66 ? 5.466   8.807   -2.793  1.00 0.00 ? 67 VAL A CG1  10 
ATOM 11667 C CG2  . VAL A 1 66 ? 7.386   10.396  -2.793  1.00 0.00 ? 67 VAL A CG2  10 
ATOM 11668 H H    . VAL A 1 66 ? 6.762   9.558   -5.164  1.00 0.00 ? 67 VAL A H    10 
ATOM 11669 H HA   . VAL A 1 66 ? 4.365   10.797  -4.207  1.00 0.00 ? 67 VAL A HA   10 
ATOM 11670 H HB   . VAL A 1 66 ? 5.458   10.803  -2.028  1.00 0.00 ? 67 VAL A HB   10 
ATOM 11671 H HG11 . VAL A 1 66 ? 5.363   8.427   -3.798  1.00 0.00 ? 67 VAL A HG11 10 
ATOM 11672 H HG12 . VAL A 1 66 ? 6.210   8.235   -2.261  1.00 0.00 ? 67 VAL A HG12 10 
ATOM 11673 H HG13 . VAL A 1 66 ? 4.518   8.731   -2.282  1.00 0.00 ? 67 VAL A HG13 10 
ATOM 11674 H HG21 . VAL A 1 66 ? 7.774   10.311  -3.792  1.00 0.00 ? 67 VAL A HG21 10 
ATOM 11675 H HG22 . VAL A 1 66 ? 7.632   11.365  -2.392  1.00 0.00 ? 67 VAL A HG22 10 
ATOM 11676 H HG23 . VAL A 1 66 ? 7.794   9.621   -2.169  1.00 0.00 ? 67 VAL A HG23 10 
ATOM 11677 N N    . LYS A 1 67 ? 7.045   12.646  -4.475  1.00 0.00 ? 68 LYS A N    10 
ATOM 11678 C CA   . LYS A 1 67 ? 7.515   14.066  -4.495  1.00 0.00 ? 68 LYS A CA   10 
ATOM 11679 C C    . LYS A 1 67 ? 6.669   14.857  -5.495  1.00 0.00 ? 68 LYS A C    10 
ATOM 11680 O O    . LYS A 1 67 ? 6.058   15.852  -5.158  1.00 0.00 ? 68 LYS A O    10 
ATOM 11681 C CB   . LYS A 1 67 ? 8.985   14.114  -4.915  1.00 0.00 ? 68 LYS A CB   10 
ATOM 11682 C CG   . LYS A 1 67 ? 9.639   15.372  -4.342  1.00 0.00 ? 68 LYS A CG   10 
ATOM 11683 C CD   . LYS A 1 67 ? 9.124   16.603  -5.091  1.00 0.00 ? 68 LYS A CD   10 
ATOM 11684 C CE   . LYS A 1 67 ? 8.291   17.466  -4.142  1.00 0.00 ? 68 LYS A CE   10 
ATOM 11685 N NZ   . LYS A 1 67 ? 8.926   18.808  -4.005  1.00 0.00 ? 68 LYS A NZ   10 
ATOM 11686 H H    . LYS A 1 67 ? 7.658   11.925  -4.715  1.00 0.00 ? 68 LYS A H    10 
ATOM 11687 H HA   . LYS A 1 67 ? 7.405   14.496  -3.509  1.00 0.00 ? 68 LYS A HA   10 
ATOM 11688 H HB2  . LYS A 1 67 ? 9.495   13.239  -4.540  1.00 0.00 ? 68 LYS A HB2  10 
ATOM 11689 H HB3  . LYS A 1 67 ? 9.051   14.135  -5.993  1.00 0.00 ? 68 LYS A HB3  10 
ATOM 11690 H HG2  . LYS A 1 67 ? 9.392   15.459  -3.293  1.00 0.00 ? 68 LYS A HG2  10 
ATOM 11691 H HG3  . LYS A 1 67 ? 10.710  15.305  -4.457  1.00 0.00 ? 68 LYS A HG3  10 
ATOM 11692 H HD2  . LYS A 1 67 ? 9.963   17.176  -5.458  1.00 0.00 ? 68 LYS A HD2  10 
ATOM 11693 H HD3  . LYS A 1 67 ? 8.511   16.288  -5.922  1.00 0.00 ? 68 LYS A HD3  10 
ATOM 11694 H HE2  . LYS A 1 67 ? 7.293   17.580  -4.541  1.00 0.00 ? 68 LYS A HE2  10 
ATOM 11695 H HE3  . LYS A 1 67 ? 8.240   16.991  -3.173  1.00 0.00 ? 68 LYS A HE3  10 
ATOM 11696 H HZ1  . LYS A 1 67 ? 9.944   18.731  -4.196  1.00 0.00 ? 68 LYS A HZ1  10 
ATOM 11697 H HZ2  . LYS A 1 67 ? 8.493   19.467  -4.684  1.00 0.00 ? 68 LYS A HZ2  10 
ATOM 11698 H HZ3  . LYS A 1 67 ? 8.782   19.162  -3.038  1.00 0.00 ? 68 LYS A HZ3  10 
ATOM 11699 N N    . GLU A 1 68 ? 6.606   14.406  -6.719  1.00 0.00 ? 69 GLU A N    10 
ATOM 11700 C CA   . GLU A 1 68 ? 5.773   15.107  -7.735  1.00 0.00 ? 69 GLU A CA   10 
ATOM 11701 C C    . GLU A 1 68 ? 4.340   15.125  -7.209  1.00 0.00 ? 69 GLU A C    10 
ATOM 11702 O O    . GLU A 1 68 ? 3.572   16.042  -7.419  1.00 0.00 ? 69 GLU A O    10 
ATOM 11703 C CB   . GLU A 1 68 ? 5.831   14.302  -9.032  1.00 0.00 ? 69 GLU A CB   10 
ATOM 11704 C CG   . GLU A 1 68 ? 6.927   14.866  -9.938  1.00 0.00 ? 69 GLU A CG   10 
ATOM 11705 C CD   . GLU A 1 68 ? 6.363   15.095  -11.340 1.00 0.00 ? 69 GLU A CD   10 
ATOM 11706 O OE1  . GLU A 1 68 ? 6.293   14.137  -12.092 1.00 0.00 ? 69 GLU A OE1  10 
ATOM 11707 O OE2  . GLU A 1 68 ? 6.011   16.225  -11.638 1.00 0.00 ? 69 GLU A OE2  10 
ATOM 11708 H H    . GLU A 1 68 ? 7.090   13.590  -6.967  1.00 0.00 ? 69 GLU A H    10 
ATOM 11709 H HA   . GLU A 1 68 ? 6.134   16.112  -7.896  1.00 0.00 ? 69 GLU A HA   10 
ATOM 11710 H HB2  . GLU A 1 68 ? 6.054   13.265  -8.793  1.00 0.00 ? 69 GLU A HB2  10 
ATOM 11711 H HB3  . GLU A 1 68 ? 4.879   14.361  -9.536  1.00 0.00 ? 69 GLU A HB3  10 
ATOM 11712 H HG2  . GLU A 1 68 ? 7.281   15.804  -9.533  1.00 0.00 ? 69 GLU A HG2  10 
ATOM 11713 H HG3  . GLU A 1 68 ? 7.747   14.165  -9.991  1.00 0.00 ? 69 GLU A HG3  10 
ATOM 11714 N N    . PHE A 1 69 ? 4.018   14.086  -6.508  1.00 0.00 ? 70 PHE A N    10 
ATOM 11715 C CA   . PHE A 1 69 ? 2.678   13.908  -5.889  1.00 0.00 ? 70 PHE A CA   10 
ATOM 11716 C C    . PHE A 1 69 ? 2.492   14.872  -4.717  1.00 0.00 ? 70 PHE A C    10 
ATOM 11717 O O    . PHE A 1 69 ? 1.392   15.270  -4.389  1.00 0.00 ? 70 PHE A O    10 
ATOM 11718 C CB   . PHE A 1 69 ? 2.653   12.500  -5.351  1.00 0.00 ? 70 PHE A CB   10 
ATOM 11719 C CG   . PHE A 1 69 ? 1.635   12.410  -4.281  1.00 0.00 ? 70 PHE A CG   10 
ATOM 11720 C CD1  . PHE A 1 69 ? 0.316   12.233  -4.632  1.00 0.00 ? 70 PHE A CD1  10 
ATOM 11721 C CD2  . PHE A 1 69 ? 2.022   12.532  -2.955  1.00 0.00 ? 70 PHE A CD2  10 
ATOM 11722 C CE1  . PHE A 1 69 ? -0.662  12.167  -3.645  1.00 0.00 ? 70 PHE A CE1  10 
ATOM 11723 C CE2  . PHE A 1 69 ? 1.053   12.470  -1.949  1.00 0.00 ? 70 PHE A CE2  10 
ATOM 11724 C CZ   . PHE A 1 69 ? -0.296  12.285  -2.294  1.00 0.00 ? 70 PHE A CZ   10 
ATOM 11725 H H    . PHE A 1 69 ? 4.693   13.392  -6.373  1.00 0.00 ? 70 PHE A H    10 
ATOM 11726 H HA   . PHE A 1 69 ? 1.881   14.014  -6.604  1.00 0.00 ? 70 PHE A HA   10 
ATOM 11727 H HB2  . PHE A 1 69 ? 2.398   11.822  -6.145  1.00 0.00 ? 70 PHE A HB2  10 
ATOM 11728 H HB3  . PHE A 1 69 ? 3.619   12.265  -4.941  1.00 0.00 ? 70 PHE A HB3  10 
ATOM 11729 H HD1  . PHE A 1 69 ? 0.056   12.151  -5.677  1.00 0.00 ? 70 PHE A HD1  10 
ATOM 11730 H HD2  . PHE A 1 69 ? 3.074   12.679  -2.713  1.00 0.00 ? 70 PHE A HD2  10 
ATOM 11731 H HE1  . PHE A 1 69 ? -1.691  12.029  -3.923  1.00 0.00 ? 70 PHE A HE1  10 
ATOM 11732 H HE2  . PHE A 1 69 ? 1.340   12.564  -0.913  1.00 0.00 ? 70 PHE A HE2  10 
ATOM 11733 H HZ   . PHE A 1 69 ? -1.051  12.235  -1.523  1.00 0.00 ? 70 PHE A HZ   10 
ATOM 11734 N N    . GLU A 1 70 ? 3.557   15.216  -4.066  1.00 0.00 ? 71 GLU A N    10 
ATOM 11735 C CA   . GLU A 1 70 ? 3.451   16.114  -2.893  1.00 0.00 ? 71 GLU A CA   10 
ATOM 11736 C C    . GLU A 1 70 ? 3.650   17.547  -3.366  1.00 0.00 ? 71 GLU A C    10 
ATOM 11737 O O    . GLU A 1 70 ? 3.453   18.501  -2.639  1.00 0.00 ? 71 GLU A O    10 
ATOM 11738 C CB   . GLU A 1 70 ? 4.536   15.753  -1.873  1.00 0.00 ? 71 GLU A CB   10 
ATOM 11739 C CG   . GLU A 1 70 ? 4.275   14.345  -1.326  1.00 0.00 ? 71 GLU A CG   10 
ATOM 11740 C CD   . GLU A 1 70 ? 4.521   14.325  0.185   1.00 0.00 ? 71 GLU A CD   10 
ATOM 11741 O OE1  . GLU A 1 70 ? 4.124   15.273  0.842   1.00 0.00 ? 71 GLU A OE1  10 
ATOM 11742 O OE2  . GLU A 1 70 ? 5.102   13.361  0.658   1.00 0.00 ? 71 GLU A OE2  10 
ATOM 11743 H H    . GLU A 1 70 ? 4.426   14.879  -4.345  1.00 0.00 ? 71 GLU A H    10 
ATOM 11744 H HA   . GLU A 1 70 ? 2.478   15.990  -2.443  1.00 0.00 ? 71 GLU A HA   10 
ATOM 11745 H HB2  . GLU A 1 70 ? 5.502   15.781  -2.354  1.00 0.00 ? 71 GLU A HB2  10 
ATOM 11746 H HB3  . GLU A 1 70 ? 4.516   16.462  -1.060  1.00 0.00 ? 71 GLU A HB3  10 
ATOM 11747 H HG2  . GLU A 1 70 ? 3.252   14.068  -1.527  1.00 0.00 ? 71 GLU A HG2  10 
ATOM 11748 H HG3  . GLU A 1 70 ? 4.938   13.641  -1.806  1.00 0.00 ? 71 GLU A HG3  10 
ATOM 11749 N N    . ALA A 1 71 ? 4.065   17.686  -4.589  1.00 0.00 ? 72 ALA A N    10 
ATOM 11750 C CA   . ALA A 1 71 ? 4.322   19.020  -5.169  1.00 0.00 ? 72 ALA A CA   10 
ATOM 11751 C C    . ALA A 1 71 ? 3.043   19.569  -5.806  1.00 0.00 ? 72 ALA A C    10 
ATOM 11752 O O    . ALA A 1 71 ? 3.046   20.034  -6.928  1.00 0.00 ? 72 ALA A O    10 
ATOM 11753 C CB   . ALA A 1 71 ? 5.398   18.838  -6.230  1.00 0.00 ? 72 ALA A CB   10 
ATOM 11754 H H    . ALA A 1 71 ? 4.228   16.894  -5.137  1.00 0.00 ? 72 ALA A H    10 
ATOM 11755 H HA   . ALA A 1 71 ? 4.674   19.693  -4.405  1.00 0.00 ? 72 ALA A HA   10 
ATOM 11756 H HB1  . ALA A 1 71 ? 5.661   17.783  -6.278  1.00 0.00 ? 72 ALA A HB1  10 
ATOM 11757 H HB2  . ALA A 1 71 ? 5.020   19.161  -7.189  1.00 0.00 ? 72 ALA A HB2  10 
ATOM 11758 H HB3  . ALA A 1 71 ? 6.270   19.417  -5.968  1.00 0.00 ? 72 ALA A HB3  10 
ATOM 11759 N N    . ASN A 1 72 ? 1.946   19.518  -5.100  1.00 0.00 ? 73 ASN A N    10 
ATOM 11760 C CA   . ASN A 1 72 ? 0.670   20.036  -5.667  1.00 0.00 ? 73 ASN A CA   10 
ATOM 11761 C C    . ASN A 1 72 ? -0.118  20.762  -4.575  1.00 0.00 ? 73 ASN A C    10 
ATOM 11762 O O    . ASN A 1 72 ? -1.018  20.208  -3.973  1.00 0.00 ? 73 ASN A O    10 
ATOM 11763 C CB   . ASN A 1 72 ? -0.160  18.868  -6.203  1.00 0.00 ? 73 ASN A CB   10 
ATOM 11764 C CG   . ASN A 1 72 ? -1.218  19.388  -7.166  1.00 0.00 ? 73 ASN A CG   10 
ATOM 11765 O OD1  . ASN A 1 72 ? -1.011  20.373  -7.847  1.00 0.00 ? 73 ASN A OD1  10 
ATOM 11766 N ND2  . ASN A 1 72 ? -2.353  18.760  -7.252  1.00 0.00 ? 73 ASN A ND2  10 
ATOM 11767 H H    . ASN A 1 72 ? 1.962   19.138  -4.197  1.00 0.00 ? 73 ASN A H    10 
ATOM 11768 H HA   . ASN A 1 72 ? 0.886   20.723  -6.472  1.00 0.00 ? 73 ASN A HA   10 
ATOM 11769 H HB2  . ASN A 1 72 ? 0.485   18.174  -6.721  1.00 0.00 ? 73 ASN A HB2  10 
ATOM 11770 H HB3  . ASN A 1 72 ? -0.647  18.364  -5.383  1.00 0.00 ? 73 ASN A HB3  10 
ATOM 11771 H HD21 . ASN A 1 72 ? -2.518  17.966  -6.701  1.00 0.00 ? 73 ASN A HD21 10 
ATOM 11772 H HD22 . ASN A 1 72 ? -3.040  19.080  -7.862  1.00 0.00 ? 73 ASN A HD22 10 
ATOM 11773 N N    . GLY A 1 73 ? 0.211   21.996  -4.312  1.00 0.00 ? 74 GLY A N    10 
ATOM 11774 C CA   . GLY A 1 73 ? -0.519  22.754  -3.259  1.00 0.00 ? 74 GLY A CA   10 
ATOM 11775 C C    . GLY A 1 73 ? -0.597  24.231  -3.651  1.00 0.00 ? 74 GLY A C    10 
ATOM 11776 O O    . GLY A 1 73 ? -1.678  24.674  -4.003  1.00 0.00 ? 74 GLY A O    10 
ATOM 11777 O OXT  . GLY A 1 73 ? 0.426   24.894  -3.595  1.00 0.00 ? 74 GLY A OXT  10 
ATOM 11778 H H    . GLY A 1 73 ? 0.940   22.425  -4.809  1.00 0.00 ? 74 GLY A H    10 
ATOM 11779 H HA2  . GLY A 1 73 ? -1.518  22.355  -3.156  1.00 0.00 ? 74 GLY A HA2  10 
ATOM 11780 H HA3  . GLY A 1 73 ? 0.006   22.662  -2.320  1.00 0.00 ? 74 GLY A HA3  10 
ATOM 11781 N N    . SER A 1 1  ? 0.106   2.438   -23.301 1.00 0.00 ? 2  SER A N    11 
ATOM 11782 C CA   . SER A 1 1  ? -0.359  1.728   -22.077 1.00 0.00 ? 2  SER A CA   11 
ATOM 11783 C C    . SER A 1 1  ? -1.469  2.539   -21.406 1.00 0.00 ? 2  SER A C    11 
ATOM 11784 O O    . SER A 1 1  ? -1.437  3.754   -21.383 1.00 0.00 ? 2  SER A O    11 
ATOM 11785 C CB   . SER A 1 1  ? 0.813   1.570   -21.107 1.00 0.00 ? 2  SER A CB   11 
ATOM 11786 O OG   . SER A 1 1  ? 1.127   2.836   -20.541 1.00 0.00 ? 2  SER A OG   11 
ATOM 11787 H H    . SER A 1 1  ? -0.037  3.404   -23.391 1.00 0.00 ? 2  SER A H    11 
ATOM 11788 H HA   . SER A 1 1  ? -0.737  0.753   -22.347 1.00 0.00 ? 2  SER A HA   11 
ATOM 11789 H HB2  . SER A 1 1  ? 0.540   0.887   -20.319 1.00 0.00 ? 2  SER A HB2  11 
ATOM 11790 H HB3  . SER A 1 1  ? 1.670   1.180   -21.639 1.00 0.00 ? 2  SER A HB3  11 
ATOM 11791 H HG   . SER A 1 1  ? 0.914   3.511   -21.189 1.00 0.00 ? 2  SER A HG   11 
ATOM 11792 N N    . ASP A 1 2  ? -2.454  1.877   -20.860 1.00 0.00 ? 3  ASP A N    11 
ATOM 11793 C CA   . ASP A 1 2  ? -3.567  2.608   -20.192 1.00 0.00 ? 3  ASP A CA   11 
ATOM 11794 C C    . ASP A 1 2  ? -3.281  2.722   -18.692 1.00 0.00 ? 3  ASP A C    11 
ATOM 11795 O O    . ASP A 1 2  ? -2.700  3.685   -18.233 1.00 0.00 ? 3  ASP A O    11 
ATOM 11796 C CB   . ASP A 1 2  ? -4.876  1.845   -20.407 1.00 0.00 ? 3  ASP A CB   11 
ATOM 11797 C CG   . ASP A 1 2  ? -5.240  1.865   -21.892 1.00 0.00 ? 3  ASP A CG   11 
ATOM 11798 O OD1  . ASP A 1 2  ? -4.941  2.854   -22.542 1.00 0.00 ? 3  ASP A OD1  11 
ATOM 11799 O OD2  . ASP A 1 2  ? -5.811  0.891   -22.354 1.00 0.00 ? 3  ASP A OD2  11 
ATOM 11800 H H    . ASP A 1 2  ? -2.461  0.898   -20.891 1.00 0.00 ? 3  ASP A H    11 
ATOM 11801 H HA   . ASP A 1 2  ? -3.654  3.597   -20.618 1.00 0.00 ? 3  ASP A HA   11 
ATOM 11802 H HB2  . ASP A 1 2  ? -4.753  0.823   -20.079 1.00 0.00 ? 3  ASP A HB2  11 
ATOM 11803 H HB3  . ASP A 1 2  ? -5.663  2.315   -19.838 1.00 0.00 ? 3  ASP A HB3  11 
ATOM 11804 N N    . LYS A 1 3  ? -3.687  1.747   -17.924 1.00 0.00 ? 4  LYS A N    11 
ATOM 11805 C CA   . LYS A 1 3  ? -3.439  1.805   -16.456 1.00 0.00 ? 4  LYS A CA   11 
ATOM 11806 C C    . LYS A 1 3  ? -2.174  1.004   -16.117 1.00 0.00 ? 4  LYS A C    11 
ATOM 11807 O O    . LYS A 1 3  ? -1.959  -0.064  -16.656 1.00 0.00 ? 4  LYS A O    11 
ATOM 11808 C CB   . LYS A 1 3  ? -4.635  1.203   -15.712 1.00 0.00 ? 4  LYS A CB   11 
ATOM 11809 C CG   . LYS A 1 3  ? -4.480  1.438   -14.208 1.00 0.00 ? 4  LYS A CG   11 
ATOM 11810 C CD   . LYS A 1 3  ? -5.616  0.734   -13.462 1.00 0.00 ? 4  LYS A CD   11 
ATOM 11811 C CE   . LYS A 1 3  ? -6.959  1.299   -13.927 1.00 0.00 ? 4  LYS A CE   11 
ATOM 11812 N NZ   . LYS A 1 3  ? -7.534  0.410   -14.975 1.00 0.00 ? 4  LYS A NZ   11 
ATOM 11813 H H    . LYS A 1 3  ? -4.156  0.979   -18.313 1.00 0.00 ? 4  LYS A H    11 
ATOM 11814 H HA   . LYS A 1 3  ? -3.311  2.833   -16.156 1.00 0.00 ? 4  LYS A HA   11 
ATOM 11815 H HB2  . LYS A 1 3  ? -5.546  1.671   -16.058 1.00 0.00 ? 4  LYS A HB2  11 
ATOM 11816 H HB3  . LYS A 1 3  ? -4.681  0.142   -15.905 1.00 0.00 ? 4  LYS A HB3  11 
ATOM 11817 H HG2  . LYS A 1 3  ? -3.531  1.042   -13.877 1.00 0.00 ? 4  LYS A HG2  11 
ATOM 11818 H HG3  . LYS A 1 3  ? -4.520  2.498   -14.003 1.00 0.00 ? 4  LYS A HG3  11 
ATOM 11819 H HD2  . LYS A 1 3  ? -5.579  -0.326  -13.669 1.00 0.00 ? 4  LYS A HD2  11 
ATOM 11820 H HD3  . LYS A 1 3  ? -5.505  0.898   -12.400 1.00 0.00 ? 4  LYS A HD3  11 
ATOM 11821 H HE2  . LYS A 1 3  ? -7.638  1.352   -13.088 1.00 0.00 ? 4  LYS A HE2  11 
ATOM 11822 H HE3  . LYS A 1 3  ? -6.813  2.289   -14.334 1.00 0.00 ? 4  LYS A HE3  11 
ATOM 11823 H HZ1  . LYS A 1 3  ? -7.661  -0.546  -14.588 1.00 0.00 ? 4  LYS A HZ1  11 
ATOM 11824 H HZ2  . LYS A 1 3  ? -8.455  0.783   -15.280 1.00 0.00 ? 4  LYS A HZ2  11 
ATOM 11825 H HZ3  . LYS A 1 3  ? -6.887  0.372   -15.789 1.00 0.00 ? 4  LYS A HZ3  11 
ATOM 11826 N N    . PRO A 1 4  ? -1.373  1.545   -15.232 1.00 0.00 ? 5  PRO A N    11 
ATOM 11827 C CA   . PRO A 1 4  ? -0.122  0.910   -14.795 1.00 0.00 ? 5  PRO A CA   11 
ATOM 11828 C C    . PRO A 1 4  ? -0.383  -0.207  -13.788 1.00 0.00 ? 5  PRO A C    11 
ATOM 11829 O O    . PRO A 1 4  ? -1.447  -0.306  -13.210 1.00 0.00 ? 5  PRO A O    11 
ATOM 11830 C CB   . PRO A 1 4  ? 0.658   2.036   -14.147 1.00 0.00 ? 5  PRO A CB   11 
ATOM 11831 C CG   . PRO A 1 4  ? -0.373  3.102   -13.752 1.00 0.00 ? 5  PRO A CG   11 
ATOM 11832 C CD   . PRO A 1 4  ? -1.638  2.841   -14.587 1.00 0.00 ? 5  PRO A CD   11 
ATOM 11833 H HA   . PRO A 1 4  ? 0.427   0.551   -15.626 1.00 0.00 ? 5  PRO A HA   11 
ATOM 11834 H HB2  . PRO A 1 4  ? 1.174   1.666   -13.271 1.00 0.00 ? 5  PRO A HB2  11 
ATOM 11835 H HB3  . PRO A 1 4  ? 1.361   2.447   -14.851 1.00 0.00 ? 5  PRO A HB3  11 
ATOM 11836 H HG2  . PRO A 1 4  ? -0.595  3.015   -12.704 1.00 0.00 ? 5  PRO A HG2  11 
ATOM 11837 H HG3  . PRO A 1 4  ? 0.014   4.074   -13.978 1.00 0.00 ? 5  PRO A HG3  11 
ATOM 11838 H HD2  . PRO A 1 4  ? -2.508  2.779   -13.947 1.00 0.00 ? 5  PRO A HD2  11 
ATOM 11839 H HD3  . PRO A 1 4  ? -1.765  3.610   -15.333 1.00 0.00 ? 5  PRO A HD3  11 
ATOM 11840 N N    . LYS A 1 5  ? 0.592   -1.039  -13.571 1.00 0.00 ? 6  LYS A N    11 
ATOM 11841 C CA   . LYS A 1 5  ? 0.423   -2.147  -12.593 1.00 0.00 ? 6  LYS A CA   11 
ATOM 11842 C C    . LYS A 1 5  ? 0.478   -1.574  -11.176 1.00 0.00 ? 6  LYS A C    11 
ATOM 11843 O O    . LYS A 1 5  ? 1.387   -0.849  -10.826 1.00 0.00 ? 6  LYS A O    11 
ATOM 11844 C CB   . LYS A 1 5  ? 1.539   -3.168  -12.779 1.00 0.00 ? 6  LYS A CB   11 
ATOM 11845 C CG   . LYS A 1 5  ? 2.897   -2.495  -12.569 1.00 0.00 ? 6  LYS A CG   11 
ATOM 11846 C CD   . LYS A 1 5  ? 3.980   -3.307  -13.282 1.00 0.00 ? 6  LYS A CD   11 
ATOM 11847 C CE   . LYS A 1 5  ? 4.773   -2.391  -14.218 1.00 0.00 ? 6  LYS A CE   11 
ATOM 11848 N NZ   . LYS A 1 5  ? 5.431   -1.317  -13.421 1.00 0.00 ? 6  LYS A NZ   11 
ATOM 11849 H H    . LYS A 1 5  ? 1.442   -0.926  -14.046 1.00 0.00 ? 6  LYS A H    11 
ATOM 11850 H HA   . LYS A 1 5  ? -0.526  -2.629  -12.753 1.00 0.00 ? 6  LYS A HA   11 
ATOM 11851 H HB2  . LYS A 1 5  ? 1.413   -3.963  -12.060 1.00 0.00 ? 6  LYS A HB2  11 
ATOM 11852 H HB3  . LYS A 1 5  ? 1.486   -3.571  -13.776 1.00 0.00 ? 6  LYS A HB3  11 
ATOM 11853 H HG2  . LYS A 1 5  ? 2.869   -1.494  -12.975 1.00 0.00 ? 6  LYS A HG2  11 
ATOM 11854 H HG3  . LYS A 1 5  ? 3.118   -2.451  -11.514 1.00 0.00 ? 6  LYS A HG3  11 
ATOM 11855 H HD2  . LYS A 1 5  ? 4.646   -3.739  -12.549 1.00 0.00 ? 6  LYS A HD2  11 
ATOM 11856 H HD3  . LYS A 1 5  ? 3.519   -4.094  -13.859 1.00 0.00 ? 6  LYS A HD3  11 
ATOM 11857 H HE2  . LYS A 1 5  ? 5.525   -2.969  -14.733 1.00 0.00 ? 6  LYS A HE2  11 
ATOM 11858 H HE3  . LYS A 1 5  ? 4.103   -1.947  -14.938 1.00 0.00 ? 6  LYS A HE3  11 
ATOM 11859 H HZ1  . LYS A 1 5  ? 4.803   -1.026  -12.644 1.00 0.00 ? 6  LYS A HZ1  11 
ATOM 11860 H HZ2  . LYS A 1 5  ? 6.326   -1.676  -13.030 1.00 0.00 ? 6  LYS A HZ2  11 
ATOM 11861 H HZ3  . LYS A 1 5  ? 5.623   -0.499  -14.033 1.00 0.00 ? 6  LYS A HZ3  11 
ATOM 11862 N N    . ARG A 1 6  ? -0.494  -1.881  -10.362 1.00 0.00 ? 7  ARG A N    11 
ATOM 11863 C CA   . ARG A 1 6  ? -0.497  -1.338  -8.976  1.00 0.00 ? 7  ARG A CA   11 
ATOM 11864 C C    . ARG A 1 6  ? 0.493   -2.122  -8.100  1.00 0.00 ? 7  ARG A C    11 
ATOM 11865 O O    . ARG A 1 6  ? 0.651   -3.315  -8.261  1.00 0.00 ? 7  ARG A O    11 
ATOM 11866 C CB   . ARG A 1 6  ? -1.904  -1.456  -8.385  1.00 0.00 ? 7  ARG A CB   11 
ATOM 11867 C CG   . ARG A 1 6  ? -2.307  -2.929  -8.305  1.00 0.00 ? 7  ARG A CG   11 
ATOM 11868 C CD   . ARG A 1 6  ? -3.721  -3.103  -8.863  1.00 0.00 ? 7  ARG A CD   11 
ATOM 11869 N NE   . ARG A 1 6  ? -3.699  -4.103  -9.966  1.00 0.00 ? 7  ARG A NE   11 
ATOM 11870 C CZ   . ARG A 1 6  ? -4.198  -3.799  -11.133 1.00 0.00 ? 7  ARG A CZ   11 
ATOM 11871 N NH1  . ARG A 1 6  ? -5.254  -3.035  -11.212 1.00 0.00 ? 7  ARG A NH1  11 
ATOM 11872 N NH2  . ARG A 1 6  ? -3.644  -4.258  -12.222 1.00 0.00 ? 7  ARG A NH2  11 
ATOM 11873 H H    . ARG A 1 6  ? -1.224  -2.459  -10.664 1.00 0.00 ? 7  ARG A H    11 
ATOM 11874 H HA   . ARG A 1 6  ? -0.209  -0.298  -9.004  1.00 0.00 ? 7  ARG A HA   11 
ATOM 11875 H HB2  . ARG A 1 6  ? -1.915  -1.025  -7.395  1.00 0.00 ? 7  ARG A HB2  11 
ATOM 11876 H HB3  . ARG A 1 6  ? -2.604  -0.928  -9.015  1.00 0.00 ? 7  ARG A HB3  11 
ATOM 11877 H HG2  . ARG A 1 6  ? -1.614  -3.523  -8.884  1.00 0.00 ? 7  ARG A HG2  11 
ATOM 11878 H HG3  . ARG A 1 6  ? -2.286  -3.252  -7.275  1.00 0.00 ? 7  ARG A HG3  11 
ATOM 11879 H HD2  . ARG A 1 6  ? -4.377  -3.447  -8.078  1.00 0.00 ? 7  ARG A HD2  11 
ATOM 11880 H HD3  . ARG A 1 6  ? -4.077  -2.157  -9.242  1.00 0.00 ? 7  ARG A HD3  11 
ATOM 11881 H HE   . ARG A 1 6  ? -3.308  -4.990  -9.817  1.00 0.00 ? 7  ARG A HE   11 
ATOM 11882 H HH11 . ARG A 1 6  ? -5.680  -2.682  -10.378 1.00 0.00 ? 7  ARG A HH11 11 
ATOM 11883 H HH12 . ARG A 1 6  ? -5.636  -2.800  -12.106 1.00 0.00 ? 7  ARG A HH12 11 
ATOM 11884 H HH21 . ARG A 1 6  ? -2.837  -4.845  -12.162 1.00 0.00 ? 7  ARG A HH21 11 
ATOM 11885 H HH22 . ARG A 1 6  ? -4.026  -4.023  -13.116 1.00 0.00 ? 7  ARG A HH22 11 
ATOM 11886 N N    . PRO A 1 7  ? 1.123   -1.416  -7.192  1.00 0.00 ? 8  PRO A N    11 
ATOM 11887 C CA   . PRO A 1 7  ? 2.103   -2.001  -6.254  1.00 0.00 ? 8  PRO A CA   11 
ATOM 11888 C C    . PRO A 1 7  ? 1.400   -2.843  -5.182  1.00 0.00 ? 8  PRO A C    11 
ATOM 11889 O O    . PRO A 1 7