data_1HS6
# 
_entry.id   1HS6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HS6         
RCSB  RCSB012557   
WWPDB D_1000012557 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HS6 
_pdbx_database_status.recvd_initial_deposition_date   2000-12-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Thunnissen, M.M.G.M.' 1 
'Nordlund, P.N.'       2 
'Haeggstrom, J.Z.'     3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human leukotriene A(4) hydrolase, a bifunctional enzyme in inflammation.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                131 
_citation.page_last                 135 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11175901 
_citation.pdbx_database_id_DOI      10.1038/84117 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Thunnissen, M.M.' 1 ? 
primary 'Nordlund, P.'     2 ? 
primary 'Haeggstrom, J.Z.' 3 ? 
# 
_cell.entry_id           1HS6 
_cell.length_a           67.6 
_cell.length_b           133.5 
_cell.length_c           83.4 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HS6 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'LEUKOTRIENE A-4 HYDROLASE'                                           69363.969 1   3.3.2.6 ? ? ? 
2 non-polymer syn 'ZINC ION'                                                            65.409    1   ?       ? ? ? 
3 non-polymer syn 'YTTERBIUM (III) ION'                                                 173.040   3   ?       ? ? ? 
4 non-polymer syn 'ACETATE ION'                                                         59.044    1   ?       ? ? ? 
5 non-polymer syn '2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID' 308.373   1   ?       ? ? ? 
6 non-polymer syn IMIDAZOLE                                                             69.085    1   ?       ? ? ? 
7 water       nat water                                                                 18.015    551 ?       ? ? ? 
# 
_entity_name_com.entity_id   5 
_entity_name_com.name        BESTATIN 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQ
SYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAE
VSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEG
HTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG
PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQ
SYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAE
VSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEG
HTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG
PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLU n 
1 4   ILE n 
1 5   VAL n 
1 6   ASP n 
1 7   THR n 
1 8   CYS n 
1 9   SER n 
1 10  LEU n 
1 11  ALA n 
1 12  SER n 
1 13  PRO n 
1 14  ALA n 
1 15  SER n 
1 16  VAL n 
1 17  CYS n 
1 18  ARG n 
1 19  THR n 
1 20  LYS n 
1 21  HIS n 
1 22  LEU n 
1 23  HIS n 
1 24  LEU n 
1 25  ARG n 
1 26  CYS n 
1 27  SER n 
1 28  VAL n 
1 29  ASP n 
1 30  PHE n 
1 31  THR n 
1 32  ARG n 
1 33  ARG n 
1 34  THR n 
1 35  LEU n 
1 36  THR n 
1 37  GLY n 
1 38  THR n 
1 39  ALA n 
1 40  ALA n 
1 41  LEU n 
1 42  THR n 
1 43  VAL n 
1 44  GLN n 
1 45  SER n 
1 46  GLN n 
1 47  GLU n 
1 48  ASP n 
1 49  ASN n 
1 50  LEU n 
1 51  ARG n 
1 52  SER n 
1 53  LEU n 
1 54  VAL n 
1 55  LEU n 
1 56  ASP n 
1 57  THR n 
1 58  LYS n 
1 59  ASP n 
1 60  LEU n 
1 61  THR n 
1 62  ILE n 
1 63  GLU n 
1 64  LYS n 
1 65  VAL n 
1 66  VAL n 
1 67  ILE n 
1 68  ASN n 
1 69  GLY n 
1 70  GLN n 
1 71  GLU n 
1 72  VAL n 
1 73  LYS n 
1 74  TYR n 
1 75  ALA n 
1 76  LEU n 
1 77  GLY n 
1 78  GLU n 
1 79  ARG n 
1 80  GLN n 
1 81  SER n 
1 82  TYR n 
1 83  LYS n 
1 84  GLY n 
1 85  SER n 
1 86  PRO n 
1 87  MET n 
1 88  GLU n 
1 89  ILE n 
1 90  SER n 
1 91  LEU n 
1 92  PRO n 
1 93  ILE n 
1 94  ALA n 
1 95  LEU n 
1 96  SER n 
1 97  LYS n 
1 98  ASN n 
1 99  GLN n 
1 100 GLU n 
1 101 ILE n 
1 102 VAL n 
1 103 ILE n 
1 104 GLU n 
1 105 ILE n 
1 106 SER n 
1 107 PHE n 
1 108 GLU n 
1 109 THR n 
1 110 SER n 
1 111 PRO n 
1 112 LYS n 
1 113 SER n 
1 114 SER n 
1 115 ALA n 
1 116 LEU n 
1 117 GLN n 
1 118 TRP n 
1 119 LEU n 
1 120 THR n 
1 121 PRO n 
1 122 GLU n 
1 123 GLN n 
1 124 THR n 
1 125 SER n 
1 126 GLY n 
1 127 LYS n 
1 128 GLU n 
1 129 HIS n 
1 130 PRO n 
1 131 TYR n 
1 132 LEU n 
1 133 PHE n 
1 134 SER n 
1 135 GLN n 
1 136 CYS n 
1 137 GLN n 
1 138 ALA n 
1 139 ILE n 
1 140 HIS n 
1 141 CYS n 
1 142 ARG n 
1 143 ALA n 
1 144 ILE n 
1 145 LEU n 
1 146 PRO n 
1 147 CYS n 
1 148 GLN n 
1 149 ASP n 
1 150 THR n 
1 151 PRO n 
1 152 SER n 
1 153 VAL n 
1 154 LYS n 
1 155 LEU n 
1 156 THR n 
1 157 TYR n 
1 158 THR n 
1 159 ALA n 
1 160 GLU n 
1 161 VAL n 
1 162 SER n 
1 163 VAL n 
1 164 PRO n 
1 165 LYS n 
1 166 GLU n 
1 167 LEU n 
1 168 VAL n 
1 169 ALA n 
1 170 LEU n 
1 171 MET n 
1 172 SER n 
1 173 ALA n 
1 174 ILE n 
1 175 ARG n 
1 176 ASP n 
1 177 GLY n 
1 178 GLU n 
1 179 THR n 
1 180 PRO n 
1 181 ASP n 
1 182 PRO n 
1 183 GLU n 
1 184 ASP n 
1 185 PRO n 
1 186 SER n 
1 187 ARG n 
1 188 LYS n 
1 189 ILE n 
1 190 TYR n 
1 191 LYS n 
1 192 PHE n 
1 193 ILE n 
1 194 GLN n 
1 195 LYS n 
1 196 VAL n 
1 197 PRO n 
1 198 ILE n 
1 199 PRO n 
1 200 CYS n 
1 201 TYR n 
1 202 LEU n 
1 203 ILE n 
1 204 ALA n 
1 205 LEU n 
1 206 VAL n 
1 207 VAL n 
1 208 GLY n 
1 209 ALA n 
1 210 LEU n 
1 211 GLU n 
1 212 SER n 
1 213 ARG n 
1 214 GLN n 
1 215 ILE n 
1 216 GLY n 
1 217 PRO n 
1 218 ARG n 
1 219 THR n 
1 220 LEU n 
1 221 VAL n 
1 222 TRP n 
1 223 SER n 
1 224 GLU n 
1 225 LYS n 
1 226 GLU n 
1 227 GLN n 
1 228 VAL n 
1 229 GLU n 
1 230 LYS n 
1 231 SER n 
1 232 ALA n 
1 233 TYR n 
1 234 GLU n 
1 235 PHE n 
1 236 SER n 
1 237 GLU n 
1 238 THR n 
1 239 GLU n 
1 240 SER n 
1 241 MET n 
1 242 LEU n 
1 243 LYS n 
1 244 ILE n 
1 245 ALA n 
1 246 GLU n 
1 247 ASP n 
1 248 LEU n 
1 249 GLY n 
1 250 GLY n 
1 251 PRO n 
1 252 TYR n 
1 253 VAL n 
1 254 TRP n 
1 255 GLY n 
1 256 GLN n 
1 257 TYR n 
1 258 ASP n 
1 259 LEU n 
1 260 LEU n 
1 261 VAL n 
1 262 LEU n 
1 263 PRO n 
1 264 PRO n 
1 265 SER n 
1 266 PHE n 
1 267 PRO n 
1 268 TYR n 
1 269 GLY n 
1 270 GLY n 
1 271 MET n 
1 272 GLU n 
1 273 ASN n 
1 274 PRO n 
1 275 CYS n 
1 276 LEU n 
1 277 THR n 
1 278 PHE n 
1 279 VAL n 
1 280 THR n 
1 281 PRO n 
1 282 THR n 
1 283 LEU n 
1 284 LEU n 
1 285 ALA n 
1 286 GLY n 
1 287 ASP n 
1 288 LYS n 
1 289 SER n 
1 290 LEU n 
1 291 SER n 
1 292 ASN n 
1 293 VAL n 
1 294 ILE n 
1 295 ALA n 
1 296 HIS n 
1 297 GLU n 
1 298 ILE n 
1 299 SER n 
1 300 HIS n 
1 301 SER n 
1 302 TRP n 
1 303 THR n 
1 304 GLY n 
1 305 ASN n 
1 306 LEU n 
1 307 VAL n 
1 308 THR n 
1 309 ASN n 
1 310 LYS n 
1 311 THR n 
1 312 TRP n 
1 313 ASP n 
1 314 HIS n 
1 315 PHE n 
1 316 TRP n 
1 317 LEU n 
1 318 ASN n 
1 319 GLU n 
1 320 GLY n 
1 321 HIS n 
1 322 THR n 
1 323 VAL n 
1 324 TYR n 
1 325 LEU n 
1 326 GLU n 
1 327 ARG n 
1 328 HIS n 
1 329 ILE n 
1 330 CYS n 
1 331 GLY n 
1 332 ARG n 
1 333 LEU n 
1 334 PHE n 
1 335 GLY n 
1 336 GLU n 
1 337 LYS n 
1 338 PHE n 
1 339 ARG n 
1 340 HIS n 
1 341 PHE n 
1 342 ASN n 
1 343 ALA n 
1 344 LEU n 
1 345 GLY n 
1 346 GLY n 
1 347 TRP n 
1 348 GLY n 
1 349 GLU n 
1 350 LEU n 
1 351 GLN n 
1 352 ASN n 
1 353 SER n 
1 354 VAL n 
1 355 LYS n 
1 356 THR n 
1 357 PHE n 
1 358 GLY n 
1 359 GLU n 
1 360 THR n 
1 361 HIS n 
1 362 PRO n 
1 363 PHE n 
1 364 THR n 
1 365 LYS n 
1 366 LEU n 
1 367 VAL n 
1 368 VAL n 
1 369 ASP n 
1 370 LEU n 
1 371 THR n 
1 372 ASP n 
1 373 ILE n 
1 374 ASP n 
1 375 PRO n 
1 376 ASP n 
1 377 VAL n 
1 378 ALA n 
1 379 TYR n 
1 380 SER n 
1 381 SER n 
1 382 VAL n 
1 383 PRO n 
1 384 TYR n 
1 385 GLU n 
1 386 LYS n 
1 387 GLY n 
1 388 PHE n 
1 389 ALA n 
1 390 LEU n 
1 391 LEU n 
1 392 PHE n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 GLN n 
1 397 LEU n 
1 398 LEU n 
1 399 GLY n 
1 400 GLY n 
1 401 PRO n 
1 402 GLU n 
1 403 ILE n 
1 404 PHE n 
1 405 LEU n 
1 406 GLY n 
1 407 PHE n 
1 408 LEU n 
1 409 LYS n 
1 410 ALA n 
1 411 TYR n 
1 412 VAL n 
1 413 GLU n 
1 414 LYS n 
1 415 PHE n 
1 416 SER n 
1 417 TYR n 
1 418 LYS n 
1 419 SER n 
1 420 ILE n 
1 421 THR n 
1 422 THR n 
1 423 ASP n 
1 424 ASP n 
1 425 TRP n 
1 426 LYS n 
1 427 ASP n 
1 428 PHE n 
1 429 LEU n 
1 430 TYR n 
1 431 SER n 
1 432 TYR n 
1 433 PHE n 
1 434 LYS n 
1 435 ASP n 
1 436 LYS n 
1 437 VAL n 
1 438 ASP n 
1 439 VAL n 
1 440 LEU n 
1 441 ASN n 
1 442 GLN n 
1 443 VAL n 
1 444 ASP n 
1 445 TRP n 
1 446 ASN n 
1 447 ALA n 
1 448 TRP n 
1 449 LEU n 
1 450 TYR n 
1 451 SER n 
1 452 PRO n 
1 453 GLY n 
1 454 LEU n 
1 455 PRO n 
1 456 PRO n 
1 457 ILE n 
1 458 LYS n 
1 459 PRO n 
1 460 ASN n 
1 461 TYR n 
1 462 ASP n 
1 463 MET n 
1 464 THR n 
1 465 LEU n 
1 466 THR n 
1 467 ASN n 
1 468 ALA n 
1 469 CYS n 
1 470 ILE n 
1 471 ALA n 
1 472 LEU n 
1 473 SER n 
1 474 GLN n 
1 475 ARG n 
1 476 TRP n 
1 477 ILE n 
1 478 THR n 
1 479 ALA n 
1 480 LYS n 
1 481 GLU n 
1 482 ASP n 
1 483 ASP n 
1 484 LEU n 
1 485 ASN n 
1 486 SER n 
1 487 PHE n 
1 488 ASN n 
1 489 ALA n 
1 490 THR n 
1 491 ASP n 
1 492 LEU n 
1 493 LYS n 
1 494 ASP n 
1 495 LEU n 
1 496 SER n 
1 497 SER n 
1 498 HIS n 
1 499 GLN n 
1 500 LEU n 
1 501 ASN n 
1 502 GLU n 
1 503 PHE n 
1 504 LEU n 
1 505 ALA n 
1 506 GLN n 
1 507 THR n 
1 508 LEU n 
1 509 GLN n 
1 510 ARG n 
1 511 ALA n 
1 512 PRO n 
1 513 LEU n 
1 514 PRO n 
1 515 LEU n 
1 516 GLY n 
1 517 HIS n 
1 518 ILE n 
1 519 LYS n 
1 520 ARG n 
1 521 MET n 
1 522 GLN n 
1 523 GLU n 
1 524 VAL n 
1 525 TYR n 
1 526 ASN n 
1 527 PHE n 
1 528 ASN n 
1 529 ALA n 
1 530 ILE n 
1 531 ASN n 
1 532 ASN n 
1 533 SER n 
1 534 GLU n 
1 535 ILE n 
1 536 ARG n 
1 537 PHE n 
1 538 ARG n 
1 539 TRP n 
1 540 LEU n 
1 541 ARG n 
1 542 LEU n 
1 543 CYS n 
1 544 ILE n 
1 545 GLN n 
1 546 SER n 
1 547 LYS n 
1 548 TRP n 
1 549 GLU n 
1 550 ASP n 
1 551 ALA n 
1 552 ILE n 
1 553 PRO n 
1 554 LEU n 
1 555 ALA n 
1 556 LEU n 
1 557 LYS n 
1 558 MET n 
1 559 ALA n 
1 560 THR n 
1 561 GLU n 
1 562 GLN n 
1 563 GLY n 
1 564 ARG n 
1 565 MET n 
1 566 LYS n 
1 567 PHE n 
1 568 THR n 
1 569 ARG n 
1 570 PRO n 
1 571 LEU n 
1 572 PHE n 
1 573 LYS n 
1 574 ASP n 
1 575 LEU n 
1 576 ALA n 
1 577 ALA n 
1 578 PHE n 
1 579 ASP n 
1 580 LYS n 
1 581 SER n 
1 582 HIS n 
1 583 ASP n 
1 584 GLN n 
1 585 ALA n 
1 586 VAL n 
1 587 ARG n 
1 588 THR n 
1 589 TYR n 
1 590 GLN n 
1 591 GLU n 
1 592 HIS n 
1 593 LYS n 
1 594 ALA n 
1 595 SER n 
1 596 MET n 
1 597 HIS n 
1 598 PRO n 
1 599 VAL n 
1 600 THR n 
1 601 ALA n 
1 602 MET n 
1 603 LEU n 
1 604 VAL n 
1 605 GLY n 
1 606 LYS n 
1 607 ASP n 
1 608 LEU n 
1 609 LYS n 
1 610 VAL n 
1 611 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PT3-MB4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LKHA4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P09960 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HS6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 611 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09960 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  611 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       610 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                                         ?        'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                                                               ?        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                              ?        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                            ?        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                       ?        'C4 H7 N O4'     133.103 
BES non-polymer         . '2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID' BESTATIN 'C16 H24 N2 O4'  308.373 
CYS 'L-peptide linking' y CYSTEINE                                                              ?        'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                             ?        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                       ?        'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                               ?        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                             ?        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                 ?        'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                            ?        'C6 H13 N O2'    131.173 
IMD non-polymer         . IMIDAZOLE                                                             ?        'C3 H5 N2 1'     69.085  
LEU 'L-peptide linking' y LEUCINE                                                               ?        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                ?        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                            ?        'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                         ?        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                               ?        'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                ?        'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                             ?        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                            ?        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                              ?        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                ?        'C5 H11 N O2'    117.146 
YB  non-polymer         . 'YTTERBIUM (III) ION'                                                 ?        'Yb 3'           173.040 
ZN  non-polymer         . 'ZINC ION'                                                            ?        'Zn 2'           65.409  
# 
_exptl.entry_id          1HS6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.71 
_exptl_crystal.density_percent_sol   54.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'PEG8000, imidazole, sodium acetate, ytterbium chloride, bestatin, pH 6.8, LIQUID DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-07-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.992  1.0 
2 1.3838 1.0 
3 1.3842 1.0 
4 0.8856 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.992, 1.3838, 1.3842, 0.8856' 
# 
_reflns.entry_id                     1HS6 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             34 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   54827 
_reflns.number_all                   54827 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            0.0430000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.59 
_reflns.B_iso_Wilson_estimate        20.906 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.05 
_reflns_shell.percent_possible_all   89.6 
_reflns_shell.Rmerge_I_obs           0.1860000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1HS6 
_refine.ls_number_reflns_obs                     54827 
_refine.ls_number_reflns_all                     54827 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             25 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1850000 
_refine.ls_R_factor_all                          0.1850000 
_refine.ls_R_factor_R_work                       0.1880000 
_refine.ls_R_factor_R_free                       0.2470000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2460 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4876 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             551 
_refine_hist.number_atoms_total               5462 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        25 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.2   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1HS6 
_struct.title                     'STRUCTURE OF LEUKOTRIENE A4 HYDROLASE COMPLEXED WITH BESTATIN.' 
_struct.pdbx_descriptor           
'LEUKOTRIENE A-4 HYDROLASE(E.C.3.3.2.6), 2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID, IMIDAZOLE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HS6 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'protein-inhibitor complex, alpha-beta protein, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 80  ? GLY A 84  ? GLN A 79  GLY A 83  5 ? 5  
HELX_P HELX_P2  2  THR A 120 ? THR A 124 ? THR A 119 THR A 123 5 ? 5  
HELX_P HELX_P3  3  HIS A 140 ? ILE A 144 ? HIS A 139 ILE A 143 5 ? 5  
HELX_P HELX_P4  4  PRO A 199 ? ILE A 203 ? PRO A 198 ILE A 202 5 ? 5  
HELX_P HELX_P5  5  LYS A 225 ? PHE A 235 ? LYS A 224 PHE A 234 1 ? 11 
HELX_P HELX_P6  6  GLU A 237 ? GLY A 250 ? GLU A 236 GLY A 249 1 ? 14 
HELX_P HELX_P7  7  PRO A 281 ? LEU A 284 ? PRO A 280 LEU A 283 5 ? 4  
HELX_P HELX_P8  8  SER A 291 ? SER A 301 ? SER A 290 SER A 300 1 ? 11 
HELX_P HELX_P9  9  THR A 311 ? ASP A 313 ? THR A 310 ASP A 312 5 ? 3  
HELX_P HELX_P10 10 HIS A 314 ? GLY A 335 ? HIS A 313 GLY A 334 1 ? 22 
HELX_P HELX_P11 11 GLY A 335 ? GLY A 358 ? GLY A 334 GLY A 357 1 ? 24 
HELX_P HELX_P12 12 HIS A 361 ? LYS A 365 ? HIS A 360 LYS A 364 5 ? 5  
HELX_P HELX_P13 13 ASP A 374 ? TYR A 379 ? ASP A 373 TYR A 378 1 ? 6  
HELX_P HELX_P14 14 SER A 381 ? LEU A 398 ? SER A 380 LEU A 397 1 ? 18 
HELX_P HELX_P15 15 GLY A 400 ? SER A 416 ? GLY A 399 SER A 415 1 ? 17 
HELX_P HELX_P16 16 THR A 421 ? PHE A 433 ? THR A 420 PHE A 432 1 ? 13 
HELX_P HELX_P17 17 LYS A 436 ? ASN A 441 ? LYS A 435 ASN A 440 1 ? 6  
HELX_P HELX_P18 18 ASP A 444 ? SER A 451 ? ASP A 443 SER A 450 1 ? 8  
HELX_P HELX_P19 19 THR A 466 ? THR A 478 ? THR A 465 THR A 477 1 ? 13 
HELX_P HELX_P20 20 LYS A 480 ? PHE A 487 ? LYS A 479 PHE A 486 5 ? 8  
HELX_P HELX_P21 21 ASN A 488 ? LYS A 493 ? ASN A 487 LYS A 492 5 ? 6  
HELX_P HELX_P22 22 SER A 496 ? GLN A 509 ? SER A 495 GLN A 508 1 ? 14 
HELX_P HELX_P23 23 PRO A 514 ? ASN A 526 ? PRO A 513 ASN A 525 1 ? 13 
HELX_P HELX_P24 24 PHE A 527 ? ILE A 530 ? PHE A 526 ILE A 529 5 ? 4  
HELX_P HELX_P25 25 ASN A 532 ? SER A 546 ? ASN A 531 SER A 545 1 ? 15 
HELX_P HELX_P26 26 ASP A 550 ? GLN A 562 ? ASP A 549 GLN A 561 1 ? 13 
HELX_P HELX_P27 27 ARG A 564 ? PHE A 578 ? ARG A 563 PHE A 577 1 ? 15 
HELX_P HELX_P28 28 SER A 581 ? LYS A 593 ? SER A 580 LYS A 592 1 ? 13 
HELX_P HELX_P29 29 ALA A 594 ? MET A 596 ? ALA A 593 MET A 595 5 ? 3  
HELX_P HELX_P30 30 HIS A 597 ? LYS A 609 ? HIS A 596 LYS A 608 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 108 OE1 ? ? ? 1_555 E YB  . YB ? ? A GLU 107 A YB  803  1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc2  metalc ? ? A GLU 108 OE2 ? ? ? 1_555 E YB  . YB ? ? A GLU 107 A YB  803  1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc3  metalc ? ? A HIS 296 NE2 ? ? ? 1_555 B ZN  . ZN ? ? A HIS 295 A ZN  701  1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc4  metalc ? ? A HIS 300 NE2 ? ? ? 1_555 B ZN  . ZN ? ? A HIS 299 A ZN  701  1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc5  metalc ? ? A GLU 319 OE1 ? ? ? 1_555 B ZN  . ZN ? ? A GLU 318 A ZN  701  1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc6  metalc ? ? A ASP 482 OD1 ? ? ? 1_555 C YB  . YB ? ? A ASP 481 A YB  801  1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc7  metalc ? ? A ASP 482 OD2 ? ? ? 1_555 C YB  . YB ? ? A ASP 481 A YB  801  1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc8  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 G BES . O2 ? ? A ZN  701 A BES 901  1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc9  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 G BES . O3 ? ? A ZN  701 A BES 901  1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc10 metalc ? ? C YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  801 A HOH 1260 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc11 metalc ? ? E YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  803 A HOH 1409 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc12 metalc ? ? A GLU 128 OE1 ? ? ? 1_555 E YB  . YB ? ? A GLU 127 A YB  803  2_565 ? ? ? ? ? ? ? 2.843 ? 
metalc13 metalc ? ? A GLU 128 OE2 ? ? ? 1_555 E YB  . YB ? ? A GLU 127 A YB  803  2_565 ? ? ? ? ? ? ? 2.880 ? 
metalc14 metalc ? ? A GLU 128 OE2 ? ? ? 1_555 D YB  . YB ? ? A GLU 127 A YB  802  2_565 ? ? ? ? ? ? ? 2.387 ? 
metalc15 metalc ? ? A ASP 423 OD1 ? ? ? 1_555 C YB  . YB ? ? A ASP 422 A YB  801  4_457 ? ? ? ? ? ? ? 2.405 ? 
metalc16 metalc ? ? A ASP 423 OD2 ? ? ? 1_555 C YB  . YB ? ? A ASP 422 A YB  801  4_457 ? ? ? ? ? ? ? 2.341 ? 
metalc17 metalc ? ? A ASP 427 OD1 ? ? ? 1_555 C YB  . YB ? ? A ASP 426 A YB  801  4_457 ? ? ? ? ? ? ? 2.490 ? 
metalc18 metalc ? ? A ASP 427 OD2 ? ? ? 1_555 C YB  . YB ? ? A ASP 426 A YB  801  4_457 ? ? ? ? ? ? ? 2.251 ? 
metalc19 metalc ? ? C YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  801 A HOH 1259 4_557 ? ? ? ? ? ? ? 2.287 ? 
metalc20 metalc ? ? C YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  801 A HOH 1290 4_557 ? ? ? ? ? ? ? 2.302 ? 
metalc21 metalc ? ? D YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  802 A HOH 1486 2_565 ? ? ? ? ? ? ? 3.159 ? 
metalc22 metalc ? ? E YB  .   YB  ? ? ? 1_555 I HOH . O  ? ? A YB  803 A HOH 1541 2_565 ? ? ? ? ? ? ? 2.255 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 137 A . ? GLN 136 A ALA 138 A ? ALA 137 A 1 1.09 
2 ALA 511 A . ? ALA 510 A PRO 512 A ? PRO 511 A 1 2.99 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 70  ? GLU A 71  ? GLN A 69  GLU A 70  
A 2 LEU A 60  ? ILE A 67  ? LEU A 59  ILE A 66  
A 3 GLU A 100 ? THR A 109 ? GLU A 99  THR A 108 
A 4 THR A 34  ? SER A 45  ? THR A 33  SER A 44  
A 5 CYS A 17  ? ASP A 29  ? CYS A 16  ASP A 28  
A 6 LEU A 155 ? PRO A 164 ? LEU A 154 PRO A 163 
A 7 ARG A 187 ? ILE A 198 ? ARG A 186 ILE A 197 
A 8 ILE A 174 ? PRO A 180 ? ILE A 173 PRO A 179 
B 1 LEU A 50  ? LEU A 55  ? LEU A 49  LEU A 54  
B 2 MET A 87  ? LEU A 95  ? MET A 86  LEU A 94  
B 3 TYR A 74  ? LEU A 76  ? TYR A 73  LEU A 75  
C 1 LEU A 116 ? LEU A 119 ? LEU A 115 LEU A 118 
C 2 TYR A 131 ? SER A 134 ? TYR A 130 SER A 133 
C 3 LEU A 205 ? GLY A 208 ? LEU A 204 GLY A 207 
C 4 VAL A 168 ? MET A 171 ? VAL A 167 MET A 170 
D 1 LEU A 210 ? GLY A 216 ? LEU A 209 GLY A 215 
D 2 THR A 219 ? GLU A 224 ? THR A 218 GLU A 223 
D 3 ASP A 258 ? VAL A 261 ? ASP A 257 VAL A 260 
D 4 LEU A 276 ? VAL A 279 ? LEU A 275 VAL A 278 
D 5 GLY A 270 ? MET A 271 ? GLY A 269 MET A 270 
E 1 VAL A 307 ? ASN A 309 ? VAL A 306 ASN A 308 
E 2 LYS A 418 ? ILE A 420 ? LYS A 417 ILE A 419 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 70  ? O GLN A 69  N ILE A 67  ? N ILE A 66  
A 2 3 O VAL A 66  ? O VAL A 65  N GLU A 104 ? N GLU A 103 
A 3 4 N THR A 109 ? N THR A 108 O LEU A 35  ? O LEU A 34  
A 4 5 N GLN A 44  ? N GLN A 43  O ARG A 18  ? O ARG A 17  
A 5 6 O LYS A 20  ? O LYS A 19  N THR A 156 ? N THR A 155 
A 6 7 O VAL A 163 ? O VAL A 162 N LYS A 188 ? N LYS A 187 
A 7 8 O ILE A 193 ? O ILE A 192 N ILE A 174 ? N ILE A 173 
B 1 2 O LEU A 55  ? O LEU A 54  N MET A 87  ? N MET A 86  
B 2 3 O GLU A 88  ? O GLU A 87  N ALA A 75  ? N ALA A 74  
C 1 2 N LEU A 119 ? N LEU A 118 O TYR A 131 ? O TYR A 130 
C 2 3 N SER A 134 ? N SER A 133 O LEU A 205 ? O LEU A 204 
C 3 4 O GLY A 208 ? O GLY A 207 N VAL A 168 ? N VAL A 167 
D 1 2 N ILE A 215 ? N ILE A 214 O THR A 219 ? O THR A 218 
D 2 3 N TRP A 222 ? N TRP A 221 O LEU A 259 ? O LEU A 258 
D 3 4 N LEU A 260 ? N LEU A 259 O THR A 277 ? O THR A 276 
D 4 5 N PHE A 278 ? N PHE A 277 O MET A 271 ? O MET A 270 
E 1 2 N THR A 308 ? N THR A 307 O LYS A 418 ? O LYS A 417 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 701'   
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE YB A 801'   
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE YB A 802'   
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE YB A 803'   
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 1101' 
AC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE BES A 901'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IMD A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 296 ? HIS A 295  . ? 1_555 ? 
2  AC1 4  HIS A 300 ? HIS A 299  . ? 1_555 ? 
3  AC1 4  GLU A 319 ? GLU A 318  . ? 1_555 ? 
4  AC1 4  BES G .   ? BES A 901  . ? 1_555 ? 
5  AC2 6  ASP A 423 ? ASP A 422  . ? 4_557 ? 
6  AC2 6  ASP A 427 ? ASP A 426  . ? 4_557 ? 
7  AC2 6  ASP A 482 ? ASP A 481  . ? 1_555 ? 
8  AC2 6  HOH I .   ? HOH A 1259 . ? 4_557 ? 
9  AC2 6  HOH I .   ? HOH A 1260 . ? 1_555 ? 
10 AC2 6  HOH I .   ? HOH A 1290 . ? 4_557 ? 
11 AC3 2  GLU A 128 ? GLU A 127  . ? 2_565 ? 
12 AC3 2  YB  E .   ? YB  A 803  . ? 1_555 ? 
13 AC4 5  GLU A 108 ? GLU A 107  . ? 1_555 ? 
14 AC4 5  GLU A 128 ? GLU A 127  . ? 2_565 ? 
15 AC4 5  YB  D .   ? YB  A 802  . ? 1_555 ? 
16 AC4 5  HOH I .   ? HOH A 1409 . ? 1_555 ? 
17 AC4 5  HOH I .   ? HOH A 1541 . ? 2_565 ? 
18 AC5 5  LYS A 426 ? LYS A 425  . ? 1_555 ? 
19 AC5 5  ASP A 427 ? ASP A 426  . ? 1_555 ? 
20 AC5 5  TYR A 430 ? TYR A 429  . ? 1_555 ? 
21 AC5 5  ASP A 482 ? ASP A 481  . ? 4_457 ? 
22 AC5 5  HOH I .   ? HOH A 1260 . ? 4_457 ? 
23 AC6 17 GLN A 135 ? GLN A 134  . ? 1_555 ? 
24 AC6 17 GLN A 137 ? GLN A 136  . ? 1_555 ? 
25 AC6 17 TYR A 268 ? TYR A 267  . ? 1_555 ? 
26 AC6 17 GLY A 269 ? GLY A 268  . ? 1_555 ? 
27 AC6 17 GLY A 270 ? GLY A 269  . ? 1_555 ? 
28 AC6 17 MET A 271 ? MET A 270  . ? 1_555 ? 
29 AC6 17 GLU A 272 ? GLU A 271  . ? 1_555 ? 
30 AC6 17 HIS A 296 ? HIS A 295  . ? 1_555 ? 
31 AC6 17 GLU A 297 ? GLU A 296  . ? 1_555 ? 
32 AC6 17 HIS A 300 ? HIS A 299  . ? 1_555 ? 
33 AC6 17 GLU A 319 ? GLU A 318  . ? 1_555 ? 
34 AC6 17 TYR A 379 ? TYR A 378  . ? 1_555 ? 
35 AC6 17 TYR A 384 ? TYR A 383  . ? 1_555 ? 
36 AC6 17 ZN  B .   ? ZN  A 701  . ? 1_555 ? 
37 AC6 17 HOH I .   ? HOH A 1178 . ? 1_555 ? 
38 AC6 17 HOH I .   ? HOH A 1295 . ? 1_555 ? 
39 AC6 17 HOH I .   ? HOH A 1347 . ? 1_555 ? 
40 AC7 6  GLY A 345 ? GLY A 344  . ? 1_555 ? 
41 AC7 6  GLY A 348 ? GLY A 347  . ? 1_555 ? 
42 AC7 6  GLU A 349 ? GLU A 348  . ? 1_555 ? 
43 AC7 6  GLU A 502 ? GLU A 501  . ? 1_555 ? 
44 AC7 6  ALA A 505 ? ALA A 504  . ? 1_555 ? 
45 AC7 6  GLN A 509 ? GLN A 508  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HS6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HS6 
_atom_sites.fract_transf_matrix[1][1]   0.014793 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007491 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011990 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
YB 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 2   ? -2.496  16.950 65.263  1.00 100.00 ? 1    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 2   ? -1.236  17.634 65.508  1.00 99.43  ? 1    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 2   ? -1.279  19.127 65.159  1.00 99.95  ? 1    PRO A C   1 
ATOM   4    O  O   . PRO A 1 2   ? -0.289  19.676 64.664  1.00 100.00 ? 1    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 2   ? -0.177  16.885 64.670  1.00 100.00 ? 1    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 2   ? -0.850  15.680 64.020  1.00 100.00 ? 1    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 2   ? -2.318  15.723 64.426  1.00 99.22  ? 1    PRO A CD  1 
ATOM   8    N  N   . GLU A 1 3   ? -2.412  19.789 65.446  1.00 90.69  ? 2    GLU A N   1 
ATOM   9    C  CA  . GLU A 1 3   ? -2.616  21.205 65.132  1.00 88.44  ? 2    GLU A CA  1 
ATOM   10   C  C   . GLU A 1 3   ? -1.945  22.313 65.960  1.00 86.73  ? 2    GLU A C   1 
ATOM   11   O  O   . GLU A 1 3   ? -2.129  22.438 67.174  1.00 88.87  ? 2    GLU A O   1 
ATOM   12   C  CB  . GLU A 1 3   ? -4.088  21.530 64.831  1.00 89.80  ? 2    GLU A CB  1 
ATOM   13   C  CG  . GLU A 1 3   ? -4.228  22.312 63.514  1.00 95.02  ? 2    GLU A CG  1 
ATOM   14   C  CD  . GLU A 1 3   ? -3.125  21.962 62.559  1.00 100.00 ? 2    GLU A CD  1 
ATOM   15   O  OE1 . GLU A 1 3   ? -2.011  22.486 62.601  1.00 70.64  ? 2    GLU A OE1 1 
ATOM   16   O  OE2 . GLU A 1 3   ? -3.487  21.008 61.722  1.00 83.56  ? 2    GLU A OE2 1 
ATOM   17   N  N   . ILE A 1 4   ? -1.177  23.171 65.274  1.00 73.36  ? 3    ILE A N   1 
ATOM   18   C  CA  . ILE A 1 4   ? -0.495  24.292 65.914  1.00 69.05  ? 3    ILE A CA  1 
ATOM   19   C  C   . ILE A 1 4   ? -1.215  25.619 65.639  1.00 60.01  ? 3    ILE A C   1 
ATOM   20   O  O   . ILE A 1 4   ? -1.489  25.975 64.480  1.00 56.74  ? 3    ILE A O   1 
ATOM   21   C  CB  . ILE A 1 4   ? 1.014   24.323 65.649  1.00 73.58  ? 3    ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 4   ? 1.560   25.747 65.693  1.00 73.27  ? 3    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 4   ? 1.360   23.656 64.319  1.00 79.61  ? 3    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 4   ? 3.062   25.814 65.946  1.00 75.66  ? 3    ILE A CD1 1 
ATOM   25   N  N   . VAL A 1 5   ? -1.530  26.333 66.734  1.00 46.96  ? 4    VAL A N   1 
ATOM   26   C  CA  . VAL A 1 5   ? -2.266  27.598 66.688  1.00 41.58  ? 4    VAL A CA  1 
ATOM   27   C  C   . VAL A 1 5   ? -1.472  28.880 66.873  1.00 30.92  ? 4    VAL A C   1 
ATOM   28   O  O   . VAL A 1 5   ? -0.723  29.061 67.838  1.00 28.33  ? 4    VAL A O   1 
ATOM   29   C  CB  . VAL A 1 5   ? -3.441  27.614 67.680  1.00 45.38  ? 4    VAL A CB  1 
ATOM   30   C  CG1 . VAL A 1 5   ? -4.362  28.831 67.511  1.00 44.59  ? 4    VAL A CG1 1 
ATOM   31   C  CG2 . VAL A 1 5   ? -4.271  26.359 67.495  1.00 45.63  ? 4    VAL A CG2 1 
ATOM   32   N  N   . ASP A 1 6   ? -1.727  29.798 65.947  1.00 22.16  ? 5    ASP A N   1 
ATOM   33   C  CA  . ASP A 1 6   ? -1.139  31.105 66.027  1.00 21.88  ? 5    ASP A CA  1 
ATOM   34   C  C   . ASP A 1 6   ? -2.103  31.939 66.842  1.00 25.15  ? 5    ASP A C   1 
ATOM   35   O  O   . ASP A 1 6   ? -3.064  32.490 66.346  1.00 21.09  ? 5    ASP A O   1 
ATOM   36   C  CB  . ASP A 1 6   ? -0.915  31.761 64.661  1.00 21.53  ? 5    ASP A CB  1 
ATOM   37   C  CG  . ASP A 1 6   ? -0.170  33.040 64.836  1.00 21.15  ? 5    ASP A CG  1 
ATOM   38   O  OD1 . ASP A 1 6   ? -0.200  33.672 65.879  1.00 23.73  ? 5    ASP A OD1 1 
ATOM   39   O  OD2 . ASP A 1 6   ? 0.484   33.404 63.754  1.00 18.74  ? 5    ASP A OD2 1 
ATOM   40   N  N   . THR A 1 7   ? -1.812  32.004 68.122  1.00 22.87  ? 6    THR A N   1 
ATOM   41   C  CA  . THR A 1 7   ? -2.614  32.733 69.039  1.00 17.86  ? 6    THR A CA  1 
ATOM   42   C  C   . THR A 1 7   ? -2.468  34.218 68.837  1.00 25.17  ? 6    THR A C   1 
ATOM   43   O  O   . THR A 1 7   ? -3.013  35.005 69.583  1.00 32.74  ? 6    THR A O   1 
ATOM   44   C  CB  . THR A 1 7   ? -2.366  32.263 70.467  1.00 28.19  ? 6    THR A CB  1 
ATOM   45   O  OG1 . THR A 1 7   ? -0.986  32.305 70.759  1.00 31.35  ? 6    THR A OG1 1 
ATOM   46   C  CG2 . THR A 1 7   ? -2.827  30.824 70.556  1.00 24.61  ? 6    THR A CG2 1 
ATOM   47   N  N   . CYS A 1 8   ? -1.756  34.657 67.824  1.00 19.01  ? 7    CYS A N   1 
ATOM   48   C  CA  . CYS A 1 8   ? -1.687  36.105 67.594  1.00 18.86  ? 7    CYS A CA  1 
ATOM   49   C  C   . CYS A 1 8   ? -2.514  36.534 66.364  1.00 27.36  ? 7    CYS A C   1 
ATOM   50   O  O   . CYS A 1 8   ? -2.589  37.717 66.031  1.00 24.81  ? 7    CYS A O   1 
ATOM   51   C  CB  . CYS A 1 8   ? -0.244  36.638 67.389  1.00 19.56  ? 7    CYS A CB  1 
ATOM   52   S  SG  . CYS A 1 8   ? 0.817   36.357 68.834  1.00 23.65  ? 7    CYS A SG  1 
ATOM   53   N  N   . SER A 1 9   ? -3.077  35.572 65.619  1.00 28.38  ? 8    SER A N   1 
ATOM   54   C  CA  . SER A 1 9   ? -3.820  35.920 64.408  1.00 25.64  ? 8    SER A CA  1 
ATOM   55   C  C   . SER A 1 9   ? -5.279  35.549 64.559  1.00 25.67  ? 8    SER A C   1 
ATOM   56   O  O   . SER A 1 9   ? -5.622  34.573 65.244  1.00 20.89  ? 8    SER A O   1 
ATOM   57   C  CB  . SER A 1 9   ? -3.286  35.203 63.175  1.00 27.58  ? 8    SER A CB  1 
ATOM   58   O  OG  . SER A 1 9   ? -4.110  35.477 62.050  1.00 26.21  ? 8    SER A OG  1 
ATOM   59   N  N   . LEU A 1 10  ? -6.127  36.354 63.928  1.00 23.57  ? 9    LEU A N   1 
ATOM   60   C  CA  . LEU A 1 10  ? -7.555  36.054 64.006  1.00 24.90  ? 9    LEU A CA  1 
ATOM   61   C  C   . LEU A 1 10  ? -8.006  35.381 62.706  1.00 26.66  ? 9    LEU A C   1 
ATOM   62   O  O   . LEU A 1 10  ? -9.114  34.912 62.612  1.00 28.44  ? 9    LEU A O   1 
ATOM   63   C  CB  . LEU A 1 10  ? -8.411  37.332 64.224  1.00 22.92  ? 9    LEU A CB  1 
ATOM   64   C  CG  . LEU A 1 10  ? -8.092  38.121 65.494  1.00 24.11  ? 9    LEU A CG  1 
ATOM   65   C  CD1 . LEU A 1 10  ? -8.997  39.353 65.644  1.00 25.94  ? 9    LEU A CD1 1 
ATOM   66   C  CD2 . LEU A 1 10  ? -8.302  37.203 66.698  1.00 16.04  ? 9    LEU A CD2 1 
ATOM   67   N  N   . ALA A 1 11  ? -7.137  35.392 61.699  1.00 23.67  ? 10   ALA A N   1 
ATOM   68   C  CA  . ALA A 1 11  ? -7.378  34.838 60.373  1.00 20.08  ? 10   ALA A CA  1 
ATOM   69   C  C   . ALA A 1 11  ? -7.559  33.342 60.324  1.00 23.49  ? 10   ALA A C   1 
ATOM   70   O  O   . ALA A 1 11  ? -7.321  32.597 61.261  1.00 22.41  ? 10   ALA A O   1 
ATOM   71   C  CB  . ALA A 1 11  ? -6.365  35.297 59.334  1.00 18.72  ? 10   ALA A CB  1 
ATOM   72   N  N   . SER A 1 12  ? -8.066  32.886 59.190  1.00 26.45  ? 11   SER A N   1 
ATOM   73   C  CA  . SER A 1 12  ? -8.239  31.460 59.014  1.00 27.04  ? 11   SER A CA  1 
ATOM   74   C  C   . SER A 1 12  ? -6.821  30.862 58.977  1.00 19.63  ? 11   SER A C   1 
ATOM   75   O  O   . SER A 1 12  ? -5.931  31.368 58.288  1.00 20.98  ? 11   SER A O   1 
ATOM   76   C  CB  . SER A 1 12  ? -8.972  31.228 57.683  1.00 34.23  ? 11   SER A CB  1 
ATOM   77   O  OG  . SER A 1 12  ? -10.377 31.332 57.861  1.00 36.98  ? 11   SER A OG  1 
ATOM   78   N  N   . PRO A 1 13  ? -6.609  29.777 59.689  1.00 20.69  ? 12   PRO A N   1 
ATOM   79   C  CA  . PRO A 1 13  ? -5.293  29.146 59.759  1.00 23.75  ? 12   PRO A CA  1 
ATOM   80   C  C   . PRO A 1 13  ? -4.838  28.466 58.479  1.00 32.70  ? 12   PRO A C   1 
ATOM   81   O  O   . PRO A 1 13  ? -5.628  28.213 57.566  1.00 34.79  ? 12   PRO A O   1 
ATOM   82   C  CB  . PRO A 1 13  ? -5.378  28.124 60.898  1.00 24.49  ? 12   PRO A CB  1 
ATOM   83   C  CG  . PRO A 1 13  ? -6.850  27.923 61.197  1.00 26.79  ? 12   PRO A CG  1 
ATOM   84   C  CD  . PRO A 1 13  ? -7.620  28.984 60.422  1.00 18.71  ? 12   PRO A CD  1 
ATOM   85   N  N   . ALA A 1 14  ? -3.542  28.158 58.424  1.00 28.05  ? 13   ALA A N   1 
ATOM   86   C  CA  . ALA A 1 14  ? -2.958  27.522 57.254  1.00 26.23  ? 13   ALA A CA  1 
ATOM   87   C  C   . ALA A 1 14  ? -3.575  26.147 56.955  1.00 22.95  ? 13   ALA A C   1 
ATOM   88   O  O   . ALA A 1 14  ? -3.463  25.623 55.868  1.00 25.46  ? 13   ALA A O   1 
ATOM   89   C  CB  . ALA A 1 14  ? -1.432  27.511 57.312  1.00 24.61  ? 13   ALA A CB  1 
ATOM   90   N  N   . SER A 1 15  ? -4.227  25.555 57.935  1.00 21.79  ? 14   SER A N   1 
ATOM   91   C  CA  . SER A 1 15  ? -4.840  24.254 57.758  1.00 23.68  ? 14   SER A CA  1 
ATOM   92   C  C   . SER A 1 15  ? -6.239  24.371 57.129  1.00 32.59  ? 14   SER A C   1 
ATOM   93   O  O   . SER A 1 15  ? -6.977  23.401 56.944  1.00 34.73  ? 14   SER A O   1 
ATOM   94   C  CB  . SER A 1 15  ? -4.921  23.533 59.102  1.00 26.34  ? 14   SER A CB  1 
ATOM   95   O  OG  . SER A 1 15  ? -5.722  24.269 60.022  1.00 28.63  ? 14   SER A OG  1 
ATOM   96   N  N   . VAL A 1 16  ? -6.632  25.589 56.814  1.00 28.74  ? 15   VAL A N   1 
ATOM   97   C  CA  . VAL A 1 16  ? -7.913  25.838 56.183  1.00 29.68  ? 15   VAL A CA  1 
ATOM   98   C  C   . VAL A 1 16  ? -7.714  26.415 54.790  1.00 28.85  ? 15   VAL A C   1 
ATOM   99   O  O   . VAL A 1 16  ? -8.284  25.983 53.793  1.00 30.55  ? 15   VAL A O   1 
ATOM   100  C  CB  . VAL A 1 16  ? -8.736  26.750 57.064  1.00 33.16  ? 15   VAL A CB  1 
ATOM   101  C  CG1 . VAL A 1 16  ? -9.867  27.390 56.256  1.00 32.75  ? 15   VAL A CG1 1 
ATOM   102  C  CG2 . VAL A 1 16  ? -9.232  25.957 58.267  1.00 30.08  ? 15   VAL A CG2 1 
ATOM   103  N  N   . CYS A 1 17  ? -6.856  27.406 54.714  1.00 22.64  ? 16   CYS A N   1 
ATOM   104  C  CA  . CYS A 1 17  ? -6.559  28.009 53.440  1.00 25.21  ? 16   CYS A CA  1 
ATOM   105  C  C   . CYS A 1 17  ? -5.237  28.693 53.559  1.00 29.42  ? 16   CYS A C   1 
ATOM   106  O  O   . CYS A 1 17  ? -4.779  28.929 54.690  1.00 29.35  ? 16   CYS A O   1 
ATOM   107  C  CB  . CYS A 1 17  ? -7.621  28.958 52.872  1.00 29.68  ? 16   CYS A CB  1 
ATOM   108  S  SG  . CYS A 1 17  ? -7.936  30.421 53.895  1.00 35.74  ? 16   CYS A SG  1 
ATOM   109  N  N   . ARG A 1 18  ? -4.637  28.959 52.405  1.00 23.28  ? 17   ARG A N   1 
ATOM   110  C  CA  . ARG A 1 18  ? -3.332  29.581 52.397  1.00 27.42  ? 17   ARG A CA  1 
ATOM   111  C  C   . ARG A 1 18  ? -3.224  30.603 51.288  1.00 29.92  ? 17   ARG A C   1 
ATOM   112  O  O   . ARG A 1 18  ? -3.516  30.317 50.133  1.00 30.00  ? 17   ARG A O   1 
ATOM   113  C  CB  . ARG A 1 18  ? -2.205  28.555 52.227  1.00 23.72  ? 17   ARG A CB  1 
ATOM   114  C  CG  . ARG A 1 18  ? -2.233  27.401 53.201  1.00 21.97  ? 17   ARG A CG  1 
ATOM   115  C  CD  . ARG A 1 18  ? -1.407  26.256 52.647  1.00 23.54  ? 17   ARG A CD  1 
ATOM   116  N  NE  . ARG A 1 18  ? -0.812  25.328 53.619  1.00 61.25  ? 17   ARG A NE  1 
ATOM   117  C  CZ  . ARG A 1 18  ? -1.432  24.397 54.351  1.00 74.57  ? 17   ARG A CZ  1 
ATOM   118  N  NH1 . ARG A 1 18  ? -2.727  24.196 54.302  1.00 81.15  ? 17   ARG A NH1 1 
ATOM   119  N  NH2 . ARG A 1 18  ? -0.734  23.629 55.172  1.00 66.19  ? 17   ARG A NH2 1 
ATOM   120  N  N   . THR A 1 19  ? -2.752  31.787 51.640  1.00 19.72  ? 18   THR A N   1 
ATOM   121  C  CA  . THR A 1 19  ? -2.591  32.805 50.644  1.00 16.81  ? 18   THR A CA  1 
ATOM   122  C  C   . THR A 1 19  ? -1.334  32.493 49.887  1.00 26.15  ? 18   THR A C   1 
ATOM   123  O  O   . THR A 1 19  ? -0.323  32.299 50.512  1.00 28.80  ? 18   THR A O   1 
ATOM   124  C  CB  . THR A 1 19  ? -2.466  34.204 51.296  1.00 25.57  ? 18   THR A CB  1 
ATOM   125  O  OG1 . THR A 1 19  ? -3.626  34.537 52.038  1.00 29.71  ? 18   THR A OG1 1 
ATOM   126  C  CG2 . THR A 1 19  ? -2.186  35.291 50.261  1.00 23.47  ? 18   THR A CG2 1 
ATOM   127  N  N   . LYS A 1 20  ? -1.361  32.518 48.568  1.00 23.41  ? 19   LYS A N   1 
ATOM   128  C  CA  . LYS A 1 20  ? -0.185  32.210 47.806  1.00 21.13  ? 19   LYS A CA  1 
ATOM   129  C  C   . LYS A 1 20  ? 0.459   33.389 47.154  1.00 22.88  ? 19   LYS A C   1 
ATOM   130  O  O   . LYS A 1 20  ? 1.643   33.365 46.806  1.00 26.65  ? 19   LYS A O   1 
ATOM   131  C  CB  . LYS A 1 20  ? -0.542  31.198 46.727  1.00 29.31  ? 19   LYS A CB  1 
ATOM   132  C  CG  . LYS A 1 20  ? -1.357  30.002 47.207  1.00 38.67  ? 19   LYS A CG  1 
ATOM   133  C  CD  . LYS A 1 20  ? -0.856  29.376 48.505  1.00 83.39  ? 19   LYS A CD  1 
ATOM   134  C  CE  . LYS A 1 20  ? 0.228   28.313 48.317  1.00 100.00 ? 19   LYS A CE  1 
ATOM   135  N  NZ  . LYS A 1 20  ? 0.082   27.127 49.186  1.00 95.09  ? 19   LYS A NZ  1 
ATOM   136  N  N   . HIS A 1 21  ? -0.334  34.419 46.949  1.00 19.69  ? 20   HIS A N   1 
ATOM   137  C  CA  . HIS A 1 21  ? 0.217   35.576 46.285  1.00 19.81  ? 20   HIS A CA  1 
ATOM   138  C  C   . HIS A 1 21  ? -0.586  36.810 46.644  1.00 28.29  ? 20   HIS A C   1 
ATOM   139  O  O   . HIS A 1 21  ? -1.767  36.712 47.018  1.00 30.86  ? 20   HIS A O   1 
ATOM   140  C  CB  . HIS A 1 21  ? 0.093   35.392 44.758  1.00 17.26  ? 20   HIS A CB  1 
ATOM   141  C  CG  . HIS A 1 21  ? 0.795   36.466 44.024  1.00 19.73  ? 20   HIS A CG  1 
ATOM   142  N  ND1 . HIS A 1 21  ? 2.171   36.455 43.885  1.00 22.73  ? 20   HIS A ND1 1 
ATOM   143  C  CD2 . HIS A 1 21  ? 0.305   37.600 43.437  1.00 20.99  ? 20   HIS A CD2 1 
ATOM   144  C  CE1 . HIS A 1 21  ? 2.491   37.554 43.201  1.00 21.23  ? 20   HIS A CE1 1 
ATOM   145  N  NE2 . HIS A 1 21  ? 1.386   38.269 42.903  1.00 20.99  ? 20   HIS A NE2 1 
ATOM   146  N  N   . LEU A 1 22  ? 0.073   37.954 46.508  1.00 25.18  ? 21   LEU A N   1 
ATOM   147  C  CA  . LEU A 1 22  ? -0.585  39.209 46.747  1.00 28.41  ? 21   LEU A CA  1 
ATOM   148  C  C   . LEU A 1 22  ? -0.211  40.147 45.656  1.00 28.28  ? 21   LEU A C   1 
ATOM   149  O  O   . LEU A 1 22  ? 0.974   40.321 45.363  1.00 26.48  ? 21   LEU A O   1 
ATOM   150  C  CB  . LEU A 1 22  ? -0.249  39.882 48.102  1.00 32.02  ? 21   LEU A CB  1 
ATOM   151  C  CG  . LEU A 1 22  ? -0.533  41.395 48.217  1.00 34.40  ? 21   LEU A CG  1 
ATOM   152  C  CD1 . LEU A 1 22  ? -1.979  41.712 48.615  1.00 30.29  ? 21   LEU A CD1 1 
ATOM   153  C  CD2 . LEU A 1 22  ? 0.389   42.000 49.268  1.00 32.78  ? 21   LEU A CD2 1 
ATOM   154  N  N   . HIS A 1 23  ? -1.244  40.728 45.062  1.00 28.64  ? 22   HIS A N   1 
ATOM   155  C  CA  . HIS A 1 23  ? -1.000  41.741 44.057  1.00 30.85  ? 22   HIS A CA  1 
ATOM   156  C  C   . HIS A 1 23  ? -1.517  43.012 44.701  1.00 30.38  ? 22   HIS A C   1 
ATOM   157  O  O   . HIS A 1 23  ? -2.696  43.102 45.056  1.00 30.58  ? 22   HIS A O   1 
ATOM   158  C  CB  . HIS A 1 23  ? -1.554  41.551 42.611  1.00 31.85  ? 22   HIS A CB  1 
ATOM   159  C  CG  . HIS A 1 23  ? -1.182  42.743 41.778  1.00 32.51  ? 22   HIS A CG  1 
ATOM   160  N  ND1 . HIS A 1 23  ? -2.120  43.577 41.209  1.00 35.74  ? 22   HIS A ND1 1 
ATOM   161  C  CD2 . HIS A 1 23  ? 0.035   43.261 41.489  1.00 36.85  ? 22   HIS A CD2 1 
ATOM   162  C  CE1 . HIS A 1 23  ? -1.463  44.545 40.580  1.00 36.22  ? 22   HIS A CE1 1 
ATOM   163  N  NE2 . HIS A 1 23  ? -0.152  44.400 40.736  1.00 37.12  ? 22   HIS A NE2 1 
ATOM   164  N  N   . LEU A 1 24  ? -0.583  43.938 44.898  1.00 29.56  ? 23   LEU A N   1 
ATOM   165  C  CA  . LEU A 1 24  ? -0.842  45.192 45.558  1.00 30.11  ? 23   LEU A CA  1 
ATOM   166  C  C   . LEU A 1 24  ? -0.590  46.398 44.661  1.00 32.22  ? 23   LEU A C   1 
ATOM   167  O  O   . LEU A 1 24  ? 0.486   46.685 44.121  1.00 32.37  ? 23   LEU A O   1 
ATOM   168  C  CB  . LEU A 1 24  ? -0.018  45.260 46.884  1.00 30.21  ? 23   LEU A CB  1 
ATOM   169  C  CG  . LEU A 1 24  ? -0.410  46.274 47.982  1.00 33.02  ? 23   LEU A CG  1 
ATOM   170  C  CD1 . LEU A 1 24  ? 0.663   47.343 48.117  1.00 32.82  ? 23   LEU A CD1 1 
ATOM   171  C  CD2 . LEU A 1 24  ? -1.745  46.956 47.745  1.00 38.23  ? 23   LEU A CD2 1 
ATOM   172  N  N   . ARG A 1 25  ? -1.656  47.133 44.534  1.00 34.49  ? 24   ARG A N   1 
ATOM   173  C  CA  . ARG A 1 25  ? -1.632  48.369 43.784  1.00 38.52  ? 24   ARG A CA  1 
ATOM   174  C  C   . ARG A 1 25  ? -2.194  49.370 44.783  1.00 40.35  ? 24   ARG A C   1 
ATOM   175  O  O   . ARG A 1 25  ? -3.268  49.139 45.369  1.00 36.87  ? 24   ARG A O   1 
ATOM   176  C  CB  . ARG A 1 25  ? -2.487  48.307 42.521  1.00 45.90  ? 24   ARG A CB  1 
ATOM   177  C  CG  . ARG A 1 25  ? -1.833  47.544 41.371  1.00 63.78  ? 24   ARG A CG  1 
ATOM   178  C  CD  . ARG A 1 25  ? -2.551  47.750 40.046  1.00 88.27  ? 24   ARG A CD  1 
ATOM   179  N  NE  . ARG A 1 25  ? -3.826  47.027 39.967  1.00 96.90  ? 24   ARG A NE  1 
ATOM   180  C  CZ  . ARG A 1 25  ? -5.046  47.558 40.154  1.00 100.00 ? 24   ARG A CZ  1 
ATOM   181  N  NH1 . ARG A 1 25  ? -5.263  48.853 40.383  1.00 100.00 ? 24   ARG A NH1 1 
ATOM   182  N  NH2 . ARG A 1 25  ? -6.104  46.743 40.069  1.00 100.00 ? 24   ARG A NH2 1 
ATOM   183  N  N   . CYS A 1 26  ? -1.426  50.431 45.031  1.00 39.47  ? 25   CYS A N   1 
ATOM   184  C  CA  . CYS A 1 26  ? -1.849  51.420 46.022  1.00 37.37  ? 25   CYS A CA  1 
ATOM   185  C  C   . CYS A 1 26  ? -1.146  52.736 45.798  1.00 36.83  ? 25   CYS A C   1 
ATOM   186  O  O   . CYS A 1 26  ? -0.142  52.824 45.066  1.00 33.74  ? 25   CYS A O   1 
ATOM   187  C  CB  . CYS A 1 26  ? -1.530  50.963 47.475  1.00 35.76  ? 25   CYS A CB  1 
ATOM   188  S  SG  . CYS A 1 26  ? 0.259   50.957 47.818  1.00 38.00  ? 25   CYS A SG  1 
ATOM   189  N  N   . SER A 1 27  ? -1.713  53.740 46.463  1.00 36.43  ? 26   SER A N   1 
ATOM   190  C  CA  . SER A 1 27  ? -1.142  55.075 46.417  1.00 38.33  ? 26   SER A CA  1 
ATOM   191  C  C   . SER A 1 27  ? -0.971  55.634 47.816  1.00 30.93  ? 26   SER A C   1 
ATOM   192  O  O   . SER A 1 27  ? -1.815  55.443 48.713  1.00 29.52  ? 26   SER A O   1 
ATOM   193  C  CB  . SER A 1 27  ? -1.828  56.089 45.502  1.00 49.53  ? 26   SER A CB  1 
ATOM   194  O  OG  . SER A 1 27  ? -0.941  57.173 45.231  1.00 58.28  ? 26   SER A OG  1 
ATOM   195  N  N   . VAL A 1 28  ? 0.151   56.326 47.925  1.00 30.23  ? 27   VAL A N   1 
ATOM   196  C  CA  . VAL A 1 28  ? 0.555   56.974 49.156  1.00 31.98  ? 27   VAL A CA  1 
ATOM   197  C  C   . VAL A 1 28  ? 0.120   58.438 49.259  1.00 34.81  ? 27   VAL A C   1 
ATOM   198  O  O   . VAL A 1 28  ? 0.708   59.320 48.614  1.00 36.20  ? 27   VAL A O   1 
ATOM   199  C  CB  . VAL A 1 28  ? 2.056   56.797 49.389  1.00 36.39  ? 27   VAL A CB  1 
ATOM   200  C  CG1 . VAL A 1 28  ? 2.402   57.292 50.802  1.00 36.16  ? 27   VAL A CG1 1 
ATOM   201  C  CG2 . VAL A 1 28  ? 2.392   55.309 49.226  1.00 34.26  ? 27   VAL A CG2 1 
ATOM   202  N  N   . ASP A 1 29  ? -0.915  58.693 50.070  1.00 32.47  ? 28   ASP A N   1 
ATOM   203  C  CA  . ASP A 1 29  ? -1.391  60.061 50.283  1.00 32.12  ? 28   ASP A CA  1 
ATOM   204  C  C   . ASP A 1 29  ? -0.872  60.655 51.590  1.00 29.94  ? 28   ASP A C   1 
ATOM   205  O  O   . ASP A 1 29  ? -1.385  60.375 52.668  1.00 27.16  ? 28   ASP A O   1 
ATOM   206  C  CB  . ASP A 1 29  ? -2.908  60.186 50.345  1.00 35.00  ? 28   ASP A CB  1 
ATOM   207  C  CG  . ASP A 1 29  ? -3.313  61.619 50.120  1.00 53.22  ? 28   ASP A CG  1 
ATOM   208  O  OD1 . ASP A 1 29  ? -2.651  62.584 50.471  1.00 49.41  ? 28   ASP A OD1 1 
ATOM   209  O  OD2 . ASP A 1 29  ? -4.427  61.711 49.443  1.00 71.15  ? 28   ASP A OD2 1 
ATOM   210  N  N   . PHE A 1 30  ? 0.151   61.476 51.445  1.00 26.90  ? 29   PHE A N   1 
ATOM   211  C  CA  . PHE A 1 30  ? 0.824   62.141 52.517  1.00 30.95  ? 29   PHE A CA  1 
ATOM   212  C  C   . PHE A 1 30  ? 0.030   63.292 53.087  1.00 46.44  ? 29   PHE A C   1 
ATOM   213  O  O   . PHE A 1 30  ? 0.319   63.796 54.155  1.00 49.29  ? 29   PHE A O   1 
ATOM   214  C  CB  . PHE A 1 30  ? 2.100   62.723 51.935  1.00 35.58  ? 29   PHE A CB  1 
ATOM   215  C  CG  . PHE A 1 30  ? 3.276   61.805 52.080  1.00 42.10  ? 29   PHE A CG  1 
ATOM   216  C  CD1 . PHE A 1 30  ? 3.676   61.428 53.360  1.00 46.10  ? 29   PHE A CD1 1 
ATOM   217  C  CD2 . PHE A 1 30  ? 3.981   61.318 50.978  1.00 48.22  ? 29   PHE A CD2 1 
ATOM   218  C  CE1 . PHE A 1 30  ? 4.765   60.586 53.561  1.00 44.91  ? 29   PHE A CE1 1 
ATOM   219  C  CE2 . PHE A 1 30  ? 5.073   60.468 51.159  1.00 52.10  ? 29   PHE A CE2 1 
ATOM   220  C  CZ  . PHE A 1 30  ? 5.465   60.115 52.451  1.00 47.34  ? 29   PHE A CZ  1 
ATOM   221  N  N   . THR A 1 31  ? -0.968  63.747 52.360  1.00 48.35  ? 30   THR A N   1 
ATOM   222  C  CA  . THR A 1 31  ? -1.739  64.842 52.861  1.00 45.84  ? 30   THR A CA  1 
ATOM   223  C  C   . THR A 1 31  ? -2.775  64.261 53.763  1.00 44.97  ? 30   THR A C   1 
ATOM   224  O  O   . THR A 1 31  ? -3.096  64.772 54.823  1.00 49.48  ? 30   THR A O   1 
ATOM   225  C  CB  . THR A 1 31  ? -2.404  65.608 51.725  1.00 55.54  ? 30   THR A CB  1 
ATOM   226  O  OG1 . THR A 1 31  ? -1.559  66.700 51.398  1.00 68.26  ? 30   THR A OG1 1 
ATOM   227  C  CG2 . THR A 1 31  ? -3.777  66.061 52.205  1.00 46.96  ? 30   THR A CG2 1 
ATOM   228  N  N   . ARG A 1 32  ? -3.283  63.147 53.323  1.00 32.80  ? 31   ARG A N   1 
ATOM   229  C  CA  . ARG A 1 32  ? -4.268  62.480 54.132  1.00 32.20  ? 31   ARG A CA  1 
ATOM   230  C  C   . ARG A 1 32  ? -3.634  61.456 55.067  1.00 32.13  ? 31   ARG A C   1 
ATOM   231  O  O   . ARG A 1 32  ? -4.409  60.864 55.817  1.00 25.23  ? 31   ARG A O   1 
ATOM   232  C  CB  . ARG A 1 32  ? -5.159  61.629 53.241  1.00 35.88  ? 31   ARG A CB  1 
ATOM   233  C  CG  . ARG A 1 32  ? -6.462  62.306 52.863  1.00 66.91  ? 31   ARG A CG  1 
ATOM   234  C  CD  . ARG A 1 32  ? -6.539  62.672 51.392  1.00 93.56  ? 31   ARG A CD  1 
ATOM   235  N  NE  . ARG A 1 32  ? -5.721  63.825 51.011  1.00 98.33  ? 31   ARG A NE  1 
ATOM   236  C  CZ  . ARG A 1 32  ? -6.218  64.857 50.328  1.00 89.65  ? 31   ARG A CZ  1 
ATOM   237  N  NH1 . ARG A 1 32  ? -7.498  64.895 49.977  1.00 51.14  ? 31   ARG A NH1 1 
ATOM   238  N  NH2 . ARG A 1 32  ? -5.436  65.878 49.985  1.00 74.59  ? 31   ARG A NH2 1 
ATOM   239  N  N   . ARG A 1 33  ? -2.297  61.231 54.941  1.00 31.30  ? 32   ARG A N   1 
ATOM   240  C  CA  . ARG A 1 33  ? -1.532  60.215 55.692  1.00 32.00  ? 32   ARG A CA  1 
ATOM   241  C  C   . ARG A 1 33  ? -2.237  58.877 55.522  1.00 35.90  ? 32   ARG A C   1 
ATOM   242  O  O   . ARG A 1 33  ? -2.616  58.213 56.497  1.00 26.95  ? 32   ARG A O   1 
ATOM   243  C  CB  . ARG A 1 33  ? -1.207  60.481 57.169  1.00 26.70  ? 32   ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 33  ? -1.154  61.960 57.566  1.00 62.26  ? 32   ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 33  ? 0.170   62.511 58.124  1.00 84.61  ? 32   ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 33  ? 0.480   62.134 59.510  1.00 72.60  ? 32   ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 33  ? 1.452   62.642 60.280  1.00 62.89  ? 32   ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 33  ? 2.263   63.606 59.881  1.00 47.22  ? 32   ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 33  ? 1.636   62.159 61.505  1.00 34.21  ? 32   ARG A NH2 1 
ATOM   250  N  N   . THR A 1 34  ? -2.450  58.522 54.252  1.00 32.05  ? 33   THR A N   1 
ATOM   251  C  CA  . THR A 1 34  ? -3.137  57.281 53.939  1.00 31.81  ? 33   THR A CA  1 
ATOM   252  C  C   . THR A 1 34  ? -2.518  56.516 52.788  1.00 38.17  ? 33   THR A C   1 
ATOM   253  O  O   . THR A 1 34  ? -1.863  57.045 51.884  1.00 40.95  ? 33   THR A O   1 
ATOM   254  C  CB  . THR A 1 34  ? -4.604  57.441 53.507  1.00 40.71  ? 33   THR A CB  1 
ATOM   255  O  OG1 . THR A 1 34  ? -4.727  58.394 52.471  1.00 49.59  ? 33   THR A OG1 1 
ATOM   256  C  CG2 . THR A 1 34  ? -5.598  57.635 54.638  1.00 36.31  ? 33   THR A CG2 1 
ATOM   257  N  N   . LEU A 1 35  ? -2.804  55.231 52.887  1.00 36.61  ? 34   LEU A N   1 
ATOM   258  C  CA  . LEU A 1 35  ? -2.446  54.238 51.916  1.00 37.65  ? 34   LEU A CA  1 
ATOM   259  C  C   . LEU A 1 35  ? -3.787  53.723 51.432  1.00 30.48  ? 34   LEU A C   1 
ATOM   260  O  O   . LEU A 1 35  ? -4.667  53.249 52.175  1.00 31.53  ? 34   LEU A O   1 
ATOM   261  C  CB  . LEU A 1 35  ? -1.595  53.099 52.497  1.00 39.99  ? 34   LEU A CB  1 
ATOM   262  C  CG  . LEU A 1 35  ? -0.159  53.091 52.033  1.00 44.09  ? 34   LEU A CG  1 
ATOM   263  C  CD1 . LEU A 1 35  ? 0.279   51.634 52.017  1.00 42.13  ? 34   LEU A CD1 1 
ATOM   264  C  CD2 . LEU A 1 35  ? -0.102  53.656 50.627  1.00 52.70  ? 34   LEU A CD2 1 
ATOM   265  N  N   . THR A 1 36  ? -3.963  53.889 50.149  1.00 29.30  ? 35   THR A N   1 
ATOM   266  C  CA  . THR A 1 36  ? -5.230  53.461 49.625  1.00 34.60  ? 35   THR A CA  1 
ATOM   267  C  C   . THR A 1 36  ? -5.039  52.558 48.420  1.00 39.30  ? 35   THR A C   1 
ATOM   268  O  O   . THR A 1 36  ? -4.116  52.754 47.594  1.00 36.72  ? 35   THR A O   1 
ATOM   269  C  CB  . THR A 1 36  ? -5.983  54.705 49.146  1.00 62.16  ? 35   THR A CB  1 
ATOM   270  O  OG1 . THR A 1 36  ? -6.129  55.655 50.184  1.00 63.09  ? 35   THR A OG1 1 
ATOM   271  C  CG2 . THR A 1 36  ? -7.320  54.270 48.569  1.00 67.46  ? 35   THR A CG2 1 
ATOM   272  N  N   . GLY A 1 37  ? -5.923  51.576 48.315  1.00 33.04  ? 36   GLY A N   1 
ATOM   273  C  CA  . GLY A 1 37  ? -5.736  50.731 47.162  1.00 32.58  ? 36   GLY A CA  1 
ATOM   274  C  C   . GLY A 1 37  ? -6.472  49.414 47.226  1.00 29.34  ? 36   GLY A C   1 
ATOM   275  O  O   . GLY A 1 37  ? -7.502  49.276 47.901  1.00 29.27  ? 36   GLY A O   1 
ATOM   276  N  N   . THR A 1 38  ? -5.871  48.454 46.512  1.00 29.27  ? 37   THR A N   1 
ATOM   277  C  CA  . THR A 1 38  ? -6.422  47.099 46.445  1.00 30.12  ? 37   THR A CA  1 
ATOM   278  C  C   . THR A 1 38  ? -5.399  46.039 46.733  1.00 27.15  ? 37   THR A C   1 
ATOM   279  O  O   . THR A 1 38  ? -4.260  46.093 46.280  1.00 29.53  ? 37   THR A O   1 
ATOM   280  C  CB  . THR A 1 38  ? -6.985  46.710 45.065  1.00 29.58  ? 37   THR A CB  1 
ATOM   281  O  OG1 . THR A 1 38  ? -6.019  47.050 44.078  1.00 35.41  ? 37   THR A OG1 1 
ATOM   282  C  CG2 . THR A 1 38  ? -8.267  47.478 44.850  1.00 34.18  ? 37   THR A CG2 1 
ATOM   283  N  N   . ALA A 1 39  ? -5.911  45.069 47.445  1.00 25.51  ? 38   ALA A N   1 
ATOM   284  C  CA  . ALA A 1 39  ? -5.117  43.938 47.811  1.00 28.59  ? 38   ALA A CA  1 
ATOM   285  C  C   . ALA A 1 39  ? -5.727  42.723 47.142  1.00 28.95  ? 38   ALA A C   1 
ATOM   286  O  O   . ALA A 1 39  ? -6.743  42.181 47.580  1.00 29.76  ? 38   ALA A O   1 
ATOM   287  C  CB  . ALA A 1 39  ? -5.053  43.783 49.332  1.00 28.09  ? 38   ALA A CB  1 
ATOM   288  N  N   . ALA A 1 40  ? -5.087  42.281 46.069  1.00 29.16  ? 39   ALA A N   1 
ATOM   289  C  CA  . ALA A 1 40  ? -5.595  41.098 45.400  1.00 28.96  ? 39   ALA A CA  1 
ATOM   290  C  C   . ALA A 1 40  ? -4.856  39.897 45.952  1.00 32.32  ? 39   ALA A C   1 
ATOM   291  O  O   . ALA A 1 40  ? -3.656  39.721 45.724  1.00 31.17  ? 39   ALA A O   1 
ATOM   292  C  CB  . ALA A 1 40  ? -5.360  41.169 43.908  1.00 28.71  ? 39   ALA A CB  1 
ATOM   293  N  N   . LEU A 1 41  ? -5.592  39.103 46.706  1.00 29.20  ? 40   LEU A N   1 
ATOM   294  C  CA  . LEU A 1 41  ? -5.003  37.945 47.317  1.00 30.98  ? 40   LEU A CA  1 
ATOM   295  C  C   . LEU A 1 41  ? -5.327  36.648 46.592  1.00 34.18  ? 40   LEU A C   1 
ATOM   296  O  O   . LEU A 1 41  ? -6.498  36.316 46.393  1.00 32.36  ? 40   LEU A O   1 
ATOM   297  C  CB  . LEU A 1 41  ? -5.554  37.761 48.760  1.00 31.07  ? 40   LEU A CB  1 
ATOM   298  C  CG  . LEU A 1 41  ? -5.397  38.943 49.718  1.00 31.64  ? 40   LEU A CG  1 
ATOM   299  C  CD1 . LEU A 1 41  ? -5.822  38.486 51.108  1.00 28.47  ? 40   LEU A CD1 1 
ATOM   300  C  CD2 . LEU A 1 41  ? -3.944  39.386 49.725  1.00 21.87  ? 40   LEU A CD2 1 
ATOM   301  N  N   . THR A 1 42  ? -4.311  35.861 46.263  1.00 30.21  ? 41   THR A N   1 
ATOM   302  C  CA  . THR A 1 42  ? -4.632  34.568 45.683  1.00 30.42  ? 41   THR A CA  1 
ATOM   303  C  C   . THR A 1 42  ? -4.602  33.586 46.837  1.00 35.30  ? 41   THR A C   1 
ATOM   304  O  O   . THR A 1 42  ? -3.571  33.422 47.482  1.00 34.05  ? 41   THR A O   1 
ATOM   305  C  CB  . THR A 1 42  ? -3.679  34.105 44.584  1.00 42.24  ? 41   THR A CB  1 
ATOM   306  O  OG1 . THR A 1 42  ? -3.701  35.078 43.562  1.00 39.08  ? 41   THR A OG1 1 
ATOM   307  C  CG2 . THR A 1 42  ? -4.097  32.709 44.090  1.00 29.36  ? 41   THR A CG2 1 
ATOM   308  N  N   . VAL A 1 43  ? -5.752  32.982 47.091  1.00 30.50  ? 42   VAL A N   1 
ATOM   309  C  CA  . VAL A 1 43  ? -5.944  32.058 48.180  1.00 30.58  ? 42   VAL A CA  1 
ATOM   310  C  C   . VAL A 1 43  ? -6.186  30.625 47.728  1.00 38.17  ? 42   VAL A C   1 
ATOM   311  O  O   . VAL A 1 43  ? -6.913  30.370 46.764  1.00 37.98  ? 42   VAL A O   1 
ATOM   312  C  CB  . VAL A 1 43  ? -7.074  32.551 49.091  1.00 31.60  ? 42   VAL A CB  1 
ATOM   313  C  CG1 . VAL A 1 43  ? -7.339  31.536 50.190  1.00 30.16  ? 42   VAL A CG1 1 
ATOM   314  C  CG2 . VAL A 1 43  ? -6.681  33.877 49.750  1.00 31.76  ? 42   VAL A CG2 1 
ATOM   315  N  N   . GLN A 1 44  ? -5.570  29.690 48.453  1.00 30.27  ? 43   GLN A N   1 
ATOM   316  C  CA  . GLN A 1 44  ? -5.721  28.291 48.163  1.00 28.24  ? 43   GLN A CA  1 
ATOM   317  C  C   . GLN A 1 44  ? -6.374  27.521 49.293  1.00 30.98  ? 43   GLN A C   1 
ATOM   318  O  O   . GLN A 1 44  ? -5.906  27.495 50.437  1.00 30.47  ? 43   GLN A O   1 
ATOM   319  C  CB  . GLN A 1 44  ? -4.376  27.685 47.751  1.00 30.68  ? 43   GLN A CB  1 
ATOM   320  C  CG  . GLN A 1 44  ? -4.447  26.152 47.645  1.00 44.61  ? 43   GLN A CG  1 
ATOM   321  C  CD  . GLN A 1 44  ? -3.066  25.550 47.505  1.00 49.18  ? 43   GLN A CD  1 
ATOM   322  O  OE1 . GLN A 1 44  ? -2.652  25.101 46.429  1.00 53.81  ? 43   GLN A OE1 1 
ATOM   323  N  NE2 . GLN A 1 44  ? -2.341  25.541 48.608  1.00 45.20  ? 43   GLN A NE2 1 
ATOM   324  N  N   . SER A 1 45  ? -7.497  26.882 48.985  1.00 25.18  ? 44   SER A N   1 
ATOM   325  C  CA  . SER A 1 45  ? -8.183  26.107 49.989  1.00 20.91  ? 44   SER A CA  1 
ATOM   326  C  C   . SER A 1 45  ? -7.415  24.853 50.329  1.00 32.88  ? 44   SER A C   1 
ATOM   327  O  O   . SER A 1 45  ? -6.657  24.358 49.493  1.00 35.47  ? 44   SER A O   1 
ATOM   328  C  CB  . SER A 1 45  ? -9.552  25.704 49.511  1.00 22.65  ? 44   SER A CB  1 
ATOM   329  O  OG  . SER A 1 45  ? -10.157 24.911 50.512  1.00 31.76  ? 44   SER A OG  1 
ATOM   330  N  N   . GLN A 1 46  ? -7.630  24.344 51.546  1.00 29.62  ? 45   GLN A N   1 
ATOM   331  C  CA  . GLN A 1 46  ? -7.006  23.114 52.035  1.00 30.38  ? 45   GLN A CA  1 
ATOM   332  C  C   . GLN A 1 46  ? -8.085  22.147 52.497  1.00 38.25  ? 45   GLN A C   1 
ATOM   333  O  O   . GLN A 1 46  ? -7.848  21.077 53.083  1.00 33.96  ? 45   GLN A O   1 
ATOM   334  C  CB  . GLN A 1 46  ? -6.126  23.384 53.276  1.00 30.97  ? 45   GLN A CB  1 
ATOM   335  C  CG  . GLN A 1 46  ? -5.209  24.589 53.105  1.00 19.22  ? 45   GLN A CG  1 
ATOM   336  C  CD  . GLN A 1 46  ? -4.264  24.414 51.939  1.00 44.80  ? 45   GLN A CD  1 
ATOM   337  O  OE1 . GLN A 1 46  ? -4.199  25.228 50.995  1.00 46.26  ? 45   GLN A OE1 1 
ATOM   338  N  NE2 . GLN A 1 46  ? -3.520  23.319 52.002  1.00 28.67  ? 45   GLN A NE2 1 
ATOM   339  N  N   . GLU A 1 47  ? -9.295  22.622 52.280  1.00 38.36  ? 46   GLU A N   1 
ATOM   340  C  CA  . GLU A 1 47  ? -10.494 21.931 52.674  1.00 41.96  ? 46   GLU A CA  1 
ATOM   341  C  C   . GLU A 1 47  ? -11.465 21.892 51.512  1.00 44.78  ? 46   GLU A C   1 
ATOM   342  O  O   . GLU A 1 47  ? -11.482 22.772 50.648  1.00 38.52  ? 46   GLU A O   1 
ATOM   343  C  CB  . GLU A 1 47  ? -11.225 22.681 53.828  1.00 44.36  ? 46   GLU A CB  1 
ATOM   344  C  CG  . GLU A 1 47  ? -10.440 22.959 55.132  1.00 56.09  ? 46   GLU A CG  1 
ATOM   345  C  CD  . GLU A 1 47  ? -11.309 23.520 56.226  1.00 70.52  ? 46   GLU A CD  1 
ATOM   346  O  OE1 . GLU A 1 47  ? -12.359 24.099 55.997  1.00 65.91  ? 46   GLU A OE1 1 
ATOM   347  O  OE2 . GLU A 1 47  ? -10.822 23.315 57.432  1.00 89.95  ? 46   GLU A OE2 1 
ATOM   348  N  N   . ASP A 1 48  ? -12.301 20.871 51.516  1.00 45.87  ? 47   ASP A N   1 
ATOM   349  C  CA  . ASP A 1 48  ? -13.287 20.831 50.474  1.00 49.24  ? 47   ASP A CA  1 
ATOM   350  C  C   . ASP A 1 48  ? -14.443 21.658 50.966  1.00 50.94  ? 47   ASP A C   1 
ATOM   351  O  O   . ASP A 1 48  ? -14.693 21.733 52.167  1.00 50.75  ? 47   ASP A O   1 
ATOM   352  C  CB  . ASP A 1 48  ? -13.770 19.400 50.251  1.00 53.61  ? 47   ASP A CB  1 
ATOM   353  C  CG  . ASP A 1 48  ? -12.685 18.588 49.621  1.00 74.24  ? 47   ASP A CG  1 
ATOM   354  O  OD1 . ASP A 1 48  ? -12.004 19.005 48.689  1.00 70.46  ? 47   ASP A OD1 1 
ATOM   355  O  OD2 . ASP A 1 48  ? -12.545 17.420 50.206  1.00 90.87  ? 47   ASP A OD2 1 
ATOM   356  N  N   . ASN A 1 49  ? -15.152 22.285 50.059  1.00 48.17  ? 48   ASN A N   1 
ATOM   357  C  CA  . ASN A 1 49  ? -16.290 23.066 50.491  1.00 48.03  ? 48   ASN A CA  1 
ATOM   358  C  C   . ASN A 1 49  ? -15.954 24.303 51.298  1.00 44.92  ? 48   ASN A C   1 
ATOM   359  O  O   . ASN A 1 49  ? -16.641 24.644 52.272  1.00 40.67  ? 48   ASN A O   1 
ATOM   360  C  CB  . ASN A 1 49  ? -17.289 22.225 51.310  1.00 44.29  ? 48   ASN A CB  1 
ATOM   361  C  CG  . ASN A 1 49  ? -18.688 22.771 51.105  1.00 86.53  ? 48   ASN A CG  1 
ATOM   362  O  OD1 . ASN A 1 49  ? -19.012 23.236 49.996  1.00 80.31  ? 48   ASN A OD1 1 
ATOM   363  N  ND2 . ASN A 1 49  ? -19.495 22.754 52.167  1.00 79.87  ? 48   ASN A ND2 1 
ATOM   364  N  N   . LEU A 1 50  ? -14.902 24.975 50.899  1.00 37.27  ? 49   LEU A N   1 
ATOM   365  C  CA  . LEU A 1 50  ? -14.575 26.165 51.639  1.00 35.59  ? 49   LEU A CA  1 
ATOM   366  C  C   . LEU A 1 50  ? -15.499 27.253 51.115  1.00 40.36  ? 49   LEU A C   1 
ATOM   367  O  O   . LEU A 1 50  ? -15.408 27.618 49.944  1.00 41.04  ? 49   LEU A O   1 
ATOM   368  C  CB  . LEU A 1 50  ? -13.075 26.504 51.519  1.00 33.17  ? 49   LEU A CB  1 
ATOM   369  C  CG  . LEU A 1 50  ? -12.645 27.780 52.244  1.00 36.35  ? 49   LEU A CG  1 
ATOM   370  C  CD1 . LEU A 1 50  ? -12.842 27.583 53.737  1.00 34.98  ? 49   LEU A CD1 1 
ATOM   371  C  CD2 . LEU A 1 50  ? -11.169 28.024 51.977  1.00 32.02  ? 49   LEU A CD2 1 
ATOM   372  N  N   . ARG A 1 51  ? -16.402 27.745 51.966  1.00 38.16  ? 50   ARG A N   1 
ATOM   373  C  CA  . ARG A 1 51  ? -17.343 28.785 51.541  1.00 40.98  ? 50   ARG A CA  1 
ATOM   374  C  C   . ARG A 1 51  ? -17.066 30.228 51.997  1.00 46.66  ? 50   ARG A C   1 
ATOM   375  O  O   . ARG A 1 51  ? -17.541 31.214 51.410  1.00 38.00  ? 50   ARG A O   1 
ATOM   376  C  CB  . ARG A 1 51  ? -18.744 28.339 51.902  1.00 46.12  ? 50   ARG A CB  1 
ATOM   377  C  CG  . ARG A 1 51  ? -19.238 27.266 50.932  1.00 61.10  ? 50   ARG A CG  1 
ATOM   378  C  CD  . ARG A 1 51  ? -20.306 26.345 51.511  1.00 75.76  ? 50   ARG A CD  1 
ATOM   379  N  NE  . ARG A 1 51  ? -20.745 25.322 50.554  1.00 100.00 ? 50   ARG A NE  1 
ATOM   380  C  CZ  . ARG A 1 51  ? -21.979 24.809 50.451  1.00 100.00 ? 50   ARG A CZ  1 
ATOM   381  N  NH1 . ARG A 1 51  ? -22.981 25.195 51.240  1.00 100.00 ? 50   ARG A NH1 1 
ATOM   382  N  NH2 . ARG A 1 51  ? -22.220 23.875 49.527  1.00 84.13  ? 50   ARG A NH2 1 
ATOM   383  N  N   . SER A 1 52  ? -16.271 30.339 53.066  1.00 50.16  ? 51   SER A N   1 
ATOM   384  C  CA  . SER A 1 52  ? -15.885 31.610 53.671  1.00 49.64  ? 51   SER A CA  1 
ATOM   385  C  C   . SER A 1 52  ? -14.550 31.540 54.403  1.00 47.77  ? 51   SER A C   1 
ATOM   386  O  O   . SER A 1 52  ? -14.207 30.522 55.029  1.00 42.04  ? 51   SER A O   1 
ATOM   387  C  CB  . SER A 1 52  ? -16.925 32.073 54.697  1.00 53.65  ? 51   SER A CB  1 
ATOM   388  O  OG  . SER A 1 52  ? -17.107 31.125 55.755  1.00 51.47  ? 51   SER A OG  1 
ATOM   389  N  N   . LEU A 1 53  ? -13.829 32.663 54.351  1.00 41.55  ? 52   LEU A N   1 
ATOM   390  C  CA  . LEU A 1 53  ? -12.575 32.757 55.087  1.00 40.56  ? 52   LEU A CA  1 
ATOM   391  C  C   . LEU A 1 53  ? -12.474 33.996 55.991  1.00 43.53  ? 52   LEU A C   1 
ATOM   392  O  O   . LEU A 1 53  ? -13.288 34.921 55.895  1.00 39.84  ? 52   LEU A O   1 
ATOM   393  C  CB  . LEU A 1 53  ? -11.291 32.385 54.325  1.00 39.23  ? 52   LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 53  ? -10.884 33.281 53.164  1.00 45.23  ? 52   LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 53  ? -11.692 32.934 51.927  1.00 47.83  ? 52   LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 53  ? -10.973 34.762 53.516  1.00 44.42  ? 52   LEU A CD2 1 
ATOM   397  N  N   . VAL A 1 54  ? -11.489 34.013 56.899  1.00 37.60  ? 53   VAL A N   1 
ATOM   398  C  CA  . VAL A 1 54  ? -11.289 35.157 57.773  1.00 32.60  ? 53   VAL A CA  1 
ATOM   399  C  C   . VAL A 1 54  ? -9.902  35.696 57.554  1.00 31.28  ? 53   VAL A C   1 
ATOM   400  O  O   . VAL A 1 54  ? -8.942  34.925 57.414  1.00 26.57  ? 53   VAL A O   1 
ATOM   401  C  CB  . VAL A 1 54  ? -11.527 34.916 59.258  1.00 34.90  ? 53   VAL A CB  1 
ATOM   402  C  CG1 . VAL A 1 54  ? -11.411 36.227 60.052  1.00 32.09  ? 53   VAL A CG1 1 
ATOM   403  C  CG2 . VAL A 1 54  ? -12.904 34.310 59.444  1.00 34.64  ? 53   VAL A CG2 1 
ATOM   404  N  N   . LEU A 1 55  ? -9.857  37.020 57.478  1.00 22.73  ? 54   LEU A N   1 
ATOM   405  C  CA  . LEU A 1 55  ? -8.634  37.730 57.325  1.00 21.84  ? 54   LEU A CA  1 
ATOM   406  C  C   . LEU A 1 55  ? -8.434  38.607 58.562  1.00 30.12  ? 54   LEU A C   1 
ATOM   407  O  O   . LEU A 1 55  ? -9.386  38.932 59.275  1.00 27.27  ? 54   LEU A O   1 
ATOM   408  C  CB  . LEU A 1 55  ? -8.642  38.619 56.097  1.00 23.04  ? 54   LEU A CB  1 
ATOM   409  C  CG  . LEU A 1 55  ? -8.545  37.839 54.796  1.00 29.10  ? 54   LEU A CG  1 
ATOM   410  C  CD1 . LEU A 1 55  ? -8.495  38.869 53.678  1.00 26.16  ? 54   LEU A CD1 1 
ATOM   411  C  CD2 . LEU A 1 55  ? -7.251  37.027 54.743  1.00 24.36  ? 54   LEU A CD2 1 
ATOM   412  N  N   . ASP A 1 56  ? -7.175  38.970 58.810  1.00 27.32  ? 55   ASP A N   1 
ATOM   413  C  CA  . ASP A 1 56  ? -6.807  39.843 59.910  1.00 24.82  ? 55   ASP A CA  1 
ATOM   414  C  C   . ASP A 1 56  ? -6.785  41.269 59.354  1.00 24.10  ? 55   ASP A C   1 
ATOM   415  O  O   . ASP A 1 56  ? -6.404  41.485 58.196  1.00 20.86  ? 55   ASP A O   1 
ATOM   416  C  CB  . ASP A 1 56  ? -5.390  39.545 60.475  1.00 23.73  ? 55   ASP A CB  1 
ATOM   417  C  CG  . ASP A 1 56  ? -5.197  38.294 61.291  1.00 16.69  ? 55   ASP A CG  1 
ATOM   418  O  OD1 . ASP A 1 56  ? -5.748  38.060 62.371  1.00 23.25  ? 55   ASP A OD1 1 
ATOM   419  O  OD2 . ASP A 1 56  ? -4.279  37.499 60.737  1.00 20.96  ? 55   ASP A OD2 1 
ATOM   420  N  N   . THR A 1 57  ? -7.203  42.241 60.199  1.00 24.09  ? 56   THR A N   1 
ATOM   421  C  CA  . THR A 1 57  ? -7.176  43.675 59.882  1.00 21.61  ? 56   THR A CA  1 
ATOM   422  C  C   . THR A 1 57  ? -6.990  44.475 61.175  1.00 20.13  ? 56   THR A C   1 
ATOM   423  O  O   . THR A 1 57  ? -7.355  44.035 62.254  1.00 18.34  ? 56   THR A O   1 
ATOM   424  C  CB  . THR A 1 57  ? -8.477  44.244 59.263  1.00 21.22  ? 56   THR A CB  1 
ATOM   425  O  OG1 . THR A 1 57  ? -9.507  44.197 60.246  1.00 22.90  ? 56   THR A OG1 1 
ATOM   426  C  CG2 . THR A 1 57  ? -8.831  43.494 57.987  1.00 21.74  ? 56   THR A CG2 1 
ATOM   427  N  N   . LYS A 1 58  ? -6.498  45.695 61.046  1.00 20.23  ? 57   LYS A N   1 
ATOM   428  C  CA  . LYS A 1 58  ? -6.428  46.501 62.242  1.00 19.81  ? 57   LYS A CA  1 
ATOM   429  C  C   . LYS A 1 58  ? -6.591  47.937 61.799  1.00 21.15  ? 57   LYS A C   1 
ATOM   430  O  O   . LYS A 1 58  ? -5.807  48.429 61.010  1.00 19.90  ? 57   LYS A O   1 
ATOM   431  C  CB  . LYS A 1 58  ? -5.124  46.230 62.926  1.00 24.68  ? 57   LYS A CB  1 
ATOM   432  C  CG  . LYS A 1 58  ? -4.922  46.928 64.262  1.00 40.66  ? 57   LYS A CG  1 
ATOM   433  C  CD  . LYS A 1 58  ? -3.439  47.032 64.609  1.00 42.93  ? 57   LYS A CD  1 
ATOM   434  C  CE  . LYS A 1 58  ? -3.141  46.702 66.060  1.00 75.78  ? 57   LYS A CE  1 
ATOM   435  N  NZ  . LYS A 1 58  ? -1.894  47.316 66.567  1.00 94.53  ? 57   LYS A NZ  1 
ATOM   436  N  N   . ASP A 1 59  ? -7.639  48.622 62.241  1.00 20.19  ? 58   ASP A N   1 
ATOM   437  C  CA  . ASP A 1 59  ? -7.788  49.989 61.784  1.00 17.85  ? 58   ASP A CA  1 
ATOM   438  C  C   . ASP A 1 59  ? -7.836  50.124 60.283  1.00 24.95  ? 58   ASP A C   1 
ATOM   439  O  O   . ASP A 1 59  ? -7.335  51.088 59.678  1.00 23.25  ? 58   ASP A O   1 
ATOM   440  C  CB  . ASP A 1 59  ? -6.780  50.959 62.402  1.00 21.68  ? 58   ASP A CB  1 
ATOM   441  C  CG  . ASP A 1 59  ? -7.118  50.982 63.856  1.00 36.83  ? 58   ASP A CG  1 
ATOM   442  O  OD1 . ASP A 1 59  ? -8.253  51.136 64.263  1.00 40.21  ? 58   ASP A OD1 1 
ATOM   443  O  OD2 . ASP A 1 59  ? -6.100  50.683 64.618  1.00 37.52  ? 58   ASP A OD2 1 
ATOM   444  N  N   . LEU A 1 60  ? -8.466  49.121 59.698  1.00 26.52  ? 59   LEU A N   1 
ATOM   445  C  CA  . LEU A 1 60  ? -8.615  49.130 58.259  1.00 29.86  ? 59   LEU A CA  1 
ATOM   446  C  C   . LEU A 1 60  ? -10.025 49.586 57.847  1.00 33.01  ? 59   LEU A C   1 
ATOM   447  O  O   . LEU A 1 60  ? -11.070 49.255 58.424  1.00 29.32  ? 59   LEU A O   1 
ATOM   448  C  CB  . LEU A 1 60  ? -8.196  47.789 57.588  1.00 29.02  ? 59   LEU A CB  1 
ATOM   449  C  CG  . LEU A 1 60  ? -6.682  47.520 57.589  1.00 29.22  ? 59   LEU A CG  1 
ATOM   450  C  CD1 . LEU A 1 60  ? -6.377  46.244 56.795  1.00 29.68  ? 59   LEU A CD1 1 
ATOM   451  C  CD2 . LEU A 1 60  ? -5.923  48.703 56.978  1.00 22.97  ? 59   LEU A CD2 1 
ATOM   452  N  N   . THR A 1 61  ? -10.029 50.399 56.819  1.00 36.77  ? 60   THR A N   1 
ATOM   453  C  CA  . THR A 1 61  ? -11.279 50.877 56.254  1.00 42.01  ? 60   THR A CA  1 
ATOM   454  C  C   . THR A 1 61  ? -11.494 50.092 54.940  1.00 36.44  ? 60   THR A C   1 
ATOM   455  O  O   . THR A 1 61  ? -10.694 50.247 53.992  1.00 33.67  ? 60   THR A O   1 
ATOM   456  C  CB  . THR A 1 61  ? -11.220 52.424 56.080  1.00 56.43  ? 60   THR A CB  1 
ATOM   457  O  OG1 . THR A 1 61  ? -11.614 53.107 57.261  1.00 52.66  ? 60   THR A OG1 1 
ATOM   458  C  CG2 . THR A 1 61  ? -12.034 52.910 54.893  1.00 60.41  ? 60   THR A CG2 1 
ATOM   459  N  N   . ILE A 1 62  ? -12.515 49.227 54.909  1.00 29.81  ? 61   ILE A N   1 
ATOM   460  C  CA  . ILE A 1 62  ? -12.779 48.432 53.711  1.00 32.79  ? 61   ILE A CA  1 
ATOM   461  C  C   . ILE A 1 62  ? -13.799 49.068 52.780  1.00 35.88  ? 61   ILE A C   1 
ATOM   462  O  O   . ILE A 1 62  ? -14.939 49.202 53.176  1.00 30.98  ? 61   ILE A O   1 
ATOM   463  C  CB  . ILE A 1 62  ? -13.337 47.038 53.972  1.00 37.74  ? 61   ILE A CB  1 
ATOM   464  C  CG1 . ILE A 1 62  ? -12.616 46.331 55.118  1.00 40.37  ? 61   ILE A CG1 1 
ATOM   465  C  CG2 . ILE A 1 62  ? -13.264 46.240 52.661  1.00 36.33  ? 61   ILE A CG2 1 
ATOM   466  C  CD1 . ILE A 1 62  ? -11.098 46.353 54.952  1.00 49.83  ? 61   ILE A CD1 1 
ATOM   467  N  N   . GLU A 1 63  ? -13.396 49.409 51.562  1.00 40.08  ? 62   GLU A N   1 
ATOM   468  C  CA  . GLU A 1 63  ? -14.276 49.995 50.553  1.00 43.04  ? 62   GLU A CA  1 
ATOM   469  C  C   . GLU A 1 63  ? -15.199 48.885 50.016  1.00 45.27  ? 62   GLU A C   1 
ATOM   470  O  O   . GLU A 1 63  ? -16.415 48.853 50.243  1.00 45.18  ? 62   GLU A O   1 
ATOM   471  C  CB  . GLU A 1 63  ? -13.392 50.640 49.457  1.00 45.63  ? 62   GLU A CB  1 
ATOM   472  C  CG  . GLU A 1 63  ? -14.131 51.580 48.471  1.00 73.11  ? 62   GLU A CG  1 
ATOM   473  C  CD  . GLU A 1 63  ? -14.846 50.895 47.320  1.00 100.00 ? 62   GLU A CD  1 
ATOM   474  O  OE1 . GLU A 1 63  ? -15.037 49.689 47.286  1.00 100.00 ? 62   GLU A OE1 1 
ATOM   475  O  OE2 . GLU A 1 63  ? -15.254 51.717 46.368  1.00 100.00 ? 62   GLU A OE2 1 
ATOM   476  N  N   . LYS A 1 64  ? -14.588 47.918 49.336  1.00 38.38  ? 63   LYS A N   1 
ATOM   477  C  CA  . LYS A 1 64  ? -15.311 46.761 48.838  1.00 37.37  ? 63   LYS A CA  1 
ATOM   478  C  C   . LYS A 1 64  ? -14.396 45.541 48.702  1.00 38.22  ? 63   LYS A C   1 
ATOM   479  O  O   . LYS A 1 64  ? -13.167 45.646 48.717  1.00 32.45  ? 63   LYS A O   1 
ATOM   480  C  CB  . LYS A 1 64  ? -16.022 47.038 47.530  1.00 33.09  ? 63   LYS A CB  1 
ATOM   481  C  CG  . LYS A 1 64  ? -15.051 47.059 46.366  1.00 27.59  ? 63   LYS A CG  1 
ATOM   482  C  CD  . LYS A 1 64  ? -15.548 47.905 45.207  1.00 37.24  ? 63   LYS A CD  1 
ATOM   483  C  CE  . LYS A 1 64  ? -14.443 48.583 44.423  1.00 43.28  ? 63   LYS A CE  1 
ATOM   484  N  NZ  . LYS A 1 64  ? -14.395 48.151 43.015  1.00 76.13  ? 63   LYS A NZ  1 
ATOM   485  N  N   . VAL A 1 65  ? -15.049 44.395 48.574  1.00 43.49  ? 64   VAL A N   1 
ATOM   486  C  CA  . VAL A 1 65  ? -14.436 43.081 48.377  1.00 45.64  ? 64   VAL A CA  1 
ATOM   487  C  C   . VAL A 1 65  ? -14.934 42.410 47.087  1.00 45.26  ? 64   VAL A C   1 
ATOM   488  O  O   . VAL A 1 65  ? -16.058 41.916 46.997  1.00 39.88  ? 64   VAL A O   1 
ATOM   489  C  CB  . VAL A 1 65  ? -14.689 42.140 49.543  1.00 48.77  ? 64   VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 65  ? -14.270 40.746 49.101  1.00 48.87  ? 64   VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 65  ? -13.861 42.572 50.742  1.00 47.38  ? 64   VAL A CG2 1 
ATOM   492  N  N   . VAL A 1 66  ? -14.096 42.380 46.077  1.00 39.08  ? 65   VAL A N   1 
ATOM   493  C  CA  . VAL A 1 66  ? -14.534 41.789 44.840  1.00 40.48  ? 65   VAL A CA  1 
ATOM   494  C  C   . VAL A 1 66  ? -13.908 40.457 44.527  1.00 37.21  ? 65   VAL A C   1 
ATOM   495  O  O   . VAL A 1 66  ? -12.717 40.294 44.730  1.00 33.83  ? 65   VAL A O   1 
ATOM   496  C  CB  . VAL A 1 66  ? -14.162 42.709 43.687  1.00 48.88  ? 65   VAL A CB  1 
ATOM   497  C  CG1 . VAL A 1 66  ? -14.416 42.025 42.352  1.00 47.68  ? 65   VAL A CG1 1 
ATOM   498  C  CG2 . VAL A 1 66  ? -14.946 44.014 43.767  1.00 51.54  ? 65   VAL A CG2 1 
ATOM   499  N  N   . ILE A 1 67  ? -14.733 39.568 43.977  1.00 32.25  ? 66   ILE A N   1 
ATOM   500  C  CA  . ILE A 1 67  ? -14.361 38.256 43.496  1.00 32.04  ? 66   ILE A CA  1 
ATOM   501  C  C   . ILE A 1 67  ? -15.071 37.989 42.163  1.00 44.56  ? 66   ILE A C   1 
ATOM   502  O  O   . ILE A 1 67  ? -16.316 38.027 42.049  1.00 42.61  ? 66   ILE A O   1 
ATOM   503  C  CB  . ILE A 1 67  ? -14.649 37.095 44.429  1.00 35.68  ? 66   ILE A CB  1 
ATOM   504  C  CG1 . ILE A 1 67  ? -14.193 37.374 45.860  1.00 35.96  ? 66   ILE A CG1 1 
ATOM   505  C  CG2 . ILE A 1 67  ? -13.875 35.912 43.866  1.00 35.65  ? 66   ILE A CG2 1 
ATOM   506  C  CD1 . ILE A 1 67  ? -14.692 36.339 46.860  1.00 26.89  ? 66   ILE A CD1 1 
ATOM   507  N  N   . ASN A 1 68  ? -14.261 37.702 41.147  1.00 46.77  ? 67   ASN A N   1 
ATOM   508  C  CA  . ASN A 1 68  ? -14.764 37.413 39.801  1.00 48.02  ? 67   ASN A CA  1 
ATOM   509  C  C   . ASN A 1 68  ? -15.601 38.568 39.297  1.00 51.70  ? 67   ASN A C   1 
ATOM   510  O  O   . ASN A 1 68  ? -16.753 38.371 38.923  1.00 51.19  ? 67   ASN A O   1 
ATOM   511  C  CB  . ASN A 1 68  ? -15.580 36.098 39.695  1.00 32.37  ? 67   ASN A CB  1 
ATOM   512  C  CG  . ASN A 1 68  ? -14.756 34.862 40.037  1.00 57.02  ? 67   ASN A CG  1 
ATOM   513  O  OD1 . ASN A 1 68  ? -13.549 34.796 39.721  1.00 42.45  ? 67   ASN A OD1 1 
ATOM   514  N  ND2 . ASN A 1 68  ? -15.389 33.889 40.714  1.00 45.38  ? 67   ASN A ND2 1 
ATOM   515  N  N   . GLY A 1 69  ? -15.000 39.757 39.327  1.00 45.47  ? 68   GLY A N   1 
ATOM   516  C  CA  . GLY A 1 69  ? -15.638 40.982 38.876  1.00 44.33  ? 68   GLY A CA  1 
ATOM   517  C  C   . GLY A 1 69  ? -16.870 41.394 39.669  1.00 52.05  ? 68   GLY A C   1 
ATOM   518  O  O   . GLY A 1 69  ? -17.456 42.442 39.422  1.00 60.14  ? 68   GLY A O   1 
ATOM   519  N  N   . GLN A 1 70  ? -17.280 40.591 40.630  1.00 45.36  ? 69   GLN A N   1 
ATOM   520  C  CA  . GLN A 1 70  ? -18.458 40.930 41.403  1.00 46.40  ? 69   GLN A CA  1 
ATOM   521  C  C   . GLN A 1 70  ? -18.156 41.109 42.894  1.00 57.29  ? 69   GLN A C   1 
ATOM   522  O  O   . GLN A 1 70  ? -17.404 40.355 43.525  1.00 55.55  ? 69   GLN A O   1 
ATOM   523  C  CB  . GLN A 1 70  ? -19.575 39.858 41.258  1.00 48.27  ? 69   GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 70  ? -20.184 39.636 39.841  1.00 33.05  ? 69   GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 70  ? -20.435 40.926 39.098  1.00 73.86  ? 69   GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 70  ? -19.771 41.195 38.074  1.00 70.10  ? 69   GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 70  ? -21.364 41.729 39.634  1.00 75.78  ? 69   GLN A NE2 1 
ATOM   528  N  N   . GLU A 1 71  ? -18.800 42.114 43.469  1.00 54.73  ? 70   GLU A N   1 
ATOM   529  C  CA  . GLU A 1 71  ? -18.661 42.408 44.879  1.00 53.61  ? 70   GLU A CA  1 
ATOM   530  C  C   . GLU A 1 71  ? -19.274 41.297 45.728  1.00 54.45  ? 70   GLU A C   1 
ATOM   531  O  O   . GLU A 1 71  ? -20.285 40.708 45.342  1.00 56.71  ? 70   GLU A O   1 
ATOM   532  C  CB  . GLU A 1 71  ? -19.244 43.794 45.191  1.00 54.16  ? 70   GLU A CB  1 
ATOM   533  C  CG  . GLU A 1 71  ? -18.670 44.845 44.223  1.00 66.60  ? 70   GLU A CG  1 
ATOM   534  C  CD  . GLU A 1 71  ? -19.042 46.248 44.614  1.00 99.90  ? 70   GLU A CD  1 
ATOM   535  O  OE1 . GLU A 1 71  ? -19.763 46.518 45.567  1.00 55.96  ? 70   GLU A OE1 1 
ATOM   536  O  OE2 . GLU A 1 71  ? -18.515 47.139 43.807  1.00 100.00 ? 70   GLU A OE2 1 
ATOM   537  N  N   . VAL A 1 72  ? -18.652 40.992 46.875  1.00 41.84  ? 71   VAL A N   1 
ATOM   538  C  CA  . VAL A 1 72  ? -19.146 39.929 47.731  1.00 37.89  ? 71   VAL A CA  1 
ATOM   539  C  C   . VAL A 1 72  ? -19.472 40.373 49.160  1.00 37.87  ? 71   VAL A C   1 
ATOM   540  O  O   . VAL A 1 72  ? -19.112 41.469 49.586  1.00 34.22  ? 71   VAL A O   1 
ATOM   541  C  CB  . VAL A 1 72  ? -18.254 38.677 47.618  1.00 41.06  ? 71   VAL A CB  1 
ATOM   542  C  CG1 . VAL A 1 72  ? -17.823 38.468 46.158  1.00 38.37  ? 71   VAL A CG1 1 
ATOM   543  C  CG2 . VAL A 1 72  ? -17.012 38.800 48.500  1.00 39.32  ? 71   VAL A CG2 1 
ATOM   544  N  N   . LYS A 1 73  ? -20.182 39.513 49.897  1.00 35.47  ? 72   LYS A N   1 
ATOM   545  C  CA  . LYS A 1 73  ? -20.559 39.775 51.274  1.00 36.55  ? 72   LYS A CA  1 
ATOM   546  C  C   . LYS A 1 73  ? -19.325 39.664 52.171  1.00 48.55  ? 72   LYS A C   1 
ATOM   547  O  O   . LYS A 1 73  ? -18.411 38.849 51.947  1.00 44.75  ? 72   LYS A O   1 
ATOM   548  C  CB  . LYS A 1 73  ? -21.607 38.799 51.783  1.00 36.22  ? 72   LYS A CB  1 
ATOM   549  C  CG  . LYS A 1 73  ? -22.618 39.411 52.729  1.00 71.24  ? 72   LYS A CG  1 
ATOM   550  C  CD  . LYS A 1 73  ? -23.875 39.881 52.015  1.00 91.55  ? 72   LYS A CD  1 
ATOM   551  C  CE  . LYS A 1 73  ? -25.018 40.175 52.979  1.00 100.00 ? 72   LYS A CE  1 
ATOM   552  N  NZ  . LYS A 1 73  ? -25.393 39.021 53.821  1.00 100.00 ? 72   LYS A NZ  1 
ATOM   553  N  N   . TYR A 1 74  ? -19.327 40.506 53.199  1.00 46.72  ? 73   TYR A N   1 
ATOM   554  C  CA  . TYR A 1 74  ? -18.263 40.517 54.177  1.00 46.48  ? 73   TYR A CA  1 
ATOM   555  C  C   . TYR A 1 74  ? -18.637 41.190 55.466  1.00 47.06  ? 73   TYR A C   1 
ATOM   556  O  O   . TYR A 1 74  ? -19.583 41.962 55.569  1.00 46.31  ? 73   TYR A O   1 
ATOM   557  C  CB  . TYR A 1 74  ? -16.956 41.091 53.662  1.00 43.25  ? 73   TYR A CB  1 
ATOM   558  C  CG  . TYR A 1 74  ? -16.940 42.580 53.611  1.00 47.55  ? 73   TYR A CG  1 
ATOM   559  C  CD1 . TYR A 1 74  ? -16.675 43.327 54.752  1.00 49.47  ? 73   TYR A CD1 1 
ATOM   560  C  CD2 . TYR A 1 74  ? -17.111 43.242 52.396  1.00 49.40  ? 73   TYR A CD2 1 
ATOM   561  C  CE1 . TYR A 1 74  ? -16.632 44.722 54.702  1.00 45.81  ? 73   TYR A CE1 1 
ATOM   562  C  CE2 . TYR A 1 74  ? -17.031 44.632 52.315  1.00 50.44  ? 73   TYR A CE2 1 
ATOM   563  C  CZ  . TYR A 1 74  ? -16.821 45.357 53.475  1.00 55.67  ? 73   TYR A CZ  1 
ATOM   564  O  OH  . TYR A 1 74  ? -16.761 46.722 53.409  1.00 61.06  ? 73   TYR A OH  1 
ATOM   565  N  N   . ALA A 1 75  ? -17.852 40.860 56.462  1.00 41.61  ? 74   ALA A N   1 
ATOM   566  C  CA  . ALA A 1 75  ? -18.079 41.415 57.772  1.00 41.55  ? 74   ALA A CA  1 
ATOM   567  C  C   . ALA A 1 75  ? -16.763 41.674 58.524  1.00 45.67  ? 74   ALA A C   1 
ATOM   568  O  O   . ALA A 1 75  ? -15.710 41.092 58.249  1.00 38.74  ? 74   ALA A O   1 
ATOM   569  C  CB  . ALA A 1 75  ? -19.074 40.572 58.563  1.00 39.69  ? 74   ALA A CB  1 
ATOM   570  N  N   . LEU A 1 76  ? -16.861 42.609 59.464  1.00 43.41  ? 75   LEU A N   1 
ATOM   571  C  CA  . LEU A 1 76  ? -15.798 43.026 60.355  1.00 38.66  ? 75   LEU A CA  1 
ATOM   572  C  C   . LEU A 1 76  ? -16.241 42.750 61.778  1.00 34.64  ? 75   LEU A C   1 
ATOM   573  O  O   . LEU A 1 76  ? -17.202 43.316 62.260  1.00 39.67  ? 75   LEU A O   1 
ATOM   574  C  CB  . LEU A 1 76  ? -15.432 44.499 60.117  1.00 38.89  ? 75   LEU A CB  1 
ATOM   575  C  CG  . LEU A 1 76  ? -14.504 44.657 58.913  1.00 47.18  ? 75   LEU A CG  1 
ATOM   576  C  CD1 . LEU A 1 76  ? -14.025 46.099 58.824  1.00 51.19  ? 75   LEU A CD1 1 
ATOM   577  C  CD2 . LEU A 1 76  ? -13.278 43.760 59.032  1.00 48.20  ? 75   LEU A CD2 1 
ATOM   578  N  N   . GLY A 1 77  ? -15.616 41.817 62.458  1.00 33.98  ? 76   GLY A N   1 
ATOM   579  C  CA  . GLY A 1 77  ? -16.005 41.518 63.823  1.00 34.06  ? 76   GLY A CA  1 
ATOM   580  C  C   . GLY A 1 77  ? -15.526 42.623 64.766  1.00 38.57  ? 76   GLY A C   1 
ATOM   581  O  O   . GLY A 1 77  ? -14.887 43.617 64.372  1.00 36.37  ? 76   GLY A O   1 
ATOM   582  N  N   . GLU A 1 78  ? -15.857 42.491 66.037  1.00 38.70  ? 77   GLU A N   1 
ATOM   583  C  CA  . GLU A 1 78  ? -15.395 43.560 66.900  1.00 41.69  ? 77   GLU A CA  1 
ATOM   584  C  C   . GLU A 1 78  ? -13.907 43.415 67.146  1.00 41.16  ? 77   GLU A C   1 
ATOM   585  O  O   . GLU A 1 78  ? -13.371 42.308 67.121  1.00 33.89  ? 77   GLU A O   1 
ATOM   586  C  CB  . GLU A 1 78  ? -16.152 43.651 68.238  1.00 44.95  ? 77   GLU A CB  1 
ATOM   587  C  CG  . GLU A 1 78  ? -16.634 42.290 68.792  1.00 66.34  ? 77   GLU A CG  1 
ATOM   588  C  CD  . GLU A 1 78  ? -16.713 42.271 70.307  1.00 100.00 ? 77   GLU A CD  1 
ATOM   589  O  OE1 . GLU A 1 78  ? -16.003 41.551 71.002  1.00 100.00 ? 77   GLU A OE1 1 
ATOM   590  O  OE2 . GLU A 1 78  ? -17.607 43.109 70.802  1.00 100.00 ? 77   GLU A OE2 1 
ATOM   591  N  N   . ARG A 1 79  ? -13.266 44.551 67.393  1.00 42.48  ? 78   ARG A N   1 
ATOM   592  C  CA  . ARG A 1 79  ? -11.843 44.608 67.681  1.00 40.23  ? 78   ARG A CA  1 
ATOM   593  C  C   . ARG A 1 79  ? -11.440 43.802 68.895  1.00 38.54  ? 78   ARG A C   1 
ATOM   594  O  O   . ARG A 1 79  ? -12.137 43.783 69.908  1.00 33.87  ? 78   ARG A O   1 
ATOM   595  C  CB  . ARG A 1 79  ? -11.360 46.010 67.939  1.00 39.17  ? 78   ARG A CB  1 
ATOM   596  C  CG  . ARG A 1 79  ? -9.927  46.212 67.462  1.00 46.74  ? 78   ARG A CG  1 
ATOM   597  C  CD  . ARG A 1 79  ? -9.391  47.489 68.064  1.00 34.80  ? 78   ARG A CD  1 
ATOM   598  N  NE  . ARG A 1 79  ? -7.960  47.579 68.004  1.00 30.05  ? 78   ARG A NE  1 
ATOM   599  C  CZ  . ARG A 1 79  ? -7.466  48.544 67.282  1.00 56.07  ? 78   ARG A CZ  1 
ATOM   600  N  NH1 . ARG A 1 79  ? -8.293  49.370 66.631  1.00 53.51  ? 78   ARG A NH1 1 
ATOM   601  N  NH2 . ARG A 1 79  ? -6.144  48.657 67.205  1.00 33.42  ? 78   ARG A NH2 1 
ATOM   602  N  N   . GLN A 1 80  ? -10.293 43.133 68.761  1.00 31.91  ? 79   GLN A N   1 
ATOM   603  C  CA  . GLN A 1 80  ? -9.743  42.334 69.829  1.00 30.53  ? 79   GLN A CA  1 
ATOM   604  C  C   . GLN A 1 80  ? -8.425  42.981 70.197  1.00 34.86  ? 79   GLN A C   1 
ATOM   605  O  O   . GLN A 1 80  ? -7.340  42.497 69.903  1.00 33.78  ? 79   GLN A O   1 
ATOM   606  C  CB  . GLN A 1 80  ? -9.602  40.868 69.400  1.00 31.15  ? 79   GLN A CB  1 
ATOM   607  C  CG  . GLN A 1 80  ? -10.980 40.241 69.104  1.00 35.70  ? 79   GLN A CG  1 
ATOM   608  C  CD  . GLN A 1 80  ? -10.937 38.731 69.083  1.00 41.57  ? 79   GLN A CD  1 
ATOM   609  O  OE1 . GLN A 1 80  ? -10.137 38.088 69.795  1.00 41.83  ? 79   GLN A OE1 1 
ATOM   610  N  NE2 . GLN A 1 80  ? -11.802 38.159 68.255  1.00 37.26  ? 79   GLN A NE2 1 
ATOM   611  N  N   . SER A 1 81  ? -8.566  44.149 70.795  1.00 28.82  ? 80   SER A N   1 
ATOM   612  C  CA  . SER A 1 81  ? -7.443  44.951 71.184  1.00 25.23  ? 80   SER A CA  1 
ATOM   613  C  C   . SER A 1 81  ? -6.326  44.914 70.197  1.00 23.44  ? 80   SER A C   1 
ATOM   614  O  O   . SER A 1 81  ? -6.479  45.361 69.076  1.00 26.59  ? 80   SER A O   1 
ATOM   615  C  CB  . SER A 1 81  ? -6.889  44.746 72.585  1.00 31.25  ? 80   SER A CB  1 
ATOM   616  O  OG  . SER A 1 81  ? -6.560  43.393 72.744  1.00 36.44  ? 80   SER A OG  1 
ATOM   617  N  N   . TYR A 1 82  ? -5.174  44.420 70.668  1.00 20.57  ? 81   TYR A N   1 
ATOM   618  C  CA  . TYR A 1 82  ? -3.968  44.448 69.861  1.00 19.31  ? 81   TYR A CA  1 
ATOM   619  C  C   . TYR A 1 82  ? -3.981  43.578 68.648  1.00 19.50  ? 81   TYR A C   1 
ATOM   620  O  O   . TYR A 1 82  ? -3.087  43.722 67.841  1.00 24.41  ? 81   TYR A O   1 
ATOM   621  C  CB  . TYR A 1 82  ? -2.638  44.225 70.624  1.00 20.60  ? 81   TYR A CB  1 
ATOM   622  C  CG  . TYR A 1 82  ? -2.615  42.834 71.192  1.00 16.49  ? 81   TYR A CG  1 
ATOM   623  C  CD1 . TYR A 1 82  ? -3.209  42.581 72.424  1.00 17.66  ? 81   TYR A CD1 1 
ATOM   624  C  CD2 . TYR A 1 82  ? -2.085  41.783 70.452  1.00 17.05  ? 81   TYR A CD2 1 
ATOM   625  C  CE1 . TYR A 1 82  ? -3.258  41.294 72.944  1.00 20.70  ? 81   TYR A CE1 1 
ATOM   626  C  CE2 . TYR A 1 82  ? -2.178  40.481 70.933  1.00 18.17  ? 81   TYR A CE2 1 
ATOM   627  C  CZ  . TYR A 1 82  ? -2.731  40.249 72.192  1.00 21.91  ? 81   TYR A CZ  1 
ATOM   628  O  OH  . TYR A 1 82  ? -2.804  38.975 72.700  1.00 23.17  ? 81   TYR A OH  1 
ATOM   629  N  N   . LYS A 1 83  ? -4.932  42.678 68.560  1.00 15.16  ? 82   LYS A N   1 
ATOM   630  C  CA  . LYS A 1 83  ? -5.023  41.797 67.414  1.00 16.93  ? 82   LYS A CA  1 
ATOM   631  C  C   . LYS A 1 83  ? -5.794  42.437 66.270  1.00 29.18  ? 82   LYS A C   1 
ATOM   632  O  O   . LYS A 1 83  ? -5.780  41.883 65.177  1.00 28.33  ? 82   LYS A O   1 
ATOM   633  C  CB  . LYS A 1 83  ? -5.620  40.450 67.767  1.00 16.35  ? 82   LYS A CB  1 
ATOM   634  C  CG  . LYS A 1 83  ? -5.110  39.966 69.106  1.00 32.81  ? 82   LYS A CG  1 
ATOM   635  C  CD  . LYS A 1 83  ? -5.245  38.472 69.330  1.00 28.25  ? 82   LYS A CD  1 
ATOM   636  C  CE  . LYS A 1 83  ? -5.699  38.100 70.734  1.00 39.59  ? 82   LYS A CE  1 
ATOM   637  N  NZ  . LYS A 1 83  ? -6.304  36.762 70.827  1.00 41.62  ? 82   LYS A NZ  1 
ATOM   638  N  N   . GLY A 1 84  ? -6.437  43.596 66.510  1.00 24.43  ? 83   GLY A N   1 
ATOM   639  C  CA  . GLY A 1 84  ? -7.209  44.249 65.467  1.00 21.14  ? 83   GLY A CA  1 
ATOM   640  C  C   . GLY A 1 84  ? -8.579  43.564 65.361  1.00 27.80  ? 83   GLY A C   1 
ATOM   641  O  O   . GLY A 1 84  ? -9.037  42.901 66.295  1.00 23.50  ? 83   GLY A O   1 
ATOM   642  N  N   . SER A 1 85  ? -9.218  43.674 64.186  1.00 28.99  ? 84   SER A N   1 
ATOM   643  C  CA  . SER A 1 85  ? -10.541 43.072 63.948  1.00 27.81  ? 84   SER A CA  1 
ATOM   644  C  C   . SER A 1 85  ? -10.601 42.083 62.770  1.00 28.89  ? 84   SER A C   1 
ATOM   645  O  O   . SER A 1 85  ? -10.153 42.340 61.646  1.00 27.83  ? 84   SER A O   1 
ATOM   646  C  CB  . SER A 1 85  ? -11.619 44.136 63.732  1.00 30.17  ? 84   SER A CB  1 
ATOM   647  O  OG  . SER A 1 85  ? -11.229 45.402 64.258  1.00 40.66  ? 84   SER A OG  1 
ATOM   648  N  N   . PRO A 1 86  ? -11.210 40.949 63.053  1.00 22.21  ? 85   PRO A N   1 
ATOM   649  C  CA  . PRO A 1 86  ? -11.380 39.868 62.087  1.00 23.63  ? 85   PRO A CA  1 
ATOM   650  C  C   . PRO A 1 86  ? -12.323 40.261 60.970  1.00 34.83  ? 85   PRO A C   1 
ATOM   651  O  O   . PRO A 1 86  ? -13.428 40.734 61.227  1.00 32.98  ? 85   PRO A O   1 
ATOM   652  C  CB  . PRO A 1 86  ? -12.094 38.750 62.838  1.00 20.66  ? 85   PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 86  ? -12.728 39.406 64.064  1.00 26.90  ? 85   PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 86  ? -12.026 40.748 64.281  1.00 19.24  ? 85   PRO A CD  1 
ATOM   655  N  N   . MET A 1 87  ? -11.873 40.007 59.748  1.00 32.85  ? 86   MET A N   1 
ATOM   656  C  CA  . MET A 1 87  ? -12.657 40.277 58.567  1.00 27.57  ? 86   MET A CA  1 
ATOM   657  C  C   . MET A 1 87  ? -13.107 38.999 57.876  1.00 35.20  ? 86   MET A C   1 
ATOM   658  O  O   . MET A 1 87  ? -12.324 38.287 57.254  1.00 32.03  ? 86   MET A O   1 
ATOM   659  C  CB  . MET A 1 87  ? -11.867 41.111 57.587  1.00 25.81  ? 86   MET A CB  1 
ATOM   660  C  CG  . MET A 1 87  ? -12.681 41.288 56.336  1.00 27.23  ? 86   MET A CG  1 
ATOM   661  S  SD  . MET A 1 87  ? -11.733 42.327 55.236  1.00 34.75  ? 86   MET A SD  1 
ATOM   662  C  CE  . MET A 1 87  ? -12.733 42.250 53.731  1.00 34.07  ? 86   MET A CE  1 
ATOM   663  N  N   . GLU A 1 88  ? -14.383 38.690 58.005  1.00 37.91  ? 87   GLU A N   1 
ATOM   664  C  CA  . GLU A 1 88  ? -14.920 37.509 57.352  1.00 37.56  ? 87   GLU A CA  1 
ATOM   665  C  C   . GLU A 1 88  ? -15.419 37.749 55.916  1.00 38.67  ? 87   GLU A C   1 
ATOM   666  O  O   . GLU A 1 88  ? -16.161 38.678 55.590  1.00 35.07  ? 87   GLU A O   1 
ATOM   667  C  CB  . GLU A 1 88  ? -15.916 36.790 58.244  1.00 37.42  ? 87   GLU A CB  1 
ATOM   668  C  CG  . GLU A 1 88  ? -16.428 35.494 57.598  1.00 42.93  ? 87   GLU A CG  1 
ATOM   669  C  CD  . GLU A 1 88  ? -17.485 34.869 58.463  1.00 98.12  ? 87   GLU A CD  1 
ATOM   670  O  OE1 . GLU A 1 88  ? -18.518 35.442 58.765  1.00 100.00 ? 87   GLU A OE1 1 
ATOM   671  O  OE2 . GLU A 1 88  ? -17.169 33.668 58.884  1.00 97.75  ? 87   GLU A OE2 1 
ATOM   672  N  N   . ILE A 1 89  ? -14.951 36.912 55.008  1.00 35.85  ? 88   ILE A N   1 
ATOM   673  C  CA  . ILE A 1 89  ? -15.335 37.017 53.619  1.00 34.90  ? 88   ILE A CA  1 
ATOM   674  C  C   . ILE A 1 89  ? -16.128 35.804 53.112  1.00 43.97  ? 88   ILE A C   1 
ATOM   675  O  O   . ILE A 1 89  ? -15.841 34.637 53.416  1.00 40.77  ? 88   ILE A O   1 
ATOM   676  C  CB  . ILE A 1 89  ? -14.186 37.383 52.728  1.00 36.05  ? 88   ILE A CB  1 
ATOM   677  C  CG1 . ILE A 1 89  ? -13.523 38.648 53.250  1.00 33.06  ? 88   ILE A CG1 1 
ATOM   678  C  CG2 . ILE A 1 89  ? -14.681 37.567 51.297  1.00 40.76  ? 88   ILE A CG2 1 
ATOM   679  C  CD1 . ILE A 1 89  ? -12.247 38.964 52.466  1.00 23.51  ? 88   ILE A CD1 1 
ATOM   680  N  N   . SER A 1 90  ? -17.184 36.123 52.360  1.00 44.09  ? 89   SER A N   1 
ATOM   681  C  CA  . SER A 1 90  ? -18.102 35.143 51.786  1.00 45.80  ? 89   SER A CA  1 
ATOM   682  C  C   . SER A 1 90  ? -17.731 34.761 50.373  1.00 45.34  ? 89   SER A C   1 
ATOM   683  O  O   . SER A 1 90  ? -17.690 35.614 49.475  1.00 42.76  ? 89   SER A O   1 
ATOM   684  C  CB  . SER A 1 90  ? -19.556 35.586 51.839  1.00 50.73  ? 89   SER A CB  1 
ATOM   685  O  OG  . SER A 1 90  ? -19.993 35.504 53.187  1.00 74.19  ? 89   SER A OG  1 
ATOM   686  N  N   . LEU A 1 91  ? -17.458 33.462 50.220  1.00 40.59  ? 90   LEU A N   1 
ATOM   687  C  CA  . LEU A 1 91  ? -17.093 32.938 48.923  1.00 42.06  ? 90   LEU A CA  1 
ATOM   688  C  C   . LEU A 1 91  ? -18.339 32.535 48.139  1.00 46.06  ? 90   LEU A C   1 
ATOM   689  O  O   . LEU A 1 91  ? -19.189 31.774 48.630  1.00 45.88  ? 90   LEU A O   1 
ATOM   690  C  CB  . LEU A 1 91  ? -16.141 31.743 49.082  1.00 42.14  ? 90   LEU A CB  1 
ATOM   691  C  CG  . LEU A 1 91  ? -15.105 31.978 50.161  1.00 45.92  ? 90   LEU A CG  1 
ATOM   692  C  CD1 . LEU A 1 91  ? -14.261 30.708 50.278  1.00 47.05  ? 90   LEU A CD1 1 
ATOM   693  C  CD2 . LEU A 1 91  ? -14.260 33.174 49.738  1.00 48.82  ? 90   LEU A CD2 1 
ATOM   694  N  N   . PRO A 1 92  ? -18.430 33.064 46.926  1.00 45.82  ? 91   PRO A N   1 
ATOM   695  C  CA  . PRO A 1 92  ? -19.562 32.786 46.048  1.00 49.29  ? 91   PRO A CA  1 
ATOM   696  C  C   . PRO A 1 92  ? -19.576 31.355 45.482  1.00 56.99  ? 91   PRO A C   1 
ATOM   697  O  O   . PRO A 1 92  ? -20.552 30.965 44.859  1.00 55.61  ? 91   PRO A O   1 
ATOM   698  C  CB  . PRO A 1 92  ? -19.453 33.799 44.909  1.00 49.61  ? 91   PRO A CB  1 
ATOM   699  C  CG  . PRO A 1 92  ? -18.042 34.369 44.955  1.00 53.03  ? 91   PRO A CG  1 
ATOM   700  C  CD  . PRO A 1 92  ? -17.382 33.839 46.221  1.00 46.47  ? 91   PRO A CD  1 
ATOM   701  N  N   . ILE A 1 93  ? -18.506 30.582 45.696  1.00 55.26  ? 92   ILE A N   1 
ATOM   702  C  CA  . ILE A 1 93  ? -18.422 29.211 45.223  1.00 58.60  ? 92   ILE A CA  1 
ATOM   703  C  C   . ILE A 1 93  ? -17.760 28.334 46.273  1.00 58.73  ? 92   ILE A C   1 
ATOM   704  O  O   . ILE A 1 93  ? -16.685 28.673 46.724  1.00 61.40  ? 92   ILE A O   1 
ATOM   705  C  CB  . ILE A 1 93  ? -17.621 29.101 43.927  1.00 64.96  ? 92   ILE A CB  1 
ATOM   706  C  CG1 . ILE A 1 93  ? -18.422 29.655 42.750  1.00 68.88  ? 92   ILE A CG1 1 
ATOM   707  C  CG2 . ILE A 1 93  ? -17.258 27.642 43.666  1.00 65.48  ? 92   ILE A CG2 1 
ATOM   708  C  CD1 . ILE A 1 93  ? -17.579 30.091 41.549  1.00 81.60  ? 92   ILE A CD1 1 
ATOM   709  N  N   . ALA A 1 94  ? -18.335 27.210 46.673  1.00 47.92  ? 93   ALA A N   1 
ATOM   710  C  CA  . ALA A 1 94  ? -17.613 26.441 47.657  1.00 44.97  ? 93   ALA A CA  1 
ATOM   711  C  C   . ALA A 1 94  ? -16.291 26.029 47.044  1.00 53.08  ? 93   ALA A C   1 
ATOM   712  O  O   . ALA A 1 94  ? -16.279 25.772 45.841  1.00 54.26  ? 93   ALA A O   1 
ATOM   713  C  CB  . ALA A 1 94  ? -18.384 25.220 48.121  1.00 44.53  ? 93   ALA A CB  1 
ATOM   714  N  N   . LEU A 1 95  ? -15.199 25.994 47.827  1.00 46.91  ? 94   LEU A N   1 
ATOM   715  C  CA  . LEU A 1 95  ? -13.894 25.607 47.304  1.00 43.41  ? 94   LEU A CA  1 
ATOM   716  C  C   . LEU A 1 95  ? -13.570 24.240 47.797  1.00 46.24  ? 94   LEU A C   1 
ATOM   717  O  O   . LEU A 1 95  ? -14.042 23.826 48.851  1.00 47.66  ? 94   LEU A O   1 
ATOM   718  C  CB  . LEU A 1 95  ? -12.715 26.455 47.800  1.00 42.71  ? 94   LEU A CB  1 
ATOM   719  C  CG  . LEU A 1 95  ? -12.601 27.799 47.109  1.00 48.37  ? 94   LEU A CG  1 
ATOM   720  C  CD1 . LEU A 1 95  ? -11.307 28.510 47.507  1.00 45.33  ? 94   LEU A CD1 1 
ATOM   721  C  CD2 . LEU A 1 95  ? -12.659 27.584 45.600  1.00 57.15  ? 94   LEU A CD2 1 
ATOM   722  N  N   . SER A 1 96  ? -12.744 23.561 47.039  1.00 43.22  ? 95   SER A N   1 
ATOM   723  C  CA  . SER A 1 96  ? -12.335 22.250 47.476  1.00 42.38  ? 95   SER A CA  1 
ATOM   724  C  C   . SER A 1 96  ? -10.834 22.238 47.628  1.00 36.34  ? 95   SER A C   1 
ATOM   725  O  O   . SER A 1 96  ? -10.131 23.166 47.218  1.00 34.42  ? 95   SER A O   1 
ATOM   726  C  CB  . SER A 1 96  ? -12.896 21.096 46.670  1.00 48.01  ? 95   SER A CB  1 
ATOM   727  O  OG  . SER A 1 96  ? -14.209 20.867 47.143  1.00 64.55  ? 95   SER A OG  1 
ATOM   728  N  N   . LYS A 1 97  ? -10.334 21.200 48.239  1.00 32.05  ? 96   LYS A N   1 
ATOM   729  C  CA  . LYS A 1 97  ? -8.899  21.179 48.443  1.00 31.11  ? 96   LYS A CA  1 
ATOM   730  C  C   . LYS A 1 97  ? -8.126  21.687 47.252  1.00 32.56  ? 96   LYS A C   1 
ATOM   731  O  O   . LYS A 1 97  ? -8.513  21.469 46.127  1.00 39.67  ? 96   LYS A O   1 
ATOM   732  C  CB  . LYS A 1 97  ? -8.395  19.815 48.908  1.00 35.42  ? 96   LYS A CB  1 
ATOM   733  C  CG  . LYS A 1 97  ? -9.282  19.215 49.993  1.00 75.37  ? 96   LYS A CG  1 
ATOM   734  C  CD  . LYS A 1 97  ? -8.738  17.938 50.628  1.00 90.56  ? 96   LYS A CD  1 
ATOM   735  C  CE  . LYS A 1 97  ? -9.552  17.461 51.829  1.00 100.00 ? 96   LYS A CE  1 
ATOM   736  N  NZ  . LYS A 1 97  ? -8.830  16.537 52.728  1.00 100.00 ? 96   LYS A NZ  1 
ATOM   737  N  N   . ASN A 1 98  ? -7.023  22.370 47.483  1.00 24.18  ? 97   ASN A N   1 
ATOM   738  C  CA  . ASN A 1 98  ? -6.125  22.870 46.446  1.00 23.26  ? 97   ASN A CA  1 
ATOM   739  C  C   . ASN A 1 98  ? -6.635  23.805 45.396  1.00 28.02  ? 97   ASN A C   1 
ATOM   740  O  O   . ASN A 1 98  ? -5.916  24.197 44.481  1.00 32.95  ? 97   ASN A O   1 
ATOM   741  C  CB  . ASN A 1 98  ? -5.257  21.772 45.817  1.00 29.05  ? 97   ASN A CB  1 
ATOM   742  C  CG  . ASN A 1 98  ? -4.511  21.024 46.903  1.00 79.22  ? 97   ASN A CG  1 
ATOM   743  O  OD1 . ASN A 1 98  ? -3.813  21.645 47.725  1.00 66.27  ? 97   ASN A OD1 1 
ATOM   744  N  ND2 . ASN A 1 98  ? -4.690  19.700 46.926  1.00 89.90  ? 97   ASN A ND2 1 
ATOM   745  N  N   . GLN A 1 99  ? -7.876  24.148 45.539  1.00 29.12  ? 98   GLN A N   1 
ATOM   746  C  CA  . GLN A 1 99  ? -8.480  25.068 44.628  1.00 30.69  ? 98   GLN A CA  1 
ATOM   747  C  C   . GLN A 1 99  ? -8.245  26.455 45.151  1.00 34.12  ? 98   GLN A C   1 
ATOM   748  O  O   . GLN A 1 99  ? -8.220  26.673 46.363  1.00 32.27  ? 98   GLN A O   1 
ATOM   749  C  CB  . GLN A 1 99  ? -9.979  24.775 44.680  1.00 35.86  ? 98   GLN A CB  1 
ATOM   750  C  CG  . GLN A 1 99  ? -10.299 23.404 44.057  1.00 52.64  ? 98   GLN A CG  1 
ATOM   751  C  CD  . GLN A 1 99  ? -11.618 23.476 43.326  1.00 90.95  ? 98   GLN A CD  1 
ATOM   752  O  OE1 . GLN A 1 99  ? -12.506 22.646 43.569  1.00 86.29  ? 98   GLN A OE1 1 
ATOM   753  N  NE2 . GLN A 1 99  ? -11.761 24.502 42.477  1.00 83.23  ? 98   GLN A NE2 1 
ATOM   754  N  N   . GLU A 1 100 ? -8.113  27.366 44.212  1.00 34.57  ? 99   GLU A N   1 
ATOM   755  C  CA  . GLU A 1 100 ? -7.836  28.767 44.459  1.00 35.24  ? 99   GLU A CA  1 
ATOM   756  C  C   . GLU A 1 100 ? -8.799  29.788 43.877  1.00 42.30  ? 99   GLU A C   1 
ATOM   757  O  O   . GLU A 1 100 ? -9.240  29.696 42.731  1.00 42.60  ? 99   GLU A O   1 
ATOM   758  C  CB  . GLU A 1 100 ? -6.487  29.092 43.786  1.00 35.30  ? 99   GLU A CB  1 
ATOM   759  C  CG  . GLU A 1 100 ? -5.592  27.856 43.665  1.00 43.60  ? 99   GLU A CG  1 
ATOM   760  C  CD  . GLU A 1 100 ? -4.164  28.161 43.336  1.00 52.48  ? 99   GLU A CD  1 
ATOM   761  O  OE1 . GLU A 1 100 ? -3.778  29.191 42.812  1.00 54.31  ? 99   GLU A OE1 1 
ATOM   762  O  OE2 . GLU A 1 100 ? -3.377  27.171 43.663  1.00 81.49  ? 99   GLU A OE2 1 
ATOM   763  N  N   . ILE A 1 101 ? -9.036  30.820 44.680  1.00 38.20  ? 100  ILE A N   1 
ATOM   764  C  CA  . ILE A 1 101 ? -9.820  31.975 44.306  1.00 37.64  ? 100  ILE A CA  1 
ATOM   765  C  C   . ILE A 1 101 ? -8.939  33.193 44.501  1.00 47.53  ? 100  ILE A C   1 
ATOM   766  O  O   . ILE A 1 101 ? -7.889  33.202 45.153  1.00 46.12  ? 100  ILE A O   1 
ATOM   767  C  CB  . ILE A 1 101 ? -11.101 32.274 45.077  1.00 41.53  ? 100  ILE A CB  1 
ATOM   768  C  CG1 . ILE A 1 101 ? -11.070 31.895 46.542  1.00 44.24  ? 100  ILE A CG1 1 
ATOM   769  C  CG2 . ILE A 1 101 ? -12.407 31.918 44.383  1.00 43.12  ? 100  ILE A CG2 1 
ATOM   770  C  CD1 . ILE A 1 101 ? -10.379 32.958 47.391  1.00 63.56  ? 100  ILE A CD1 1 
ATOM   771  N  N   . VAL A 1 102 ? -9.398  34.268 43.917  1.00 44.45  ? 101  VAL A N   1 
ATOM   772  C  CA  . VAL A 1 102 ? -8.706  35.510 44.086  1.00 41.52  ? 101  VAL A CA  1 
ATOM   773  C  C   . VAL A 1 102 ? -9.710  36.529 44.565  1.00 44.93  ? 101  VAL A C   1 
ATOM   774  O  O   . VAL A 1 102 ? -10.794 36.664 44.001  1.00 43.66  ? 101  VAL A O   1 
ATOM   775  C  CB  . VAL A 1 102 ? -7.707  35.976 43.051  1.00 39.34  ? 101  VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 102 ? -7.825  35.219 41.749  1.00 38.49  ? 101  VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 102 ? -7.829  37.479 42.892  1.00 37.47  ? 101  VAL A CG2 1 
ATOM   778  N  N   . ILE A 1 103 ? -9.338  37.145 45.681  1.00 36.04  ? 102  ILE A N   1 
ATOM   779  C  CA  . ILE A 1 103 ? -10.137 38.122 46.378  1.00 30.61  ? 102  ILE A CA  1 
ATOM   780  C  C   . ILE A 1 103 ? -9.440  39.463 46.313  1.00 33.94  ? 102  ILE A C   1 
ATOM   781  O  O   . ILE A 1 103 ? -8.294  39.614 46.776  1.00 33.48  ? 102  ILE A O   1 
ATOM   782  C  CB  . ILE A 1 103 ? -10.260 37.610 47.798  1.00 32.63  ? 102  ILE A CB  1 
ATOM   783  C  CG1 . ILE A 1 103 ? -10.394 36.098 47.737  1.00 27.27  ? 102  ILE A CG1 1 
ATOM   784  C  CG2 . ILE A 1 103 ? -11.463 38.204 48.502  1.00 37.40  ? 102  ILE A CG2 1 
ATOM   785  C  CD1 . ILE A 1 103 ? -10.628 35.451 49.093  1.00 28.19  ? 102  ILE A CD1 1 
ATOM   786  N  N   . GLU A 1 104 ? -10.116 40.423 45.676  1.00 26.53  ? 103  GLU A N   1 
ATOM   787  C  CA  . GLU A 1 104 ? -9.549  41.755 45.548  1.00 27.13  ? 103  GLU A CA  1 
ATOM   788  C  C   . GLU A 1 104 ? -10.186 42.615 46.601  1.00 37.89  ? 103  GLU A C   1 
ATOM   789  O  O   . GLU A 1 104 ? -11.408 42.630 46.710  1.00 40.69  ? 103  GLU A O   1 
ATOM   790  C  CB  . GLU A 1 104 ? -9.731  42.362 44.169  1.00 28.43  ? 103  GLU A CB  1 
ATOM   791  C  CG  . GLU A 1 104 ? -8.946  43.670 44.000  1.00 39.11  ? 103  GLU A CG  1 
ATOM   792  C  CD  . GLU A 1 104 ? -9.263  44.343 42.690  1.00 94.53  ? 103  GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1 104 ? -10.236 45.069 42.526  1.00 100.00 ? 103  GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1 104 ? -8.388  44.051 41.750  1.00 98.87  ? 103  GLU A OE2 1 
ATOM   795  N  N   . ILE A 1 105 ? -9.355  43.252 47.416  1.00 36.94  ? 104  ILE A N   1 
ATOM   796  C  CA  . ILE A 1 105 ? -9.847  44.076 48.512  1.00 35.20  ? 104  ILE A CA  1 
ATOM   797  C  C   . ILE A 1 105 ? -9.459  45.532 48.378  1.00 38.03  ? 104  ILE A C   1 
ATOM   798  O  O   . ILE A 1 105 ? -8.277  45.856 48.192  1.00 34.77  ? 104  ILE A O   1 
ATOM   799  C  CB  . ILE A 1 105 ? -9.504  43.541 49.891  1.00 38.11  ? 104  ILE A CB  1 
ATOM   800  C  CG1 . ILE A 1 105 ? -10.003 42.125 50.061  1.00 34.81  ? 104  ILE A CG1 1 
ATOM   801  C  CG2 . ILE A 1 105 ? -10.128 44.420 50.967  1.00 39.18  ? 104  ILE A CG2 1 
ATOM   802  C  CD1 . ILE A 1 105 ? -9.015  41.335 50.896  1.00 30.92  ? 104  ILE A CD1 1 
ATOM   803  N  N   . SER A 1 106 ? -10.529 46.353 48.429  1.00 42.46  ? 105  SER A N   1 
ATOM   804  C  CA  . SER A 1 106 ? -10.510 47.811 48.323  1.00 42.36  ? 105  SER A CA  1 
ATOM   805  C  C   . SER A 1 106 ? -10.400 48.380 49.723  1.00 34.84  ? 105  SER A C   1 
ATOM   806  O  O   . SER A 1 106 ? -11.328 48.305 50.510  1.00 31.47  ? 105  SER A O   1 
ATOM   807  C  CB  . SER A 1 106 ? -11.731 48.328 47.575  1.00 45.94  ? 105  SER A CB  1 
ATOM   808  O  OG  . SER A 1 106 ? -11.386 48.517 46.209  1.00 47.45  ? 105  SER A OG  1 
ATOM   809  N  N   . PHE A 1 107 ? -9.228  48.910 50.031  1.00 33.13  ? 106  PHE A N   1 
ATOM   810  C  CA  . PHE A 1 107 ? -8.995  49.380 51.385  1.00 29.35  ? 106  PHE A CA  1 
ATOM   811  C  C   . PHE A 1 107 ? -8.269  50.713 51.494  1.00 28.86  ? 106  PHE A C   1 
ATOM   812  O  O   . PHE A 1 107 ? -7.550  51.199 50.577  1.00 24.93  ? 106  PHE A O   1 
ATOM   813  C  CB  . PHE A 1 107 ? -8.134  48.290 52.115  1.00 27.98  ? 106  PHE A CB  1 
ATOM   814  C  CG  . PHE A 1 107 ? -6.700  48.251 51.597  1.00 27.57  ? 106  PHE A CG  1 
ATOM   815  C  CD1 . PHE A 1 107 ? -6.326  47.411 50.550  1.00 30.25  ? 106  PHE A CD1 1 
ATOM   816  C  CD2 . PHE A 1 107 ? -5.709  49.085 52.123  1.00 31.01  ? 106  PHE A CD2 1 
ATOM   817  C  CE1 . PHE A 1 107 ? -5.020  47.429 50.058  1.00 33.05  ? 106  PHE A CE1 1 
ATOM   818  C  CE2 . PHE A 1 107 ? -4.401  49.136 51.641  1.00 30.90  ? 106  PHE A CE2 1 
ATOM   819  C  CZ  . PHE A 1 107 ? -4.058  48.291 50.588  1.00 30.89  ? 106  PHE A CZ  1 
ATOM   820  N  N   . GLU A 1 108 ? -8.472  51.231 52.717  1.00 31.09  ? 107  GLU A N   1 
ATOM   821  C  CA  . GLU A 1 108 ? -7.864  52.476 53.183  1.00 36.36  ? 107  GLU A CA  1 
ATOM   822  C  C   . GLU A 1 108 ? -7.271  52.257 54.583  1.00 33.60  ? 107  GLU A C   1 
ATOM   823  O  O   . GLU A 1 108 ? -7.945  51.706 55.468  1.00 34.10  ? 107  GLU A O   1 
ATOM   824  C  CB  . GLU A 1 108 ? -8.918  53.613 53.297  1.00 40.08  ? 107  GLU A CB  1 
ATOM   825  C  CG  . GLU A 1 108 ? -8.512  55.003 52.740  1.00 64.89  ? 107  GLU A CG  1 
ATOM   826  C  CD  . GLU A 1 108 ? -9.717  55.892 52.518  1.00 100.00 ? 107  GLU A CD  1 
ATOM   827  O  OE1 . GLU A 1 108 ? -10.367 55.977 51.476  1.00 100.00 ? 107  GLU A OE1 1 
ATOM   828  O  OE2 . GLU A 1 108 ? -10.011 56.578 53.592  1.00 86.39  ? 107  GLU A OE2 1 
ATOM   829  N  N   . THR A 1 109 ? -6.019  52.681 54.788  1.00 32.30  ? 108  THR A N   1 
ATOM   830  C  CA  . THR A 1 109 ? -5.408  52.538 56.114  1.00 35.58  ? 108  THR A CA  1 
ATOM   831  C  C   . THR A 1 109 ? -5.733  53.774 56.938  1.00 41.15  ? 108  THR A C   1 
ATOM   832  O  O   . THR A 1 109 ? -6.045  54.814 56.360  1.00 39.58  ? 108  THR A O   1 
ATOM   833  C  CB  . THR A 1 109 ? -3.864  52.454 56.088  1.00 36.81  ? 108  THR A CB  1 
ATOM   834  O  OG1 . THR A 1 109 ? -3.268  53.544 55.381  1.00 33.05  ? 108  THR A OG1 1 
ATOM   835  C  CG2 . THR A 1 109 ? -3.418  51.100 55.560  1.00 27.41  ? 108  THR A CG2 1 
ATOM   836  N  N   . SER A 1 110 ? -5.608  53.647 58.258  1.00 34.04  ? 109  SER A N   1 
ATOM   837  C  CA  . SER A 1 110 ? -5.823  54.723 59.207  1.00 27.85  ? 109  SER A CA  1 
ATOM   838  C  C   . SER A 1 110 ? -4.559  55.540 59.361  1.00 33.11  ? 109  SER A C   1 
ATOM   839  O  O   . SER A 1 110 ? -3.447  55.011 59.228  1.00 29.81  ? 109  SER A O   1 
ATOM   840  C  CB  . SER A 1 110 ? -6.278  54.179 60.541  1.00 26.33  ? 109  SER A CB  1 
ATOM   841  O  OG  . SER A 1 110 ? -6.058  55.183 61.512  1.00 36.95  ? 109  SER A OG  1 
ATOM   842  N  N   . PRO A 1 111 ? -4.671  56.854 59.614  1.00 33.05  ? 110  PRO A N   1 
ATOM   843  C  CA  . PRO A 1 111 ? -3.403  57.541 59.715  1.00 31.04  ? 110  PRO A CA  1 
ATOM   844  C  C   . PRO A 1 111 ? -2.685  57.099 60.978  1.00 31.17  ? 110  PRO A C   1 
ATOM   845  O  O   . PRO A 1 111 ? -1.461  57.191 61.092  1.00 32.61  ? 110  PRO A O   1 
ATOM   846  C  CB  . PRO A 1 111 ? -3.586  59.039 59.464  1.00 32.40  ? 110  PRO A CB  1 
ATOM   847  C  CG  . PRO A 1 111 ? -5.026  59.160 58.980  1.00 34.90  ? 110  PRO A CG  1 
ATOM   848  C  CD  . PRO A 1 111 ? -5.736  57.884 59.448  1.00 32.97  ? 110  PRO A CD  1 
ATOM   849  N  N   . LYS A 1 112 ? -3.467  56.512 61.870  1.00 20.99  ? 111  LYS A N   1 
ATOM   850  C  CA  . LYS A 1 112 ? -2.943  55.961 63.112  1.00 22.35  ? 111  LYS A CA  1 
ATOM   851  C  C   . LYS A 1 112 ? -2.509  54.489 63.004  1.00 26.37  ? 111  LYS A C   1 
ATOM   852  O  O   . LYS A 1 112 ? -2.436  53.796 64.033  1.00 25.46  ? 111  LYS A O   1 
ATOM   853  C  CB  . LYS A 1 112 ? -3.928  56.106 64.272  1.00 26.02  ? 111  LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 112 ? -4.211  57.544 64.706  1.00 69.25  ? 111  LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 112 ? -5.508  58.112 64.136  1.00 98.06  ? 111  LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 112 ? -6.573  58.381 65.191  1.00 100.00 ? 111  LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 112 ? -7.898  58.618 64.591  1.00 100.00 ? 111  LYS A NZ  1 
ATOM   858  N  N   . SER A 1 113 ? -2.237  54.000 61.775  1.00 25.30  ? 112  SER A N   1 
ATOM   859  C  CA  . SER A 1 113 ? -1.816  52.609 61.553  1.00 22.00  ? 112  SER A CA  1 
ATOM   860  C  C   . SER A 1 113 ? -0.545  52.268 62.367  1.00 19.89  ? 112  SER A C   1 
ATOM   861  O  O   . SER A 1 113 ? 0.496   52.894 62.223  1.00 23.91  ? 112  SER A O   1 
ATOM   862  C  CB  . SER A 1 113 ? -1.541  52.354 60.072  1.00 15.83  ? 112  SER A CB  1 
ATOM   863  O  OG  . SER A 1 113 ? -0.793  51.153 59.917  1.00 19.70  ? 112  SER A OG  1 
ATOM   864  N  N   . SER A 1 114 ? -0.613  51.245 63.195  1.00 18.58  ? 113  SER A N   1 
ATOM   865  C  CA  . SER A 1 114 ? 0.525   50.842 64.006  1.00 18.61  ? 113  SER A CA  1 
ATOM   866  C  C   . SER A 1 114 ? 1.734   50.356 63.211  1.00 24.91  ? 113  SER A C   1 
ATOM   867  O  O   . SER A 1 114 ? 2.859   50.239 63.718  1.00 22.90  ? 113  SER A O   1 
ATOM   868  C  CB  . SER A 1 114 ? 0.114   49.900 65.120  1.00 19.15  ? 113  SER A CB  1 
ATOM   869  O  OG  . SER A 1 114 ? -0.312  48.649 64.620  1.00 19.49  ? 113  SER A OG  1 
ATOM   870  N  N   . ALA A 1 115 ? 1.499   50.077 61.937  1.00 19.34  ? 114  ALA A N   1 
ATOM   871  C  CA  . ALA A 1 115 ? 2.541   49.589 61.053  1.00 17.80  ? 114  ALA A CA  1 
ATOM   872  C  C   . ALA A 1 115 ? 3.310   50.728 60.449  1.00 20.40  ? 114  ALA A C   1 
ATOM   873  O  O   . ALA A 1 115 ? 4.371   50.555 59.817  1.00 19.02  ? 114  ALA A O   1 
ATOM   874  C  CB  . ALA A 1 115 ? 1.850   48.892 59.883  1.00 16.86  ? 114  ALA A CB  1 
ATOM   875  N  N   . LEU A 1 116 ? 2.724   51.914 60.607  1.00 17.74  ? 115  LEU A N   1 
ATOM   876  C  CA  . LEU A 1 116 ? 3.358   53.026 59.960  1.00 19.94  ? 115  LEU A CA  1 
ATOM   877  C  C   . LEU A 1 116 ? 3.643   54.215 60.826  1.00 19.68  ? 115  LEU A C   1 
ATOM   878  O  O   . LEU A 1 116 ? 3.052   54.427 61.870  1.00 24.55  ? 115  LEU A O   1 
ATOM   879  C  CB  . LEU A 1 116 ? 2.440   53.538 58.829  1.00 22.23  ? 115  LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 116 ? 1.963   52.455 57.873  1.00 25.61  ? 115  LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 116 ? 0.865   53.050 57.001  1.00 29.64  ? 115  LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 116 ? 3.101   51.926 56.999  1.00 20.12  ? 115  LEU A CD2 1 
ATOM   883  N  N   . GLN A 1 117 ? 4.578   54.971 60.308  1.00 18.97  ? 116  GLN A N   1 
ATOM   884  C  CA  . GLN A 1 117 ? 4.990   56.249 60.865  1.00 22.74  ? 116  GLN A CA  1 
ATOM   885  C  C   . GLN A 1 117 ? 5.083   57.265 59.739  1.00 24.89  ? 116  GLN A C   1 
ATOM   886  O  O   . GLN A 1 117 ? 5.911   57.131 58.823  1.00 20.48  ? 116  GLN A O   1 
ATOM   887  C  CB  . GLN A 1 117 ? 6.265   56.308 61.706  1.00 23.66  ? 116  GLN A CB  1 
ATOM   888  C  CG  . GLN A 1 117 ? 6.278   57.643 62.492  1.00 31.55  ? 116  GLN A CG  1 
ATOM   889  C  CD  . GLN A 1 117 ? 7.541   57.860 63.291  1.00 28.17  ? 116  GLN A CD  1 
ATOM   890  O  OE1 . GLN A 1 117 ? 8.409   56.973 63.387  1.00 23.94  ? 116  GLN A OE1 1 
ATOM   891  N  NE2 . GLN A 1 117 ? 7.681   59.062 63.834  1.00 24.04  ? 116  GLN A NE2 1 
ATOM   892  N  N   . TRP A 1 118 ? 4.202   58.261 59.817  1.00 25.51  ? 117  TRP A N   1 
ATOM   893  C  CA  . TRP A 1 118 ? 4.154   59.323 58.829  1.00 24.50  ? 117  TRP A CA  1 
ATOM   894  C  C   . TRP A 1 118 ? 4.873   60.524 59.411  1.00 29.40  ? 117  TRP A C   1 
ATOM   895  O  O   . TRP A 1 118 ? 4.437   61.044 60.438  1.00 32.14  ? 117  TRP A O   1 
ATOM   896  C  CB  . TRP A 1 118 ? 2.697   59.715 58.631  1.00 22.31  ? 117  TRP A CB  1 
ATOM   897  C  CG  . TRP A 1 118 ? 1.865   58.712 57.898  1.00 24.18  ? 117  TRP A CG  1 
ATOM   898  C  CD1 . TRP A 1 118 ? 1.075   57.767 58.475  1.00 27.24  ? 117  TRP A CD1 1 
ATOM   899  C  CD2 . TRP A 1 118 ? 1.671   58.606 56.469  1.00 23.00  ? 117  TRP A CD2 1 
ATOM   900  N  NE1 . TRP A 1 118 ? 0.429   57.046 57.492  1.00 26.67  ? 117  TRP A NE1 1 
ATOM   901  C  CE2 . TRP A 1 118 ? 0.772   57.531 56.253  1.00 26.59  ? 117  TRP A CE2 1 
ATOM   902  C  CE3 . TRP A 1 118 ? 2.185   59.296 55.364  1.00 24.86  ? 117  TRP A CE3 1 
ATOM   903  C  CZ2 . TRP A 1 118 ? 0.347   57.145 54.973  1.00 25.38  ? 117  TRP A CZ2 1 
ATOM   904  C  CZ3 . TRP A 1 118 ? 1.789   58.900 54.090  1.00 27.68  ? 117  TRP A CZ3 1 
ATOM   905  C  CH2 . TRP A 1 118 ? 0.868   57.855 53.901  1.00 28.07  ? 117  TRP A CH2 1 
ATOM   906  N  N   . LEU A 1 119 ? 5.972   60.918 58.769  1.00 23.97  ? 118  LEU A N   1 
ATOM   907  C  CA  . LEU A 1 119 ? 6.813   62.038 59.185  1.00 25.88  ? 118  LEU A CA  1 
ATOM   908  C  C   . LEU A 1 119 ? 6.557   63.335 58.404  1.00 35.42  ? 118  LEU A C   1 
ATOM   909  O  O   . LEU A 1 119 ? 6.471   63.345 57.171  1.00 37.58  ? 118  LEU A O   1 
ATOM   910  C  CB  . LEU A 1 119 ? 8.346   61.756 59.042  1.00 24.73  ? 118  LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 119 ? 8.904   60.441 59.630  1.00 31.22  ? 118  LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 119 ? 10.425  60.511 59.713  1.00 27.63  ? 118  LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 119 ? 8.372   60.198 61.033  1.00 35.89  ? 118  LEU A CD2 1 
ATOM   914  N  N   . THR A 1 120 ? 6.493   64.452 59.136  1.00 29.43  ? 119  THR A N   1 
ATOM   915  C  CA  . THR A 1 120 ? 6.345   65.763 58.528  1.00 26.58  ? 119  THR A CA  1 
ATOM   916  C  C   . THR A 1 120 ? 7.723   66.117 58.011  1.00 28.74  ? 119  THR A C   1 
ATOM   917  O  O   . THR A 1 120 ? 8.715   65.587 58.515  1.00 33.10  ? 119  THR A O   1 
ATOM   918  C  CB  . THR A 1 120 ? 5.913   66.773 59.610  1.00 30.87  ? 119  THR A CB  1 
ATOM   919  O  OG1 . THR A 1 120 ? 6.959   66.918 60.570  1.00 43.03  ? 119  THR A OG1 1 
ATOM   920  C  CG2 . THR A 1 120 ? 4.662   66.239 60.288  1.00 35.04  ? 119  THR A CG2 1 
ATOM   921  N  N   . PRO A 1 121 ? 7.833   67.008 57.023  1.00 30.76  ? 120  PRO A N   1 
ATOM   922  C  CA  . PRO A 1 121 ? 9.151   67.332 56.511  1.00 27.85  ? 120  PRO A CA  1 
ATOM   923  C  C   . PRO A 1 121 ? 10.131  67.791 57.577  1.00 33.68  ? 120  PRO A C   1 
ATOM   924  O  O   . PRO A 1 121 ? 11.342  67.593 57.442  1.00 34.58  ? 120  PRO A O   1 
ATOM   925  C  CB  . PRO A 1 121 ? 8.944   68.390 55.431  1.00 29.01  ? 120  PRO A CB  1 
ATOM   926  C  CG  . PRO A 1 121 ? 7.483   68.312 55.046  1.00 29.59  ? 120  PRO A CG  1 
ATOM   927  C  CD  . PRO A 1 121 ? 6.768   67.680 56.215  1.00 27.06  ? 120  PRO A CD  1 
ATOM   928  N  N   . GLU A 1 122 ? 9.603   68.413 58.628  1.00 36.28  ? 121  GLU A N   1 
ATOM   929  C  CA  . GLU A 1 122 ? 10.428  68.913 59.735  1.00 41.71  ? 121  GLU A CA  1 
ATOM   930  C  C   . GLU A 1 122 ? 11.155  67.780 60.421  1.00 46.90  ? 121  GLU A C   1 
ATOM   931  O  O   . GLU A 1 122 ? 12.302  67.911 60.852  1.00 45.40  ? 121  GLU A O   1 
ATOM   932  C  CB  . GLU A 1 122 ? 9.653   69.674 60.828  1.00 43.86  ? 121  GLU A CB  1 
ATOM   933  C  CG  . GLU A 1 122 ? 8.117   69.533 60.744  1.00 58.00  ? 121  GLU A CG  1 
ATOM   934  C  CD  . GLU A 1 122 ? 7.497   70.524 59.787  1.00 95.29  ? 121  GLU A CD  1 
ATOM   935  O  OE1 . GLU A 1 122 ? 8.029   71.583 59.481  1.00 100.00 ? 121  GLU A OE1 1 
ATOM   936  O  OE2 . GLU A 1 122 ? 6.343   70.133 59.295  1.00 59.19  ? 121  GLU A OE2 1 
ATOM   937  N  N   . GLN A 1 123 ? 10.419  66.674 60.509  1.00 40.04  ? 122  GLN A N   1 
ATOM   938  C  CA  . GLN A 1 123 ? 10.898  65.442 61.105  1.00 34.75  ? 122  GLN A CA  1 
ATOM   939  C  C   . GLN A 1 123 ? 11.970  64.761 60.246  1.00 38.46  ? 122  GLN A C   1 
ATOM   940  O  O   . GLN A 1 123 ? 12.575  63.775 60.657  1.00 36.92  ? 122  GLN A O   1 
ATOM   941  C  CB  . GLN A 1 123 ? 9.688   64.505 61.280  1.00 31.67  ? 122  GLN A CB  1 
ATOM   942  C  CG  . GLN A 1 123 ? 9.002   64.705 62.627  1.00 23.93  ? 122  GLN A CG  1 
ATOM   943  C  CD  . GLN A 1 123 ? 7.722   63.930 62.790  1.00 33.52  ? 122  GLN A CD  1 
ATOM   944  O  OE1 . GLN A 1 123 ? 6.754   64.126 62.036  1.00 38.04  ? 122  GLN A OE1 1 
ATOM   945  N  NE2 . GLN A 1 123 ? 7.682   63.071 63.806  1.00 30.07  ? 122  GLN A NE2 1 
ATOM   946  N  N   . THR A 1 124 ? 12.202  65.252 59.018  1.00 36.12  ? 123  THR A N   1 
ATOM   947  C  CA  . THR A 1 124 ? 13.166  64.626 58.102  1.00 33.51  ? 123  THR A CA  1 
ATOM   948  C  C   . THR A 1 124 ? 14.492  65.315 58.131  1.00 36.18  ? 123  THR A C   1 
ATOM   949  O  O   . THR A 1 124 ? 14.617  66.359 58.755  1.00 40.90  ? 123  THR A O   1 
ATOM   950  C  CB  . THR A 1 124 ? 12.671  64.577 56.637  1.00 31.27  ? 123  THR A CB  1 
ATOM   951  O  OG1 . THR A 1 124 ? 12.565  65.900 56.137  1.00 38.36  ? 123  THR A OG1 1 
ATOM   952  C  CG2 . THR A 1 124 ? 11.300  63.912 56.566  1.00 21.97  ? 123  THR A CG2 1 
ATOM   953  N  N   . SER A 1 125 ? 15.470  64.743 57.448  1.00 30.18  ? 124  SER A N   1 
ATOM   954  C  CA  . SER A 1 125 ? 16.767  65.373 57.441  1.00 30.34  ? 124  SER A CA  1 
ATOM   955  C  C   . SER A 1 125 ? 16.774  66.616 56.579  1.00 39.98  ? 124  SER A C   1 
ATOM   956  O  O   . SER A 1 125 ? 17.434  67.609 56.904  1.00 42.72  ? 124  SER A O   1 
ATOM   957  C  CB  . SER A 1 125 ? 17.881  64.484 56.905  1.00 31.00  ? 124  SER A CB  1 
ATOM   958  O  OG  . SER A 1 125 ? 18.222  63.434 57.794  1.00 41.86  ? 124  SER A OG  1 
ATOM   959  N  N   . GLY A 1 126 ? 16.061  66.515 55.460  1.00 33.12  ? 125  GLY A N   1 
ATOM   960  C  CA  . GLY A 1 126 ? 16.018  67.566 54.465  1.00 33.55  ? 125  GLY A CA  1 
ATOM   961  C  C   . GLY A 1 126 ? 15.115  68.725 54.777  1.00 39.54  ? 125  GLY A C   1 
ATOM   962  O  O   . GLY A 1 126 ? 15.324  69.828 54.271  1.00 43.14  ? 125  GLY A O   1 
ATOM   963  N  N   . LYS A 1 127 ? 14.105  68.443 55.574  1.00 34.88  ? 126  LYS A N   1 
ATOM   964  C  CA  . LYS A 1 127 ? 13.198  69.487 55.950  1.00 35.05  ? 126  LYS A CA  1 
ATOM   965  C  C   . LYS A 1 127 ? 12.225  69.949 54.863  1.00 43.18  ? 126  LYS A C   1 
ATOM   966  O  O   . LYS A 1 127 ? 11.309  70.745 55.156  1.00 41.50  ? 126  LYS A O   1 
ATOM   967  C  CB  . LYS A 1 127 ? 13.976  70.652 56.539  1.00 34.53  ? 126  LYS A CB  1 
ATOM   968  C  CG  . LYS A 1 127 ? 15.059  70.188 57.493  1.00 33.17  ? 126  LYS A CG  1 
ATOM   969  C  CD  . LYS A 1 127 ? 14.496  69.475 58.710  1.00 28.58  ? 126  LYS A CD  1 
ATOM   970  C  CE  . LYS A 1 127 ? 15.597  69.005 59.656  1.00 35.70  ? 126  LYS A CE  1 
ATOM   971  N  NZ  . LYS A 1 127 ? 15.099  68.062 60.666  1.00 53.76  ? 126  LYS A NZ  1 
ATOM   972  N  N   . GLU A 1 128 ? 12.397  69.456 53.632  1.00 34.06  ? 127  GLU A N   1 
ATOM   973  C  CA  . GLU A 1 128 ? 11.497  69.879 52.579  1.00 32.35  ? 127  GLU A CA  1 
ATOM   974  C  C   . GLU A 1 128 ? 10.481  68.870 52.125  1.00 41.06  ? 127  GLU A C   1 
ATOM   975  O  O   . GLU A 1 128 ? 9.583   69.214 51.369  1.00 41.24  ? 127  GLU A O   1 
ATOM   976  C  CB  . GLU A 1 128 ? 12.231  70.396 51.348  1.00 32.73  ? 127  GLU A CB  1 
ATOM   977  C  CG  . GLU A 1 128 ? 13.167  71.542 51.745  1.00 41.87  ? 127  GLU A CG  1 
ATOM   978  C  CD  . GLU A 1 128 ? 12.515  72.883 51.595  1.00 68.20  ? 127  GLU A CD  1 
ATOM   979  O  OE1 . GLU A 1 128 ? 11.668  73.152 50.750  1.00 85.44  ? 127  GLU A OE1 1 
ATOM   980  O  OE2 . GLU A 1 128 ? 13.008  73.747 52.442  1.00 94.35  ? 127  GLU A OE2 1 
ATOM   981  N  N   . HIS A 1 129 ? 10.603  67.636 52.556  1.00 38.36  ? 128  HIS A N   1 
ATOM   982  C  CA  . HIS A 1 129 ? 9.649   66.635 52.130  1.00 36.38  ? 128  HIS A CA  1 
ATOM   983  C  C   . HIS A 1 129 ? 9.272   65.683 53.241  1.00 34.84  ? 128  HIS A C   1 
ATOM   984  O  O   . HIS A 1 129 ? 10.054  65.414 54.148  1.00 33.92  ? 128  HIS A O   1 
ATOM   985  C  CB  . HIS A 1 129 ? 10.311  65.761 51.062  1.00 39.67  ? 128  HIS A CB  1 
ATOM   986  C  CG  . HIS A 1 129 ? 10.775  66.438 49.801  1.00 44.07  ? 128  HIS A CG  1 
ATOM   987  N  ND1 . HIS A 1 129 ? 9.885   66.842 48.810  1.00 44.77  ? 128  HIS A ND1 1 
ATOM   988  C  CD2 . HIS A 1 129 ? 12.031  66.713 49.378  1.00 44.57  ? 128  HIS A CD2 1 
ATOM   989  C  CE1 . HIS A 1 129 ? 10.611  67.349 47.836  1.00 44.22  ? 128  HIS A CE1 1 
ATOM   990  N  NE2 . HIS A 1 129 ? 11.905  67.291 48.144  1.00 44.43  ? 128  HIS A NE2 1 
ATOM   991  N  N   . PRO A 1 130 ? 8.084   65.124 53.134  1.00 30.93  ? 129  PRO A N   1 
ATOM   992  C  CA  . PRO A 1 130 ? 7.662   64.165 54.115  1.00 30.73  ? 129  PRO A CA  1 
ATOM   993  C  C   . PRO A 1 130 ? 8.383   62.819 53.902  1.00 32.60  ? 129  PRO A C   1 
ATOM   994  O  O   . PRO A 1 130 ? 9.307   62.688 53.088  1.00 30.87  ? 129  PRO A O   1 
ATOM   995  C  CB  . PRO A 1 130 ? 6.152   64.031 53.955  1.00 28.47  ? 129  PRO A CB  1 
ATOM   996  C  CG  . PRO A 1 130 ? 5.892   64.328 52.506  1.00 28.59  ? 129  PRO A CG  1 
ATOM   997  C  CD  . PRO A 1 130 ? 7.023   65.264 52.115  1.00 29.83  ? 129  PRO A CD  1 
ATOM   998  N  N   . TYR A 1 131 ? 7.991   61.816 54.680  1.00 24.05  ? 130  TYR A N   1 
ATOM   999  C  CA  . TYR A 1 131 ? 8.641   60.521 54.581  1.00 23.32  ? 130  TYR A CA  1 
ATOM   1000 C  C   . TYR A 1 131 ? 7.739   59.482 55.193  1.00 27.11  ? 130  TYR A C   1 
ATOM   1001 O  O   . TYR A 1 131 ? 7.054   59.735 56.169  1.00 25.99  ? 130  TYR A O   1 
ATOM   1002 C  CB  . TYR A 1 131 ? 9.927   60.574 55.425  1.00 24.39  ? 130  TYR A CB  1 
ATOM   1003 C  CG  . TYR A 1 131 ? 10.932  59.447 55.270  1.00 26.41  ? 130  TYR A CG  1 
ATOM   1004 C  CD1 . TYR A 1 131 ? 10.681  58.134 55.683  1.00 26.44  ? 130  TYR A CD1 1 
ATOM   1005 C  CD2 . TYR A 1 131 ? 12.195  59.750 54.765  1.00 26.16  ? 130  TYR A CD2 1 
ATOM   1006 C  CE1 . TYR A 1 131 ? 11.650  57.136 55.575  1.00 19.38  ? 130  TYR A CE1 1 
ATOM   1007 C  CE2 . TYR A 1 131 ? 13.179  58.768 54.644  1.00 26.74  ? 130  TYR A CE2 1 
ATOM   1008 C  CZ  . TYR A 1 131 ? 12.900  57.463 55.047  1.00 21.41  ? 130  TYR A CZ  1 
ATOM   1009 O  OH  . TYR A 1 131 ? 13.904  56.550 54.915  1.00 24.90  ? 130  TYR A OH  1 
ATOM   1010 N  N   . LEU A 1 132 ? 7.704   58.299 54.639  1.00 26.48  ? 131  LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 132 ? 6.846   57.288 55.247  1.00 26.34  ? 131  LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 132 ? 7.626   55.976 55.315  1.00 29.76  ? 131  LEU A C   1 
ATOM   1013 O  O   . LEU A 1 132 ? 8.394   55.705 54.383  1.00 30.08  ? 131  LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 132 ? 5.511   57.120 54.477  1.00 24.01  ? 131  LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 132 ? 4.873   55.750 54.658  1.00 25.25  ? 131  LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 132 ? 3.923   55.774 55.850  1.00 22.47  ? 131  LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 132 ? 4.091   55.343 53.420  1.00 26.97  ? 131  LEU A CD2 1 
ATOM   1018 N  N   . PHE A 1 133 ? 7.467   55.207 56.412  1.00 24.85  ? 132  PHE A N   1 
ATOM   1019 C  CA  . PHE A 1 133 ? 8.122   53.906 56.569  1.00 22.86  ? 132  PHE A CA  1 
ATOM   1020 C  C   . PHE A 1 133 ? 7.245   52.905 57.318  1.00 23.01  ? 132  PHE A C   1 
ATOM   1021 O  O   . PHE A 1 133 ? 6.475   53.255 58.209  1.00 20.93  ? 132  PHE A O   1 
ATOM   1022 C  CB  . PHE A 1 133 ? 9.575   53.929 57.083  1.00 26.88  ? 132  PHE A CB  1 
ATOM   1023 C  CG  . PHE A 1 133 ? 9.667   54.245 58.567  1.00 29.09  ? 132  PHE A CG  1 
ATOM   1024 C  CD1 . PHE A 1 133 ? 9.345   53.286 59.532  1.00 28.26  ? 132  PHE A CD1 1 
ATOM   1025 C  CD2 . PHE A 1 133 ? 10.052  55.514 59.005  1.00 29.01  ? 132  PHE A CD2 1 
ATOM   1026 C  CE1 . PHE A 1 133 ? 9.422   53.564 60.899  1.00 23.76  ? 132  PHE A CE1 1 
ATOM   1027 C  CE2 . PHE A 1 133 ? 10.124  55.822 60.364  1.00 26.04  ? 132  PHE A CE2 1 
ATOM   1028 C  CZ  . PHE A 1 133 ? 9.808   54.842 61.304  1.00 20.79  ? 132  PHE A CZ  1 
ATOM   1029 N  N   . SER A 1 134 ? 7.319   51.632 56.959  1.00 20.01  ? 133  SER A N   1 
ATOM   1030 C  CA  . SER A 1 134 ? 6.487   50.644 57.614  1.00 18.49  ? 133  SER A CA  1 
ATOM   1031 C  C   . SER A 1 134 ? 7.343   49.758 58.499  1.00 20.07  ? 133  SER A C   1 
ATOM   1032 O  O   . SER A 1 134 ? 8.565   49.721 58.408  1.00 20.93  ? 133  SER A O   1 
ATOM   1033 C  CB  . SER A 1 134 ? 5.820   49.721 56.600  1.00 21.00  ? 133  SER A CB  1 
ATOM   1034 O  OG  . SER A 1 134 ? 6.794   48.889 55.979  1.00 19.33  ? 133  SER A OG  1 
ATOM   1035 N  N   . GLN A 1 135 ? 6.652   49.019 59.349  1.00 17.53  ? 134  GLN A N   1 
ATOM   1036 C  CA  . GLN A 1 135 ? 7.307   48.078 60.224  1.00 16.15  ? 134  GLN A CA  1 
ATOM   1037 C  C   . GLN A 1 135 ? 6.253   47.039 60.602  1.00 21.22  ? 134  GLN A C   1 
ATOM   1038 O  O   . GLN A 1 135 ? 5.445   47.228 61.500  1.00 20.50  ? 134  GLN A O   1 
ATOM   1039 C  CB  . GLN A 1 135 ? 8.094   48.787 61.354  1.00 15.03  ? 134  GLN A CB  1 
ATOM   1040 C  CG  . GLN A 1 135 ? 8.497   47.798 62.475  1.00 22.80  ? 134  GLN A CG  1 
ATOM   1041 C  CD  . GLN A 1 135 ? 9.449   46.740 61.953  1.00 32.47  ? 134  GLN A CD  1 
ATOM   1042 O  OE1 . GLN A 1 135 ? 10.430  47.087 61.278  1.00 20.01  ? 134  GLN A OE1 1 
ATOM   1043 N  NE2 . GLN A 1 135 ? 9.174   45.470 62.246  1.00 18.65  ? 134  GLN A NE2 1 
ATOM   1044 N  N   . CYS A 1 136 ? 6.173   45.933 59.853  1.00 20.27  ? 135  CYS A N   1 
ATOM   1045 C  CA  . CYS A 1 136 ? 5.121   44.948 60.131  1.00 19.65  ? 135  CYS A CA  1 
ATOM   1046 C  C   . CYS A 1 136 ? 5.386   43.913 61.204  1.00 19.96  ? 135  CYS A C   1 
ATOM   1047 O  O   . CYS A 1 136 ? 4.454   43.422 61.822  1.00 16.67  ? 135  CYS A O   1 
ATOM   1048 C  CB  . CYS A 1 136 ? 4.662   44.209 58.847  1.00 18.98  ? 135  CYS A CB  1 
ATOM   1049 S  SG  . CYS A 1 136 ? 4.157   45.396 57.599  1.00 22.04  ? 135  CYS A SG  1 
ATOM   1050 N  N   . GLN A 1 137 ? 6.646   43.517 61.379  1.00 20.85  ? 136  GLN A N   1 
ATOM   1051 C  CA  . GLN A 1 137 ? 6.936   42.489 62.366  1.00 19.49  ? 136  GLN A CA  1 
ATOM   1052 C  C   . GLN A 1 137 ? 6.654   43.049 63.750  1.00 17.79  ? 136  GLN A C   1 
ATOM   1053 O  O   . GLN A 1 137 ? 7.052   44.180 64.026  1.00 19.64  ? 136  GLN A O   1 
ATOM   1054 C  CB  . GLN A 1 137 ? 8.388   41.945 62.208  1.00 18.24  ? 136  GLN A CB  1 
ATOM   1055 C  CG  . GLN A 1 137 ? 8.670   40.708 63.090  1.00 15.69  ? 136  GLN A CG  1 
ATOM   1056 C  CD  . GLN A 1 137 ? 10.104  40.218 62.989  1.00 18.82  ? 136  GLN A CD  1 
ATOM   1057 O  OE1 . GLN A 1 137 ? 10.987  40.986 62.591  1.00 21.40  ? 136  GLN A OE1 1 
ATOM   1058 N  NE2 . GLN A 1 137 ? 10.344  38.964 63.370  1.00 20.32  ? 136  GLN A NE2 1 
ATOM   1059 N  N   . ALA A 1 138 ? 5.965   42.280 64.605  1.00 16.00  ? 137  ALA A N   1 
ATOM   1060 C  CA  . ALA A 1 138 ? 5.459   40.921 64.361  1.00 13.64  ? 137  ALA A CA  1 
ATOM   1061 C  C   . ALA A 1 138 ? 4.096   40.891 63.680  1.00 20.13  ? 137  ALA A C   1 
ATOM   1062 O  O   . ALA A 1 138 ? 3.915   40.228 62.670  1.00 19.24  ? 137  ALA A O   1 
ATOM   1063 C  CB  . ALA A 1 138 ? 5.345   40.115 65.651  1.00 13.33  ? 137  ALA A CB  1 
ATOM   1064 N  N   . ILE A 1 139 ? 3.130   41.599 64.237  1.00 17.65  ? 138  ILE A N   1 
ATOM   1065 C  CA  . ILE A 1 139 ? 1.812   41.538 63.646  1.00 17.65  ? 138  ILE A CA  1 
ATOM   1066 C  C   . ILE A 1 139 ? 1.182   42.859 63.250  1.00 17.89  ? 138  ILE A C   1 
ATOM   1067 O  O   . ILE A 1 139 ? 0.080   43.166 63.648  1.00 18.12  ? 138  ILE A O   1 
ATOM   1068 C  CB  . ILE A 1 139 ? 0.905   40.782 64.584  1.00 21.50  ? 138  ILE A CB  1 
ATOM   1069 C  CG1 . ILE A 1 139 ? 0.909   41.474 65.949  1.00 23.03  ? 138  ILE A CG1 1 
ATOM   1070 C  CG2 . ILE A 1 139 ? 1.365   39.325 64.715  1.00 17.85  ? 138  ILE A CG2 1 
ATOM   1071 C  CD1 . ILE A 1 139 ? -0.197  40.954 66.864  1.00 20.51  ? 138  ILE A CD1 1 
ATOM   1072 N  N   . HIS A 1 140 ? 1.883   43.639 62.477  1.00 14.35  ? 139  HIS A N   1 
ATOM   1073 C  CA  . HIS A 1 140 ? 1.347   44.918 62.069  1.00 20.04  ? 139  HIS A CA  1 
ATOM   1074 C  C   . HIS A 1 140 ? 0.947   44.960 60.586  1.00 22.63  ? 139  HIS A C   1 
ATOM   1075 O  O   . HIS A 1 140 ? 0.405   45.970 60.153  1.00 21.50  ? 139  HIS A O   1 
ATOM   1076 C  CB  . HIS A 1 140 ? 2.294   46.104 62.418  1.00 20.69  ? 139  HIS A CB  1 
ATOM   1077 C  CG  . HIS A 1 140 ? 2.542   46.181 63.905  1.00 22.28  ? 139  HIS A CG  1 
ATOM   1078 N  ND1 . HIS A 1 140 ? 1.598   46.682 64.780  1.00 21.42  ? 139  HIS A ND1 1 
ATOM   1079 C  CD2 . HIS A 1 140 ? 3.607   45.772 64.641  1.00 20.30  ? 139  HIS A CD2 1 
ATOM   1080 C  CE1 . HIS A 1 140 ? 2.102   46.574 66.004  1.00 21.50  ? 139  HIS A CE1 1 
ATOM   1081 N  NE2 . HIS A 1 140 ? 3.316   46.043 65.948  1.00 20.79  ? 139  HIS A NE2 1 
ATOM   1082 N  N   . CYS A 1 141 ? 1.231   43.891 59.817  1.00 23.70  ? 140  CYS A N   1 
ATOM   1083 C  CA  . CYS A 1 141 ? 0.854   43.842 58.393  1.00 20.51  ? 140  CYS A CA  1 
ATOM   1084 C  C   . CYS A 1 141 ? -0.641  44.154 58.238  1.00 18.21  ? 140  CYS A C   1 
ATOM   1085 O  O   . CYS A 1 141 ? -1.080  44.926 57.384  1.00 21.51  ? 140  CYS A O   1 
ATOM   1086 C  CB  . CYS A 1 141 ? 1.244   42.523 57.676  1.00 18.69  ? 140  CYS A CB  1 
ATOM   1087 S  SG  . CYS A 1 141 ? 1.220   42.744 55.865  1.00 23.45  ? 140  CYS A SG  1 
ATOM   1088 N  N   . ARG A 1 142 ? -1.403  43.548 59.139  1.00 17.49  ? 141  ARG A N   1 
ATOM   1089 C  CA  . ARG A 1 142 ? -2.849  43.681 59.236  1.00 19.29  ? 141  ARG A CA  1 
ATOM   1090 C  C   . ARG A 1 142 ? -3.305  45.119 59.365  1.00 29.79  ? 141  ARG A C   1 
ATOM   1091 O  O   . ARG A 1 142 ? -4.507  45.415 59.189  1.00 29.48  ? 141  ARG A O   1 
ATOM   1092 C  CB  . ARG A 1 142 ? -3.435  42.857 60.368  1.00 19.28  ? 141  ARG A CB  1 
ATOM   1093 C  CG  . ARG A 1 142 ? -3.041  43.331 61.779  1.00 17.77  ? 141  ARG A CG  1 
ATOM   1094 C  CD  . ARG A 1 142 ? -3.499  42.358 62.853  1.00 11.79  ? 141  ARG A CD  1 
ATOM   1095 N  NE  . ARG A 1 142 ? -2.697  41.124 62.834  1.00 18.11  ? 141  ARG A NE  1 
ATOM   1096 C  CZ  . ARG A 1 142 ? -2.823  40.137 63.712  1.00 23.12  ? 141  ARG A CZ  1 
ATOM   1097 N  NH1 . ARG A 1 142 ? -3.704  40.177 64.695  1.00 16.74  ? 141  ARG A NH1 1 
ATOM   1098 N  NH2 . ARG A 1 142 ? -2.046  39.061 63.605  1.00 17.67  ? 141  ARG A NH2 1 
ATOM   1099 N  N   . ALA A 1 143 ? -2.326  45.981 59.695  1.00 22.16  ? 142  ALA A N   1 
ATOM   1100 C  CA  . ALA A 1 143 ? -2.572  47.406 59.886  1.00 21.34  ? 142  ALA A CA  1 
ATOM   1101 C  C   . ALA A 1 143 ? -2.316  48.113 58.587  1.00 30.29  ? 142  ALA A C   1 
ATOM   1102 O  O   . ALA A 1 143 ? -2.436  49.334 58.521  1.00 28.98  ? 142  ALA A O   1 
ATOM   1103 C  CB  . ALA A 1 143 ? -1.797  48.097 61.022  1.00 18.86  ? 142  ALA A CB  1 
ATOM   1104 N  N   . ILE A 1 144 ? -1.929  47.346 57.563  1.00 25.27  ? 143  ILE A N   1 
ATOM   1105 C  CA  . ILE A 1 144 ? -1.681  47.999 56.299  1.00 24.86  ? 143  ILE A CA  1 
ATOM   1106 C  C   . ILE A 1 144 ? -2.654  47.464 55.249  1.00 33.21  ? 143  ILE A C   1 
ATOM   1107 O  O   . ILE A 1 144 ? -3.086  48.191 54.363  1.00 30.61  ? 143  ILE A O   1 
ATOM   1108 C  CB  . ILE A 1 144 ? -0.279  47.766 55.801  1.00 27.48  ? 143  ILE A CB  1 
ATOM   1109 C  CG1 . ILE A 1 144 ? 0.735   48.464 56.683  1.00 25.48  ? 143  ILE A CG1 1 
ATOM   1110 C  CG2 . ILE A 1 144 ? -0.178  48.243 54.355  1.00 30.86  ? 143  ILE A CG2 1 
ATOM   1111 C  CD1 . ILE A 1 144 ? 2.134   48.057 56.257  1.00 21.10  ? 143  ILE A CD1 1 
ATOM   1112 N  N   . LEU A 1 145 ? -2.968  46.170 55.368  1.00 28.50  ? 144  LEU A N   1 
ATOM   1113 C  CA  . LEU A 1 145 ? -3.882  45.474 54.469  1.00 27.04  ? 144  LEU A CA  1 
ATOM   1114 C  C   . LEU A 1 145 ? -4.383  44.197 55.122  1.00 31.13  ? 144  LEU A C   1 
ATOM   1115 O  O   . LEU A 1 145 ? -3.786  43.658 56.047  1.00 31.11  ? 144  LEU A O   1 
ATOM   1116 C  CB  . LEU A 1 145 ? -3.260  45.191 53.076  1.00 27.85  ? 144  LEU A CB  1 
ATOM   1117 C  CG  . LEU A 1 145 ? -1.930  44.437 53.144  1.00 33.41  ? 144  LEU A CG  1 
ATOM   1118 C  CD1 . LEU A 1 145 ? -2.147  42.925 53.111  1.00 34.28  ? 144  LEU A CD1 1 
ATOM   1119 C  CD2 . LEU A 1 145 ? -0.919  44.879 52.090  1.00 30.37  ? 144  LEU A CD2 1 
ATOM   1120 N  N   . PRO A 1 146 ? -5.499  43.703 54.628  1.00 28.27  ? 145  PRO A N   1 
ATOM   1121 C  CA  . PRO A 1 146 ? -6.113  42.489 55.143  1.00 25.97  ? 145  PRO A CA  1 
ATOM   1122 C  C   . PRO A 1 146 ? -5.306  41.275 54.704  1.00 25.80  ? 145  PRO A C   1 
ATOM   1123 O  O   . PRO A 1 146 ? -4.911  41.145 53.543  1.00 26.89  ? 145  PRO A O   1 
ATOM   1124 C  CB  . PRO A 1 146 ? -7.527  42.445 54.533  1.00 25.97  ? 145  PRO A CB  1 
ATOM   1125 C  CG  . PRO A 1 146 ? -7.710  43.760 53.795  1.00 30.32  ? 145  PRO A CG  1 
ATOM   1126 C  CD  . PRO A 1 146 ? -6.334  44.377 53.597  1.00 26.43  ? 145  PRO A CD  1 
ATOM   1127 N  N   . CYS A 1 147 ? -5.069  40.391 55.649  1.00 23.44  ? 146  CYS A N   1 
ATOM   1128 C  CA  . CYS A 1 147 ? -4.275  39.215 55.366  1.00 22.20  ? 146  CYS A CA  1 
ATOM   1129 C  C   . CYS A 1 147 ? -4.338  38.173 56.478  1.00 25.91  ? 146  CYS A C   1 
ATOM   1130 O  O   . CYS A 1 147 ? -4.902  38.365 57.556  1.00 24.21  ? 146  CYS A O   1 
ATOM   1131 C  CB  . CYS A 1 147 ? -2.794  39.660 55.211  1.00 22.20  ? 146  CYS A CB  1 
ATOM   1132 S  SG  . CYS A 1 147 ? -2.122  40.656 56.610  1.00 27.07  ? 146  CYS A SG  1 
ATOM   1133 N  N   . GLN A 1 148 ? -3.724  37.035 56.188  1.00 20.89  ? 147  GLN A N   1 
ATOM   1134 C  CA  . GLN A 1 148 ? -3.599  36.004 57.192  1.00 23.58  ? 147  GLN A CA  1 
ATOM   1135 C  C   . GLN A 1 148 ? -2.316  36.481 57.865  1.00 28.69  ? 147  GLN A C   1 
ATOM   1136 O  O   . GLN A 1 148 ? -1.215  36.252 57.340  1.00 22.63  ? 147  GLN A O   1 
ATOM   1137 C  CB  . GLN A 1 148 ? -3.359  34.659 56.495  1.00 24.70  ? 147  GLN A CB  1 
ATOM   1138 C  CG  . GLN A 1 148 ? -4.631  34.245 55.737  1.00 27.61  ? 147  GLN A CG  1 
ATOM   1139 C  CD  . GLN A 1 148 ? -4.456  32.860 55.173  1.00 26.33  ? 147  GLN A CD  1 
ATOM   1140 O  OE1 . GLN A 1 148 ? -3.925  32.699 54.073  1.00 23.99  ? 147  GLN A OE1 1 
ATOM   1141 N  NE2 . GLN A 1 148 ? -4.810  31.863 55.964  1.00 18.80  ? 147  GLN A NE2 1 
ATOM   1142 N  N   . ASP A 1 149 ? -2.463  37.259 58.942  1.00 20.89  ? 148  ASP A N   1 
ATOM   1143 C  CA  . ASP A 1 149 ? -1.291  37.835 59.571  1.00 18.90  ? 148  ASP A CA  1 
ATOM   1144 C  C   . ASP A 1 149 ? -0.592  36.901 60.547  1.00 24.63  ? 148  ASP A C   1 
ATOM   1145 O  O   . ASP A 1 149 ? -0.574  37.083 61.783  1.00 17.53  ? 148  ASP A O   1 
ATOM   1146 C  CB  . ASP A 1 149 ? -1.555  39.263 60.107  1.00 22.11  ? 148  ASP A CB  1 
ATOM   1147 C  CG  . ASP A 1 149 ? -0.290  40.036 60.382  1.00 23.46  ? 148  ASP A CG  1 
ATOM   1148 O  OD1 . ASP A 1 149 ? 0.830   39.631 60.126  1.00 20.04  ? 148  ASP A OD1 1 
ATOM   1149 O  OD2 . ASP A 1 149 ? -0.520  41.204 60.918  1.00 15.15  ? 148  ASP A OD2 1 
ATOM   1150 N  N   . THR A 1 150 ? -0.023  35.882 59.906  1.00 18.46  ? 149  THR A N   1 
ATOM   1151 C  CA  . THR A 1 150 ? 0.687   34.803 60.545  1.00 17.87  ? 149  THR A CA  1 
ATOM   1152 C  C   . THR A 1 150 ? 1.872   34.337 59.711  1.00 21.17  ? 149  THR A C   1 
ATOM   1153 O  O   . THR A 1 150 ? 1.851   34.344 58.469  1.00 19.34  ? 149  THR A O   1 
ATOM   1154 C  CB  . THR A 1 150 ? -0.253  33.637 60.815  1.00 26.95  ? 149  THR A CB  1 
ATOM   1155 O  OG1 . THR A 1 150 ? 0.516   32.550 61.300  1.00 22.82  ? 149  THR A OG1 1 
ATOM   1156 C  CG2 . THR A 1 150 ? -0.967  33.249 59.523  1.00 21.04  ? 149  THR A CG2 1 
ATOM   1157 N  N   . PRO A 1 151 ? 2.955   34.037 60.439  1.00 22.13  ? 150  PRO A N   1 
ATOM   1158 C  CA  . PRO A 1 151 ? 4.193   33.603 59.793  1.00 19.85  ? 150  PRO A CA  1 
ATOM   1159 C  C   . PRO A 1 151 ? 4.062   32.165 59.262  1.00 21.47  ? 150  PRO A C   1 
ATOM   1160 O  O   . PRO A 1 151 ? 4.957   31.652 58.608  1.00 20.72  ? 150  PRO A O   1 
ATOM   1161 C  CB  . PRO A 1 151 ? 5.303   33.687 60.879  1.00 15.21  ? 150  PRO A CB  1 
ATOM   1162 C  CG  . PRO A 1 151 ? 4.598   33.656 62.214  1.00 16.09  ? 150  PRO A CG  1 
ATOM   1163 C  CD  . PRO A 1 151 ? 3.182   34.142 61.931  1.00 19.51  ? 150  PRO A CD  1 
ATOM   1164 N  N   . SER A 1 152 ? 2.946   31.502 59.556  1.00 20.72  ? 151  SER A N   1 
ATOM   1165 C  CA  . SER A 1 152 ? 2.753   30.139 59.123  1.00 19.30  ? 151  SER A CA  1 
ATOM   1166 C  C   . SER A 1 152 ? 2.344   30.061 57.674  1.00 24.34  ? 151  SER A C   1 
ATOM   1167 O  O   . SER A 1 152 ? 2.298   28.979 57.111  1.00 24.80  ? 151  SER A O   1 
ATOM   1168 C  CB  . SER A 1 152 ? 1.721   29.408 59.969  1.00 22.49  ? 151  SER A CB  1 
ATOM   1169 O  OG  . SER A 1 152 ? 0.452   30.037 59.850  1.00 23.08  ? 151  SER A OG  1 
ATOM   1170 N  N   . VAL A 1 153 ? 2.082   31.215 57.085  1.00 22.82  ? 152  VAL A N   1 
ATOM   1171 C  CA  . VAL A 1 153 ? 1.685   31.325 55.685  1.00 19.43  ? 152  VAL A CA  1 
ATOM   1172 C  C   . VAL A 1 153 ? 2.725   32.126 54.909  1.00 22.28  ? 152  VAL A C   1 
ATOM   1173 O  O   . VAL A 1 153 ? 3.185   33.171 55.367  1.00 23.44  ? 152  VAL A O   1 
ATOM   1174 C  CB  . VAL A 1 153 ? 0.296   31.991 55.596  1.00 19.43  ? 152  VAL A CB  1 
ATOM   1175 C  CG1 . VAL A 1 153 ? -0.092  32.406 54.175  1.00 16.67  ? 152  VAL A CG1 1 
ATOM   1176 C  CG2 . VAL A 1 153 ? -0.781  31.119 56.239  1.00 19.27  ? 152  VAL A CG2 1 
ATOM   1177 N  N   . LYS A 1 154 ? 3.106   31.656 53.706  1.00 21.18  ? 153  LYS A N   1 
ATOM   1178 C  CA  . LYS A 1 154 ? 4.085   32.363 52.891  1.00 17.74  ? 153  LYS A CA  1 
ATOM   1179 C  C   . LYS A 1 154 ? 3.527   32.635 51.521  1.00 21.28  ? 153  LYS A C   1 
ATOM   1180 O  O   . LYS A 1 154 ? 2.866   31.793 50.953  1.00 23.85  ? 153  LYS A O   1 
ATOM   1181 C  CB  . LYS A 1 154 ? 5.402   31.603 52.767  1.00 21.27  ? 153  LYS A CB  1 
ATOM   1182 C  CG  . LYS A 1 154 ? 6.115   31.460 54.112  1.00 21.51  ? 153  LYS A CG  1 
ATOM   1183 C  CD  . LYS A 1 154 ? 7.546   30.998 53.962  1.00 21.26  ? 153  LYS A CD  1 
ATOM   1184 C  CE  . LYS A 1 154 ? 8.143   30.501 55.268  1.00 22.91  ? 153  LYS A CE  1 
ATOM   1185 N  NZ  . LYS A 1 154 ? 9.585   30.192 55.152  1.00 21.73  ? 153  LYS A NZ  1 
ATOM   1186 N  N   . LEU A 1 155 ? 3.794   33.808 50.990  1.00 18.71  ? 154  LEU A N   1 
ATOM   1187 C  CA  . LEU A 1 155 ? 3.268   34.151 49.675  1.00 21.43  ? 154  LEU A CA  1 
ATOM   1188 C  C   . LEU A 1 155 ? 4.245   34.964 48.904  1.00 26.20  ? 154  LEU A C   1 
ATOM   1189 O  O   . LEU A 1 155 ? 5.175   35.574 49.459  1.00 24.62  ? 154  LEU A O   1 
ATOM   1190 C  CB  . LEU A 1 155 ? 2.001   35.045 49.770  1.00 22.21  ? 154  LEU A CB  1 
ATOM   1191 C  CG  . LEU A 1 155 ? 2.136   36.216 50.782  1.00 27.62  ? 154  LEU A CG  1 
ATOM   1192 C  CD1 . LEU A 1 155 ? 1.461   37.505 50.309  1.00 25.48  ? 154  LEU A CD1 1 
ATOM   1193 C  CD2 . LEU A 1 155 ? 1.539   35.818 52.132  1.00 28.38  ? 154  LEU A CD2 1 
ATOM   1194 N  N   . THR A 1 156 ? 3.982   34.986 47.604  1.00 24.13  ? 155  THR A N   1 
ATOM   1195 C  CA  . THR A 1 156 ? 4.809   35.831 46.784  1.00 23.94  ? 155  THR A CA  1 
ATOM   1196 C  C   . THR A 1 156 ? 3.962   37.100 46.641  1.00 23.99  ? 155  THR A C   1 
ATOM   1197 O  O   . THR A 1 156 ? 2.791   37.148 47.030  1.00 24.22  ? 155  THR A O   1 
ATOM   1198 C  CB  . THR A 1 156 ? 5.109   35.211 45.401  1.00 29.86  ? 155  THR A CB  1 
ATOM   1199 O  OG1 . THR A 1 156 ? 3.917   34.628 44.909  1.00 36.32  ? 155  THR A OG1 1 
ATOM   1200 C  CG2 . THR A 1 156 ? 6.215   34.173 45.519  1.00 16.93  ? 155  THR A CG2 1 
ATOM   1201 N  N   . TYR A 1 157 ? 4.539   38.129 46.059  1.00 25.56  ? 156  TYR A N   1 
ATOM   1202 C  CA  . TYR A 1 157 ? 3.766   39.336 45.874  1.00 25.78  ? 156  TYR A CA  1 
ATOM   1203 C  C   . TYR A 1 157 ? 4.359   40.271 44.856  1.00 25.37  ? 156  TYR A C   1 
ATOM   1204 O  O   . TYR A 1 157 ? 5.552   40.309 44.566  1.00 29.83  ? 156  TYR A O   1 
ATOM   1205 C  CB  . TYR A 1 157 ? 3.525   40.115 47.183  1.00 27.00  ? 156  TYR A CB  1 
ATOM   1206 C  CG  . TYR A 1 157 ? 4.670   41.016 47.641  1.00 27.39  ? 156  TYR A CG  1 
ATOM   1207 C  CD1 . TYR A 1 157 ? 4.801   42.315 47.146  1.00 30.16  ? 156  TYR A CD1 1 
ATOM   1208 C  CD2 . TYR A 1 157 ? 5.595   40.604 48.607  1.00 25.30  ? 156  TYR A CD2 1 
ATOM   1209 C  CE1 . TYR A 1 157 ? 5.821   43.164 47.579  1.00 33.17  ? 156  TYR A CE1 1 
ATOM   1210 C  CE2 . TYR A 1 157 ? 6.619   41.443 49.051  1.00 25.54  ? 156  TYR A CE2 1 
ATOM   1211 C  CZ  . TYR A 1 157 ? 6.732   42.746 48.553  1.00 39.24  ? 156  TYR A CZ  1 
ATOM   1212 O  OH  . TYR A 1 157 ? 7.722   43.618 49.005  1.00 26.94  ? 156  TYR A OH  1 
ATOM   1213 N  N   . THR A 1 158 ? 3.468   41.057 44.314  1.00 25.18  ? 157  THR A N   1 
ATOM   1214 C  CA  . THR A 1 158 ? 3.850   42.069 43.361  1.00 26.36  ? 157  THR A CA  1 
ATOM   1215 C  C   . THR A 1 158 ? 3.121   43.339 43.762  1.00 26.72  ? 157  THR A C   1 
ATOM   1216 O  O   . THR A 1 158 ? 2.006   43.287 44.271  1.00 29.15  ? 157  THR A O   1 
ATOM   1217 C  CB  . THR A 1 158 ? 3.556   41.663 41.903  1.00 38.57  ? 157  THR A CB  1 
ATOM   1218 O  OG1 . THR A 1 158 ? 2.297   41.030 41.834  1.00 38.99  ? 157  THR A OG1 1 
ATOM   1219 C  CG2 . THR A 1 158 ? 4.639   40.682 41.499  1.00 35.90  ? 157  THR A CG2 1 
ATOM   1220 N  N   . ALA A 1 159 ? 3.753   44.470 43.552  1.00 28.59  ? 158  ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 159 ? 3.100   45.700 43.942  1.00 33.23  ? 158  ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 159 ? 3.495   46.868 43.051  1.00 37.76  ? 158  ALA A C   1 
ATOM   1223 O  O   . ALA A 1 159 ? 4.598   46.946 42.482  1.00 35.09  ? 158  ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 159 ? 3.487   46.038 45.382  1.00 34.39  ? 158  ALA A CB  1 
ATOM   1225 N  N   . GLU A 1 160 ? 2.557   47.793 42.962  1.00 36.52  ? 159  GLU A N   1 
ATOM   1226 C  CA  . GLU A 1 160 ? 2.779   49.011 42.213  1.00 38.54  ? 159  GLU A CA  1 
ATOM   1227 C  C   . GLU A 1 160 ? 2.305   50.109 43.125  1.00 33.69  ? 159  GLU A C   1 
ATOM   1228 O  O   . GLU A 1 160 ? 1.204   50.050 43.690  1.00 29.21  ? 159  GLU A O   1 
ATOM   1229 C  CB  . GLU A 1 160 ? 2.119   49.064 40.829  1.00 42.31  ? 159  GLU A CB  1 
ATOM   1230 C  CG  . GLU A 1 160 ? 1.120   47.914 40.600  1.00 75.57  ? 159  GLU A CG  1 
ATOM   1231 C  CD  . GLU A 1 160 ? 1.146   47.437 39.182  1.00 99.03  ? 159  GLU A CD  1 
ATOM   1232 O  OE1 . GLU A 1 160 ? 0.467   47.937 38.296  1.00 77.74  ? 159  GLU A OE1 1 
ATOM   1233 O  OE2 . GLU A 1 160 ? 2.010   46.464 39.021  1.00 90.11  ? 159  GLU A OE2 1 
ATOM   1234 N  N   . VAL A 1 161 ? 3.181   51.064 43.345  1.00 30.74  ? 160  VAL A N   1 
ATOM   1235 C  CA  . VAL A 1 161 ? 2.726   52.053 44.289  1.00 32.22  ? 160  VAL A CA  1 
ATOM   1236 C  C   . VAL A 1 161 ? 2.872   53.454 43.745  1.00 36.18  ? 160  VAL A C   1 
ATOM   1237 O  O   . VAL A 1 161 ? 3.942   53.801 43.239  1.00 32.54  ? 160  VAL A O   1 
ATOM   1238 C  CB  . VAL A 1 161 ? 3.367   51.832 45.665  1.00 31.25  ? 160  VAL A CB  1 
ATOM   1239 C  CG1 . VAL A 1 161 ? 4.614   50.978 45.535  1.00 32.36  ? 160  VAL A CG1 1 
ATOM   1240 C  CG2 . VAL A 1 161 ? 3.697   53.130 46.385  1.00 27.21  ? 160  VAL A CG2 1 
ATOM   1241 N  N   . SER A 1 162 ? 1.776   54.222 43.839  1.00 34.59  ? 161  SER A N   1 
ATOM   1242 C  CA  . SER A 1 162 ? 1.825   55.583 43.353  1.00 33.57  ? 161  SER A CA  1 
ATOM   1243 C  C   . SER A 1 162 ? 2.245   56.562 44.417  1.00 35.27  ? 161  SER A C   1 
ATOM   1244 O  O   . SER A 1 162 ? 1.623   56.619 45.487  1.00 31.96  ? 161  SER A O   1 
ATOM   1245 C  CB  . SER A 1 162 ? 0.547   56.111 42.745  1.00 33.76  ? 161  SER A CB  1 
ATOM   1246 O  OG  . SER A 1 162 ? 0.919   57.320 42.106  1.00 38.24  ? 161  SER A OG  1 
ATOM   1247 N  N   . VAL A 1 163 ? 3.285   57.313 44.054  1.00 35.28  ? 162  VAL A N   1 
ATOM   1248 C  CA  . VAL A 1 163 ? 3.825   58.333 44.924  1.00 36.08  ? 162  VAL A CA  1 
ATOM   1249 C  C   . VAL A 1 163 ? 4.182   59.588 44.159  1.00 43.76  ? 162  VAL A C   1 
ATOM   1250 O  O   . VAL A 1 163 ? 4.516   59.520 42.981  1.00 41.88  ? 162  VAL A O   1 
ATOM   1251 C  CB  . VAL A 1 163 ? 5.095   57.910 45.667  1.00 32.84  ? 162  VAL A CB  1 
ATOM   1252 C  CG1 . VAL A 1 163 ? 4.886   56.616 46.447  1.00 29.71  ? 162  VAL A CG1 1 
ATOM   1253 C  CG2 . VAL A 1 163 ? 6.294   57.870 44.722  1.00 30.90  ? 162  VAL A CG2 1 
ATOM   1254 N  N   . PRO A 1 164 ? 4.151   60.694 44.905  1.00 38.10  ? 163  PRO A N   1 
ATOM   1255 C  CA  . PRO A 1 164 ? 4.485   62.002 44.432  1.00 34.34  ? 163  PRO A CA  1 
ATOM   1256 C  C   . PRO A 1 164 ? 5.769   61.963 43.679  1.00 42.25  ? 163  PRO A C   1 
ATOM   1257 O  O   . PRO A 1 164 ? 6.785   61.519 44.193  1.00 45.19  ? 163  PRO A O   1 
ATOM   1258 C  CB  . PRO A 1 164 ? 4.577   62.867 45.689  1.00 35.12  ? 163  PRO A CB  1 
ATOM   1259 C  CG  . PRO A 1 164 ? 3.694   62.203 46.730  1.00 38.80  ? 163  PRO A CG  1 
ATOM   1260 C  CD  . PRO A 1 164 ? 3.454   60.787 46.223  1.00 35.96  ? 163  PRO A CD  1 
ATOM   1261 N  N   . LYS A 1 165 ? 5.662   62.415 42.444  1.00 45.01  ? 164  LYS A N   1 
ATOM   1262 C  CA  . LYS A 1 165 ? 6.755   62.457 41.497  1.00 46.89  ? 164  LYS A CA  1 
ATOM   1263 C  C   . LYS A 1 165 ? 8.111   62.681 42.151  1.00 46.24  ? 164  LYS A C   1 
ATOM   1264 O  O   . LYS A 1 165 ? 9.119   62.088 41.784  1.00 46.96  ? 164  LYS A O   1 
ATOM   1265 C  CB  . LYS A 1 165 ? 6.556   63.551 40.440  1.00 55.91  ? 164  LYS A CB  1 
ATOM   1266 C  CG  . LYS A 1 165 ? 5.133   63.813 39.942  1.00 97.37  ? 164  LYS A CG  1 
ATOM   1267 C  CD  . LYS A 1 165 ? 5.012   64.953 38.913  1.00 100.00 ? 164  LYS A CD  1 
ATOM   1268 C  CE  . LYS A 1 165 ? 5.120   64.558 37.434  1.00 100.00 ? 164  LYS A CE  1 
ATOM   1269 N  NZ  . LYS A 1 165 ? 3.833   64.450 36.718  1.00 100.00 ? 164  LYS A NZ  1 
ATOM   1270 N  N   . GLU A 1 166 ? 8.164   63.595 43.102  1.00 42.61  ? 165  GLU A N   1 
ATOM   1271 C  CA  . GLU A 1 166 ? 9.422   63.941 43.749  1.00 45.37  ? 165  GLU A CA  1 
ATOM   1272 C  C   . GLU A 1 166 ? 10.005  62.929 44.747  1.00 47.34  ? 165  GLU A C   1 
ATOM   1273 O  O   . GLU A 1 166 ? 11.156  63.001 45.179  1.00 43.70  ? 165  GLU A O   1 
ATOM   1274 C  CB  . GLU A 1 166 ? 9.349   65.366 44.343  1.00 47.53  ? 165  GLU A CB  1 
ATOM   1275 C  CG  . GLU A 1 166 ? 8.275   65.541 45.446  1.00 66.49  ? 165  GLU A CG  1 
ATOM   1276 C  CD  . GLU A 1 166 ? 6.837   65.640 44.991  1.00 96.79  ? 165  GLU A CD  1 
ATOM   1277 O  OE1 . GLU A 1 166 ? 6.436   65.365 43.864  1.00 99.56  ? 165  GLU A OE1 1 
ATOM   1278 O  OE2 . GLU A 1 166 ? 6.056   66.058 45.964  1.00 77.24  ? 165  GLU A OE2 1 
ATOM   1279 N  N   . LEU A 1 167 ? 9.197   61.958 45.118  1.00 44.94  ? 166  LEU A N   1 
ATOM   1280 C  CA  . LEU A 1 167 ? 9.647   60.996 46.084  1.00 40.65  ? 166  LEU A CA  1 
ATOM   1281 C  C   . LEU A 1 167 ? 9.908   59.636 45.497  1.00 50.07  ? 166  LEU A C   1 
ATOM   1282 O  O   . LEU A 1 167 ? 9.354   59.307 44.443  1.00 52.03  ? 166  LEU A O   1 
ATOM   1283 C  CB  . LEU A 1 167 ? 8.566   60.917 47.170  1.00 35.62  ? 166  LEU A CB  1 
ATOM   1284 C  CG  . LEU A 1 167 ? 8.264   62.286 47.766  1.00 31.47  ? 166  LEU A CG  1 
ATOM   1285 C  CD1 . LEU A 1 167 ? 7.234   62.081 48.848  1.00 29.41  ? 166  LEU A CD1 1 
ATOM   1286 C  CD2 . LEU A 1 167 ? 9.521   62.927 48.364  1.00 25.32  ? 166  LEU A CD2 1 
ATOM   1287 N  N   . VAL A 1 168 ? 10.744  58.884 46.229  1.00 43.25  ? 167  VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? 11.112  57.508 45.933  1.00 39.13  ? 167  VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? 10.432  56.490 46.855  1.00 44.52  ? 167  VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? 10.327  56.679 48.074  1.00 39.15  ? 167  VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? 12.592  57.293 46.083  1.00 37.94  ? 167  VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? 12.920  55.922 45.515  1.00 35.52  ? 167  VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? 13.303  58.401 45.345  1.00 37.13  ? 167  VAL A CG2 1 
ATOM   1294 N  N   . ALA A 1 169 ? 9.998   55.394 46.233  1.00 39.32  ? 168  ALA A N   1 
ATOM   1295 C  CA  . ALA A 1 169 ? 9.363   54.288 46.918  1.00 34.98  ? 168  ALA A CA  1 
ATOM   1296 C  C   . ALA A 1 169 ? 10.209  53.034 46.762  1.00 40.61  ? 168  ALA A C   1 
ATOM   1297 O  O   . ALA A 1 169 ? 10.720  52.782 45.671  1.00 40.08  ? 168  ALA A O   1 
ATOM   1298 C  CB  . ALA A 1 169 ? 7.957   54.003 46.427  1.00 33.16  ? 168  ALA A CB  1 
ATOM   1299 N  N   . LEU A 1 170 ? 10.380  52.295 47.876  1.00 32.03  ? 169  LEU A N   1 
ATOM   1300 C  CA  . LEU A 1 170 ? 11.104  51.038 47.926  1.00 27.11  ? 169  LEU A CA  1 
ATOM   1301 C  C   . LEU A 1 170 ? 10.289  50.039 48.717  1.00 32.61  ? 169  LEU A C   1 
ATOM   1302 O  O   . LEU A 1 170 ? 9.460   50.400 49.544  1.00 33.15  ? 169  LEU A O   1 
ATOM   1303 C  CB  . LEU A 1 170 ? 12.543  51.071 48.449  1.00 25.35  ? 169  LEU A CB  1 
ATOM   1304 C  CG  . LEU A 1 170 ? 13.362  52.250 47.964  1.00 29.91  ? 169  LEU A CG  1 
ATOM   1305 C  CD1 . LEU A 1 170 ? 14.686  52.206 48.708  1.00 29.99  ? 169  LEU A CD1 1 
ATOM   1306 C  CD2 . LEU A 1 170 ? 13.676  52.118 46.482  1.00 29.66  ? 169  LEU A CD2 1 
ATOM   1307 N  N   . MET A 1 171 ? 10.495  48.764 48.417  1.00 31.01  ? 170  MET A N   1 
ATOM   1308 C  CA  . MET A 1 171 ? 9.811   47.680 49.081  1.00 25.79  ? 170  MET A CA  1 
ATOM   1309 C  C   . MET A 1 171 ? 10.757  46.537 49.309  1.00 24.72  ? 170  MET A C   1 
ATOM   1310 O  O   . MET A 1 171 ? 11.896  46.474 48.835  1.00 23.26  ? 170  MET A O   1 
ATOM   1311 C  CB  . MET A 1 171 ? 8.569   47.164 48.337  1.00 28.25  ? 170  MET A CB  1 
ATOM   1312 C  CG  . MET A 1 171 ? 7.556   48.274 48.171  1.00 31.25  ? 170  MET A CG  1 
ATOM   1313 S  SD  . MET A 1 171 ? 5.901   47.652 47.812  1.00 35.46  ? 170  MET A SD  1 
ATOM   1314 C  CE  . MET A 1 171 ? 5.341   46.854 49.347  1.00 30.63  ? 170  MET A CE  1 
ATOM   1315 N  N   . SER A 1 172 ? 10.265  45.599 50.078  1.00 25.49  ? 171  SER A N   1 
ATOM   1316 C  CA  . SER A 1 172 ? 11.080  44.433 50.331  1.00 23.48  ? 171  SER A CA  1 
ATOM   1317 C  C   . SER A 1 172 ? 10.947  43.519 49.087  1.00 26.82  ? 171  SER A C   1 
ATOM   1318 O  O   . SER A 1 172 ? 10.414  42.426 49.110  1.00 22.63  ? 171  SER A O   1 
ATOM   1319 C  CB  . SER A 1 172 ? 10.623  43.790 51.641  1.00 18.95  ? 171  SER A CB  1 
ATOM   1320 O  OG  . SER A 1 172 ? 9.230   43.521 51.646  1.00 24.18  ? 171  SER A OG  1 
ATOM   1321 N  N   . ALA A 1 173 ? 11.378  43.996 47.944  1.00 28.35  ? 172  ALA A N   1 
ATOM   1322 C  CA  . ALA A 1 173 ? 11.234  43.201 46.752  1.00 28.47  ? 172  ALA A CA  1 
ATOM   1323 C  C   . ALA A 1 173 ? 12.201  43.688 45.722  1.00 31.99  ? 172  ALA A C   1 
ATOM   1324 O  O   . ALA A 1 173 ? 12.997  44.593 45.971  1.00 30.63  ? 172  ALA A O   1 
ATOM   1325 C  CB  . ALA A 1 173 ? 9.829   43.376 46.201  1.00 29.09  ? 172  ALA A CB  1 
ATOM   1326 N  N   . ILE A 1 174 ? 12.116  43.086 44.546  1.00 34.66  ? 173  ILE A N   1 
ATOM   1327 C  CA  . ILE A 1 174 ? 12.998  43.523 43.461  1.00 34.83  ? 173  ILE A CA  1 
ATOM   1328 C  C   . ILE A 1 174 ? 12.335  44.698 42.748  1.00 30.47  ? 173  ILE A C   1 
ATOM   1329 O  O   . ILE A 1 174 ? 11.131  44.679 42.428  1.00 26.31  ? 173  ILE A O   1 
ATOM   1330 C  CB  . ILE A 1 174 ? 13.395  42.387 42.489  1.00 39.20  ? 173  ILE A CB  1 
ATOM   1331 C  CG1 . ILE A 1 174 ? 14.129  41.209 43.136  1.00 36.75  ? 173  ILE A CG1 1 
ATOM   1332 C  CG2 . ILE A 1 174 ? 14.187  42.873 41.289  1.00 44.70  ? 173  ILE A CG2 1 
ATOM   1333 C  CD1 . ILE A 1 174 ? 15.550  41.465 43.629  1.00 30.83  ? 173  ILE A CD1 1 
ATOM   1334 N  N   . ARG A 1 175 ? 13.099  45.770 42.566  1.00 34.59  ? 174  ARG A N   1 
ATOM   1335 C  CA  . ARG A 1 175 ? 12.570  46.949 41.885  1.00 38.22  ? 174  ARG A CA  1 
ATOM   1336 C  C   . ARG A 1 175 ? 12.357  46.486 40.452  1.00 53.38  ? 174  ARG A C   1 
ATOM   1337 O  O   . ARG A 1 175 ? 13.316  46.011 39.836  1.00 51.64  ? 174  ARG A O   1 
ATOM   1338 C  CB  . ARG A 1 175 ? 13.605  48.057 41.889  1.00 33.91  ? 174  ARG A CB  1 
ATOM   1339 C  CG  . ARG A 1 175 ? 13.671  48.862 43.182  1.00 39.95  ? 174  ARG A CG  1 
ATOM   1340 C  CD  . ARG A 1 175 ? 14.912  49.754 43.233  1.00 34.61  ? 174  ARG A CD  1 
ATOM   1341 N  NE  . ARG A 1 175 ? 16.083  49.015 43.674  1.00 62.75  ? 174  ARG A NE  1 
ATOM   1342 C  CZ  . ARG A 1 175 ? 17.292  49.144 43.151  1.00 81.12  ? 174  ARG A CZ  1 
ATOM   1343 N  NH1 . ARG A 1 175 ? 17.505  50.000 42.133  1.00 38.29  ? 174  ARG A NH1 1 
ATOM   1344 N  NH2 . ARG A 1 175 ? 18.276  48.393 43.686  1.00 52.86  ? 174  ARG A NH2 1 
ATOM   1345 N  N   . ASP A 1 176 ? 11.119  46.550 39.968  1.00 59.05  ? 175  ASP A N   1 
ATOM   1346 C  CA  . ASP A 1 176 ? 10.801  46.044 38.640  1.00 65.93  ? 175  ASP A CA  1 
ATOM   1347 C  C   . ASP A 1 176 ? 10.737  47.100 37.551  1.00 83.82  ? 175  ASP A C   1 
ATOM   1348 O  O   . ASP A 1 176 ? 10.852  46.833 36.342  1.00 91.77  ? 175  ASP A O   1 
ATOM   1349 C  CB  . ASP A 1 176 ? 9.567   45.123 38.677  1.00 67.87  ? 175  ASP A CB  1 
ATOM   1350 C  CG  . ASP A 1 176 ? 9.102   44.615 37.340  1.00 73.42  ? 175  ASP A CG  1 
ATOM   1351 O  OD1 . ASP A 1 176 ? 9.855   44.262 36.438  1.00 75.53  ? 175  ASP A OD1 1 
ATOM   1352 O  OD2 . ASP A 1 176 ? 7.785   44.579 37.288  1.00 72.28  ? 175  ASP A OD2 1 
ATOM   1353 N  N   . GLY A 1 177 ? 10.553  48.327 38.002  1.00 77.53  ? 176  GLY A N   1 
ATOM   1354 C  CA  . GLY A 1 177 ? 10.469  49.438 37.089  1.00 77.66  ? 176  GLY A CA  1 
ATOM   1355 C  C   . GLY A 1 177 ? 9.804   50.660 37.704  1.00 82.05  ? 176  GLY A C   1 
ATOM   1356 O  O   . GLY A 1 177 ? 9.128   50.560 38.731  1.00 79.00  ? 176  GLY A O   1 
ATOM   1357 N  N   . GLU A 1 178 ? 9.995   51.815 37.044  1.00 81.79  ? 177  GLU A N   1 
ATOM   1358 C  CA  . GLU A 1 178 ? 9.441   53.110 37.460  1.00 81.14  ? 177  GLU A CA  1 
ATOM   1359 C  C   . GLU A 1 178 ? 8.800   53.917 36.333  1.00 86.27  ? 177  GLU A C   1 
ATOM   1360 O  O   . GLU A 1 178 ? 9.419   54.218 35.313  1.00 88.04  ? 177  GLU A O   1 
ATOM   1361 C  CB  . GLU A 1 178 ? 10.468  53.977 38.210  1.00 82.57  ? 177  GLU A CB  1 
ATOM   1362 C  CG  . GLU A 1 178 ? 11.115  55.073 37.340  1.00 93.83  ? 177  GLU A CG  1 
ATOM   1363 C  CD  . GLU A 1 178 ? 11.662  56.220 38.142  1.00 98.70  ? 177  GLU A CD  1 
ATOM   1364 O  OE1 . GLU A 1 178 ? 11.271  57.364 38.000  1.00 62.12  ? 177  GLU A OE1 1 
ATOM   1365 O  OE2 . GLU A 1 178 ? 12.591  55.841 38.995  1.00 78.07  ? 177  GLU A OE2 1 
ATOM   1366 N  N   . THR A 1 179 ? 7.533   54.280 36.503  1.00 82.50  ? 178  THR A N   1 
ATOM   1367 C  CA  . THR A 1 179 ? 6.844   55.029 35.463  1.00 81.70  ? 178  THR A CA  1 
ATOM   1368 C  C   . THR A 1 179 ? 5.796   56.028 35.929  1.00 86.29  ? 178  THR A C   1 
ATOM   1369 O  O   . THR A 1 179 ? 5.013   55.811 36.856  1.00 88.24  ? 178  THR A O   1 
ATOM   1370 C  CB  . THR A 1 179 ? 6.159   54.082 34.451  1.00 79.12  ? 178  THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 179 ? 4.886   53.673 34.940  1.00 55.06  ? 178  THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 179 ? 7.052   52.877 34.149  1.00 83.66  ? 178  THR A CG2 1 
ATOM   1373 N  N   . PRO A 1 180 ? 5.764   57.151 35.223  1.00 78.88  ? 179  PRO A N   1 
ATOM   1374 C  CA  . PRO A 1 180 ? 4.768   58.141 35.519  1.00 74.33  ? 179  PRO A CA  1 
ATOM   1375 C  C   . PRO A 1 180 ? 3.379   57.551 35.463  1.00 70.74  ? 179  PRO A C   1 
ATOM   1376 O  O   . PRO A 1 180 ? 3.038   56.679 34.668  1.00 66.51  ? 179  PRO A O   1 
ATOM   1377 C  CB  . PRO A 1 180 ? 4.879   59.210 34.446  1.00 76.32  ? 179  PRO A CB  1 
ATOM   1378 C  CG  . PRO A 1 180 ? 6.182   58.950 33.705  1.00 83.60  ? 179  PRO A CG  1 
ATOM   1379 C  CD  . PRO A 1 180 ? 6.791   57.663 34.270  1.00 80.56  ? 179  PRO A CD  1 
ATOM   1380 N  N   . ASP A 1 181 ? 2.597   58.025 36.405  1.00 66.91  ? 180  ASP A N   1 
ATOM   1381 C  CA  . ASP A 1 181 ? 1.242   57.625 36.543  1.00 66.81  ? 180  ASP A CA  1 
ATOM   1382 C  C   . ASP A 1 181 ? 0.510   58.373 35.459  1.00 86.40  ? 180  ASP A C   1 
ATOM   1383 O  O   . ASP A 1 181 ? 1.063   59.307 34.883  1.00 89.77  ? 180  ASP A O   1 
ATOM   1384 C  CB  . ASP A 1 181 ? 0.808   58.093 37.946  1.00 63.63  ? 180  ASP A CB  1 
ATOM   1385 C  CG  . ASP A 1 181 ? -0.408  57.401 38.482  1.00 74.66  ? 180  ASP A CG  1 
ATOM   1386 O  OD1 . ASP A 1 181 ? -0.968  56.519 37.870  1.00 83.41  ? 180  ASP A OD1 1 
ATOM   1387 O  OD2 . ASP A 1 181 ? -0.812  57.829 39.655  1.00 69.97  ? 180  ASP A OD2 1 
ATOM   1388 N  N   . PRO A 1 182 ? -0.732  57.992 35.187  1.00 90.42  ? 181  PRO A N   1 
ATOM   1389 C  CA  . PRO A 1 182 ? -1.584  58.645 34.218  1.00 91.10  ? 181  PRO A CA  1 
ATOM   1390 C  C   . PRO A 1 182 ? -2.945  58.619 34.873  1.00 91.79  ? 181  PRO A C   1 
ATOM   1391 O  O   . PRO A 1 182 ? -3.748  57.724 34.638  1.00 87.89  ? 181  PRO A O   1 
ATOM   1392 C  CB  . PRO A 1 182 ? -1.541  57.787 32.929  1.00 94.08  ? 181  PRO A CB  1 
ATOM   1393 C  CG  . PRO A 1 182 ? -0.582  56.635 33.200  1.00 98.94  ? 181  PRO A CG  1 
ATOM   1394 C  CD  . PRO A 1 182 ? -0.115  56.760 34.655  1.00 92.93  ? 181  PRO A CD  1 
ATOM   1395 N  N   . GLU A 1 183 ? -3.175  59.556 35.793  1.00 88.82  ? 182  GLU A N   1 
ATOM   1396 C  CA  . GLU A 1 183 ? -4.443  59.519 36.506  1.00 89.31  ? 182  GLU A CA  1 
ATOM   1397 C  C   . GLU A 1 183 ? -4.808  60.809 37.218  1.00 98.64  ? 182  GLU A C   1 
ATOM   1398 O  O   . GLU A 1 183 ? -5.181  60.787 38.385  1.00 99.08  ? 182  GLU A O   1 
ATOM   1399 C  CB  . GLU A 1 183 ? -4.359  58.380 37.528  1.00 90.42  ? 182  GLU A CB  1 
ATOM   1400 C  CG  . GLU A 1 183 ? -5.510  57.373 37.391  1.00 98.92  ? 182  GLU A CG  1 
ATOM   1401 C  CD  . GLU A 1 183 ? -6.826  58.010 37.750  1.00 100.00 ? 182  GLU A CD  1 
ATOM   1402 O  OE1 . GLU A 1 183 ? -7.465  58.719 36.986  1.00 100.00 ? 182  GLU A OE1 1 
ATOM   1403 O  OE2 . GLU A 1 183 ? -7.169  57.806 39.003  1.00 100.00 ? 182  GLU A OE2 1 
ATOM   1404 N  N   . ASP A 1 184 ? -4.704  61.939 36.487  1.00 100.00 ? 183  ASP A N   1 
ATOM   1405 C  CA  . ASP A 1 184 ? -4.952  63.289 37.021  1.00 100.00 ? 183  ASP A CA  1 
ATOM   1406 C  C   . ASP A 1 184 ? -4.112  63.534 38.264  1.00 100.00 ? 183  ASP A C   1 
ATOM   1407 O  O   . ASP A 1 184 ? -4.557  64.229 39.192  1.00 100.00 ? 183  ASP A O   1 
ATOM   1408 C  CB  . ASP A 1 184 ? -6.460  63.709 37.195  1.00 100.00 ? 183  ASP A CB  1 
ATOM   1409 C  CG  . ASP A 1 184 ? -7.509  62.613 37.228  1.00 100.00 ? 183  ASP A CG  1 
ATOM   1410 O  OD1 . ASP A 1 184 ? -8.091  62.209 36.225  1.00 100.00 ? 183  ASP A OD1 1 
ATOM   1411 O  OD2 . ASP A 1 184 ? -7.745  62.155 38.451  1.00 100.00 ? 183  ASP A OD2 1 
ATOM   1412 N  N   . PRO A 1 185 ? -2.878  62.960 38.272  1.00 97.37  ? 184  PRO A N   1 
ATOM   1413 C  CA  . PRO A 1 185 ? -2.075  63.104 39.462  1.00 95.12  ? 184  PRO A CA  1 
ATOM   1414 C  C   . PRO A 1 185 ? -0.708  63.687 39.190  1.00 98.12  ? 184  PRO A C   1 
ATOM   1415 O  O   . PRO A 1 185 ? -0.248  63.872 38.049  1.00 96.48  ? 184  PRO A O   1 
ATOM   1416 C  CB  . PRO A 1 185 ? -1.735  61.635 39.703  1.00 96.33  ? 184  PRO A CB  1 
ATOM   1417 C  CG  . PRO A 1 185 ? -1.335  61.138 38.314  1.00 100.00 ? 184  PRO A CG  1 
ATOM   1418 C  CD  . PRO A 1 185 ? -2.110  62.028 37.363  1.00 96.08  ? 184  PRO A CD  1 
ATOM   1419 N  N   . SER A 1 186 ? -0.023  63.913 40.311  1.00 92.79  ? 185  SER A N   1 
ATOM   1420 C  CA  . SER A 1 186 ? 1.347   64.393 40.313  1.00 88.74  ? 185  SER A CA  1 
ATOM   1421 C  C   . SER A 1 186 ? 2.206   63.348 41.012  1.00 81.94  ? 185  SER A C   1 
ATOM   1422 O  O   . SER A 1 186 ? 3.066   63.667 41.846  1.00 84.44  ? 185  SER A O   1 
ATOM   1423 C  CB  . SER A 1 186 ? 1.541   65.771 40.914  1.00 93.34  ? 185  SER A CB  1 
ATOM   1424 O  OG  . SER A 1 186 ? 2.614   66.419 40.251  1.00 100.00 ? 185  SER A OG  1 
ATOM   1425 N  N   . ARG A 1 187 ? 1.930   62.095 40.627  1.00 64.19  ? 186  ARG A N   1 
ATOM   1426 C  CA  . ARG A 1 187 ? 2.596   60.947 41.162  1.00 59.49  ? 186  ARG A CA  1 
ATOM   1427 C  C   . ARG A 1 187 ? 3.282   60.116 40.116  1.00 59.45  ? 186  ARG A C   1 
ATOM   1428 O  O   . ARG A 1 187 ? 3.053   60.227 38.916  1.00 59.05  ? 186  ARG A O   1 
ATOM   1429 C  CB  . ARG A 1 187 ? 1.659   60.042 41.958  1.00 55.86  ? 186  ARG A CB  1 
ATOM   1430 C  CG  . ARG A 1 187 ? 0.324   60.675 42.291  1.00 27.25  ? 186  ARG A CG  1 
ATOM   1431 C  CD  . ARG A 1 187 ? -0.548  59.827 43.204  1.00 57.78  ? 186  ARG A CD  1 
ATOM   1432 N  NE  . ARG A 1 187 ? 0.194   59.220 44.306  1.00 80.89  ? 186  ARG A NE  1 
ATOM   1433 C  CZ  . ARG A 1 187 ? 0.569   59.842 45.420  1.00 97.56  ? 186  ARG A CZ  1 
ATOM   1434 N  NH1 . ARG A 1 187 ? 0.297   61.124 45.643  1.00 83.79  ? 186  ARG A NH1 1 
ATOM   1435 N  NH2 . ARG A 1 187 ? 1.235   59.142 46.335  1.00 85.34  ? 186  ARG A NH2 1 
ATOM   1436 N  N   . LYS A 1 188 ? 4.128   59.268 40.675  1.00 53.71  ? 187  LYS A N   1 
ATOM   1437 C  CA  . LYS A 1 188 ? 4.904   58.295 39.970  1.00 50.62  ? 187  LYS A CA  1 
ATOM   1438 C  C   . LYS A 1 188 ? 4.359   56.988 40.450  1.00 53.26  ? 187  LYS A C   1 
ATOM   1439 O  O   . LYS A 1 188 ? 3.776   56.881 41.543  1.00 51.61  ? 187  LYS A O   1 
ATOM   1440 C  CB  . LYS A 1 188 ? 6.351   58.266 40.393  1.00 52.26  ? 187  LYS A CB  1 
ATOM   1441 C  CG  . LYS A 1 188 ? 7.282   59.118 39.571  1.00 54.27  ? 187  LYS A CG  1 
ATOM   1442 C  CD  . LYS A 1 188 ? 8.703   58.584 39.606  1.00 55.39  ? 187  LYS A CD  1 
ATOM   1443 C  CE  . LYS A 1 188 ? 9.728   59.611 40.051  1.00 31.63  ? 187  LYS A CE  1 
ATOM   1444 N  NZ  . LYS A 1 188 ? 11.058  59.374 39.481  1.00 46.19  ? 187  LYS A NZ  1 
ATOM   1445 N  N   . ILE A 1 189 ? 4.598   56.025 39.584  1.00 49.44  ? 188  ILE A N   1 
ATOM   1446 C  CA  . ILE A 1 189 ? 4.200   54.683 39.845  1.00 48.00  ? 188  ILE A CA  1 
ATOM   1447 C  C   . ILE A 1 189 ? 5.361   53.694 39.935  1.00 53.77  ? 188  ILE A C   1 
ATOM   1448 O  O   . ILE A 1 189 ? 6.057   53.436 38.951  1.00 53.51  ? 188  ILE A O   1 
ATOM   1449 C  CB  . ILE A 1 189 ? 2.753   54.307 39.572  1.00 49.99  ? 188  ILE A CB  1 
ATOM   1450 C  CG1 . ILE A 1 189 ? 2.558   52.804 39.554  1.00 51.55  ? 188  ILE A CG1 1 
ATOM   1451 C  CG2 . ILE A 1 189 ? 2.229   54.973 38.315  1.00 51.74  ? 188  ILE A CG2 1 
ATOM   1452 C  CD1 . ILE A 1 189 ? 1.336   52.415 40.385  1.00 80.62  ? 188  ILE A CD1 1 
ATOM   1453 N  N   . TYR A 1 190 ? 5.640   53.226 41.166  1.00 45.90  ? 189  TYR A N   1 
ATOM   1454 C  CA  . TYR A 1 190 ? 6.742   52.322 41.402  1.00 40.92  ? 189  TYR A CA  1 
ATOM   1455 C  C   . TYR A 1 190 ? 6.330   50.851 41.496  1.00 40.81  ? 189  TYR A C   1 
ATOM   1456 O  O   . TYR A 1 190 ? 5.362   50.493 42.188  1.00 39.23  ? 189  TYR A O   1 
ATOM   1457 C  CB  . TYR A 1 190 ? 7.528   52.773 42.638  1.00 40.24  ? 189  TYR A CB  1 
ATOM   1458 C  CG  . TYR A 1 190 ? 8.427   53.968 42.455  1.00 31.23  ? 189  TYR A CG  1 
ATOM   1459 C  CD1 . TYR A 1 190 ? 9.711   53.803 41.939  1.00 31.58  ? 189  TYR A CD1 1 
ATOM   1460 C  CD2 . TYR A 1 190 ? 8.046   55.239 42.886  1.00 30.59  ? 189  TYR A CD2 1 
ATOM   1461 C  CE1 . TYR A 1 190 ? 10.593  54.879 41.813  1.00 34.77  ? 189  TYR A CE1 1 
ATOM   1462 C  CE2 . TYR A 1 190 ? 8.913   56.328 42.764  1.00 31.23  ? 189  TYR A CE2 1 
ATOM   1463 C  CZ  . TYR A 1 190 ? 10.188  56.151 42.224  1.00 39.57  ? 189  TYR A CZ  1 
ATOM   1464 O  OH  . TYR A 1 190 ? 11.058  57.218 42.096  1.00 34.19  ? 189  TYR A OH  1 
ATOM   1465 N  N   . LYS A 1 191 ? 7.123   50.034 40.775  1.00 39.37  ? 190  LYS A N   1 
ATOM   1466 C  CA  . LYS A 1 191 ? 6.971   48.589 40.627  1.00 39.51  ? 190  LYS A CA  1 
ATOM   1467 C  C   . LYS A 1 191 ? 8.024   47.700 41.305  1.00 35.21  ? 190  LYS A C   1 
ATOM   1468 O  O   . LYS A 1 191 ? 9.235   47.928 41.275  1.00 32.65  ? 190  LYS A O   1 
ATOM   1469 C  CB  . LYS A 1 191 ? 6.775   48.214 39.161  1.00 43.13  ? 190  LYS A CB  1 
ATOM   1470 C  CG  . LYS A 1 191 ? 5.359   48.468 38.642  1.00 68.06  ? 190  LYS A CG  1 
ATOM   1471 C  CD  . LYS A 1 191 ? 5.308   49.170 37.290  1.00 80.52  ? 190  LYS A CD  1 
ATOM   1472 C  CE  . LYS A 1 191 ? 5.559   48.262 36.089  1.00 100.00 ? 190  LYS A CE  1 
ATOM   1473 N  NZ  . LYS A 1 191 ? 6.556   48.792 35.135  1.00 100.00 ? 190  LYS A NZ  1 
ATOM   1474 N  N   . PHE A 1 192 ? 7.502   46.641 41.907  1.00 32.67  ? 191  PHE A N   1 
ATOM   1475 C  CA  . PHE A 1 192 ? 8.296   45.679 42.651  1.00 31.95  ? 191  PHE A CA  1 
ATOM   1476 C  C   . PHE A 1 192 ? 7.784   44.249 42.523  1.00 33.46  ? 191  PHE A C   1 
ATOM   1477 O  O   . PHE A 1 192 ? 6.571   43.970 42.462  1.00 32.26  ? 191  PHE A O   1 
ATOM   1478 C  CB  . PHE A 1 192 ? 8.182   46.052 44.157  1.00 31.15  ? 191  PHE A CB  1 
ATOM   1479 C  CG  . PHE A 1 192 ? 8.495   47.505 44.457  1.00 25.52  ? 191  PHE A CG  1 
ATOM   1480 C  CD1 . PHE A 1 192 ? 9.813   47.930 44.618  1.00 25.46  ? 191  PHE A CD1 1 
ATOM   1481 C  CD2 . PHE A 1 192 ? 7.477   48.447 44.582  1.00 28.24  ? 191  PHE A CD2 1 
ATOM   1482 C  CE1 . PHE A 1 192 ? 10.131  49.261 44.884  1.00 27.83  ? 191  PHE A CE1 1 
ATOM   1483 C  CE2 . PHE A 1 192 ? 7.769   49.786 44.841  1.00 30.83  ? 191  PHE A CE2 1 
ATOM   1484 C  CZ  . PHE A 1 192 ? 9.095   50.188 44.999  1.00 29.60  ? 191  PHE A CZ  1 
ATOM   1485 N  N   . ILE A 1 193 ? 8.732   43.324 42.567  1.00 33.50  ? 192  ILE A N   1 
ATOM   1486 C  CA  . ILE A 1 193 ? 8.358   41.918 42.502  1.00 35.54  ? 192  ILE A CA  1 
ATOM   1487 C  C   . ILE A 1 193 ? 9.089   41.083 43.523  1.00 27.79  ? 192  ILE A C   1 
ATOM   1488 O  O   . ILE A 1 193 ? 10.299  41.147 43.644  1.00 26.68  ? 192  ILE A O   1 
ATOM   1489 C  CB  . ILE A 1 193 ? 8.521   41.221 41.133  1.00 40.49  ? 192  ILE A CB  1 
ATOM   1490 C  CG1 . ILE A 1 193 ? 9.982   41.182 40.709  1.00 43.06  ? 192  ILE A CG1 1 
ATOM   1491 C  CG2 . ILE A 1 193 ? 7.753   41.957 40.052  1.00 44.56  ? 192  ILE A CG2 1 
ATOM   1492 C  CD1 . ILE A 1 193 ? 10.729  39.903 41.096  1.00 83.58  ? 192  ILE A CD1 1 
ATOM   1493 N  N   . GLN A 1 194 ? 8.322   40.266 44.204  1.00 29.76  ? 193  GLN A N   1 
ATOM   1494 C  CA  . GLN A 1 194 ? 8.903   39.386 45.177  1.00 30.86  ? 193  GLN A CA  1 
ATOM   1495 C  C   . GLN A 1 194 ? 8.505   37.983 44.831  1.00 28.66  ? 193  GLN A C   1 
ATOM   1496 O  O   . GLN A 1 194 ? 7.406   37.529 45.181  1.00 27.73  ? 193  GLN A O   1 
ATOM   1497 C  CB  . GLN A 1 194 ? 8.625   39.729 46.669  1.00 32.91  ? 193  GLN A CB  1 
ATOM   1498 C  CG  . GLN A 1 194 ? 9.339   38.787 47.682  1.00 24.21  ? 193  GLN A CG  1 
ATOM   1499 C  CD  . GLN A 1 194 ? 10.864  38.777 47.631  1.00 20.52  ? 193  GLN A CD  1 
ATOM   1500 O  OE1 . GLN A 1 194 ? 11.448  37.867 47.031  1.00 28.37  ? 193  GLN A OE1 1 
ATOM   1501 N  NE2 . GLN A 1 194 ? 11.535  39.752 48.272  1.00 21.68  ? 193  GLN A NE2 1 
ATOM   1502 N  N   . LYS A 1 195 ? 9.477   37.342 44.163  1.00 30.49  ? 194  LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 195 ? 9.401   35.950 43.684  1.00 34.51  ? 194  LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 195 ? 9.563   34.882 44.787  1.00 40.98  ? 194  LYS A C   1 
ATOM   1505 O  O   . LYS A 1 195 ? 9.071   33.753 44.652  1.00 39.86  ? 194  LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 195 ? 10.319  35.663 42.485  1.00 36.96  ? 194  LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 195 ? 9.652   35.946 41.148  1.00 60.69  ? 194  LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 195 ? 10.655  36.201 40.037  1.00 71.49  ? 194  LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 195 ? 10.024  36.595 38.711  1.00 70.55  ? 194  LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 195 ? 11.032  37.075 37.745  1.00 96.02  ? 194  LYS A NZ  1 
ATOM   1511 N  N   . VAL A 1 196 ? 10.268  35.201 45.882  1.00 28.85  ? 195  VAL A N   1 
ATOM   1512 C  CA  . VAL A 1 196 ? 10.383  34.203 46.929  1.00 24.96  ? 195  VAL A CA  1 
ATOM   1513 C  C   . VAL A 1 196 ? 9.195   34.303 47.895  1.00 28.79  ? 195  VAL A C   1 
ATOM   1514 O  O   . VAL A 1 196 ? 8.820   35.398 48.331  1.00 30.73  ? 195  VAL A O   1 
ATOM   1515 C  CB  . VAL A 1 196 ? 11.716  34.313 47.649  1.00 28.17  ? 195  VAL A CB  1 
ATOM   1516 C  CG1 . VAL A 1 196 ? 11.907  33.002 48.380  1.00 31.42  ? 195  VAL A CG1 1 
ATOM   1517 C  CG2 . VAL A 1 196 ? 12.875  34.513 46.672  1.00 26.41  ? 195  VAL A CG2 1 
ATOM   1518 N  N   . PRO A 1 197 ? 8.540   33.179 48.222  1.00 23.07  ? 196  PRO A N   1 
ATOM   1519 C  CA  . PRO A 1 197 ? 7.423   33.248 49.134  1.00 20.29  ? 196  PRO A CA  1 
ATOM   1520 C  C   . PRO A 1 197 ? 7.931   33.653 50.519  1.00 26.98  ? 196  PRO A C   1 
ATOM   1521 O  O   . PRO A 1 197 ? 8.932   33.121 51.013  1.00 23.36  ? 196  PRO A O   1 
ATOM   1522 C  CB  . PRO A 1 197 ? 6.769   31.869 49.189  1.00 19.98  ? 196  PRO A CB  1 
ATOM   1523 C  CG  . PRO A 1 197 ? 7.665   30.923 48.414  1.00 24.10  ? 196  PRO A CG  1 
ATOM   1524 C  CD  . PRO A 1 197 ? 8.673   31.798 47.691  1.00 23.37  ? 196  PRO A CD  1 
ATOM   1525 N  N   . ILE A 1 198 ? 7.254   34.639 51.105  1.00 25.17  ? 197  ILE A N   1 
ATOM   1526 C  CA  . ILE A 1 198 ? 7.642   35.141 52.407  1.00 22.96  ? 197  ILE A CA  1 
ATOM   1527 C  C   . ILE A 1 198 ? 6.431   35.273 53.312  1.00 25.79  ? 197  ILE A C   1 
ATOM   1528 O  O   . ILE A 1 198 ? 5.281   35.395 52.833  1.00 22.84  ? 197  ILE A O   1 
ATOM   1529 C  CB  . ILE A 1 198 ? 8.228   36.535 52.230  1.00 23.36  ? 197  ILE A CB  1 
ATOM   1530 C  CG1 . ILE A 1 198 ? 7.164   37.355 51.526  1.00 25.01  ? 197  ILE A CG1 1 
ATOM   1531 C  CG2 . ILE A 1 198 ? 9.509   36.554 51.399  1.00 21.56  ? 197  ILE A CG2 1 
ATOM   1532 C  CD1 . ILE A 1 198 ? 7.429   38.859 51.634  1.00 22.37  ? 197  ILE A CD1 1 
ATOM   1533 N  N   . PRO A 1 199 ? 6.720   35.261 54.633  1.00 20.61  ? 198  PRO A N   1 
ATOM   1534 C  CA  . PRO A 1 199 ? 5.687   35.453 55.660  1.00 15.95  ? 198  PRO A CA  1 
ATOM   1535 C  C   . PRO A 1 199 ? 5.298   36.916 55.491  1.00 17.92  ? 198  PRO A C   1 
ATOM   1536 O  O   . PRO A 1 199 ? 6.185   37.687 55.086  1.00 17.98  ? 198  PRO A O   1 
ATOM   1537 C  CB  . PRO A 1 199 ? 6.399   35.297 57.011  1.00 15.44  ? 198  PRO A CB  1 
ATOM   1538 C  CG  . PRO A 1 199 ? 7.881   35.462 56.704  1.00 18.48  ? 198  PRO A CG  1 
ATOM   1539 C  CD  . PRO A 1 199 ? 8.088   35.164 55.223  1.00 15.86  ? 198  PRO A CD  1 
ATOM   1540 N  N   . CYS A 1 200 ? 4.030   37.325 55.748  1.00 18.80  ? 199  CYS A N   1 
ATOM   1541 C  CA  . CYS A 1 200 ? 3.646   38.750 55.529  1.00 19.91  ? 199  CYS A CA  1 
ATOM   1542 C  C   . CYS A 1 200 ? 4.363   39.820 56.400  1.00 22.70  ? 199  CYS A C   1 
ATOM   1543 O  O   . CYS A 1 200 ? 4.392   41.030 56.091  1.00 19.22  ? 199  CYS A O   1 
ATOM   1544 C  CB  . CYS A 1 200 ? 2.118   38.964 55.554  1.00 17.27  ? 199  CYS A CB  1 
ATOM   1545 S  SG  . CYS A 1 200 ? 1.359   38.495 57.126  1.00 22.02  ? 199  CYS A SG  1 
ATOM   1546 N  N   . TYR A 1 201 ? 4.963   39.375 57.512  1.00 20.55  ? 200  TYR A N   1 
ATOM   1547 C  CA  . TYR A 1 201 ? 5.652   40.318 58.356  1.00 19.65  ? 200  TYR A CA  1 
ATOM   1548 C  C   . TYR A 1 201 ? 6.894   40.879 57.724  1.00 24.32  ? 200  TYR A C   1 
ATOM   1549 O  O   . TYR A 1 201 ? 7.493   41.812 58.252  1.00 26.71  ? 200  TYR A O   1 
ATOM   1550 C  CB  . TYR A 1 201 ? 5.978   39.763 59.731  1.00 17.18  ? 200  TYR A CB  1 
ATOM   1551 C  CG  . TYR A 1 201 ? 7.086   38.751 59.710  1.00 17.72  ? 200  TYR A CG  1 
ATOM   1552 C  CD1 . TYR A 1 201 ? 8.409   39.169 59.846  1.00 16.87  ? 200  TYR A CD1 1 
ATOM   1553 C  CD2 . TYR A 1 201 ? 6.802   37.385 59.642  1.00 18.65  ? 200  TYR A CD2 1 
ATOM   1554 C  CE1 . TYR A 1 201 ? 9.432   38.221 59.864  1.00 14.67  ? 200  TYR A CE1 1 
ATOM   1555 C  CE2 . TYR A 1 201 ? 7.822   36.434 59.699  1.00 18.76  ? 200  TYR A CE2 1 
ATOM   1556 C  CZ  . TYR A 1 201 ? 9.146   36.855 59.802  1.00 20.42  ? 200  TYR A CZ  1 
ATOM   1557 O  OH  . TYR A 1 201 ? 10.169  35.921 59.858  1.00 17.42  ? 200  TYR A OH  1 
ATOM   1558 N  N   . LEU A 1 202 ? 7.280   40.312 56.590  1.00 16.84  ? 201  LEU A N   1 
ATOM   1559 C  CA  . LEU A 1 202 ? 8.436   40.765 55.864  1.00 14.82  ? 201  LEU A CA  1 
ATOM   1560 C  C   . LEU A 1 202 ? 8.078   41.787 54.785  1.00 24.60  ? 201  LEU A C   1 
ATOM   1561 O  O   . LEU A 1 202 ? 8.956   42.269 54.044  1.00 22.81  ? 201  LEU A O   1 
ATOM   1562 C  CB  . LEU A 1 202 ? 9.138   39.532 55.256  1.00 17.56  ? 201  LEU A CB  1 
ATOM   1563 C  CG  . LEU A 1 202 ? 9.910   38.670 56.257  1.00 16.40  ? 201  LEU A CG  1 
ATOM   1564 C  CD1 . LEU A 1 202 ? 10.674  37.594 55.489  1.00 15.76  ? 201  LEU A CD1 1 
ATOM   1565 C  CD2 . LEU A 1 202 ? 10.900  39.523 57.040  1.00 16.02  ? 201  LEU A CD2 1 
ATOM   1566 N  N   . ILE A 1 203 ? 6.761   42.084 54.657  1.00 24.26  ? 202  ILE A N   1 
ATOM   1567 C  CA  . ILE A 1 203 ? 6.293   43.088 53.698  1.00 20.28  ? 202  ILE A CA  1 
ATOM   1568 C  C   . ILE A 1 203 ? 6.703   44.481 54.226  1.00 25.46  ? 202  ILE A C   1 
ATOM   1569 O  O   . ILE A 1 203 ? 6.447   44.850 55.393  1.00 26.48  ? 202  ILE A O   1 
ATOM   1570 C  CB  . ILE A 1 203 ? 4.784   43.015 53.489  1.00 21.23  ? 202  ILE A CB  1 
ATOM   1571 C  CG1 . ILE A 1 203 ? 4.433   41.851 52.593  1.00 17.03  ? 202  ILE A CG1 1 
ATOM   1572 C  CG2 . ILE A 1 203 ? 4.312   44.312 52.826  1.00 23.71  ? 202  ILE A CG2 1 
ATOM   1573 C  CD1 . ILE A 1 203 ? 2.917   41.692 52.437  1.00 22.39  ? 202  ILE A CD1 1 
ATOM   1574 N  N   . ALA A 1 204 ? 7.375   45.252 53.384  1.00 17.97  ? 203  ALA A N   1 
ATOM   1575 C  CA  . ALA A 1 204 ? 7.860   46.568 53.782  1.00 22.84  ? 203  ALA A CA  1 
ATOM   1576 C  C   . ALA A 1 204 ? 7.849   47.593 52.658  1.00 30.22  ? 203  ALA A C   1 
ATOM   1577 O  O   . ALA A 1 204 ? 8.125   47.284 51.494  1.00 27.07  ? 203  ALA A O   1 
ATOM   1578 C  CB  . ALA A 1 204 ? 9.284   46.554 54.360  1.00 20.04  ? 203  ALA A CB  1 
ATOM   1579 N  N   . LEU A 1 205 ? 7.589   48.823 53.117  1.00 25.33  ? 204  LEU A N   1 
ATOM   1580 C  CA  . LEU A 1 205 ? 7.503   50.022 52.300  1.00 23.92  ? 204  LEU A CA  1 
ATOM   1581 C  C   . LEU A 1 205 ? 8.105   51.242 53.003  1.00 27.30  ? 204  LEU A C   1 
ATOM   1582 O  O   . LEU A 1 205 ? 8.004   51.419 54.219  1.00 24.19  ? 204  LEU A O   1 
ATOM   1583 C  CB  . LEU A 1 205 ? 6.008   50.269 51.933  1.00 22.42  ? 204  LEU A CB  1 
ATOM   1584 C  CG  . LEU A 1 205 ? 5.702   51.492 51.036  1.00 24.14  ? 204  LEU A CG  1 
ATOM   1585 C  CD1 . LEU A 1 205 ? 6.204   51.374 49.593  1.00 17.81  ? 204  LEU A CD1 1 
ATOM   1586 C  CD2 . LEU A 1 205 ? 4.210   51.792 51.073  1.00 26.36  ? 204  LEU A CD2 1 
ATOM   1587 N  N   . VAL A 1 206 ? 8.726   52.078 52.178  1.00 26.54  ? 205  VAL A N   1 
ATOM   1588 C  CA  . VAL A 1 206 ? 9.333   53.346 52.518  1.00 25.64  ? 205  VAL A CA  1 
ATOM   1589 C  C   . VAL A 1 206 ? 9.152   54.299 51.363  1.00 30.84  ? 205  VAL A C   1 
ATOM   1590 O  O   . VAL A 1 206 ? 9.382   53.955 50.204  1.00 29.34  ? 205  VAL A O   1 
ATOM   1591 C  CB  . VAL A 1 206 ? 10.827  53.298 52.785  1.00 27.61  ? 205  VAL A CB  1 
ATOM   1592 C  CG1 . VAL A 1 206 ? 11.551  52.637 51.625  1.00 25.87  ? 205  VAL A CG1 1 
ATOM   1593 C  CG2 . VAL A 1 206 ? 11.359  54.717 53.021  1.00 27.64  ? 205  VAL A CG2 1 
ATOM   1594 N  N   . VAL A 1 207 ? 8.763   55.503 51.704  1.00 28.24  ? 206  VAL A N   1 
ATOM   1595 C  CA  . VAL A 1 207 ? 8.600   56.544 50.709  1.00 27.85  ? 206  VAL A CA  1 
ATOM   1596 C  C   . VAL A 1 207 ? 9.246   57.813 51.206  1.00 30.43  ? 206  VAL A C   1 
ATOM   1597 O  O   . VAL A 1 207 ? 8.961   58.289 52.320  1.00 31.87  ? 206  VAL A O   1 
ATOM   1598 C  CB  . VAL A 1 207 ? 7.145   56.882 50.379  1.00 30.77  ? 206  VAL A CB  1 
ATOM   1599 C  CG1 . VAL A 1 207 ? 7.113   57.870 49.200  1.00 33.19  ? 206  VAL A CG1 1 
ATOM   1600 C  CG2 . VAL A 1 207 ? 6.336   55.620 50.078  1.00 26.71  ? 206  VAL A CG2 1 
ATOM   1601 N  N   . GLY A 1 208 ? 10.098  58.357 50.363  1.00 25.40  ? 207  GLY A N   1 
ATOM   1602 C  CA  . GLY A 1 208 ? 10.706  59.596 50.760  1.00 28.31  ? 207  GLY A CA  1 
ATOM   1603 C  C   . GLY A 1 208 ? 11.654  60.097 49.716  1.00 35.37  ? 207  GLY A C   1 
ATOM   1604 O  O   . GLY A 1 208 ? 11.688  59.549 48.615  1.00 34.13  ? 207  GLY A O   1 
ATOM   1605 N  N   . ALA A 1 209 ? 12.414  61.121 50.123  1.00 33.99  ? 208  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 209 ? 13.414  61.776 49.290  1.00 35.45  ? 208  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 209 ? 14.746  61.041 49.360  1.00 38.58  ? 208  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 209 ? 15.799  61.544 49.784  1.00 39.24  ? 208  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 209 ? 13.502  63.268 49.619  1.00 36.08  ? 208  ALA A CB  1 
ATOM   1610 N  N   . LEU A 1 210 ? 14.676  59.796 48.916  1.00 34.99  ? 209  LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 210 ? 15.821  58.918 48.962  1.00 32.15  ? 209  LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 210 ? 16.730  59.052 47.800  1.00 43.00  ? 209  LEU A C   1 
ATOM   1613 O  O   . LEU A 1 210 ? 16.298  59.315 46.679  1.00 44.56  ? 209  LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 210 ? 15.384  57.449 49.000  1.00 30.82  ? 209  LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 210 ? 14.293  57.238 50.030  1.00 34.48  ? 209  LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 210 ? 13.712  55.840 49.875  1.00 31.95  ? 209  LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 210 ? 14.955  57.428 51.386  1.00 31.78  ? 209  LEU A CD2 1 
ATOM   1618 N  N   . GLU A 1 211 ? 17.979  58.795 48.156  1.00 39.96  ? 210  GLU A N   1 
ATOM   1619 C  CA  . GLU A 1 211 ? 19.130  58.767 47.294  1.00 37.51  ? 210  GLU A CA  1 
ATOM   1620 C  C   . GLU A 1 211 ? 19.802  57.468 47.652  1.00 45.24  ? 210  GLU A C   1 
ATOM   1621 O  O   . GLU A 1 211 ? 19.520  56.916 48.716  1.00 45.87  ? 210  GLU A O   1 
ATOM   1622 C  CB  . GLU A 1 211 ? 20.088  59.940 47.570  1.00 39.44  ? 210  GLU A CB  1 
ATOM   1623 C  CG  . GLU A 1 211 ? 19.601  61.256 46.936  1.00 43.88  ? 210  GLU A CG  1 
ATOM   1624 C  CD  . GLU A 1 211 ? 20.679  62.289 46.960  1.00 83.62  ? 210  GLU A CD  1 
ATOM   1625 O  OE1 . GLU A 1 211 ? 21.851  62.020 47.179  1.00 69.67  ? 210  GLU A OE1 1 
ATOM   1626 O  OE2 . GLU A 1 211 ? 20.217  63.498 46.755  1.00 100.00 ? 210  GLU A OE2 1 
ATOM   1627 N  N   . SER A 1 212 ? 20.661  56.973 46.774  1.00 39.83  ? 211  SER A N   1 
ATOM   1628 C  CA  . SER A 1 212 ? 21.323  55.719 47.046  1.00 39.26  ? 211  SER A CA  1 
ATOM   1629 C  C   . SER A 1 212 ? 22.763  55.796 46.628  1.00 40.32  ? 211  SER A C   1 
ATOM   1630 O  O   . SER A 1 212 ? 23.122  56.657 45.861  1.00 47.20  ? 211  SER A O   1 
ATOM   1631 C  CB  . SER A 1 212 ? 20.662  54.587 46.273  1.00 44.16  ? 211  SER A CB  1 
ATOM   1632 O  OG  . SER A 1 212 ? 20.992  54.685 44.896  1.00 48.01  ? 211  SER A OG  1 
ATOM   1633 N  N   . ARG A 1 213 ? 23.589  54.915 47.123  1.00 30.46  ? 212  ARG A N   1 
ATOM   1634 C  CA  . ARG A 1 213 ? 24.981  54.860 46.737  1.00 30.14  ? 212  ARG A CA  1 
ATOM   1635 C  C   . ARG A 1 213 ? 25.200  53.371 46.539  1.00 38.14  ? 212  ARG A C   1 
ATOM   1636 O  O   . ARG A 1 213 ? 24.617  52.557 47.252  1.00 38.33  ? 212  ARG A O   1 
ATOM   1637 C  CB  . ARG A 1 213 ? 25.928  55.449 47.785  1.00 36.60  ? 212  ARG A CB  1 
ATOM   1638 C  CG  . ARG A 1 213 ? 26.973  56.473 47.307  1.00 66.52  ? 212  ARG A CG  1 
ATOM   1639 C  CD  . ARG A 1 213 ? 26.437  57.592 46.403  1.00 92.22  ? 212  ARG A CD  1 
ATOM   1640 N  NE  . ARG A 1 213 ? 26.336  58.944 46.974  1.00 88.06  ? 212  ARG A NE  1 
ATOM   1641 C  CZ  . ARG A 1 213 ? 25.429  59.863 46.586  1.00 100.00 ? 212  ARG A CZ  1 
ATOM   1642 N  NH1 . ARG A 1 213 ? 24.525  59.616 45.636  1.00 63.09  ? 212  ARG A NH1 1 
ATOM   1643 N  NH2 . ARG A 1 213 ? 25.405  61.069 47.169  1.00 100.00 ? 212  ARG A NH2 1 
ATOM   1644 N  N   . GLN A 1 214 ? 25.985  52.957 45.570  1.00 34.56  ? 213  GLN A N   1 
ATOM   1645 C  CA  . GLN A 1 214 ? 26.155  51.533 45.435  1.00 34.71  ? 213  GLN A CA  1 
ATOM   1646 C  C   . GLN A 1 214 ? 27.453  51.142 46.101  1.00 40.21  ? 213  GLN A C   1 
ATOM   1647 O  O   . GLN A 1 214 ? 28.493  51.737 45.826  1.00 41.35  ? 213  GLN A O   1 
ATOM   1648 C  CB  . GLN A 1 214 ? 26.081  51.014 44.000  1.00 36.31  ? 213  GLN A CB  1 
ATOM   1649 C  CG  . GLN A 1 214 ? 26.626  49.582 43.946  1.00 49.64  ? 213  GLN A CG  1 
ATOM   1650 C  CD  . GLN A 1 214 ? 26.775  49.077 42.531  1.00 80.06  ? 213  GLN A CD  1 
ATOM   1651 O  OE1 . GLN A 1 214 ? 26.908  47.861 42.312  1.00 77.10  ? 213  GLN A OE1 1 
ATOM   1652 N  NE2 . GLN A 1 214 ? 26.753  50.012 41.577  1.00 75.51  ? 213  GLN A NE2 1 
ATOM   1653 N  N   . ILE A 1 215 ? 27.370  50.166 47.007  1.00 35.56  ? 214  ILE A N   1 
ATOM   1654 C  CA  . ILE A 1 215 ? 28.531  49.737 47.760  1.00 32.74  ? 214  ILE A CA  1 
ATOM   1655 C  C   . ILE A 1 215 ? 28.947  48.311 47.535  1.00 28.86  ? 214  ILE A C   1 
ATOM   1656 O  O   . ILE A 1 215 ? 29.917  47.897 48.149  1.00 30.02  ? 214  ILE A O   1 
ATOM   1657 C  CB  . ILE A 1 215 ? 28.320  49.957 49.262  1.00 39.00  ? 214  ILE A CB  1 
ATOM   1658 C  CG1 . ILE A 1 215 ? 27.032  49.265 49.733  1.00 40.79  ? 214  ILE A CG1 1 
ATOM   1659 C  CG2 . ILE A 1 215 ? 28.198  51.447 49.566  1.00 39.90  ? 214  ILE A CG2 1 
ATOM   1660 C  CD1 . ILE A 1 215 ? 26.810  49.364 51.247  1.00 39.31  ? 214  ILE A CD1 1 
ATOM   1661 N  N   . GLY A 1 216 ? 28.231  47.569 46.691  1.00 29.42  ? 215  GLY A N   1 
ATOM   1662 C  CA  . GLY A 1 216 ? 28.518  46.166 46.367  1.00 26.41  ? 215  GLY A CA  1 
ATOM   1663 C  C   . GLY A 1 216 ? 27.778  45.743 45.106  1.00 30.00  ? 215  GLY A C   1 
ATOM   1664 O  O   . GLY A 1 216 ? 26.874  46.447 44.669  1.00 35.16  ? 215  GLY A O   1 
ATOM   1665 N  N   . PRO A 1 217 ? 28.131  44.608 44.497  1.00 33.24  ? 216  PRO A N   1 
ATOM   1666 C  CA  . PRO A 1 217 ? 27.459  44.197 43.262  1.00 33.84  ? 216  PRO A CA  1 
ATOM   1667 C  C   . PRO A 1 217 ? 25.979  43.984 43.441  1.00 39.13  ? 216  PRO A C   1 
ATOM   1668 O  O   . PRO A 1 217 ? 25.241  44.145 42.467  1.00 40.02  ? 216  PRO A O   1 
ATOM   1669 C  CB  . PRO A 1 217 ? 28.067  42.867 42.793  1.00 34.78  ? 216  PRO A CB  1 
ATOM   1670 C  CG  . PRO A 1 217 ? 29.020  42.415 43.897  1.00 38.44  ? 216  PRO A CG  1 
ATOM   1671 C  CD  . PRO A 1 217 ? 29.116  43.556 44.912  1.00 35.07  ? 216  PRO A CD  1 
ATOM   1672 N  N   . ARG A 1 218 ? 25.578  43.609 44.662  1.00 23.56  ? 217  ARG A N   1 
ATOM   1673 C  CA  . ARG A 1 218 ? 24.177  43.370 44.909  1.00 21.48  ? 217  ARG A CA  1 
ATOM   1674 C  C   . ARG A 1 218 ? 23.679  44.288 46.015  1.00 30.90  ? 217  ARG A C   1 
ATOM   1675 O  O   . ARG A 1 218 ? 22.706  44.002 46.713  1.00 27.14  ? 217  ARG A O   1 
ATOM   1676 C  CB  . ARG A 1 218 ? 23.926  41.920 45.247  1.00 22.22  ? 217  ARG A CB  1 
ATOM   1677 C  CG  . ARG A 1 218 ? 25.122  41.312 45.977  1.00 30.92  ? 217  ARG A CG  1 
ATOM   1678 C  CD  . ARG A 1 218 ? 24.882  39.839 46.242  1.00 25.36  ? 217  ARG A CD  1 
ATOM   1679 N  NE  . ARG A 1 218 ? 26.009  39.174 46.874  1.00 30.74  ? 217  ARG A NE  1 
ATOM   1680 C  CZ  . ARG A 1 218 ? 26.020  37.875 47.141  1.00 32.19  ? 217  ARG A CZ  1 
ATOM   1681 N  NH1 . ARG A 1 218 ? 24.991  37.088 46.838  1.00 29.57  ? 217  ARG A NH1 1 
ATOM   1682 N  NH2 . ARG A 1 218 ? 27.090  37.341 47.732  1.00 42.93  ? 217  ARG A NH2 1 
ATOM   1683 N  N   . THR A 1 219 ? 24.354  45.426 46.134  1.00 27.52  ? 218  THR A N   1 
ATOM   1684 C  CA  . THR A 1 219 ? 23.979  46.331 47.172  1.00 25.01  ? 218  THR A CA  1 
ATOM   1685 C  C   . THR A 1 219 ? 24.154  47.813 46.936  1.00 29.25  ? 218  THR A C   1 
ATOM   1686 O  O   . THR A 1 219 ? 25.256  48.269 46.674  1.00 32.56  ? 218  THR A O   1 
ATOM   1687 C  CB  . THR A 1 219 ? 24.877  46.003 48.388  1.00 30.92  ? 218  THR A CB  1 
ATOM   1688 O  OG1 . THR A 1 219 ? 24.591  44.711 48.891  1.00 28.41  ? 218  THR A OG1 1 
ATOM   1689 C  CG2 . THR A 1 219 ? 24.710  47.060 49.474  1.00 27.73  ? 218  THR A CG2 1 
ATOM   1690 N  N   . LEU A 1 220 ? 23.056  48.543 47.133  1.00 25.49  ? 219  LEU A N   1 
ATOM   1691 C  CA  . LEU A 1 220 ? 22.997  49.991 47.132  1.00 27.09  ? 219  LEU A CA  1 
ATOM   1692 C  C   . LEU A 1 220 ? 22.572  50.417 48.532  1.00 35.31  ? 219  LEU A C   1 
ATOM   1693 O  O   . LEU A 1 220 ? 21.748  49.739 49.162  1.00 32.55  ? 219  LEU A O   1 
ATOM   1694 C  CB  . LEU A 1 220 ? 21.822  50.526 46.319  1.00 29.51  ? 219  LEU A CB  1 
ATOM   1695 C  CG  . LEU A 1 220 ? 22.159  50.812 44.869  1.00 31.54  ? 219  LEU A CG  1 
ATOM   1696 C  CD1 . LEU A 1 220 ? 23.162  49.773 44.395  1.00 31.76  ? 219  LEU A CD1 1 
ATOM   1697 C  CD2 . LEU A 1 220 ? 20.836  50.658 44.148  1.00 32.31  ? 219  LEU A CD2 1 
ATOM   1698 N  N   . VAL A 1 221 ? 23.086  51.549 49.001  1.00 31.15  ? 220  VAL A N   1 
ATOM   1699 C  CA  . VAL A 1 221 ? 22.715  52.101 50.289  1.00 31.32  ? 220  VAL A CA  1 
ATOM   1700 C  C   . VAL A 1 221 ? 21.720  53.197 50.002  1.00 31.45  ? 220  VAL A C   1 
ATOM   1701 O  O   . VAL A 1 221 ? 22.004  54.072 49.190  1.00 31.85  ? 220  VAL A O   1 
ATOM   1702 C  CB  . VAL A 1 221 ? 23.878  52.729 51.089  1.00 39.68  ? 220  VAL A CB  1 
ATOM   1703 C  CG1 . VAL A 1 221 ? 23.538  52.833 52.574  1.00 37.81  ? 220  VAL A CG1 1 
ATOM   1704 C  CG2 . VAL A 1 221 ? 25.193  51.970 50.965  1.00 42.41  ? 220  VAL A CG2 1 
ATOM   1705 N  N   . TRP A 1 222 ? 20.579  53.168 50.665  1.00 28.89  ? 221  TRP A N   1 
ATOM   1706 C  CA  . TRP A 1 222 ? 19.574  54.197 50.471  1.00 30.76  ? 221  TRP A CA  1 
ATOM   1707 C  C   . TRP A 1 222 ? 19.317  55.010 51.729  1.00 38.31  ? 221  TRP A C   1 
ATOM   1708 O  O   . TRP A 1 222 ? 19.205  54.446 52.812  1.00 35.62  ? 221  TRP A O   1 
ATOM   1709 C  CB  . TRP A 1 222 ? 18.240  53.555 50.116  1.00 30.66  ? 221  TRP A CB  1 
ATOM   1710 C  CG  . TRP A 1 222 ? 18.321  52.711 48.896  1.00 34.85  ? 221  TRP A CG  1 
ATOM   1711 C  CD1 . TRP A 1 222 ? 18.752  51.434 48.798  1.00 37.00  ? 221  TRP A CD1 1 
ATOM   1712 C  CD2 . TRP A 1 222 ? 17.952  53.129 47.584  1.00 36.50  ? 221  TRP A CD2 1 
ATOM   1713 N  NE1 . TRP A 1 222 ? 18.648  51.014 47.501  1.00 35.82  ? 221  TRP A NE1 1 
ATOM   1714 C  CE2 . TRP A 1 222 ? 18.154  52.033 46.737  1.00 39.42  ? 221  TRP A CE2 1 
ATOM   1715 C  CE3 . TRP A 1 222 ? 17.429  54.325 47.067  1.00 36.65  ? 221  TRP A CE3 1 
ATOM   1716 C  CZ2 . TRP A 1 222 ? 17.864  52.123 45.374  1.00 38.93  ? 221  TRP A CZ2 1 
ATOM   1717 C  CZ3 . TRP A 1 222 ? 17.124  54.398 45.732  1.00 36.06  ? 221  TRP A CZ3 1 
ATOM   1718 C  CH2 . TRP A 1 222 ? 17.353  53.308 44.897  1.00 36.29  ? 221  TRP A CH2 1 
ATOM   1719 N  N   . SER A 1 223 ? 19.172  56.319 51.557  1.00 31.91  ? 222  SER A N   1 
ATOM   1720 C  CA  . SER A 1 223 ? 18.877  57.235 52.639  1.00 32.45  ? 222  SER A CA  1 
ATOM   1721 C  C   . SER A 1 223 ? 18.692  58.639 52.086  1.00 40.59  ? 222  SER A C   1 
ATOM   1722 O  O   . SER A 1 223 ? 18.918  58.901 50.894  1.00 40.28  ? 222  SER A O   1 
ATOM   1723 C  CB  . SER A 1 223 ? 19.941  57.242 53.735  1.00 31.75  ? 222  SER A CB  1 
ATOM   1724 O  OG  . SER A 1 223 ? 21.077  57.977 53.297  1.00 35.91  ? 222  SER A OG  1 
ATOM   1725 N  N   . GLU A 1 224 ? 18.277  59.534 52.972  1.00 31.05  ? 223  GLU A N   1 
ATOM   1726 C  CA  . GLU A 1 224 ? 18.173  60.885 52.539  1.00 28.81  ? 223  GLU A CA  1 
ATOM   1727 C  C   . GLU A 1 224 ? 19.612  61.239 52.186  1.00 38.65  ? 223  GLU A C   1 
ATOM   1728 O  O   . GLU A 1 224 ? 20.566  60.582 52.608  1.00 34.90  ? 223  GLU A O   1 
ATOM   1729 C  CB  . GLU A 1 224 ? 17.638  61.815 53.630  1.00 27.66  ? 223  GLU A CB  1 
ATOM   1730 C  CG  . GLU A 1 224 ? 16.099  61.840 53.673  1.00 36.07  ? 223  GLU A CG  1 
ATOM   1731 C  CD  . GLU A 1 224 ? 15.540  62.978 54.497  1.00 57.21  ? 223  GLU A CD  1 
ATOM   1732 O  OE1 . GLU A 1 224 ? 15.442  64.108 54.071  1.00 40.65  ? 223  GLU A OE1 1 
ATOM   1733 O  OE2 . GLU A 1 224 ? 15.155  62.645 55.711  1.00 38.93  ? 223  GLU A OE2 1 
ATOM   1734 N  N   . LYS A 1 225 ? 19.740  62.273 51.372  1.00 39.48  ? 224  LYS A N   1 
ATOM   1735 C  CA  . LYS A 1 225 ? 20.983  62.809 50.871  1.00 37.65  ? 224  LYS A CA  1 
ATOM   1736 C  C   . LYS A 1 225 ? 22.045  62.999 51.962  1.00 35.43  ? 224  LYS A C   1 
ATOM   1737 O  O   . LYS A 1 225 ? 23.215  62.614 51.833  1.00 35.56  ? 224  LYS A O   1 
ATOM   1738 C  CB  . LYS A 1 225 ? 20.645  64.109 50.115  1.00 39.12  ? 224  LYS A CB  1 
ATOM   1739 C  CG  . LYS A 1 225 ? 21.806  64.741 49.359  1.00 73.65  ? 224  LYS A CG  1 
ATOM   1740 C  CD  . LYS A 1 225 ? 21.391  65.942 48.513  1.00 100.00 ? 224  LYS A CD  1 
ATOM   1741 C  CE  . LYS A 1 225 ? 21.854  67.295 49.055  1.00 100.00 ? 224  LYS A CE  1 
ATOM   1742 N  NZ  . LYS A 1 225 ? 21.228  68.446 48.366  1.00 100.00 ? 224  LYS A NZ  1 
ATOM   1743 N  N   . GLU A 1 226 ? 21.631  63.614 53.061  1.00 29.04  ? 225  GLU A N   1 
ATOM   1744 C  CA  . GLU A 1 226 ? 22.503  63.910 54.177  1.00 29.49  ? 225  GLU A CA  1 
ATOM   1745 C  C   . GLU A 1 226 ? 23.114  62.705 54.868  1.00 38.42  ? 225  GLU A C   1 
ATOM   1746 O  O   . GLU A 1 226 ? 24.074  62.857 55.612  1.00 41.35  ? 225  GLU A O   1 
ATOM   1747 C  CB  . GLU A 1 226 ? 21.760  64.741 55.223  1.00 32.49  ? 225  GLU A CB  1 
ATOM   1748 C  CG  . GLU A 1 226 ? 20.251  64.516 55.075  1.00 59.17  ? 225  GLU A CG  1 
ATOM   1749 C  CD  . GLU A 1 226 ? 19.687  65.377 53.982  1.00 72.33  ? 225  GLU A CD  1 
ATOM   1750 O  OE1 . GLU A 1 226 ? 20.013  66.539 53.851  1.00 51.07  ? 225  GLU A OE1 1 
ATOM   1751 O  OE2 . GLU A 1 226 ? 18.840  64.757 53.195  1.00 54.65  ? 225  GLU A OE2 1 
ATOM   1752 N  N   . GLN A 1 227 ? 22.575  61.511 54.647  1.00 36.99  ? 226  GLN A N   1 
ATOM   1753 C  CA  . GLN A 1 227 ? 23.114  60.333 55.307  1.00 33.80  ? 226  GLN A CA  1 
ATOM   1754 C  C   . GLN A 1 227 ? 23.845  59.389 54.379  1.00 32.45  ? 226  GLN A C   1 
ATOM   1755 O  O   . GLN A 1 227 ? 24.549  58.487 54.812  1.00 29.61  ? 226  GLN A O   1 
ATOM   1756 C  CB  . GLN A 1 227 ? 21.953  59.585 55.988  1.00 33.92  ? 226  GLN A CB  1 
ATOM   1757 C  CG  . GLN A 1 227 ? 21.625  60.145 57.379  1.00 27.50  ? 226  GLN A CG  1 
ATOM   1758 C  CD  . GLN A 1 227 ? 21.179  61.600 57.359  1.00 47.10  ? 226  GLN A CD  1 
ATOM   1759 O  OE1 . GLN A 1 227 ? 21.839  62.495 57.933  1.00 40.63  ? 226  GLN A OE1 1 
ATOM   1760 N  NE2 . GLN A 1 227 ? 20.042  61.842 56.717  1.00 26.24  ? 226  GLN A NE2 1 
ATOM   1761 N  N   . VAL A 1 228 ? 23.678  59.591 53.084  1.00 33.73  ? 227  VAL A N   1 
ATOM   1762 C  CA  . VAL A 1 228 ? 24.256  58.708 52.072  1.00 36.03  ? 227  VAL A CA  1 
ATOM   1763 C  C   . VAL A 1 228 ? 25.733  58.366 52.155  1.00 38.24  ? 227  VAL A C   1 
ATOM   1764 O  O   . VAL A 1 228 ? 26.180  57.209 52.105  1.00 36.89  ? 227  VAL A O   1 
ATOM   1765 C  CB  . VAL A 1 228 ? 23.935  59.160 50.648  1.00 41.90  ? 227  VAL A CB  1 
ATOM   1766 C  CG1 . VAL A 1 228 ? 25.168  58.940 49.784  1.00 41.75  ? 227  VAL A CG1 1 
ATOM   1767 C  CG2 . VAL A 1 228 ? 22.767  58.374 50.066  1.00 41.36  ? 227  VAL A CG2 1 
ATOM   1768 N  N   . GLU A 1 229 ? 26.504  59.419 52.206  1.00 29.72  ? 228  GLU A N   1 
ATOM   1769 C  CA  . GLU A 1 229 ? 27.917  59.259 52.217  1.00 29.22  ? 228  GLU A CA  1 
ATOM   1770 C  C   . GLU A 1 229 ? 28.437  58.475 53.393  1.00 34.68  ? 228  GLU A C   1 
ATOM   1771 O  O   . GLU A 1 229 ? 29.243  57.544 53.266  1.00 34.08  ? 228  GLU A O   1 
ATOM   1772 C  CB  . GLU A 1 229 ? 28.512  60.665 52.133  1.00 33.75  ? 228  GLU A CB  1 
ATOM   1773 C  CG  . GLU A 1 229 ? 28.603  61.094 50.642  1.00 67.15  ? 228  GLU A CG  1 
ATOM   1774 C  CD  . GLU A 1 229 ? 29.180  60.016 49.748  1.00 100.00 ? 228  GLU A CD  1 
ATOM   1775 O  OE1 . GLU A 1 229 ? 30.366  59.735 49.725  1.00 100.00 ? 228  GLU A OE1 1 
ATOM   1776 O  OE2 . GLU A 1 229 ? 28.288  59.395 49.010  1.00 93.51  ? 228  GLU A OE2 1 
ATOM   1777 N  N   . LYS A 1 230 ? 27.966  58.893 54.561  1.00 35.63  ? 229  LYS A N   1 
ATOM   1778 C  CA  . LYS A 1 230 ? 28.363  58.244 55.804  1.00 35.00  ? 229  LYS A CA  1 
ATOM   1779 C  C   . LYS A 1 230 ? 27.866  56.794 55.838  1.00 29.64  ? 229  LYS A C   1 
ATOM   1780 O  O   . LYS A 1 230 ? 28.543  55.844 56.251  1.00 32.26  ? 229  LYS A O   1 
ATOM   1781 C  CB  . LYS A 1 230 ? 27.924  59.086 56.995  1.00 40.51  ? 229  LYS A CB  1 
ATOM   1782 C  CG  . LYS A 1 230 ? 28.344  58.551 58.355  1.00 81.35  ? 229  LYS A CG  1 
ATOM   1783 C  CD  . LYS A 1 230 ? 28.898  59.623 59.293  1.00 100.00 ? 229  LYS A CD  1 
ATOM   1784 C  CE  . LYS A 1 230 ? 29.377  59.096 60.648  1.00 100.00 ? 229  LYS A CE  1 
ATOM   1785 N  NZ  . LYS A 1 230 ? 30.083  60.097 61.477  1.00 100.00 ? 229  LYS A NZ  1 
ATOM   1786 N  N   . SER A 1 231 ? 26.660  56.593 55.349  1.00 23.52  ? 230  SER A N   1 
ATOM   1787 C  CA  . SER A 1 231 ? 26.178  55.239 55.340  1.00 22.02  ? 230  SER A CA  1 
ATOM   1788 C  C   . SER A 1 231 ? 27.057  54.388 54.459  1.00 28.88  ? 230  SER A C   1 
ATOM   1789 O  O   . SER A 1 231 ? 27.446  53.270 54.798  1.00 26.72  ? 230  SER A O   1 
ATOM   1790 C  CB  . SER A 1 231 ? 24.794  55.259 54.768  1.00 24.16  ? 230  SER A CB  1 
ATOM   1791 O  OG  . SER A 1 231 ? 23.976  55.991 55.660  1.00 31.92  ? 230  SER A OG  1 
ATOM   1792 N  N   . ALA A 1 232 ? 27.338  54.956 53.295  1.00 30.71  ? 231  ALA A N   1 
ATOM   1793 C  CA  . ALA A 1 232 ? 28.162  54.287 52.314  1.00 31.57  ? 231  ALA A CA  1 
ATOM   1794 C  C   . ALA A 1 232 ? 29.460  53.827 52.957  1.00 35.46  ? 231  ALA A C   1 
ATOM   1795 O  O   . ALA A 1 232 ? 29.919  52.702 52.752  1.00 38.54  ? 231  ALA A O   1 
ATOM   1796 C  CB  . ALA A 1 232 ? 28.363  55.167 51.087  1.00 31.57  ? 231  ALA A CB  1 
ATOM   1797 N  N   . TYR A 1 233 ? 30.052  54.699 53.773  1.00 32.67  ? 232  TYR A N   1 
ATOM   1798 C  CA  . TYR A 1 233 ? 31.271  54.323 54.472  1.00 30.97  ? 232  TYR A CA  1 
ATOM   1799 C  C   . TYR A 1 233 ? 31.016  53.245 55.541  1.00 31.41  ? 232  TYR A C   1 
ATOM   1800 O  O   . TYR A 1 233 ? 31.694  52.206 55.613  1.00 25.59  ? 232  TYR A O   1 
ATOM   1801 C  CB  . TYR A 1 233 ? 31.896  55.533 55.199  1.00 31.17  ? 232  TYR A CB  1 
ATOM   1802 C  CG  . TYR A 1 233 ? 33.004  55.084 56.136  1.00 36.66  ? 232  TYR A CG  1 
ATOM   1803 C  CD1 . TYR A 1 233 ? 34.306  54.872 55.667  1.00 38.45  ? 232  TYR A CD1 1 
ATOM   1804 C  CD2 . TYR A 1 233 ? 32.744  54.825 57.484  1.00 38.25  ? 232  TYR A CD2 1 
ATOM   1805 C  CE1 . TYR A 1 233 ? 35.336  54.432 56.501  1.00 38.86  ? 232  TYR A CE1 1 
ATOM   1806 C  CE2 . TYR A 1 233 ? 33.761  54.375 58.332  1.00 40.20  ? 232  TYR A CE2 1 
ATOM   1807 C  CZ  . TYR A 1 233 ? 35.054  54.174 57.844  1.00 53.86  ? 232  TYR A CZ  1 
ATOM   1808 O  OH  . TYR A 1 233 ? 36.048  53.741 58.690  1.00 61.49  ? 232  TYR A OH  1 
ATOM   1809 N  N   . GLU A 1 234 ? 30.031  53.541 56.397  1.00 25.55  ? 233  GLU A N   1 
ATOM   1810 C  CA  . GLU A 1 234 ? 29.707  52.671 57.515  1.00 26.18  ? 233  GLU A CA  1 
ATOM   1811 C  C   . GLU A 1 234 ? 29.512  51.180 57.188  1.00 29.28  ? 233  GLU A C   1 
ATOM   1812 O  O   . GLU A 1 234 ? 29.995  50.286 57.894  1.00 24.42  ? 233  GLU A O   1 
ATOM   1813 C  CB  . GLU A 1 234 ? 28.552  53.249 58.378  1.00 25.67  ? 233  GLU A CB  1 
ATOM   1814 C  CG  . GLU A 1 234 ? 28.555  52.694 59.834  1.00 18.89  ? 233  GLU A CG  1 
ATOM   1815 C  CD  . GLU A 1 234 ? 29.382  53.550 60.760  1.00 26.93  ? 233  GLU A CD  1 
ATOM   1816 O  OE1 . GLU A 1 234 ? 29.452  54.765 60.620  1.00 27.88  ? 233  GLU A OE1 1 
ATOM   1817 O  OE2 . GLU A 1 234 ? 30.040  52.884 61.693  1.00 24.94  ? 233  GLU A OE2 1 
ATOM   1818 N  N   . PHE A 1 235 ? 28.771  50.928 56.103  1.00 24.06  ? 234  PHE A N   1 
ATOM   1819 C  CA  . PHE A 1 235 ? 28.405  49.601 55.690  1.00 21.98  ? 234  PHE A CA  1 
ATOM   1820 C  C   . PHE A 1 235 ? 29.236  48.989 54.590  1.00 28.86  ? 234  PHE A C   1 
ATOM   1821 O  O   . PHE A 1 235 ? 28.824  48.018 53.970  1.00 31.83  ? 234  PHE A O   1 
ATOM   1822 C  CB  . PHE A 1 235 ? 26.896  49.559 55.393  1.00 24.08  ? 234  PHE A CB  1 
ATOM   1823 C  CG  . PHE A 1 235 ? 26.104  50.243 56.504  1.00 26.00  ? 234  PHE A CG  1 
ATOM   1824 C  CD1 . PHE A 1 235 ? 26.254  49.860 57.840  1.00 25.17  ? 234  PHE A CD1 1 
ATOM   1825 C  CD2 . PHE A 1 235 ? 25.221  51.293 56.243  1.00 24.04  ? 234  PHE A CD2 1 
ATOM   1826 C  CE1 . PHE A 1 235 ? 25.543  50.470 58.875  1.00 22.99  ? 234  PHE A CE1 1 
ATOM   1827 C  CE2 . PHE A 1 235 ? 24.510  51.932 57.263  1.00 27.32  ? 234  PHE A CE2 1 
ATOM   1828 C  CZ  . PHE A 1 235 ? 24.676  51.524 58.588  1.00 21.69  ? 234  PHE A CZ  1 
ATOM   1829 N  N   . SER A 1 236 ? 30.404  49.560 54.355  1.00 26.37  ? 235  SER A N   1 
ATOM   1830 C  CA  . SER A 1 236 ? 31.316  49.070 53.330  1.00 23.42  ? 235  SER A CA  1 
ATOM   1831 C  C   . SER A 1 236 ? 31.477  47.546 53.325  1.00 29.66  ? 235  SER A C   1 
ATOM   1832 O  O   . SER A 1 236 ? 31.561  46.923 52.270  1.00 28.78  ? 235  SER A O   1 
ATOM   1833 C  CB  . SER A 1 236 ? 32.649  49.751 53.541  1.00 21.15  ? 235  SER A CB  1 
ATOM   1834 O  OG  . SER A 1 236 ? 33.483  48.977 54.386  1.00 30.93  ? 235  SER A OG  1 
ATOM   1835 N  N   . GLU A 1 237 ? 31.514  46.917 54.506  1.00 26.42  ? 236  GLU A N   1 
ATOM   1836 C  CA  . GLU A 1 237 ? 31.708  45.477 54.600  1.00 24.96  ? 236  GLU A CA  1 
ATOM   1837 C  C   . GLU A 1 237 ? 30.566  44.562 54.193  1.00 25.09  ? 236  GLU A C   1 
ATOM   1838 O  O   . GLU A 1 237 ? 30.719  43.346 54.196  1.00 24.51  ? 236  GLU A O   1 
ATOM   1839 C  CB  . GLU A 1 237 ? 32.243  45.007 55.968  1.00 27.28  ? 236  GLU A CB  1 
ATOM   1840 C  CG  . GLU A 1 237 ? 33.391  45.867 56.539  1.00 29.83  ? 236  GLU A CG  1 
ATOM   1841 C  CD  . GLU A 1 237 ? 33.396  45.909 58.055  1.00 62.44  ? 236  GLU A CD  1 
ATOM   1842 O  OE1 . GLU A 1 237 ? 32.410  46.157 58.739  1.00 33.13  ? 236  GLU A OE1 1 
ATOM   1843 O  OE2 . GLU A 1 237 ? 34.574  45.665 58.572  1.00 45.68  ? 236  GLU A OE2 1 
ATOM   1844 N  N   . THR A 1 238 ? 29.428  45.112 53.843  1.00 20.37  ? 237  THR A N   1 
ATOM   1845 C  CA  . THR A 1 238 ? 28.298  44.271 53.487  1.00 20.82  ? 237  THR A CA  1 
ATOM   1846 C  C   . THR A 1 238 ? 28.534  43.130 52.541  1.00 29.25  ? 237  THR A C   1 
ATOM   1847 O  O   . THR A 1 238 ? 28.150  42.007 52.817  1.00 32.13  ? 237  THR A O   1 
ATOM   1848 C  CB  . THR A 1 238 ? 27.137  45.128 52.989  1.00 27.71  ? 237  THR A CB  1 
ATOM   1849 O  OG1 . THR A 1 238 ? 26.840  46.044 54.020  1.00 30.30  ? 237  THR A OG1 1 
ATOM   1850 C  CG2 . THR A 1 238 ? 25.909  44.303 52.610  1.00 21.64  ? 237  THR A CG2 1 
ATOM   1851 N  N   . GLU A 1 239 ? 29.126  43.411 51.399  1.00 26.94  ? 238  GLU A N   1 
ATOM   1852 C  CA  . GLU A 1 239 ? 29.306  42.335 50.454  1.00 27.70  ? 238  GLU A CA  1 
ATOM   1853 C  C   . GLU A 1 239 ? 30.150  41.241 51.009  1.00 26.72  ? 238  GLU A C   1 
ATOM   1854 O  O   . GLU A 1 239 ? 29.896  40.077 50.782  1.00 32.69  ? 238  GLU A O   1 
ATOM   1855 C  CB  . GLU A 1 239 ? 29.844  42.795 49.088  1.00 28.58  ? 238  GLU A CB  1 
ATOM   1856 C  CG  . GLU A 1 239 ? 30.088  41.593 48.154  1.00 27.86  ? 238  GLU A CG  1 
ATOM   1857 C  CD  . GLU A 1 239 ? 28.859  40.827 47.718  1.00 21.53  ? 238  GLU A CD  1 
ATOM   1858 O  OE1 . GLU A 1 239 ? 27.709  41.240 47.709  1.00 31.37  ? 238  GLU A OE1 1 
ATOM   1859 O  OE2 . GLU A 1 239 ? 29.193  39.652 47.262  1.00 28.77  ? 238  GLU A OE2 1 
ATOM   1860 N  N   . SER A 1 240 ? 31.179  41.605 51.727  1.00 21.43  ? 239  SER A N   1 
ATOM   1861 C  CA  . SER A 1 240 ? 32.002  40.540 52.279  1.00 20.35  ? 239  SER A CA  1 
ATOM   1862 C  C   . SER A 1 240 ? 31.235  39.691 53.270  1.00 27.26  ? 239  SER A C   1 
ATOM   1863 O  O   . SER A 1 240 ? 31.524  38.499 53.482  1.00 24.57  ? 239  SER A O   1 
ATOM   1864 C  CB  . SER A 1 240 ? 33.268  41.078 52.951  1.00 28.19  ? 239  SER A CB  1 
ATOM   1865 O  OG  . SER A 1 240 ? 32.986  41.780 54.157  1.00 38.57  ? 239  SER A OG  1 
ATOM   1866 N  N   . MET A 1 241 ? 30.240  40.330 53.910  1.00 26.94  ? 240  MET A N   1 
ATOM   1867 C  CA  . MET A 1 241 ? 29.432  39.610 54.898  1.00 20.31  ? 240  MET A CA  1 
ATOM   1868 C  C   . MET A 1 241 ? 28.541  38.616 54.210  1.00 17.27  ? 240  MET A C   1 
ATOM   1869 O  O   . MET A 1 241 ? 28.413  37.482 54.657  1.00 19.98  ? 240  MET A O   1 
ATOM   1870 C  CB  . MET A 1 241 ? 28.609  40.545 55.802  1.00 20.22  ? 240  MET A CB  1 
ATOM   1871 C  CG  . MET A 1 241 ? 29.543  41.286 56.744  1.00 21.15  ? 240  MET A CG  1 
ATOM   1872 S  SD  . MET A 1 241 ? 28.696  42.501 57.783  1.00 24.45  ? 240  MET A SD  1 
ATOM   1873 C  CE  . MET A 1 241 ? 29.842  42.552 59.180  1.00 22.66  ? 240  MET A CE  1 
ATOM   1874 N  N   . LEU A 1 242 ? 27.958  39.073 53.114  1.00 21.32  ? 241  LEU A N   1 
ATOM   1875 C  CA  . LEU A 1 242 ? 27.070  38.293 52.255  1.00 24.19  ? 241  LEU A CA  1 
ATOM   1876 C  C   . LEU A 1 242 ? 27.822  37.062 51.812  1.00 27.53  ? 241  LEU A C   1 
ATOM   1877 O  O   . LEU A 1 242 ? 27.328  35.950 51.882  1.00 29.31  ? 241  LEU A O   1 
ATOM   1878 C  CB  . LEU A 1 242 ? 26.656  39.080 50.991  1.00 25.13  ? 241  LEU A CB  1 
ATOM   1879 C  CG  . LEU A 1 242 ? 25.493  40.037 51.219  1.00 30.35  ? 241  LEU A CG  1 
ATOM   1880 C  CD1 . LEU A 1 242 ? 25.400  41.089 50.119  1.00 27.92  ? 241  LEU A CD1 1 
ATOM   1881 C  CD2 . LEU A 1 242 ? 24.213  39.220 51.277  1.00 33.53  ? 241  LEU A CD2 1 
ATOM   1882 N  N   . LYS A 1 243 ? 29.060  37.257 51.378  1.00 25.05  ? 242  LYS A N   1 
ATOM   1883 C  CA  . LYS A 1 243 ? 29.822  36.095 50.972  1.00 23.44  ? 242  LYS A CA  1 
ATOM   1884 C  C   . LYS A 1 243 ? 30.013  35.091 52.100  1.00 24.02  ? 242  LYS A C   1 
ATOM   1885 O  O   . LYS A 1 243 ? 29.895  33.880 51.889  1.00 20.91  ? 242  LYS A O   1 
ATOM   1886 C  CB  . LYS A 1 243 ? 31.131  36.414 50.252  1.00 26.75  ? 242  LYS A CB  1 
ATOM   1887 C  CG  . LYS A 1 243 ? 30.946  36.983 48.856  1.00 34.89  ? 242  LYS A CG  1 
ATOM   1888 C  CD  . LYS A 1 243 ? 31.238  38.475 48.764  1.00 72.37  ? 242  LYS A CD  1 
ATOM   1889 C  CE  . LYS A 1 243 ? 32.118  38.849 47.572  1.00 83.37  ? 242  LYS A CE  1 
ATOM   1890 N  NZ  . LYS A 1 243 ? 31.373  39.172 46.343  1.00 63.05  ? 242  LYS A NZ  1 
ATOM   1891 N  N   . ILE A 1 244 ? 30.332  35.551 53.319  1.00 21.99  ? 243  ILE A N   1 
ATOM   1892 C  CA  . ILE A 1 244 ? 30.530  34.589 54.412  1.00 21.52  ? 243  ILE A CA  1 
ATOM   1893 C  C   . ILE A 1 244 ? 29.251  33.777 54.684  1.00 22.96  ? 243  ILE A C   1 
ATOM   1894 O  O   . ILE A 1 244 ? 29.197  32.554 54.801  1.00 22.71  ? 243  ILE A O   1 
ATOM   1895 C  CB  . ILE A 1 244 ? 31.058  35.328 55.644  1.00 26.02  ? 243  ILE A CB  1 
ATOM   1896 C  CG1 . ILE A 1 244 ? 32.372  36.021 55.261  1.00 31.56  ? 243  ILE A CG1 1 
ATOM   1897 C  CG2 . ILE A 1 244 ? 31.313  34.376 56.803  1.00 22.17  ? 243  ILE A CG2 1 
ATOM   1898 C  CD1 . ILE A 1 244 ? 33.036  36.860 56.363  1.00 18.00  ? 243  ILE A CD1 1 
ATOM   1899 N  N   . ALA A 1 245 ? 28.166  34.528 54.762  1.00 25.12  ? 244  ALA A N   1 
ATOM   1900 C  CA  . ALA A 1 245 ? 26.863  33.979 55.015  1.00 23.22  ? 244  ALA A CA  1 
ATOM   1901 C  C   . ALA A 1 245 ? 26.500  32.902 53.995  1.00 29.00  ? 244  ALA A C   1 
ATOM   1902 O  O   . ALA A 1 245 ? 25.878  31.893 54.323  1.00 28.18  ? 244  ALA A O   1 
ATOM   1903 C  CB  . ALA A 1 245 ? 25.901  35.157 55.072  1.00 21.72  ? 244  ALA A CB  1 
ATOM   1904 N  N   . GLU A 1 246 ? 26.892  33.104 52.731  1.00 27.16  ? 245  GLU A N   1 
ATOM   1905 C  CA  . GLU A 1 246 ? 26.581  32.130 51.706  1.00 22.70  ? 245  GLU A CA  1 
ATOM   1906 C  C   . GLU A 1 246 ? 27.328  30.874 52.001  1.00 25.30  ? 245  GLU A C   1 
ATOM   1907 O  O   . GLU A 1 246 ? 26.844  29.762 51.887  1.00 28.85  ? 245  GLU A O   1 
ATOM   1908 C  CB  . GLU A 1 246 ? 26.915  32.653 50.315  1.00 22.34  ? 245  GLU A CB  1 
ATOM   1909 C  CG  . GLU A 1 246 ? 25.838  33.625 49.841  1.00 26.07  ? 245  GLU A CG  1 
ATOM   1910 C  CD  . GLU A 1 246 ? 26.137  34.180 48.472  1.00 52.41  ? 245  GLU A CD  1 
ATOM   1911 O  OE1 . GLU A 1 246 ? 27.101  34.897 48.236  1.00 39.38  ? 245  GLU A OE1 1 
ATOM   1912 O  OE2 . GLU A 1 246 ? 25.260  33.798 47.566  1.00 37.85  ? 245  GLU A OE2 1 
ATOM   1913 N  N   . ASP A 1 247 ? 28.540  31.079 52.445  1.00 27.12  ? 246  ASP A N   1 
ATOM   1914 C  CA  . ASP A 1 247 ? 29.361  29.946 52.792  1.00 29.38  ? 246  ASP A CA  1 
ATOM   1915 C  C   . ASP A 1 247 ? 28.782  29.251 53.996  1.00 27.88  ? 246  ASP A C   1 
ATOM   1916 O  O   . ASP A 1 247 ? 28.832  28.037 54.170  1.00 23.60  ? 246  ASP A O   1 
ATOM   1917 C  CB  . ASP A 1 247 ? 30.857  30.287 53.015  1.00 34.30  ? 246  ASP A CB  1 
ATOM   1918 C  CG  . ASP A 1 247 ? 31.627  29.070 53.420  1.00 63.22  ? 246  ASP A CG  1 
ATOM   1919 O  OD1 . ASP A 1 247 ? 31.877  28.135 52.678  1.00 70.56  ? 246  ASP A OD1 1 
ATOM   1920 O  OD2 . ASP A 1 247 ? 31.934  29.082 54.686  1.00 89.74  ? 246  ASP A OD2 1 
ATOM   1921 N  N   . LEU A 1 248 ? 28.191  30.025 54.861  1.00 22.96  ? 247  LEU A N   1 
ATOM   1922 C  CA  . LEU A 1 248 ? 27.644  29.333 56.028  1.00 26.75  ? 247  LEU A CA  1 
ATOM   1923 C  C   . LEU A 1 248 ? 26.274  28.715 55.782  1.00 25.45  ? 247  LEU A C   1 
ATOM   1924 O  O   . LEU A 1 248 ? 25.966  27.625 56.268  1.00 26.16  ? 247  LEU A O   1 
ATOM   1925 C  CB  . LEU A 1 248 ? 27.522  30.296 57.251  1.00 28.55  ? 247  LEU A CB  1 
ATOM   1926 C  CG  . LEU A 1 248 ? 28.834  30.551 58.009  1.00 35.08  ? 247  LEU A CG  1 
ATOM   1927 C  CD1 . LEU A 1 248 ? 30.008  30.474 57.061  1.00 37.19  ? 247  LEU A CD1 1 
ATOM   1928 C  CD2 . LEU A 1 248 ? 28.799  31.948 58.597  1.00 33.92  ? 247  LEU A CD2 1 
ATOM   1929 N  N   . GLY A 1 249 ? 25.401  29.437 55.086  1.00 21.51  ? 248  GLY A N   1 
ATOM   1930 C  CA  . GLY A 1 249 ? 24.075  28.880 54.940  1.00 22.31  ? 248  GLY A CA  1 
ATOM   1931 C  C   . GLY A 1 249 ? 23.729  28.415 53.550  1.00 28.05  ? 248  GLY A C   1 
ATOM   1932 O  O   . GLY A 1 249 ? 22.623  27.946 53.306  1.00 27.83  ? 248  GLY A O   1 
ATOM   1933 N  N   . GLY A 1 250 ? 24.657  28.534 52.622  1.00 23.33  ? 249  GLY A N   1 
ATOM   1934 C  CA  . GLY A 1 250 ? 24.262  28.120 51.289  1.00 21.34  ? 249  GLY A CA  1 
ATOM   1935 C  C   . GLY A 1 250 ? 23.976  29.381 50.493  1.00 30.63  ? 249  GLY A C   1 
ATOM   1936 O  O   . GLY A 1 250 ? 24.178  30.490 50.960  1.00 30.72  ? 249  GLY A O   1 
ATOM   1937 N  N   . PRO A 1 251 ? 23.527  29.227 49.262  1.00 37.05  ? 250  PRO A N   1 
ATOM   1938 C  CA  . PRO A 1 251 ? 23.264  30.361 48.403  1.00 37.47  ? 250  PRO A CA  1 
ATOM   1939 C  C   . PRO A 1 251 ? 22.230  31.367 48.883  1.00 35.89  ? 250  PRO A C   1 
ATOM   1940 O  O   . PRO A 1 251 ? 21.184  31.002 49.410  1.00 32.74  ? 250  PRO A O   1 
ATOM   1941 C  CB  . PRO A 1 251 ? 22.704  29.749 47.114  1.00 41.49  ? 250  PRO A CB  1 
ATOM   1942 C  CG  . PRO A 1 251 ? 22.260  28.330 47.442  1.00 47.11  ? 250  PRO A CG  1 
ATOM   1943 C  CD  . PRO A 1 251 ? 22.942  27.959 48.743  1.00 40.92  ? 250  PRO A CD  1 
ATOM   1944 N  N   . TYR A 1 252 ? 22.533  32.637 48.620  1.00 27.85  ? 251  TYR A N   1 
ATOM   1945 C  CA  . TYR A 1 252 ? 21.660  33.756 48.887  1.00 24.11  ? 251  TYR A CA  1 
ATOM   1946 C  C   . TYR A 1 252 ? 20.665  33.769 47.747  1.00 30.54  ? 251  TYR A C   1 
ATOM   1947 O  O   . TYR A 1 252 ? 21.068  34.022 46.622  1.00 36.51  ? 251  TYR A O   1 
ATOM   1948 C  CB  . TYR A 1 252 ? 22.482  35.026 48.722  1.00 22.57  ? 251  TYR A CB  1 
ATOM   1949 C  CG  . TYR A 1 252 ? 21.650  36.243 48.975  1.00 24.77  ? 251  TYR A CG  1 
ATOM   1950 C  CD1 . TYR A 1 252 ? 21.189  36.479 50.269  1.00 28.27  ? 251  TYR A CD1 1 
ATOM   1951 C  CD2 . TYR A 1 252 ? 21.288  37.118 47.953  1.00 23.82  ? 251  TYR A CD2 1 
ATOM   1952 C  CE1 . TYR A 1 252 ? 20.398  37.589 50.560  1.00 27.52  ? 251  TYR A CE1 1 
ATOM   1953 C  CE2 . TYR A 1 252 ? 20.503  38.239 48.227  1.00 21.46  ? 251  TYR A CE2 1 
ATOM   1954 C  CZ  . TYR A 1 252 ? 20.069  38.471 49.533  1.00 30.19  ? 251  TYR A CZ  1 
ATOM   1955 O  OH  . TYR A 1 252 ? 19.310  39.565 49.839  1.00 26.69  ? 251  TYR A OH  1 
ATOM   1956 N  N   . VAL A 1 253 ? 19.389  33.528 47.996  1.00 21.77  ? 252  VAL A N   1 
ATOM   1957 C  CA  . VAL A 1 253 ? 18.419  33.432 46.922  1.00 22.73  ? 252  VAL A CA  1 
ATOM   1958 C  C   . VAL A 1 253 ? 17.553  34.632 46.586  1.00 30.33  ? 252  VAL A C   1 
ATOM   1959 O  O   . VAL A 1 253 ? 16.701  34.572 45.683  1.00 31.28  ? 252  VAL A O   1 
ATOM   1960 C  CB  . VAL A 1 253 ? 17.477  32.314 47.337  1.00 28.37  ? 252  VAL A CB  1 
ATOM   1961 C  CG1 . VAL A 1 253 ? 18.252  31.009 47.541  1.00 27.04  ? 252  VAL A CG1 1 
ATOM   1962 C  CG2 . VAL A 1 253 ? 16.639  32.723 48.572  1.00 29.19  ? 252  VAL A CG2 1 
ATOM   1963 N  N   . TRP A 1 254 ? 17.733  35.711 47.324  1.00 24.23  ? 253  TRP A N   1 
ATOM   1964 C  CA  . TRP A 1 254 ? 16.883  36.868 47.152  1.00 22.27  ? 253  TRP A CA  1 
ATOM   1965 C  C   . TRP A 1 254 ? 17.300  37.793 46.041  1.00 27.00  ? 253  TRP A C   1 
ATOM   1966 O  O   . TRP A 1 254 ? 16.557  38.683 45.646  1.00 27.03  ? 253  TRP A O   1 
ATOM   1967 C  CB  . TRP A 1 254 ? 16.782  37.617 48.482  1.00 20.01  ? 253  TRP A CB  1 
ATOM   1968 C  CG  . TRP A 1 254 ? 16.465  36.613 49.516  1.00 20.82  ? 253  TRP A CG  1 
ATOM   1969 C  CD1 . TRP A 1 254 ? 17.322  35.799 50.186  1.00 23.01  ? 253  TRP A CD1 1 
ATOM   1970 C  CD2 . TRP A 1 254 ? 15.137  36.270 49.921  1.00 20.48  ? 253  TRP A CD2 1 
ATOM   1971 N  NE1 . TRP A 1 254 ? 16.601  34.977 51.043  1.00 23.74  ? 253  TRP A NE1 1 
ATOM   1972 C  CE2 . TRP A 1 254 ? 15.254  35.266 50.904  1.00 24.56  ? 253  TRP A CE2 1 
ATOM   1973 C  CE3 . TRP A 1 254 ? 13.882  36.771 49.588  1.00 22.14  ? 253  TRP A CE3 1 
ATOM   1974 C  CZ2 . TRP A 1 254 ? 14.109  34.730 51.517  1.00 23.35  ? 253  TRP A CZ2 1 
ATOM   1975 C  CZ3 . TRP A 1 254 ? 12.768  36.257 50.222  1.00 23.92  ? 253  TRP A CZ3 1 
ATOM   1976 C  CH2 . TRP A 1 254 ? 12.874  35.239 51.177  1.00 23.31  ? 253  TRP A CH2 1 
ATOM   1977 N  N   . GLY A 1 255 ? 18.501  37.611 45.545  1.00 27.81  ? 254  GLY A N   1 
ATOM   1978 C  CA  . GLY A 1 255 ? 18.892  38.465 44.452  1.00 28.22  ? 254  GLY A CA  1 
ATOM   1979 C  C   . GLY A 1 255 ? 19.621  39.697 44.909  1.00 35.44  ? 254  GLY A C   1 
ATOM   1980 O  O   . GLY A 1 255 ? 20.847  39.714 44.874  1.00 43.76  ? 254  GLY A O   1 
ATOM   1981 N  N   . GLN A 1 256 ? 18.881  40.732 45.300  1.00 27.98  ? 255  GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 256 ? 19.534  41.960 45.744  1.00 27.20  ? 255  GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 256 ? 19.640  42.000 47.258  1.00 29.51  ? 255  GLN A C   1 
ATOM   1984 O  O   . GLN A 1 256 ? 18.806  41.408 47.954  1.00 28.12  ? 255  GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 256 ? 18.662  43.159 45.345  1.00 28.02  ? 255  GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 256 ? 19.350  44.520 45.558  1.00 45.41  ? 255  GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 256 ? 20.484  44.770 44.589  1.00 58.13  ? 255  GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 256 ? 20.911  43.848 43.877  1.00 52.27  ? 255  GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 256 ? 20.982  46.004 44.575  1.00 30.88  ? 255  GLN A NE2 1 
ATOM   1990 N  N   . TYR A 1 257 ? 20.653  42.704 47.744  1.00 27.70  ? 256  TYR A N   1 
ATOM   1991 C  CA  . TYR A 1 257 ? 20.809  42.901 49.172  1.00 26.42  ? 256  TYR A CA  1 
ATOM   1992 C  C   . TYR A 1 257 ? 20.972  44.378 49.406  1.00 21.82  ? 256  TYR A C   1 
ATOM   1993 O  O   . TYR A 1 257 ? 22.075  44.858 49.525  1.00 23.87  ? 256  TYR A O   1 
ATOM   1994 C  CB  . TYR A 1 257 ? 21.869  42.093 49.955  1.00 27.12  ? 256  TYR A CB  1 
ATOM   1995 C  CG  . TYR A 1 257 ? 21.726  42.369 51.460  1.00 21.81  ? 256  TYR A CG  1 
ATOM   1996 C  CD1 . TYR A 1 257 ? 20.740  41.730 52.215  1.00 20.63  ? 256  TYR A CD1 1 
ATOM   1997 C  CD2 . TYR A 1 257 ? 22.547  43.282 52.130  1.00 21.46  ? 256  TYR A CD2 1 
ATOM   1998 C  CE1 . TYR A 1 257 ? 20.573  42.001 53.579  1.00 17.95  ? 256  TYR A CE1 1 
ATOM   1999 C  CE2 . TYR A 1 257 ? 22.405  43.573 53.490  1.00 21.50  ? 256  TYR A CE2 1 
ATOM   2000 C  CZ  . TYR A 1 257 ? 21.412  42.913 54.223  1.00 32.29  ? 256  TYR A CZ  1 
ATOM   2001 O  OH  . TYR A 1 257 ? 21.239  43.150 55.580  1.00 22.78  ? 256  TYR A OH  1 
ATOM   2002 N  N   . ASP A 1 258 ? 19.880  45.109 49.398  1.00 19.68  ? 257  ASP A N   1 
ATOM   2003 C  CA  . ASP A 1 258 ? 20.005  46.529 49.608  1.00 21.07  ? 257  ASP A CA  1 
ATOM   2004 C  C   . ASP A 1 258 ? 19.808  46.875 51.089  1.00 31.39  ? 257  ASP A C   1 
ATOM   2005 O  O   . ASP A 1 258 ? 19.263  46.079 51.872  1.00 27.96  ? 257  ASP A O   1 
ATOM   2006 C  CB  . ASP A 1 258 ? 19.010  47.346 48.760  1.00 19.02  ? 257  ASP A CB  1 
ATOM   2007 C  CG  . ASP A 1 258 ? 19.455  47.592 47.327  1.00 28.98  ? 257  ASP A CG  1 
ATOM   2008 O  OD1 . ASP A 1 258 ? 20.490  47.136 46.840  1.00 23.83  ? 257  ASP A OD1 1 
ATOM   2009 O  OD2 . ASP A 1 258 ? 18.582  48.312 46.645  1.00 28.76  ? 257  ASP A OD2 1 
ATOM   2010 N  N   . LEU A 1 259 ? 20.251  48.099 51.423  1.00 27.55  ? 258  LEU A N   1 
ATOM   2011 C  CA  . LEU A 1 259 ? 20.145  48.669 52.746  1.00 24.78  ? 258  LEU A CA  1 
ATOM   2012 C  C   . LEU A 1 259 ? 19.434  50.003 52.680  1.00 30.32  ? 258  LEU A C   1 
ATOM   2013 O  O   . LEU A 1 259 ? 19.615  50.784 51.732  1.00 31.77  ? 258  LEU A O   1 
ATOM   2014 C  CB  . LEU A 1 259 ? 21.511  48.889 53.440  1.00 23.08  ? 258  LEU A CB  1 
ATOM   2015 C  CG  . LEU A 1 259 ? 22.225  47.626 53.916  1.00 24.93  ? 258  LEU A CG  1 
ATOM   2016 C  CD1 . LEU A 1 259 ? 23.687  47.922 54.245  1.00 21.22  ? 258  LEU A CD1 1 
ATOM   2017 C  CD2 . LEU A 1 259 ? 21.538  47.060 55.152  1.00 21.84  ? 258  LEU A CD2 1 
ATOM   2018 N  N   . LEU A 1 260 ? 18.644  50.245 53.726  1.00 23.21  ? 259  LEU A N   1 
ATOM   2019 C  CA  . LEU A 1 260 ? 17.936  51.484 53.915  1.00 21.37  ? 259  LEU A CA  1 
ATOM   2020 C  C   . LEU A 1 260 ? 18.185  52.045 55.330  1.00 27.59  ? 259  LEU A C   1 
ATOM   2021 O  O   . LEU A 1 260 ? 17.771  51.432 56.319  1.00 26.86  ? 259  LEU A O   1 
ATOM   2022 C  CB  . LEU A 1 260 ? 16.433  51.307 53.702  1.00 18.80  ? 259  LEU A CB  1 
ATOM   2023 C  CG  . LEU A 1 260 ? 15.667  52.543 54.132  1.00 19.47  ? 259  LEU A CG  1 
ATOM   2024 C  CD1 . LEU A 1 260 ? 15.857  53.670 53.128  1.00 21.23  ? 259  LEU A CD1 1 
ATOM   2025 C  CD2 . LEU A 1 260 ? 14.192  52.205 54.204  1.00 18.79  ? 259  LEU A CD2 1 
ATOM   2026 N  N   . VAL A 1 261 ? 18.847  53.205 55.408  1.00 21.57  ? 260  VAL A N   1 
ATOM   2027 C  CA  . VAL A 1 261 ? 19.111  53.903 56.648  1.00 21.30  ? 260  VAL A CA  1 
ATOM   2028 C  C   . VAL A 1 261 ? 17.968  54.863 56.866  1.00 30.36  ? 260  VAL A C   1 
ATOM   2029 O  O   . VAL A 1 261 ? 17.833  55.881 56.181  1.00 31.96  ? 260  VAL A O   1 
ATOM   2030 C  CB  . VAL A 1 261 ? 20.403  54.663 56.563  1.00 24.67  ? 260  VAL A CB  1 
ATOM   2031 C  CG1 . VAL A 1 261 ? 20.789  55.226 57.929  1.00 22.98  ? 260  VAL A CG1 1 
ATOM   2032 C  CG2 . VAL A 1 261 ? 21.446  53.677 56.074  1.00 26.02  ? 260  VAL A CG2 1 
ATOM   2033 N  N   . LEU A 1 262 ? 17.116  54.507 57.818  1.00 23.24  ? 261  LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 262 ? 15.930  55.273 58.105  1.00 19.43  ? 261  LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 262 ? 16.171  56.472 58.971  1.00 23.79  ? 261  LEU A C   1 
ATOM   2036 O  O   . LEU A 1 262 ? 17.278  56.708 59.443  1.00 25.06  ? 261  LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 262 ? 14.943  54.367 58.842  1.00 19.66  ? 261  LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 262 ? 14.286  53.442 57.827  1.00 28.61  ? 261  LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 262 ? 14.992  52.089 57.734  1.00 28.87  ? 261  LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 262 ? 12.786  53.354 58.044  1.00 37.75  ? 261  LEU A CD2 1 
ATOM   2041 N  N   . PRO A 1 263 ? 15.087  57.203 59.170  1.00 25.75  ? 262  PRO A N   1 
ATOM   2042 C  CA  . PRO A 1 263 ? 15.137  58.343 60.051  1.00 27.87  ? 262  PRO A CA  1 
ATOM   2043 C  C   . PRO A 1 263 ? 15.219  57.793 61.487  1.00 29.99  ? 262  PRO A C   1 
ATOM   2044 O  O   . PRO A 1 263 ? 14.875  56.636 61.792  1.00 25.40  ? 262  PRO A O   1 
ATOM   2045 C  CB  . PRO A 1 263 ? 13.872  59.168 59.811  1.00 28.11  ? 262  PRO A CB  1 
ATOM   2046 C  CG  . PRO A 1 263 ? 13.039  58.416 58.792  1.00 29.99  ? 262  PRO A CG  1 
ATOM   2047 C  CD  . PRO A 1 263 ? 13.722  57.078 58.569  1.00 24.33  ? 262  PRO A CD  1 
ATOM   2048 N  N   . PRO A 1 264 ? 15.704  58.649 62.378  1.00 27.92  ? 263  PRO A N   1 
ATOM   2049 C  CA  . PRO A 1 264 ? 15.950  58.306 63.776  1.00 22.66  ? 263  PRO A CA  1 
ATOM   2050 C  C   . PRO A 1 264 ? 14.891  57.588 64.585  1.00 21.89  ? 263  PRO A C   1 
ATOM   2051 O  O   . PRO A 1 264 ? 15.234  56.802 65.462  1.00 22.12  ? 263  PRO A O   1 
ATOM   2052 C  CB  . PRO A 1 264 ? 16.552  59.545 64.448  1.00 23.50  ? 263  PRO A CB  1 
ATOM   2053 C  CG  . PRO A 1 264 ? 16.866  60.527 63.325  1.00 29.26  ? 263  PRO A CG  1 
ATOM   2054 C  CD  . PRO A 1 264 ? 16.003  60.104 62.142  1.00 26.83  ? 263  PRO A CD  1 
ATOM   2055 N  N   . SER A 1 265 ? 13.621  57.862 64.315  1.00 21.95  ? 264  SER A N   1 
ATOM   2056 C  CA  . SER A 1 265 ? 12.531  57.219 65.037  1.00 21.99  ? 264  SER A CA  1 
ATOM   2057 C  C   . SER A 1 265 ? 12.344  55.765 64.610  1.00 16.88  ? 264  SER A C   1 
ATOM   2058 O  O   . SER A 1 265 ? 11.457  55.099 65.134  1.00 16.95  ? 264  SER A O   1 
ATOM   2059 C  CB  . SER A 1 265 ? 11.206  57.962 64.947  1.00 26.27  ? 264  SER A CB  1 
ATOM   2060 O  OG  . SER A 1 265 ? 10.928  58.148 63.564  1.00 26.00  ? 264  SER A OG  1 
ATOM   2061 N  N   . PHE A 1 266 ? 13.154  55.245 63.675  1.00 17.99  ? 265  PHE A N   1 
ATOM   2062 C  CA  . PHE A 1 266 ? 12.949  53.832 63.372  1.00 18.59  ? 265  PHE A CA  1 
ATOM   2063 C  C   . PHE A 1 266 ? 13.104  53.056 64.707  1.00 21.28  ? 265  PHE A C   1 
ATOM   2064 O  O   . PHE A 1 266 ? 14.080  53.190 65.453  1.00 17.40  ? 265  PHE A O   1 
ATOM   2065 C  CB  . PHE A 1 266 ? 13.961  53.395 62.300  1.00 19.34  ? 265  PHE A CB  1 
ATOM   2066 C  CG  . PHE A 1 266 ? 13.738  51.955 61.907  1.00 22.24  ? 265  PHE A CG  1 
ATOM   2067 C  CD1 . PHE A 1 266 ? 12.492  51.545 61.432  1.00 20.61  ? 265  PHE A CD1 1 
ATOM   2068 C  CD2 . PHE A 1 266 ? 14.769  51.016 62.003  1.00 24.16  ? 265  PHE A CD2 1 
ATOM   2069 C  CE1 . PHE A 1 266 ? 12.264  50.221 61.061  1.00 21.03  ? 265  PHE A CE1 1 
ATOM   2070 C  CE2 . PHE A 1 266 ? 14.572  49.687 61.620  1.00 23.73  ? 265  PHE A CE2 1 
ATOM   2071 C  CZ  . PHE A 1 266 ? 13.311  49.300 61.161  1.00 20.97  ? 265  PHE A CZ  1 
ATOM   2072 N  N   . PRO A 1 267 ? 12.126  52.262 65.075  1.00 16.27  ? 266  PRO A N   1 
ATOM   2073 C  CA  . PRO A 1 267 ? 12.147  51.558 66.343  1.00 15.83  ? 266  PRO A CA  1 
ATOM   2074 C  C   . PRO A 1 267 ? 13.168  50.441 66.590  1.00 16.31  ? 266  PRO A C   1 
ATOM   2075 O  O   . PRO A 1 267 ? 13.354  50.045 67.733  1.00 12.99  ? 266  PRO A O   1 
ATOM   2076 C  CB  . PRO A 1 267 ? 10.744  50.987 66.520  1.00 15.93  ? 266  PRO A CB  1 
ATOM   2077 C  CG  . PRO A 1 267 ? 10.017  51.164 65.205  1.00 18.48  ? 266  PRO A CG  1 
ATOM   2078 C  CD  . PRO A 1 267 ? 10.879  52.008 64.308  1.00 14.04  ? 266  PRO A CD  1 
ATOM   2079 N  N   . TYR A 1 268 ? 13.785  49.894 65.537  1.00 16.40  ? 267  TYR A N   1 
ATOM   2080 C  CA  . TYR A 1 268 ? 14.752  48.813 65.694  1.00 15.75  ? 267  TYR A CA  1 
ATOM   2081 C  C   . TYR A 1 268 ? 16.131  49.180 65.197  1.00 19.44  ? 267  TYR A C   1 
ATOM   2082 O  O   . TYR A 1 268 ? 16.342  50.176 64.499  1.00 18.10  ? 267  TYR A O   1 
ATOM   2083 C  CB  . TYR A 1 268 ? 14.269  47.507 65.006  1.00 17.45  ? 267  TYR A CB  1 
ATOM   2084 C  CG  . TYR A 1 268 ? 12.954  47.043 65.626  1.00 19.30  ? 267  TYR A CG  1 
ATOM   2085 C  CD1 . TYR A 1 268 ? 12.992  46.238 66.766  1.00 19.19  ? 267  TYR A CD1 1 
ATOM   2086 C  CD2 . TYR A 1 268 ? 11.705  47.435 65.127  1.00 14.85  ? 267  TYR A CD2 1 
ATOM   2087 C  CE1 . TYR A 1 268 ? 11.806  45.817 67.369  1.00 21.05  ? 267  TYR A CE1 1 
ATOM   2088 C  CE2 . TYR A 1 268 ? 10.512  47.032 65.734  1.00 9.78   ? 267  TYR A CE2 1 
ATOM   2089 C  CZ  . TYR A 1 268 ? 10.563  46.208 66.861  1.00 13.87  ? 267  TYR A CZ  1 
ATOM   2090 O  OH  . TYR A 1 268 ? 9.427   45.791 67.529  1.00 15.56  ? 267  TYR A OH  1 
ATOM   2091 N  N   . GLY A 1 269 ? 17.091  48.353 65.583  1.00 14.17  ? 268  GLY A N   1 
ATOM   2092 C  CA  . GLY A 1 269 ? 18.460  48.522 65.122  1.00 15.06  ? 268  GLY A CA  1 
ATOM   2093 C  C   . GLY A 1 269 ? 18.508  48.085 63.652  1.00 19.31  ? 268  GLY A C   1 
ATOM   2094 O  O   . GLY A 1 269 ? 19.152  48.695 62.809  1.00 17.05  ? 268  GLY A O   1 
ATOM   2095 N  N   . GLY A 1 270 ? 17.773  47.011 63.360  1.00 18.06  ? 269  GLY A N   1 
ATOM   2096 C  CA  . GLY A 1 270 ? 17.688  46.453 62.026  1.00 15.91  ? 269  GLY A CA  1 
ATOM   2097 C  C   . GLY A 1 270 ? 16.438  45.598 61.892  1.00 16.11  ? 269  GLY A C   1 
ATOM   2098 O  O   . GLY A 1 270 ? 15.869  45.183 62.891  1.00 14.41  ? 269  GLY A O   1 
ATOM   2099 N  N   . MET A 1 271 ? 16.031  45.376 60.637  1.00 13.94  ? 270  MET A N   1 
ATOM   2100 C  CA  . MET A 1 271 ? 14.868  44.605 60.233  1.00 13.83  ? 270  MET A CA  1 
ATOM   2101 C  C   . MET A 1 271 ? 15.162  43.978 58.874  1.00 21.59  ? 270  MET A C   1 
ATOM   2102 O  O   . MET A 1 271 ? 15.310  44.700 57.890  1.00 18.65  ? 270  MET A O   1 
ATOM   2103 C  CB  . MET A 1 271 ? 13.590  45.444 60.058  1.00 16.36  ? 270  MET A CB  1 
ATOM   2104 C  CG  . MET A 1 271 ? 12.450  44.562 59.571  1.00 17.70  ? 270  MET A CG  1 
ATOM   2105 S  SD  . MET A 1 271 ? 11.946  43.379 60.866  1.00 21.03  ? 270  MET A SD  1 
ATOM   2106 C  CE  . MET A 1 271 ? 11.379  41.967 59.867  1.00 19.69  ? 270  MET A CE  1 
ATOM   2107 N  N   . GLU A 1 272 ? 15.249  42.647 58.859  1.00 22.89  ? 271  GLU A N   1 
ATOM   2108 C  CA  . GLU A 1 272 ? 15.571  41.810 57.700  1.00 18.36  ? 271  GLU A CA  1 
ATOM   2109 C  C   . GLU A 1 272 ? 14.546  41.835 56.562  1.00 20.73  ? 271  GLU A C   1 
ATOM   2110 O  O   . GLU A 1 272 ? 14.238  40.794 55.994  1.00 17.43  ? 271  GLU A O   1 
ATOM   2111 C  CB  . GLU A 1 272 ? 15.852  40.352 58.174  1.00 17.49  ? 271  GLU A CB  1 
ATOM   2112 C  CG  . GLU A 1 272 ? 14.595  39.641 58.706  1.00 14.64  ? 271  GLU A CG  1 
ATOM   2113 C  CD  . GLU A 1 272 ? 14.297  39.896 60.175  1.00 16.61  ? 271  GLU A CD  1 
ATOM   2114 O  OE1 . GLU A 1 272 ? 14.592  40.925 60.774  1.00 16.52  ? 271  GLU A OE1 1 
ATOM   2115 O  OE2 . GLU A 1 272 ? 13.660  38.891 60.720  1.00 15.49  ? 271  GLU A OE2 1 
ATOM   2116 N  N   . ASN A 1 273 ? 13.985  42.991 56.218  1.00 16.76  ? 272  ASN A N   1 
ATOM   2117 C  CA  . ASN A 1 273 ? 13.022  42.971 55.122  1.00 19.27  ? 272  ASN A CA  1 
ATOM   2118 C  C   . ASN A 1 273 ? 13.741  42.476 53.880  1.00 17.37  ? 272  ASN A C   1 
ATOM   2119 O  O   . ASN A 1 273 ? 14.781  43.005 53.535  1.00 18.02  ? 272  ASN A O   1 
ATOM   2120 C  CB  . ASN A 1 273 ? 12.360  44.340 54.873  1.00 21.66  ? 272  ASN A CB  1 
ATOM   2121 C  CG  . ASN A 1 273 ? 11.711  44.929 56.126  1.00 17.62  ? 272  ASN A CG  1 
ATOM   2122 O  OD1 . ASN A 1 273 ? 12.045  46.057 56.536  1.00 30.09  ? 272  ASN A OD1 1 
ATOM   2123 N  ND2 . ASN A 1 273 ? 10.846  44.154 56.773  1.00 14.05  ? 272  ASN A ND2 1 
ATOM   2124 N  N   . PRO A 1 274 ? 13.202  41.457 53.238  1.00 16.45  ? 273  PRO A N   1 
ATOM   2125 C  CA  . PRO A 1 274 ? 13.855  40.842 52.070  1.00 18.72  ? 273  PRO A CA  1 
ATOM   2126 C  C   . PRO A 1 274 ? 14.199  41.795 50.934  1.00 25.09  ? 273  PRO A C   1 
ATOM   2127 O  O   . PRO A 1 274 ? 13.350  42.525 50.420  1.00 25.34  ? 273  PRO A O   1 
ATOM   2128 C  CB  . PRO A 1 274 ? 12.985  39.662 51.608  1.00 17.23  ? 273  PRO A CB  1 
ATOM   2129 C  CG  . PRO A 1 274 ? 11.682  39.824 52.370  1.00 19.73  ? 273  PRO A CG  1 
ATOM   2130 C  CD  . PRO A 1 274 ? 11.839  40.918 53.426  1.00 14.09  ? 273  PRO A CD  1 
ATOM   2131 N  N   . CYS A 1 275 ? 15.475  41.766 50.548  1.00 22.07  ? 274  CYS A N   1 
ATOM   2132 C  CA  . CYS A 1 275 ? 16.006  42.590 49.475  1.00 25.86  ? 274  CYS A CA  1 
ATOM   2133 C  C   . CYS A 1 275 ? 16.258  44.014 49.898  1.00 27.30  ? 274  CYS A C   1 
ATOM   2134 O  O   . CYS A 1 275 ? 16.910  44.743 49.142  1.00 25.31  ? 274  CYS A O   1 
ATOM   2135 C  CB  . CYS A 1 275 ? 15.096  42.678 48.220  1.00 28.73  ? 274  CYS A CB  1 
ATOM   2136 S  SG  . CYS A 1 275 ? 14.579  41.105 47.493  1.00 31.75  ? 274  CYS A SG  1 
ATOM   2137 N  N   . LEU A 1 276 ? 15.729  44.378 51.073  1.00 22.65  ? 275  LEU A N   1 
ATOM   2138 C  CA  . LEU A 1 276 ? 15.850  45.744 51.607  1.00 23.25  ? 275  LEU A CA  1 
ATOM   2139 C  C   . LEU A 1 276 ? 15.861  45.771 53.127  1.00 24.49  ? 275  LEU A C   1 
ATOM   2140 O  O   . LEU A 1 276 ? 14.857  46.049 53.766  1.00 20.30  ? 275  LEU A O   1 
ATOM   2141 C  CB  . LEU A 1 276 ? 14.720  46.664 51.076  1.00 21.69  ? 275  LEU A CB  1 
ATOM   2142 C  CG  . LEU A 1 276 ? 14.883  48.179 51.233  1.00 23.67  ? 275  LEU A CG  1 
ATOM   2143 C  CD1 . LEU A 1 276 ? 16.161  48.676 50.567  1.00 21.04  ? 275  LEU A CD1 1 
ATOM   2144 C  CD2 . LEU A 1 276 ? 13.678  48.860 50.598  1.00 24.01  ? 275  LEU A CD2 1 
ATOM   2145 N  N   . THR A 1 277 ? 17.019  45.459 53.693  1.00 23.64  ? 276  THR A N   1 
ATOM   2146 C  CA  . THR A 1 277 ? 17.168  45.522 55.142  1.00 23.40  ? 276  THR A CA  1 
ATOM   2147 C  C   . THR A 1 277 ? 17.072  46.994 55.594  1.00 24.89  ? 276  THR A C   1 
ATOM   2148 O  O   . THR A 1 277 ? 17.685  47.911 55.035  1.00 21.17  ? 276  THR A O   1 
ATOM   2149 C  CB  . THR A 1 277 ? 18.493  44.855 55.596  1.00 27.90  ? 276  THR A CB  1 
ATOM   2150 O  OG1 . THR A 1 277 ? 18.355  43.451 55.661  1.00 27.28  ? 276  THR A OG1 1 
ATOM   2151 C  CG2 . THR A 1 277 ? 19.029  45.362 56.936  1.00 23.58  ? 276  THR A CG2 1 
ATOM   2152 N  N   . PHE A 1 278 ? 16.247  47.234 56.612  1.00 22.02  ? 277  PHE A N   1 
ATOM   2153 C  CA  . PHE A 1 278 ? 16.088  48.573 57.195  1.00 20.16  ? 277  PHE A CA  1 
ATOM   2154 C  C   . PHE A 1 278 ? 17.044  48.709 58.384  1.00 25.70  ? 277  PHE A C   1 
ATOM   2155 O  O   . PHE A 1 278 ? 17.162  47.764 59.167  1.00 21.88  ? 277  PHE A O   1 
ATOM   2156 C  CB  . PHE A 1 278 ? 14.694  48.687 57.829  1.00 18.17  ? 277  PHE A CB  1 
ATOM   2157 C  CG  . PHE A 1 278 ? 13.634  48.938 56.817  1.00 19.00  ? 277  PHE A CG  1 
ATOM   2158 C  CD1 . PHE A 1 278 ? 13.835  48.531 55.500  1.00 24.17  ? 277  PHE A CD1 1 
ATOM   2159 C  CD2 . PHE A 1 278 ? 12.427  49.542 57.152  1.00 20.88  ? 277  PHE A CD2 1 
ATOM   2160 C  CE1 . PHE A 1 278 ? 12.862  48.745 54.525  1.00 23.52  ? 277  PHE A CE1 1 
ATOM   2161 C  CE2 . PHE A 1 278 ? 11.446  49.770 56.185  1.00 26.94  ? 277  PHE A CE2 1 
ATOM   2162 C  CZ  . PHE A 1 278 ? 11.659  49.364 54.865  1.00 22.89  ? 277  PHE A CZ  1 
ATOM   2163 N  N   . VAL A 1 279 ? 17.713  49.843 58.572  1.00 20.87  ? 278  VAL A N   1 
ATOM   2164 C  CA  . VAL A 1 279 ? 18.595  49.962 59.732  1.00 19.42  ? 278  VAL A CA  1 
ATOM   2165 C  C   . VAL A 1 279 ? 18.432  51.321 60.375  1.00 23.68  ? 278  VAL A C   1 
ATOM   2166 O  O   . VAL A 1 279 ? 18.086  52.292 59.711  1.00 19.82  ? 278  VAL A O   1 
ATOM   2167 C  CB  . VAL A 1 279 ? 20.094  49.721 59.491  1.00 18.82  ? 278  VAL A CB  1 
ATOM   2168 C  CG1 . VAL A 1 279 ? 20.320  48.314 59.001  1.00 19.20  ? 278  VAL A CG1 1 
ATOM   2169 C  CG2 . VAL A 1 279 ? 20.715  50.743 58.521  1.00 15.74  ? 278  VAL A CG2 1 
ATOM   2170 N  N   . THR A 1 280 ? 18.751  51.374 61.655  1.00 18.56  ? 279  THR A N   1 
ATOM   2171 C  CA  . THR A 1 280 ? 18.702  52.616 62.391  1.00 18.24  ? 279  THR A CA  1 
ATOM   2172 C  C   . THR A 1 280 ? 19.889  53.506 61.996  1.00 19.64  ? 279  THR A C   1 
ATOM   2173 O  O   . THR A 1 280 ? 20.971  53.008 61.740  1.00 19.05  ? 279  THR A O   1 
ATOM   2174 C  CB  . THR A 1 280 ? 18.821  52.343 63.921  1.00 19.60  ? 279  THR A CB  1 
ATOM   2175 O  OG1 . THR A 1 280 ? 18.895  53.595 64.581  1.00 16.90  ? 279  THR A OG1 1 
ATOM   2176 C  CG2 . THR A 1 280 ? 20.120  51.588 64.205  1.00 13.57  ? 279  THR A CG2 1 
ATOM   2177 N  N   . PRO A 1 281 ? 19.719  54.836 61.999  1.00 19.21  ? 280  PRO A N   1 
ATOM   2178 C  CA  . PRO A 1 281 ? 20.829  55.707 61.712  1.00 18.61  ? 280  PRO A CA  1 
ATOM   2179 C  C   . PRO A 1 281 ? 21.772  55.699 62.912  1.00 21.55  ? 280  PRO A C   1 
ATOM   2180 O  O   . PRO A 1 281 ? 22.918  56.168 62.799  1.00 21.21  ? 280  PRO A O   1 
ATOM   2181 C  CB  . PRO A 1 281 ? 20.267  57.113 61.511  1.00 19.88  ? 280  PRO A CB  1 
ATOM   2182 C  CG  . PRO A 1 281 ? 18.901  57.068 62.176  1.00 18.63  ? 280  PRO A CG  1 
ATOM   2183 C  CD  . PRO A 1 281 ? 18.448  55.624 62.007  1.00 17.87  ? 280  PRO A CD  1 
ATOM   2184 N  N   . THR A 1 282 ? 21.303  55.127 64.044  1.00 20.04  ? 281  THR A N   1 
ATOM   2185 C  CA  . THR A 1 282 ? 22.174  55.031 65.214  1.00 21.24  ? 281  THR A CA  1 
ATOM   2186 C  C   . THR A 1 282 ? 23.367  54.097 65.002  1.00 22.67  ? 281  THR A C   1 
ATOM   2187 O  O   . THR A 1 282 ? 24.300  54.031 65.829  1.00 20.18  ? 281  THR A O   1 
ATOM   2188 C  CB  . THR A 1 282 ? 21.477  54.765 66.547  1.00 24.13  ? 281  THR A CB  1 
ATOM   2189 O  OG1 . THR A 1 282 ? 20.923  53.454 66.562  1.00 21.04  ? 281  THR A OG1 1 
ATOM   2190 C  CG2 . THR A 1 282 ? 20.438  55.869 66.750  1.00 20.84  ? 281  THR A CG2 1 
ATOM   2191 N  N   . LEU A 1 283 ? 23.342  53.397 63.867  1.00 16.05  ? 282  LEU A N   1 
ATOM   2192 C  CA  . LEU A 1 283 ? 24.460  52.528 63.556  1.00 16.95  ? 282  LEU A CA  1 
ATOM   2193 C  C   . LEU A 1 283 ? 25.644  53.343 63.000  1.00 23.24  ? 282  LEU A C   1 
ATOM   2194 O  O   . LEU A 1 283 ? 26.768  52.846 62.861  1.00 21.40  ? 282  LEU A O   1 
ATOM   2195 C  CB  . LEU A 1 283 ? 24.087  51.519 62.454  1.00 16.65  ? 282  LEU A CB  1 
ATOM   2196 C  CG  . LEU A 1 283 ? 23.053  50.463 62.813  1.00 20.67  ? 282  LEU A CG  1 
ATOM   2197 C  CD1 . LEU A 1 283 ? 23.121  49.359 61.760  1.00 17.37  ? 282  LEU A CD1 1 
ATOM   2198 C  CD2 . LEU A 1 283 ? 23.359  49.877 64.193  1.00 11.35  ? 282  LEU A CD2 1 
ATOM   2199 N  N   . LEU A 1 284 ? 25.410  54.598 62.615  1.00 19.06  ? 283  LEU A N   1 
ATOM   2200 C  CA  . LEU A 1 284 ? 26.474  55.379 61.979  1.00 21.46  ? 283  LEU A CA  1 
ATOM   2201 C  C   . LEU A 1 284 ? 27.530  55.898 62.926  1.00 29.82  ? 283  LEU A C   1 
ATOM   2202 O  O   . LEU A 1 284 ? 27.608  57.107 63.129  1.00 30.36  ? 283  LEU A O   1 
ATOM   2203 C  CB  . LEU A 1 284 ? 25.861  56.561 61.208  1.00 20.36  ? 283  LEU A CB  1 
ATOM   2204 C  CG  . LEU A 1 284 ? 24.829  56.070 60.198  1.00 26.22  ? 283  LEU A CG  1 
ATOM   2205 C  CD1 . LEU A 1 284 ? 24.170  57.268 59.509  1.00 26.75  ? 283  LEU A CD1 1 
ATOM   2206 C  CD2 . LEU A 1 284 ? 25.542  55.174 59.178  1.00 28.22  ? 283  LEU A CD2 1 
ATOM   2207 N  N   . ALA A 1 285 ? 28.307  54.983 63.499  1.00 24.27  ? 284  ALA A N   1 
ATOM   2208 C  CA  . ALA A 1 285 ? 29.299  55.346 64.481  1.00 23.44  ? 284  ALA A CA  1 
ATOM   2209 C  C   . ALA A 1 285 ? 30.519  55.998 63.865  1.00 30.13  ? 284  ALA A C   1 
ATOM   2210 O  O   . ALA A 1 285 ? 31.280  56.659 64.566  1.00 28.42  ? 284  ALA A O   1 
ATOM   2211 C  CB  . ALA A 1 285 ? 29.683  54.147 65.325  1.00 23.18  ? 284  ALA A CB  1 
ATOM   2212 N  N   . GLY A 1 286 ? 30.706  55.829 62.561  1.00 26.03  ? 285  GLY A N   1 
ATOM   2213 C  CA  . GLY A 1 286 ? 31.852  56.425 61.898  1.00 23.94  ? 285  GLY A CA  1 
ATOM   2214 C  C   . GLY A 1 286 ? 33.106  55.548 61.857  1.00 35.38  ? 285  GLY A C   1 
ATOM   2215 O  O   . GLY A 1 286 ? 34.152  55.934 61.321  1.00 35.31  ? 285  GLY A O   1 
ATOM   2216 N  N   . ASP A 1 287 ? 33.010  54.339 62.409  1.00 29.64  ? 286  ASP A N   1 
ATOM   2217 C  CA  . ASP A 1 287 ? 34.121  53.427 62.408  1.00 22.48  ? 286  ASP A CA  1 
ATOM   2218 C  C   . ASP A 1 287 ? 33.702  52.013 62.065  1.00 22.54  ? 286  ASP A C   1 
ATOM   2219 O  O   . ASP A 1 287 ? 34.484  51.120 62.321  1.00 20.43  ? 286  ASP A O   1 
ATOM   2220 C  CB  . ASP A 1 287 ? 34.798  53.422 63.776  1.00 22.77  ? 286  ASP A CB  1 
ATOM   2221 C  CG  . ASP A 1 287 ? 33.830  53.000 64.842  1.00 23.72  ? 286  ASP A CG  1 
ATOM   2222 O  OD1 . ASP A 1 287 ? 32.727  52.571 64.605  1.00 23.69  ? 286  ASP A OD1 1 
ATOM   2223 O  OD2 . ASP A 1 287 ? 34.303  53.119 66.039  1.00 25.35  ? 286  ASP A OD2 1 
ATOM   2224 N  N   . LYS A 1 288 ? 32.483  51.824 61.557  1.00 18.47  ? 287  LYS A N   1 
ATOM   2225 C  CA  . LYS A 1 288 ? 31.998  50.498 61.175  1.00 19.69  ? 287  LYS A CA  1 
ATOM   2226 C  C   . LYS A 1 288 ? 31.839  49.507 62.330  1.00 23.72  ? 287  LYS A C   1 
ATOM   2227 O  O   . LYS A 1 288 ? 31.524  48.328 62.143  1.00 23.33  ? 287  LYS A O   1 
ATOM   2228 C  CB  . LYS A 1 288 ? 32.928  49.860 60.138  1.00 23.38  ? 287  LYS A CB  1 
ATOM   2229 C  CG  . LYS A 1 288 ? 33.393  50.760 58.992  1.00 28.89  ? 287  LYS A CG  1 
ATOM   2230 C  CD  . LYS A 1 288 ? 34.194  49.994 57.933  1.00 29.02  ? 287  LYS A CD  1 
ATOM   2231 C  CE  . LYS A 1 288 ? 35.016  50.878 56.992  1.00 29.20  ? 287  LYS A CE  1 
ATOM   2232 N  NZ  . LYS A 1 288 ? 34.225  51.494 55.908  1.00 31.15  ? 287  LYS A NZ  1 
ATOM   2233 N  N   . SER A 1 289 ? 32.090  49.993 63.537  1.00 23.67  ? 288  SER A N   1 
ATOM   2234 C  CA  . SER A 1 289 ? 32.033  49.195 64.756  1.00 21.48  ? 288  SER A CA  1 
ATOM   2235 C  C   . SER A 1 289 ? 30.681  48.520 65.080  1.00 24.82  ? 288  SER A C   1 
ATOM   2236 O  O   . SER A 1 289 ? 30.644  47.530 65.833  1.00 23.30  ? 288  SER A O   1 
ATOM   2237 C  CB  . SER A 1 289 ? 32.568  50.021 65.915  1.00 17.62  ? 288  SER A CB  1 
ATOM   2238 O  OG  . SER A 1 289 ? 31.613  50.986 66.283  1.00 22.51  ? 288  SER A OG  1 
ATOM   2239 N  N   . LEU A 1 290 ? 29.577  49.068 64.546  1.00 17.98  ? 289  LEU A N   1 
ATOM   2240 C  CA  . LEU A 1 290 ? 28.235  48.524 64.763  1.00 17.52  ? 289  LEU A CA  1 
ATOM   2241 C  C   . LEU A 1 290 ? 27.719  47.621 63.632  1.00 25.16  ? 289  LEU A C   1 
ATOM   2242 O  O   . LEU A 1 290 ? 26.526  47.300 63.525  1.00 22.82  ? 289  LEU A O   1 
ATOM   2243 C  CB  . LEU A 1 290 ? 27.236  49.616 65.156  1.00 15.28  ? 289  LEU A CB  1 
ATOM   2244 C  CG  . LEU A 1 290 ? 27.741  50.434 66.350  1.00 20.44  ? 289  LEU A CG  1 
ATOM   2245 C  CD1 . LEU A 1 290 ? 26.607  51.363 66.782  1.00 18.76  ? 289  LEU A CD1 1 
ATOM   2246 C  CD2 . LEU A 1 290 ? 28.151  49.556 67.549  1.00 14.67  ? 289  LEU A CD2 1 
ATOM   2247 N  N   . SER A 1 291 ? 28.649  47.173 62.784  1.00 20.51  ? 290  SER A N   1 
ATOM   2248 C  CA  . SER A 1 291 ? 28.298  46.332 61.655  1.00 22.41  ? 290  SER A CA  1 
ATOM   2249 C  C   . SER A 1 291 ? 27.734  44.950 62.011  1.00 24.28  ? 290  SER A C   1 
ATOM   2250 O  O   . SER A 1 291 ? 27.186  44.251 61.157  1.00 24.24  ? 290  SER A O   1 
ATOM   2251 C  CB  . SER A 1 291 ? 29.457  46.263 60.676  1.00 22.09  ? 290  SER A CB  1 
ATOM   2252 O  OG  . SER A 1 291 ? 30.484  45.473 61.248  1.00 25.07  ? 290  SER A OG  1 
ATOM   2253 N  N   . ASN A 1 292 ? 27.873  44.530 63.261  1.00 19.37  ? 291  ASN A N   1 
ATOM   2254 C  CA  . ASN A 1 292 ? 27.317  43.249 63.591  1.00 18.43  ? 291  ASN A CA  1 
ATOM   2255 C  C   . ASN A 1 292 ? 25.826  43.236 63.256  1.00 17.33  ? 291  ASN A C   1 
ATOM   2256 O  O   . ASN A 1 292 ? 25.265  42.192 62.964  1.00 14.56  ? 291  ASN A O   1 
ATOM   2257 C  CB  . ASN A 1 292 ? 27.513  42.937 65.085  1.00 19.46  ? 291  ASN A CB  1 
ATOM   2258 C  CG  . ASN A 1 292 ? 26.602  43.764 65.973  1.00 20.66  ? 291  ASN A CG  1 
ATOM   2259 O  OD1 . ASN A 1 292 ? 26.798  44.984 66.108  1.00 17.05  ? 291  ASN A OD1 1 
ATOM   2260 N  ND2 . ASN A 1 292 ? 25.549  43.128 66.515  1.00 16.48  ? 291  ASN A ND2 1 
ATOM   2261 N  N   . VAL A 1 293 ? 25.177  44.399 63.318  1.00 14.47  ? 292  VAL A N   1 
ATOM   2262 C  CA  . VAL A 1 293 ? 23.743  44.469 63.064  1.00 13.82  ? 292  VAL A CA  1 
ATOM   2263 C  C   . VAL A 1 293 ? 23.510  44.099 61.629  1.00 21.19  ? 292  VAL A C   1 
ATOM   2264 O  O   . VAL A 1 293 ? 22.525  43.437 61.257  1.00 19.13  ? 292  VAL A O   1 
ATOM   2265 C  CB  . VAL A 1 293 ? 23.176  45.855 63.358  1.00 16.20  ? 292  VAL A CB  1 
ATOM   2266 C  CG1 . VAL A 1 293 ? 21.717  45.989 62.910  1.00 13.99  ? 292  VAL A CG1 1 
ATOM   2267 C  CG2 . VAL A 1 293 ? 23.375  46.193 64.832  1.00 14.21  ? 292  VAL A CG2 1 
ATOM   2268 N  N   . ILE A 1 294 ? 24.478  44.519 60.820  1.00 18.72  ? 293  ILE A N   1 
ATOM   2269 C  CA  . ILE A 1 294 ? 24.388  44.196 59.388  1.00 17.35  ? 293  ILE A CA  1 
ATOM   2270 C  C   . ILE A 1 294 ? 24.537  42.686 59.190  1.00 18.12  ? 293  ILE A C   1 
ATOM   2271 O  O   . ILE A 1 294 ? 23.706  42.048 58.535  1.00 20.68  ? 293  ILE A O   1 
ATOM   2272 C  CB  . ILE A 1 294 ? 25.347  45.002 58.504  1.00 21.90  ? 293  ILE A CB  1 
ATOM   2273 C  CG1 . ILE A 1 294 ? 25.212  46.508 58.732  1.00 22.34  ? 293  ILE A CG1 1 
ATOM   2274 C  CG2 . ILE A 1 294 ? 25.106  44.651 57.036  1.00 24.91  ? 293  ILE A CG2 1 
ATOM   2275 C  CD1 . ILE A 1 294 ? 23.875  47.084 58.267  1.00 17.25  ? 293  ILE A CD1 1 
ATOM   2276 N  N   . ALA A 1 295 ? 25.577  42.108 59.809  1.00 14.70  ? 294  ALA A N   1 
ATOM   2277 C  CA  . ALA A 1 295 ? 25.798  40.674 59.744  1.00 14.92  ? 294  ALA A CA  1 
ATOM   2278 C  C   . ALA A 1 295 ? 24.525  39.915 60.144  1.00 19.80  ? 294  ALA A C   1 
ATOM   2279 O  O   . ALA A 1 295 ? 24.134  38.879 59.613  1.00 19.51  ? 294  ALA A O   1 
ATOM   2280 C  CB  . ALA A 1 295 ? 26.963  40.320 60.692  1.00 11.24  ? 294  ALA A CB  1 
ATOM   2281 N  N   . HIS A 1 296 ? 23.858  40.467 61.141  1.00 19.87  ? 295  HIS A N   1 
ATOM   2282 C  CA  . HIS A 1 296 ? 22.684  39.855 61.718  1.00 17.44  ? 295  HIS A CA  1 
ATOM   2283 C  C   . HIS A 1 296 ? 21.564  39.788 60.725  1.00 15.33  ? 295  HIS A C   1 
ATOM   2284 O  O   . HIS A 1 296 ? 21.046  38.695 60.487  1.00 15.82  ? 295  HIS A O   1 
ATOM   2285 C  CB  . HIS A 1 296 ? 22.243  40.560 63.038  1.00 16.85  ? 295  HIS A CB  1 
ATOM   2286 C  CG  . HIS A 1 296 ? 20.982  40.016 63.661  1.00 14.90  ? 295  HIS A CG  1 
ATOM   2287 N  ND1 . HIS A 1 296 ? 21.029  39.160 64.771  1.00 13.18  ? 295  HIS A ND1 1 
ATOM   2288 C  CD2 . HIS A 1 296 ? 19.681  40.220 63.307  1.00 14.18  ? 295  HIS A CD2 1 
ATOM   2289 C  CE1 . HIS A 1 296 ? 19.763  38.841 65.046  1.00 12.25  ? 295  HIS A CE1 1 
ATOM   2290 N  NE2 . HIS A 1 296 ? 18.926  39.479 64.206  1.00 13.88  ? 295  HIS A NE2 1 
ATOM   2291 N  N   . GLU A 1 297 ? 21.201  40.970 60.217  1.00 15.43  ? 296  GLU A N   1 
ATOM   2292 C  CA  . GLU A 1 297 ? 20.097  41.041 59.253  1.00 16.75  ? 296  GLU A CA  1 
ATOM   2293 C  C   . GLU A 1 297 ? 20.374  40.223 58.006  1.00 19.55  ? 296  GLU A C   1 
ATOM   2294 O  O   . GLU A 1 297 ? 19.470  39.579 57.471  1.00 19.03  ? 296  GLU A O   1 
ATOM   2295 C  CB  . GLU A 1 297 ? 19.579  42.442 58.926  1.00 18.78  ? 296  GLU A CB  1 
ATOM   2296 C  CG  . GLU A 1 297 ? 19.319  43.284 60.187  1.00 15.45  ? 296  GLU A CG  1 
ATOM   2297 C  CD  . GLU A 1 297 ? 18.430  42.683 61.258  1.00 15.87  ? 296  GLU A CD  1 
ATOM   2298 O  OE1 . GLU A 1 297 ? 17.607  41.809 61.045  1.00 18.99  ? 296  GLU A OE1 1 
ATOM   2299 O  OE2 . GLU A 1 297 ? 18.590  43.282 62.423  1.00 16.74  ? 296  GLU A OE2 1 
ATOM   2300 N  N   . ILE A 1 298 ? 21.622  40.231 57.561  1.00 14.69  ? 297  ILE A N   1 
ATOM   2301 C  CA  . ILE A 1 298 ? 22.017  39.411 56.420  1.00 15.42  ? 297  ILE A CA  1 
ATOM   2302 C  C   . ILE A 1 298 ? 21.689  37.950 56.688  1.00 23.32  ? 297  ILE A C   1 
ATOM   2303 O  O   . ILE A 1 298 ? 21.127  37.216 55.852  1.00 20.13  ? 297  ILE A O   1 
ATOM   2304 C  CB  . ILE A 1 298 ? 23.518  39.491 56.229  1.00 17.39  ? 297  ILE A CB  1 
ATOM   2305 C  CG1 . ILE A 1 298 ? 23.800  40.762 55.435  1.00 15.89  ? 297  ILE A CG1 1 
ATOM   2306 C  CG2 . ILE A 1 298 ? 23.998  38.252 55.482  1.00 18.34  ? 297  ILE A CG2 1 
ATOM   2307 C  CD1 . ILE A 1 298 ? 25.286  41.106 55.363  1.00 18.27  ? 297  ILE A CD1 1 
ATOM   2308 N  N   . SER A 1 299 ? 22.043  37.525 57.903  1.00 19.20  ? 298  SER A N   1 
ATOM   2309 C  CA  . SER A 1 299 ? 21.828  36.138 58.327  1.00 18.22  ? 298  SER A CA  1 
ATOM   2310 C  C   . SER A 1 299 ? 20.386  35.663 58.269  1.00 17.45  ? 298  SER A C   1 
ATOM   2311 O  O   . SER A 1 299 ? 20.138  34.479 58.073  1.00 18.23  ? 298  SER A O   1 
ATOM   2312 C  CB  . SER A 1 299 ? 22.415  35.795 59.687  1.00 19.89  ? 298  SER A CB  1 
ATOM   2313 O  OG  . SER A 1 299 ? 23.812  35.938 59.627  1.00 20.48  ? 298  SER A OG  1 
ATOM   2314 N  N   . HIS A 1 300 ? 19.458  36.589 58.479  1.00 14.42  ? 299  HIS A N   1 
ATOM   2315 C  CA  . HIS A 1 300 ? 18.038  36.284 58.435  1.00 14.65  ? 299  HIS A CA  1 
ATOM   2316 C  C   . HIS A 1 300 ? 17.620  35.833 57.031  1.00 19.81  ? 299  HIS A C   1 
ATOM   2317 O  O   . HIS A 1 300 ? 16.610  35.136 56.857  1.00 22.28  ? 299  HIS A O   1 
ATOM   2318 C  CB  . HIS A 1 300 ? 17.235  37.515 58.891  1.00 16.87  ? 299  HIS A CB  1 
ATOM   2319 C  CG  . HIS A 1 300 ? 16.952  37.582 60.387  1.00 18.36  ? 299  HIS A CG  1 
ATOM   2320 N  ND1 . HIS A 1 300 ? 16.386  36.512 61.090  1.00 15.19  ? 299  HIS A ND1 1 
ATOM   2321 C  CD2 . HIS A 1 300 ? 17.138  38.601 61.282  1.00 14.09  ? 299  HIS A CD2 1 
ATOM   2322 C  CE1 . HIS A 1 300 ? 16.235  36.894 62.356  1.00 13.44  ? 299  HIS A CE1 1 
ATOM   2323 N  NE2 . HIS A 1 300 ? 16.671  38.129 62.478  1.00 13.61  ? 299  HIS A NE2 1 
ATOM   2324 N  N   . SER A 1 301 ? 18.416  36.216 56.025  1.00 16.24  ? 300  SER A N   1 
ATOM   2325 C  CA  . SER A 1 301 ? 18.121  35.813 54.635  1.00 18.63  ? 300  SER A CA  1 
ATOM   2326 C  C   . SER A 1 301 ? 18.061  34.297 54.485  1.00 22.35  ? 300  SER A C   1 
ATOM   2327 O  O   . SER A 1 301 ? 17.696  33.798 53.426  1.00 20.36  ? 300  SER A O   1 
ATOM   2328 C  CB  . SER A 1 301 ? 19.092  36.353 53.595  1.00 18.87  ? 300  SER A CB  1 
ATOM   2329 O  OG  . SER A 1 301 ? 19.383  37.715 53.804  1.00 19.75  ? 300  SER A OG  1 
ATOM   2330 N  N   . TRP A 1 302 ? 18.469  33.616 55.557  1.00 19.18  ? 301  TRP A N   1 
ATOM   2331 C  CA  . TRP A 1 302 ? 18.431  32.189 55.676  1.00 21.61  ? 301  TRP A CA  1 
ATOM   2332 C  C   . TRP A 1 302 ? 17.572  31.826 56.889  1.00 23.56  ? 301  TRP A C   1 
ATOM   2333 O  O   . TRP A 1 302 ? 16.478  31.271 56.777  1.00 23.82  ? 301  TRP A O   1 
ATOM   2334 C  CB  . TRP A 1 302 ? 19.815  31.539 55.793  1.00 23.04  ? 301  TRP A CB  1 
ATOM   2335 C  CG  . TRP A 1 302 ? 20.658  31.686 54.552  1.00 25.35  ? 301  TRP A CG  1 
ATOM   2336 C  CD1 . TRP A 1 302 ? 20.855  30.728 53.601  1.00 27.96  ? 301  TRP A CD1 1 
ATOM   2337 C  CD2 . TRP A 1 302 ? 21.462  32.798 54.143  1.00 23.60  ? 301  TRP A CD2 1 
ATOM   2338 N  NE1 . TRP A 1 302 ? 21.694  31.178 52.618  1.00 23.97  ? 301  TRP A NE1 1 
ATOM   2339 C  CE2 . TRP A 1 302 ? 22.097  32.432 52.915  1.00 23.82  ? 301  TRP A CE2 1 
ATOM   2340 C  CE3 . TRP A 1 302 ? 21.688  34.053 54.689  1.00 22.79  ? 301  TRP A CE3 1 
ATOM   2341 C  CZ2 . TRP A 1 302 ? 22.939  33.272 52.216  1.00 22.46  ? 301  TRP A CZ2 1 
ATOM   2342 C  CZ3 . TRP A 1 302 ? 22.534  34.892 54.000  1.00 24.82  ? 301  TRP A CZ3 1 
ATOM   2343 C  CH2 . TRP A 1 302 ? 23.153  34.502 52.796  1.00 26.57  ? 301  TRP A CH2 1 
ATOM   2344 N  N   . THR A 1 303 ? 18.080  32.149 58.074  1.00 19.87  ? 302  THR A N   1 
ATOM   2345 C  CA  . THR A 1 303 ? 17.358  31.822 59.285  1.00 20.49  ? 302  THR A CA  1 
ATOM   2346 C  C   . THR A 1 303 ? 16.294  32.866 59.616  1.00 20.03  ? 302  THR A C   1 
ATOM   2347 O  O   . THR A 1 303 ? 16.577  33.805 60.340  1.00 20.36  ? 302  THR A O   1 
ATOM   2348 C  CB  . THR A 1 303 ? 18.309  31.537 60.479  1.00 15.81  ? 302  THR A CB  1 
ATOM   2349 O  OG1 . THR A 1 303 ? 19.251  32.581 60.555  1.00 17.11  ? 302  THR A OG1 1 
ATOM   2350 C  CG2 . THR A 1 303 ? 19.047  30.205 60.307  1.00 17.75  ? 302  THR A CG2 1 
ATOM   2351 N  N   . GLY A 1 304 ? 15.080  32.699 59.111  1.00 15.84  ? 303  GLY A N   1 
ATOM   2352 C  CA  . GLY A 1 304 ? 14.020  33.646 59.409  1.00 13.98  ? 303  GLY A CA  1 
ATOM   2353 C  C   . GLY A 1 304 ? 13.222  33.854 58.145  1.00 16.87  ? 303  GLY A C   1 
ATOM   2354 O  O   . GLY A 1 304 ? 12.009  33.604 58.075  1.00 18.37  ? 303  GLY A O   1 
ATOM   2355 N  N   . ASN A 1 305 ? 13.944  34.287 57.138  1.00 15.59  ? 304  ASN A N   1 
ATOM   2356 C  CA  . ASN A 1 305 ? 13.332  34.542 55.846  1.00 15.84  ? 304  ASN A CA  1 
ATOM   2357 C  C   . ASN A 1 305 ? 13.151  33.277 55.002  1.00 23.11  ? 304  ASN A C   1 
ATOM   2358 O  O   . ASN A 1 305 ? 12.133  33.172 54.319  1.00 20.28  ? 304  ASN A O   1 
ATOM   2359 C  CB  . ASN A 1 305 ? 14.075  35.643 55.069  1.00 14.22  ? 304  ASN A CB  1 
ATOM   2360 C  CG  . ASN A 1 305 ? 14.069  36.963 55.803  1.00 28.04  ? 304  ASN A CG  1 
ATOM   2361 O  OD1 . ASN A 1 305 ? 13.522  37.030 56.927  1.00 21.54  ? 304  ASN A OD1 1 
ATOM   2362 N  ND2 . ASN A 1 305 ? 14.660  37.988 55.159  1.00 15.69  ? 304  ASN A ND2 1 
ATOM   2363 N  N   . LEU A 1 306 ? 14.106  32.310 55.061  1.00 22.32  ? 305  LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 306 ? 13.970  31.036 54.310  1.00 21.16  ? 305  LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 306 ? 13.179  29.990 55.107  1.00 24.14  ? 305  LEU A C   1 
ATOM   2366 O  O   . LEU A 1 306 ? 12.183  29.414 54.657  1.00 20.26  ? 305  LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 306 ? 15.312  30.421 53.877  1.00 20.64  ? 305  LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 306 ? 15.667  30.763 52.443  1.00 25.36  ? 305  LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 306 ? 17.031  30.163 52.135  1.00 21.74  ? 305  LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 306 ? 14.601  30.274 51.458  1.00 29.52  ? 305  LEU A CD2 1 
ATOM   2371 N  N   . VAL A 1 307 ? 13.690  29.750 56.320  1.00 22.11  ? 306  VAL A N   1 
ATOM   2372 C  CA  . VAL A 1 307 ? 13.087  28.894 57.326  1.00 22.78  ? 306  VAL A CA  1 
ATOM   2373 C  C   . VAL A 1 307 ? 12.593  29.863 58.387  1.00 20.95  ? 306  VAL A C   1 
ATOM   2374 O  O   . VAL A 1 307 ? 13.360  30.606 59.023  1.00 17.13  ? 306  VAL A O   1 
ATOM   2375 C  CB  . VAL A 1 307 ? 13.972  27.779 57.846  1.00 26.88  ? 306  VAL A CB  1 
ATOM   2376 C  CG1 . VAL A 1 307 ? 15.369  28.300 58.012  1.00 30.17  ? 306  VAL A CG1 1 
ATOM   2377 C  CG2 . VAL A 1 307 ? 13.470  27.219 59.162  1.00 24.85  ? 306  VAL A CG2 1 
ATOM   2378 N  N   . THR A 1 308 ? 11.268  29.875 58.487  1.00 19.71  ? 307  THR A N   1 
ATOM   2379 C  CA  . THR A 1 308 ? 10.533  30.800 59.346  1.00 18.22  ? 307  THR A CA  1 
ATOM   2380 C  C   . THR A 1 308 ? 9.839   30.176 60.539  1.00 16.26  ? 307  THR A C   1 
ATOM   2381 O  O   . THR A 1 308 ? 9.262   29.105 60.437  1.00 12.74  ? 307  THR A O   1 
ATOM   2382 C  CB  . THR A 1 308 ? 9.463   31.476 58.441  1.00 21.45  ? 307  THR A CB  1 
ATOM   2383 O  OG1 . THR A 1 308 ? 10.078  31.965 57.280  1.00 17.92  ? 307  THR A OG1 1 
ATOM   2384 C  CG2 . THR A 1 308 ? 8.739   32.628 59.134  1.00 11.03  ? 307  THR A CG2 1 
ATOM   2385 N  N   . ASN A 1 309 ? 9.840   30.870 61.679  1.00 13.09  ? 308  ASN A N   1 
ATOM   2386 C  CA  . ASN A 1 309 ? 9.111   30.345 62.816  1.00 14.06  ? 308  ASN A CA  1 
ATOM   2387 C  C   . ASN A 1 309 ? 7.633   30.248 62.421  1.00 16.30  ? 308  ASN A C   1 
ATOM   2388 O  O   . ASN A 1 309 ? 7.041   31.166 61.832  1.00 16.00  ? 308  ASN A O   1 
ATOM   2389 C  CB  . ASN A 1 309 ? 9.277   31.223 64.092  1.00 12.92  ? 308  ASN A CB  1 
ATOM   2390 C  CG  . ASN A 1 309 ? 9.213   32.731 63.891  1.00 20.56  ? 308  ASN A CG  1 
ATOM   2391 O  OD1 . ASN A 1 309 ? 9.877   33.505 64.593  1.00 19.56  ? 308  ASN A OD1 1 
ATOM   2392 N  ND2 . ASN A 1 309 ? 8.406   33.206 62.953  1.00 16.07  ? 308  ASN A ND2 1 
ATOM   2393 N  N   . LYS A 1 310 ? 7.004   29.141 62.729  1.00 15.40  ? 309  LYS A N   1 
ATOM   2394 C  CA  . LYS A 1 310 ? 5.600   28.971 62.366  1.00 15.11  ? 309  LYS A CA  1 
ATOM   2395 C  C   . LYS A 1 310 ? 4.607   29.891 63.122  1.00 19.89  ? 309  LYS A C   1 
ATOM   2396 O  O   . LYS A 1 310 ? 3.540   30.305 62.651  1.00 16.39  ? 309  LYS A O   1 
ATOM   2397 C  CB  . LYS A 1 310 ? 5.279   27.493 62.491  1.00 14.57  ? 309  LYS A CB  1 
ATOM   2398 C  CG  . LYS A 1 310 ? 3.863   27.208 62.020  1.00 19.79  ? 309  LYS A CG  1 
ATOM   2399 C  CD  . LYS A 1 310 ? 3.513   25.738 62.103  1.00 30.87  ? 309  LYS A CD  1 
ATOM   2400 C  CE  . LYS A 1 310 ? 3.169   25.135 60.754  1.00 82.87  ? 309  LYS A CE  1 
ATOM   2401 N  NZ  . LYS A 1 310 ? 4.126   24.100 60.326  1.00 100.00 ? 309  LYS A NZ  1 
ATOM   2402 N  N   . THR A 1 311 ? 4.930   30.182 64.367  1.00 15.49  ? 310  THR A N   1 
ATOM   2403 C  CA  . THR A 1 311 ? 4.165   31.100 65.196  1.00 14.00  ? 310  THR A CA  1 
ATOM   2404 C  C   . THR A 1 311 ? 5.196   31.851 66.038  1.00 21.33  ? 310  THR A C   1 
ATOM   2405 O  O   . THR A 1 311 ? 6.333   31.382 66.204  1.00 17.08  ? 310  THR A O   1 
ATOM   2406 C  CB  . THR A 1 311 ? 3.158   30.422 66.130  1.00 23.18  ? 310  THR A CB  1 
ATOM   2407 O  OG1 . THR A 1 311 ? 3.843   29.888 67.272  1.00 17.70  ? 310  THR A OG1 1 
ATOM   2408 C  CG2 . THR A 1 311 ? 2.354   29.366 65.357  1.00 24.41  ? 310  THR A CG2 1 
ATOM   2409 N  N   . TRP A 1 312 ? 4.797   32.998 66.591  1.00 16.85  ? 311  TRP A N   1 
ATOM   2410 C  CA  . TRP A 1 312 ? 5.703   33.779 67.408  1.00 13.14  ? 311  TRP A CA  1 
ATOM   2411 C  C   . TRP A 1 312 ? 6.121   33.074 68.703  1.00 14.85  ? 311  TRP A C   1 
ATOM   2412 O  O   . TRP A 1 312 ? 7.023   33.499 69.408  1.00 16.76  ? 311  TRP A O   1 
ATOM   2413 C  CB  . TRP A 1 312 ? 5.152   35.196 67.620  1.00 11.46  ? 311  TRP A CB  1 
ATOM   2414 C  CG  . TRP A 1 312 ? 4.878   35.825 66.301  1.00 12.77  ? 311  TRP A CG  1 
ATOM   2415 C  CD1 . TRP A 1 312 ? 3.661   36.134 65.773  1.00 15.35  ? 311  TRP A CD1 1 
ATOM   2416 C  CD2 . TRP A 1 312 ? 5.867   36.192 65.320  1.00 14.76  ? 311  TRP A CD2 1 
ATOM   2417 N  NE1 . TRP A 1 312 ? 3.809   36.710 64.528  1.00 15.45  ? 311  TRP A NE1 1 
ATOM   2418 C  CE2 . TRP A 1 312 ? 5.167   36.734 64.217  1.00 16.76  ? 311  TRP A CE2 1 
ATOM   2419 C  CE3 . TRP A 1 312 ? 7.265   36.090 65.283  1.00 15.71  ? 311  TRP A CE3 1 
ATOM   2420 C  CZ2 . TRP A 1 312 ? 5.851   37.203 63.090  1.00 13.67  ? 311  TRP A CZ2 1 
ATOM   2421 C  CZ3 . TRP A 1 312 ? 7.933   36.555 64.180  1.00 16.49  ? 311  TRP A CZ3 1 
ATOM   2422 C  CH2 . TRP A 1 312 ? 7.230   37.101 63.091  1.00 17.12  ? 311  TRP A CH2 1 
ATOM   2423 N  N   . ASP A 1 313 ? 5.490   31.969 69.043  1.00 13.30  ? 312  ASP A N   1 
ATOM   2424 C  CA  . ASP A 1 313 ? 5.895   31.246 70.222  1.00 16.21  ? 312  ASP A CA  1 
ATOM   2425 C  C   . ASP A 1 313 ? 7.274   30.591 70.003  1.00 17.53  ? 312  ASP A C   1 
ATOM   2426 O  O   . ASP A 1 313 ? 8.008   30.260 70.927  1.00 15.45  ? 312  ASP A O   1 
ATOM   2427 C  CB  . ASP A 1 313 ? 4.866   30.143 70.538  1.00 17.39  ? 312  ASP A CB  1 
ATOM   2428 C  CG  . ASP A 1 313 ? 3.597   30.710 71.126  1.00 16.83  ? 312  ASP A CG  1 
ATOM   2429 O  OD1 . ASP A 1 313 ? 3.467   31.852 71.479  1.00 19.29  ? 312  ASP A OD1 1 
ATOM   2430 O  OD2 . ASP A 1 313 ? 2.658   29.837 71.234  1.00 22.09  ? 312  ASP A OD2 1 
ATOM   2431 N  N   . HIS A 1 314 ? 7.628   30.392 68.748  1.00 13.40  ? 313  HIS A N   1 
ATOM   2432 C  CA  . HIS A 1 314 ? 8.881   29.767 68.392  1.00 11.86  ? 313  HIS A CA  1 
ATOM   2433 C  C   . HIS A 1 314 ? 9.855   30.779 67.820  1.00 14.50  ? 313  HIS A C   1 
ATOM   2434 O  O   . HIS A 1 314 ? 10.768  30.463 67.080  1.00 17.00  ? 313  HIS A O   1 
ATOM   2435 C  CB  . HIS A 1 314 ? 8.547   28.724 67.308  1.00 14.08  ? 313  HIS A CB  1 
ATOM   2436 C  CG  . HIS A 1 314 ? 7.649   27.679 67.892  1.00 16.09  ? 313  HIS A CG  1 
ATOM   2437 N  ND1 . HIS A 1 314 ? 8.144   26.653 68.689  1.00 15.85  ? 313  HIS A ND1 1 
ATOM   2438 C  CD2 . HIS A 1 314 ? 6.287   27.557 67.842  1.00 13.64  ? 313  HIS A CD2 1 
ATOM   2439 C  CE1 . HIS A 1 314 ? 7.097   25.922 69.096  1.00 14.23  ? 313  HIS A CE1 1 
ATOM   2440 N  NE2 . HIS A 1 314 ? 5.985   26.458 68.615  1.00 13.52  ? 313  HIS A NE2 1 
ATOM   2441 N  N   . PHE A 1 315 ? 9.654   32.022 68.178  1.00 14.17  ? 314  PHE A N   1 
ATOM   2442 C  CA  . PHE A 1 315 ? 10.435  33.140 67.723  1.00 13.18  ? 314  PHE A CA  1 
ATOM   2443 C  C   . PHE A 1 315 ? 11.910  32.890 67.944  1.00 13.98  ? 314  PHE A C   1 
ATOM   2444 O  O   . PHE A 1 315 ? 12.775  33.355 67.210  1.00 13.88  ? 314  PHE A O   1 
ATOM   2445 C  CB  . PHE A 1 315 ? 9.968   34.367 68.516  1.00 11.94  ? 314  PHE A CB  1 
ATOM   2446 C  CG  . PHE A 1 315 ? 10.644  35.668 68.130  1.00 16.32  ? 314  PHE A CG  1 
ATOM   2447 C  CD1 . PHE A 1 315 ? 10.734  36.090 66.802  1.00 15.58  ? 314  PHE A CD1 1 
ATOM   2448 C  CD2 . PHE A 1 315 ? 11.163  36.510 69.121  1.00 16.22  ? 314  PHE A CD2 1 
ATOM   2449 C  CE1 . PHE A 1 315 ? 11.326  37.314 66.482  1.00 15.39  ? 314  PHE A CE1 1 
ATOM   2450 C  CE2 . PHE A 1 315 ? 11.779  37.727 68.826  1.00 17.56  ? 314  PHE A CE2 1 
ATOM   2451 C  CZ  . PHE A 1 315 ? 11.857  38.128 67.490  1.00 16.63  ? 314  PHE A CZ  1 
ATOM   2452 N  N   . TRP A 1 316 ? 12.244  32.131 68.950  1.00 11.22  ? 315  TRP A N   1 
ATOM   2453 C  CA  . TRP A 1 316 ? 13.701  31.921 69.150  1.00 8.85   ? 315  TRP A CA  1 
ATOM   2454 C  C   . TRP A 1 316 ? 14.386  31.236 67.968  1.00 16.46  ? 315  TRP A C   1 
ATOM   2455 O  O   . TRP A 1 316 ? 15.577  31.416 67.735  1.00 17.37  ? 315  TRP A O   1 
ATOM   2456 C  CB  . TRP A 1 316 ? 13.968  31.130 70.425  1.00 7.05   ? 315  TRP A CB  1 
ATOM   2457 C  CG  . TRP A 1 316 ? 13.737  29.668 70.223  1.00 11.50  ? 315  TRP A CG  1 
ATOM   2458 C  CD1 . TRP A 1 316 ? 12.552  28.982 70.289  1.00 14.09  ? 315  TRP A CD1 1 
ATOM   2459 C  CD2 . TRP A 1 316 ? 14.755  28.696 69.909  1.00 14.05  ? 315  TRP A CD2 1 
ATOM   2460 N  NE1 . TRP A 1 316 ? 12.757  27.639 70.053  1.00 14.75  ? 315  TRP A NE1 1 
ATOM   2461 C  CE2 . TRP A 1 316 ? 14.112  27.426 69.829  1.00 19.21  ? 315  TRP A CE2 1 
ATOM   2462 C  CE3 . TRP A 1 316 ? 16.135  28.783 69.668  1.00 14.13  ? 315  TRP A CE3 1 
ATOM   2463 C  CZ2 . TRP A 1 316 ? 14.854  26.239 69.553  1.00 18.59  ? 315  TRP A CZ2 1 
ATOM   2464 C  CZ3 . TRP A 1 316 ? 16.848  27.603 69.408  1.00 15.80  ? 315  TRP A CZ3 1 
ATOM   2465 C  CH2 . TRP A 1 316 ? 16.225  26.341 69.370  1.00 15.36  ? 315  TRP A CH2 1 
ATOM   2466 N  N   . LEU A 1 317 ? 13.665  30.427 67.199  1.00 15.45  ? 316  LEU A N   1 
ATOM   2467 C  CA  . LEU A 1 317 ? 14.275  29.786 66.039  1.00 15.59  ? 316  LEU A CA  1 
ATOM   2468 C  C   . LEU A 1 317 ? 14.806  30.877 65.102  1.00 19.42  ? 316  LEU A C   1 
ATOM   2469 O  O   . LEU A 1 317 ? 15.912  30.785 64.558  1.00 18.71  ? 316  LEU A O   1 
ATOM   2470 C  CB  . LEU A 1 317 ? 13.187  28.974 65.268  1.00 16.46  ? 316  LEU A CB  1 
ATOM   2471 C  CG  . LEU A 1 317 ? 12.679  27.700 65.971  1.00 17.87  ? 316  LEU A CG  1 
ATOM   2472 C  CD1 . LEU A 1 317 ? 11.619  27.020 65.096  1.00 15.05  ? 316  LEU A CD1 1 
ATOM   2473 C  CD2 . LEU A 1 317 ? 13.812  26.696 66.232  1.00 16.57  ? 316  LEU A CD2 1 
ATOM   2474 N  N   . ASN A 1 318 ? 14.004  31.928 64.892  1.00 12.40  ? 317  ASN A N   1 
ATOM   2475 C  CA  . ASN A 1 318 ? 14.421  33.011 64.034  1.00 12.09  ? 317  ASN A CA  1 
ATOM   2476 C  C   . ASN A 1 318 ? 15.639  33.720 64.594  1.00 19.91  ? 317  ASN A C   1 
ATOM   2477 O  O   . ASN A 1 318 ? 16.680  33.810 63.968  1.00 20.50  ? 317  ASN A O   1 
ATOM   2478 C  CB  . ASN A 1 318 ? 13.304  34.073 63.870  1.00 18.56  ? 317  ASN A CB  1 
ATOM   2479 C  CG  . ASN A 1 318 ? 12.331  33.798 62.729  1.00 19.35  ? 317  ASN A CG  1 
ATOM   2480 O  OD1 . ASN A 1 318 ? 12.028  32.647 62.381  1.00 15.37  ? 317  ASN A OD1 1 
ATOM   2481 N  ND2 . ASN A 1 318 ? 11.761  34.856 62.180  1.00 15.57  ? 317  ASN A ND2 1 
ATOM   2482 N  N   . GLU A 1 319 ? 15.486  34.281 65.789  1.00 15.19  ? 318  GLU A N   1 
ATOM   2483 C  CA  . GLU A 1 319 ? 16.522  35.073 66.433  1.00 11.97  ? 318  GLU A CA  1 
ATOM   2484 C  C   . GLU A 1 319 ? 17.754  34.318 66.948  1.00 14.90  ? 318  GLU A C   1 
ATOM   2485 O  O   . GLU A 1 319 ? 18.861  34.762 66.724  1.00 14.03  ? 318  GLU A O   1 
ATOM   2486 C  CB  . GLU A 1 319 ? 15.894  36.023 67.500  1.00 9.48   ? 318  GLU A CB  1 
ATOM   2487 C  CG  . GLU A 1 319 ? 14.862  36.983 66.862  1.00 8.24   ? 318  GLU A CG  1 
ATOM   2488 C  CD  . GLU A 1 319 ? 15.409  37.898 65.776  1.00 14.75  ? 318  GLU A CD  1 
ATOM   2489 O  OE1 . GLU A 1 319 ? 16.597  38.104 65.536  1.00 13.03  ? 318  GLU A OE1 1 
ATOM   2490 O  OE2 . GLU A 1 319 ? 14.468  38.428 65.046  1.00 13.56  ? 318  GLU A OE2 1 
ATOM   2491 N  N   . GLY A 1 320 ? 17.586  33.196 67.672  1.00 11.86  ? 319  GLY A N   1 
ATOM   2492 C  CA  . GLY A 1 320 ? 18.740  32.468 68.173  1.00 11.63  ? 319  GLY A CA  1 
ATOM   2493 C  C   . GLY A 1 320 ? 19.655  31.995 67.047  1.00 16.47  ? 319  GLY A C   1 
ATOM   2494 O  O   . GLY A 1 320 ? 20.862  32.192 67.142  1.00 16.49  ? 319  GLY A O   1 
ATOM   2495 N  N   . HIS A 1 321 ? 19.118  31.374 65.991  1.00 13.41  ? 320  HIS A N   1 
ATOM   2496 C  CA  . HIS A 1 321 ? 19.963  30.915 64.885  1.00 13.77  ? 320  HIS A CA  1 
ATOM   2497 C  C   . HIS A 1 321 ? 20.671  32.086 64.195  1.00 14.09  ? 320  HIS A C   1 
ATOM   2498 O  O   . HIS A 1 321 ? 21.808  32.000 63.739  1.00 17.34  ? 320  HIS A O   1 
ATOM   2499 C  CB  . HIS A 1 321 ? 19.148  30.128 63.832  1.00 12.48  ? 320  HIS A CB  1 
ATOM   2500 C  CG  . HIS A 1 321 ? 18.795  28.772 64.335  1.00 16.54  ? 320  HIS A CG  1 
ATOM   2501 N  ND1 . HIS A 1 321 ? 17.663  28.555 65.111  1.00 18.54  ? 320  HIS A ND1 1 
ATOM   2502 C  CD2 . HIS A 1 321 ? 19.459  27.585 64.203  1.00 19.71  ? 320  HIS A CD2 1 
ATOM   2503 C  CE1 . HIS A 1 321 ? 17.644  27.262 65.413  1.00 17.18  ? 320  HIS A CE1 1 
ATOM   2504 N  NE2 . HIS A 1 321 ? 18.699  26.647 64.875  1.00 17.83  ? 320  HIS A NE2 1 
ATOM   2505 N  N   . THR A 1 322 ? 19.952  33.190 64.090  1.00 12.05  ? 321  THR A N   1 
ATOM   2506 C  CA  . THR A 1 322 ? 20.492  34.376 63.465  1.00 15.46  ? 321  THR A CA  1 
ATOM   2507 C  C   . THR A 1 322 ? 21.669  34.999 64.244  1.00 20.32  ? 321  THR A C   1 
ATOM   2508 O  O   . THR A 1 322 ? 22.678  35.421 63.665  1.00 17.11  ? 321  THR A O   1 
ATOM   2509 C  CB  . THR A 1 322 ? 19.406  35.394 63.078  1.00 19.10  ? 321  THR A CB  1 
ATOM   2510 O  OG1 . THR A 1 322 ? 18.517  34.726 62.203  1.00 14.48  ? 321  THR A OG1 1 
ATOM   2511 C  CG2 . THR A 1 322 ? 20.089  36.593 62.382  1.00 12.29  ? 321  THR A CG2 1 
ATOM   2512 N  N   . VAL A 1 323 ? 21.541  35.047 65.573  1.00 13.35  ? 322  VAL A N   1 
ATOM   2513 C  CA  . VAL A 1 323 ? 22.615  35.545 66.391  1.00 12.65  ? 322  VAL A CA  1 
ATOM   2514 C  C   . VAL A 1 323 ? 23.795  34.588 66.234  1.00 16.03  ? 322  VAL A C   1 
ATOM   2515 O  O   . VAL A 1 323 ? 24.959  34.956 66.195  1.00 16.36  ? 322  VAL A O   1 
ATOM   2516 C  CB  . VAL A 1 323 ? 22.149  35.593 67.838  1.00 12.95  ? 322  VAL A CB  1 
ATOM   2517 C  CG1 . VAL A 1 323 ? 23.340  35.917 68.744  1.00 12.06  ? 322  VAL A CG1 1 
ATOM   2518 C  CG2 . VAL A 1 323 ? 21.070  36.690 67.972  1.00 11.64  ? 322  VAL A CG2 1 
ATOM   2519 N  N   . TYR A 1 324 ? 23.484  33.319 66.107  1.00 12.22  ? 323  TYR A N   1 
ATOM   2520 C  CA  . TYR A 1 324 ? 24.543  32.350 65.974  1.00 10.51  ? 323  TYR A CA  1 
ATOM   2521 C  C   . TYR A 1 324 ? 25.297  32.597 64.670  1.00 15.55  ? 323  TYR A C   1 
ATOM   2522 O  O   . TYR A 1 324 ? 26.534  32.680 64.604  1.00 15.83  ? 323  TYR A O   1 
ATOM   2523 C  CB  . TYR A 1 324 ? 23.955  30.941 66.161  1.00 12.86  ? 323  TYR A CB  1 
ATOM   2524 C  CG  . TYR A 1 324 ? 25.002  29.841 66.078  1.00 16.99  ? 323  TYR A CG  1 
ATOM   2525 C  CD1 . TYR A 1 324 ? 25.666  29.350 67.208  1.00 18.18  ? 323  TYR A CD1 1 
ATOM   2526 C  CD2 . TYR A 1 324 ? 25.323  29.291 64.834  1.00 21.03  ? 323  TYR A CD2 1 
ATOM   2527 C  CE1 . TYR A 1 324 ? 26.610  28.319 67.112  1.00 15.16  ? 323  TYR A CE1 1 
ATOM   2528 C  CE2 . TYR A 1 324 ? 26.266  28.268 64.707  1.00 20.54  ? 323  TYR A CE2 1 
ATOM   2529 C  CZ  . TYR A 1 324 ? 26.902  27.789 65.853  1.00 19.73  ? 323  TYR A CZ  1 
ATOM   2530 O  OH  . TYR A 1 324 ? 27.875  26.842 65.715  1.00 18.13  ? 323  TYR A OH  1 
ATOM   2531 N  N   . LEU A 1 325 ? 24.547  32.768 63.593  1.00 12.82  ? 324  LEU A N   1 
ATOM   2532 C  CA  . LEU A 1 325 ? 25.216  33.034 62.335  1.00 15.52  ? 324  LEU A CA  1 
ATOM   2533 C  C   . LEU A 1 325 ? 26.008  34.346 62.366  1.00 22.74  ? 324  LEU A C   1 
ATOM   2534 O  O   . LEU A 1 325 ? 27.160  34.471 61.935  1.00 22.72  ? 324  LEU A O   1 
ATOM   2535 C  CB  . LEU A 1 325 ? 24.225  33.012 61.148  1.00 14.70  ? 324  LEU A CB  1 
ATOM   2536 C  CG  . LEU A 1 325 ? 23.724  31.586 60.863  1.00 18.25  ? 324  LEU A CG  1 
ATOM   2537 C  CD1 . LEU A 1 325 ? 22.608  31.574 59.808  1.00 17.22  ? 324  LEU A CD1 1 
ATOM   2538 C  CD2 . LEU A 1 325 ? 24.905  30.704 60.448  1.00 23.48  ? 324  LEU A CD2 1 
ATOM   2539 N  N   . GLU A 1 326 ? 25.332  35.361 62.859  1.00 15.47  ? 325  GLU A N   1 
ATOM   2540 C  CA  . GLU A 1 326 ? 25.885  36.694 63.007  1.00 13.65  ? 325  GLU A CA  1 
ATOM   2541 C  C   . GLU A 1 326 ? 27.246  36.636 63.628  1.00 16.34  ? 325  GLU A C   1 
ATOM   2542 O  O   . GLU A 1 326 ? 28.168  37.246 63.123  1.00 15.36  ? 325  GLU A O   1 
ATOM   2543 C  CB  . GLU A 1 326 ? 24.988  37.464 63.996  1.00 16.31  ? 325  GLU A CB  1 
ATOM   2544 C  CG  . GLU A 1 326 ? 25.472  38.890 64.363  1.00 20.54  ? 325  GLU A CG  1 
ATOM   2545 C  CD  . GLU A 1 326 ? 24.743  39.395 65.599  1.00 30.10  ? 325  GLU A CD  1 
ATOM   2546 O  OE1 . GLU A 1 326 ? 23.641  39.008 65.966  1.00 18.40  ? 325  GLU A OE1 1 
ATOM   2547 O  OE2 . GLU A 1 326 ? 25.421  40.260 66.301  1.00 21.65  ? 325  GLU A OE2 1 
ATOM   2548 N  N   . ARG A 1 327 ? 27.329  35.892 64.727  1.00 15.29  ? 326  ARG A N   1 
ATOM   2549 C  CA  . ARG A 1 327 ? 28.565  35.781 65.469  1.00 14.94  ? 326  ARG A CA  1 
ATOM   2550 C  C   . ARG A 1 327 ? 29.651  35.048 64.718  1.00 18.22  ? 326  ARG A C   1 
ATOM   2551 O  O   . ARG A 1 327 ? 30.828  35.316 64.914  1.00 16.55  ? 326  ARG A O   1 
ATOM   2552 C  CB  . ARG A 1 327 ? 28.367  35.352 66.915  1.00 15.15  ? 326  ARG A CB  1 
ATOM   2553 C  CG  . ARG A 1 327 ? 27.548  36.410 67.619  1.00 11.35  ? 326  ARG A CG  1 
ATOM   2554 C  CD  . ARG A 1 327 ? 27.266  36.102 69.095  1.00 11.37  ? 326  ARG A CD  1 
ATOM   2555 N  NE  . ARG A 1 327 ? 26.619  37.266 69.724  1.00 14.76  ? 326  ARG A NE  1 
ATOM   2556 C  CZ  . ARG A 1 327 ? 25.805  37.229 70.769  1.00 16.13  ? 326  ARG A CZ  1 
ATOM   2557 N  NH1 . ARG A 1 327 ? 25.523  36.107 71.419  1.00 8.40   ? 326  ARG A NH1 1 
ATOM   2558 N  NH2 . ARG A 1 327 ? 25.262  38.379 71.166  1.00 16.43  ? 326  ARG A NH2 1 
ATOM   2559 N  N   . HIS A 1 328 ? 29.233  34.146 63.843  1.00 17.38  ? 327  HIS A N   1 
ATOM   2560 C  CA  . HIS A 1 328 ? 30.174  33.400 63.018  1.00 19.62  ? 327  HIS A CA  1 
ATOM   2561 C  C   . HIS A 1 328 ? 30.700  34.341 61.938  1.00 18.88  ? 327  HIS A C   1 
ATOM   2562 O  O   . HIS A 1 328 ? 31.866  34.359 61.573  1.00 19.41  ? 327  HIS A O   1 
ATOM   2563 C  CB  . HIS A 1 328 ? 29.485  32.146 62.407  1.00 17.97  ? 327  HIS A CB  1 
ATOM   2564 C  CG  . HIS A 1 328 ? 29.698  30.875 63.188  1.00 19.10  ? 327  HIS A CG  1 
ATOM   2565 N  ND1 . HIS A 1 328 ? 30.973  30.414 63.524  1.00 20.08  ? 327  HIS A ND1 1 
ATOM   2566 C  CD2 . HIS A 1 328 ? 28.792  29.954 63.642  1.00 18.16  ? 327  HIS A CD2 1 
ATOM   2567 C  CE1 . HIS A 1 328 ? 30.824  29.266 64.188  1.00 18.80  ? 327  HIS A CE1 1 
ATOM   2568 N  NE2 . HIS A 1 328 ? 29.519  28.976 64.284  1.00 19.69  ? 327  HIS A NE2 1 
ATOM   2569 N  N   . ILE A 1 329 ? 29.827  35.168 61.391  1.00 14.60  ? 328  ILE A N   1 
ATOM   2570 C  CA  . ILE A 1 329 ? 30.304  36.097 60.362  1.00 15.76  ? 328  ILE A CA  1 
ATOM   2571 C  C   . ILE A 1 329 ? 31.423  36.971 60.935  1.00 28.02  ? 328  ILE A C   1 
ATOM   2572 O  O   . ILE A 1 329 ? 32.504  37.099 60.355  1.00 26.14  ? 328  ILE A O   1 
ATOM   2573 C  CB  . ILE A 1 329 ? 29.145  36.946 59.788  1.00 16.17  ? 328  ILE A CB  1 
ATOM   2574 C  CG1 . ILE A 1 329 ? 28.220  36.087 58.911  1.00 19.03  ? 328  ILE A CG1 1 
ATOM   2575 C  CG2 . ILE A 1 329 ? 29.642  38.126 58.968  1.00 18.66  ? 328  ILE A CG2 1 
ATOM   2576 C  CD1 . ILE A 1 329 ? 26.852  36.718 58.595  1.00 14.57  ? 328  ILE A CD1 1 
ATOM   2577 N  N   . CYS A 1 330 ? 31.139  37.562 62.116  1.00 21.94  ? 329  CYS A N   1 
ATOM   2578 C  CA  . CYS A 1 330 ? 32.040  38.433 62.826  1.00 19.84  ? 329  CYS A CA  1 
ATOM   2579 C  C   . CYS A 1 330 ? 33.306  37.718 63.233  1.00 20.23  ? 329  CYS A C   1 
ATOM   2580 O  O   . CYS A 1 330 ? 34.391  38.278 63.154  1.00 21.18  ? 329  CYS A O   1 
ATOM   2581 C  CB  . CYS A 1 330 ? 31.309  39.092 64.007  1.00 26.30  ? 329  CYS A CB  1 
ATOM   2582 S  SG  . CYS A 1 330 ? 30.024  40.241 63.391  1.00 33.21  ? 329  CYS A SG  1 
ATOM   2583 N  N   . GLY A 1 331 ? 33.169  36.480 63.655  1.00 17.16  ? 330  GLY A N   1 
ATOM   2584 C  CA  . GLY A 1 331 ? 34.314  35.683 64.039  1.00 17.88  ? 330  GLY A CA  1 
ATOM   2585 C  C   . GLY A 1 331 ? 35.160  35.471 62.786  1.00 23.13  ? 330  GLY A C   1 
ATOM   2586 O  O   . GLY A 1 331 ? 36.381  35.479 62.773  1.00 19.20  ? 330  GLY A O   1 
ATOM   2587 N  N   . ARG A 1 332 ? 34.494  35.297 61.673  1.00 23.41  ? 331  ARG A N   1 
ATOM   2588 C  CA  . ARG A 1 332 ? 35.238  35.107 60.454  1.00 25.42  ? 331  ARG A CA  1 
ATOM   2589 C  C   . ARG A 1 332 ? 35.949  36.374 60.013  1.00 27.08  ? 331  ARG A C   1 
ATOM   2590 O  O   . ARG A 1 332 ? 37.066  36.354 59.519  1.00 30.59  ? 331  ARG A O   1 
ATOM   2591 C  CB  . ARG A 1 332 ? 34.323  34.671 59.328  1.00 29.56  ? 331  ARG A CB  1 
ATOM   2592 C  CG  . ARG A 1 332 ? 34.103  33.178 59.357  1.00 42.38  ? 331  ARG A CG  1 
ATOM   2593 C  CD  . ARG A 1 332 ? 34.542  32.499 58.075  1.00 45.62  ? 331  ARG A CD  1 
ATOM   2594 N  NE  . ARG A 1 332 ? 33.755  31.307 57.851  1.00 59.13  ? 331  ARG A NE  1 
ATOM   2595 C  CZ  . ARG A 1 332 ? 33.469  30.431 58.821  1.00 84.69  ? 331  ARG A CZ  1 
ATOM   2596 N  NH1 . ARG A 1 332 ? 33.882  30.552 60.089  1.00 53.45  ? 331  ARG A NH1 1 
ATOM   2597 N  NH2 . ARG A 1 332 ? 32.744  29.367 58.501  1.00 89.38  ? 331  ARG A NH2 1 
ATOM   2598 N  N   . LEU A 1 333 ? 35.309  37.506 60.144  1.00 18.29  ? 332  LEU A N   1 
ATOM   2599 C  CA  . LEU A 1 333 ? 35.960  38.699 59.689  1.00 18.18  ? 332  LEU A CA  1 
ATOM   2600 C  C   . LEU A 1 333 ? 36.972  39.217 60.683  1.00 27.48  ? 332  LEU A C   1 
ATOM   2601 O  O   . LEU A 1 333 ? 37.943  39.809 60.248  1.00 26.78  ? 332  LEU A O   1 
ATOM   2602 C  CB  . LEU A 1 333 ? 34.892  39.790 59.583  1.00 20.70  ? 332  LEU A CB  1 
ATOM   2603 C  CG  . LEU A 1 333 ? 34.604  40.445 58.237  1.00 29.09  ? 332  LEU A CG  1 
ATOM   2604 C  CD1 . LEU A 1 333 ? 34.898  39.569 57.036  1.00 26.07  ? 332  LEU A CD1 1 
ATOM   2605 C  CD2 . LEU A 1 333 ? 33.138  40.831 58.200  1.00 29.25  ? 332  LEU A CD2 1 
ATOM   2606 N  N   . PHE A 1 334 ? 36.721  39.049 61.995  1.00 21.64  ? 333  PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 334 ? 37.570  39.583 63.050  1.00 20.45  ? 333  PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 334 ? 38.248  38.620 63.966  1.00 21.67  ? 333  PHE A C   1 
ATOM   2609 O  O   . PHE A 1 334 ? 39.050  39.031 64.794  1.00 27.38  ? 333  PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 334 ? 36.882  40.672 63.907  1.00 23.81  ? 333  PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 334 ? 36.150  41.625 62.994  1.00 25.90  ? 333  PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 334 ? 36.871  42.470 62.151  1.00 27.97  ? 333  PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 334 ? 34.757  41.624 62.931  1.00 27.62  ? 333  PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 334 ? 36.198  43.314 61.269  1.00 30.62  ? 333  PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 334 ? 34.069  42.462 62.053  1.00 32.30  ? 333  PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 334 ? 34.804  43.309 61.221  1.00 30.11  ? 333  PHE A CZ  1 
ATOM   2617 N  N   . GLY A 1 335 ? 37.950  37.362 63.877  1.00 17.26  ? 334  GLY A N   1 
ATOM   2618 C  CA  . GLY A 1 335 ? 38.653  36.481 64.791  1.00 18.41  ? 334  GLY A CA  1 
ATOM   2619 C  C   . GLY A 1 335 ? 37.735  35.732 65.735  1.00 23.30  ? 334  GLY A C   1 
ATOM   2620 O  O   . GLY A 1 335 ? 36.758  36.276 66.244  1.00 21.87  ? 334  GLY A O   1 
ATOM   2621 N  N   . GLU A 1 336 ? 38.100  34.471 65.947  1.00 18.34  ? 335  GLU A N   1 
ATOM   2622 C  CA  . GLU A 1 336 ? 37.377  33.558 66.821  1.00 20.82  ? 335  GLU A CA  1 
ATOM   2623 C  C   . GLU A 1 336 ? 37.301  34.102 68.238  1.00 20.81  ? 335  GLU A C   1 
ATOM   2624 O  O   . GLU A 1 336 ? 36.341  33.888 68.975  1.00 20.60  ? 335  GLU A O   1 
ATOM   2625 C  CB  . GLU A 1 336 ? 38.057  32.183 66.811  1.00 19.30  ? 335  GLU A CB  1 
ATOM   2626 C  CG  . GLU A 1 336 ? 37.366  31.179 67.751  1.00 22.22  ? 335  GLU A CG  1 
ATOM   2627 C  CD  . GLU A 1 336 ? 35.963  30.786 67.350  1.00 22.99  ? 335  GLU A CD  1 
ATOM   2628 O  OE1 . GLU A 1 336 ? 35.278  31.338 66.513  1.00 26.34  ? 335  GLU A OE1 1 
ATOM   2629 O  OE2 . GLU A 1 336 ? 35.554  29.762 68.020  1.00 20.74  ? 335  GLU A OE2 1 
ATOM   2630 N  N   . LYS A 1 337 ? 38.327  34.845 68.615  1.00 17.24  ? 336  LYS A N   1 
ATOM   2631 C  CA  . LYS A 1 337 ? 38.375  35.413 69.947  1.00 16.83  ? 336  LYS A CA  1 
ATOM   2632 C  C   . LYS A 1 337 ? 37.316  36.470 70.050  1.00 17.51  ? 336  LYS A C   1 
ATOM   2633 O  O   . LYS A 1 337 ? 36.732  36.668 71.110  1.00 17.26  ? 336  LYS A O   1 
ATOM   2634 C  CB  . LYS A 1 337 ? 39.735  36.002 70.264  1.00 16.58  ? 336  LYS A CB  1 
ATOM   2635 C  CG  . LYS A 1 337 ? 40.725  34.912 70.659  1.00 20.77  ? 336  LYS A CG  1 
ATOM   2636 C  CD  . LYS A 1 337 ? 42.162  35.378 70.871  1.00 32.80  ? 336  LYS A CD  1 
ATOM   2637 C  CE  . LYS A 1 337 ? 43.184  34.329 70.432  1.00 66.91  ? 336  LYS A CE  1 
ATOM   2638 N  NZ  . LYS A 1 337 ? 44.484  34.418 71.112  1.00 80.02  ? 336  LYS A NZ  1 
ATOM   2639 N  N   . PHE A 1 338 ? 37.094  37.146 68.927  1.00 11.07  ? 337  PHE A N   1 
ATOM   2640 C  CA  . PHE A 1 338 ? 36.075  38.183 68.893  1.00 13.51  ? 337  PHE A CA  1 
ATOM   2641 C  C   . PHE A 1 338 ? 34.691  37.519 68.993  1.00 18.73  ? 337  PHE A C   1 
ATOM   2642 O  O   . PHE A 1 338 ? 33.797  37.992 69.659  1.00 15.94  ? 337  PHE A O   1 
ATOM   2643 C  CB  . PHE A 1 338 ? 36.113  38.963 67.569  1.00 14.14  ? 337  PHE A CB  1 
ATOM   2644 C  CG  . PHE A 1 338 ? 35.241  40.194 67.632  1.00 19.04  ? 337  PHE A CG  1 
ATOM   2645 C  CD1 . PHE A 1 338 ? 35.266  41.054 68.734  1.00 23.19  ? 337  PHE A CD1 1 
ATOM   2646 C  CD2 . PHE A 1 338 ? 34.406  40.562 66.571  1.00 25.81  ? 337  PHE A CD2 1 
ATOM   2647 C  CE1 . PHE A 1 338 ? 34.473  42.209 68.789  1.00 26.28  ? 337  PHE A CE1 1 
ATOM   2648 C  CE2 . PHE A 1 338 ? 33.634  41.727 66.594  1.00 26.38  ? 337  PHE A CE2 1 
ATOM   2649 C  CZ  . PHE A 1 338 ? 33.645  42.557 67.718  1.00 25.06  ? 337  PHE A CZ  1 
ATOM   2650 N  N   . ARG A 1 339 ? 34.501  36.384 68.327  1.00 16.12  ? 338  ARG A N   1 
ATOM   2651 C  CA  . ARG A 1 339 ? 33.239  35.665 68.384  1.00 15.03  ? 338  ARG A CA  1 
ATOM   2652 C  C   . ARG A 1 339 ? 32.936  35.314 69.804  1.00 18.17  ? 338  ARG A C   1 
ATOM   2653 O  O   . ARG A 1 339 ? 31.806  35.480 70.240  1.00 18.12  ? 338  ARG A O   1 
ATOM   2654 C  CB  . ARG A 1 339 ? 33.294  34.359 67.617  1.00 11.66  ? 338  ARG A CB  1 
ATOM   2655 C  CG  . ARG A 1 339 ? 31.961  33.629 67.660  1.00 12.35  ? 338  ARG A CG  1 
ATOM   2656 C  CD  . ARG A 1 339 ? 31.899  32.552 66.583  1.00 17.19  ? 338  ARG A CD  1 
ATOM   2657 N  NE  . ARG A 1 339 ? 32.554  31.328 67.051  1.00 17.53  ? 338  ARG A NE  1 
ATOM   2658 C  CZ  . ARG A 1 339 ? 31.981  30.175 67.417  1.00 23.05  ? 338  ARG A CZ  1 
ATOM   2659 N  NH1 . ARG A 1 339 ? 30.670  29.953 67.424  1.00 16.55  ? 338  ARG A NH1 1 
ATOM   2660 N  NH2 . ARG A 1 339 ? 32.772  29.179 67.803  1.00 12.25  ? 338  ARG A NH2 1 
ATOM   2661 N  N   . HIS A 1 340 ? 33.956  34.816 70.504  1.00 12.76  ? 339  HIS A N   1 
ATOM   2662 C  CA  . HIS A 1 340 ? 33.772  34.426 71.888  1.00 13.75  ? 339  HIS A CA  1 
ATOM   2663 C  C   . HIS A 1 340 ? 33.408  35.617 72.756  1.00 18.91  ? 339  HIS A C   1 
ATOM   2664 O  O   . HIS A 1 340 ? 32.587  35.520 73.655  1.00 12.72  ? 339  HIS A O   1 
ATOM   2665 C  CB  . HIS A 1 340 ? 35.006  33.697 72.480  1.00 14.46  ? 339  HIS A CB  1 
ATOM   2666 C  CG  . HIS A 1 340 ? 34.975  32.250 72.096  1.00 14.96  ? 339  HIS A CG  1 
ATOM   2667 N  ND1 . HIS A 1 340 ? 34.952  31.249 73.046  1.00 15.14  ? 339  HIS A ND1 1 
ATOM   2668 C  CD2 . HIS A 1 340 ? 34.943  31.693 70.855  1.00 15.02  ? 339  HIS A CD2 1 
ATOM   2669 C  CE1 . HIS A 1 340 ? 34.914  30.101 72.405  1.00 12.56  ? 339  HIS A CE1 1 
ATOM   2670 N  NE2 . HIS A 1 340 ? 34.895  30.343 71.097  1.00 15.39  ? 339  HIS A NE2 1 
ATOM   2671 N  N   . PHE A 1 341 ? 34.066  36.739 72.487  1.00 16.25  ? 340  PHE A N   1 
ATOM   2672 C  CA  . PHE A 1 341 ? 33.832  37.961 73.250  1.00 13.96  ? 340  PHE A CA  1 
ATOM   2673 C  C   . PHE A 1 341 ? 32.361  38.397 73.164  1.00 16.27  ? 340  PHE A C   1 
ATOM   2674 O  O   . PHE A 1 341 ? 31.700  38.760 74.158  1.00 13.82  ? 340  PHE A O   1 
ATOM   2675 C  CB  . PHE A 1 341 ? 34.823  39.032 72.753  1.00 11.82  ? 340  PHE A CB  1 
ATOM   2676 C  CG  . PHE A 1 341 ? 34.525  40.414 73.286  1.00 14.06  ? 340  PHE A CG  1 
ATOM   2677 C  CD1 . PHE A 1 341 ? 35.064  40.835 74.503  1.00 13.72  ? 340  PHE A CD1 1 
ATOM   2678 C  CD2 . PHE A 1 341 ? 33.703  41.284 72.566  1.00 16.13  ? 340  PHE A CD2 1 
ATOM   2679 C  CE1 . PHE A 1 341 ? 34.753  42.091 75.016  1.00 8.85   ? 340  PHE A CE1 1 
ATOM   2680 C  CE2 . PHE A 1 341 ? 33.401  42.560 73.044  1.00 16.77  ? 340  PHE A CE2 1 
ATOM   2681 C  CZ  . PHE A 1 341 ? 33.937  42.946 74.273  1.00 11.27  ? 340  PHE A CZ  1 
ATOM   2682 N  N   . ASN A 1 342 ? 31.871  38.363 71.925  1.00 13.64  ? 341  ASN A N   1 
ATOM   2683 C  CA  . ASN A 1 342 ? 30.507  38.730 71.637  1.00 15.75  ? 341  ASN A CA  1 
ATOM   2684 C  C   . ASN A 1 342 ? 29.529  37.762 72.257  1.00 18.72  ? 341  ASN A C   1 
ATOM   2685 O  O   . ASN A 1 342 ? 28.446  38.129 72.717  1.00 19.01  ? 341  ASN A O   1 
ATOM   2686 C  CB  . ASN A 1 342 ? 30.256  38.827 70.136  1.00 15.22  ? 341  ASN A CB  1 
ATOM   2687 C  CG  . ASN A 1 342 ? 30.886  40.099 69.603  1.00 29.77  ? 341  ASN A CG  1 
ATOM   2688 O  OD1 . ASN A 1 342 ? 31.197  40.172 68.416  1.00 60.07  ? 341  ASN A OD1 1 
ATOM   2689 N  ND2 . ASN A 1 342 ? 30.995  41.133 70.437  1.00 17.13  ? 341  ASN A ND2 1 
ATOM   2690 N  N   . ALA A 1 343 ? 29.908  36.511 72.229  1.00 11.92  ? 342  ALA A N   1 
ATOM   2691 C  CA  . ALA A 1 343 ? 29.065  35.487 72.804  1.00 12.85  ? 342  ALA A CA  1 
ATOM   2692 C  C   . ALA A 1 343 ? 28.923  35.676 74.314  1.00 15.91  ? 342  ALA A C   1 
ATOM   2693 O  O   . ALA A 1 343 ? 27.832  35.578 74.884  1.00 14.84  ? 342  ALA A O   1 
ATOM   2694 C  CB  . ALA A 1 343 ? 29.614  34.099 72.492  1.00 12.26  ? 342  ALA A CB  1 
ATOM   2695 N  N   . LEU A 1 344 ? 30.043  35.937 74.986  1.00 13.24  ? 343  LEU A N   1 
ATOM   2696 C  CA  . LEU A 1 344 ? 30.030  36.113 76.417  1.00 10.68  ? 343  LEU A CA  1 
ATOM   2697 C  C   . LEU A 1 344 ? 29.264  37.372 76.748  1.00 14.78  ? 343  LEU A C   1 
ATOM   2698 O  O   . LEU A 1 344 ? 28.551  37.413 77.737  1.00 18.40  ? 343  LEU A O   1 
ATOM   2699 C  CB  . LEU A 1 344 ? 31.459  36.148 77.006  1.00 9.64   ? 343  LEU A CB  1 
ATOM   2700 C  CG  . LEU A 1 344 ? 31.476  36.187 78.528  1.00 14.79  ? 343  LEU A CG  1 
ATOM   2701 C  CD1 . LEU A 1 344 ? 30.680  35.010 79.105  1.00 11.42  ? 343  LEU A CD1 1 
ATOM   2702 C  CD2 . LEU A 1 344 ? 32.931  36.014 78.992  1.00 14.08  ? 343  LEU A CD2 1 
ATOM   2703 N  N   . GLY A 1 345 ? 29.420  38.440 75.953  1.00 10.89  ? 344  GLY A N   1 
ATOM   2704 C  CA  . GLY A 1 345 ? 28.648  39.658 76.253  1.00 10.09  ? 344  GLY A CA  1 
ATOM   2705 C  C   . GLY A 1 345 ? 27.124  39.384 76.115  1.00 17.65  ? 344  GLY A C   1 
ATOM   2706 O  O   . GLY A 1 345 ? 26.321  39.969 76.838  1.00 17.82  ? 344  GLY A O   1 
ATOM   2707 N  N   . GLY A 1 346 ? 26.706  38.516 75.167  1.00 13.70  ? 345  GLY A N   1 
ATOM   2708 C  CA  . GLY A 1 346 ? 25.298  38.162 74.927  1.00 8.39   ? 345  GLY A CA  1 
ATOM   2709 C  C   . GLY A 1 346 ? 24.753  37.490 76.190  1.00 13.97  ? 345  GLY A C   1 
ATOM   2710 O  O   . GLY A 1 346 ? 23.611  37.741 76.620  1.00 12.61  ? 345  GLY A O   1 
ATOM   2711 N  N   . TRP A 1 347 ? 25.592  36.634 76.814  1.00 13.97  ? 346  TRP A N   1 
ATOM   2712 C  CA  . TRP A 1 347 ? 25.230  35.929 78.059  1.00 9.72   ? 346  TRP A CA  1 
ATOM   2713 C  C   . TRP A 1 347 ? 24.922  37.005 79.095  1.00 15.65  ? 346  TRP A C   1 
ATOM   2714 O  O   . TRP A 1 347 ? 23.975  36.947 79.906  1.00 12.16  ? 346  TRP A O   1 
ATOM   2715 C  CB  . TRP A 1 347 ? 26.367  34.981 78.555  1.00 8.14   ? 346  TRP A CB  1 
ATOM   2716 C  CG  . TRP A 1 347 ? 25.958  34.282 79.835  1.00 10.60  ? 346  TRP A CG  1 
ATOM   2717 C  CD1 . TRP A 1 347 ? 26.106  34.787 81.102  1.00 12.86  ? 346  TRP A CD1 1 
ATOM   2718 C  CD2 . TRP A 1 347 ? 25.267  33.009 80.004  1.00 11.80  ? 346  TRP A CD2 1 
ATOM   2719 N  NE1 . TRP A 1 347 ? 25.585  33.926 82.032  1.00 13.12  ? 346  TRP A NE1 1 
ATOM   2720 C  CE2 . TRP A 1 347 ? 25.065  32.806 81.394  1.00 16.02  ? 346  TRP A CE2 1 
ATOM   2721 C  CE3 . TRP A 1 347 ? 24.806  32.001 79.140  1.00 14.58  ? 346  TRP A CE3 1 
ATOM   2722 C  CZ2 . TRP A 1 347 ? 24.431  31.641 81.909  1.00 14.92  ? 346  TRP A CZ2 1 
ATOM   2723 C  CZ3 . TRP A 1 347 ? 24.188  30.860 79.646  1.00 14.14  ? 346  TRP A CZ3 1 
ATOM   2724 C  CH2 . TRP A 1 347 ? 23.982  30.685 81.027  1.00 14.57  ? 346  TRP A CH2 1 
ATOM   2725 N  N   . GLY A 1 348 ? 25.728  38.064 79.012  1.00 10.25  ? 347  GLY A N   1 
ATOM   2726 C  CA  . GLY A 1 348 ? 25.516  39.160 79.953  1.00 11.27  ? 347  GLY A CA  1 
ATOM   2727 C  C   . GLY A 1 348 ? 24.171  39.838 79.758  1.00 11.91  ? 347  GLY A C   1 
ATOM   2728 O  O   . GLY A 1 348 ? 23.531  40.217 80.724  1.00 12.39  ? 347  GLY A O   1 
ATOM   2729 N  N   . GLU A 1 349 ? 23.789  40.049 78.500  1.00 13.80  ? 348  GLU A N   1 
ATOM   2730 C  CA  . GLU A 1 349 ? 22.502  40.674 78.185  1.00 11.62  ? 348  GLU A CA  1 
ATOM   2731 C  C   . GLU A 1 349 ? 21.399  39.762 78.682  1.00 16.45  ? 348  GLU A C   1 
ATOM   2732 O  O   . GLU A 1 349 ? 20.381  40.234 79.211  1.00 14.72  ? 348  GLU A O   1 
ATOM   2733 C  CB  . GLU A 1 349 ? 22.401  40.992 76.683  1.00 11.49  ? 348  GLU A CB  1 
ATOM   2734 C  CG  . GLU A 1 349 ? 23.434  42.056 76.317  1.00 12.72  ? 348  GLU A CG  1 
ATOM   2735 C  CD  . GLU A 1 349 ? 23.027  43.349 76.970  1.00 29.34  ? 348  GLU A CD  1 
ATOM   2736 O  OE1 . GLU A 1 349 ? 21.910  43.796 76.855  1.00 45.66  ? 348  GLU A OE1 1 
ATOM   2737 O  OE2 . GLU A 1 349 ? 23.939  43.872 77.746  1.00 21.11  ? 348  GLU A OE2 1 
ATOM   2738 N  N   . LEU A 1 350 ? 21.648  38.442 78.531  1.00 11.46  ? 349  LEU A N   1 
ATOM   2739 C  CA  . LEU A 1 350 ? 20.686  37.471 79.030  1.00 12.33  ? 349  LEU A CA  1 
ATOM   2740 C  C   . LEU A 1 350 ? 20.538  37.591 80.565  1.00 17.72  ? 349  LEU A C   1 
ATOM   2741 O  O   . LEU A 1 350 ? 19.438  37.548 81.111  1.00 13.76  ? 349  LEU A O   1 
ATOM   2742 C  CB  . LEU A 1 350 ? 21.011  36.014 78.591  1.00 12.25  ? 349  LEU A CB  1 
ATOM   2743 C  CG  . LEU A 1 350 ? 20.011  34.943 79.079  1.00 13.43  ? 349  LEU A CG  1 
ATOM   2744 C  CD1 . LEU A 1 350 ? 18.665  35.153 78.379  1.00 9.66   ? 349  LEU A CD1 1 
ATOM   2745 C  CD2 . LEU A 1 350 ? 20.532  33.546 78.712  1.00 13.00  ? 349  LEU A CD2 1 
ATOM   2746 N  N   . GLN A 1 351 ? 21.631  37.719 81.301  1.00 12.48  ? 350  GLN A N   1 
ATOM   2747 C  CA  . GLN A 1 351 ? 21.524  37.864 82.738  1.00 8.81   ? 350  GLN A CA  1 
ATOM   2748 C  C   . GLN A 1 351 ? 20.685  39.085 83.083  1.00 15.50  ? 350  GLN A C   1 
ATOM   2749 O  O   . GLN A 1 351 ? 19.876  39.083 84.015  1.00 18.35  ? 350  GLN A O   1 
ATOM   2750 C  CB  . GLN A 1 351 ? 22.929  38.135 83.300  1.00 12.42  ? 350  GLN A CB  1 
ATOM   2751 C  CG  . GLN A 1 351 ? 23.810  36.867 83.324  1.00 13.26  ? 350  GLN A CG  1 
ATOM   2752 C  CD  . GLN A 1 351 ? 25.238  37.162 83.789  1.00 25.25  ? 350  GLN A CD  1 
ATOM   2753 O  OE1 . GLN A 1 351 ? 25.856  36.393 84.540  1.00 24.47  ? 350  GLN A OE1 1 
ATOM   2754 N  NE2 . GLN A 1 351 ? 25.770  38.303 83.383  1.00 17.04  ? 350  GLN A NE2 1 
ATOM   2755 N  N   . ASN A 1 352 ? 20.856  40.155 82.316  1.00 15.07  ? 351  ASN A N   1 
ATOM   2756 C  CA  . ASN A 1 352 ? 20.111  41.382 82.543  1.00 13.40  ? 351  ASN A CA  1 
ATOM   2757 C  C   . ASN A 1 352 ? 18.641  41.166 82.291  1.00 15.52  ? 351  ASN A C   1 
ATOM   2758 O  O   . ASN A 1 352 ? 17.800  41.602 83.072  1.00 14.93  ? 351  ASN A O   1 
ATOM   2759 C  CB  . ASN A 1 352 ? 20.581  42.551 81.657  1.00 15.98  ? 351  ASN A CB  1 
ATOM   2760 C  CG  . ASN A 1 352 ? 21.996  42.987 81.972  1.00 10.13  ? 351  ASN A CG  1 
ATOM   2761 O  OD1 . ASN A 1 352 ? 22.615  42.513 82.928  1.00 16.52  ? 351  ASN A OD1 1 
ATOM   2762 N  ND2 . ASN A 1 352 ? 22.563  43.766 81.065  1.00 12.55  ? 351  ASN A ND2 1 
ATOM   2763 N  N   . SER A 1 353 ? 18.310  40.514 81.187  1.00 11.92  ? 352  SER A N   1 
ATOM   2764 C  CA  . SER A 1 353 ? 16.888  40.272 80.893  1.00 12.49  ? 352  SER A CA  1 
ATOM   2765 C  C   . SER A 1 353 ? 16.167  39.437 81.959  1.00 16.90  ? 352  SER A C   1 
ATOM   2766 O  O   . SER A 1 353 ? 15.015  39.650 82.332  1.00 15.33  ? 352  SER A O   1 
ATOM   2767 C  CB  . SER A 1 353 ? 16.772  39.519 79.567  1.00 17.32  ? 352  SER A CB  1 
ATOM   2768 O  OG  . SER A 1 353 ? 16.959  40.434 78.526  1.00 24.23  ? 352  SER A OG  1 
ATOM   2769 N  N   . VAL A 1 354 ? 16.861  38.419 82.432  1.00 14.57  ? 353  VAL A N   1 
ATOM   2770 C  CA  . VAL A 1 354 ? 16.321  37.538 83.446  1.00 13.92  ? 353  VAL A CA  1 
ATOM   2771 C  C   . VAL A 1 354 ? 16.163  38.312 84.734  1.00 20.86  ? 353  VAL A C   1 
ATOM   2772 O  O   . VAL A 1 354 ? 15.191  38.139 85.468  1.00 17.05  ? 353  VAL A O   1 
ATOM   2773 C  CB  . VAL A 1 354 ? 17.158  36.280 83.664  1.00 11.73  ? 353  VAL A CB  1 
ATOM   2774 C  CG1 . VAL A 1 354 ? 16.794  35.472 84.932  1.00 9.84   ? 353  VAL A CG1 1 
ATOM   2775 C  CG2 . VAL A 1 354 ? 17.089  35.402 82.409  1.00 12.88  ? 353  VAL A CG2 1 
ATOM   2776 N  N   . LYS A 1 355 ? 17.112  39.198 84.995  1.00 14.12  ? 354  LYS A N   1 
ATOM   2777 C  CA  . LYS A 1 355 ? 17.002  39.913 86.238  1.00 12.36  ? 354  LYS A CA  1 
ATOM   2778 C  C   . LYS A 1 355 ? 15.826  40.848 86.179  1.00 17.58  ? 354  LYS A C   1 
ATOM   2779 O  O   . LYS A 1 355 ? 15.072  41.024 87.109  1.00 19.87  ? 354  LYS A O   1 
ATOM   2780 C  CB  . LYS A 1 355 ? 18.298  40.637 86.571  1.00 17.00  ? 354  LYS A CB  1 
ATOM   2781 C  CG  . LYS A 1 355 ? 18.143  41.562 87.760  1.00 23.68  ? 354  LYS A CG  1 
ATOM   2782 C  CD  . LYS A 1 355 ? 19.434  42.305 88.057  1.00 46.34  ? 354  LYS A CD  1 
ATOM   2783 C  CE  . LYS A 1 355 ? 19.458  43.018 89.409  1.00 67.61  ? 354  LYS A CE  1 
ATOM   2784 N  NZ  . LYS A 1 355 ? 20.473  44.087 89.499  1.00 72.09  ? 354  LYS A NZ  1 
ATOM   2785 N  N   . THR A 1 356 ? 15.685  41.464 85.045  1.00 17.30  ? 355  THR A N   1 
ATOM   2786 C  CA  . THR A 1 356 ? 14.634  42.423 84.776  1.00 19.03  ? 355  THR A CA  1 
ATOM   2787 C  C   . THR A 1 356 ? 13.239  41.788 84.894  1.00 24.56  ? 355  THR A C   1 
ATOM   2788 O  O   . THR A 1 356 ? 12.375  42.258 85.644  1.00 21.41  ? 355  THR A O   1 
ATOM   2789 C  CB  . THR A 1 356 ? 14.938  43.046 83.383  1.00 26.33  ? 355  THR A CB  1 
ATOM   2790 O  OG1 . THR A 1 356 ? 15.936  44.041 83.502  1.00 33.25  ? 355  THR A OG1 1 
ATOM   2791 C  CG2 . THR A 1 356 ? 13.720  43.535 82.618  1.00 35.80  ? 355  THR A CG2 1 
ATOM   2792 N  N   . PHE A 1 357 ? 12.986  40.698 84.173  1.00 15.72  ? 356  PHE A N   1 
ATOM   2793 C  CA  . PHE A 1 357 ? 11.685  40.084 84.266  1.00 13.01  ? 356  PHE A CA  1 
ATOM   2794 C  C   . PHE A 1 357 ? 11.492  39.347 85.550  1.00 16.31  ? 356  PHE A C   1 
ATOM   2795 O  O   . PHE A 1 357 ? 10.364  39.197 85.974  1.00 17.60  ? 356  PHE A O   1 
ATOM   2796 C  CB  . PHE A 1 357 ? 11.633  38.916 83.282  1.00 14.64  ? 356  PHE A CB  1 
ATOM   2797 C  CG  . PHE A 1 357 ? 11.306  39.389 81.925  1.00 20.28  ? 356  PHE A CG  1 
ATOM   2798 C  CD1 . PHE A 1 357 ? 10.172  40.180 81.740  1.00 26.98  ? 356  PHE A CD1 1 
ATOM   2799 C  CD2 . PHE A 1 357 ? 12.119  39.030 80.848  1.00 25.24  ? 356  PHE A CD2 1 
ATOM   2800 C  CE1 . PHE A 1 357 ? 9.854   40.645 80.463  1.00 32.69  ? 356  PHE A CE1 1 
ATOM   2801 C  CE2 . PHE A 1 357 ? 11.801  39.480 79.568  1.00 32.46  ? 356  PHE A CE2 1 
ATOM   2802 C  CZ  . PHE A 1 357 ? 10.672  40.285 79.388  1.00 34.40  ? 356  PHE A CZ  1 
ATOM   2803 N  N   . GLY A 1 358 ? 12.567  38.773 86.080  1.00 13.33  ? 357  GLY A N   1 
ATOM   2804 C  CA  . GLY A 1 358 ? 12.484  37.898 87.250  1.00 13.08  ? 357  GLY A CA  1 
ATOM   2805 C  C   . GLY A 1 358 ? 12.710  36.459 86.719  1.00 14.31  ? 357  GLY A C   1 
ATOM   2806 O  O   . GLY A 1 358 ? 12.203  36.080 85.639  1.00 15.86  ? 357  GLY A O   1 
ATOM   2807 N  N   . GLU A 1 359 ? 13.458  35.652 87.492  1.00 10.82  ? 358  GLU A N   1 
ATOM   2808 C  CA  . GLU A 1 359 ? 13.852  34.295 87.104  1.00 14.45  ? 358  GLU A CA  1 
ATOM   2809 C  C   . GLU A 1 359 ? 12.748  33.275 86.946  1.00 17.31  ? 358  GLU A C   1 
ATOM   2810 O  O   . GLU A 1 359 ? 12.966  32.190 86.382  1.00 16.43  ? 358  GLU A O   1 
ATOM   2811 C  CB  . GLU A 1 359 ? 14.976  33.766 88.003  1.00 15.36  ? 358  GLU A CB  1 
ATOM   2812 C  CG  . GLU A 1 359 ? 14.483  33.548 89.449  1.00 29.12  ? 358  GLU A CG  1 
ATOM   2813 C  CD  . GLU A 1 359 ? 15.577  33.165 90.432  1.00 29.41  ? 358  GLU A CD  1 
ATOM   2814 O  OE1 . GLU A 1 359 ? 16.737  32.999 90.104  1.00 53.87  ? 358  GLU A OE1 1 
ATOM   2815 O  OE2 . GLU A 1 359 ? 15.150  33.063 91.673  1.00 78.82  ? 358  GLU A OE2 1 
ATOM   2816 N  N   . THR A 1 360 ? 11.552  33.623 87.445  1.00 15.09  ? 359  THR A N   1 
ATOM   2817 C  CA  . THR A 1 360 ? 10.397  32.715 87.319  1.00 14.57  ? 359  THR A CA  1 
ATOM   2818 C  C   . THR A 1 360 ? 9.370   33.195 86.297  1.00 18.20  ? 359  THR A C   1 
ATOM   2819 O  O   . THR A 1 360 ? 8.308   32.602 86.161  1.00 17.32  ? 359  THR A O   1 
ATOM   2820 C  CB  . THR A 1 360 ? 9.665   32.513 88.661  1.00 10.95  ? 359  THR A CB  1 
ATOM   2821 O  OG1 . THR A 1 360 ? 9.014   33.714 89.058  1.00 16.14  ? 359  THR A OG1 1 
ATOM   2822 C  CG2 . THR A 1 360 ? 10.598  31.933 89.726  1.00 12.38  ? 359  THR A CG2 1 
ATOM   2823 N  N   . HIS A 1 361 ? 9.704   34.267 85.600  1.00 13.00  ? 360  HIS A N   1 
ATOM   2824 C  CA  . HIS A 1 361 ? 8.838   34.886 84.648  1.00 13.62  ? 360  HIS A CA  1 
ATOM   2825 C  C   . HIS A 1 361 ? 8.702   34.081 83.372  1.00 22.06  ? 360  HIS A C   1 
ATOM   2826 O  O   . HIS A 1 361 ? 9.701   33.663 82.770  1.00 18.40  ? 360  HIS A O   1 
ATOM   2827 C  CB  . HIS A 1 361 ? 9.369   36.276 84.298  1.00 14.44  ? 360  HIS A CB  1 
ATOM   2828 C  CG  . HIS A 1 361 ? 8.321   37.043 83.556  1.00 16.43  ? 360  HIS A CG  1 
ATOM   2829 N  ND1 . HIS A 1 361 ? 7.725   38.218 84.074  1.00 18.54  ? 360  HIS A ND1 1 
ATOM   2830 C  CD2 . HIS A 1 361 ? 7.765   36.779 82.349  1.00 13.02  ? 360  HIS A CD2 1 
ATOM   2831 C  CE1 . HIS A 1 361 ? 6.832   38.646 83.174  1.00 15.62  ? 360  HIS A CE1 1 
ATOM   2832 N  NE2 . HIS A 1 361 ? 6.848   37.781 82.139  1.00 17.56  ? 360  HIS A NE2 1 
ATOM   2833 N  N   . PRO A 1 362 ? 7.447   33.890 82.953  1.00 18.85  ? 361  PRO A N   1 
ATOM   2834 C  CA  . PRO A 1 362 ? 7.204   33.111 81.752  1.00 17.22  ? 361  PRO A CA  1 
ATOM   2835 C  C   . PRO A 1 362 ? 7.871   33.616 80.481  1.00 18.11  ? 361  PRO A C   1 
ATOM   2836 O  O   . PRO A 1 362 ? 8.093   32.859 79.534  1.00 16.08  ? 361  PRO A O   1 
ATOM   2837 C  CB  . PRO A 1 362 ? 5.680   32.939 81.654  1.00 17.39  ? 361  PRO A CB  1 
ATOM   2838 C  CG  . PRO A 1 362 ? 5.232   32.970 83.121  1.00 22.59  ? 361  PRO A CG  1 
ATOM   2839 C  CD  . PRO A 1 362 ? 6.220   33.896 83.819  1.00 17.68  ? 361  PRO A CD  1 
ATOM   2840 N  N   . PHE A 1 363 ? 8.192   34.899 80.434  1.00 13.89  ? 362  PHE A N   1 
ATOM   2841 C  CA  . PHE A 1 363 ? 8.822   35.408 79.237  1.00 15.98  ? 362  PHE A CA  1 
ATOM   2842 C  C   . PHE A 1 363 ? 10.286  35.089 79.221  1.00 13.98  ? 362  PHE A C   1 
ATOM   2843 O  O   . PHE A 1 363 ? 10.926  35.501 78.277  1.00 14.94  ? 362  PHE A O   1 
ATOM   2844 C  CB  . PHE A 1 363 ? 8.690   36.921 79.035  1.00 19.97  ? 362  PHE A CB  1 
ATOM   2845 C  CG  . PHE A 1 363 ? 7.273   37.416 78.899  1.00 23.23  ? 362  PHE A CG  1 
ATOM   2846 C  CD1 . PHE A 1 363 ? 6.227   36.538 78.616  1.00 24.55  ? 362  PHE A CD1 1 
ATOM   2847 C  CD2 . PHE A 1 363 ? 6.998   38.782 79.021  1.00 27.19  ? 362  PHE A CD2 1 
ATOM   2848 C  CE1 . PHE A 1 363 ? 4.927   37.035 78.487  1.00 26.53  ? 362  PHE A CE1 1 
ATOM   2849 C  CE2 . PHE A 1 363 ? 5.704   39.298 78.891  1.00 31.58  ? 362  PHE A CE2 1 
ATOM   2850 C  CZ  . PHE A 1 363 ? 4.663   38.404 78.626  1.00 28.23  ? 362  PHE A CZ  1 
ATOM   2851 N  N   . THR A 1 364 ? 10.787  34.395 80.244  1.00 14.98  ? 363  THR A N   1 
ATOM   2852 C  CA  . THR A 1 364 ? 12.209  33.992 80.288  1.00 12.84  ? 363  THR A CA  1 
ATOM   2853 C  C   . THR A 1 364 ? 12.446  32.567 79.724  1.00 19.07  ? 363  THR A C   1 
ATOM   2854 O  O   . THR A 1 364 ? 13.562  32.031 79.682  1.00 15.98  ? 363  THR A O   1 
ATOM   2855 C  CB  . THR A 1 364 ? 12.924  34.230 81.643  1.00 12.16  ? 363  THR A CB  1 
ATOM   2856 O  OG1 . THR A 1 364 ? 12.406  33.364 82.634  1.00 12.37  ? 363  THR A OG1 1 
ATOM   2857 C  CG2 . THR A 1 364 ? 12.828  35.706 82.046  1.00 15.02  ? 363  THR A CG2 1 
ATOM   2858 N  N   . LYS A 1 365 ? 11.344  31.922 79.336  1.00 15.36  ? 364  LYS A N   1 
ATOM   2859 C  CA  . LYS A 1 365 ? 11.390  30.603 78.747  1.00 12.01  ? 364  LYS A CA  1 
ATOM   2860 C  C   . LYS A 1 365 ? 11.762  30.792 77.276  1.00 15.28  ? 364  LYS A C   1 
ATOM   2861 O  O   . LYS A 1 365 ? 11.373  31.788 76.600  1.00 12.86  ? 364  LYS A O   1 
ATOM   2862 C  CB  . LYS A 1 365 ? 9.988   30.005 78.770  1.00 11.05  ? 364  LYS A CB  1 
ATOM   2863 C  CG  . LYS A 1 365 ? 9.506   29.626 80.142  1.00 18.14  ? 364  LYS A CG  1 
ATOM   2864 C  CD  . LYS A 1 365 ? 8.036   29.218 80.150  1.00 16.21  ? 364  LYS A CD  1 
ATOM   2865 C  CE  . LYS A 1 365 ? 7.664   28.728 81.534  1.00 29.65  ? 364  LYS A CE  1 
ATOM   2866 N  NZ  . LYS A 1 365 ? 6.221   28.541 81.736  1.00 39.48  ? 364  LYS A NZ  1 
ATOM   2867 N  N   . LEU A 1 366 ? 12.474  29.806 76.720  1.00 13.94  ? 365  LEU A N   1 
ATOM   2868 C  CA  . LEU A 1 366 ? 12.885  29.872 75.325  1.00 12.51  ? 365  LEU A CA  1 
ATOM   2869 C  C   . LEU A 1 366 ? 11.671  29.766 74.388  1.00 18.38  ? 365  LEU A C   1 
ATOM   2870 O  O   . LEU A 1 366 ? 11.491  30.548 73.436  1.00 17.81  ? 365  LEU A O   1 
ATOM   2871 C  CB  . LEU A 1 366 ? 13.926  28.767 75.037  1.00 13.31  ? 365  LEU A CB  1 
ATOM   2872 C  CG  . LEU A 1 366 ? 14.542  28.857 73.653  1.00 18.68  ? 365  LEU A CG  1 
ATOM   2873 C  CD1 . LEU A 1 366 ? 15.219  30.203 73.489  1.00 19.46  ? 365  LEU A CD1 1 
ATOM   2874 C  CD2 . LEU A 1 366 ? 15.612  27.777 73.545  1.00 19.36  ? 365  LEU A CD2 1 
ATOM   2875 N  N   . VAL A 1 367 ? 10.805  28.804 74.685  1.00 15.92  ? 366  VAL A N   1 
ATOM   2876 C  CA  . VAL A 1 367 ? 9.534   28.572 73.964  1.00 18.17  ? 366  VAL A CA  1 
ATOM   2877 C  C   . VAL A 1 367 ? 8.411   29.193 74.832  1.00 19.02  ? 366  VAL A C   1 
ATOM   2878 O  O   . VAL A 1 367 ? 8.188   28.759 75.953  1.00 15.50  ? 366  VAL A O   1 
ATOM   2879 C  CB  . VAL A 1 367 ? 9.276   27.091 73.587  1.00 17.55  ? 366  VAL A CB  1 
ATOM   2880 C  CG1 . VAL A 1 367 ? 7.985   26.938 72.761  1.00 13.93  ? 366  VAL A CG1 1 
ATOM   2881 C  CG2 . VAL A 1 367 ? 10.488  26.522 72.828  1.00 15.55  ? 366  VAL A CG2 1 
ATOM   2882 N  N   . VAL A 1 368 ? 7.724   30.226 74.348  1.00 15.38  ? 367  VAL A N   1 
ATOM   2883 C  CA  . VAL A 1 368 ? 6.725   30.907 75.166  1.00 14.70  ? 367  VAL A CA  1 
ATOM   2884 C  C   . VAL A 1 368 ? 5.318   30.654 74.723  1.00 22.22  ? 367  VAL A C   1 
ATOM   2885 O  O   . VAL A 1 368 ? 5.145   30.064 73.683  1.00 21.51  ? 367  VAL A O   1 
ATOM   2886 C  CB  . VAL A 1 368 ? 6.946   32.396 75.034  1.00 17.48  ? 367  VAL A CB  1 
ATOM   2887 C  CG1 . VAL A 1 368 ? 8.305   32.742 75.633  1.00 17.07  ? 367  VAL A CG1 1 
ATOM   2888 C  CG2 . VAL A 1 368 ? 6.874   32.793 73.566  1.00 15.29  ? 367  VAL A CG2 1 
ATOM   2889 N  N   . ASP A 1 369 ? 4.331   31.134 75.471  1.00 17.48  ? 368  ASP A N   1 
ATOM   2890 C  CA  . ASP A 1 369 ? 2.937   30.940 75.054  1.00 16.38  ? 368  ASP A CA  1 
ATOM   2891 C  C   . ASP A 1 369 ? 2.362   32.335 74.997  1.00 14.53  ? 368  ASP A C   1 
ATOM   2892 O  O   . ASP A 1 369 ? 2.198   32.991 75.998  1.00 18.37  ? 368  ASP A O   1 
ATOM   2893 C  CB  . ASP A 1 369 ? 2.181   30.036 76.049  1.00 17.68  ? 368  ASP A CB  1 
ATOM   2894 C  CG  . ASP A 1 369 ? 0.683   29.999 75.796  1.00 25.53  ? 368  ASP A CG  1 
ATOM   2895 O  OD1 . ASP A 1 369 ? 0.115   30.610 74.927  1.00 17.63  ? 368  ASP A OD1 1 
ATOM   2896 O  OD2 . ASP A 1 369 ? 0.047   29.214 76.601  1.00 31.38  ? 368  ASP A OD2 1 
ATOM   2897 N  N   . LEU A 1 370 ? 2.161   32.859 73.829  1.00 10.10  ? 369  LEU A N   1 
ATOM   2898 C  CA  . LEU A 1 370 ? 1.697   34.212 73.698  1.00 12.48  ? 369  LEU A CA  1 
ATOM   2899 C  C   . LEU A 1 370 ? 0.215   34.381 73.668  1.00 18.80  ? 369  LEU A C   1 
ATOM   2900 O  O   . LEU A 1 370 ? -0.276  35.378 73.147  1.00 21.46  ? 369  LEU A O   1 
ATOM   2901 C  CB  . LEU A 1 370 ? 2.274   34.974 72.500  1.00 10.77  ? 369  LEU A CB  1 
ATOM   2902 C  CG  . LEU A 1 370 ? 3.779   35.129 72.552  1.00 17.85  ? 369  LEU A CG  1 
ATOM   2903 C  CD1 . LEU A 1 370 ? 4.256   35.435 71.127  1.00 16.11  ? 369  LEU A CD1 1 
ATOM   2904 C  CD2 . LEU A 1 370 ? 4.076   36.290 73.493  1.00 16.09  ? 369  LEU A CD2 1 
ATOM   2905 N  N   . THR A 1 371 ? -0.484  33.422 74.207  1.00 18.13  ? 370  THR A N   1 
ATOM   2906 C  CA  . THR A 1 371 ? -1.922  33.603 74.226  1.00 19.34  ? 370  THR A CA  1 
ATOM   2907 C  C   . THR A 1 371 ? -2.259  34.856 75.052  1.00 24.31  ? 370  THR A C   1 
ATOM   2908 O  O   . THR A 1 371 ? -1.890  35.048 76.218  1.00 22.17  ? 370  THR A O   1 
ATOM   2909 C  CB  . THR A 1 371 ? -2.558  32.439 74.994  1.00 31.44  ? 370  THR A CB  1 
ATOM   2910 O  OG1 . THR A 1 371 ? -2.383  31.226 74.291  1.00 25.88  ? 370  THR A OG1 1 
ATOM   2911 C  CG2 . THR A 1 371 ? -4.020  32.785 75.234  1.00 26.93  ? 370  THR A CG2 1 
ATOM   2912 N  N   . ASP A 1 372 ? -3.003  35.742 74.449  1.00 22.55  ? 371  ASP A N   1 
ATOM   2913 C  CA  . ASP A 1 372 ? -3.367  36.940 75.169  1.00 23.57  ? 371  ASP A CA  1 
ATOM   2914 C  C   . ASP A 1 372 ? -2.254  37.904 75.464  1.00 24.80  ? 371  ASP A C   1 
ATOM   2915 O  O   . ASP A 1 372 ? -2.491  38.846 76.176  1.00 21.58  ? 371  ASP A O   1 
ATOM   2916 C  CB  . ASP A 1 372 ? -4.191  36.676 76.420  1.00 26.84  ? 371  ASP A CB  1 
ATOM   2917 C  CG  . ASP A 1 372 ? -5.528  36.132 75.994  1.00 39.22  ? 371  ASP A CG  1 
ATOM   2918 O  OD1 . ASP A 1 372 ? -6.111  36.460 74.949  1.00 32.59  ? 371  ASP A OD1 1 
ATOM   2919 O  OD2 . ASP A 1 372 ? -5.951  35.237 76.850  1.00 41.05  ? 371  ASP A OD2 1 
ATOM   2920 N  N   . ILE A 1 373 ? -1.084  37.719 74.889  1.00 20.31  ? 372  ILE A N   1 
ATOM   2921 C  CA  . ILE A 1 373 ? -0.009  38.663 75.120  1.00 17.55  ? 372  ILE A CA  1 
ATOM   2922 C  C   . ILE A 1 373 ? 0.375   39.330 73.822  1.00 19.77  ? 372  ILE A C   1 
ATOM   2923 O  O   . ILE A 1 373 ? 0.553   38.641 72.818  1.00 22.17  ? 372  ILE A O   1 
ATOM   2924 C  CB  . ILE A 1 373 ? 1.249   37.911 75.480  1.00 20.80  ? 372  ILE A CB  1 
ATOM   2925 C  CG1 . ILE A 1 373 ? 1.016   36.973 76.645  1.00 22.62  ? 372  ILE A CG1 1 
ATOM   2926 C  CG2 . ILE A 1 373 ? 2.392   38.904 75.707  1.00 22.69  ? 372  ILE A CG2 1 
ATOM   2927 C  CD1 . ILE A 1 373 ? 0.374   37.712 77.794  1.00 32.92  ? 372  ILE A CD1 1 
ATOM   2928 N  N   . ASP A 1 374 ? 0.560   40.636 73.857  1.00 14.79  ? 373  ASP A N   1 
ATOM   2929 C  CA  . ASP A 1 374 ? 0.958   41.385 72.693  1.00 14.17  ? 373  ASP A CA  1 
ATOM   2930 C  C   . ASP A 1 374 ? 2.445   41.160 72.485  1.00 21.76  ? 373  ASP A C   1 
ATOM   2931 O  O   . ASP A 1 374 ? 3.280   41.384 73.355  1.00 21.72  ? 373  ASP A O   1 
ATOM   2932 C  CB  . ASP A 1 374 ? 0.717   42.882 72.934  1.00 15.14  ? 373  ASP A CB  1 
ATOM   2933 C  CG  . ASP A 1 374 ? 1.247   43.773 71.829  1.00 21.68  ? 373  ASP A CG  1 
ATOM   2934 O  OD1 . ASP A 1 374 ? 2.004   43.399 70.933  1.00 23.88  ? 373  ASP A OD1 1 
ATOM   2935 O  OD2 . ASP A 1 374 ? 0.769   45.005 71.893  1.00 22.14  ? 373  ASP A OD2 1 
ATOM   2936 N  N   . PRO A 1 375 ? 2.810   40.719 71.305  1.00 21.82  ? 374  PRO A N   1 
ATOM   2937 C  CA  . PRO A 1 375 ? 4.210   40.450 71.050  1.00 21.09  ? 374  PRO A CA  1 
ATOM   2938 C  C   . PRO A 1 375 ? 5.149   41.600 71.350  1.00 19.90  ? 374  PRO A C   1 
ATOM   2939 O  O   . PRO A 1 375 ? 6.240   41.371 71.873  1.00 14.86  ? 374  PRO A O   1 
ATOM   2940 C  CB  . PRO A 1 375 ? 4.312   39.943 69.607  1.00 23.86  ? 374  PRO A CB  1 
ATOM   2941 C  CG  . PRO A 1 375 ? 2.896   39.591 69.183  1.00 24.47  ? 374  PRO A CG  1 
ATOM   2942 C  CD  . PRO A 1 375 ? 1.967   40.317 70.149  1.00 22.40  ? 374  PRO A CD  1 
ATOM   2943 N  N   . ASP A 1 376 ? 4.722   42.819 71.007  1.00 14.82  ? 375  ASP A N   1 
ATOM   2944 C  CA  . ASP A 1 376 ? 5.537   44.022 71.250  1.00 16.55  ? 375  ASP A CA  1 
ATOM   2945 C  C   . ASP A 1 376 ? 5.870   44.193 72.728  1.00 20.20  ? 375  ASP A C   1 
ATOM   2946 O  O   . ASP A 1 376 ? 6.896   44.725 73.140  1.00 19.90  ? 375  ASP A O   1 
ATOM   2947 C  CB  . ASP A 1 376 ? 4.811   45.273 70.724  1.00 15.07  ? 375  ASP A CB  1 
ATOM   2948 C  CG  . ASP A 1 376 ? 4.971   45.315 69.240  1.00 18.22  ? 375  ASP A CG  1 
ATOM   2949 O  OD1 . ASP A 1 376 ? 5.933   44.823 68.667  1.00 18.62  ? 375  ASP A OD1 1 
ATOM   2950 O  OD2 . ASP A 1 376 ? 3.980   45.894 68.637  1.00 21.94  ? 375  ASP A OD2 1 
ATOM   2951 N  N   . VAL A 1 377 ? 4.952   43.710 73.532  1.00 17.46  ? 376  VAL A N   1 
ATOM   2952 C  CA  . VAL A 1 377 ? 5.064   43.756 74.968  1.00 17.12  ? 376  VAL A CA  1 
ATOM   2953 C  C   . VAL A 1 377 ? 5.930   42.629 75.532  1.00 22.81  ? 376  VAL A C   1 
ATOM   2954 O  O   . VAL A 1 377 ? 6.634   42.825 76.514  1.00 23.05  ? 376  VAL A O   1 
ATOM   2955 C  CB  . VAL A 1 377 ? 3.686   43.683 75.601  1.00 19.84  ? 376  VAL A CB  1 
ATOM   2956 C  CG1 . VAL A 1 377 ? 3.841   43.374 77.085  1.00 21.03  ? 376  VAL A CG1 1 
ATOM   2957 C  CG2 . VAL A 1 377 ? 2.950   45.006 75.445  1.00 15.99  ? 376  VAL A CG2 1 
ATOM   2958 N  N   . ALA A 1 378 ? 5.896   41.436 74.950  1.00 16.51  ? 377  ALA A N   1 
ATOM   2959 C  CA  . ALA A 1 378 ? 6.711   40.369 75.484  1.00 15.14  ? 377  ALA A CA  1 
ATOM   2960 C  C   . ALA A 1 378 ? 8.136   40.459 74.987  1.00 16.36  ? 377  ALA A C   1 
ATOM   2961 O  O   . ALA A 1 378 ? 9.037   39.827 75.498  1.00 13.72  ? 377  ALA A O   1 
ATOM   2962 C  CB  . ALA A 1 378 ? 6.105   39.042 75.033  1.00 14.47  ? 377  ALA A CB  1 
ATOM   2963 N  N   . TYR A 1 379 ? 8.350   41.216 73.928  1.00 15.01  ? 378  TYR A N   1 
ATOM   2964 C  CA  . TYR A 1 379 ? 9.671   41.304 73.305  1.00 15.91  ? 378  TYR A CA  1 
ATOM   2965 C  C   . TYR A 1 379 ? 10.864  41.502 74.222  1.00 20.25  ? 378  TYR A C   1 
ATOM   2966 O  O   . TYR A 1 379 ? 10.855  42.413 75.021  1.00 12.62  ? 378  TYR A O   1 
ATOM   2967 C  CB  . TYR A 1 379 ? 9.648   42.365 72.215  1.00 15.77  ? 378  TYR A CB  1 
ATOM   2968 C  CG  . TYR A 1 379 ? 10.914  42.510 71.412  1.00 14.92  ? 378  TYR A CG  1 
ATOM   2969 C  CD1 . TYR A 1 379 ? 11.304  41.495 70.541  1.00 15.79  ? 378  TYR A CD1 1 
ATOM   2970 C  CD2 . TYR A 1 379 ? 11.691  43.665 71.485  1.00 12.44  ? 378  TYR A CD2 1 
ATOM   2971 C  CE1 . TYR A 1 379 ? 12.437  41.625 69.745  1.00 13.18  ? 378  TYR A CE1 1 
ATOM   2972 C  CE2 . TYR A 1 379 ? 12.830  43.807 70.694  1.00 10.34  ? 378  TYR A CE2 1 
ATOM   2973 C  CZ  . TYR A 1 379 ? 13.206  42.783 69.828  1.00 13.99  ? 378  TYR A CZ  1 
ATOM   2974 O  OH  . TYR A 1 379 ? 14.324  42.907 69.034  1.00 17.70  ? 378  TYR A OH  1 
ATOM   2975 N  N   . SER A 1 380 ? 11.924  40.690 74.065  1.00 19.28  ? 379  SER A N   1 
ATOM   2976 C  CA  . SER A 1 380 ? 13.121  40.813 74.896  1.00 16.38  ? 379  SER A CA  1 
ATOM   2977 C  C   . SER A 1 380 ? 14.324  40.157 74.257  1.00 16.16  ? 379  SER A C   1 
ATOM   2978 O  O   . SER A 1 380 ? 14.257  39.722 73.109  1.00 14.62  ? 379  SER A O   1 
ATOM   2979 C  CB  . SER A 1 380 ? 12.883  40.256 76.301  1.00 13.15  ? 379  SER A CB  1 
ATOM   2980 O  OG  . SER A 1 380 ? 13.035  38.846 76.268  1.00 14.44  ? 379  SER A OG  1 
ATOM   2981 N  N   . SER A 1 381 ? 15.431  40.094 75.019  1.00 13.34  ? 380  SER A N   1 
ATOM   2982 C  CA  . SER A 1 381 ? 16.705  39.480 74.595  1.00 13.12  ? 380  SER A CA  1 
ATOM   2983 C  C   . SER A 1 381 ? 16.734  37.989 74.811  1.00 13.76  ? 380  SER A C   1 
ATOM   2984 O  O   . SER A 1 381 ? 17.705  37.336 74.470  1.00 15.40  ? 380  SER A O   1 
ATOM   2985 C  CB  . SER A 1 381 ? 17.864  40.053 75.421  1.00 12.15  ? 380  SER A CB  1 
ATOM   2986 O  OG  . SER A 1 381 ? 17.883  41.443 75.162  1.00 18.31  ? 380  SER A OG  1 
ATOM   2987 N  N   . VAL A 1 382 ? 15.685  37.472 75.444  1.00 10.45  ? 381  VAL A N   1 
ATOM   2988 C  CA  . VAL A 1 382 ? 15.613  36.070 75.778  1.00 10.90  ? 381  VAL A CA  1 
ATOM   2989 C  C   . VAL A 1 382 ? 15.709  35.177 74.561  1.00 15.64  ? 381  VAL A C   1 
ATOM   2990 O  O   . VAL A 1 382 ? 16.547  34.295 74.468  1.00 17.11  ? 381  VAL A O   1 
ATOM   2991 C  CB  . VAL A 1 382 ? 14.384  35.734 76.636  1.00 12.01  ? 381  VAL A CB  1 
ATOM   2992 C  CG1 . VAL A 1 382 ? 14.269  34.234 76.861  1.00 12.07  ? 381  VAL A CG1 1 
ATOM   2993 C  CG2 . VAL A 1 382 ? 14.410  36.468 77.980  1.00 9.45   ? 381  VAL A CG2 1 
ATOM   2994 N  N   . PRO A 1 383 ? 14.832  35.347 73.603  1.00 12.68  ? 382  PRO A N   1 
ATOM   2995 C  CA  . PRO A 1 383 ? 14.939  34.427 72.488  1.00 11.41  ? 382  PRO A CA  1 
ATOM   2996 C  C   . PRO A 1 383 ? 16.300  34.551 71.794  1.00 17.91  ? 382  PRO A C   1 
ATOM   2997 O  O   . PRO A 1 383 ? 16.830  33.564 71.249  1.00 16.29  ? 382  PRO A O   1 
ATOM   2998 C  CB  . PRO A 1 383 ? 13.817  34.802 71.513  1.00 11.39  ? 382  PRO A CB  1 
ATOM   2999 C  CG  . PRO A 1 383 ? 13.328  36.176 71.947  1.00 14.03  ? 382  PRO A CG  1 
ATOM   3000 C  CD  . PRO A 1 383 ? 13.778  36.366 73.378  1.00 10.32  ? 382  PRO A CD  1 
ATOM   3001 N  N   . TYR A 1 384 ? 16.835  35.791 71.761  1.00 11.66  ? 383  TYR A N   1 
ATOM   3002 C  CA  . TYR A 1 384 ? 18.106  36.045 71.127  1.00 11.53  ? 383  TYR A CA  1 
ATOM   3003 C  C   . TYR A 1 384 ? 19.229  35.291 71.821  1.00 17.48  ? 383  TYR A C   1 
ATOM   3004 O  O   . TYR A 1 384 ? 19.975  34.554 71.192  1.00 13.36  ? 383  TYR A O   1 
ATOM   3005 C  CB  . TYR A 1 384 ? 18.443  37.560 71.238  1.00 12.85  ? 383  TYR A CB  1 
ATOM   3006 C  CG  . TYR A 1 384 ? 17.598  38.417 70.335  1.00 14.70  ? 383  TYR A CG  1 
ATOM   3007 C  CD1 . TYR A 1 384 ? 16.309  38.809 70.707  1.00 16.40  ? 383  TYR A CD1 1 
ATOM   3008 C  CD2 . TYR A 1 384 ? 18.069  38.790 69.073  1.00 13.38  ? 383  TYR A CD2 1 
ATOM   3009 C  CE1 . TYR A 1 384 ? 15.536  39.577 69.832  1.00 15.57  ? 383  TYR A CE1 1 
ATOM   3010 C  CE2 . TYR A 1 384 ? 17.318  39.560 68.187  1.00 10.16  ? 383  TYR A CE2 1 
ATOM   3011 C  CZ  . TYR A 1 384 ? 16.039  39.947 68.582  1.00 14.31  ? 383  TYR A CZ  1 
ATOM   3012 O  OH  . TYR A 1 384 ? 15.280  40.713 67.728  1.00 12.64  ? 383  TYR A OH  1 
ATOM   3013 N  N   . GLU A 1 385 ? 19.335  35.529 73.134  1.00 12.00  ? 384  GLU A N   1 
ATOM   3014 C  CA  . GLU A 1 385 ? 20.409  35.067 73.989  1.00 10.21  ? 384  GLU A CA  1 
ATOM   3015 C  C   . GLU A 1 385 ? 20.251  33.701 74.605  1.00 15.22  ? 384  GLU A C   1 
ATOM   3016 O  O   . GLU A 1 385 ? 21.228  32.952 74.692  1.00 12.89  ? 384  GLU A O   1 
ATOM   3017 C  CB  . GLU A 1 385 ? 20.888  36.205 74.899  1.00 9.54   ? 384  GLU A CB  1 
ATOM   3018 C  CG  . GLU A 1 385 ? 21.207  37.468 74.056  1.00 7.64   ? 384  GLU A CG  1 
ATOM   3019 C  CD  . GLU A 1 385 ? 22.497  37.277 73.260  1.00 19.43  ? 384  GLU A CD  1 
ATOM   3020 O  OE1 . GLU A 1 385 ? 23.237  36.310 73.331  1.00 15.97  ? 384  GLU A OE1 1 
ATOM   3021 O  OE2 . GLU A 1 385 ? 22.779  38.260 72.480  1.00 11.96  ? 384  GLU A OE2 1 
ATOM   3022 N  N   . LYS A 1 386 ? 19.036  33.345 75.034  1.00 12.07  ? 385  LYS A N   1 
ATOM   3023 C  CA  . LYS A 1 386 ? 18.898  31.984 75.533  1.00 13.42  ? 385  LYS A CA  1 
ATOM   3024 C  C   . LYS A 1 386 ? 19.015  31.052 74.294  1.00 16.08  ? 385  LYS A C   1 
ATOM   3025 O  O   . LYS A 1 386 ? 19.593  29.947 74.359  1.00 13.01  ? 385  LYS A O   1 
ATOM   3026 C  CB  . LYS A 1 386 ? 17.623  31.742 76.350  1.00 12.55  ? 385  LYS A CB  1 
ATOM   3027 C  CG  . LYS A 1 386 ? 17.554  30.302 76.839  1.00 14.13  ? 385  LYS A CG  1 
ATOM   3028 C  CD  . LYS A 1 386 ? 16.371  29.987 77.750  1.00 11.06  ? 385  LYS A CD  1 
ATOM   3029 C  CE  . LYS A 1 386 ? 16.360  30.692 79.099  1.00 12.13  ? 385  LYS A CE  1 
ATOM   3030 N  NZ  . LYS A 1 386 ? 15.359  30.132 80.029  1.00 11.47  ? 385  LYS A NZ  1 
ATOM   3031 N  N   . GLY A 1 387 ? 18.477  31.533 73.138  1.00 11.14  ? 386  GLY A N   1 
ATOM   3032 C  CA  . GLY A 1 387 ? 18.521  30.792 71.864  1.00 9.75   ? 386  GLY A CA  1 
ATOM   3033 C  C   . GLY A 1 387 ? 19.974  30.567 71.409  1.00 16.73  ? 386  GLY A C   1 
ATOM   3034 O  O   . GLY A 1 387 ? 20.417  29.446 71.100  1.00 13.12  ? 386  GLY A O   1 
ATOM   3035 N  N   . PHE A 1 388 ? 20.747  31.663 71.383  1.00 15.76  ? 387  PHE A N   1 
ATOM   3036 C  CA  . PHE A 1 388 ? 22.155  31.620 71.013  1.00 13.70  ? 387  PHE A CA  1 
ATOM   3037 C  C   . PHE A 1 388 ? 22.926  30.744 71.982  1.00 17.51  ? 387  PHE A C   1 
ATOM   3038 O  O   . PHE A 1 388 ? 23.763  29.955 71.563  1.00 14.54  ? 387  PHE A O   1 
ATOM   3039 C  CB  . PHE A 1 388 ? 22.846  32.992 70.918  1.00 13.42  ? 387  PHE A CB  1 
ATOM   3040 C  CG  . PHE A 1 388 ? 24.350  32.820 70.816  1.00 12.26  ? 387  PHE A CG  1 
ATOM   3041 C  CD1 . PHE A 1 388 ? 24.963  32.588 69.582  1.00 11.34  ? 387  PHE A CD1 1 
ATOM   3042 C  CD2 . PHE A 1 388 ? 25.170  32.869 71.944  1.00 14.36  ? 387  PHE A CD2 1 
ATOM   3043 C  CE1 . PHE A 1 388 ? 26.346  32.422 69.468  1.00 12.53  ? 387  PHE A CE1 1 
ATOM   3044 C  CE2 . PHE A 1 388 ? 26.558  32.693 71.864  1.00 12.76  ? 387  PHE A CE2 1 
ATOM   3045 C  CZ  . PHE A 1 388 ? 27.141  32.454 70.618  1.00 8.96   ? 387  PHE A CZ  1 
ATOM   3046 N  N   . ALA A 1 389 ? 22.620  30.836 73.284  1.00 15.35  ? 388  ALA A N   1 
ATOM   3047 C  CA  . ALA A 1 389 ? 23.344  30.017 74.240  1.00 12.20  ? 388  ALA A CA  1 
ATOM   3048 C  C   . ALA A 1 389 ? 23.084  28.552 74.014  1.00 15.51  ? 388  ALA A C   1 
ATOM   3049 O  O   . ALA A 1 389 ? 23.973  27.717 74.125  1.00 16.33  ? 388  ALA A O   1 
ATOM   3050 C  CB  . ALA A 1 389 ? 22.970  30.429 75.655  1.00 13.75  ? 388  ALA A CB  1 
ATOM   3051 N  N   . LEU A 1 390 ? 21.843  28.209 73.701  1.00 12.77  ? 389  LEU A N   1 
ATOM   3052 C  CA  . LEU A 1 390 ? 21.542  26.793 73.446  1.00 13.17  ? 389  LEU A CA  1 
ATOM   3053 C  C   . LEU A 1 390 ? 22.382  26.286 72.266  1.00 20.08  ? 389  LEU A C   1 
ATOM   3054 O  O   . LEU A 1 390 ? 23.030  25.214 72.312  1.00 16.85  ? 389  LEU A O   1 
ATOM   3055 C  CB  . LEU A 1 390 ? 20.065  26.657 73.061  1.00 9.51   ? 389  LEU A CB  1 
ATOM   3056 C  CG  . LEU A 1 390 ? 19.639  25.263 72.656  1.00 16.80  ? 389  LEU A CG  1 
ATOM   3057 C  CD1 . LEU A 1 390 ? 20.089  24.265 73.719  1.00 16.85  ? 389  LEU A CD1 1 
ATOM   3058 C  CD2 . LEU A 1 390 ? 18.119  25.247 72.538  1.00 12.75  ? 389  LEU A CD2 1 
ATOM   3059 N  N   . LEU A 1 391 ? 22.374  27.059 71.172  1.00 11.37  ? 390  LEU A N   1 
ATOM   3060 C  CA  . LEU A 1 391 ? 23.140  26.650 69.998  1.00 9.78   ? 390  LEU A CA  1 
ATOM   3061 C  C   . LEU A 1 391 ? 24.651  26.539 70.251  1.00 19.70  ? 390  LEU A C   1 
ATOM   3062 O  O   . LEU A 1 391 ? 25.305  25.609 69.745  1.00 18.74  ? 390  LEU A O   1 
ATOM   3063 C  CB  . LEU A 1 391 ? 22.887  27.525 68.764  1.00 9.94   ? 390  LEU A CB  1 
ATOM   3064 C  CG  . LEU A 1 391 ? 21.402  27.590 68.367  1.00 14.32  ? 390  LEU A CG  1 
ATOM   3065 C  CD1 . LEU A 1 391 ? 21.153  28.632 67.257  1.00 14.04  ? 390  LEU A CD1 1 
ATOM   3066 C  CD2 . LEU A 1 391 ? 20.902  26.209 67.923  1.00 14.70  ? 390  LEU A CD2 1 
ATOM   3067 N  N   . PHE A 1 392 ? 25.205  27.490 71.026  1.00 12.66  ? 391  PHE A N   1 
ATOM   3068 C  CA  . PHE A 1 392 ? 26.635  27.538 71.333  1.00 13.86  ? 391  PHE A CA  1 
ATOM   3069 C  C   . PHE A 1 392 ? 27.053  26.343 72.147  1.00 17.87  ? 391  PHE A C   1 
ATOM   3070 O  O   . PHE A 1 392 ? 28.104  25.733 71.983  1.00 18.52  ? 391  PHE A O   1 
ATOM   3071 C  CB  . PHE A 1 392 ? 26.964  28.806 72.105  1.00 14.47  ? 391  PHE A CB  1 
ATOM   3072 C  CG  . PHE A 1 392 ? 28.437  29.179 72.101  1.00 18.51  ? 391  PHE A CG  1 
ATOM   3073 C  CD1 . PHE A 1 392 ? 29.237  28.996 70.973  1.00 18.55  ? 391  PHE A CD1 1 
ATOM   3074 C  CD2 . PHE A 1 392 ? 29.030  29.748 73.233  1.00 18.59  ? 391  PHE A CD2 1 
ATOM   3075 C  CE1 . PHE A 1 392 ? 30.571  29.402 70.966  1.00 15.73  ? 391  PHE A CE1 1 
ATOM   3076 C  CE2 . PHE A 1 392 ? 30.373  30.137 73.252  1.00 18.49  ? 391  PHE A CE2 1 
ATOM   3077 C  CZ  . PHE A 1 392 ? 31.148  29.954 72.109  1.00 15.63  ? 391  PHE A CZ  1 
ATOM   3078 N  N   . TYR A 1 393 ? 26.148  26.008 73.039  1.00 16.91  ? 392  TYR A N   1 
ATOM   3079 C  CA  . TYR A 1 393 ? 26.315  24.893 73.944  1.00 17.78  ? 392  TYR A CA  1 
ATOM   3080 C  C   . TYR A 1 393 ? 26.288  23.570 73.175  1.00 19.46  ? 392  TYR A C   1 
ATOM   3081 O  O   . TYR A 1 393 ? 27.095  22.666 73.388  1.00 18.21  ? 392  TYR A O   1 
ATOM   3082 C  CB  . TYR A 1 393 ? 25.243  25.000 75.049  1.00 15.50  ? 392  TYR A CB  1 
ATOM   3083 C  CG  . TYR A 1 393 ? 24.928  23.688 75.736  1.00 20.94  ? 392  TYR A CG  1 
ATOM   3084 C  CD1 . TYR A 1 393 ? 25.849  23.106 76.609  1.00 24.90  ? 392  TYR A CD1 1 
ATOM   3085 C  CD2 . TYR A 1 393 ? 23.715  23.034 75.528  1.00 21.37  ? 392  TYR A CD2 1 
ATOM   3086 C  CE1 . TYR A 1 393 ? 25.596  21.899 77.260  1.00 23.89  ? 392  TYR A CE1 1 
ATOM   3087 C  CE2 . TYR A 1 393 ? 23.438  21.821 76.162  1.00 24.11  ? 392  TYR A CE2 1 
ATOM   3088 C  CZ  . TYR A 1 393 ? 24.383  21.256 77.020  1.00 28.03  ? 392  TYR A CZ  1 
ATOM   3089 O  OH  . TYR A 1 393 ? 24.112  20.087 77.665  1.00 20.09  ? 392  TYR A OH  1 
ATOM   3090 N  N   . LEU A 1 394 ? 25.332  23.456 72.271  1.00 14.83  ? 393  LEU A N   1 
ATOM   3091 C  CA  . LEU A 1 394 ? 25.210  22.267 71.440  1.00 15.47  ? 393  LEU A CA  1 
ATOM   3092 C  C   . LEU A 1 394 ? 26.432  22.122 70.544  1.00 20.32  ? 393  LEU A C   1 
ATOM   3093 O  O   . LEU A 1 394 ? 26.867  21.005 70.304  1.00 21.36  ? 393  LEU A O   1 
ATOM   3094 C  CB  . LEU A 1 394 ? 23.961  22.344 70.508  1.00 16.00  ? 393  LEU A CB  1 
ATOM   3095 C  CG  . LEU A 1 394 ? 22.638  22.027 71.223  1.00 18.37  ? 393  LEU A CG  1 
ATOM   3096 C  CD1 . LEU A 1 394 ? 21.443  22.392 70.347  1.00 15.16  ? 393  LEU A CD1 1 
ATOM   3097 C  CD2 . LEU A 1 394 ? 22.577  20.601 71.795  1.00 17.06  ? 393  LEU A CD2 1 
ATOM   3098 N  N   . GLU A 1 395 ? 26.921  23.255 70.015  1.00 16.00  ? 394  GLU A N   1 
ATOM   3099 C  CA  . GLU A 1 395 ? 28.104  23.298 69.160  1.00 13.58  ? 394  GLU A CA  1 
ATOM   3100 C  C   . GLU A 1 395 ? 29.268  22.719 69.931  1.00 17.05  ? 394  GLU A C   1 
ATOM   3101 O  O   . GLU A 1 395 ? 30.014  21.889 69.453  1.00 15.79  ? 394  GLU A O   1 
ATOM   3102 C  CB  . GLU A 1 395 ? 28.434  24.745 68.776  1.00 17.59  ? 394  GLU A CB  1 
ATOM   3103 C  CG  . GLU A 1 395 ? 29.903  24.871 68.320  1.00 23.24  ? 394  GLU A CG  1 
ATOM   3104 C  CD  . GLU A 1 395 ? 30.332  26.300 68.152  1.00 32.12  ? 394  GLU A CD  1 
ATOM   3105 O  OE1 . GLU A 1 395 ? 29.709  27.146 67.532  1.00 23.57  ? 394  GLU A OE1 1 
ATOM   3106 O  OE2 . GLU A 1 395 ? 31.480  26.547 68.714  1.00 26.27  ? 394  GLU A OE2 1 
ATOM   3107 N  N   . GLN A 1 396 ? 29.410  23.127 71.183  1.00 16.99  ? 395  GLN A N   1 
ATOM   3108 C  CA  . GLN A 1 396 ? 30.462  22.610 72.030  1.00 17.56  ? 395  GLN A CA  1 
ATOM   3109 C  C   . GLN A 1 396 ? 30.293  21.127 72.360  1.00 23.89  ? 395  GLN A C   1 
ATOM   3110 O  O   . GLN A 1 396 ? 31.258  20.359 72.421  1.00 24.66  ? 395  GLN A O   1 
ATOM   3111 C  CB  . GLN A 1 396 ? 30.725  23.461 73.318  1.00 17.71  ? 395  GLN A CB  1 
ATOM   3112 C  CG  . GLN A 1 396 ? 31.195  24.888 72.918  1.00 17.45  ? 395  GLN A CG  1 
ATOM   3113 C  CD  . GLN A 1 396 ? 31.354  25.851 74.081  1.00 21.98  ? 395  GLN A CD  1 
ATOM   3114 O  OE1 . GLN A 1 396 ? 30.986  25.584 75.224  1.00 16.80  ? 395  GLN A OE1 1 
ATOM   3115 N  NE2 . GLN A 1 396 ? 31.943  26.985 73.776  1.00 16.78  ? 395  GLN A NE2 1 
ATOM   3116 N  N   . LEU A 1 397 ? 29.058  20.706 72.588  1.00 21.86  ? 396  LEU A N   1 
ATOM   3117 C  CA  . LEU A 1 397 ? 28.767  19.330 72.932  1.00 20.27  ? 396  LEU A CA  1 
ATOM   3118 C  C   . LEU A 1 397 ? 28.936  18.387 71.744  1.00 22.03  ? 396  LEU A C   1 
ATOM   3119 O  O   . LEU A 1 397 ? 29.381  17.260 71.857  1.00 25.07  ? 396  LEU A O   1 
ATOM   3120 C  CB  . LEU A 1 397 ? 27.315  19.276 73.441  1.00 18.56  ? 396  LEU A CB  1 
ATOM   3121 C  CG  . LEU A 1 397 ? 26.852  17.960 73.994  1.00 22.66  ? 396  LEU A CG  1 
ATOM   3122 C  CD1 . LEU A 1 397 ? 27.493  17.780 75.354  1.00 25.52  ? 396  LEU A CD1 1 
ATOM   3123 C  CD2 . LEU A 1 397 ? 25.340  18.045 74.179  1.00 17.79  ? 396  LEU A CD2 1 
ATOM   3124 N  N   . LEU A 1 398 ? 28.575  18.831 70.579  1.00 15.28  ? 397  LEU A N   1 
ATOM   3125 C  CA  . LEU A 1 398 ? 28.603  17.939 69.433  1.00 16.80  ? 397  LEU A CA  1 
ATOM   3126 C  C   . LEU A 1 398 ? 29.846  17.946 68.565  1.00 26.85  ? 397  LEU A C   1 
ATOM   3127 O  O   . LEU A 1 398 ? 29.864  17.399 67.458  1.00 29.08  ? 397  LEU A O   1 
ATOM   3128 C  CB  . LEU A 1 398 ? 27.371  18.242 68.552  1.00 15.51  ? 397  LEU A CB  1 
ATOM   3129 C  CG  . LEU A 1 398 ? 26.013  18.018 69.261  1.00 20.96  ? 397  LEU A CG  1 
ATOM   3130 C  CD1 . LEU A 1 398 ? 24.874  18.717 68.501  1.00 19.35  ? 397  LEU A CD1 1 
ATOM   3131 C  CD2 . LEU A 1 398 ? 25.692  16.536 69.461  1.00 19.12  ? 397  LEU A CD2 1 
ATOM   3132 N  N   . GLY A 1 399 ? 30.901  18.598 68.985  1.00 24.55  ? 398  GLY A N   1 
ATOM   3133 C  CA  . GLY A 1 399 ? 32.006  18.516 68.076  1.00 27.19  ? 398  GLY A CA  1 
ATOM   3134 C  C   . GLY A 1 399 ? 32.648  19.794 67.598  1.00 29.41  ? 398  GLY A C   1 
ATOM   3135 O  O   . GLY A 1 399 ? 33.743  19.713 67.048  1.00 30.13  ? 398  GLY A O   1 
ATOM   3136 N  N   . GLY A 1 400 ? 32.020  20.951 67.752  1.00 19.25  ? 399  GLY A N   1 
ATOM   3137 C  CA  . GLY A 1 400 ? 32.700  22.143 67.291  1.00 16.50  ? 399  GLY A CA  1 
ATOM   3138 C  C   . GLY A 1 400 ? 31.937  22.850 66.212  1.00 15.03  ? 399  GLY A C   1 
ATOM   3139 O  O   . GLY A 1 400 ? 30.976  22.315 65.694  1.00 17.49  ? 399  GLY A O   1 
ATOM   3140 N  N   . PRO A 1 401 ? 32.397  24.045 65.870  1.00 21.52  ? 400  PRO A N   1 
ATOM   3141 C  CA  . PRO A 1 401 ? 31.758  24.918 64.909  1.00 21.69  ? 400  PRO A CA  1 
ATOM   3142 C  C   . PRO A 1 401 ? 31.599  24.312 63.552  1.00 29.85  ? 400  PRO A C   1 
ATOM   3143 O  O   . PRO A 1 401 ? 30.540  24.433 62.921  1.00 24.28  ? 400  PRO A O   1 
ATOM   3144 C  CB  . PRO A 1 401 ? 32.574  26.210 64.802  1.00 21.33  ? 400  PRO A CB  1 
ATOM   3145 C  CG  . PRO A 1 401 ? 33.868  25.949 65.552  1.00 27.07  ? 400  PRO A CG  1 
ATOM   3146 C  CD  . PRO A 1 401 ? 33.698  24.635 66.306  1.00 25.67  ? 400  PRO A CD  1 
ATOM   3147 N  N   . GLU A 1 402 ? 32.679  23.674 63.128  1.00 28.84  ? 401  GLU A N   1 
ATOM   3148 C  CA  . GLU A 1 402 ? 32.630  23.048 61.831  1.00 30.42  ? 401  GLU A CA  1 
ATOM   3149 C  C   . GLU A 1 402 ? 31.491  22.055 61.764  1.00 22.63  ? 401  GLU A C   1 
ATOM   3150 O  O   . GLU A 1 402 ? 30.664  22.034 60.872  1.00 21.35  ? 401  GLU A O   1 
ATOM   3151 C  CB  . GLU A 1 402 ? 33.915  22.247 61.648  1.00 35.39  ? 401  GLU A CB  1 
ATOM   3152 C  CG  . GLU A 1 402 ? 35.125  23.160 61.445  1.00 70.34  ? 401  GLU A CG  1 
ATOM   3153 C  CD  . GLU A 1 402 ? 35.978  22.574 60.355  1.00 100.00 ? 401  GLU A CD  1 
ATOM   3154 O  OE1 . GLU A 1 402 ? 35.711  21.486 59.851  1.00 100.00 ? 401  GLU A OE1 1 
ATOM   3155 O  OE2 . GLU A 1 402 ? 37.013  23.329 60.026  1.00 100.00 ? 401  GLU A OE2 1 
ATOM   3156 N  N   . ILE A 1 403 ? 31.484  21.185 62.731  1.00 20.44  ? 402  ILE A N   1 
ATOM   3157 C  CA  . ILE A 1 403 ? 30.481  20.165 62.766  1.00 21.27  ? 402  ILE A CA  1 
ATOM   3158 C  C   . ILE A 1 403 ? 29.082  20.761 62.895  1.00 26.84  ? 402  ILE A C   1 
ATOM   3159 O  O   . ILE A 1 403 ? 28.142  20.366 62.199  1.00 18.68  ? 402  ILE A O   1 
ATOM   3160 C  CB  . ILE A 1 403 ? 30.819  19.218 63.904  1.00 24.03  ? 402  ILE A CB  1 
ATOM   3161 C  CG1 . ILE A 1 403 ? 31.974  18.299 63.503  1.00 23.45  ? 402  ILE A CG1 1 
ATOM   3162 C  CG2 . ILE A 1 403 ? 29.587  18.421 64.334  1.00 28.69  ? 402  ILE A CG2 1 
ATOM   3163 C  CD1 . ILE A 1 403 ? 32.370  17.396 64.665  1.00 26.57  ? 402  ILE A CD1 1 
ATOM   3164 N  N   . PHE A 1 404 ? 28.948  21.745 63.773  1.00 21.88  ? 403  PHE A N   1 
ATOM   3165 C  CA  . PHE A 1 404 ? 27.646  22.325 63.962  1.00 20.25  ? 403  PHE A CA  1 
ATOM   3166 C  C   . PHE A 1 404 ? 27.149  23.152 62.802  1.00 20.90  ? 403  PHE A C   1 
ATOM   3167 O  O   . PHE A 1 404 ? 25.951  23.246 62.510  1.00 21.88  ? 403  PHE A O   1 
ATOM   3168 C  CB  . PHE A 1 404 ? 27.555  23.073 65.298  1.00 22.18  ? 403  PHE A CB  1 
ATOM   3169 C  CG  . PHE A 1 404 ? 26.121  23.247 65.764  1.00 20.23  ? 403  PHE A CG  1 
ATOM   3170 C  CD1 . PHE A 1 404 ? 25.411  22.189 66.331  1.00 21.99  ? 403  PHE A CD1 1 
ATOM   3171 C  CD2 . PHE A 1 404 ? 25.478  24.479 65.660  1.00 25.50  ? 403  PHE A CD2 1 
ATOM   3172 C  CE1 . PHE A 1 404 ? 24.106  22.345 66.801  1.00 23.07  ? 403  PHE A CE1 1 
ATOM   3173 C  CE2 . PHE A 1 404 ? 24.156  24.651 66.081  1.00 25.44  ? 403  PHE A CE2 1 
ATOM   3174 C  CZ  . PHE A 1 404 ? 23.472  23.581 66.661  1.00 22.55  ? 403  PHE A CZ  1 
ATOM   3175 N  N   . LEU A 1 405 ? 28.076  23.804 62.121  1.00 17.83  ? 404  LEU A N   1 
ATOM   3176 C  CA  . LEU A 1 405 ? 27.664  24.596 60.973  1.00 17.93  ? 404  LEU A CA  1 
ATOM   3177 C  C   . LEU A 1 405 ? 27.136  23.666 59.868  1.00 24.59  ? 404  LEU A C   1 
ATOM   3178 O  O   . LEU A 1 405 ? 26.297  24.031 59.044  1.00 22.86  ? 404  LEU A O   1 
ATOM   3179 C  CB  . LEU A 1 405 ? 28.808  25.526 60.504  1.00 17.59  ? 404  LEU A CB  1 
ATOM   3180 C  CG  . LEU A 1 405 ? 28.952  26.728 61.425  1.00 19.68  ? 404  LEU A CG  1 
ATOM   3181 C  CD1 . LEU A 1 405 ? 30.297  27.424 61.239  1.00 19.60  ? 404  LEU A CD1 1 
ATOM   3182 C  CD2 . LEU A 1 405 ? 27.873  27.719 61.047  1.00 20.62  ? 404  LEU A CD2 1 
ATOM   3183 N  N   . GLY A 1 406 ? 27.630  22.418 59.852  1.00 21.24  ? 405  GLY A N   1 
ATOM   3184 C  CA  . GLY A 1 406 ? 27.164  21.461 58.868  1.00 18.72  ? 405  GLY A CA  1 
ATOM   3185 C  C   . GLY A 1 406 ? 25.691  21.148 59.148  1.00 23.90  ? 405  GLY A C   1 
ATOM   3186 O  O   . GLY A 1 406 ? 24.853  21.054 58.240  1.00 24.54  ? 405  GLY A O   1 
ATOM   3187 N  N   . PHE A 1 407 ? 25.363  20.987 60.438  1.00 18.59  ? 406  PHE A N   1 
ATOM   3188 C  CA  . PHE A 1 407 ? 23.979  20.734 60.824  1.00 18.47  ? 406  PHE A CA  1 
ATOM   3189 C  C   . PHE A 1 407 ? 23.165  21.964 60.367  1.00 23.08  ? 406  PHE A C   1 
ATOM   3190 O  O   . PHE A 1 407 ? 22.150  21.917 59.663  1.00 20.15  ? 406  PHE A O   1 
ATOM   3191 C  CB  . PHE A 1 407 ? 23.863  20.473 62.348  1.00 17.79  ? 406  PHE A CB  1 
ATOM   3192 C  CG  . PHE A 1 407 ? 22.470  20.814 62.819  1.00 19.42  ? 406  PHE A CG  1 
ATOM   3193 C  CD1 . PHE A 1 407 ? 21.400  19.986 62.482  1.00 20.66  ? 406  PHE A CD1 1 
ATOM   3194 C  CD2 . PHE A 1 407 ? 22.213  21.990 63.526  1.00 20.37  ? 406  PHE A CD2 1 
ATOM   3195 C  CE1 . PHE A 1 407 ? 20.099  20.274 62.898  1.00 22.34  ? 406  PHE A CE1 1 
ATOM   3196 C  CE2 . PHE A 1 407 ? 20.921  22.313 63.938  1.00 24.74  ? 406  PHE A CE2 1 
ATOM   3197 C  CZ  . PHE A 1 407 ? 19.874  21.441 63.634  1.00 23.87  ? 406  PHE A CZ  1 
ATOM   3198 N  N   . LEU A 1 408 ? 23.674  23.139 60.702  1.00 22.33  ? 407  LEU A N   1 
ATOM   3199 C  CA  . LEU A 1 408 ? 22.979  24.352 60.309  1.00 26.37  ? 407  LEU A CA  1 
ATOM   3200 C  C   . LEU A 1 408 ? 22.690  24.501 58.819  1.00 24.88  ? 407  LEU A C   1 
ATOM   3201 O  O   . LEU A 1 408 ? 21.588  24.869 58.409  1.00 21.77  ? 407  LEU A O   1 
ATOM   3202 C  CB  . LEU A 1 408 ? 23.742  25.574 60.831  1.00 30.18  ? 407  LEU A CB  1 
ATOM   3203 C  CG  . LEU A 1 408 ? 22.859  26.773 61.112  1.00 40.95  ? 407  LEU A CG  1 
ATOM   3204 C  CD1 . LEU A 1 408 ? 23.559  27.710 62.083  1.00 43.78  ? 407  LEU A CD1 1 
ATOM   3205 C  CD2 . LEU A 1 408 ? 22.622  27.498 59.806  1.00 47.26  ? 407  LEU A CD2 1 
ATOM   3206 N  N   . LYS A 1 409 ? 23.679  24.256 57.981  1.00 21.87  ? 408  LYS A N   1 
ATOM   3207 C  CA  . LYS A 1 409 ? 23.425  24.378 56.555  1.00 20.93  ? 408  LYS A CA  1 
ATOM   3208 C  C   . LYS A 1 409 ? 22.386  23.351 56.080  1.00 19.73  ? 408  LYS A C   1 
ATOM   3209 O  O   . LYS A 1 409 ? 21.502  23.596 55.265  1.00 18.85  ? 408  LYS A O   1 
ATOM   3210 C  CB  . LYS A 1 409 ? 24.715  24.325 55.746  1.00 22.33  ? 408  LYS A CB  1 
ATOM   3211 C  CG  . LYS A 1 409 ? 24.420  24.240 54.262  1.00 33.19  ? 408  LYS A CG  1 
ATOM   3212 C  CD  . LYS A 1 409 ? 25.621  24.508 53.374  1.00 24.21  ? 408  LYS A CD  1 
ATOM   3213 C  CE  . LYS A 1 409 ? 26.812  25.035 54.131  1.00 44.20  ? 408  LYS A CE  1 
ATOM   3214 N  NZ  . LYS A 1 409 ? 27.904  25.399 53.217  1.00 61.63  ? 408  LYS A NZ  1 
ATOM   3215 N  N   . ALA A 1 410 ? 22.458  22.161 56.625  1.00 21.49  ? 409  ALA A N   1 
ATOM   3216 C  CA  . ALA A 1 410 ? 21.496  21.116 56.278  1.00 23.64  ? 409  ALA A CA  1 
ATOM   3217 C  C   . ALA A 1 410 ? 20.037  21.458 56.689  1.00 28.20  ? 409  ALA A C   1 
ATOM   3218 O  O   . ALA A 1 410 ? 19.059  21.204 55.968  1.00 23.25  ? 409  ALA A O   1 
ATOM   3219 C  CB  . ALA A 1 410 ? 21.936  19.821 56.974  1.00 23.41  ? 409  ALA A CB  1 
ATOM   3220 N  N   . TYR A 1 411 ? 19.921  22.030 57.900  1.00 23.19  ? 410  TYR A N   1 
ATOM   3221 C  CA  . TYR A 1 411 ? 18.668  22.463 58.495  1.00 18.98  ? 410  TYR A CA  1 
ATOM   3222 C  C   . TYR A 1 411 ? 18.014  23.507 57.594  1.00 18.81  ? 410  TYR A C   1 
ATOM   3223 O  O   . TYR A 1 411 ? 16.832  23.464 57.298  1.00 19.59  ? 410  TYR A O   1 
ATOM   3224 C  CB  . TYR A 1 411 ? 18.973  22.980 59.910  1.00 19.89  ? 410  TYR A CB  1 
ATOM   3225 C  CG  . TYR A 1 411 ? 17.947  23.924 60.516  1.00 20.57  ? 410  TYR A CG  1 
ATOM   3226 C  CD1 . TYR A 1 411 ? 16.715  23.463 60.981  1.00 22.20  ? 410  TYR A CD1 1 
ATOM   3227 C  CD2 . TYR A 1 411 ? 18.219  25.286 60.649  1.00 21.16  ? 410  TYR A CD2 1 
ATOM   3228 C  CE1 . TYR A 1 411 ? 15.767  24.320 61.551  1.00 17.85  ? 410  TYR A CE1 1 
ATOM   3229 C  CE2 . TYR A 1 411 ? 17.289  26.163 61.213  1.00 22.58  ? 410  TYR A CE2 1 
ATOM   3230 C  CZ  . TYR A 1 411 ? 16.064  25.679 61.682  1.00 25.33  ? 410  TYR A CZ  1 
ATOM   3231 O  OH  . TYR A 1 411 ? 15.182  26.528 62.315  1.00 20.84  ? 410  TYR A OH  1 
ATOM   3232 N  N   . VAL A 1 412 ? 18.809  24.459 57.147  1.00 17.01  ? 411  VAL A N   1 
ATOM   3233 C  CA  . VAL A 1 412 ? 18.378  25.520 56.254  1.00 20.36  ? 411  VAL A CA  1 
ATOM   3234 C  C   . VAL A 1 412 ? 17.876  24.946 54.936  1.00 25.04  ? 411  VAL A C   1 
ATOM   3235 O  O   . VAL A 1 412 ? 16.859  25.377 54.394  1.00 22.50  ? 411  VAL A O   1 
ATOM   3236 C  CB  . VAL A 1 412 ? 19.533  26.493 55.937  1.00 24.82  ? 411  VAL A CB  1 
ATOM   3237 C  CG1 . VAL A 1 412 ? 19.220  27.380 54.724  1.00 21.10  ? 411  VAL A CG1 1 
ATOM   3238 C  CG2 . VAL A 1 412 ? 19.920  27.333 57.163  1.00 25.82  ? 411  VAL A CG2 1 
ATOM   3239 N  N   . GLU A 1 413 ? 18.616  23.952 54.443  1.00 24.87  ? 412  GLU A N   1 
ATOM   3240 C  CA  . GLU A 1 413 ? 18.264  23.283 53.202  1.00 24.91  ? 412  GLU A CA  1 
ATOM   3241 C  C   . GLU A 1 413 ? 16.960  22.532 53.366  1.00 24.56  ? 412  GLU A C   1 
ATOM   3242 O  O   . GLU A 1 413 ? 16.045  22.612 52.555  1.00 26.86  ? 412  GLU A O   1 
ATOM   3243 C  CB  . GLU A 1 413 ? 19.330  22.211 52.913  1.00 28.91  ? 412  GLU A CB  1 
ATOM   3244 C  CG  . GLU A 1 413 ? 20.206  22.405 51.660  1.00 51.34  ? 412  GLU A CG  1 
ATOM   3245 C  CD  . GLU A 1 413 ? 21.671  22.089 51.908  1.00 100.00 ? 412  GLU A CD  1 
ATOM   3246 O  OE1 . GLU A 1 413 ? 22.243  22.331 52.963  1.00 100.00 ? 412  GLU A OE1 1 
ATOM   3247 O  OE2 . GLU A 1 413 ? 22.274  21.541 50.874  1.00 100.00 ? 412  GLU A OE2 1 
ATOM   3248 N  N   . LYS A 1 414 ? 16.909  21.757 54.442  1.00 19.78  ? 413  LYS A N   1 
ATOM   3249 C  CA  . LYS A 1 414 ? 15.755  20.940 54.747  1.00 15.53  ? 413  LYS A CA  1 
ATOM   3250 C  C   . LYS A 1 414 ? 14.484  21.718 54.892  1.00 22.00  ? 413  LYS A C   1 
ATOM   3251 O  O   . LYS A 1 414 ? 13.464  21.272 54.409  1.00 23.41  ? 413  LYS A O   1 
ATOM   3252 C  CB  . LYS A 1 414 ? 16.020  20.156 56.008  1.00 17.04  ? 413  LYS A CB  1 
ATOM   3253 C  CG  . LYS A 1 414 ? 14.754  19.602 56.629  1.00 26.97  ? 413  LYS A CG  1 
ATOM   3254 C  CD  . LYS A 1 414 ? 14.225  18.351 55.955  1.00 37.17  ? 413  LYS A CD  1 
ATOM   3255 C  CE  . LYS A 1 414 ? 13.553  17.352 56.893  1.00 56.50  ? 413  LYS A CE  1 
ATOM   3256 N  NZ  . LYS A 1 414 ? 13.126  16.109 56.223  1.00 80.78  ? 413  LYS A NZ  1 
ATOM   3257 N  N   . PHE A 1 415 ? 14.543  22.888 55.532  1.00 19.76  ? 414  PHE A N   1 
ATOM   3258 C  CA  . PHE A 1 415 ? 13.366  23.700 55.808  1.00 17.00  ? 414  PHE A CA  1 
ATOM   3259 C  C   . PHE A 1 415 ? 13.192  24.945 54.985  1.00 21.55  ? 414  PHE A C   1 
ATOM   3260 O  O   . PHE A 1 415 ? 12.329  25.748 55.303  1.00 17.11  ? 414  PHE A O   1 
ATOM   3261 C  CB  . PHE A 1 415 ? 13.219  24.035 57.303  1.00 16.42  ? 414  PHE A CB  1 
ATOM   3262 C  CG  . PHE A 1 415 ? 13.047  22.800 58.122  1.00 15.55  ? 414  PHE A CG  1 
ATOM   3263 C  CD1 . PHE A 1 415 ? 11.894  22.029 57.979  1.00 19.53  ? 414  PHE A CD1 1 
ATOM   3264 C  CD2 . PHE A 1 415 ? 14.024  22.368 59.015  1.00 20.06  ? 414  PHE A CD2 1 
ATOM   3265 C  CE1 . PHE A 1 415 ? 11.709  20.868 58.729  1.00 18.22  ? 414  PHE A CE1 1 
ATOM   3266 C  CE2 . PHE A 1 415 ? 13.861  21.205 59.771  1.00 21.10  ? 414  PHE A CE2 1 
ATOM   3267 C  CZ  . PHE A 1 415 ? 12.695  20.456 59.627  1.00 19.80  ? 414  PHE A CZ  1 
ATOM   3268 N  N   . SER A 1 416 ? 13.972  25.111 53.928  1.00 22.05  ? 415  SER A N   1 
ATOM   3269 C  CA  . SER A 1 416 ? 13.807  26.273 53.044  1.00 23.12  ? 415  SER A CA  1 
ATOM   3270 C  C   . SER A 1 416 ? 12.380  26.434 52.548  1.00 23.50  ? 415  SER A C   1 
ATOM   3271 O  O   . SER A 1 416 ? 11.775  25.451 52.138  1.00 22.71  ? 415  SER A O   1 
ATOM   3272 C  CB  . SER A 1 416 ? 14.763  26.214 51.858  1.00 23.04  ? 415  SER A CB  1 
ATOM   3273 O  OG  . SER A 1 416 ? 16.054  26.591 52.319  1.00 31.15  ? 415  SER A OG  1 
ATOM   3274 N  N   . TYR A 1 417 ? 11.860  27.670 52.600  1.00 21.68  ? 416  TYR A N   1 
ATOM   3275 C  CA  . TYR A 1 417 ? 10.506  28.036 52.165  1.00 22.03  ? 416  TYR A CA  1 
ATOM   3276 C  C   . TYR A 1 417 ? 9.401   27.514 53.056  1.00 22.90  ? 416  TYR A C   1 
ATOM   3277 O  O   . TYR A 1 417 ? 8.239   27.556 52.681  1.00 19.44  ? 416  TYR A O   1 
ATOM   3278 C  CB  . TYR A 1 417 ? 10.181  27.732 50.669  1.00 21.41  ? 416  TYR A CB  1 
ATOM   3279 C  CG  . TYR A 1 417 ? 11.390  28.011 49.812  1.00 21.01  ? 416  TYR A CG  1 
ATOM   3280 C  CD1 . TYR A 1 417 ? 12.232  27.003 49.339  1.00 22.57  ? 416  TYR A CD1 1 
ATOM   3281 C  CD2 . TYR A 1 417 ? 11.686  29.339 49.509  1.00 20.93  ? 416  TYR A CD2 1 
ATOM   3282 C  CE1 . TYR A 1 417 ? 13.354  27.305 48.566  1.00 19.33  ? 416  TYR A CE1 1 
ATOM   3283 C  CE2 . TYR A 1 417 ? 12.792  29.665 48.729  1.00 23.16  ? 416  TYR A CE2 1 
ATOM   3284 C  CZ  . TYR A 1 417 ? 13.628  28.643 48.271  1.00 32.30  ? 416  TYR A CZ  1 
ATOM   3285 O  OH  . TYR A 1 417 ? 14.715  28.959 47.491  1.00 25.33  ? 416  TYR A OH  1 
ATOM   3286 N  N   . LYS A 1 418 ? 9.747   27.012 54.230  1.00 21.98  ? 417  LYS A N   1 
ATOM   3287 C  CA  . LYS A 1 418 ? 8.749   26.482 55.127  1.00 20.82  ? 417  LYS A CA  1 
ATOM   3288 C  C   . LYS A 1 418 ? 8.702   27.284 56.408  1.00 20.61  ? 417  LYS A C   1 
ATOM   3289 O  O   . LYS A 1 418 ? 9.629   28.038 56.671  1.00 18.79  ? 417  LYS A O   1 
ATOM   3290 C  CB  . LYS A 1 418 ? 9.115   25.041 55.481  1.00 22.26  ? 417  LYS A CB  1 
ATOM   3291 C  CG  . LYS A 1 418 ? 9.094   24.078 54.266  1.00 29.52  ? 417  LYS A CG  1 
ATOM   3292 C  CD  . LYS A 1 418 ? 7.999   24.355 53.237  1.00 72.37  ? 417  LYS A CD  1 
ATOM   3293 C  CE  . LYS A 1 418 ? 8.204   23.679 51.876  1.00 100.00 ? 417  LYS A CE  1 
ATOM   3294 N  NZ  . LYS A 1 418 ? 7.124   23.931 50.895  1.00 100.00 ? 417  LYS A NZ  1 
ATOM   3295 N  N   . SER A 1 419 ? 7.645   27.068 57.177  1.00 17.88  ? 418  SER A N   1 
ATOM   3296 C  CA  . SER A 1 419 ? 7.429   27.702 58.478  1.00 19.91  ? 418  SER A CA  1 
ATOM   3297 C  C   . SER A 1 419 ? 7.410   26.538 59.459  1.00 23.93  ? 418  SER A C   1 
ATOM   3298 O  O   . SER A 1 419 ? 6.660   25.601 59.227  1.00 21.09  ? 418  SER A O   1 
ATOM   3299 C  CB  . SER A 1 419 ? 6.139   28.495 58.451  1.00 12.45  ? 418  SER A CB  1 
ATOM   3300 O  OG  . SER A 1 419 ? 6.279   29.520 57.494  1.00 17.15  ? 418  SER A OG  1 
ATOM   3301 N  N   . ILE A 1 420 ? 8.240   26.529 60.516  1.00 14.38  ? 419  ILE A N   1 
ATOM   3302 C  CA  . ILE A 1 420 ? 8.323   25.353 61.382  1.00 12.23  ? 419  ILE A CA  1 
ATOM   3303 C  C   . ILE A 1 420 ? 8.330   25.695 62.841  1.00 16.49  ? 419  ILE A C   1 
ATOM   3304 O  O   . ILE A 1 420 ? 8.334   26.875 63.219  1.00 14.48  ? 419  ILE A O   1 
ATOM   3305 C  CB  . ILE A 1 420 ? 9.662   24.641 61.097  1.00 18.50  ? 419  ILE A CB  1 
ATOM   3306 C  CG1 . ILE A 1 420 ? 10.782  25.649 61.392  1.00 18.34  ? 419  ILE A CG1 1 
ATOM   3307 C  CG2 . ILE A 1 420 ? 9.782   24.271 59.611  1.00 14.45  ? 419  ILE A CG2 1 
ATOM   3308 C  CD1 . ILE A 1 420 ? 12.163  25.028 61.473  1.00 22.79  ? 419  ILE A CD1 1 
ATOM   3309 N  N   . THR A 1 421 ? 8.320   24.635 63.644  1.00 16.31  ? 420  THR A N   1 
ATOM   3310 C  CA  . THR A 1 421 ? 8.281   24.810 65.083  1.00 14.71  ? 420  THR A CA  1 
ATOM   3311 C  C   . THR A 1 421 ? 9.545   24.290 65.714  1.00 16.25  ? 420  THR A C   1 
ATOM   3312 O  O   . THR A 1 421 ? 10.346  23.636 65.077  1.00 17.31  ? 420  THR A O   1 
ATOM   3313 C  CB  . THR A 1 421 ? 7.118   24.004 65.697  1.00 17.59  ? 420  THR A CB  1 
ATOM   3314 O  OG1 . THR A 1 421 ? 7.437   22.645 65.519  1.00 17.59  ? 420  THR A OG1 1 
ATOM   3315 C  CG2 . THR A 1 421 ? 5.794   24.260 65.010  1.00 16.45  ? 420  THR A CG2 1 
ATOM   3316 N  N   . THR A 1 422 ? 9.679   24.540 67.010  1.00 15.19  ? 421  THR A N   1 
ATOM   3317 C  CA  . THR A 1 422 ? 10.782  24.047 67.818  1.00 15.49  ? 421  THR A CA  1 
ATOM   3318 C  C   . THR A 1 422 ? 10.930  22.520 67.618  1.00 21.17  ? 421  THR A C   1 
ATOM   3319 O  O   . THR A 1 422 ? 12.041  22.044 67.401  1.00 18.91  ? 421  THR A O   1 
ATOM   3320 C  CB  . THR A 1 422 ? 10.564  24.437 69.309  1.00 10.87  ? 421  THR A CB  1 
ATOM   3321 O  OG1 . THR A 1 422 ? 10.618  25.851 69.383  1.00 15.99  ? 421  THR A OG1 1 
ATOM   3322 C  CG2 . THR A 1 422 ? 11.691  23.868 70.170  1.00 11.46  ? 421  THR A CG2 1 
ATOM   3323 N  N   . ASP A 1 423 ? 9.829   21.736 67.673  1.00 18.70  ? 422  ASP A N   1 
ATOM   3324 C  CA  . ASP A 1 423 ? 9.885   20.262 67.467  1.00 16.03  ? 422  ASP A CA  1 
ATOM   3325 C  C   . ASP A 1 423 ? 10.469  19.867 66.107  1.00 16.08  ? 422  ASP A C   1 
ATOM   3326 O  O   . ASP A 1 423 ? 11.273  18.932 65.958  1.00 16.68  ? 422  ASP A O   1 
ATOM   3327 C  CB  . ASP A 1 423 ? 8.523   19.568 67.581  1.00 16.64  ? 422  ASP A CB  1 
ATOM   3328 C  CG  . ASP A 1 423 ? 8.719   18.079 67.574  1.00 26.85  ? 422  ASP A CG  1 
ATOM   3329 O  OD1 . ASP A 1 423 ? 9.568   17.580 68.286  1.00 23.44  ? 422  ASP A OD1 1 
ATOM   3330 O  OD2 . ASP A 1 423 ? 7.924   17.366 66.787  1.00 23.32  ? 422  ASP A OD2 1 
ATOM   3331 N  N   . ASP A 1 424 ? 10.069  20.575 65.060  1.00 17.50  ? 423  ASP A N   1 
ATOM   3332 C  CA  . ASP A 1 424 ? 10.654  20.224 63.757  1.00 18.18  ? 423  ASP A CA  1 
ATOM   3333 C  C   . ASP A 1 424 ? 12.148  20.442 63.826  1.00 17.70  ? 423  ASP A C   1 
ATOM   3334 O  O   . ASP A 1 424 ? 12.922  19.645 63.316  1.00 15.95  ? 423  ASP A O   1 
ATOM   3335 C  CB  . ASP A 1 424 ? 10.099  21.075 62.613  1.00 17.77  ? 423  ASP A CB  1 
ATOM   3336 C  CG  . ASP A 1 424 ? 8.614   20.972 62.510  1.00 20.51  ? 423  ASP A CG  1 
ATOM   3337 O  OD1 . ASP A 1 424 ? 8.042   19.936 62.718  1.00 29.77  ? 423  ASP A OD1 1 
ATOM   3338 O  OD2 . ASP A 1 424 ? 8.016   22.095 62.226  1.00 18.32  ? 423  ASP A OD2 1 
ATOM   3339 N  N   . TRP A 1 425 ? 12.559  21.545 64.459  1.00 12.60  ? 424  TRP A N   1 
ATOM   3340 C  CA  . TRP A 1 425 ? 13.979  21.793 64.555  1.00 14.79  ? 424  TRP A CA  1 
ATOM   3341 C  C   . TRP A 1 425 ? 14.690  20.684 65.330  1.00 19.67  ? 424  TRP A C   1 
ATOM   3342 O  O   . TRP A 1 425 ? 15.731  20.154 64.939  1.00 16.84  ? 424  TRP A O   1 
ATOM   3343 C  CB  . TRP A 1 425 ? 14.187  23.134 65.283  1.00 14.84  ? 424  TRP A CB  1 
ATOM   3344 C  CG  . TRP A 1 425 ? 15.603  23.332 65.711  1.00 13.71  ? 424  TRP A CG  1 
ATOM   3345 C  CD1 . TRP A 1 425 ? 16.594  23.830 64.937  1.00 15.42  ? 424  TRP A CD1 1 
ATOM   3346 C  CD2 . TRP A 1 425 ? 16.185  23.060 67.002  1.00 13.68  ? 424  TRP A CD2 1 
ATOM   3347 N  NE1 . TRP A 1 425 ? 17.765  23.853 65.640  1.00 14.21  ? 424  TRP A NE1 1 
ATOM   3348 C  CE2 . TRP A 1 425 ? 17.558  23.383 66.909  1.00 13.75  ? 424  TRP A CE2 1 
ATOM   3349 C  CE3 . TRP A 1 425 ? 15.684  22.576 68.210  1.00 16.53  ? 424  TRP A CE3 1 
ATOM   3350 C  CZ2 . TRP A 1 425 ? 18.436  23.247 67.983  1.00 13.89  ? 424  TRP A CZ2 1 
ATOM   3351 C  CZ3 . TRP A 1 425 ? 16.564  22.434 69.288  1.00 16.24  ? 424  TRP A CZ3 1 
ATOM   3352 C  CH2 . TRP A 1 425 ? 17.919  22.786 69.175  1.00 15.55  ? 424  TRP A CH2 1 
ATOM   3353 N  N   . LYS A 1 426 ? 14.139  20.328 66.480  1.00 13.83  ? 425  LYS A N   1 
ATOM   3354 C  CA  . LYS A 1 426 ? 14.778  19.337 67.319  1.00 14.35  ? 425  LYS A CA  1 
ATOM   3355 C  C   . LYS A 1 426 ? 14.705  17.914 66.753  1.00 19.43  ? 425  LYS A C   1 
ATOM   3356 O  O   . LYS A 1 426 ? 15.619  17.089 66.910  1.00 16.20  ? 425  LYS A O   1 
ATOM   3357 C  CB  . LYS A 1 426 ? 14.262  19.441 68.735  1.00 13.53  ? 425  LYS A CB  1 
ATOM   3358 C  CG  . LYS A 1 426 ? 14.912  18.488 69.720  1.00 14.17  ? 425  LYS A CG  1 
ATOM   3359 C  CD  . LYS A 1 426 ? 14.289  18.698 71.085  1.00 14.61  ? 425  LYS A CD  1 
ATOM   3360 C  CE  . LYS A 1 426 ? 14.214  17.413 71.872  1.00 33.75  ? 425  LYS A CE  1 
ATOM   3361 N  NZ  . LYS A 1 426 ? 12.961  16.707 71.574  1.00 28.69  ? 425  LYS A NZ  1 
ATOM   3362 N  N   . ASP A 1 427 ? 13.591  17.633 66.093  1.00 17.34  ? 426  ASP A N   1 
ATOM   3363 C  CA  . ASP A 1 427 ? 13.430  16.341 65.480  1.00 15.98  ? 426  ASP A CA  1 
ATOM   3364 C  C   . ASP A 1 427 ? 14.524  16.256 64.383  1.00 23.28  ? 426  ASP A C   1 
ATOM   3365 O  O   . ASP A 1 427 ? 15.177  15.246 64.128  1.00 25.50  ? 426  ASP A O   1 
ATOM   3366 C  CB  . ASP A 1 427 ? 11.987  16.225 64.918  1.00 13.29  ? 426  ASP A CB  1 
ATOM   3367 C  CG  . ASP A 1 427 ? 10.984  15.900 65.989  1.00 14.86  ? 426  ASP A CG  1 
ATOM   3368 O  OD1 . ASP A 1 427 ? 11.296  15.712 67.147  1.00 19.08  ? 426  ASP A OD1 1 
ATOM   3369 O  OD2 . ASP A 1 427 ? 9.746   15.852 65.579  1.00 18.33  ? 426  ASP A OD2 1 
ATOM   3370 N  N   . PHE A 1 428 ? 14.770  17.354 63.684  1.00 20.60  ? 427  PHE A N   1 
ATOM   3371 C  CA  . PHE A 1 428 ? 15.789  17.331 62.633  1.00 20.61  ? 427  PHE A CA  1 
ATOM   3372 C  C   . PHE A 1 428 ? 17.203  17.172 63.165  1.00 26.34  ? 427  PHE A C   1 
ATOM   3373 O  O   . PHE A 1 428 ? 18.056  16.476 62.592  1.00 22.98  ? 427  PHE A O   1 
ATOM   3374 C  CB  . PHE A 1 428 ? 15.712  18.535 61.679  1.00 20.77  ? 427  PHE A CB  1 
ATOM   3375 C  CG  . PHE A 1 428 ? 16.772  18.432 60.611  1.00 24.06  ? 427  PHE A CG  1 
ATOM   3376 C  CD1 . PHE A 1 428 ? 16.747  17.398 59.674  1.00 27.11  ? 427  PHE A CD1 1 
ATOM   3377 C  CD2 . PHE A 1 428 ? 17.815  19.355 60.549  1.00 24.52  ? 427  PHE A CD2 1 
ATOM   3378 C  CE1 . PHE A 1 428 ? 17.726  17.312 58.685  1.00 27.68  ? 427  PHE A CE1 1 
ATOM   3379 C  CE2 . PHE A 1 428 ? 18.801  19.284 59.565  1.00 28.65  ? 427  PHE A CE2 1 
ATOM   3380 C  CZ  . PHE A 1 428 ? 18.756  18.254 58.629  1.00 24.74  ? 427  PHE A CZ  1 
ATOM   3381 N  N   . LEU A 1 429 ? 17.417  17.848 64.291  1.00 22.50  ? 428  LEU A N   1 
ATOM   3382 C  CA  . LEU A 1 429 ? 18.686  17.827 64.979  1.00 24.10  ? 428  LEU A CA  1 
ATOM   3383 C  C   . LEU A 1 429 ? 19.053  16.391 65.339  1.00 22.01  ? 428  LEU A C   1 
ATOM   3384 O  O   . LEU A 1 429 ? 20.183  15.960 65.123  1.00 23.99  ? 428  LEU A O   1 
ATOM   3385 C  CB  . LEU A 1 429 ? 18.685  18.806 66.186  1.00 23.18  ? 428  LEU A CB  1 
ATOM   3386 C  CG  . LEU A 1 429 ? 19.949  18.790 67.054  1.00 26.21  ? 428  LEU A CG  1 
ATOM   3387 C  CD1 . LEU A 1 429 ? 21.120  19.538 66.421  1.00 25.09  ? 428  LEU A CD1 1 
ATOM   3388 C  CD2 . LEU A 1 429 ? 19.659  19.334 68.459  1.00 21.07  ? 428  LEU A CD2 1 
ATOM   3389 N  N   . TYR A 1 430 ? 18.087  15.650 65.866  1.00 16.35  ? 429  TYR A N   1 
ATOM   3390 C  CA  . TYR A 1 430 ? 18.278  14.259 66.241  1.00 15.82  ? 429  TYR A CA  1 
ATOM   3391 C  C   . TYR A 1 430 ? 18.482  13.390 65.019  1.00 20.80  ? 429  TYR A C   1 
ATOM   3392 O  O   . TYR A 1 430 ? 19.216  12.416 64.997  1.00 21.02  ? 429  TYR A O   1 
ATOM   3393 C  CB  . TYR A 1 430 ? 17.037  13.759 66.940  1.00 14.93  ? 429  TYR A CB  1 
ATOM   3394 C  CG  . TYR A 1 430 ? 17.232  13.841 68.426  1.00 19.52  ? 429  TYR A CG  1 
ATOM   3395 C  CD1 . TYR A 1 430 ? 16.999  15.039 69.104  1.00 18.07  ? 429  TYR A CD1 1 
ATOM   3396 C  CD2 . TYR A 1 430 ? 17.667  12.710 69.121  1.00 17.20  ? 429  TYR A CD2 1 
ATOM   3397 C  CE1 . TYR A 1 430 ? 17.183  15.108 70.484  1.00 14.78  ? 429  TYR A CE1 1 
ATOM   3398 C  CE2 . TYR A 1 430 ? 17.850  12.752 70.496  1.00 15.85  ? 429  TYR A CE2 1 
ATOM   3399 C  CZ  . TYR A 1 430 ? 17.615  13.961 71.157  1.00 26.56  ? 429  TYR A CZ  1 
ATOM   3400 O  OH  . TYR A 1 430 ? 17.807  14.009 72.508  1.00 23.93  ? 429  TYR A OH  1 
ATOM   3401 N  N   . SER A 1 431 ? 17.839  13.785 63.955  1.00 18.00  ? 430  SER A N   1 
ATOM   3402 C  CA  . SER A 1 431 ? 17.986  13.048 62.735  1.00 20.34  ? 430  SER A CA  1 
ATOM   3403 C  C   . SER A 1 431 ? 19.392  13.282 62.136  1.00 28.86  ? 430  SER A C   1 
ATOM   3404 O  O   . SER A 1 431 ? 20.133  12.347 61.797  1.00 25.84  ? 430  SER A O   1 
ATOM   3405 C  CB  . SER A 1 431 ? 16.843  13.486 61.845  1.00 19.64  ? 430  SER A CB  1 
ATOM   3406 O  OG  . SER A 1 431 ? 16.960  12.766 60.657  1.00 32.88  ? 430  SER A OG  1 
ATOM   3407 N  N   . TYR A 1 432 ? 19.792  14.556 62.021  1.00 23.08  ? 431  TYR A N   1 
ATOM   3408 C  CA  . TYR A 1 432 ? 21.104  14.862 61.497  1.00 23.26  ? 431  TYR A CA  1 
ATOM   3409 C  C   . TYR A 1 432 ? 22.209  14.166 62.288  1.00 31.19  ? 431  TYR A C   1 
ATOM   3410 O  O   . TYR A 1 432 ? 23.152  13.580 61.747  1.00 27.84  ? 431  TYR A O   1 
ATOM   3411 C  CB  . TYR A 1 432 ? 21.392  16.372 61.476  1.00 22.23  ? 431  TYR A CB  1 
ATOM   3412 C  CG  . TYR A 1 432 ? 22.660  16.758 60.741  1.00 23.21  ? 431  TYR A CG  1 
ATOM   3413 C  CD1 . TYR A 1 432 ? 22.665  16.994 59.365  1.00 26.21  ? 431  TYR A CD1 1 
ATOM   3414 C  CD2 . TYR A 1 432 ? 23.864  16.920 61.433  1.00 28.30  ? 431  TYR A CD2 1 
ATOM   3415 C  CE1 . TYR A 1 432 ? 23.836  17.354 58.692  1.00 33.33  ? 431  TYR A CE1 1 
ATOM   3416 C  CE2 . TYR A 1 432 ? 25.045  17.277 60.777  1.00 29.03  ? 431  TYR A CE2 1 
ATOM   3417 C  CZ  . TYR A 1 432 ? 25.032  17.498 59.401  1.00 33.73  ? 431  TYR A CZ  1 
ATOM   3418 O  OH  . TYR A 1 432 ? 26.201  17.881 58.802  1.00 30.59  ? 431  TYR A OH  1 
ATOM   3419 N  N   . PHE A 1 433 ? 22.078  14.272 63.608  1.00 23.42  ? 432  PHE A N   1 
ATOM   3420 C  CA  . PHE A 1 433 ? 23.039  13.735 64.556  1.00 22.14  ? 432  PHE A CA  1 
ATOM   3421 C  C   . PHE A 1 433 ? 22.659  12.334 65.001  1.00 27.48  ? 432  PHE A C   1 
ATOM   3422 O  O   . PHE A 1 433 ? 22.824  11.964 66.168  1.00 20.81  ? 432  PHE A O   1 
ATOM   3423 C  CB  . PHE A 1 433 ? 23.211  14.715 65.751  1.00 20.76  ? 432  PHE A CB  1 
ATOM   3424 C  CG  . PHE A 1 433 ? 24.035  15.918 65.348  1.00 21.62  ? 432  PHE A CG  1 
ATOM   3425 C  CD1 . PHE A 1 433 ? 25.364  15.674 65.025  1.00 25.75  ? 432  PHE A CD1 1 
ATOM   3426 C  CD2 . PHE A 1 433 ? 23.566  17.232 65.250  1.00 22.01  ? 432  PHE A CD2 1 
ATOM   3427 C  CE1 . PHE A 1 433 ? 26.202  16.708 64.619  1.00 26.06  ? 432  PHE A CE1 1 
ATOM   3428 C  CE2 . PHE A 1 433 ? 24.398  18.277 64.841  1.00 24.06  ? 432  PHE A CE2 1 
ATOM   3429 C  CZ  . PHE A 1 433 ? 25.732  18.014 64.539  1.00 22.97  ? 432  PHE A CZ  1 
ATOM   3430 N  N   . LYS A 1 434 ? 22.150  11.536 64.065  1.00 30.29  ? 433  LYS A N   1 
ATOM   3431 C  CA  . LYS A 1 434 ? 21.757  10.205 64.480  1.00 33.97  ? 433  LYS A CA  1 
ATOM   3432 C  C   . LYS A 1 434 ? 22.886  9.408  65.113  1.00 40.77  ? 433  LYS A C   1 
ATOM   3433 O  O   . LYS A 1 434 ? 22.690  8.545  65.964  1.00 45.44  ? 433  LYS A O   1 
ATOM   3434 C  CB  . LYS A 1 434 ? 21.017  9.429  63.418  1.00 41.36  ? 433  LYS A CB  1 
ATOM   3435 C  CG  . LYS A 1 434 ? 21.934  9.107  62.270  1.00 42.12  ? 433  LYS A CG  1 
ATOM   3436 C  CD  . LYS A 1 434 ? 21.340  9.569  60.951  1.00 85.11  ? 433  LYS A CD  1 
ATOM   3437 C  CE  . LYS A 1 434 ? 21.770  8.690  59.784  1.00 100.00 ? 433  LYS A CE  1 
ATOM   3438 N  NZ  . LYS A 1 434 ? 21.052  8.990  58.530  1.00 100.00 ? 433  LYS A NZ  1 
ATOM   3439 N  N   . ASP A 1 435 ? 24.091  9.729  64.700  1.00 38.33  ? 434  ASP A N   1 
ATOM   3440 C  CA  . ASP A 1 435 ? 25.295  9.086  65.188  1.00 40.98  ? 434  ASP A CA  1 
ATOM   3441 C  C   . ASP A 1 435 ? 25.640  9.549  66.594  1.00 42.43  ? 434  ASP A C   1 
ATOM   3442 O  O   . ASP A 1 435 ? 26.508  8.979  67.241  1.00 42.35  ? 434  ASP A O   1 
ATOM   3443 C  CB  . ASP A 1 435 ? 26.493  9.429  64.250  1.00 47.81  ? 434  ASP A CB  1 
ATOM   3444 C  CG  . ASP A 1 435 ? 26.762  10.919 64.034  1.00 73.28  ? 434  ASP A CG  1 
ATOM   3445 O  OD1 . ASP A 1 435 ? 25.948  11.739 63.601  1.00 69.11  ? 434  ASP A OD1 1 
ATOM   3446 O  OD2 . ASP A 1 435 ? 28.007  11.242 64.314  1.00 80.38  ? 434  ASP A OD2 1 
ATOM   3447 N  N   . LYS A 1 436 ? 24.987  10.601 67.068  1.00 33.72  ? 435  LYS A N   1 
ATOM   3448 C  CA  . LYS A 1 436 ? 25.312  11.120 68.374  1.00 30.49  ? 435  LYS A CA  1 
ATOM   3449 C  C   . LYS A 1 436 ? 24.122  11.247 69.306  1.00 32.57  ? 435  LYS A C   1 
ATOM   3450 O  O   . LYS A 1 436 ? 24.181  12.067 70.217  1.00 29.28  ? 435  LYS A O   1 
ATOM   3451 C  CB  . LYS A 1 436 ? 26.018  12.465 68.200  1.00 30.20  ? 435  LYS A CB  1 
ATOM   3452 C  CG  . LYS A 1 436 ? 27.396  12.351 67.568  1.00 19.40  ? 435  LYS A CG  1 
ATOM   3453 C  CD  . LYS A 1 436 ? 27.984  13.718 67.237  1.00 28.53  ? 435  LYS A CD  1 
ATOM   3454 C  CE  . LYS A 1 436 ? 29.504  13.723 67.224  1.00 36.05  ? 435  LYS A CE  1 
ATOM   3455 N  NZ  . LYS A 1 436 ? 30.078  14.696 66.281  1.00 38.07  ? 435  LYS A NZ  1 
ATOM   3456 N  N   . VAL A 1 437 ? 23.063  10.467 69.083  1.00 32.65  ? 436  VAL A N   1 
ATOM   3457 C  CA  . VAL A 1 437 ? 21.867  10.565 69.920  1.00 36.68  ? 436  VAL A CA  1 
ATOM   3458 C  C   . VAL A 1 437 ? 22.189  10.528 71.391  1.00 39.39  ? 436  VAL A C   1 
ATOM   3459 O  O   . VAL A 1 437 ? 21.544  11.154 72.236  1.00 34.16  ? 436  VAL A O   1 
ATOM   3460 C  CB  . VAL A 1 437 ? 20.768  9.553  69.613  1.00 44.95  ? 436  VAL A CB  1 
ATOM   3461 C  CG1 . VAL A 1 437 ? 20.016  9.971  68.355  1.00 45.77  ? 436  VAL A CG1 1 
ATOM   3462 C  CG2 . VAL A 1 437 ? 21.391  8.187  69.405  1.00 48.21  ? 436  VAL A CG2 1 
ATOM   3463 N  N   . ASP A 1 438 ? 23.205  9.740  71.670  1.00 40.66  ? 437  ASP A N   1 
ATOM   3464 C  CA  . ASP A 1 438 ? 23.663  9.569  73.019  1.00 39.64  ? 437  ASP A CA  1 
ATOM   3465 C  C   . ASP A 1 438 ? 24.119  10.875 73.622  1.00 35.59  ? 437  ASP A C   1 
ATOM   3466 O  O   . ASP A 1 438 ? 23.871  11.128 74.785  1.00 36.38  ? 437  ASP A O   1 
ATOM   3467 C  CB  . ASP A 1 438 ? 24.686  8.437  73.136  1.00 42.27  ? 437  ASP A CB  1 
ATOM   3468 C  CG  . ASP A 1 438 ? 23.976  7.123  73.303  1.00 64.05  ? 437  ASP A CG  1 
ATOM   3469 O  OD1 . ASP A 1 438 ? 22.749  7.018  73.361  1.00 57.77  ? 437  ASP A OD1 1 
ATOM   3470 O  OD2 . ASP A 1 438 ? 24.825  6.121  73.385  1.00 89.95  ? 437  ASP A OD2 1 
ATOM   3471 N  N   . VAL A 1 439 ? 24.778  11.697 72.826  1.00 33.10  ? 438  VAL A N   1 
ATOM   3472 C  CA  . VAL A 1 439 ? 25.235  12.988 73.309  1.00 31.59  ? 438  VAL A CA  1 
ATOM   3473 C  C   . VAL A 1 439 ? 24.012  13.879 73.521  1.00 28.65  ? 438  VAL A C   1 
ATOM   3474 O  O   . VAL A 1 439 ? 23.828  14.461 74.571  1.00 26.75  ? 438  VAL A O   1 
ATOM   3475 C  CB  . VAL A 1 439 ? 26.289  13.599 72.371  1.00 30.58  ? 438  VAL A CB  1 
ATOM   3476 C  CG1 . VAL A 1 439 ? 26.809  14.928 72.920  1.00 27.87  ? 438  VAL A CG1 1 
ATOM   3477 C  CG2 . VAL A 1 439 ? 27.441  12.608 72.226  1.00 29.01  ? 438  VAL A CG2 1 
ATOM   3478 N  N   . LEU A 1 440 ? 23.179  13.926 72.494  1.00 22.69  ? 439  LEU A N   1 
ATOM   3479 C  CA  . LEU A 1 440 ? 21.952  14.698 72.466  1.00 20.02  ? 439  LEU A CA  1 
ATOM   3480 C  C   . LEU A 1 440 ? 21.118  14.396 73.675  1.00 28.06  ? 439  LEU A C   1 
ATOM   3481 O  O   . LEU A 1 440 ? 20.547  15.279 74.289  1.00 31.30  ? 439  LEU A O   1 
ATOM   3482 C  CB  . LEU A 1 440 ? 21.125  14.403 71.201  1.00 17.24  ? 439  LEU A CB  1 
ATOM   3483 C  CG  . LEU A 1 440 ? 21.769  15.002 69.960  1.00 19.41  ? 439  LEU A CG  1 
ATOM   3484 C  CD1 . LEU A 1 440 ? 21.029  14.542 68.724  1.00 16.82  ? 439  LEU A CD1 1 
ATOM   3485 C  CD2 . LEU A 1 440 ? 21.748  16.528 70.034  1.00 23.96  ? 439  LEU A CD2 1 
ATOM   3486 N  N   . ASN A 1 441 ? 21.045  13.129 74.022  1.00 24.23  ? 440  ASN A N   1 
ATOM   3487 C  CA  . ASN A 1 441 ? 20.242  12.765 75.165  1.00 24.80  ? 440  ASN A CA  1 
ATOM   3488 C  C   . ASN A 1 441 ? 20.785  13.294 76.473  1.00 29.26  ? 440  ASN A C   1 
ATOM   3489 O  O   . ASN A 1 441 ? 20.128  13.233 77.507  1.00 31.02  ? 440  ASN A O   1 
ATOM   3490 C  CB  . ASN A 1 441 ? 19.842  11.275 75.237  1.00 28.06  ? 440  ASN A CB  1 
ATOM   3491 C  CG  . ASN A 1 441 ? 18.971  10.884 74.066  1.00 29.31  ? 440  ASN A CG  1 
ATOM   3492 O  OD1 . ASN A 1 441 ? 19.138  9.820  73.451  1.00 40.12  ? 440  ASN A OD1 1 
ATOM   3493 N  ND2 . ASN A 1 441 ? 18.058  11.773 73.721  1.00 28.40  ? 440  ASN A ND2 1 
ATOM   3494 N  N   . GLN A 1 442 ? 21.984  13.833 76.434  1.00 26.30  ? 441  GLN A N   1 
ATOM   3495 C  CA  . GLN A 1 442 ? 22.535  14.361 77.656  1.00 27.26  ? 441  GLN A CA  1 
ATOM   3496 C  C   . GLN A 1 442 ? 22.022  15.764 77.912  1.00 26.46  ? 441  GLN A C   1 
ATOM   3497 O  O   . GLN A 1 442 ? 22.203  16.336 78.988  1.00 25.27  ? 441  GLN A O   1 
ATOM   3498 C  CB  . GLN A 1 442 ? 24.073  14.404 77.609  1.00 32.14  ? 441  GLN A CB  1 
ATOM   3499 C  CG  . GLN A 1 442 ? 24.762  13.016 77.641  1.00 49.60  ? 441  GLN A CG  1 
ATOM   3500 C  CD  . GLN A 1 442 ? 26.057  13.019 76.850  1.00 66.63  ? 441  GLN A CD  1 
ATOM   3501 O  OE1 . GLN A 1 442 ? 26.546  11.975 76.382  1.00 76.27  ? 441  GLN A OE1 1 
ATOM   3502 N  NE2 . GLN A 1 442 ? 26.608  14.217 76.676  1.00 56.68  ? 441  GLN A NE2 1 
ATOM   3503 N  N   . VAL A 1 443 ? 21.388  16.345 76.909  1.00 21.59  ? 442  VAL A N   1 
ATOM   3504 C  CA  . VAL A 1 443 ? 20.922  17.688 77.159  1.00 18.91  ? 442  VAL A CA  1 
ATOM   3505 C  C   . VAL A 1 443 ? 19.615  17.729 77.897  1.00 19.52  ? 442  VAL A C   1 
ATOM   3506 O  O   . VAL A 1 443 ? 18.742  16.908 77.650  1.00 21.02  ? 442  VAL A O   1 
ATOM   3507 C  CB  . VAL A 1 443 ? 20.898  18.538 75.917  1.00 19.77  ? 442  VAL A CB  1 
ATOM   3508 C  CG1 . VAL A 1 443 ? 21.472  17.891 74.680  1.00 23.00  ? 442  VAL A CG1 1 
ATOM   3509 C  CG2 . VAL A 1 443 ? 19.787  19.580 75.787  1.00 13.26  ? 442  VAL A CG2 1 
ATOM   3510 N  N   . ASP A 1 444 ? 19.490  18.677 78.811  1.00 17.20  ? 443  ASP A N   1 
ATOM   3511 C  CA  . ASP A 1 444 ? 18.243  18.856 79.551  1.00 16.44  ? 443  ASP A CA  1 
ATOM   3512 C  C   . ASP A 1 444 ? 17.277  19.752 78.727  1.00 17.64  ? 443  ASP A C   1 
ATOM   3513 O  O   . ASP A 1 444 ? 17.091  20.980 78.921  1.00 15.06  ? 443  ASP A O   1 
ATOM   3514 C  CB  . ASP A 1 444 ? 18.611  19.494 80.901  1.00 17.40  ? 443  ASP A CB  1 
ATOM   3515 C  CG  . ASP A 1 444 ? 17.422  19.595 81.778  1.00 21.50  ? 443  ASP A CG  1 
ATOM   3516 O  OD1 . ASP A 1 444 ? 16.309  19.286 81.395  1.00 26.57  ? 443  ASP A OD1 1 
ATOM   3517 O  OD2 . ASP A 1 444 ? 17.731  20.068 82.959  1.00 23.49  ? 443  ASP A OD2 1 
ATOM   3518 N  N   . TRP A 1 445 ? 16.675  19.105 77.736  1.00 15.54  ? 444  TRP A N   1 
ATOM   3519 C  CA  . TRP A 1 445 ? 15.763  19.759 76.816  1.00 16.92  ? 444  TRP A CA  1 
ATOM   3520 C  C   . TRP A 1 445 ? 14.641  20.468 77.546  1.00 19.29  ? 444  TRP A C   1 
ATOM   3521 O  O   . TRP A 1 445 ? 14.292  21.572 77.194  1.00 18.00  ? 444  TRP A O   1 
ATOM   3522 C  CB  . TRP A 1 445 ? 15.195  18.747 75.793  1.00 13.71  ? 444  TRP A CB  1 
ATOM   3523 C  CG  . TRP A 1 445 ? 16.267  18.226 74.892  1.00 14.88  ? 444  TRP A CG  1 
ATOM   3524 C  CD1 . TRP A 1 445 ? 16.797  16.969 74.872  1.00 17.32  ? 444  TRP A CD1 1 
ATOM   3525 C  CD2 . TRP A 1 445 ? 16.952  18.958 73.861  1.00 16.34  ? 444  TRP A CD2 1 
ATOM   3526 N  NE1 . TRP A 1 445 ? 17.779  16.869 73.915  1.00 14.83  ? 444  TRP A NE1 1 
ATOM   3527 C  CE2 . TRP A 1 445 ? 17.880  18.063 73.255  1.00 16.96  ? 444  TRP A CE2 1 
ATOM   3528 C  CE3 . TRP A 1 445 ? 16.896  20.295 73.415  1.00 17.06  ? 444  TRP A CE3 1 
ATOM   3529 C  CZ2 . TRP A 1 445 ? 18.737  18.482 72.229  1.00 16.95  ? 444  TRP A CZ2 1 
ATOM   3530 C  CZ3 . TRP A 1 445 ? 17.750  20.697 72.382  1.00 16.35  ? 444  TRP A CZ3 1 
ATOM   3531 C  CH2 . TRP A 1 445 ? 18.664  19.807 71.806  1.00 16.47  ? 444  TRP A CH2 1 
ATOM   3532 N  N   . ASN A 1 446 ? 14.059  19.808 78.557  1.00 18.46  ? 445  ASN A N   1 
ATOM   3533 C  CA  . ASN A 1 446 ? 12.957  20.414 79.260  1.00 17.22  ? 445  ASN A CA  1 
ATOM   3534 C  C   . ASN A 1 446 ? 13.334  21.761 79.837  1.00 20.45  ? 445  ASN A C   1 
ATOM   3535 O  O   . ASN A 1 446 ? 12.581  22.732 79.740  1.00 17.51  ? 445  ASN A O   1 
ATOM   3536 C  CB  . ASN A 1 446 ? 12.347  19.512 80.357  1.00 15.11  ? 445  ASN A CB  1 
ATOM   3537 C  CG  . ASN A 1 446 ? 11.322  20.272 81.234  1.00 46.40  ? 445  ASN A CG  1 
ATOM   3538 O  OD1 . ASN A 1 446 ? 11.526  20.515 82.448  1.00 39.99  ? 445  ASN A OD1 1 
ATOM   3539 N  ND2 . ASN A 1 446 ? 10.198  20.671 80.643  1.00 26.34  ? 445  ASN A ND2 1 
ATOM   3540 N  N   . ALA A 1 447 ? 14.504  21.791 80.484  1.00 18.70  ? 446  ALA A N   1 
ATOM   3541 C  CA  . ALA A 1 447 ? 14.918  23.022 81.091  1.00 16.75  ? 446  ALA A CA  1 
ATOM   3542 C  C   . ALA A 1 447 ? 15.272  24.029 80.032  1.00 21.46  ? 446  ALA A C   1 
ATOM   3543 O  O   . ALA A 1 447 ? 14.765  25.172 80.030  1.00 20.55  ? 446  ALA A O   1 
ATOM   3544 C  CB  . ALA A 1 447 ? 16.049  22.774 82.055  1.00 19.42  ? 446  ALA A CB  1 
ATOM   3545 N  N   . TRP A 1 448 ? 16.116  23.605 79.097  1.00 16.36  ? 447  TRP A N   1 
ATOM   3546 C  CA  . TRP A 1 448 ? 16.476  24.563 78.054  1.00 14.85  ? 447  TRP A CA  1 
ATOM   3547 C  C   . TRP A 1 448 ? 15.277  25.163 77.279  1.00 18.68  ? 447  TRP A C   1 
ATOM   3548 O  O   . TRP A 1 448 ? 15.246  26.365 76.985  1.00 14.03  ? 447  TRP A O   1 
ATOM   3549 C  CB  . TRP A 1 448 ? 17.473  23.938 77.040  1.00 17.25  ? 447  TRP A CB  1 
ATOM   3550 C  CG  . TRP A 1 448 ? 18.952  23.982 77.391  1.00 19.35  ? 447  TRP A CG  1 
ATOM   3551 C  CD1 . TRP A 1 448 ? 19.697  22.957 77.930  1.00 22.25  ? 447  TRP A CD1 1 
ATOM   3552 C  CD2 . TRP A 1 448 ? 19.864  25.090 77.224  1.00 16.70  ? 447  TRP A CD2 1 
ATOM   3553 N  NE1 . TRP A 1 448 ? 21.007  23.356 78.105  1.00 19.46  ? 447  TRP A NE1 1 
ATOM   3554 C  CE2 . TRP A 1 448 ? 21.131  24.662 77.679  1.00 18.42  ? 447  TRP A CE2 1 
ATOM   3555 C  CE3 . TRP A 1 448 ? 19.737  26.403 76.766  1.00 16.34  ? 447  TRP A CE3 1 
ATOM   3556 C  CZ2 . TRP A 1 448 ? 22.241  25.512 77.625  1.00 16.76  ? 447  TRP A CZ2 1 
ATOM   3557 C  CZ3 . TRP A 1 448 ? 20.854  27.230 76.705  1.00 14.87  ? 447  TRP A CZ3 1 
ATOM   3558 C  CH2 . TRP A 1 448 ? 22.090  26.786 77.141  1.00 14.22  ? 447  TRP A CH2 1 
ATOM   3559 N  N   . LEU A 1 449 ? 14.275  24.336 76.899  1.00 14.96  ? 448  LEU A N   1 
ATOM   3560 C  CA  . LEU A 1 449 ? 13.146  24.835 76.096  1.00 16.27  ? 448  LEU A CA  1 
ATOM   3561 C  C   . LEU A 1 449 ? 11.995  25.464 76.877  1.00 17.91  ? 448  LEU A C   1 
ATOM   3562 O  O   . LEU A 1 449 ? 11.332  26.404 76.398  1.00 13.49  ? 448  LEU A O   1 
ATOM   3563 C  CB  . LEU A 1 449 ? 12.522  23.690 75.238  1.00 16.42  ? 448  LEU A CB  1 
ATOM   3564 C  CG  . LEU A 1 449 ? 13.500  22.945 74.302  1.00 16.43  ? 448  LEU A CG  1 
ATOM   3565 C  CD1 . LEU A 1 449 ? 12.845  21.795 73.536  1.00 15.65  ? 448  LEU A CD1 1 
ATOM   3566 C  CD2 . LEU A 1 449 ? 14.163  23.901 73.315  1.00 12.87  ? 448  LEU A CD2 1 
ATOM   3567 N  N   . TYR A 1 450 ? 11.733  24.874 78.048  1.00 15.32  ? 449  TYR A N   1 
ATOM   3568 C  CA  . TYR A 1 450 ? 10.557  25.255 78.826  1.00 15.36  ? 449  TYR A CA  1 
ATOM   3569 C  C   . TYR A 1 450 ? 10.763  25.822 80.198  1.00 19.93  ? 449  TYR A C   1 
ATOM   3570 O  O   . TYR A 1 450 ? 9.763   26.226 80.806  1.00 21.29  ? 449  TYR A O   1 
ATOM   3571 C  CB  . TYR A 1 450 ? 9.611   24.031 78.983  1.00 14.65  ? 449  TYR A CB  1 
ATOM   3572 C  CG  . TYR A 1 450 ? 9.473   23.315 77.667  1.00 17.69  ? 449  TYR A CG  1 
ATOM   3573 C  CD1 . TYR A 1 450 ? 9.117   24.048 76.533  1.00 22.12  ? 449  TYR A CD1 1 
ATOM   3574 C  CD2 . TYR A 1 450 ? 9.771   21.958 77.541  1.00 19.27  ? 449  TYR A CD2 1 
ATOM   3575 C  CE1 . TYR A 1 450 ? 9.010   23.432 75.286  1.00 21.15  ? 449  TYR A CE1 1 
ATOM   3576 C  CE2 . TYR A 1 450 ? 9.669   21.318 76.301  1.00 18.29  ? 449  TYR A CE2 1 
ATOM   3577 C  CZ  . TYR A 1 450 ? 9.301   22.070 75.183  1.00 25.71  ? 449  TYR A CZ  1 
ATOM   3578 O  OH  . TYR A 1 450 ? 9.216   21.480 73.951  1.00 26.15  ? 449  TYR A OH  1 
ATOM   3579 N  N   . SER A 1 451 ? 11.985  25.806 80.724  1.00 15.79  ? 450  SER A N   1 
ATOM   3580 C  CA  . SER A 1 451 ? 12.156  26.362 82.061  1.00 14.12  ? 450  SER A CA  1 
ATOM   3581 C  C   . SER A 1 451 ? 12.474  27.864 82.025  1.00 16.42  ? 450  SER A C   1 
ATOM   3582 O  O   . SER A 1 451 ? 13.127  28.340 81.109  1.00 15.32  ? 450  SER A O   1 
ATOM   3583 C  CB  . SER A 1 451 ? 13.136  25.567 82.938  1.00 20.04  ? 450  SER A CB  1 
ATOM   3584 O  OG  . SER A 1 451 ? 12.687  24.254 83.189  1.00 16.61  ? 450  SER A OG  1 
ATOM   3585 N  N   . PRO A 1 452 ? 11.995  28.645 83.014  1.00 14.16  ? 451  PRO A N   1 
ATOM   3586 C  CA  . PRO A 1 452 ? 12.287  30.052 83.032  1.00 12.96  ? 451  PRO A CA  1 
ATOM   3587 C  C   . PRO A 1 452 ? 13.696  30.228 83.581  1.00 15.11  ? 451  PRO A C   1 
ATOM   3588 O  O   . PRO A 1 452 ? 14.347  29.259 83.997  1.00 15.64  ? 451  PRO A O   1 
ATOM   3589 C  CB  . PRO A 1 452 ? 11.274  30.669 84.029  1.00 11.76  ? 451  PRO A CB  1 
ATOM   3590 C  CG  . PRO A 1 452 ? 10.903  29.560 84.988  1.00 16.01  ? 451  PRO A CG  1 
ATOM   3591 C  CD  . PRO A 1 452 ? 11.298  28.259 84.288  1.00 15.25  ? 451  PRO A CD  1 
ATOM   3592 N  N   . GLY A 1 453 ? 14.148  31.481 83.586  1.00 12.85  ? 452  GLY A N   1 
ATOM   3593 C  CA  . GLY A 1 453 ? 15.430  31.822 84.160  1.00 12.46  ? 452  GLY A CA  1 
ATOM   3594 C  C   . GLY A 1 453 ? 16.652  31.517 83.311  1.00 17.53  ? 452  GLY A C   1 
ATOM   3595 O  O   . GLY A 1 453 ? 16.559  31.320 82.117  1.00 14.38  ? 452  GLY A O   1 
ATOM   3596 N  N   . LEU A 1 454 ? 17.839  31.539 83.926  1.00 17.18  ? 453  LEU A N   1 
ATOM   3597 C  CA  . LEU A 1 454 ? 19.054  31.268 83.196  1.00 14.53  ? 453  LEU A CA  1 
ATOM   3598 C  C   . LEU A 1 454 ? 19.087  29.819 82.762  1.00 14.71  ? 453  LEU A C   1 
ATOM   3599 O  O   . LEU A 1 454 ? 18.523  28.978 83.456  1.00 16.06  ? 453  LEU A O   1 
ATOM   3600 C  CB  . LEU A 1 454 ? 20.296  31.588 84.031  1.00 14.09  ? 453  LEU A CB  1 
ATOM   3601 C  CG  . LEU A 1 454 ? 20.526  33.091 84.216  1.00 18.81  ? 453  LEU A CG  1 
ATOM   3602 C  CD1 . LEU A 1 454 ? 21.635  33.253 85.247  1.00 16.98  ? 453  LEU A CD1 1 
ATOM   3603 C  CD2 . LEU A 1 454 ? 21.001  33.761 82.919  1.00 21.45  ? 453  LEU A CD2 1 
ATOM   3604 N  N   . PRO A 1 455 ? 19.770  29.537 81.637  1.00 15.62  ? 454  PRO A N   1 
ATOM   3605 C  CA  . PRO A 1 455 ? 19.907  28.194 81.119  1.00 15.68  ? 454  PRO A CA  1 
ATOM   3606 C  C   . PRO A 1 455 ? 20.486  27.258 82.170  1.00 21.35  ? 454  PRO A C   1 
ATOM   3607 O  O   . PRO A 1 455 ? 21.236  27.662 83.039  1.00 21.73  ? 454  PRO A O   1 
ATOM   3608 C  CB  . PRO A 1 455 ? 20.918  28.317 79.965  1.00 16.56  ? 454  PRO A CB  1 
ATOM   3609 C  CG  . PRO A 1 455 ? 20.906  29.751 79.501  1.00 16.74  ? 454  PRO A CG  1 
ATOM   3610 C  CD  . PRO A 1 455 ? 20.290  30.524 80.640  1.00 15.71  ? 454  PRO A CD  1 
ATOM   3611 N  N   . PRO A 1 456 ? 20.146  25.978 82.079  1.00 16.53  ? 455  PRO A N   1 
ATOM   3612 C  CA  . PRO A 1 456 ? 20.619  24.976 83.005  1.00 16.33  ? 455  PRO A CA  1 
ATOM   3613 C  C   . PRO A 1 456 ? 22.146  24.834 83.016  1.00 25.51  ? 455  PRO A C   1 
ATOM   3614 O  O   . PRO A 1 456 ? 22.718  24.370 83.999  1.00 24.17  ? 455  PRO A O   1 
ATOM   3615 C  CB  . PRO A 1 456 ? 19.999  23.666 82.520  1.00 17.40  ? 455  PRO A CB  1 
ATOM   3616 C  CG  . PRO A 1 456 ? 19.523  23.888 81.094  1.00 21.81  ? 455  PRO A CG  1 
ATOM   3617 C  CD  . PRO A 1 456 ? 19.403  25.389 80.932  1.00 19.90  ? 455  PRO A CD  1 
ATOM   3618 N  N   . ILE A 1 457 ? 22.816  25.205 81.916  1.00 20.88  ? 456  ILE A N   1 
ATOM   3619 C  CA  . ILE A 1 457 ? 24.262  25.117 81.810  1.00 17.40  ? 456  ILE A CA  1 
ATOM   3620 C  C   . ILE A 1 457 ? 24.822  26.292 81.000  1.00 19.27  ? 456  ILE A C   1 
ATOM   3621 O  O   . ILE A 1 457 ? 24.191  26.798 80.064  1.00 17.96  ? 456  ILE A O   1 
ATOM   3622 C  CB  . ILE A 1 457 ? 24.675  23.737 81.316  1.00 23.45  ? 456  ILE A CB  1 
ATOM   3623 C  CG1 . ILE A 1 457 ? 26.173  23.543 81.456  1.00 27.66  ? 456  ILE A CG1 1 
ATOM   3624 C  CG2 . ILE A 1 457 ? 24.285  23.529 79.865  1.00 26.37  ? 456  ILE A CG2 1 
ATOM   3625 C  CD1 . ILE A 1 457 ? 26.571  22.167 80.951  1.00 35.97  ? 456  ILE A CD1 1 
ATOM   3626 N  N   . LYS A 1 458 ? 26.011  26.772 81.383  1.00 15.81  ? 457  LYS A N   1 
ATOM   3627 C  CA  . LYS A 1 458 ? 26.649  27.883 80.697  1.00 17.12  ? 457  LYS A CA  1 
ATOM   3628 C  C   . LYS A 1 458 ? 27.727  27.333 79.815  1.00 18.91  ? 457  LYS A C   1 
ATOM   3629 O  O   . LYS A 1 458 ? 28.541  26.562 80.281  1.00 17.84  ? 457  LYS A O   1 
ATOM   3630 C  CB  . LYS A 1 458 ? 27.308  28.793 81.727  1.00 16.24  ? 457  LYS A CB  1 
ATOM   3631 C  CG  . LYS A 1 458 ? 27.896  30.067 81.130  1.00 16.93  ? 457  LYS A CG  1 
ATOM   3632 C  CD  . LYS A 1 458 ? 28.245  31.062 82.227  1.00 10.77  ? 457  LYS A CD  1 
ATOM   3633 C  CE  . LYS A 1 458 ? 28.785  32.347 81.659  1.00 11.49  ? 457  LYS A CE  1 
ATOM   3634 N  NZ  . LYS A 1 458 ? 29.467  33.164 82.683  1.00 18.20  ? 457  LYS A NZ  1 
ATOM   3635 N  N   . PRO A 1 459 ? 27.733  27.708 78.558  1.00 15.31  ? 458  PRO A N   1 
ATOM   3636 C  CA  . PRO A 1 459 ? 28.780  27.205 77.655  1.00 13.94  ? 458  PRO A CA  1 
ATOM   3637 C  C   . PRO A 1 459 ? 30.169  27.681 78.096  1.00 16.97  ? 458  PRO A C   1 
ATOM   3638 O  O   . PRO A 1 459 ? 30.341  28.456 79.036  1.00 14.39  ? 458  PRO A O   1 
ATOM   3639 C  CB  . PRO A 1 459 ? 28.465  27.835 76.274  1.00 13.66  ? 458  PRO A CB  1 
ATOM   3640 C  CG  . PRO A 1 459 ? 27.036  28.364 76.363  1.00 14.88  ? 458  PRO A CG  1 
ATOM   3641 C  CD  . PRO A 1 459 ? 26.702  28.535 77.855  1.00 10.08  ? 458  PRO A CD  1 
ATOM   3642 N  N   . ASN A 1 460 ? 31.199  27.223 77.408  1.00 17.07  ? 459  ASN A N   1 
ATOM   3643 C  CA  . ASN A 1 460 ? 32.546  27.672 77.722  1.00 15.61  ? 459  ASN A CA  1 
ATOM   3644 C  C   . ASN A 1 460 ? 32.924  28.839 76.793  1.00 22.19  ? 459  ASN A C   1 
ATOM   3645 O  O   . ASN A 1 460 ? 32.647  28.812 75.578  1.00 20.83  ? 459  ASN A O   1 
ATOM   3646 C  CB  . ASN A 1 460 ? 33.580  26.559 77.455  1.00 19.60  ? 459  ASN A CB  1 
ATOM   3647 C  CG  . ASN A 1 460 ? 33.158  25.288 78.136  1.00 26.10  ? 459  ASN A CG  1 
ATOM   3648 O  OD1 . ASN A 1 460 ? 32.952  25.278 79.347  1.00 25.15  ? 459  ASN A OD1 1 
ATOM   3649 N  ND2 . ASN A 1 460 ? 32.972  24.236 77.361  1.00 24.39  ? 459  ASN A ND2 1 
ATOM   3650 N  N   . TYR A 1 461 ? 33.620  29.849 77.341  1.00 13.51  ? 460  TYR A N   1 
ATOM   3651 C  CA  . TYR A 1 461 ? 34.021  30.994 76.536  1.00 14.52  ? 460  TYR A CA  1 
ATOM   3652 C  C   . TYR A 1 461 ? 35.485  31.370 76.683  1.00 16.97  ? 460  TYR A C   1 
ATOM   3653 O  O   . TYR A 1 461 ? 36.003  31.442 77.802  1.00 13.34  ? 460  TYR A O   1 
ATOM   3654 C  CB  . TYR A 1 461 ? 33.266  32.254 76.990  1.00 12.53  ? 460  TYR A CB  1 
ATOM   3655 C  CG  . TYR A 1 461 ? 31.764  32.129 76.980  1.00 13.07  ? 460  TYR A CG  1 
ATOM   3656 C  CD1 . TYR A 1 461 ? 31.070  31.553 78.046  1.00 17.79  ? 460  TYR A CD1 1 
ATOM   3657 C  CD2 . TYR A 1 461 ? 31.043  32.584 75.880  1.00 12.08  ? 460  TYR A CD2 1 
ATOM   3658 C  CE1 . TYR A 1 461 ? 29.677  31.450 78.049  1.00 16.54  ? 460  TYR A CE1 1 
ATOM   3659 C  CE2 . TYR A 1 461 ? 29.654  32.477 75.861  1.00 11.82  ? 460  TYR A CE2 1 
ATOM   3660 C  CZ  . TYR A 1 461 ? 28.971  31.911 76.938  1.00 16.71  ? 460  TYR A CZ  1 
ATOM   3661 O  OH  . TYR A 1 461 ? 27.589  31.834 76.894  1.00 15.52  ? 460  TYR A OH  1 
ATOM   3662 N  N   . ASP A 1 462 ? 36.098  31.706 75.558  1.00 13.99  ? 461  ASP A N   1 
ATOM   3663 C  CA  . ASP A 1 462 ? 37.463  32.218 75.579  1.00 13.74  ? 461  ASP A CA  1 
ATOM   3664 C  C   . ASP A 1 462 ? 37.414  33.608 76.255  1.00 16.51  ? 461  ASP A C   1 
ATOM   3665 O  O   . ASP A 1 462 ? 36.516  34.415 75.966  1.00 15.04  ? 461  ASP A O   1 
ATOM   3666 C  CB  . ASP A 1 462 ? 37.968  32.336 74.133  1.00 12.98  ? 461  ASP A CB  1 
ATOM   3667 C  CG  . ASP A 1 462 ? 39.393  32.801 74.148  1.00 25.31  ? 461  ASP A CG  1 
ATOM   3668 O  OD1 . ASP A 1 462 ? 40.335  32.064 74.314  1.00 40.40  ? 461  ASP A OD1 1 
ATOM   3669 O  OD2 . ASP A 1 462 ? 39.520  34.087 74.051  1.00 19.41  ? 461  ASP A OD2 1 
ATOM   3670 N  N   . MET A 1 463 ? 38.339  33.887 77.191  1.00 12.14  ? 462  MET A N   1 
ATOM   3671 C  CA  . MET A 1 463 ? 38.359  35.144 77.928  1.00 9.92   ? 462  MET A CA  1 
ATOM   3672 C  C   . MET A 1 463 ? 39.312  36.203 77.406  1.00 15.43  ? 462  MET A C   1 
ATOM   3673 O  O   . MET A 1 463 ? 39.413  37.265 77.958  1.00 15.61  ? 462  MET A O   1 
ATOM   3674 C  CB  . MET A 1 463 ? 38.688  34.910 79.404  1.00 9.27   ? 462  MET A CB  1 
ATOM   3675 C  CG  . MET A 1 463 ? 37.716  33.909 79.977  1.00 13.43  ? 462  MET A CG  1 
ATOM   3676 S  SD  . MET A 1 463 ? 36.053  34.635 80.074  1.00 19.12  ? 462  MET A SD  1 
ATOM   3677 C  CE  . MET A 1 463 ? 36.505  35.919 81.264  1.00 17.88  ? 462  MET A CE  1 
ATOM   3678 N  N   . THR A 1 464 ? 40.037  35.922 76.347  1.00 13.87  ? 463  THR A N   1 
ATOM   3679 C  CA  . THR A 1 464 ? 41.004  36.860 75.849  1.00 12.21  ? 463  THR A CA  1 
ATOM   3680 C  C   . THR A 1 464 ? 40.675  38.339 75.910  1.00 16.34  ? 463  THR A C   1 
ATOM   3681 O  O   . THR A 1 464 ? 41.365  39.106 76.567  1.00 16.05  ? 463  THR A O   1 
ATOM   3682 C  CB  . THR A 1 464 ? 41.595  36.434 74.489  1.00 17.83  ? 463  THR A CB  1 
ATOM   3683 O  OG1 . THR A 1 464 ? 41.940  35.051 74.538  1.00 14.22  ? 463  THR A OG1 1 
ATOM   3684 C  CG2 . THR A 1 464 ? 42.841  37.298 74.204  1.00 15.70  ? 463  THR A CG2 1 
ATOM   3685 N  N   . LEU A 1 465 ? 39.679  38.762 75.136  1.00 14.21  ? 464  LEU A N   1 
ATOM   3686 C  CA  . LEU A 1 465 ? 39.262  40.154 75.060  1.00 13.52  ? 464  LEU A CA  1 
ATOM   3687 C  C   . LEU A 1 465 ? 38.408  40.679 76.228  1.00 12.70  ? 464  LEU A C   1 
ATOM   3688 O  O   . LEU A 1 465 ? 38.259  41.881 76.442  1.00 15.39  ? 464  LEU A O   1 
ATOM   3689 C  CB  . LEU A 1 465 ? 38.508  40.348 73.725  1.00 13.87  ? 464  LEU A CB  1 
ATOM   3690 C  CG  . LEU A 1 465 ? 39.363  40.009 72.495  1.00 18.04  ? 464  LEU A CG  1 
ATOM   3691 C  CD1 . LEU A 1 465 ? 38.448  40.076 71.260  1.00 14.36  ? 464  LEU A CD1 1 
ATOM   3692 C  CD2 . LEU A 1 465 ? 40.490  41.054 72.345  1.00 17.86  ? 464  LEU A CD2 1 
ATOM   3693 N  N   . THR A 1 466 ? 37.808  39.770 76.979  1.00 11.81  ? 465  THR A N   1 
ATOM   3694 C  CA  . THR A 1 466 ? 36.946  40.116 78.103  1.00 10.62  ? 465  THR A CA  1 
ATOM   3695 C  C   . THR A 1 466 ? 37.728  40.487 79.360  1.00 17.70  ? 465  THR A C   1 
ATOM   3696 O  O   . THR A 1 466 ? 37.361  41.359 80.131  1.00 15.35  ? 465  THR A O   1 
ATOM   3697 C  CB  . THR A 1 466 ? 35.996  38.934 78.368  1.00 12.56  ? 465  THR A CB  1 
ATOM   3698 O  OG1 . THR A 1 466 ? 35.209  38.765 77.199  1.00 16.68  ? 465  THR A OG1 1 
ATOM   3699 C  CG2 . THR A 1 466 ? 35.075  39.241 79.545  1.00 17.17  ? 465  THR A CG2 1 
ATOM   3700 N  N   . ASN A 1 467 ? 38.828  39.785 79.584  1.00 14.17  ? 466  ASN A N   1 
ATOM   3701 C  CA  . ASN A 1 467 ? 39.639  40.017 80.738  1.00 14.86  ? 466  ASN A CA  1 
ATOM   3702 C  C   . ASN A 1 467 ? 39.933  41.491 81.017  1.00 16.02  ? 466  ASN A C   1 
ATOM   3703 O  O   . ASN A 1 467 ? 39.843  41.892 82.177  1.00 17.05  ? 466  ASN A O   1 
ATOM   3704 C  CB  . ASN A 1 467 ? 40.942  39.197 80.694  1.00 14.48  ? 466  ASN A CB  1 
ATOM   3705 C  CG  . ASN A 1 467 ? 40.787  37.705 80.932  1.00 22.10  ? 466  ASN A CG  1 
ATOM   3706 O  OD1 . ASN A 1 467 ? 41.539  36.878 80.386  1.00 21.72  ? 466  ASN A OD1 1 
ATOM   3707 N  ND2 . ASN A 1 467 ? 39.925  37.356 81.852  1.00 11.12  ? 466  ASN A ND2 1 
ATOM   3708 N  N   . ALA A 1 468 ? 40.313  42.307 80.012  1.00 16.17  ? 467  ALA A N   1 
ATOM   3709 C  CA  . ALA A 1 468 ? 40.614  43.704 80.336  1.00 16.10  ? 467  ALA A CA  1 
ATOM   3710 C  C   . ALA A 1 468 ? 39.394  44.448 80.871  1.00 20.19  ? 467  ALA A C   1 
ATOM   3711 O  O   . ALA A 1 468 ? 39.488  45.363 81.722  1.00 17.63  ? 467  ALA A O   1 
ATOM   3712 C  CB  . ALA A 1 468 ? 41.159  44.411 79.118  1.00 14.71  ? 467  ALA A CB  1 
ATOM   3713 N  N   . CYS A 1 469 ? 38.227  44.022 80.343  1.00 15.87  ? 468  CYS A N   1 
ATOM   3714 C  CA  . CYS A 1 469 ? 36.938  44.608 80.712  1.00 13.86  ? 468  CYS A CA  1 
ATOM   3715 C  C   . CYS A 1 469 ? 36.609  44.369 82.167  1.00 15.16  ? 468  CYS A C   1 
ATOM   3716 O  O   . CYS A 1 469 ? 36.229  45.234 82.931  1.00 17.79  ? 468  CYS A O   1 
ATOM   3717 C  CB  . CYS A 1 469 ? 35.820  44.045 79.808  1.00 11.73  ? 468  CYS A CB  1 
ATOM   3718 S  SG  . CYS A 1 469 ? 36.215  44.458 78.102  1.00 15.87  ? 468  CYS A SG  1 
ATOM   3719 N  N   . ILE A 1 470 ? 36.811  43.145 82.571  1.00 13.83  ? 469  ILE A N   1 
ATOM   3720 C  CA  . ILE A 1 470 ? 36.531  42.747 83.941  1.00 11.80  ? 469  ILE A CA  1 
ATOM   3721 C  C   . ILE A 1 470 ? 37.488  43.393 84.910  1.00 16.06  ? 469  ILE A C   1 
ATOM   3722 O  O   . ILE A 1 470 ? 37.076  43.848 85.970  1.00 18.22  ? 469  ILE A O   1 
ATOM   3723 C  CB  . ILE A 1 470 ? 36.659  41.230 84.042  1.00 15.30  ? 469  ILE A CB  1 
ATOM   3724 C  CG1 . ILE A 1 470 ? 35.527  40.557 83.263  1.00 19.73  ? 469  ILE A CG1 1 
ATOM   3725 C  CG2 . ILE A 1 470 ? 36.688  40.791 85.497  1.00 11.46  ? 469  ILE A CG2 1 
ATOM   3726 C  CD1 . ILE A 1 470 ? 35.788  39.073 82.977  1.00 25.13  ? 469  ILE A CD1 1 
ATOM   3727 N  N   . ALA A 1 471 ? 38.776  43.375 84.572  1.00 12.77  ? 470  ALA A N   1 
ATOM   3728 C  CA  . ALA A 1 471 ? 39.729  43.967 85.475  1.00 11.93  ? 470  ALA A CA  1 
ATOM   3729 C  C   . ALA A 1 471 ? 39.304  45.404 85.786  1.00 14.05  ? 470  ALA A C   1 
ATOM   3730 O  O   . ALA A 1 471 ? 39.264  45.860 86.941  1.00 15.14  ? 470  ALA A O   1 
ATOM   3731 C  CB  . ALA A 1 471 ? 41.078  43.982 84.759  1.00 12.54  ? 470  ALA A CB  1 
ATOM   3732 N  N   . LEU A 1 472 ? 38.979  46.120 84.708  1.00 15.25  ? 471  LEU A N   1 
ATOM   3733 C  CA  . LEU A 1 472 ? 38.585  47.538 84.796  1.00 13.62  ? 471  LEU A CA  1 
ATOM   3734 C  C   . LEU A 1 472 ? 37.257  47.792 85.510  1.00 17.64  ? 471  LEU A C   1 
ATOM   3735 O  O   . LEU A 1 472 ? 37.144  48.630 86.411  1.00 13.08  ? 471  LEU A O   1 
ATOM   3736 C  CB  . LEU A 1 472 ? 38.685  48.274 83.442  1.00 11.79  ? 471  LEU A CB  1 
ATOM   3737 C  CG  . LEU A 1 472 ? 38.684  49.803 83.614  1.00 15.97  ? 471  LEU A CG  1 
ATOM   3738 C  CD1 . LEU A 1 472 ? 39.855  50.262 84.497  1.00 12.47  ? 471  LEU A CD1 1 
ATOM   3739 C  CD2 . LEU A 1 472 ? 38.753  50.493 82.248  1.00 17.27  ? 471  LEU A CD2 1 
ATOM   3740 N  N   . SER A 1 473 ? 36.220  47.049 85.137  1.00 14.37  ? 472  SER A N   1 
ATOM   3741 C  CA  . SER A 1 473 ? 34.963  47.264 85.808  1.00 11.84  ? 472  SER A CA  1 
ATOM   3742 C  C   . SER A 1 473 ? 35.082  46.900 87.284  1.00 18.13  ? 472  SER A C   1 
ATOM   3743 O  O   . SER A 1 473 ? 34.533  47.581 88.145  1.00 16.29  ? 472  SER A O   1 
ATOM   3744 C  CB  . SER A 1 473 ? 33.822  46.488 85.153  1.00 12.21  ? 472  SER A CB  1 
ATOM   3745 O  OG  . SER A 1 473 ? 34.090  45.121 85.240  1.00 18.74  ? 472  SER A OG  1 
ATOM   3746 N  N   . GLN A 1 474 ? 35.761  45.804 87.615  1.00 12.67  ? 473  GLN A N   1 
ATOM   3747 C  CA  . GLN A 1 474 ? 35.886  45.455 89.028  1.00 10.49  ? 473  GLN A CA  1 
ATOM   3748 C  C   . GLN A 1 474 ? 36.615  46.538 89.813  1.00 12.50  ? 473  GLN A C   1 
ATOM   3749 O  O   . GLN A 1 474 ? 36.278  46.879 90.950  1.00 12.44  ? 473  GLN A O   1 
ATOM   3750 C  CB  . GLN A 1 474 ? 36.649  44.137 89.180  1.00 13.06  ? 473  GLN A CB  1 
ATOM   3751 C  CG  . GLN A 1 474 ? 35.730  42.908 89.040  1.00 20.04  ? 473  GLN A CG  1 
ATOM   3752 C  CD  . GLN A 1 474 ? 34.634  42.874 90.108  1.00 19.81  ? 473  GLN A CD  1 
ATOM   3753 O  OE1 . GLN A 1 474 ? 34.917  42.605 91.270  1.00 30.46  ? 473  GLN A OE1 1 
ATOM   3754 N  NE2 . GLN A 1 474 ? 33.387  43.130 89.742  1.00 21.25  ? 473  GLN A NE2 1 
ATOM   3755 N  N   . ARG A 1 475 ? 37.656  47.087 89.183  1.00 14.11  ? 474  ARG A N   1 
ATOM   3756 C  CA  . ARG A 1 475 ? 38.400  48.158 89.868  1.00 17.39  ? 474  ARG A CA  1 
ATOM   3757 C  C   . ARG A 1 475 ? 37.478  49.325 90.235  1.00 21.36  ? 474  ARG A C   1 
ATOM   3758 O  O   . ARG A 1 475 ? 37.577  49.922 91.304  1.00 18.76  ? 474  ARG A O   1 
ATOM   3759 C  CB  . ARG A 1 475 ? 39.532  48.719 89.034  1.00 11.27  ? 474  ARG A CB  1 
ATOM   3760 C  CG  . ARG A 1 475 ? 40.786  47.842 89.038  1.00 17.88  ? 474  ARG A CG  1 
ATOM   3761 C  CD  . ARG A 1 475 ? 41.727  48.283 87.928  1.00 21.70  ? 474  ARG A CD  1 
ATOM   3762 N  NE  . ARG A 1 475 ? 42.122  49.665 88.177  1.00 19.49  ? 474  ARG A NE  1 
ATOM   3763 C  CZ  . ARG A 1 475 ? 42.837  50.419 87.361  1.00 31.34  ? 474  ARG A CZ  1 
ATOM   3764 N  NH1 . ARG A 1 475 ? 43.239  49.918 86.190  1.00 25.99  ? 474  ARG A NH1 1 
ATOM   3765 N  NH2 . ARG A 1 475 ? 43.160  51.679 87.742  1.00 17.92  ? 474  ARG A NH2 1 
ATOM   3766 N  N   . TRP A 1 476 ? 36.602  49.686 89.306  1.00 14.64  ? 475  TRP A N   1 
ATOM   3767 C  CA  . TRP A 1 476 ? 35.683  50.774 89.542  1.00 13.85  ? 475  TRP A CA  1 
ATOM   3768 C  C   . TRP A 1 476 ? 34.608  50.352 90.524  1.00 18.33  ? 475  TRP A C   1 
ATOM   3769 O  O   . TRP A 1 476 ? 34.250  51.076 91.430  1.00 15.30  ? 475  TRP A O   1 
ATOM   3770 C  CB  . TRP A 1 476 ? 35.033  51.236 88.235  1.00 13.65  ? 475  TRP A CB  1 
ATOM   3771 C  CG  . TRP A 1 476 ? 35.867  52.222 87.479  1.00 14.81  ? 475  TRP A CG  1 
ATOM   3772 C  CD1 . TRP A 1 476 ? 36.645  51.943 86.399  1.00 17.78  ? 475  TRP A CD1 1 
ATOM   3773 C  CD2 . TRP A 1 476 ? 36.007  53.640 87.742  1.00 14.88  ? 475  TRP A CD2 1 
ATOM   3774 N  NE1 . TRP A 1 476 ? 37.284  53.090 85.976  1.00 18.25  ? 475  TRP A NE1 1 
ATOM   3775 C  CE2 . TRP A 1 476 ? 36.885  54.152 86.756  1.00 20.66  ? 475  TRP A CE2 1 
ATOM   3776 C  CE3 . TRP A 1 476 ? 35.464  54.518 88.694  1.00 15.98  ? 475  TRP A CE3 1 
ATOM   3777 C  CZ2 . TRP A 1 476 ? 37.243  55.511 86.714  1.00 19.78  ? 475  TRP A CZ2 1 
ATOM   3778 C  CZ3 . TRP A 1 476 ? 35.839  55.853 88.665  1.00 18.27  ? 475  TRP A CZ3 1 
ATOM   3779 C  CH2 . TRP A 1 476 ? 36.723  56.341 87.682  1.00 18.20  ? 475  TRP A CH2 1 
ATOM   3780 N  N   . ILE A 1 477 ? 34.081  49.157 90.362  1.00 15.43  ? 476  ILE A N   1 
ATOM   3781 C  CA  . ILE A 1 477 ? 33.027  48.713 91.251  1.00 15.88  ? 476  ILE A CA  1 
ATOM   3782 C  C   . ILE A 1 477 ? 33.508  48.628 92.684  1.00 21.66  ? 476  ILE A C   1 
ATOM   3783 O  O   . ILE A 1 477 ? 32.742  48.833 93.614  1.00 20.18  ? 476  ILE A O   1 
ATOM   3784 C  CB  . ILE A 1 477 ? 32.498  47.354 90.775  1.00 16.74  ? 476  ILE A CB  1 
ATOM   3785 C  CG1 . ILE A 1 477 ? 31.692  47.485 89.497  1.00 13.74  ? 476  ILE A CG1 1 
ATOM   3786 C  CG2 . ILE A 1 477 ? 31.697  46.620 91.844  1.00 17.08  ? 476  ILE A CG2 1 
ATOM   3787 C  CD1 . ILE A 1 477 ? 31.568  46.130 88.810  1.00 22.82  ? 476  ILE A CD1 1 
ATOM   3788 N  N   . THR A 1 478 ? 34.780  48.321 92.886  1.00 18.89  ? 477  THR A N   1 
ATOM   3789 C  CA  . THR A 1 478 ? 35.286  48.193 94.256  1.00 15.92  ? 477  THR A CA  1 
ATOM   3790 C  C   . THR A 1 478 ? 36.151  49.355 94.708  1.00 17.65  ? 477  THR A C   1 
ATOM   3791 O  O   . THR A 1 478 ? 36.711  49.333 95.792  1.00 17.49  ? 477  THR A O   1 
ATOM   3792 C  CB  . THR A 1 478 ? 36.132  46.904 94.384  1.00 21.13  ? 477  THR A CB  1 
ATOM   3793 O  OG1 . THR A 1 478 ? 37.296  46.986 93.545  1.00 19.88  ? 477  THR A OG1 1 
ATOM   3794 C  CG2 . THR A 1 478 ? 35.268  45.673 94.035  1.00 16.31  ? 477  THR A CG2 1 
ATOM   3795 N  N   . ALA A 1 479 ? 36.302  50.369 93.884  1.00 18.44  ? 478  ALA A N   1 
ATOM   3796 C  CA  . ALA A 1 479 ? 37.131  51.548 94.191  1.00 16.94  ? 478  ALA A CA  1 
ATOM   3797 C  C   . ALA A 1 479 ? 36.729  52.219 95.490  1.00 20.18  ? 478  ALA A C   1 
ATOM   3798 O  O   . ALA A 1 479 ? 35.552  52.233 95.863  1.00 19.40  ? 478  ALA A O   1 
ATOM   3799 C  CB  . ALA A 1 479 ? 37.017  52.608 93.077  1.00 15.66  ? 478  ALA A CB  1 
ATOM   3800 N  N   . LYS A 1 480 ? 37.753  52.763 96.148  1.00 17.33  ? 479  LYS A N   1 
ATOM   3801 C  CA  . LYS A 1 480 ? 37.654  53.518 97.371  1.00 15.43  ? 479  LYS A CA  1 
ATOM   3802 C  C   . LYS A 1 480 ? 38.196  54.907 97.115  1.00 19.77  ? 479  LYS A C   1 
ATOM   3803 O  O   . LYS A 1 480 ? 38.757  55.192 96.073  1.00 16.97  ? 479  LYS A O   1 
ATOM   3804 C  CB  . LYS A 1 480 ? 38.325  52.853 98.562  1.00 17.71  ? 479  LYS A CB  1 
ATOM   3805 C  CG  . LYS A 1 480 ? 37.468  51.685 99.049  1.00 25.29  ? 479  LYS A CG  1 
ATOM   3806 C  CD  . LYS A 1 480 ? 38.002  51.058 100.324 1.00 28.77  ? 479  LYS A CD  1 
ATOM   3807 C  CE  . LYS A 1 480 ? 36.895  50.623 101.280 1.00 75.63  ? 479  LYS A CE  1 
ATOM   3808 N  NZ  . LYS A 1 480 ? 36.090  49.481 100.815 1.00 66.83  ? 479  LYS A NZ  1 
ATOM   3809 N  N   . GLU A 1 481 ? 38.010  55.793 98.068  1.00 19.41  ? 480  GLU A N   1 
ATOM   3810 C  CA  . GLU A 1 481 ? 38.497  57.120 97.853  1.00 19.30  ? 480  GLU A CA  1 
ATOM   3811 C  C   . GLU A 1 481 ? 39.933  57.069 97.387  1.00 21.25  ? 480  GLU A C   1 
ATOM   3812 O  O   . GLU A 1 481 ? 40.321  57.802 96.489  1.00 21.38  ? 480  GLU A O   1 
ATOM   3813 C  CB  . GLU A 1 481 ? 38.457  57.901 99.183  1.00 21.20  ? 480  GLU A CB  1 
ATOM   3814 C  CG  . GLU A 1 481 ? 37.322  58.931 99.171  1.00 53.93  ? 480  GLU A CG  1 
ATOM   3815 C  CD  . GLU A 1 481 ? 37.505  59.998 98.131  1.00 100.00 ? 480  GLU A CD  1 
ATOM   3816 O  OE1 . GLU A 1 481 ? 38.596  60.401 97.756  1.00 100.00 ? 480  GLU A OE1 1 
ATOM   3817 O  OE2 . GLU A 1 481 ? 36.360  60.456 97.684  1.00 100.00 ? 480  GLU A OE2 1 
ATOM   3818 N  N   . ASP A 1 482 ? 40.730  56.249 98.059  1.00 15.59  ? 481  ASP A N   1 
ATOM   3819 C  CA  . ASP A 1 482 ? 42.120  56.150 97.734  1.00 17.58  ? 481  ASP A CA  1 
ATOM   3820 C  C   . ASP A 1 482 ? 42.463  55.609 96.372  1.00 22.00  ? 481  ASP A C   1 
ATOM   3821 O  O   . ASP A 1 482 ? 43.639  55.651 96.002  1.00 21.23  ? 481  ASP A O   1 
ATOM   3822 C  CB  . ASP A 1 482 ? 42.966  55.475 98.824  1.00 22.35  ? 481  ASP A CB  1 
ATOM   3823 C  CG  . ASP A 1 482 ? 42.845  53.974 98.879  1.00 26.70  ? 481  ASP A CG  1 
ATOM   3824 O  OD1 . ASP A 1 482 ? 42.040  53.276 98.295  1.00 22.31  ? 481  ASP A OD1 1 
ATOM   3825 O  OD2 . ASP A 1 482 ? 43.769  53.466 99.638  1.00 19.37  ? 481  ASP A OD2 1 
ATOM   3826 N  N   . ASP A 1 483 ? 41.483  55.147 95.608  1.00 16.23  ? 482  ASP A N   1 
ATOM   3827 C  CA  . ASP A 1 483 ? 41.795  54.667 94.250  1.00 15.66  ? 482  ASP A CA  1 
ATOM   3828 C  C   . ASP A 1 483 ? 41.485  55.667 93.144  1.00 20.38  ? 482  ASP A C   1 
ATOM   3829 O  O   . ASP A 1 483 ? 41.994  55.549 92.031  1.00 19.78  ? 482  ASP A O   1 
ATOM   3830 C  CB  . ASP A 1 483 ? 41.058  53.340 93.885  1.00 16.37  ? 482  ASP A CB  1 
ATOM   3831 C  CG  . ASP A 1 483 ? 41.360  52.283 94.918  1.00 14.59  ? 482  ASP A CG  1 
ATOM   3832 O  OD1 . ASP A 1 483 ? 42.463  51.867 95.146  1.00 16.94  ? 482  ASP A OD1 1 
ATOM   3833 O  OD2 . ASP A 1 483 ? 40.338  51.972 95.654  1.00 17.55  ? 482  ASP A OD2 1 
ATOM   3834 N  N   . LEU A 1 484 ? 40.627  56.645 93.423  1.00 17.94  ? 483  LEU A N   1 
ATOM   3835 C  CA  . LEU A 1 484 ? 40.167  57.591 92.403  1.00 14.70  ? 483  LEU A CA  1 
ATOM   3836 C  C   . LEU A 1 484 ? 41.214  58.319 91.581  1.00 21.17  ? 483  LEU A C   1 
ATOM   3837 O  O   . LEU A 1 484 ? 41.122  58.519 90.368  1.00 21.03  ? 483  LEU A O   1 
ATOM   3838 C  CB  . LEU A 1 484 ? 39.110  58.581 92.960  1.00 13.43  ? 483  LEU A CB  1 
ATOM   3839 C  CG  . LEU A 1 484 ? 37.870  57.925 93.558  1.00 15.53  ? 483  LEU A CG  1 
ATOM   3840 C  CD1 . LEU A 1 484 ? 36.970  59.020 94.114  1.00 19.32  ? 483  LEU A CD1 1 
ATOM   3841 C  CD2 . LEU A 1 484 ? 37.047  57.172 92.512  1.00 16.27  ? 483  LEU A CD2 1 
ATOM   3842 N  N   . ASN A 1 485 ? 42.220  58.761 92.289  1.00 19.63  ? 484  ASN A N   1 
ATOM   3843 C  CA  . ASN A 1 485 ? 43.274  59.541 91.713  1.00 19.74  ? 484  ASN A CA  1 
ATOM   3844 C  C   . ASN A 1 485 ? 44.128  58.789 90.738  1.00 21.84  ? 484  ASN A C   1 
ATOM   3845 O  O   . ASN A 1 485 ? 44.723  59.343 89.827  1.00 20.30  ? 484  ASN A O   1 
ATOM   3846 C  CB  . ASN A 1 485 ? 44.110  60.036 92.891  1.00 34.83  ? 484  ASN A CB  1 
ATOM   3847 C  CG  . ASN A 1 485 ? 45.382  60.719 92.449  1.00 100.00 ? 484  ASN A CG  1 
ATOM   3848 O  OD1 . ASN A 1 485 ? 45.345  61.686 91.662  1.00 87.99  ? 484  ASN A OD1 1 
ATOM   3849 N  ND2 . ASN A 1 485 ? 46.510  60.200 92.946  1.00 100.00 ? 484  ASN A ND2 1 
ATOM   3850 N  N   . SER A 1 486 ? 44.183  57.510 90.918  1.00 17.69  ? 485  SER A N   1 
ATOM   3851 C  CA  . SER A 1 486 ? 44.986  56.711 90.020  1.00 19.64  ? 485  SER A CA  1 
ATOM   3852 C  C   . SER A 1 486 ? 44.283  56.335 88.728  1.00 22.88  ? 485  SER A C   1 
ATOM   3853 O  O   . SER A 1 486 ? 44.965  55.937 87.778  1.00 23.74  ? 485  SER A O   1 
ATOM   3854 C  CB  . SER A 1 486 ? 45.543  55.508 90.752  1.00 26.03  ? 485  SER A CB  1 
ATOM   3855 O  OG  . SER A 1 486 ? 45.864  55.954 92.057  1.00 52.22  ? 485  SER A OG  1 
ATOM   3856 N  N   . PHE A 1 487 ? 42.948  56.451 88.650  1.00 15.68  ? 486  PHE A N   1 
ATOM   3857 C  CA  . PHE A 1 487 ? 42.367  56.105 87.371  1.00 17.12  ? 486  PHE A CA  1 
ATOM   3858 C  C   . PHE A 1 487 ? 42.879  57.120 86.403  1.00 16.98  ? 486  PHE A C   1 
ATOM   3859 O  O   . PHE A 1 487 ? 43.165  58.236 86.812  1.00 15.87  ? 486  PHE A O   1 
ATOM   3860 C  CB  . PHE A 1 487 ? 40.827  56.088 87.376  1.00 18.47  ? 486  PHE A CB  1 
ATOM   3861 C  CG  . PHE A 1 487 ? 40.270  54.950 88.181  1.00 17.85  ? 486  PHE A CG  1 
ATOM   3862 C  CD1 . PHE A 1 487 ? 40.325  53.646 87.686  1.00 17.48  ? 486  PHE A CD1 1 
ATOM   3863 C  CD2 . PHE A 1 487 ? 39.669  55.169 89.423  1.00 19.85  ? 486  PHE A CD2 1 
ATOM   3864 C  CE1 . PHE A 1 487 ? 39.790  52.599 88.441  1.00 18.74  ? 486  PHE A CE1 1 
ATOM   3865 C  CE2 . PHE A 1 487 ? 39.119  54.139 90.189  1.00 19.10  ? 486  PHE A CE2 1 
ATOM   3866 C  CZ  . PHE A 1 487 ? 39.208  52.839 89.689  1.00 17.75  ? 486  PHE A CZ  1 
ATOM   3867 N  N   . ASN A 1 488 ? 42.965  56.744 85.140  1.00 16.22  ? 487  ASN A N   1 
ATOM   3868 C  CA  . ASN A 1 488 ? 43.499  57.636 84.141  1.00 20.09  ? 487  ASN A CA  1 
ATOM   3869 C  C   . ASN A 1 488 ? 43.100  57.184 82.746  1.00 23.67  ? 487  ASN A C   1 
ATOM   3870 O  O   . ASN A 1 488 ? 42.770  56.024 82.522  1.00 22.60  ? 487  ASN A O   1 
ATOM   3871 C  CB  . ASN A 1 488 ? 45.058  57.575 84.255  1.00 21.63  ? 487  ASN A CB  1 
ATOM   3872 C  CG  . ASN A 1 488 ? 45.776  58.616 83.415  1.00 32.80  ? 487  ASN A CG  1 
ATOM   3873 O  OD1 . ASN A 1 488 ? 45.901  58.498 82.202  1.00 29.22  ? 487  ASN A OD1 1 
ATOM   3874 N  ND2 . ASN A 1 488 ? 46.159  59.725 84.021  1.00 31.52  ? 487  ASN A ND2 1 
ATOM   3875 N  N   . ALA A 1 489 ? 43.145  58.126 81.800  1.00 23.87  ? 488  ALA A N   1 
ATOM   3876 C  CA  . ALA A 1 489 ? 42.808  57.829 80.411  1.00 24.07  ? 488  ALA A CA  1 
ATOM   3877 C  C   . ALA A 1 489 ? 43.673  56.703 79.873  1.00 30.63  ? 488  ALA A C   1 
ATOM   3878 O  O   . ALA A 1 489 ? 43.336  55.962 78.958  1.00 33.83  ? 488  ALA A O   1 
ATOM   3879 C  CB  . ALA A 1 489 ? 42.978  59.086 79.574  1.00 26.14  ? 488  ALA A CB  1 
ATOM   3880 N  N   . THR A 1 490 ? 44.835  56.532 80.467  1.00 25.63  ? 489  THR A N   1 
ATOM   3881 C  CA  . THR A 1 490 ? 45.666  55.468 79.987  1.00 22.82  ? 489  THR A CA  1 
ATOM   3882 C  C   . THR A 1 490 ? 44.976  54.168 80.210  1.00 24.75  ? 489  THR A C   1 
ATOM   3883 O  O   . THR A 1 490 ? 45.323  53.163 79.615  1.00 26.26  ? 489  THR A O   1 
ATOM   3884 C  CB  . THR A 1 490 ? 47.017  55.459 80.691  1.00 29.64  ? 489  THR A CB  1 
ATOM   3885 O  OG1 . THR A 1 490 ? 46.814  55.537 82.076  1.00 29.43  ? 489  THR A OG1 1 
ATOM   3886 C  CG2 . THR A 1 490 ? 47.774  56.684 80.231  1.00 35.78  ? 489  THR A CG2 1 
ATOM   3887 N  N   . ASP A 1 491 ? 43.999  54.180 81.097  1.00 21.60  ? 490  ASP A N   1 
ATOM   3888 C  CA  . ASP A 1 491 ? 43.288  52.946 81.362  1.00 20.54  ? 490  ASP A CA  1 
ATOM   3889 C  C   . ASP A 1 491 ? 42.628  52.391 80.104  1.00 14.90  ? 490  ASP A C   1 
ATOM   3890 O  O   . ASP A 1 491 ? 42.363  51.207 80.013  1.00 18.94  ? 490  ASP A O   1 
ATOM   3891 C  CB  . ASP A 1 491 ? 42.188  53.100 82.462  1.00 18.42  ? 490  ASP A CB  1 
ATOM   3892 C  CG  . ASP A 1 491 ? 42.764  53.483 83.785  1.00 21.60  ? 490  ASP A CG  1 
ATOM   3893 O  OD1 . ASP A 1 491 ? 43.865  53.165 84.170  1.00 22.97  ? 490  ASP A OD1 1 
ATOM   3894 O  OD2 . ASP A 1 491 ? 41.930  54.124 84.534  1.00 18.24  ? 490  ASP A OD2 1 
ATOM   3895 N  N   . LEU A 1 492 ? 42.309  53.262 79.180  1.00 14.42  ? 491  LEU A N   1 
ATOM   3896 C  CA  . LEU A 1 492 ? 41.571  52.910 77.971  1.00 18.63  ? 491  LEU A CA  1 
ATOM   3897 C  C   . LEU A 1 492 ? 42.404  52.634 76.735  1.00 26.17  ? 491  LEU A C   1 
ATOM   3898 O  O   . LEU A 1 492 ? 41.863  52.350 75.689  1.00 23.53  ? 491  LEU A O   1 
ATOM   3899 C  CB  . LEU A 1 492 ? 40.626  54.065 77.600  1.00 16.48  ? 491  LEU A CB  1 
ATOM   3900 C  CG  . LEU A 1 492 ? 39.793  54.553 78.786  1.00 17.62  ? 491  LEU A CG  1 
ATOM   3901 C  CD1 . LEU A 1 492 ? 38.719  55.504 78.256  1.00 18.61  ? 491  LEU A CD1 1 
ATOM   3902 C  CD2 . LEU A 1 492 ? 39.164  53.341 79.481  1.00 10.99  ? 491  LEU A CD2 1 
ATOM   3903 N  N   . LYS A 1 493 ? 43.697  52.773 76.906  1.00 25.72  ? 492  LYS A N   1 
ATOM   3904 C  CA  . LYS A 1 493 ? 44.773  52.625 75.944  1.00 29.38  ? 492  LYS A CA  1 
ATOM   3905 C  C   . LYS A 1 493 ? 44.601  51.464 74.987  1.00 26.62  ? 492  LYS A C   1 
ATOM   3906 O  O   . LYS A 1 493 ? 44.640  51.598 73.769  1.00 25.36  ? 492  LYS A O   1 
ATOM   3907 C  CB  . LYS A 1 493 ? 46.051  52.369 76.768  1.00 39.68  ? 492  LYS A CB  1 
ATOM   3908 C  CG  . LYS A 1 493 ? 47.400  52.731 76.164  1.00 74.03  ? 492  LYS A CG  1 
ATOM   3909 C  CD  . LYS A 1 493 ? 48.535  52.573 77.175  1.00 92.88  ? 492  LYS A CD  1 
ATOM   3910 C  CE  . LYS A 1 493 ? 49.162  51.184 77.249  1.00 100.00 ? 492  LYS A CE  1 
ATOM   3911 N  NZ  . LYS A 1 493 ? 50.629  51.214 77.397  1.00 100.00 ? 492  LYS A NZ  1 
ATOM   3912 N  N   . ASP A 1 494 ? 44.504  50.271 75.514  1.00 22.05  ? 493  ASP A N   1 
ATOM   3913 C  CA  . ASP A 1 494 ? 44.400  49.213 74.525  1.00 25.28  ? 493  ASP A CA  1 
ATOM   3914 C  C   . ASP A 1 494 ? 43.008  48.604 74.421  1.00 31.85  ? 493  ASP A C   1 
ATOM   3915 O  O   . ASP A 1 494 ? 42.844  47.411 74.178  1.00 31.64  ? 493  ASP A O   1 
ATOM   3916 C  CB  . ASP A 1 494 ? 45.414  48.126 74.874  1.00 30.29  ? 493  ASP A CB  1 
ATOM   3917 C  CG  . ASP A 1 494 ? 46.803  48.680 74.973  1.00 47.27  ? 493  ASP A CG  1 
ATOM   3918 O  OD1 . ASP A 1 494 ? 47.322  49.280 74.036  1.00 49.99  ? 493  ASP A OD1 1 
ATOM   3919 O  OD2 . ASP A 1 494 ? 47.334  48.481 76.167  1.00 45.03  ? 493  ASP A OD2 1 
ATOM   3920 N  N   . LEU A 1 495 ? 41.989  49.430 74.622  1.00 23.95  ? 494  LEU A N   1 
ATOM   3921 C  CA  . LEU A 1 495 ? 40.633  48.920 74.576  1.00 19.08  ? 494  LEU A CA  1 
ATOM   3922 C  C   . LEU A 1 495 ? 39.939  49.350 73.295  1.00 21.27  ? 494  LEU A C   1 
ATOM   3923 O  O   . LEU A 1 495 ? 39.960  50.537 72.963  1.00 22.24  ? 494  LEU A O   1 
ATOM   3924 C  CB  . LEU A 1 495 ? 39.833  49.421 75.800  1.00 16.85  ? 494  LEU A CB  1 
ATOM   3925 C  CG  . LEU A 1 495 ? 40.346  48.949 77.145  1.00 19.46  ? 494  LEU A CG  1 
ATOM   3926 C  CD1 . LEU A 1 495 ? 39.307  49.363 78.182  1.00 18.39  ? 494  LEU A CD1 1 
ATOM   3927 C  CD2 . LEU A 1 495 ? 40.511  47.422 77.183  1.00 20.77  ? 494  LEU A CD2 1 
ATOM   3928 N  N   . SER A 1 496 ? 39.320  48.401 72.573  1.00 17.36  ? 495  SER A N   1 
ATOM   3929 C  CA  . SER A 1 496 ? 38.594  48.790 71.382  1.00 16.04  ? 495  SER A CA  1 
ATOM   3930 C  C   . SER A 1 496 ? 37.256  49.395 71.854  1.00 16.87  ? 495  SER A C   1 
ATOM   3931 O  O   . SER A 1 496 ? 36.902  49.328 73.042  1.00 13.30  ? 495  SER A O   1 
ATOM   3932 C  CB  . SER A 1 496 ? 38.253  47.547 70.576  1.00 16.67  ? 495  SER A CB  1 
ATOM   3933 O  OG  . SER A 1 496 ? 37.477  46.701 71.422  1.00 17.37  ? 495  SER A OG  1 
ATOM   3934 N  N   . SER A 1 497 ? 36.496  49.950 70.922  1.00 14.14  ? 496  SER A N   1 
ATOM   3935 C  CA  . SER A 1 497 ? 35.200  50.501 71.254  1.00 16.64  ? 496  SER A CA  1 
ATOM   3936 C  C   . SER A 1 497 ? 34.316  49.365 71.794  1.00 17.90  ? 496  SER A C   1 
ATOM   3937 O  O   . SER A 1 497 ? 33.495  49.589 72.680  1.00 16.25  ? 496  SER A O   1 
ATOM   3938 C  CB  . SER A 1 497 ? 34.553  51.190 70.050  1.00 17.35  ? 496  SER A CB  1 
ATOM   3939 O  OG  . SER A 1 497 ? 34.309  50.183 69.105  1.00 23.79  ? 496  SER A OG  1 
ATOM   3940 N  N   . HIS A 1 498 ? 34.522  48.136 71.274  1.00 15.34  ? 497  HIS A N   1 
ATOM   3941 C  CA  . HIS A 1 498 ? 33.794  46.965 71.729  1.00 13.46  ? 497  HIS A CA  1 
ATOM   3942 C  C   . HIS A 1 498 ? 33.999  46.671 73.224  1.00 17.45  ? 497  HIS A C   1 
ATOM   3943 O  O   . HIS A 1 498 ? 33.120  46.277 73.992  1.00 17.69  ? 497  HIS A O   1 
ATOM   3944 C  CB  . HIS A 1 498 ? 34.211  45.761 70.874  1.00 13.79  ? 497  HIS A CB  1 
ATOM   3945 C  CG  . HIS A 1 498 ? 33.804  46.004 69.470  1.00 20.43  ? 497  HIS A CG  1 
ATOM   3946 N  ND1 . HIS A 1 498 ? 34.738  46.342 68.482  1.00 24.52  ? 497  HIS A ND1 1 
ATOM   3947 C  CD2 . HIS A 1 498 ? 32.551  46.044 68.930  1.00 21.08  ? 497  HIS A CD2 1 
ATOM   3948 C  CE1 . HIS A 1 498 ? 34.039  46.531 67.358  1.00 21.87  ? 497  HIS A CE1 1 
ATOM   3949 N  NE2 . HIS A 1 498 ? 32.725  46.363 67.602  1.00 23.02  ? 497  HIS A NE2 1 
ATOM   3950 N  N   . GLN A 1 499 ? 35.230  46.833 73.662  1.00 14.00  ? 498  GLN A N   1 
ATOM   3951 C  CA  . GLN A 1 499 ? 35.633  46.593 75.029  1.00 10.78  ? 498  GLN A CA  1 
ATOM   3952 C  C   . GLN A 1 499 ? 35.180  47.697 75.968  1.00 13.63  ? 498  GLN A C   1 
ATOM   3953 O  O   . GLN A 1 499 ? 34.829  47.449 77.118  1.00 13.35  ? 498  GLN A O   1 
ATOM   3954 C  CB  . GLN A 1 499 ? 37.156  46.416 75.038  1.00 11.59  ? 498  GLN A CB  1 
ATOM   3955 C  CG  . GLN A 1 499 ? 37.585  45.026 74.488  1.00 14.99  ? 498  GLN A CG  1 
ATOM   3956 C  CD  . GLN A 1 499 ? 39.101  44.938 74.454  1.00 21.92  ? 498  GLN A CD  1 
ATOM   3957 O  OE1 . GLN A 1 499 ? 39.746  45.833 73.897  1.00 18.12  ? 498  GLN A OE1 1 
ATOM   3958 N  NE2 . GLN A 1 499 ? 39.685  43.957 75.117  1.00 11.55  ? 498  GLN A NE2 1 
ATOM   3959 N  N   . LEU A 1 500 ? 35.200  48.942 75.490  1.00 16.63  ? 499  LEU A N   1 
ATOM   3960 C  CA  . LEU A 1 500 ? 34.712  50.095 76.273  1.00 18.30  ? 499  LEU A CA  1 
ATOM   3961 C  C   . LEU A 1 500 ? 33.222  49.848 76.647  1.00 18.08  ? 499  LEU A C   1 
ATOM   3962 O  O   . LEU A 1 500 ? 32.711  50.004 77.782  1.00 14.69  ? 499  LEU A O   1 
ATOM   3963 C  CB  . LEU A 1 500 ? 34.719  51.296 75.293  1.00 19.02  ? 499  LEU A CB  1 
ATOM   3964 C  CG  . LEU A 1 500 ? 35.650  52.421 75.677  1.00 28.28  ? 499  LEU A CG  1 
ATOM   3965 C  CD1 . LEU A 1 500 ? 36.768  51.856 76.527  1.00 27.69  ? 499  LEU A CD1 1 
ATOM   3966 C  CD2 . LEU A 1 500 ? 36.210  53.135 74.448  1.00 31.77  ? 499  LEU A CD2 1 
ATOM   3967 N  N   . ASN A 1 501 ? 32.491  49.430 75.610  1.00 11.59  ? 500  ASN A N   1 
ATOM   3968 C  CA  . ASN A 1 501 ? 31.084  49.123 75.748  1.00 10.98  ? 500  ASN A CA  1 
ATOM   3969 C  C   . ASN A 1 501 ? 30.844  48.021 76.775  1.00 11.55  ? 500  ASN A C   1 
ATOM   3970 O  O   . ASN A 1 501 ? 29.989  48.125 77.656  1.00 13.43  ? 500  ASN A O   1 
ATOM   3971 C  CB  . ASN A 1 501 ? 30.530  48.735 74.355  1.00 11.90  ? 500  ASN A CB  1 
ATOM   3972 C  CG  . ASN A 1 501 ? 29.020  48.504 74.328  1.00 26.05  ? 500  ASN A CG  1 
ATOM   3973 O  OD1 . ASN A 1 501 ? 28.208  49.304 74.815  1.00 19.55  ? 500  ASN A OD1 1 
ATOM   3974 N  ND2 . ASN A 1 501 ? 28.607  47.387 73.759  1.00 21.02  ? 500  ASN A ND2 1 
ATOM   3975 N  N   . GLU A 1 502 ? 31.601  46.927 76.633  1.00 11.18  ? 501  GLU A N   1 
ATOM   3976 C  CA  . GLU A 1 502 ? 31.471  45.787 77.537  1.00 11.00  ? 501  GLU A CA  1 
ATOM   3977 C  C   . GLU A 1 502 ? 31.859  46.184 78.954  1.00 14.40  ? 501  GLU A C   1 
ATOM   3978 O  O   . GLU A 1 502 ? 31.266  45.757 79.930  1.00 13.70  ? 501  GLU A O   1 
ATOM   3979 C  CB  . GLU A 1 502 ? 32.286  44.574 77.022  1.00 13.23  ? 501  GLU A CB  1 
ATOM   3980 C  CG  . GLU A 1 502 ? 32.328  43.425 78.064  1.00 12.24  ? 501  GLU A CG  1 
ATOM   3981 C  CD  . GLU A 1 502 ? 30.930  42.880 78.253  1.00 20.51  ? 501  GLU A CD  1 
ATOM   3982 O  OE1 . GLU A 1 502 ? 30.040  43.113 77.452  1.00 18.75  ? 501  GLU A OE1 1 
ATOM   3983 O  OE2 . GLU A 1 502 ? 30.747  42.158 79.338  1.00 16.17  ? 501  GLU A OE2 1 
ATOM   3984 N  N   . PHE A 1 503 ? 32.876  47.051 79.080  1.00 10.99  ? 502  PHE A N   1 
ATOM   3985 C  CA  . PHE A 1 503 ? 33.281  47.530 80.382  1.00 12.47  ? 502  PHE A CA  1 
ATOM   3986 C  C   . PHE A 1 503 ? 32.095  48.241 81.068  1.00 12.80  ? 502  PHE A C   1 
ATOM   3987 O  O   . PHE A 1 503 ? 31.733  48.062 82.230  1.00 11.74  ? 502  PHE A O   1 
ATOM   3988 C  CB  . PHE A 1 503 ? 34.498  48.490 80.167  1.00 14.11  ? 502  PHE A CB  1 
ATOM   3989 C  CG  . PHE A 1 503 ? 34.641  49.500 81.265  1.00 11.76  ? 502  PHE A CG  1 
ATOM   3990 C  CD1 . PHE A 1 503 ? 34.958  49.120 82.570  1.00 9.77   ? 502  PHE A CD1 1 
ATOM   3991 C  CD2 . PHE A 1 503 ? 34.363  50.847 81.040  1.00 17.45  ? 502  PHE A CD2 1 
ATOM   3992 C  CE1 . PHE A 1 503 ? 35.059  50.053 83.605  1.00 12.88  ? 502  PHE A CE1 1 
ATOM   3993 C  CE2 . PHE A 1 503 ? 34.443  51.799 82.063  1.00 20.32  ? 502  PHE A CE2 1 
ATOM   3994 C  CZ  . PHE A 1 503 ? 34.812  51.406 83.350  1.00 16.55  ? 502  PHE A CZ  1 
ATOM   3995 N  N   . LEU A 1 504 ? 31.470  49.100 80.286  1.00 10.48  ? 503  LEU A N   1 
ATOM   3996 C  CA  . LEU A 1 504 ? 30.342  49.835 80.759  1.00 11.84  ? 503  LEU A CA  1 
ATOM   3997 C  C   . LEU A 1 504 ? 29.184  48.917 81.089  1.00 11.65  ? 503  LEU A C   1 
ATOM   3998 O  O   . LEU A 1 504 ? 28.531  49.077 82.110  1.00 14.41  ? 503  LEU A O   1 
ATOM   3999 C  CB  . LEU A 1 504 ? 29.974  50.854 79.668  1.00 12.15  ? 503  LEU A CB  1 
ATOM   4000 C  CG  . LEU A 1 504 ? 30.872  52.105 79.668  1.00 12.97  ? 503  LEU A CG  1 
ATOM   4001 C  CD1 . LEU A 1 504 ? 30.572  52.957 78.438  1.00 9.62   ? 503  LEU A CD1 1 
ATOM   4002 C  CD2 . LEU A 1 504 ? 30.614  52.935 80.936  1.00 14.08  ? 503  LEU A CD2 1 
ATOM   4003 N  N   . ALA A 1 505 ? 28.947  47.910 80.248  1.00 12.65  ? 504  ALA A N   1 
ATOM   4004 C  CA  . ALA A 1 505 ? 27.850  46.977 80.499  1.00 8.77   ? 504  ALA A CA  1 
ATOM   4005 C  C   . ALA A 1 505 ? 28.038  46.282 81.812  1.00 12.09  ? 504  ALA A C   1 
ATOM   4006 O  O   . ALA A 1 505 ? 27.118  46.081 82.598  1.00 10.26  ? 504  ALA A O   1 
ATOM   4007 C  CB  . ALA A 1 505 ? 27.742  45.965 79.370  1.00 7.47   ? 504  ALA A CB  1 
ATOM   4008 N  N   . GLN A 1 506 ? 29.280  45.900 82.035  1.00 12.47  ? 505  GLN A N   1 
ATOM   4009 C  CA  . GLN A 1 506 ? 29.609  45.209 83.271  1.00 12.94  ? 505  GLN A CA  1 
ATOM   4010 C  C   . GLN A 1 506 ? 29.424  46.144 84.484  1.00 14.71  ? 505  GLN A C   1 
ATOM   4011 O  O   . GLN A 1 506 ? 28.902  45.773 85.566  1.00 13.04  ? 505  GLN A O   1 
ATOM   4012 C  CB  . GLN A 1 506 ? 31.068  44.689 83.183  1.00 14.37  ? 505  GLN A CB  1 
ATOM   4013 C  CG  . GLN A 1 506 ? 31.243  43.520 82.174  1.00 17.48  ? 505  GLN A CG  1 
ATOM   4014 C  CD  . GLN A 1 506 ? 32.693  43.054 82.089  1.00 20.84  ? 505  GLN A CD  1 
ATOM   4015 O  OE1 . GLN A 1 506 ? 33.556  43.462 82.890  1.00 21.65  ? 505  GLN A OE1 1 
ATOM   4016 N  NE2 . GLN A 1 506 ? 32.990  42.221 81.096  1.00 16.13  ? 505  GLN A NE2 1 
ATOM   4017 N  N   . THR A 1 507 ? 29.862  47.389 84.298  1.00 13.56  ? 506  THR A N   1 
ATOM   4018 C  CA  . THR A 1 507 ? 29.749  48.348 85.373  1.00 15.13  ? 506  THR A CA  1 
ATOM   4019 C  C   . THR A 1 507 ? 28.280  48.610 85.714  1.00 17.30  ? 506  THR A C   1 
ATOM   4020 O  O   . THR A 1 507 ? 27.835  48.662 86.879  1.00 13.71  ? 506  THR A O   1 
ATOM   4021 C  CB  . THR A 1 507 ? 30.561  49.613 85.043  1.00 13.74  ? 506  THR A CB  1 
ATOM   4022 O  OG1 . THR A 1 507 ? 31.903  49.243 84.853  1.00 13.66  ? 506  THR A OG1 1 
ATOM   4023 C  CG2 . THR A 1 507 ? 30.542  50.538 86.242  1.00 16.98  ? 506  THR A CG2 1 
ATOM   4024 N  N   . LEU A 1 508 ? 27.532  48.734 84.636  1.00 15.17  ? 507  LEU A N   1 
ATOM   4025 C  CA  . LEU A 1 508 ? 26.109  49.007 84.748  1.00 15.46  ? 507  LEU A CA  1 
ATOM   4026 C  C   . LEU A 1 508 ? 25.391  47.944 85.517  1.00 15.53  ? 507  LEU A C   1 
ATOM   4027 O  O   . LEU A 1 508 ? 24.464  48.230 86.256  1.00 14.10  ? 507  LEU A O   1 
ATOM   4028 C  CB  . LEU A 1 508 ? 25.476  49.185 83.351  1.00 16.26  ? 507  LEU A CB  1 
ATOM   4029 C  CG  . LEU A 1 508 ? 24.017  49.581 83.374  1.00 17.96  ? 507  LEU A CG  1 
ATOM   4030 C  CD1 . LEU A 1 508 ? 23.801  50.929 84.087  1.00 12.71  ? 507  LEU A CD1 1 
ATOM   4031 C  CD2 . LEU A 1 508 ? 23.550  49.633 81.923  1.00 13.10  ? 507  LEU A CD2 1 
ATOM   4032 N  N   . GLN A 1 509 ? 25.802  46.696 85.343  1.00 14.24  ? 508  GLN A N   1 
ATOM   4033 C  CA  . GLN A 1 509 ? 25.145  45.630 86.077  1.00 11.70  ? 508  GLN A CA  1 
ATOM   4034 C  C   . GLN A 1 509 ? 25.264  45.846 87.581  1.00 19.07  ? 508  GLN A C   1 
ATOM   4035 O  O   . GLN A 1 509 ? 24.521  45.269 88.354  1.00 16.98  ? 508  GLN A O   1 
ATOM   4036 C  CB  . GLN A 1 509 ? 25.736  44.246 85.745  1.00 11.79  ? 508  GLN A CB  1 
ATOM   4037 C  CG  . GLN A 1 509 ? 25.402  43.722 84.334  1.00 17.73  ? 508  GLN A CG  1 
ATOM   4038 C  CD  . GLN A 1 509 ? 25.860  42.282 84.204  1.00 20.08  ? 508  GLN A CD  1 
ATOM   4039 O  OE1 . GLN A 1 509 ? 26.960  41.972 84.695  1.00 23.98  ? 508  GLN A OE1 1 
ATOM   4040 N  NE2 . GLN A 1 509 ? 25.048  41.402 83.594  1.00 15.23  ? 508  GLN A NE2 1 
ATOM   4041 N  N   . ARG A 1 510 ? 26.217  46.639 88.053  1.00 17.16  ? 509  ARG A N   1 
ATOM   4042 C  CA  . ARG A 1 510 ? 26.332  46.847 89.498  1.00 12.26  ? 509  ARG A CA  1 
ATOM   4043 C  C   . ARG A 1 510 ? 25.960  48.279 89.899  1.00 17.09  ? 509  ARG A C   1 
ATOM   4044 O  O   . ARG A 1 510 ? 26.379  48.778 90.948  1.00 18.12  ? 509  ARG A O   1 
ATOM   4045 C  CB  . ARG A 1 510 ? 27.741  46.537 90.036  1.00 12.59  ? 509  ARG A CB  1 
ATOM   4046 C  CG  . ARG A 1 510 ? 28.095  45.097 89.784  1.00 17.56  ? 509  ARG A CG  1 
ATOM   4047 C  CD  . ARG A 1 510 ? 27.422  44.228 90.829  1.00 25.37  ? 509  ARG A CD  1 
ATOM   4048 N  NE  . ARG A 1 510 ? 28.134  44.270 92.117  1.00 81.24  ? 509  ARG A NE  1 
ATOM   4049 C  CZ  . ARG A 1 510 ? 29.377  43.822 92.417  1.00 88.85  ? 509  ARG A CZ  1 
ATOM   4050 N  NH1 . ARG A 1 510 ? 30.235  43.233 91.555  1.00 63.02  ? 509  ARG A NH1 1 
ATOM   4051 N  NH2 . ARG A 1 510 ? 29.779  43.978 93.676  1.00 42.33  ? 509  ARG A NH2 1 
ATOM   4052 N  N   . ALA A 1 511 ? 25.162  48.958 89.088  1.00 14.89  ? 510  ALA A N   1 
ATOM   4053 C  CA  . ALA A 1 511 ? 24.782  50.321 89.428  1.00 13.02  ? 510  ALA A CA  1 
ATOM   4054 C  C   . ALA A 1 511 ? 23.824  50.270 90.594  1.00 22.66  ? 510  ALA A C   1 
ATOM   4055 O  O   . ALA A 1 511 ? 23.176  49.243 90.747  1.00 21.57  ? 510  ALA A O   1 
ATOM   4056 C  CB  . ALA A 1 511 ? 24.166  51.066 88.248  1.00 13.60  ? 510  ALA A CB  1 
ATOM   4057 N  N   . PRO A 1 512 ? 23.755  51.340 91.417  1.00 20.55  ? 511  PRO A N   1 
ATOM   4058 C  CA  . PRO A 1 512 ? 24.521  52.568 91.190  1.00 16.50  ? 511  PRO A CA  1 
ATOM   4059 C  C   . PRO A 1 512 ? 25.912  52.528 91.759  1.00 17.68  ? 511  PRO A C   1 
ATOM   4060 O  O   . PRO A 1 512 ? 26.199  51.765 92.658  1.00 15.20  ? 511  PRO A O   1 
ATOM   4061 C  CB  . PRO A 1 512 ? 23.836  53.667 92.001  1.00 15.68  ? 511  PRO A CB  1 
ATOM   4062 C  CG  . PRO A 1 512 ? 23.118  52.916 93.106  1.00 22.23  ? 511  PRO A CG  1 
ATOM   4063 C  CD  . PRO A 1 512 ? 22.859  51.497 92.597  1.00 18.77  ? 511  PRO A CD  1 
ATOM   4064 N  N   . LEU A 1 513 ? 26.755  53.380 91.203  1.00 19.26  ? 512  LEU A N   1 
ATOM   4065 C  CA  . LEU A 1 513 ? 28.070  53.588 91.751  1.00 19.26  ? 512  LEU A CA  1 
ATOM   4066 C  C   . LEU A 1 513 ? 27.964  54.919 92.529  1.00 19.35  ? 512  LEU A C   1 
ATOM   4067 O  O   . LEU A 1 513 ? 27.053  55.732 92.316  1.00 15.40  ? 512  LEU A O   1 
ATOM   4068 C  CB  . LEU A 1 513 ? 29.183  53.659 90.683  1.00 19.06  ? 512  LEU A CB  1 
ATOM   4069 C  CG  . LEU A 1 513 ? 29.796  52.274 90.415  1.00 23.85  ? 512  LEU A CG  1 
ATOM   4070 C  CD1 . LEU A 1 513 ? 28.762  51.351 89.763  1.00 24.14  ? 512  LEU A CD1 1 
ATOM   4071 C  CD2 . LEU A 1 513 ? 30.975  52.408 89.453  1.00 17.31  ? 512  LEU A CD2 1 
ATOM   4072 N  N   . PRO A 1 514 ? 28.880  55.157 93.459  1.00 18.91  ? 513  PRO A N   1 
ATOM   4073 C  CA  . PRO A 1 514 ? 28.823  56.408 94.168  1.00 16.34  ? 513  PRO A CA  1 
ATOM   4074 C  C   . PRO A 1 514 ? 28.925  57.520 93.140  1.00 17.64  ? 513  PRO A C   1 
ATOM   4075 O  O   . PRO A 1 514 ? 29.686  57.443 92.192  1.00 15.39  ? 513  PRO A O   1 
ATOM   4076 C  CB  . PRO A 1 514 ? 30.031  56.431 95.107  1.00 16.06  ? 513  PRO A CB  1 
ATOM   4077 C  CG  . PRO A 1 514 ? 30.443  54.972 95.246  1.00 21.97  ? 513  PRO A CG  1 
ATOM   4078 C  CD  . PRO A 1 514 ? 29.960  54.270 93.987  1.00 17.15  ? 513  PRO A CD  1 
ATOM   4079 N  N   . LEU A 1 515 ? 28.154  58.573 93.341  1.00 19.37  ? 514  LEU A N   1 
ATOM   4080 C  CA  . LEU A 1 515 ? 28.155  59.712 92.431  1.00 20.71  ? 514  LEU A CA  1 
ATOM   4081 C  C   . LEU A 1 515 ? 29.567  60.240 92.151  1.00 22.73  ? 514  LEU A C   1 
ATOM   4082 O  O   . LEU A 1 515 ? 29.934  60.486 90.991  1.00 20.91  ? 514  LEU A O   1 
ATOM   4083 C  CB  . LEU A 1 515 ? 27.209  60.816 92.955  1.00 19.46  ? 514  LEU A CB  1 
ATOM   4084 C  CG  . LEU A 1 515 ? 27.173  62.058 92.077  1.00 23.47  ? 514  LEU A CG  1 
ATOM   4085 C  CD1 . LEU A 1 515 ? 26.650  61.694 90.681  1.00 21.60  ? 514  LEU A CD1 1 
ATOM   4086 C  CD2 . LEU A 1 515 ? 26.275  63.087 92.767  1.00 19.09  ? 514  LEU A CD2 1 
ATOM   4087 N  N   . GLY A 1 516 ? 30.353  60.384 93.236  1.00 19.02  ? 515  GLY A N   1 
ATOM   4088 C  CA  . GLY A 1 516 ? 31.711  60.866 93.104  1.00 16.33  ? 515  GLY A CA  1 
ATOM   4089 C  C   . GLY A 1 516 ? 32.489  60.000 92.121  1.00 20.68  ? 515  GLY A C   1 
ATOM   4090 O  O   . GLY A 1 516 ? 33.336  60.489 91.363  1.00 17.47  ? 515  GLY A O   1 
ATOM   4091 N  N   . HIS A 1 517 ? 32.199  58.691 92.105  1.00 16.69  ? 516  HIS A N   1 
ATOM   4092 C  CA  . HIS A 1 517 ? 32.961  57.829 91.206  1.00 16.67  ? 516  HIS A CA  1 
ATOM   4093 C  C   . HIS A 1 517 ? 32.629  58.092 89.762  1.00 16.39  ? 516  HIS A C   1 
ATOM   4094 O  O   . HIS A 1 517 ? 33.485  58.094 88.886  1.00 13.40  ? 516  HIS A O   1 
ATOM   4095 C  CB  . HIS A 1 517 ? 32.781  56.335 91.479  1.00 16.85  ? 516  HIS A CB  1 
ATOM   4096 C  CG  . HIS A 1 517 ? 33.328  55.909 92.786  1.00 23.07  ? 516  HIS A CG  1 
ATOM   4097 N  ND1 . HIS A 1 517 ? 33.586  56.811 93.804  1.00 27.10  ? 516  HIS A ND1 1 
ATOM   4098 C  CD2 . HIS A 1 517 ? 33.691  54.664 93.219  1.00 26.55  ? 516  HIS A CD2 1 
ATOM   4099 C  CE1 . HIS A 1 517 ? 34.067  56.096 94.831  1.00 27.40  ? 516  HIS A CE1 1 
ATOM   4100 N  NE2 . HIS A 1 517 ? 34.144  54.803 94.514  1.00 26.59  ? 516  HIS A NE2 1 
ATOM   4101 N  N   . ILE A 1 518 ? 31.349  58.288 89.534  1.00 14.76  ? 517  ILE A N   1 
ATOM   4102 C  CA  . ILE A 1 518 ? 30.887  58.520 88.189  1.00 15.71  ? 517  ILE A CA  1 
ATOM   4103 C  C   . ILE A 1 518 ? 31.444  59.817 87.666  1.00 13.62  ? 517  ILE A C   1 
ATOM   4104 O  O   . ILE A 1 518 ? 31.851  59.960 86.511  1.00 13.02  ? 517  ILE A O   1 
ATOM   4105 C  CB  . ILE A 1 518 ? 29.350  58.408 88.144  1.00 20.46  ? 517  ILE A CB  1 
ATOM   4106 C  CG1 . ILE A 1 518 ? 28.925  56.989 88.555  1.00 23.97  ? 517  ILE A CG1 1 
ATOM   4107 C  CG2 . ILE A 1 518 ? 28.793  58.653 86.750  1.00 19.51  ? 517  ILE A CG2 1 
ATOM   4108 C  CD1 . ILE A 1 518 ? 29.636  55.831 87.826  1.00 21.92  ? 517  ILE A CD1 1 
ATOM   4109 N  N   . LYS A 1 519 ? 31.433  60.804 88.549  1.00 13.76  ? 518  LYS A N   1 
ATOM   4110 C  CA  . LYS A 1 519 ? 32.004  62.082 88.137  1.00 12.83  ? 518  LYS A CA  1 
ATOM   4111 C  C   . LYS A 1 519 ? 33.487  61.877 87.759  1.00 17.13  ? 518  LYS A C   1 
ATOM   4112 O  O   . LYS A 1 519 ? 33.971  62.371 86.745  1.00 14.95  ? 518  LYS A O   1 
ATOM   4113 C  CB  . LYS A 1 519 ? 31.858  63.092 89.279  1.00 12.59  ? 518  LYS A CB  1 
ATOM   4114 C  CG  . LYS A 1 519 ? 30.392  63.447 89.416  1.00 15.77  ? 518  LYS A CG  1 
ATOM   4115 C  CD  . LYS A 1 519 ? 30.169  64.528 90.446  1.00 25.59  ? 518  LYS A CD  1 
ATOM   4116 C  CE  . LYS A 1 519 ? 28.743  65.047 90.425  1.00 26.22  ? 518  LYS A CE  1 
ATOM   4117 N  NZ  . LYS A 1 519 ? 28.669  66.440 90.886  1.00 26.75  ? 518  LYS A NZ  1 
ATOM   4118 N  N   . ARG A 1 520 ? 34.237  61.144 88.604  1.00 15.99  ? 519  ARG A N   1 
ATOM   4119 C  CA  . ARG A 1 520 ? 35.647  60.914 88.321  1.00 13.25  ? 519  ARG A CA  1 
ATOM   4120 C  C   . ARG A 1 520 ? 35.803  60.213 86.998  1.00 16.26  ? 519  ARG A C   1 
ATOM   4121 O  O   . ARG A 1 520 ? 36.679  60.478 86.216  1.00 13.50  ? 519  ARG A O   1 
ATOM   4122 C  CB  . ARG A 1 520 ? 36.265  60.075 89.423  1.00 14.16  ? 519  ARG A CB  1 
ATOM   4123 C  CG  . ARG A 1 520 ? 37.741  59.741 89.216  1.00 13.79  ? 519  ARG A CG  1 
ATOM   4124 C  CD  . ARG A 1 520 ? 38.685  60.955 89.134  1.00 22.42  ? 519  ARG A CD  1 
ATOM   4125 N  NE  . ARG A 1 520 ? 40.127  60.613 89.069  1.00 17.77  ? 519  ARG A NE  1 
ATOM   4126 C  CZ  . ARG A 1 520 ? 41.035  61.432 88.570  1.00 19.26  ? 519  ARG A CZ  1 
ATOM   4127 N  NH1 . ARG A 1 520 ? 40.692  62.640 88.087  1.00 18.57  ? 519  ARG A NH1 1 
ATOM   4128 N  NH2 . ARG A 1 520 ? 42.289  61.014 88.549  1.00 17.51  ? 519  ARG A NH2 1 
ATOM   4129 N  N   . MET A 1 521 ? 34.897  59.292 86.743  1.00 13.85  ? 520  MET A N   1 
ATOM   4130 C  CA  . MET A 1 521 ? 34.944  58.548 85.514  1.00 13.32  ? 520  MET A CA  1 
ATOM   4131 C  C   . MET A 1 521 ? 34.803  59.460 84.299  1.00 16.61  ? 520  MET A C   1 
ATOM   4132 O  O   . MET A 1 521 ? 35.461  59.286 83.279  1.00 15.39  ? 520  MET A O   1 
ATOM   4133 C  CB  . MET A 1 521 ? 33.860  57.425 85.585  1.00 15.92  ? 520  MET A CB  1 
ATOM   4134 C  CG  . MET A 1 521 ? 33.887  56.502 84.369  1.00 16.73  ? 520  MET A CG  1 
ATOM   4135 S  SD  . MET A 1 521 ? 32.699  55.131 84.463  1.00 19.40  ? 520  MET A SD  1 
ATOM   4136 C  CE  . MET A 1 521 ? 33.250  54.267 85.942  1.00 17.31  ? 520  MET A CE  1 
ATOM   4137 N  N   . GLN A 1 522 ? 33.919  60.449 84.358  1.00 10.96  ? 521  GLN A N   1 
ATOM   4138 C  CA  . GLN A 1 522 ? 33.800  61.336 83.205  1.00 10.25  ? 521  GLN A CA  1 
ATOM   4139 C  C   . GLN A 1 522 ? 35.105  62.160 83.122  1.00 14.21  ? 521  GLN A C   1 
ATOM   4140 O  O   . GLN A 1 522 ? 35.684  62.487 82.073  1.00 11.43  ? 521  GLN A O   1 
ATOM   4141 C  CB  . GLN A 1 522 ? 32.548  62.237 83.376  1.00 9.22   ? 521  GLN A CB  1 
ATOM   4142 C  CG  . GLN A 1 522 ? 32.547  63.519 82.503  1.00 12.68  ? 521  GLN A CG  1 
ATOM   4143 C  CD  . GLN A 1 522 ? 32.758  63.301 81.025  1.00 18.23  ? 521  GLN A CD  1 
ATOM   4144 O  OE1 . GLN A 1 522 ? 33.271  64.187 80.309  1.00 20.20  ? 521  GLN A OE1 1 
ATOM   4145 N  NE2 . GLN A 1 522 ? 32.453  62.102 80.554  1.00 10.43  ? 521  GLN A NE2 1 
ATOM   4146 N  N   . GLU A 1 523 ? 35.608  62.524 84.295  1.00 15.29  ? 522  GLU A N   1 
ATOM   4147 C  CA  . GLU A 1 523 ? 36.816  63.335 84.345  1.00 14.86  ? 522  GLU A CA  1 
ATOM   4148 C  C   . GLU A 1 523 ? 38.026  62.632 83.702  1.00 24.87  ? 522  GLU A C   1 
ATOM   4149 O  O   . GLU A 1 523 ? 38.848  63.232 82.990  1.00 19.95  ? 522  GLU A O   1 
ATOM   4150 C  CB  . GLU A 1 523 ? 37.068  63.573 85.820  1.00 15.93  ? 522  GLU A CB  1 
ATOM   4151 C  CG  . GLU A 1 523 ? 38.175  64.573 86.121  1.00 34.79  ? 522  GLU A CG  1 
ATOM   4152 C  CD  . GLU A 1 523 ? 38.013  64.959 87.556  1.00 61.54  ? 522  GLU A CD  1 
ATOM   4153 O  OE1 . GLU A 1 523 ? 38.436  64.271 88.466  1.00 24.02  ? 522  GLU A OE1 1 
ATOM   4154 O  OE2 . GLU A 1 523 ? 37.252  66.014 87.710  1.00 60.58  ? 522  GLU A OE2 1 
ATOM   4155 N  N   . VAL A 1 524 ? 38.179  61.338 83.966  1.00 17.81  ? 523  VAL A N   1 
ATOM   4156 C  CA  . VAL A 1 524 ? 39.302  60.635 83.392  1.00 17.49  ? 523  VAL A CA  1 
ATOM   4157 C  C   . VAL A 1 524 ? 39.081  60.051 81.994  1.00 17.20  ? 523  VAL A C   1 
ATOM   4158 O  O   . VAL A 1 524 ? 40.038  59.940 81.230  1.00 22.12  ? 523  VAL A O   1 
ATOM   4159 C  CB  . VAL A 1 524 ? 39.952  59.621 84.340  1.00 18.80  ? 523  VAL A CB  1 
ATOM   4160 C  CG1 . VAL A 1 524 ? 40.427  60.324 85.613  1.00 18.67  ? 523  VAL A CG1 1 
ATOM   4161 C  CG2 . VAL A 1 524 ? 38.957  58.522 84.717  1.00 17.30  ? 523  VAL A CG2 1 
ATOM   4162 N  N   . TYR A 1 525 ? 37.851  59.676 81.633  1.00 13.33  ? 524  TYR A N   1 
ATOM   4163 C  CA  . TYR A 1 525 ? 37.638  59.045 80.331  1.00 12.09  ? 524  TYR A CA  1 
ATOM   4164 C  C   . TYR A 1 525 ? 36.842  59.839 79.321  1.00 19.77  ? 524  TYR A C   1 
ATOM   4165 O  O   . TYR A 1 525 ? 36.720  59.417 78.179  1.00 17.94  ? 524  TYR A O   1 
ATOM   4166 C  CB  . TYR A 1 525 ? 36.961  57.656 80.463  1.00 13.83  ? 524  TYR A CB  1 
ATOM   4167 C  CG  . TYR A 1 525 ? 37.615  56.667 81.421  1.00 14.86  ? 524  TYR A CG  1 
ATOM   4168 C  CD1 . TYR A 1 525 ? 38.999  56.608 81.574  1.00 13.07  ? 524  TYR A CD1 1 
ATOM   4169 C  CD2 . TYR A 1 525 ? 36.832  55.761 82.146  1.00 19.57  ? 524  TYR A CD2 1 
ATOM   4170 C  CE1 . TYR A 1 525 ? 39.592  55.704 82.460  1.00 18.13  ? 524  TYR A CE1 1 
ATOM   4171 C  CE2 . TYR A 1 525 ? 37.403  54.832 83.019  1.00 18.46  ? 524  TYR A CE2 1 
ATOM   4172 C  CZ  . TYR A 1 525 ? 38.790  54.813 83.181  1.00 17.58  ? 524  TYR A CZ  1 
ATOM   4173 O  OH  . TYR A 1 525 ? 39.360  53.937 84.087  1.00 16.81  ? 524  TYR A OH  1 
ATOM   4174 N  N   . ASN A 1 526 ? 36.235  60.940 79.753  1.00 20.91  ? 525  ASN A N   1 
ATOM   4175 C  CA  . ASN A 1 526 ? 35.435  61.755 78.865  1.00 16.88  ? 525  ASN A CA  1 
ATOM   4176 C  C   . ASN A 1 526 ? 34.488  60.923 78.018  1.00 18.05  ? 525  ASN A C   1 
ATOM   4177 O  O   . ASN A 1 526 ? 34.450  61.014 76.789  1.00 15.92  ? 525  ASN A O   1 
ATOM   4178 C  CB  . ASN A 1 526 ? 36.361  62.615 78.002  1.00 13.81  ? 525  ASN A CB  1 
ATOM   4179 C  CG  . ASN A 1 526 ? 35.680  63.751 77.259  1.00 18.94  ? 525  ASN A CG  1 
ATOM   4180 O  OD1 . ASN A 1 526 ? 36.243  64.268 76.280  1.00 18.98  ? 525  ASN A OD1 1 
ATOM   4181 N  ND2 . ASN A 1 526 ? 34.502  64.169 77.693  1.00 14.31  ? 525  ASN A ND2 1 
ATOM   4182 N  N   . PHE A 1 527 ? 33.659  60.120 78.683  1.00 14.70  ? 526  PHE A N   1 
ATOM   4183 C  CA  . PHE A 1 527 ? 32.676  59.337 77.947  1.00 12.71  ? 526  PHE A CA  1 
ATOM   4184 C  C   . PHE A 1 527 ? 31.596  60.234 77.380  1.00 16.60  ? 526  PHE A C   1 
ATOM   4185 O  O   . PHE A 1 527 ? 30.891  59.866 76.439  1.00 15.88  ? 526  PHE A O   1 
ATOM   4186 C  CB  . PHE A 1 527 ? 32.038  58.303 78.876  1.00 14.35  ? 526  PHE A CB  1 
ATOM   4187 C  CG  . PHE A 1 527 ? 32.957  57.130 79.130  1.00 15.85  ? 526  PHE A CG  1 
ATOM   4188 C  CD1 . PHE A 1 527 ? 33.895  56.735 78.175  1.00 19.68  ? 526  PHE A CD1 1 
ATOM   4189 C  CD2 . PHE A 1 527 ? 32.876  56.397 80.314  1.00 16.85  ? 526  PHE A CD2 1 
ATOM   4190 C  CE1 . PHE A 1 527 ? 34.687  55.604 78.378  1.00 21.64  ? 526  PHE A CE1 1 
ATOM   4191 C  CE2 . PHE A 1 527 ? 33.698  55.298 80.567  1.00 19.90  ? 526  PHE A CE2 1 
ATOM   4192 C  CZ  . PHE A 1 527 ? 34.590  54.890 79.575  1.00 18.31  ? 526  PHE A CZ  1 
ATOM   4193 N  N   . ASN A 1 528 ? 31.418  61.433 77.949  1.00 12.75  ? 527  ASN A N   1 
ATOM   4194 C  CA  . ASN A 1 528 ? 30.391  62.355 77.446  1.00 12.28  ? 527  ASN A CA  1 
ATOM   4195 C  C   . ASN A 1 528 ? 30.627  62.668 75.971  1.00 19.85  ? 527  ASN A C   1 
ATOM   4196 O  O   . ASN A 1 528 ? 29.715  62.907 75.185  1.00 18.13  ? 527  ASN A O   1 
ATOM   4197 C  CB  . ASN A 1 528 ? 30.431  63.713 78.160  1.00 13.86  ? 527  ASN A CB  1 
ATOM   4198 C  CG  . ASN A 1 528 ? 29.641  63.696 79.434  1.00 25.14  ? 527  ASN A CG  1 
ATOM   4199 O  OD1 . ASN A 1 528 ? 29.760  64.600 80.250  1.00 20.32  ? 527  ASN A OD1 1 
ATOM   4200 N  ND2 . ASN A 1 528 ? 28.830  62.668 79.610  1.00 10.82  ? 527  ASN A ND2 1 
ATOM   4201 N  N   . ALA A 1 529 ? 31.906  62.668 75.607  1.00 15.34  ? 528  ALA A N   1 
ATOM   4202 C  CA  . ALA A 1 529 ? 32.280  62.964 74.264  1.00 17.72  ? 528  ALA A CA  1 
ATOM   4203 C  C   . ALA A 1 529 ? 32.075  61.861 73.228  1.00 26.48  ? 528  ALA A C   1 
ATOM   4204 O  O   . ALA A 1 529 ? 32.198  62.127 72.031  1.00 21.26  ? 528  ALA A O   1 
ATOM   4205 C  CB  . ALA A 1 529 ? 33.729  63.372 74.236  1.00 18.38  ? 528  ALA A CB  1 
ATOM   4206 N  N   . ILE A 1 530 ? 31.810  60.629 73.664  1.00 19.00  ? 529  ILE A N   1 
ATOM   4207 C  CA  . ILE A 1 530 ? 31.690  59.524 72.731  1.00 15.58  ? 529  ILE A CA  1 
ATOM   4208 C  C   . ILE A 1 530 ? 30.389  59.499 71.945  1.00 15.90  ? 529  ILE A C   1 
ATOM   4209 O  O   . ILE A 1 530 ? 29.305  59.561 72.494  1.00 16.45  ? 529  ILE A O   1 
ATOM   4210 C  CB  . ILE A 1 530 ? 31.946  58.208 73.454  1.00 17.38  ? 529  ILE A CB  1 
ATOM   4211 C  CG1 . ILE A 1 530 ? 33.456  58.159 73.709  1.00 19.42  ? 529  ILE A CG1 1 
ATOM   4212 C  CG2 . ILE A 1 530 ? 31.511  57.103 72.488  1.00 17.67  ? 529  ILE A CG2 1 
ATOM   4213 C  CD1 . ILE A 1 530 ? 34.027  57.047 74.576  1.00 23.37  ? 529  ILE A CD1 1 
ATOM   4214 N  N   . ASN A 1 531 ? 30.440  59.418 70.641  1.00 16.94  ? 530  ASN A N   1 
ATOM   4215 C  CA  . ASN A 1 531 ? 29.151  59.417 69.969  1.00 20.74  ? 530  ASN A CA  1 
ATOM   4216 C  C   . ASN A 1 531 ? 28.522  58.081 69.611  1.00 25.19  ? 530  ASN A C   1 
ATOM   4217 O  O   . ASN A 1 531 ? 27.369  58.026 69.217  1.00 23.63  ? 530  ASN A O   1 
ATOM   4218 C  CB  . ASN A 1 531 ? 28.937  60.566 68.986  1.00 39.14  ? 530  ASN A CB  1 
ATOM   4219 C  CG  . ASN A 1 531 ? 28.612  61.852 69.749  1.00 80.92  ? 530  ASN A CG  1 
ATOM   4220 O  OD1 . ASN A 1 531 ? 27.639  61.959 70.533  1.00 86.83  ? 530  ASN A OD1 1 
ATOM   4221 N  ND2 . ASN A 1 531 ? 29.470  62.838 69.537  1.00 45.14  ? 530  ASN A ND2 1 
ATOM   4222 N  N   . ASN A 1 532 ? 29.306  57.019 69.759  1.00 19.99  ? 531  ASN A N   1 
ATOM   4223 C  CA  . ASN A 1 532 ? 28.875  55.667 69.494  1.00 18.88  ? 531  ASN A CA  1 
ATOM   4224 C  C   . ASN A 1 532 ? 27.637  55.452 70.350  1.00 15.67  ? 531  ASN A C   1 
ATOM   4225 O  O   . ASN A 1 532 ? 27.671  55.661 71.566  1.00 15.13  ? 531  ASN A O   1 
ATOM   4226 C  CB  . ASN A 1 532 ? 30.045  54.762 69.928  1.00 11.62  ? 531  ASN A CB  1 
ATOM   4227 C  CG  . ASN A 1 532 ? 29.705  53.292 69.866  1.00 26.73  ? 531  ASN A CG  1 
ATOM   4228 O  OD1 . ASN A 1 532 ? 28.724  52.832 70.471  1.00 21.97  ? 531  ASN A OD1 1 
ATOM   4229 N  ND2 . ASN A 1 532 ? 30.510  52.554 69.105  1.00 18.28  ? 531  ASN A ND2 1 
ATOM   4230 N  N   . SER A 1 533 ? 26.551  55.074 69.715  1.00 12.93  ? 532  SER A N   1 
ATOM   4231 C  CA  . SER A 1 533 ? 25.293  54.931 70.456  1.00 15.99  ? 532  SER A CA  1 
ATOM   4232 C  C   . SER A 1 533 ? 25.248  53.889 71.565  1.00 17.50  ? 532  SER A C   1 
ATOM   4233 O  O   . SER A 1 533 ? 24.631  54.066 72.611  1.00 20.47  ? 532  SER A O   1 
ATOM   4234 C  CB  . SER A 1 533 ? 24.088  54.846 69.518  1.00 17.43  ? 532  SER A CB  1 
ATOM   4235 O  OG  . SER A 1 533 ? 24.274  53.791 68.570  1.00 24.83  ? 532  SER A OG  1 
ATOM   4236 N  N   . GLU A 1 534 ? 25.876  52.753 71.337  1.00 14.65  ? 533  GLU A N   1 
ATOM   4237 C  CA  . GLU A 1 534 ? 25.835  51.708 72.339  1.00 13.13  ? 533  GLU A CA  1 
ATOM   4238 C  C   . GLU A 1 534 ? 26.497  52.181 73.614  1.00 19.42  ? 533  GLU A C   1 
ATOM   4239 O  O   . GLU A 1 534 ? 25.964  52.028 74.725  1.00 15.25  ? 533  GLU A O   1 
ATOM   4240 C  CB  . GLU A 1 534 ? 26.547  50.464 71.780  1.00 13.22  ? 533  GLU A CB  1 
ATOM   4241 C  CG  . GLU A 1 534 ? 25.712  49.829 70.637  1.00 9.87   ? 533  GLU A CG  1 
ATOM   4242 C  CD  . GLU A 1 534 ? 24.531  49.055 71.162  1.00 21.99  ? 533  GLU A CD  1 
ATOM   4243 O  OE1 . GLU A 1 534 ? 24.395  48.722 72.319  1.00 18.49  ? 533  GLU A OE1 1 
ATOM   4244 O  OE2 . GLU A 1 534 ? 23.625  48.805 70.267  1.00 16.24  ? 533  GLU A OE2 1 
ATOM   4245 N  N   . ILE A 1 535 ? 27.686  52.747 73.415  1.00 15.22  ? 534  ILE A N   1 
ATOM   4246 C  CA  . ILE A 1 535 ? 28.495  53.265 74.512  1.00 14.94  ? 534  ILE A CA  1 
ATOM   4247 C  C   . ILE A 1 535 ? 27.793  54.420 75.228  1.00 14.04  ? 534  ILE A C   1 
ATOM   4248 O  O   . ILE A 1 535 ? 27.677  54.447 76.461  1.00 17.42  ? 534  ILE A O   1 
ATOM   4249 C  CB  . ILE A 1 535 ? 29.926  53.655 74.077  1.00 17.98  ? 534  ILE A CB  1 
ATOM   4250 C  CG1 . ILE A 1 535 ? 30.733  52.461 73.557  1.00 13.41  ? 534  ILE A CG1 1 
ATOM   4251 C  CG2 . ILE A 1 535 ? 30.680  54.387 75.216  1.00 15.34  ? 534  ILE A CG2 1 
ATOM   4252 C  CD1 . ILE A 1 535 ? 32.003  52.906 72.825  1.00 17.39  ? 534  ILE A CD1 1 
ATOM   4253 N  N   . ARG A 1 536 ? 27.310  55.402 74.475  1.00 14.39  ? 535  ARG A N   1 
ATOM   4254 C  CA  . ARG A 1 536 ? 26.611  56.511 75.135  1.00 17.35  ? 535  ARG A CA  1 
ATOM   4255 C  C   . ARG A 1 536 ? 25.347  56.016 75.868  1.00 14.54  ? 535  ARG A C   1 
ATOM   4256 O  O   . ARG A 1 536 ? 24.998  56.382 76.973  1.00 15.05  ? 535  ARG A O   1 
ATOM   4257 C  CB  . ARG A 1 536 ? 26.232  57.576 74.108  1.00 16.26  ? 535  ARG A CB  1 
ATOM   4258 C  CG  . ARG A 1 536 ? 25.583  58.826 74.730  1.00 8.73   ? 535  ARG A CG  1 
ATOM   4259 C  CD  . ARG A 1 536 ? 25.392  59.919 73.666  1.00 11.55  ? 535  ARG A CD  1 
ATOM   4260 N  NE  . ARG A 1 536 ? 25.126  61.228 74.251  1.00 15.18  ? 535  ARG A NE  1 
ATOM   4261 C  CZ  . ARG A 1 536 ? 26.049  62.043 74.761  1.00 26.20  ? 535  ARG A CZ  1 
ATOM   4262 N  NH1 . ARG A 1 536 ? 27.354  61.765 74.769  1.00 20.26  ? 535  ARG A NH1 1 
ATOM   4263 N  NH2 . ARG A 1 536 ? 25.636  63.189 75.286  1.00 19.91  ? 535  ARG A NH2 1 
ATOM   4264 N  N   . PHE A 1 537 ? 24.632  55.126 75.233  1.00 11.71  ? 536  PHE A N   1 
ATOM   4265 C  CA  . PHE A 1 537 ? 23.462  54.627 75.876  1.00 9.63   ? 536  PHE A CA  1 
ATOM   4266 C  C   . PHE A 1 537 ? 23.825  54.092 77.233  1.00 13.77  ? 536  PHE A C   1 
ATOM   4267 O  O   . PHE A 1 537 ? 23.256  54.497 78.231  1.00 13.81  ? 536  PHE A O   1 
ATOM   4268 C  CB  . PHE A 1 537 ? 22.906  53.471 75.016  1.00 10.66  ? 536  PHE A CB  1 
ATOM   4269 C  CG  . PHE A 1 537 ? 21.865  52.621 75.710  1.00 14.64  ? 536  PHE A CG  1 
ATOM   4270 C  CD1 . PHE A 1 537 ? 20.699  53.158 76.256  1.00 13.81  ? 536  PHE A CD1 1 
ATOM   4271 C  CD2 . PHE A 1 537 ? 22.052  51.242 75.840  1.00 19.23  ? 536  PHE A CD2 1 
ATOM   4272 C  CE1 . PHE A 1 537 ? 19.762  52.325 76.877  1.00 14.23  ? 536  PHE A CE1 1 
ATOM   4273 C  CE2 . PHE A 1 537 ? 21.127  50.395 76.457  1.00 16.53  ? 536  PHE A CE2 1 
ATOM   4274 C  CZ  . PHE A 1 537 ? 19.960  50.945 76.984  1.00 11.63  ? 536  PHE A CZ  1 
ATOM   4275 N  N   . ARG A 1 538 ? 24.750  53.131 77.282  1.00 12.89  ? 537  ARG A N   1 
ATOM   4276 C  CA  . ARG A 1 538 ? 25.110  52.536 78.577  1.00 11.92  ? 537  ARG A CA  1 
ATOM   4277 C  C   . ARG A 1 538 ? 25.734  53.520 79.575  1.00 16.03  ? 537  ARG A C   1 
ATOM   4278 O  O   . ARG A 1 538 ? 25.525  53.436 80.793  1.00 10.71  ? 537  ARG A O   1 
ATOM   4279 C  CB  . ARG A 1 538 ? 25.949  51.253 78.505  1.00 11.85  ? 537  ARG A CB  1 
ATOM   4280 C  CG  . ARG A 1 538 ? 25.274  50.113 77.776  1.00 8.59   ? 537  ARG A CG  1 
ATOM   4281 C  CD  . ARG A 1 538 ? 26.142  48.857 77.547  1.00 17.16  ? 537  ARG A CD  1 
ATOM   4282 N  NE  . ARG A 1 538 ? 25.233  47.845 76.992  1.00 16.12  ? 537  ARG A NE  1 
ATOM   4283 C  CZ  . ARG A 1 538 ? 24.869  47.824 75.716  1.00 25.23  ? 537  ARG A CZ  1 
ATOM   4284 N  NH1 . ARG A 1 538 ? 25.414  48.641 74.802  1.00 13.55  ? 537  ARG A NH1 1 
ATOM   4285 N  NH2 . ARG A 1 538 ? 23.946  46.947 75.356  1.00 16.52  ? 537  ARG A NH2 1 
ATOM   4286 N  N   . TRP A 1 539 ? 26.544  54.451 79.060  1.00 13.16  ? 538  TRP A N   1 
ATOM   4287 C  CA  . TRP A 1 539 ? 27.170  55.440 79.907  1.00 10.77  ? 538  TRP A CA  1 
ATOM   4288 C  C   . TRP A 1 539 ? 26.079  56.286 80.532  1.00 13.43  ? 538  TRP A C   1 
ATOM   4289 O  O   . TRP A 1 539 ? 26.048  56.509 81.736  1.00 13.45  ? 538  TRP A O   1 
ATOM   4290 C  CB  . TRP A 1 539 ? 28.036  56.318 78.996  1.00 12.97  ? 538  TRP A CB  1 
ATOM   4291 C  CG  . TRP A 1 539 ? 28.489  57.611 79.604  1.00 12.46  ? 538  TRP A CG  1 
ATOM   4292 C  CD1 . TRP A 1 539 ? 28.330  58.807 79.019  1.00 13.56  ? 538  TRP A CD1 1 
ATOM   4293 C  CD2 . TRP A 1 539 ? 29.199  57.826 80.857  1.00 11.95  ? 538  TRP A CD2 1 
ATOM   4294 N  NE1 . TRP A 1 539 ? 28.932  59.757 79.801  1.00 12.84  ? 538  TRP A NE1 1 
ATOM   4295 C  CE2 . TRP A 1 539 ? 29.455  59.208 80.938  1.00 12.68  ? 538  TRP A CE2 1 
ATOM   4296 C  CE3 . TRP A 1 539 ? 29.667  57.000 81.914  1.00 11.87  ? 538  TRP A CE3 1 
ATOM   4297 C  CZ2 . TRP A 1 539 ? 30.115  59.780 82.024  1.00 10.55  ? 538  TRP A CZ2 1 
ATOM   4298 C  CZ3 . TRP A 1 539 ? 30.334  57.557 82.994  1.00 12.97  ? 538  TRP A CZ3 1 
ATOM   4299 C  CH2 . TRP A 1 539 ? 30.537  58.953 83.046  1.00 14.62  ? 538  TRP A CH2 1 
ATOM   4300 N  N   . LEU A 1 540 ? 25.160  56.761 79.714  1.00 8.88   ? 539  LEU A N   1 
ATOM   4301 C  CA  . LEU A 1 540 ? 24.132  57.592 80.310  1.00 11.52  ? 539  LEU A CA  1 
ATOM   4302 C  C   . LEU A 1 540 ? 23.249  56.878 81.335  1.00 17.64  ? 539  LEU A C   1 
ATOM   4303 O  O   . LEU A 1 540 ? 22.775  57.470 82.308  1.00 15.29  ? 539  LEU A O   1 
ATOM   4304 C  CB  . LEU A 1 540 ? 23.253  58.271 79.251  1.00 13.68  ? 539  LEU A CB  1 
ATOM   4305 C  CG  . LEU A 1 540 ? 23.977  59.247 78.323  1.00 15.24  ? 539  LEU A CG  1 
ATOM   4306 C  CD1 . LEU A 1 540 ? 22.989  59.923 77.388  1.00 13.27  ? 539  LEU A CD1 1 
ATOM   4307 C  CD2 . LEU A 1 540 ? 24.693  60.312 79.121  1.00 13.80  ? 539  LEU A CD2 1 
ATOM   4308 N  N   . ARG A 1 541 ? 22.988  55.583 81.115  1.00 14.05  ? 540  ARG A N   1 
ATOM   4309 C  CA  . ARG A 1 541 ? 22.176  54.850 82.067  1.00 11.62  ? 540  ARG A CA  1 
ATOM   4310 C  C   . ARG A 1 541 ? 22.880  54.792 83.418  1.00 13.27  ? 540  ARG A C   1 
ATOM   4311 O  O   . ARG A 1 541 ? 22.277  54.942 84.488  1.00 12.86  ? 540  ARG A O   1 
ATOM   4312 C  CB  . ARG A 1 541 ? 21.883  53.426 81.584  1.00 12.88  ? 540  ARG A CB  1 
ATOM   4313 C  CG  . ARG A 1 541 ? 20.894  53.325 80.408  1.00 8.76   ? 540  ARG A CG  1 
ATOM   4314 C  CD  . ARG A 1 541 ? 20.453  51.857 80.281  1.00 14.08  ? 540  ARG A CD  1 
ATOM   4315 N  NE  . ARG A 1 541 ? 19.442  51.552 81.288  1.00 11.93  ? 540  ARG A NE  1 
ATOM   4316 C  CZ  . ARG A 1 541 ? 18.856  50.391 81.486  1.00 16.72  ? 540  ARG A CZ  1 
ATOM   4317 N  NH1 . ARG A 1 541 ? 19.145  49.317 80.774  1.00 16.31  ? 540  ARG A NH1 1 
ATOM   4318 N  NH2 . ARG A 1 541 ? 17.926  50.330 82.416  1.00 9.86   ? 540  ARG A NH2 1 
ATOM   4319 N  N   . LEU A 1 542 ? 24.189  54.546 83.338  1.00 10.69  ? 541  LEU A N   1 
ATOM   4320 C  CA  . LEU A 1 542 ? 25.036  54.432 84.526  1.00 9.89   ? 541  LEU A CA  1 
ATOM   4321 C  C   . LEU A 1 542 ? 25.017  55.712 85.353  1.00 12.38  ? 541  LEU A C   1 
ATOM   4322 O  O   . LEU A 1 542 ? 24.961  55.749 86.598  1.00 12.85  ? 541  LEU A O   1 
ATOM   4323 C  CB  . LEU A 1 542 ? 26.482  54.119 84.074  1.00 8.98   ? 541  LEU A CB  1 
ATOM   4324 C  CG  . LEU A 1 542 ? 27.519  53.986 85.194  1.00 13.06  ? 541  LEU A CG  1 
ATOM   4325 C  CD1 . LEU A 1 542 ? 27.144  52.889 86.196  1.00 11.30  ? 541  LEU A CD1 1 
ATOM   4326 C  CD2 . LEU A 1 542 ? 28.904  53.697 84.606  1.00 11.15  ? 541  LEU A CD2 1 
ATOM   4327 N  N   . CYS A 1 543 ? 25.097  56.800 84.603  1.00 14.91  ? 542  CYS A N   1 
ATOM   4328 C  CA  . CYS A 1 543 ? 25.043  58.147 85.153  1.00 15.42  ? 542  CYS A CA  1 
ATOM   4329 C  C   . CYS A 1 543 ? 23.719  58.436 85.881  1.00 12.87  ? 542  CYS A C   1 
ATOM   4330 O  O   . CYS A 1 543 ? 23.689  58.913 87.019  1.00 13.42  ? 542  CYS A O   1 
ATOM   4331 C  CB  . CYS A 1 543 ? 25.234  59.166 83.987  1.00 14.29  ? 542  CYS A CB  1 
ATOM   4332 S  SG  . CYS A 1 543 ? 26.987  59.258 83.516  1.00 15.48  ? 542  CYS A SG  1 
ATOM   4333 N  N   . ILE A 1 544 ? 22.620  58.161 85.188  1.00 11.12  ? 543  ILE A N   1 
ATOM   4334 C  CA  . ILE A 1 544 ? 21.287  58.388 85.723  1.00 12.92  ? 543  ILE A CA  1 
ATOM   4335 C  C   . ILE A 1 544 ? 21.034  57.514 86.912  1.00 15.64  ? 543  ILE A C   1 
ATOM   4336 O  O   . ILE A 1 544 ? 20.565  57.959 87.965  1.00 14.40  ? 543  ILE A O   1 
ATOM   4337 C  CB  . ILE A 1 544 ? 20.193  58.168 84.670  1.00 14.69  ? 543  ILE A CB  1 
ATOM   4338 C  CG1 . ILE A 1 544 ? 20.350  59.208 83.580  1.00 14.31  ? 543  ILE A CG1 1 
ATOM   4339 C  CG2 . ILE A 1 544 ? 18.785  58.292 85.281  1.00 11.05  ? 543  ILE A CG2 1 
ATOM   4340 C  CD1 . ILE A 1 544 ? 20.139  60.651 84.095  1.00 13.56  ? 543  ILE A CD1 1 
ATOM   4341 N  N   . GLN A 1 545 ? 21.362  56.237 86.729  1.00 13.09  ? 544  GLN A N   1 
ATOM   4342 C  CA  . GLN A 1 545 ? 21.144  55.310 87.829  1.00 12.90  ? 544  GLN A CA  1 
ATOM   4343 C  C   . GLN A 1 545 ? 22.017  55.629 89.015  1.00 16.30  ? 544  GLN A C   1 
ATOM   4344 O  O   . GLN A 1 545 ? 21.649  55.299 90.140  1.00 12.81  ? 544  GLN A O   1 
ATOM   4345 C  CB  . GLN A 1 545 ? 21.287  53.846 87.396  1.00 14.77  ? 544  GLN A CB  1 
ATOM   4346 C  CG  . GLN A 1 545 ? 20.159  53.374 86.449  1.00 13.43  ? 544  GLN A CG  1 
ATOM   4347 C  CD  . GLN A 1 545 ? 20.399  51.967 85.889  1.00 16.60  ? 544  GLN A CD  1 
ATOM   4348 O  OE1 . GLN A 1 545 ? 20.048  51.639 84.754  1.00 18.63  ? 544  GLN A OE1 1 
ATOM   4349 N  NE2 . GLN A 1 545 ? 20.976  51.100 86.695  1.00 7.00   ? 544  GLN A NE2 1 
ATOM   4350 N  N   . SER A 1 546 ? 23.143  56.296 88.748  1.00 13.80  ? 545  SER A N   1 
ATOM   4351 C  CA  . SER A 1 546 ? 24.058  56.712 89.799  1.00 13.01  ? 545  SER A CA  1 
ATOM   4352 C  C   . SER A 1 546 ? 23.715  58.091 90.368  1.00 17.51  ? 545  SER A C   1 
ATOM   4353 O  O   . SER A 1 546 ? 24.429  58.656 91.189  1.00 17.76  ? 545  SER A O   1 
ATOM   4354 C  CB  . SER A 1 546 ? 25.495  56.649 89.330  1.00 14.26  ? 545  SER A CB  1 
ATOM   4355 O  OG  . SER A 1 546 ? 25.735  55.273 89.138  1.00 15.74  ? 545  SER A OG  1 
ATOM   4356 N  N   . LYS A 1 547 ? 22.586  58.609 89.924  1.00 13.25  ? 546  LYS A N   1 
ATOM   4357 C  CA  . LYS A 1 547 ? 22.029  59.857 90.370  1.00 14.37  ? 546  LYS A CA  1 
ATOM   4358 C  C   . LYS A 1 547 ? 22.771  61.109 89.963  1.00 16.71  ? 546  LYS A C   1 
ATOM   4359 O  O   . LYS A 1 547 ? 22.770  62.106 90.698  1.00 16.30  ? 546  LYS A O   1 
ATOM   4360 C  CB  . LYS A 1 547 ? 21.850  59.890 91.878  1.00 15.93  ? 546  LYS A CB  1 
ATOM   4361 C  CG  . LYS A 1 547 ? 21.320  58.602 92.470  1.00 16.80  ? 546  LYS A CG  1 
ATOM   4362 C  CD  . LYS A 1 547 ? 19.919  58.370 91.982  1.00 13.30  ? 546  LYS A CD  1 
ATOM   4363 C  CE  . LYS A 1 547 ? 19.280  57.148 92.617  1.00 24.82  ? 546  LYS A CE  1 
ATOM   4364 N  NZ  . LYS A 1 547 ? 18.052  56.742 91.905  1.00 17.92  ? 546  LYS A NZ  1 
ATOM   4365 N  N   . TRP A 1 548 ? 23.418  61.104 88.827  1.00 15.72  ? 547  TRP A N   1 
ATOM   4366 C  CA  . TRP A 1 548 ? 24.103  62.319 88.438  1.00 16.24  ? 547  TRP A CA  1 
ATOM   4367 C  C   . TRP A 1 548 ? 23.132  63.246 87.727  1.00 18.78  ? 547  TRP A C   1 
ATOM   4368 O  O   . TRP A 1 548 ? 22.760  63.007 86.605  1.00 16.35  ? 547  TRP A O   1 
ATOM   4369 C  CB  . TRP A 1 548 ? 25.261  61.999 87.505  1.00 15.42  ? 547  TRP A CB  1 
ATOM   4370 C  CG  . TRP A 1 548 ? 26.211  63.156 87.344  1.00 16.84  ? 547  TRP A CG  1 
ATOM   4371 C  CD1 . TRP A 1 548 ? 26.177  64.386 87.949  1.00 18.62  ? 547  TRP A CD1 1 
ATOM   4372 C  CD2 . TRP A 1 548 ? 27.349  63.140 86.479  1.00 15.94  ? 547  TRP A CD2 1 
ATOM   4373 N  NE1 . TRP A 1 548 ? 27.267  65.115 87.543  1.00 16.22  ? 547  TRP A NE1 1 
ATOM   4374 C  CE2 . TRP A 1 548 ? 27.997  64.380 86.629  1.00 18.06  ? 547  TRP A CE2 1 
ATOM   4375 C  CE3 . TRP A 1 548 ? 27.900  62.159 85.647  1.00 16.57  ? 547  TRP A CE3 1 
ATOM   4376 C  CZ2 . TRP A 1 548 ? 29.186  64.662 85.928  1.00 16.68  ? 547  TRP A CZ2 1 
ATOM   4377 C  CZ3 . TRP A 1 548 ? 29.068  62.459 84.966  1.00 19.03  ? 547  TRP A CZ3 1 
ATOM   4378 C  CH2 . TRP A 1 548 ? 29.693  63.709 85.079  1.00 18.04  ? 547  TRP A CH2 1 
ATOM   4379 N  N   . GLU A 1 549 ? 22.706  64.327 88.376  1.00 13.95  ? 548  GLU A N   1 
ATOM   4380 C  CA  . GLU A 1 549 ? 21.745  65.238 87.780  1.00 13.21  ? 548  GLU A CA  1 
ATOM   4381 C  C   . GLU A 1 549 ? 22.176  65.856 86.468  1.00 17.27  ? 548  GLU A C   1 
ATOM   4382 O  O   . GLU A 1 549 ? 21.352  66.149 85.617  1.00 18.18  ? 548  GLU A O   1 
ATOM   4383 C  CB  . GLU A 1 549 ? 21.375  66.370 88.771  1.00 15.29  ? 548  GLU A CB  1 
ATOM   4384 C  CG  . GLU A 1 549 ? 20.751  65.878 90.109  1.00 19.42  ? 548  GLU A CG  1 
ATOM   4385 C  CD  . GLU A 1 549 ? 20.207  67.018 90.953  1.00 33.00  ? 548  GLU A CD  1 
ATOM   4386 O  OE1 . GLU A 1 549 ? 19.775  68.057 90.492  1.00 46.88  ? 548  GLU A OE1 1 
ATOM   4387 O  OE2 . GLU A 1 549 ? 20.224  66.791 92.239  1.00 30.89  ? 548  GLU A OE2 1 
ATOM   4388 N  N   . ASP A 1 550 ? 23.477  66.105 86.285  1.00 17.99  ? 549  ASP A N   1 
ATOM   4389 C  CA  . ASP A 1 550 ? 23.929  66.735 85.054  1.00 10.58  ? 549  ASP A CA  1 
ATOM   4390 C  C   . ASP A 1 550 ? 23.666  65.896 83.853  1.00 12.02  ? 549  ASP A C   1 
ATOM   4391 O  O   . ASP A 1 550 ? 23.629  66.354 82.709  1.00 18.87  ? 549  ASP A O   1 
ATOM   4392 C  CB  . ASP A 1 550 ? 25.426  67.034 85.126  1.00 11.36  ? 549  ASP A CB  1 
ATOM   4393 C  CG  . ASP A 1 550 ? 25.703  68.058 86.214  1.00 22.44  ? 549  ASP A CG  1 
ATOM   4394 O  OD1 . ASP A 1 550 ? 25.396  69.227 86.150  1.00 25.44  ? 549  ASP A OD1 1 
ATOM   4395 O  OD2 . ASP A 1 550 ? 26.252  67.575 87.271  1.00 25.86  ? 549  ASP A OD2 1 
ATOM   4396 N  N   . ALA A 1 551 ? 23.511  64.624 84.122  1.00 13.24  ? 550  ALA A N   1 
ATOM   4397 C  CA  . ALA A 1 551 ? 23.269  63.709 83.004  1.00 14.70  ? 550  ALA A CA  1 
ATOM   4398 C  C   . ALA A 1 551 ? 21.845  63.707 82.473  1.00 17.89  ? 550  ALA A C   1 
ATOM   4399 O  O   . ALA A 1 551 ? 21.598  63.132 81.389  1.00 15.28  ? 550  ALA A O   1 
ATOM   4400 C  CB  . ALA A 1 551 ? 23.713  62.280 83.335  1.00 14.77  ? 550  ALA A CB  1 
ATOM   4401 N  N   . ILE A 1 552 ? 20.926  64.308 83.251  1.00 16.18  ? 551  ILE A N   1 
ATOM   4402 C  CA  . ILE A 1 552 ? 19.497  64.377 82.914  1.00 16.05  ? 551  ILE A CA  1 
ATOM   4403 C  C   . ILE A 1 552 ? 19.182  64.894 81.523  1.00 18.70  ? 551  ILE A C   1 
ATOM   4404 O  O   . ILE A 1 552 ? 18.441  64.290 80.736  1.00 19.01  ? 551  ILE A O   1 
ATOM   4405 C  CB  . ILE A 1 552 ? 18.701  65.139 83.971  1.00 19.52  ? 551  ILE A CB  1 
ATOM   4406 C  CG1 . ILE A 1 552 ? 18.692  64.281 85.232  1.00 20.39  ? 551  ILE A CG1 1 
ATOM   4407 C  CG2 . ILE A 1 552 ? 17.251  65.361 83.512  1.00 12.65  ? 551  ILE A CG2 1 
ATOM   4408 C  CD1 . ILE A 1 552 ? 18.167  64.995 86.485  1.00 15.78  ? 551  ILE A CD1 1 
ATOM   4409 N  N   . PRO A 1 553 ? 19.748  66.038 81.197  1.00 18.48  ? 552  PRO A N   1 
ATOM   4410 C  CA  . PRO A 1 553 ? 19.487  66.600 79.888  1.00 16.36  ? 552  PRO A CA  1 
ATOM   4411 C  C   . PRO A 1 553 ? 20.084  65.736 78.795  1.00 19.64  ? 552  PRO A C   1 
ATOM   4412 O  O   . PRO A 1 553 ? 19.551  65.606 77.700  1.00 16.94  ? 552  PRO A O   1 
ATOM   4413 C  CB  . PRO A 1 553 ? 20.125  67.995 79.870  1.00 18.41  ? 552  PRO A CB  1 
ATOM   4414 C  CG  . PRO A 1 553 ? 21.001  68.070 81.116  1.00 24.69  ? 552  PRO A CG  1 
ATOM   4415 C  CD  . PRO A 1 553 ? 20.504  66.981 82.059  1.00 17.97  ? 552  PRO A CD  1 
ATOM   4416 N  N   . LEU A 1 554 ? 21.226  65.144 79.075  1.00 17.67  ? 553  LEU A N   1 
ATOM   4417 C  CA  . LEU A 1 554 ? 21.852  64.302 78.072  1.00 15.47  ? 553  LEU A CA  1 
ATOM   4418 C  C   . LEU A 1 554 ? 20.940  63.101 77.795  1.00 19.23  ? 553  LEU A C   1 
ATOM   4419 O  O   . LEU A 1 554 ? 20.704  62.655 76.681  1.00 16.64  ? 553  LEU A O   1 
ATOM   4420 C  CB  . LEU A 1 554 ? 23.275  63.819 78.501  1.00 13.81  ? 553  LEU A CB  1 
ATOM   4421 C  CG  . LEU A 1 554 ? 24.239  64.905 79.002  1.00 19.25  ? 553  LEU A CG  1 
ATOM   4422 C  CD1 . LEU A 1 554 ? 25.606  64.289 79.247  1.00 17.04  ? 553  LEU A CD1 1 
ATOM   4423 C  CD2 . LEU A 1 554 ? 24.412  65.997 77.955  1.00 18.39  ? 553  LEU A CD2 1 
ATOM   4424 N  N   . ALA A 1 555 ? 20.440  62.529 78.867  1.00 17.65  ? 554  ALA A N   1 
ATOM   4425 C  CA  . ALA A 1 555 ? 19.614  61.341 78.730  1.00 15.25  ? 554  ALA A CA  1 
ATOM   4426 C  C   . ALA A 1 555 ? 18.330  61.673 78.029  1.00 19.37  ? 554  ALA A C   1 
ATOM   4427 O  O   . ALA A 1 555 ? 17.896  60.913 77.157  1.00 14.92  ? 554  ALA A O   1 
ATOM   4428 C  CB  . ALA A 1 555 ? 19.415  60.697 80.094  1.00 12.41  ? 554  ALA A CB  1 
ATOM   4429 N  N   . LEU A 1 556 ? 17.746  62.821 78.410  1.00 14.59  ? 555  LEU A N   1 
ATOM   4430 C  CA  . LEU A 1 556 ? 16.514  63.224 77.750  1.00 17.50  ? 555  LEU A CA  1 
ATOM   4431 C  C   . LEU A 1 556 ? 16.686  63.445 76.249  1.00 16.25  ? 555  LEU A C   1 
ATOM   4432 O  O   . LEU A 1 556 ? 15.822  63.168 75.435  1.00 15.71  ? 555  LEU A O   1 
ATOM   4433 C  CB  . LEU A 1 556 ? 15.921  64.531 78.318  1.00 18.40  ? 555  LEU A CB  1 
ATOM   4434 C  CG  . LEU A 1 556 ? 15.298  64.374 79.695  1.00 23.82  ? 555  LEU A CG  1 
ATOM   4435 C  CD1 . LEU A 1 556 ? 15.153  65.771 80.333  1.00 23.08  ? 555  LEU A CD1 1 
ATOM   4436 C  CD2 . LEU A 1 556 ? 13.934  63.692 79.583  1.00 18.63  ? 555  LEU A CD2 1 
ATOM   4437 N  N   . LYS A 1 557 ? 17.827  64.008 75.899  1.00 17.73  ? 556  LYS A N   1 
ATOM   4438 C  CA  . LYS A 1 557 ? 18.139  64.330 74.536  1.00 15.70  ? 556  LYS A CA  1 
ATOM   4439 C  C   . LYS A 1 557 ? 18.285  63.076 73.702  1.00 19.09  ? 556  LYS A C   1 
ATOM   4440 O  O   . LYS A 1 557 ? 17.690  62.959 72.626  1.00 19.08  ? 556  LYS A O   1 
ATOM   4441 C  CB  . LYS A 1 557 ? 19.380  65.206 74.530  1.00 15.52  ? 556  LYS A CB  1 
ATOM   4442 C  CG  . LYS A 1 557 ? 19.729  65.769 73.163  1.00 41.74  ? 556  LYS A CG  1 
ATOM   4443 C  CD  . LYS A 1 557 ? 21.020  66.590 73.160  1.00 77.82  ? 556  LYS A CD  1 
ATOM   4444 C  CE  . LYS A 1 557 ? 21.851  66.449 71.883  1.00 79.74  ? 556  LYS A CE  1 
ATOM   4445 N  NZ  . LYS A 1 557 ? 22.446  67.709 71.404  1.00 60.52  ? 556  LYS A NZ  1 
ATOM   4446 N  N   . MET A 1 558 ? 19.089  62.128 74.207  1.00 15.27  ? 557  MET A N   1 
ATOM   4447 C  CA  . MET A 1 558 ? 19.294  60.904 73.446  1.00 13.47  ? 557  MET A CA  1 
ATOM   4448 C  C   . MET A 1 558 ? 17.997  60.140 73.264  1.00 16.45  ? 557  MET A C   1 
ATOM   4449 O  O   . MET A 1 558 ? 17.723  59.507 72.253  1.00 15.63  ? 557  MET A O   1 
ATOM   4450 C  CB  . MET A 1 558 ? 20.312  59.998 74.165  1.00 14.26  ? 557  MET A CB  1 
ATOM   4451 C  CG  . MET A 1 558 ? 20.499  58.682 73.405  1.00 13.00  ? 557  MET A CG  1 
ATOM   4452 S  SD  . MET A 1 558 ? 21.984  57.796 73.915  1.00 16.44  ? 557  MET A SD  1 
ATOM   4453 C  CE  . MET A 1 558 ? 22.027  56.574 72.596  1.00 12.39  ? 557  MET A CE  1 
ATOM   4454 N  N   . ALA A 1 559 ? 17.200  60.181 74.327  1.00 18.08  ? 558  ALA A N   1 
ATOM   4455 C  CA  . ALA A 1 559 ? 15.955  59.438 74.323  1.00 17.49  ? 558  ALA A CA  1 
ATOM   4456 C  C   . ALA A 1 559 ? 14.968  59.922 73.292  1.00 23.08  ? 558  ALA A C   1 
ATOM   4457 O  O   . ALA A 1 559 ? 14.221  59.153 72.723  1.00 21.14  ? 558  ALA A O   1 
ATOM   4458 C  CB  . ALA A 1 559 ? 15.316  59.439 75.705  1.00 16.55  ? 558  ALA A CB  1 
ATOM   4459 N  N   . THR A 1 560 ? 14.951  61.220 73.082  1.00 18.89  ? 559  THR A N   1 
ATOM   4460 C  CA  . THR A 1 560 ? 13.980  61.798 72.186  1.00 19.50  ? 559  THR A CA  1 
ATOM   4461 C  C   . THR A 1 560 ? 14.542  62.125 70.830  1.00 22.12  ? 559  THR A C   1 
ATOM   4462 O  O   . THR A 1 560 ? 13.804  62.219 69.862  1.00 23.28  ? 559  THR A O   1 
ATOM   4463 C  CB  . THR A 1 560 ? 13.418  63.078 72.824  1.00 25.23  ? 559  THR A CB  1 
ATOM   4464 O  OG1 . THR A 1 560 ? 14.493  63.999 73.001  1.00 22.20  ? 559  THR A OG1 1 
ATOM   4465 C  CG2 . THR A 1 560 ? 12.734  62.723 74.147  1.00 18.19  ? 559  THR A CG2 1 
ATOM   4466 N  N   . GLU A 1 561 ? 15.841  62.316 70.756  1.00 16.68  ? 560  GLU A N   1 
ATOM   4467 C  CA  . GLU A 1 561 ? 16.399  62.646 69.479  1.00 18.60  ? 560  GLU A CA  1 
ATOM   4468 C  C   . GLU A 1 561 ? 16.492  61.448 68.545  1.00 26.45  ? 560  GLU A C   1 
ATOM   4469 O  O   . GLU A 1 561 ? 16.714  61.608 67.344  1.00 21.93  ? 560  GLU A O   1 
ATOM   4470 C  CB  . GLU A 1 561 ? 17.748  63.317 69.640  1.00 21.55  ? 560  GLU A CB  1 
ATOM   4471 C  CG  . GLU A 1 561 ? 17.623  64.757 70.136  1.00 38.31  ? 560  GLU A CG  1 
ATOM   4472 C  CD  . GLU A 1 561 ? 18.990  65.352 70.221  1.00 55.37  ? 560  GLU A CD  1 
ATOM   4473 O  OE1 . GLU A 1 561 ? 20.007  64.691 70.053  1.00 40.21  ? 560  GLU A OE1 1 
ATOM   4474 O  OE2 . GLU A 1 561 ? 18.946  66.627 70.504  1.00 55.04  ? 560  GLU A OE2 1 
ATOM   4475 N  N   . GLN A 1 562 ? 16.344  60.251 69.101  1.00 20.47  ? 561  GLN A N   1 
ATOM   4476 C  CA  . GLN A 1 562 ? 16.340  59.043 68.291  1.00 19.24  ? 561  GLN A CA  1 
ATOM   4477 C  C   . GLN A 1 562 ? 15.283  58.189 68.921  1.00 18.06  ? 561  GLN A C   1 
ATOM   4478 O  O   . GLN A 1 562 ? 14.874  58.520 70.022  1.00 16.87  ? 561  GLN A O   1 
ATOM   4479 C  CB  . GLN A 1 562 ? 17.684  58.307 68.136  1.00 20.45  ? 561  GLN A CB  1 
ATOM   4480 C  CG  . GLN A 1 562 ? 18.341  58.001 69.495  1.00 21.17  ? 561  GLN A CG  1 
ATOM   4481 C  CD  . GLN A 1 562 ? 17.692  56.815 70.165  1.00 21.31  ? 561  GLN A CD  1 
ATOM   4482 O  OE1 . GLN A 1 562 ? 17.302  56.877 71.344  1.00 23.07  ? 561  GLN A OE1 1 
ATOM   4483 N  NE2 . GLN A 1 562 ? 17.543  55.758 69.379  1.00 11.21  ? 561  GLN A NE2 1 
ATOM   4484 N  N   . GLY A 1 563 ? 14.821  57.148 68.239  1.00 16.15  ? 562  GLY A N   1 
ATOM   4485 C  CA  . GLY A 1 563 ? 13.758  56.367 68.827  1.00 14.79  ? 562  GLY A CA  1 
ATOM   4486 C  C   . GLY A 1 563 ? 13.919  54.872 68.750  1.00 17.42  ? 562  GLY A C   1 
ATOM   4487 O  O   . GLY A 1 563 ? 12.941  54.134 68.842  1.00 22.06  ? 562  GLY A O   1 
ATOM   4488 N  N   . ARG A 1 564 ? 15.152  54.424 68.598  1.00 18.35  ? 563  ARG A N   1 
ATOM   4489 C  CA  . ARG A 1 564 ? 15.453  52.990 68.617  1.00 18.80  ? 563  ARG A CA  1 
ATOM   4490 C  C   . ARG A 1 564 ? 15.023  52.501 70.018  1.00 16.67  ? 563  ARG A C   1 
ATOM   4491 O  O   . ARG A 1 564 ? 15.518  52.925 71.085  1.00 14.27  ? 563  ARG A O   1 
ATOM   4492 C  CB  . ARG A 1 564 ? 16.949  52.812 68.321  1.00 16.78  ? 563  ARG A CB  1 
ATOM   4493 C  CG  . ARG A 1 564 ? 17.394  51.363 68.218  1.00 14.43  ? 563  ARG A CG  1 
ATOM   4494 C  CD  . ARG A 1 564 ? 18.911  51.276 68.095  1.00 15.41  ? 563  ARG A CD  1 
ATOM   4495 N  NE  . ARG A 1 564 ? 19.423  49.897 68.119  1.00 19.33  ? 563  ARG A NE  1 
ATOM   4496 C  CZ  . ARG A 1 564 ? 20.683  49.669 67.774  1.00 19.66  ? 563  ARG A CZ  1 
ATOM   4497 N  NH1 . ARG A 1 564 ? 21.482  50.681 67.417  1.00 10.67  ? 563  ARG A NH1 1 
ATOM   4498 N  NH2 . ARG A 1 564 ? 21.148  48.428 67.779  1.00 13.38  ? 563  ARG A NH2 1 
ATOM   4499 N  N   . MET A 1 565 ? 14.003  51.648 70.069  1.00 13.84  ? 564  MET A N   1 
ATOM   4500 C  CA  . MET A 1 565 ? 13.447  51.247 71.369  1.00 13.05  ? 564  MET A CA  1 
ATOM   4501 C  C   . MET A 1 565 ? 14.443  50.787 72.419  1.00 18.69  ? 564  MET A C   1 
ATOM   4502 O  O   . MET A 1 565 ? 14.257  50.973 73.628  1.00 12.40  ? 564  MET A O   1 
ATOM   4503 C  CB  . MET A 1 565 ? 12.315  50.212 71.198  1.00 13.81  ? 564  MET A CB  1 
ATOM   4504 C  CG  . MET A 1 565 ? 11.159  50.825 70.424  1.00 16.20  ? 564  MET A CG  1 
ATOM   4505 S  SD  . MET A 1 565 ? 9.692   49.805 70.530  1.00 21.23  ? 564  MET A SD  1 
ATOM   4506 C  CE  . MET A 1 565 ? 10.114  48.581 69.265  1.00 17.64  ? 564  MET A CE  1 
ATOM   4507 N  N   . LYS A 1 566 ? 15.464  50.097 71.892  1.00 16.37  ? 565  LYS A N   1 
ATOM   4508 C  CA  . LYS A 1 566 ? 16.521  49.537 72.701  1.00 13.75  ? 565  LYS A CA  1 
ATOM   4509 C  C   . LYS A 1 566 ? 17.129  50.623 73.582  1.00 16.90  ? 565  LYS A C   1 
ATOM   4510 O  O   . LYS A 1 566 ? 17.493  50.376 74.735  1.00 14.97  ? 565  LYS A O   1 
ATOM   4511 C  CB  . LYS A 1 566 ? 17.549  48.885 71.767  1.00 11.37  ? 565  LYS A CB  1 
ATOM   4512 C  CG  . LYS A 1 566 ? 18.793  48.371 72.459  1.00 12.72  ? 565  LYS A CG  1 
ATOM   4513 C  CD  . LYS A 1 566 ? 19.962  48.100 71.525  1.00 17.72  ? 565  LYS A CD  1 
ATOM   4514 C  CE  . LYS A 1 566 ? 21.060  47.336 72.239  1.00 19.39  ? 565  LYS A CE  1 
ATOM   4515 N  NZ  . LYS A 1 566 ? 22.030  46.721 71.308  1.00 15.47  ? 565  LYS A NZ  1 
ATOM   4516 N  N   . PHE A 1 567 ? 17.211  51.847 73.057  1.00 12.01  ? 566  PHE A N   1 
ATOM   4517 C  CA  . PHE A 1 567 ? 17.801  52.912 73.846  1.00 12.25  ? 566  PHE A CA  1 
ATOM   4518 C  C   . PHE A 1 567 ? 16.739  53.770 74.509  1.00 15.74  ? 566  PHE A C   1 
ATOM   4519 O  O   . PHE A 1 567 ? 16.843  54.177 75.661  1.00 12.91  ? 566  PHE A O   1 
ATOM   4520 C  CB  . PHE A 1 567 ? 18.641  53.814 72.932  1.00 12.87  ? 566  PHE A CB  1 
ATOM   4521 C  CG  . PHE A 1 567 ? 19.744  53.117 72.165  1.00 14.44  ? 566  PHE A CG  1 
ATOM   4522 C  CD1 . PHE A 1 567 ? 20.465  52.053 72.714  1.00 13.84  ? 566  PHE A CD1 1 
ATOM   4523 C  CD2 . PHE A 1 567 ? 20.111  53.577 70.894  1.00 15.31  ? 566  PHE A CD2 1 
ATOM   4524 C  CE1 . PHE A 1 567 ? 21.510  51.434 72.014  1.00 13.86  ? 566  PHE A CE1 1 
ATOM   4525 C  CE2 . PHE A 1 567 ? 21.145  52.977 70.172  1.00 14.39  ? 566  PHE A CE2 1 
ATOM   4526 C  CZ  . PHE A 1 567 ? 21.849  51.910 70.744  1.00 15.76  ? 566  PHE A CZ  1 
ATOM   4527 N  N   . THR A 1 568 ? 15.721  54.095 73.724  1.00 16.10  ? 567  THR A N   1 
ATOM   4528 C  CA  . THR A 1 568 ? 14.642  54.966 74.184  1.00 14.70  ? 567  THR A CA  1 
ATOM   4529 C  C   . THR A 1 568 ? 13.876  54.518 75.423  1.00 14.32  ? 567  THR A C   1 
ATOM   4530 O  O   . THR A 1 568 ? 13.615  55.315 76.346  1.00 14.88  ? 567  THR A O   1 
ATOM   4531 C  CB  . THR A 1 568 ? 13.707  55.409 73.030  1.00 14.81  ? 567  THR A CB  1 
ATOM   4532 O  OG1 . THR A 1 568 ? 14.465  56.204 72.148  1.00 15.28  ? 567  THR A OG1 1 
ATOM   4533 C  CG2 . THR A 1 568 ? 12.520  56.196 73.596  1.00 14.89  ? 567  THR A CG2 1 
ATOM   4534 N  N   . ARG A 1 569 ? 13.478  53.245 75.412  1.00 12.20  ? 568  ARG A N   1 
ATOM   4535 C  CA  . ARG A 1 569 ? 12.697  52.764 76.533  1.00 13.57  ? 568  ARG A CA  1 
ATOM   4536 C  C   . ARG A 1 569 ? 13.393  52.797 77.876  1.00 14.85  ? 568  ARG A C   1 
ATOM   4537 O  O   . ARG A 1 569 ? 12.896  53.312 78.861  1.00 14.39  ? 568  ARG A O   1 
ATOM   4538 C  CB  . ARG A 1 569 ? 12.133  51.400 76.218  1.00 13.49  ? 568  ARG A CB  1 
ATOM   4539 C  CG  . ARG A 1 569 ? 11.021  51.467 75.155  1.00 14.02  ? 568  ARG A CG  1 
ATOM   4540 C  CD  . ARG A 1 569 ? 10.387  50.098 74.884  1.00 9.84   ? 568  ARG A CD  1 
ATOM   4541 N  NE  . ARG A 1 569 ? 9.662   49.607 76.063  1.00 13.61  ? 568  ARG A NE  1 
ATOM   4542 C  CZ  . ARG A 1 569 ? 9.236   48.368 76.197  1.00 17.32  ? 568  ARG A CZ  1 
ATOM   4543 N  NH1 . ARG A 1 569 ? 9.471   47.427 75.275  1.00 13.23  ? 568  ARG A NH1 1 
ATOM   4544 N  NH2 . ARG A 1 569 ? 8.566   48.053 77.293  1.00 13.32  ? 568  ARG A NH2 1 
ATOM   4545 N  N   . PRO A 1 570 ? 14.577  52.237 77.948  1.00 12.95  ? 569  PRO A N   1 
ATOM   4546 C  CA  . PRO A 1 570 ? 15.294  52.206 79.229  1.00 10.82  ? 569  PRO A CA  1 
ATOM   4547 C  C   . PRO A 1 570 ? 15.810  53.574 79.653  1.00 15.13  ? 569  PRO A C   1 
ATOM   4548 O  O   . PRO A 1 570 ? 15.977  53.859 80.849  1.00 14.45  ? 569  PRO A O   1 
ATOM   4549 C  CB  . PRO A 1 570 ? 16.479  51.262 79.000  1.00 14.29  ? 569  PRO A CB  1 
ATOM   4550 C  CG  . PRO A 1 570 ? 16.245  50.553 77.659  1.00 17.55  ? 569  PRO A CG  1 
ATOM   4551 C  CD  . PRO A 1 570 ? 15.224  51.385 76.897  1.00 16.15  ? 569  PRO A CD  1 
ATOM   4552 N  N   . LEU A 1 571 ? 16.069  54.462 78.685  1.00 15.08  ? 570  LEU A N   1 
ATOM   4553 C  CA  . LEU A 1 571 ? 16.502  55.813 79.082  1.00 16.35  ? 570  LEU A CA  1 
ATOM   4554 C  C   . LEU A 1 571 ? 15.321  56.509 79.784  1.00 19.34  ? 570  LEU A C   1 
ATOM   4555 O  O   . LEU A 1 571 ? 15.401  57.045 80.898  1.00 16.13  ? 570  LEU A O   1 
ATOM   4556 C  CB  . LEU A 1 571 ? 16.944  56.615 77.840  1.00 16.51  ? 570  LEU A CB  1 
ATOM   4557 C  CG  . LEU A 1 571 ? 18.372  56.269 77.386  1.00 18.67  ? 570  LEU A CG  1 
ATOM   4558 C  CD1 . LEU A 1 571 ? 18.737  57.028 76.110  1.00 16.85  ? 570  LEU A CD1 1 
ATOM   4559 C  CD2 . LEU A 1 571 ? 19.392  56.601 78.486  1.00 14.01  ? 570  LEU A CD2 1 
ATOM   4560 N  N   . PHE A 1 572 ? 14.161  56.435 79.129  1.00 14.02  ? 571  PHE A N   1 
ATOM   4561 C  CA  . PHE A 1 572 ? 12.978  57.007 79.732  1.00 14.67  ? 571  PHE A CA  1 
ATOM   4562 C  C   . PHE A 1 572 ? 12.684  56.323 81.054  1.00 18.94  ? 571  PHE A C   1 
ATOM   4563 O  O   . PHE A 1 572 ? 12.257  56.933 82.030  1.00 18.09  ? 571  PHE A O   1 
ATOM   4564 C  CB  . PHE A 1 572 ? 11.721  56.805 78.872  1.00 14.94  ? 571  PHE A CB  1 
ATOM   4565 C  CG  . PHE A 1 572 ? 11.462  57.993 78.014  1.00 17.38  ? 571  PHE A CG  1 
ATOM   4566 C  CD1 . PHE A 1 572 ? 11.035  59.194 78.591  1.00 18.00  ? 571  PHE A CD1 1 
ATOM   4567 C  CD2 . PHE A 1 572 ? 11.634  57.902 76.633  1.00 19.72  ? 571  PHE A CD2 1 
ATOM   4568 C  CE1 . PHE A 1 572 ? 10.768  60.317 77.805  1.00 17.86  ? 571  PHE A CE1 1 
ATOM   4569 C  CE2 . PHE A 1 572 ? 11.358  59.016 75.836  1.00 23.80  ? 571  PHE A CE2 1 
ATOM   4570 C  CZ  . PHE A 1 572 ? 10.933  60.213 76.422  1.00 22.47  ? 571  PHE A CZ  1 
ATOM   4571 N  N   . LYS A 1 573 ? 12.839  55.023 81.080  1.00 14.21  ? 572  LYS A N   1 
ATOM   4572 C  CA  . LYS A 1 573 ? 12.530  54.361 82.325  1.00 14.07  ? 572  LYS A CA  1 
ATOM   4573 C  C   . LYS A 1 573 ? 13.476  54.788 83.444  1.00 16.22  ? 572  LYS A C   1 
ATOM   4574 O  O   . LYS A 1 573 ? 13.123  54.998 84.620  1.00 16.74  ? 572  LYS A O   1 
ATOM   4575 C  CB  . LYS A 1 573 ? 12.533  52.850 82.147  1.00 15.58  ? 572  LYS A CB  1 
ATOM   4576 C  CG  . LYS A 1 573 ? 11.179  52.157 82.243  1.00 32.41  ? 572  LYS A CG  1 
ATOM   4577 C  CD  . LYS A 1 573 ? 11.197  50.722 81.697  1.00 46.79  ? 572  LYS A CD  1 
ATOM   4578 C  CE  . LYS A 1 573 ? 11.249  50.620 80.160  1.00 56.38  ? 572  LYS A CE  1 
ATOM   4579 N  NZ  . LYS A 1 573 ? 11.823  49.373 79.593  1.00 42.31  ? 572  LYS A NZ  1 
ATOM   4580 N  N   . ASP A 1 574 ? 14.735  54.914 83.089  1.00 14.00  ? 573  ASP A N   1 
ATOM   4581 C  CA  . ASP A 1 574 ? 15.671  55.286 84.148  1.00 15.33  ? 573  ASP A CA  1 
ATOM   4582 C  C   . ASP A 1 574 ? 15.394  56.675 84.662  1.00 15.63  ? 573  ASP A C   1 
ATOM   4583 O  O   . ASP A 1 574 ? 15.531  56.959 85.850  1.00 15.64  ? 573  ASP A O   1 
ATOM   4584 C  CB  . ASP A 1 574 ? 17.137  55.288 83.627  1.00 14.94  ? 573  ASP A CB  1 
ATOM   4585 C  CG  . ASP A 1 574 ? 17.688  53.889 83.452  1.00 22.26  ? 573  ASP A CG  1 
ATOM   4586 O  OD1 . ASP A 1 574 ? 17.054  52.891 83.773  1.00 18.66  ? 573  ASP A OD1 1 
ATOM   4587 O  OD2 . ASP A 1 574 ? 18.923  53.848 82.983  1.00 18.27  ? 573  ASP A OD2 1 
ATOM   4588 N  N   . LEU A 1 575 ? 15.090  57.554 83.708  1.00 12.68  ? 574  LEU A N   1 
ATOM   4589 C  CA  . LEU A 1 575 ? 14.851  58.926 84.092  1.00 11.33  ? 574  LEU A CA  1 
ATOM   4590 C  C   . LEU A 1 575 ? 13.611  59.053 84.970  1.00 22.78  ? 574  LEU A C   1 
ATOM   4591 O  O   . LEU A 1 575 ? 13.513  59.923 85.837  1.00 18.71  ? 574  LEU A O   1 
ATOM   4592 C  CB  . LEU A 1 575 ? 14.682  59.802 82.863  1.00 10.39  ? 574  LEU A CB  1 
ATOM   4593 C  CG  . LEU A 1 575 ? 15.953  60.021 82.061  1.00 16.41  ? 574  LEU A CG  1 
ATOM   4594 C  CD1 . LEU A 1 575 ? 15.501  60.352 80.630  1.00 16.48  ? 574  LEU A CD1 1 
ATOM   4595 C  CD2 . LEU A 1 575 ? 16.785  61.200 82.608  1.00 12.08  ? 574  LEU A CD2 1 
ATOM   4596 N  N   . ALA A 1 576 ? 12.638  58.173 84.726  1.00 17.79  ? 575  ALA A N   1 
ATOM   4597 C  CA  . ALA A 1 576 ? 11.437  58.235 85.500  1.00 15.87  ? 575  ALA A CA  1 
ATOM   4598 C  C   . ALA A 1 576 ? 11.720  57.682 86.856  1.00 17.98  ? 575  ALA A C   1 
ATOM   4599 O  O   . ALA A 1 576 ? 11.050  58.033 87.801  1.00 17.45  ? 575  ALA A O   1 
ATOM   4600 C  CB  . ALA A 1 576 ? 10.325  57.449 84.820  1.00 17.20  ? 575  ALA A CB  1 
ATOM   4601 N  N   . ALA A 1 577 ? 12.703  56.801 86.972  1.00 14.91  ? 576  ALA A N   1 
ATOM   4602 C  CA  . ALA A 1 577 ? 13.024  56.222 88.272  1.00 12.59  ? 576  ALA A CA  1 
ATOM   4603 C  C   . ALA A 1 577 ? 13.930  57.135 89.097  1.00 19.97  ? 576  ALA A C   1 
ATOM   4604 O  O   . ALA A 1 577 ? 14.140  56.920 90.281  1.00 22.87  ? 576  ALA A O   1 
ATOM   4605 C  CB  . ALA A 1 577 ? 13.732  54.881 88.146  1.00 16.01  ? 576  ALA A CB  1 
ATOM   4606 N  N   . PHE A 1 578 ? 14.474  58.152 88.469  1.00 15.13  ? 577  PHE A N   1 
ATOM   4607 C  CA  . PHE A 1 578 ? 15.337  59.105 89.161  1.00 15.19  ? 577  PHE A CA  1 
ATOM   4608 C  C   . PHE A 1 578 ? 14.412  60.219 89.660  1.00 19.07  ? 577  PHE A C   1 
ATOM   4609 O  O   . PHE A 1 578 ? 13.790  60.932 88.868  1.00 16.74  ? 577  PHE A O   1 
ATOM   4610 C  CB  . PHE A 1 578 ? 16.447  59.652 88.210  1.00 14.02  ? 577  PHE A CB  1 
ATOM   4611 C  CG  . PHE A 1 578 ? 17.494  60.595 88.820  1.00 15.39  ? 577  PHE A CG  1 
ATOM   4612 C  CD1 . PHE A 1 578 ? 17.678  60.707 90.202  1.00 17.32  ? 577  PHE A CD1 1 
ATOM   4613 C  CD2 . PHE A 1 578 ? 18.295  61.380 87.983  1.00 15.42  ? 577  PHE A CD2 1 
ATOM   4614 C  CE1 . PHE A 1 578 ? 18.646  61.570 90.727  1.00 18.05  ? 577  PHE A CE1 1 
ATOM   4615 C  CE2 . PHE A 1 578 ? 19.272  62.236 88.483  1.00 18.23  ? 577  PHE A CE2 1 
ATOM   4616 C  CZ  . PHE A 1 578 ? 19.442  62.330 89.866  1.00 18.02  ? 577  PHE A CZ  1 
ATOM   4617 N  N   . ASP A 1 579 ? 14.285  60.335 90.983  1.00 19.21  ? 578  ASP A N   1 
ATOM   4618 C  CA  . ASP A 1 579 ? 13.394  61.327 91.584  1.00 19.27  ? 578  ASP A CA  1 
ATOM   4619 C  C   . ASP A 1 579 ? 13.568  62.692 90.981  1.00 18.95  ? 578  ASP A C   1 
ATOM   4620 O  O   . ASP A 1 579 ? 12.577  63.347 90.660  1.00 18.48  ? 578  ASP A O   1 
ATOM   4621 C  CB  . ASP A 1 579 ? 13.457  61.342 93.130  1.00 28.60  ? 578  ASP A CB  1 
ATOM   4622 C  CG  . ASP A 1 579 ? 14.714  61.992 93.690  1.00 55.79  ? 578  ASP A CG  1 
ATOM   4623 O  OD1 . ASP A 1 579 ? 15.779  62.135 93.064  1.00 45.74  ? 578  ASP A OD1 1 
ATOM   4624 O  OD2 . ASP A 1 579 ? 14.512  62.401 94.929  1.00 67.85  ? 578  ASP A OD2 1 
ATOM   4625 N  N   . LYS A 1 580 ? 14.839  63.083 90.791  1.00 17.12  ? 579  LYS A N   1 
ATOM   4626 C  CA  . LYS A 1 580 ? 15.185  64.352 90.194  1.00 13.88  ? 579  LYS A CA  1 
ATOM   4627 C  C   . LYS A 1 580 ? 14.693  64.569 88.758  1.00 21.03  ? 579  LYS A C   1 
ATOM   4628 O  O   . LYS A 1 580 ? 14.338  65.689 88.386  1.00 20.91  ? 579  LYS A O   1 
ATOM   4629 C  CB  . LYS A 1 580 ? 16.669  64.621 90.293  1.00 13.46  ? 579  LYS A CB  1 
ATOM   4630 C  CG  . LYS A 1 580 ? 17.159  64.570 91.724  1.00 33.01  ? 579  LYS A CG  1 
ATOM   4631 C  CD  . LYS A 1 580 ? 16.890  65.878 92.442  1.00 55.78  ? 579  LYS A CD  1 
ATOM   4632 C  CE  . LYS A 1 580 ? 16.292  65.662 93.816  1.00 58.11  ? 579  LYS A CE  1 
ATOM   4633 N  NZ  . LYS A 1 580 ? 17.121  66.260 94.867  1.00 54.50  ? 579  LYS A NZ  1 
ATOM   4634 N  N   . SER A 1 581 ? 14.646  63.553 87.897  1.00 14.45  ? 580  SER A N   1 
ATOM   4635 C  CA  . SER A 1 581 ? 14.187  63.844 86.540  1.00 13.57  ? 580  SER A CA  1 
ATOM   4636 C  C   . SER A 1 581 ? 12.798  63.298 86.228  1.00 20.81  ? 580  SER A C   1 
ATOM   4637 O  O   . SER A 1 581 ? 12.313  63.384 85.103  1.00 19.66  ? 580  SER A O   1 
ATOM   4638 C  CB  . SER A 1 581 ? 15.113  63.091 85.601  1.00 12.97  ? 580  SER A CB  1 
ATOM   4639 O  OG  . SER A 1 581 ? 15.350  61.809 86.186  1.00 17.95  ? 580  SER A OG  1 
ATOM   4640 N  N   . HIS A 1 582 ? 12.184  62.664 87.196  1.00 16.52  ? 581  HIS A N   1 
ATOM   4641 C  CA  . HIS A 1 582 ? 10.897  62.042 86.971  1.00 16.52  ? 581  HIS A CA  1 
ATOM   4642 C  C   . HIS A 1 582 ? 9.816   62.866 86.281  1.00 21.39  ? 581  HIS A C   1 
ATOM   4643 O  O   . HIS A 1 582 ? 9.250   62.522 85.234  1.00 18.75  ? 581  HIS A O   1 
ATOM   4644 C  CB  . HIS A 1 582 ? 10.389  61.487 88.289  1.00 15.62  ? 581  HIS A CB  1 
ATOM   4645 C  CG  . HIS A 1 582 ? 9.034   60.927 88.100  1.00 22.66  ? 581  HIS A CG  1 
ATOM   4646 N  ND1 . HIS A 1 582 ? 7.914   61.748 88.110  1.00 27.83  ? 581  HIS A ND1 1 
ATOM   4647 C  CD2 . HIS A 1 582 ? 8.623   59.644 87.899  1.00 27.04  ? 581  HIS A CD2 1 
ATOM   4648 C  CE1 . HIS A 1 582 ? 6.843   60.975 87.926  1.00 27.26  ? 581  HIS A CE1 1 
ATOM   4649 N  NE2 . HIS A 1 582 ? 7.242   59.715 87.789  1.00 28.84  ? 581  HIS A NE2 1 
ATOM   4650 N  N   . ASP A 1 583 ? 9.515   63.986 86.884  1.00 17.59  ? 582  ASP A N   1 
ATOM   4651 C  CA  . ASP A 1 583 ? 8.491   64.831 86.322  1.00 20.99  ? 582  ASP A CA  1 
ATOM   4652 C  C   . ASP A 1 583 ? 8.831   65.284 84.927  1.00 24.43  ? 582  ASP A C   1 
ATOM   4653 O  O   . ASP A 1 583 ? 8.013   65.343 84.030  1.00 21.69  ? 582  ASP A O   1 
ATOM   4654 C  CB  . ASP A 1 583 ? 8.331   66.085 87.197  1.00 25.08  ? 582  ASP A CB  1 
ATOM   4655 C  CG  . ASP A 1 583 ? 7.626   65.730 88.466  1.00 30.98  ? 582  ASP A CG  1 
ATOM   4656 O  OD1 . ASP A 1 583 ? 7.129   64.638 88.645  1.00 36.19  ? 582  ASP A OD1 1 
ATOM   4657 O  OD2 . ASP A 1 583 ? 7.659   66.680 89.359  1.00 38.67  ? 582  ASP A OD2 1 
ATOM   4658 N  N   . GLN A 1 584 ? 10.075  65.649 84.762  1.00 20.38  ? 583  GLN A N   1 
ATOM   4659 C  CA  . GLN A 1 584 ? 10.451  66.076 83.465  1.00 19.54  ? 583  GLN A CA  1 
ATOM   4660 C  C   . GLN A 1 584 ? 10.423  64.938 82.431  1.00 23.45  ? 583  GLN A C   1 
ATOM   4661 O  O   . GLN A 1 584 ? 10.182  65.148 81.229  1.00 23.51  ? 583  GLN A O   1 
ATOM   4662 C  CB  . GLN A 1 584 ? 11.857  66.642 83.573  1.00 19.50  ? 583  GLN A CB  1 
ATOM   4663 C  CG  . GLN A 1 584 ? 12.188  67.300 82.240  1.00 21.61  ? 583  GLN A CG  1 
ATOM   4664 C  CD  . GLN A 1 584 ? 13.503  68.019 82.370  1.00 44.67  ? 583  GLN A CD  1 
ATOM   4665 O  OE1 . GLN A 1 584 ? 14.236  67.818 83.357  1.00 39.11  ? 583  GLN A OE1 1 
ATOM   4666 N  NE2 . GLN A 1 584 ? 13.778  68.840 81.373  1.00 40.61  ? 583  GLN A NE2 1 
ATOM   4667 N  N   . ALA A 1 585 ? 10.706  63.718 82.866  1.00 18.70  ? 584  ALA A N   1 
ATOM   4668 C  CA  . ALA A 1 585 ? 10.700  62.595 81.927  1.00 15.00  ? 584  ALA A CA  1 
ATOM   4669 C  C   . ALA A 1 585 ? 9.307   62.411 81.375  1.00 19.16  ? 584  ALA A C   1 
ATOM   4670 O  O   . ALA A 1 585 ? 9.101   62.211 80.176  1.00 19.25  ? 584  ALA A O   1 
ATOM   4671 C  CB  . ALA A 1 585 ? 11.043  61.288 82.642  1.00 13.44  ? 584  ALA A CB  1 
ATOM   4672 N  N   . VAL A 1 586 ? 8.356   62.452 82.316  1.00 15.46  ? 585  VAL A N   1 
ATOM   4673 C  CA  . VAL A 1 586 ? 6.941   62.258 81.999  1.00 18.57  ? 585  VAL A CA  1 
ATOM   4674 C  C   . VAL A 1 586 ? 6.418   63.339 81.064  1.00 25.46  ? 585  VAL A C   1 
ATOM   4675 O  O   . VAL A 1 586 ? 5.743   63.106 80.055  1.00 23.63  ? 585  VAL A O   1 
ATOM   4676 C  CB  . VAL A 1 586 ? 6.090   62.120 83.274  1.00 23.07  ? 585  VAL A CB  1 
ATOM   4677 C  CG1 . VAL A 1 586 ? 4.610   62.298 82.946  1.00 23.53  ? 585  VAL A CG1 1 
ATOM   4678 C  CG2 . VAL A 1 586 ? 6.340   60.775 83.966  1.00 21.15  ? 585  VAL A CG2 1 
ATOM   4679 N  N   . ARG A 1 587 ? 6.792   64.564 81.405  1.00 23.81  ? 586  ARG A N   1 
ATOM   4680 C  CA  . ARG A 1 587 ? 6.395   65.688 80.615  1.00 22.41  ? 586  ARG A CA  1 
ATOM   4681 C  C   . ARG A 1 587 ? 6.974   65.628 79.223  1.00 22.13  ? 586  ARG A C   1 
ATOM   4682 O  O   . ARG A 1 587 ? 6.283   65.909 78.254  1.00 20.69  ? 586  ARG A O   1 
ATOM   4683 C  CB  . ARG A 1 587 ? 6.695   67.000 81.329  1.00 21.27  ? 586  ARG A CB  1 
ATOM   4684 C  CG  . ARG A 1 587 ? 6.573   68.251 80.461  1.00 39.32  ? 586  ARG A CG  1 
ATOM   4685 C  CD  . ARG A 1 587 ? 7.134   69.519 81.129  1.00 45.58  ? 586  ARG A CD  1 
ATOM   4686 N  NE  . ARG A 1 587 ? 7.498   69.270 82.525  1.00 68.78  ? 586  ARG A NE  1 
ATOM   4687 C  CZ  . ARG A 1 587 ? 8.712   69.427 83.074  1.00 82.97  ? 586  ARG A CZ  1 
ATOM   4688 N  NH1 . ARG A 1 587 ? 9.767   69.873 82.357  1.00 50.55  ? 586  ARG A NH1 1 
ATOM   4689 N  NH2 . ARG A 1 587 ? 8.842   69.129 84.383  1.00 31.22  ? 586  ARG A NH2 1 
ATOM   4690 N  N   . THR A 1 588 ? 8.231   65.247 79.095  1.00 19.40  ? 587  THR A N   1 
ATOM   4691 C  CA  . THR A 1 588 ? 8.856   65.157 77.781  1.00 18.84  ? 587  THR A CA  1 
ATOM   4692 C  C   . THR A 1 588 ? 8.150   64.170 76.882  1.00 20.71  ? 587  THR A C   1 
ATOM   4693 O  O   . THR A 1 588 ? 7.885   64.391 75.702  1.00 23.03  ? 587  THR A O   1 
ATOM   4694 C  CB  . THR A 1 588 ? 10.313  64.746 77.975  1.00 23.70  ? 587  THR A CB  1 
ATOM   4695 O  OG1 . THR A 1 588 ? 10.887  65.693 78.846  1.00 21.83  ? 587  THR A OG1 1 
ATOM   4696 C  CG2 . THR A 1 588 ? 11.048  64.672 76.654  1.00 21.38  ? 587  THR A CG2 1 
ATOM   4697 N  N   . TYR A 1 589 ? 7.822   63.043 77.464  1.00 21.74  ? 588  TYR A N   1 
ATOM   4698 C  CA  . TYR A 1 589 ? 7.137   62.033 76.693  1.00 19.43  ? 588  TYR A CA  1 
ATOM   4699 C  C   . TYR A 1 589 ? 5.808   62.573 76.151  1.00 24.31  ? 588  TYR A C   1 
ATOM   4700 O  O   . TYR A 1 589 ? 5.450   62.483 74.963  1.00 26.68  ? 588  TYR A O   1 
ATOM   4701 C  CB  . TYR A 1 589 ? 6.846   60.854 77.638  1.00 18.46  ? 588  TYR A CB  1 
ATOM   4702 C  CG  . TYR A 1 589 ? 5.842   59.904 77.014  1.00 21.76  ? 588  TYR A CG  1 
ATOM   4703 C  CD1 . TYR A 1 589 ? 6.169   59.136 75.891  1.00 22.44  ? 588  TYR A CD1 1 
ATOM   4704 C  CD2 . TYR A 1 589 ? 4.549   59.808 77.540  1.00 22.19  ? 588  TYR A CD2 1 
ATOM   4705 C  CE1 . TYR A 1 589 ? 5.217   58.274 75.335  1.00 26.93  ? 588  TYR A CE1 1 
ATOM   4706 C  CE2 . TYR A 1 589 ? 3.584   58.961 76.999  1.00 19.19  ? 588  TYR A CE2 1 
ATOM   4707 C  CZ  . TYR A 1 589 ? 3.936   58.191 75.890  1.00 25.45  ? 588  TYR A CZ  1 
ATOM   4708 O  OH  . TYR A 1 589 ? 3.008   57.335 75.359  1.00 24.42  ? 588  TYR A OH  1 
ATOM   4709 N  N   . GLN A 1 590 ? 5.039   63.110 77.088  1.00 23.42  ? 589  GLN A N   1 
ATOM   4710 C  CA  . GLN A 1 590 ? 3.727   63.642 76.762  1.00 22.93  ? 589  GLN A CA  1 
ATOM   4711 C  C   . GLN A 1 590 ? 3.806   64.594 75.596  1.00 20.18  ? 589  GLN A C   1 
ATOM   4712 O  O   . GLN A 1 590 ? 2.957   64.626 74.707  1.00 23.55  ? 589  GLN A O   1 
ATOM   4713 C  CB  . GLN A 1 590 ? 3.139   64.384 77.981  1.00 25.07  ? 589  GLN A CB  1 
ATOM   4714 C  CG  . GLN A 1 590 ? 2.683   63.449 79.119  1.00 21.54  ? 589  GLN A CG  1 
ATOM   4715 C  CD  . GLN A 1 590 ? 1.470   62.587 78.765  1.00 41.81  ? 589  GLN A CD  1 
ATOM   4716 O  OE1 . GLN A 1 590 ? 1.197   62.264 77.606  1.00 37.70  ? 589  GLN A OE1 1 
ATOM   4717 N  NE2 . GLN A 1 590 ? 0.721   62.186 79.779  1.00 58.94  ? 589  GLN A NE2 1 
ATOM   4718 N  N   . GLU A 1 591 ? 4.844   65.400 75.649  1.00 17.93  ? 590  GLU A N   1 
ATOM   4719 C  CA  . GLU A 1 591 ? 5.097   66.416 74.644  1.00 19.01  ? 590  GLU A CA  1 
ATOM   4720 C  C   . GLU A 1 591 ? 5.566   65.826 73.363  1.00 26.93  ? 590  GLU A C   1 
ATOM   4721 O  O   . GLU A 1 591 ? 5.393   66.453 72.312  1.00 23.86  ? 590  GLU A O   1 
ATOM   4722 C  CB  . GLU A 1 591 ? 6.176   67.452 75.021  1.00 20.73  ? 590  GLU A CB  1 
ATOM   4723 C  CG  . GLU A 1 591 ? 5.706   68.358 76.180  1.00 36.88  ? 590  GLU A CG  1 
ATOM   4724 C  CD  . GLU A 1 591 ? 6.810   69.187 76.769  1.00 62.73  ? 590  GLU A CD  1 
ATOM   4725 O  OE1 . GLU A 1 591 ? 7.988   69.112 76.403  1.00 55.19  ? 590  GLU A OE1 1 
ATOM   4726 O  OE2 . GLU A 1 591 ? 6.341   69.975 77.718  1.00 40.10  ? 590  GLU A OE2 1 
ATOM   4727 N  N   . HIS A 1 592 ? 6.203   64.666 73.476  1.00 23.79  ? 591  HIS A N   1 
ATOM   4728 C  CA  . HIS A 1 592 ? 6.700   64.086 72.250  1.00 23.24  ? 591  HIS A CA  1 
ATOM   4729 C  C   . HIS A 1 592 ? 5.818   63.013 71.689  1.00 20.50  ? 591  HIS A C   1 
ATOM   4730 O  O   . HIS A 1 592 ? 5.965   62.619 70.541  1.00 24.92  ? 591  HIS A O   1 
ATOM   4731 C  CB  . HIS A 1 592 ? 8.076   63.446 72.481  1.00 22.84  ? 591  HIS A CB  1 
ATOM   4732 C  CG  . HIS A 1 592 ? 9.175   64.446 72.384  1.00 25.11  ? 591  HIS A CG  1 
ATOM   4733 N  ND1 . HIS A 1 592 ? 9.381   65.385 73.378  1.00 28.84  ? 591  HIS A ND1 1 
ATOM   4734 C  CD2 . HIS A 1 592 ? 10.092  64.667 71.403  1.00 26.79  ? 591  HIS A CD2 1 
ATOM   4735 C  CE1 . HIS A 1 592 ? 10.408  66.147 72.984  1.00 27.18  ? 591  HIS A CE1 1 
ATOM   4736 N  NE2 . HIS A 1 592 ? 10.853  65.745 71.796  1.00 26.51  ? 591  HIS A NE2 1 
ATOM   4737 N  N   . LYS A 1 593 ? 4.939   62.487 72.503  1.00 19.36  ? 592  LYS A N   1 
ATOM   4738 C  CA  . LYS A 1 593 ? 4.202   61.366 71.988  1.00 19.14  ? 592  LYS A CA  1 
ATOM   4739 C  C   . LYS A 1 593 ? 3.553   61.382 70.613  1.00 28.03  ? 592  LYS A C   1 
ATOM   4740 O  O   . LYS A 1 593 ? 3.592   60.409 69.856  1.00 23.29  ? 592  LYS A O   1 
ATOM   4741 C  CB  . LYS A 1 593 ? 3.431   60.669 73.048  1.00 18.80  ? 592  LYS A CB  1 
ATOM   4742 C  CG  . LYS A 1 593 ? 2.321   61.545 73.519  1.00 26.37  ? 592  LYS A CG  1 
ATOM   4743 C  CD  . LYS A 1 593 ? 1.414   60.713 74.400  1.00 33.29  ? 592  LYS A CD  1 
ATOM   4744 C  CE  . LYS A 1 593 ? 0.018   61.301 74.523  1.00 45.98  ? 592  LYS A CE  1 
ATOM   4745 N  NZ  . LYS A 1 593 ? -0.530  61.163 75.874  1.00 25.02  ? 592  LYS A NZ  1 
ATOM   4746 N  N   . ALA A 1 594 ? 2.905   62.494 70.300  1.00 29.63  ? 593  ALA A N   1 
ATOM   4747 C  CA  . ALA A 1 594 ? 2.225   62.650 69.016  1.00 26.27  ? 593  ALA A CA  1 
ATOM   4748 C  C   . ALA A 1 594 ? 3.157   62.524 67.808  1.00 26.27  ? 593  ALA A C   1 
ATOM   4749 O  O   . ALA A 1 594 ? 2.741   62.121 66.732  1.00 28.39  ? 593  ALA A O   1 
ATOM   4750 C  CB  . ALA A 1 594 ? 1.558   64.018 68.998  1.00 24.94  ? 593  ALA A CB  1 
ATOM   4751 N  N   . SER A 1 595 ? 4.420   62.891 67.988  1.00 21.56  ? 594  SER A N   1 
ATOM   4752 C  CA  . SER A 1 595 ? 5.404   62.867 66.930  1.00 22.18  ? 594  SER A CA  1 
ATOM   4753 C  C   . SER A 1 595 ? 6.238   61.590 66.949  1.00 22.38  ? 594  SER A C   1 
ATOM   4754 O  O   . SER A 1 595 ? 7.160   61.444 66.137  1.00 20.87  ? 594  SER A O   1 
ATOM   4755 C  CB  . SER A 1 595 ? 6.352   64.049 67.098  1.00 29.27  ? 594  SER A CB  1 
ATOM   4756 O  OG  . SER A 1 595 ? 7.286   63.814 68.156  1.00 45.26  ? 594  SER A OG  1 
ATOM   4757 N  N   . MET A 1 596 ? 5.922   60.678 67.858  1.00 17.72  ? 595  MET A N   1 
ATOM   4758 C  CA  . MET A 1 596 ? 6.732   59.453 67.945  1.00 17.90  ? 595  MET A CA  1 
ATOM   4759 C  C   . MET A 1 596 ? 6.240   58.295 67.114  1.00 21.97  ? 595  MET A C   1 
ATOM   4760 O  O   . MET A 1 596 ? 5.105   58.257 66.683  1.00 26.36  ? 595  MET A O   1 
ATOM   4761 C  CB  . MET A 1 596 ? 6.717   58.931 69.396  1.00 17.35  ? 595  MET A CB  1 
ATOM   4762 C  CG  . MET A 1 596 ? 7.616   59.720 70.321  1.00 18.64  ? 595  MET A CG  1 
ATOM   4763 S  SD  . MET A 1 596 ? 7.451   59.068 71.999  1.00 25.54  ? 595  MET A SD  1 
ATOM   4764 C  CE  . MET A 1 596 ? 7.775   60.523 72.990  1.00 32.21  ? 595  MET A CE  1 
ATOM   4765 N  N   . HIS A 1 597 ? 7.066   57.284 66.954  1.00 15.02  ? 596  HIS A N   1 
ATOM   4766 C  CA  . HIS A 1 597 ? 6.593   56.105 66.258  1.00 16.62  ? 596  HIS A CA  1 
ATOM   4767 C  C   . HIS A 1 597 ? 5.458   55.524 67.111  1.00 19.77  ? 596  HIS A C   1 
ATOM   4768 O  O   . HIS A 1 597 ? 5.474   55.605 68.324  1.00 19.53  ? 596  HIS A O   1 
ATOM   4769 C  CB  . HIS A 1 597 ? 7.756   55.103 66.052  1.00 17.44  ? 596  HIS A CB  1 
ATOM   4770 C  CG  . HIS A 1 597 ? 7.280   53.844 65.414  1.00 20.36  ? 596  HIS A CG  1 
ATOM   4771 N  ND1 . HIS A 1 597 ? 7.474   53.623 64.059  1.00 22.76  ? 596  HIS A ND1 1 
ATOM   4772 C  CD2 . HIS A 1 597 ? 6.582   52.790 65.937  1.00 19.37  ? 596  HIS A CD2 1 
ATOM   4773 C  CE1 . HIS A 1 597 ? 6.928   52.443 63.770  1.00 21.23  ? 596  HIS A CE1 1 
ATOM   4774 N  NE2 . HIS A 1 597 ? 6.375   51.935 64.879  1.00 22.61  ? 596  HIS A NE2 1 
ATOM   4775 N  N   . PRO A 1 598 ? 4.425   54.948 66.507  1.00 19.72  ? 597  PRO A N   1 
ATOM   4776 C  CA  . PRO A 1 598 ? 3.284   54.409 67.233  1.00 17.32  ? 597  PRO A CA  1 
ATOM   4777 C  C   . PRO A 1 598 ? 3.515   53.268 68.221  1.00 22.24  ? 597  PRO A C   1 
ATOM   4778 O  O   . PRO A 1 598 ? 2.887   53.165 69.277  1.00 20.86  ? 597  PRO A O   1 
ATOM   4779 C  CB  . PRO A 1 598 ? 2.228   54.031 66.181  1.00 15.13  ? 597  PRO A CB  1 
ATOM   4780 C  CG  . PRO A 1 598 ? 2.989   53.918 64.893  1.00 20.16  ? 597  PRO A CG  1 
ATOM   4781 C  CD  . PRO A 1 598 ? 4.195   54.843 65.045  1.00 19.53  ? 597  PRO A CD  1 
ATOM   4782 N  N   . VAL A 1 599 ? 4.381   52.340 67.895  1.00 17.95  ? 598  VAL A N   1 
ATOM   4783 C  CA  . VAL A 1 599 ? 4.575   51.277 68.868  1.00 17.06  ? 598  VAL A CA  1 
ATOM   4784 C  C   . VAL A 1 599 ? 5.463   51.830 69.993  1.00 16.39  ? 598  VAL A C   1 
ATOM   4785 O  O   . VAL A 1 599 ? 5.188   51.629 71.176  1.00 18.72  ? 598  VAL A O   1 
ATOM   4786 C  CB  . VAL A 1 599 ? 5.175   50.039 68.180  1.00 20.87  ? 598  VAL A CB  1 
ATOM   4787 C  CG1 . VAL A 1 599 ? 5.739   48.974 69.142  1.00 15.98  ? 598  VAL A CG1 1 
ATOM   4788 C  CG2 . VAL A 1 599 ? 4.169   49.498 67.132  1.00 17.75  ? 598  VAL A CG2 1 
ATOM   4789 N  N   . THR A 1 600 ? 6.521   52.548 69.605  1.00 17.91  ? 599  THR A N   1 
ATOM   4790 C  CA  . THR A 1 600 ? 7.370   53.125 70.636  1.00 20.42  ? 599  THR A CA  1 
ATOM   4791 C  C   . THR A 1 600 ? 6.544   53.965 71.615  1.00 25.40  ? 599  THR A C   1 
ATOM   4792 O  O   . THR A 1 600 ? 6.683   53.931 72.848  1.00 18.93  ? 599  THR A O   1 
ATOM   4793 C  CB  . THR A 1 600 ? 8.436   53.999 69.997  1.00 17.80  ? 599  THR A CB  1 
ATOM   4794 O  OG1 . THR A 1 600 ? 9.082   53.238 68.989  1.00 19.92  ? 599  THR A OG1 1 
ATOM   4795 C  CG2 . THR A 1 600 ? 9.399   54.486 71.090  1.00 17.59  ? 599  THR A CG2 1 
ATOM   4796 N  N   . ALA A 1 601 ? 5.657   54.749 71.018  1.00 18.73  ? 600  ALA A N   1 
ATOM   4797 C  CA  . ALA A 1 601 ? 4.798   55.590 71.796  1.00 17.65  ? 600  ALA A CA  1 
ATOM   4798 C  C   . ALA A 1 601 ? 3.971   54.764 72.739  1.00 20.00  ? 600  ALA A C   1 
ATOM   4799 O  O   . ALA A 1 601 ? 3.867   55.053 73.932  1.00 21.50  ? 600  ALA A O   1 
ATOM   4800 C  CB  . ALA A 1 601 ? 3.869   56.344 70.879  1.00 19.26  ? 600  ALA A CB  1 
ATOM   4801 N  N   . MET A 1 602 ? 3.344   53.731 72.218  1.00 17.31  ? 601  MET A N   1 
ATOM   4802 C  CA  . MET A 1 602 ? 2.539   52.928 73.126  1.00 15.28  ? 601  MET A CA  1 
ATOM   4803 C  C   . MET A 1 602 ? 3.409   52.308 74.224  1.00 17.52  ? 601  MET A C   1 
ATOM   4804 O  O   . MET A 1 602 ? 3.018   52.245 75.371  1.00 15.39  ? 601  MET A O   1 
ATOM   4805 C  CB  . MET A 1 602 ? 1.761   51.815 72.369  1.00 16.44  ? 601  MET A CB  1 
ATOM   4806 C  CG  . MET A 1 602 ? 1.008   50.813 73.242  1.00 20.22  ? 601  MET A CG  1 
ATOM   4807 S  SD  . MET A 1 602 ? 1.962   49.492 74.103  1.00 24.22  ? 601  MET A SD  1 
ATOM   4808 C  CE  . MET A 1 602 ? 2.327   48.392 72.695  1.00 18.59  ? 601  MET A CE  1 
ATOM   4809 N  N   . LEU A 1 603 ? 4.580   51.778 73.889  1.00 16.21  ? 602  LEU A N   1 
ATOM   4810 C  CA  . LEU A 1 603 ? 5.389   51.117 74.924  1.00 16.19  ? 602  LEU A CA  1 
ATOM   4811 C  C   . LEU A 1 603 ? 5.940   52.055 76.027  1.00 18.15  ? 602  LEU A C   1 
ATOM   4812 O  O   . LEU A 1 603 ? 5.962   51.722 77.214  1.00 18.36  ? 602  LEU A O   1 
ATOM   4813 C  CB  . LEU A 1 603 ? 6.507   50.267 74.269  1.00 14.21  ? 602  LEU A CB  1 
ATOM   4814 C  CG  . LEU A 1 603 ? 5.987   49.058 73.508  1.00 18.02  ? 602  LEU A CG  1 
ATOM   4815 C  CD1 . LEU A 1 603 ? 7.100   48.467 72.642  1.00 17.78  ? 602  LEU A CD1 1 
ATOM   4816 C  CD2 . LEU A 1 603 ? 5.502   48.030 74.515  1.00 21.84  ? 602  LEU A CD2 1 
ATOM   4817 N  N   . VAL A 1 604 ? 6.426   53.224 75.617  1.00 15.71  ? 603  VAL A N   1 
ATOM   4818 C  CA  . VAL A 1 604 ? 6.962   54.208 76.549  1.00 15.67  ? 603  VAL A CA  1 
ATOM   4819 C  C   . VAL A 1 604 ? 5.877   54.648 77.537  1.00 17.35  ? 603  VAL A C   1 
ATOM   4820 O  O   . VAL A 1 604 ? 6.093   54.733 78.741  1.00 18.72  ? 603  VAL A O   1 
ATOM   4821 C  CB  . VAL A 1 604 ? 7.665   55.345 75.807  1.00 19.16  ? 603  VAL A CB  1 
ATOM   4822 C  CG1 . VAL A 1 604 ? 8.035   56.477 76.764  1.00 15.61  ? 603  VAL A CG1 1 
ATOM   4823 C  CG2 . VAL A 1 604 ? 8.943   54.837 75.115  1.00 17.56  ? 603  VAL A CG2 1 
ATOM   4824 N  N   . GLY A 1 605 ? 4.661   54.851 77.027  1.00 14.92  ? 604  GLY A N   1 
ATOM   4825 C  CA  . GLY A 1 605 ? 3.535   55.262 77.879  1.00 14.02  ? 604  GLY A CA  1 
ATOM   4826 C  C   . GLY A 1 605 ? 3.239   54.206 78.898  1.00 17.85  ? 604  GLY A C   1 
ATOM   4827 O  O   . GLY A 1 605 ? 2.984   54.443 80.075  1.00 21.21  ? 604  GLY A O   1 
ATOM   4828 N  N   . LYS A 1 606 ? 3.306   52.987 78.426  1.00 16.57  ? 605  LYS A N   1 
ATOM   4829 C  CA  . LYS A 1 606 ? 3.127   51.873 79.330  1.00 18.08  ? 605  LYS A CA  1 
ATOM   4830 C  C   . LYS A 1 606 ? 4.251   51.892 80.348  1.00 22.76  ? 605  LYS A C   1 
ATOM   4831 O  O   . LYS A 1 606 ? 4.034   51.859 81.558  1.00 26.27  ? 605  LYS A O   1 
ATOM   4832 C  CB  . LYS A 1 606 ? 3.190   50.541 78.607  1.00 22.73  ? 605  LYS A CB  1 
ATOM   4833 C  CG  . LYS A 1 606 ? 1.870   49.811 78.714  1.00 40.15  ? 605  LYS A CG  1 
ATOM   4834 C  CD  . LYS A 1 606 ? 1.919   48.377 78.211  1.00 57.40  ? 605  LYS A CD  1 
ATOM   4835 C  CE  . LYS A 1 606 ? 1.068   47.461 79.074  1.00 75.31  ? 605  LYS A CE  1 
ATOM   4836 N  NZ  . LYS A 1 606 ? 1.808   46.387 79.758  1.00 74.64  ? 605  LYS A NZ  1 
ATOM   4837 N  N   . ASP A 1 607 ? 5.470   51.943 79.836  1.00 17.17  ? 606  ASP A N   1 
ATOM   4838 C  CA  . ASP A 1 607 ? 6.607   51.972 80.718  1.00 16.61  ? 606  ASP A CA  1 
ATOM   4839 C  C   . ASP A 1 607 ? 6.442   53.059 81.738  1.00 19.46  ? 606  ASP A C   1 
ATOM   4840 O  O   . ASP A 1 607 ? 6.790   52.848 82.884  1.00 19.57  ? 606  ASP A O   1 
ATOM   4841 C  CB  . ASP A 1 607 ? 7.945   52.255 79.990  1.00 16.98  ? 606  ASP A CB  1 
ATOM   4842 C  CG  . ASP A 1 607 ? 8.365   51.063 79.187  1.00 21.21  ? 606  ASP A CG  1 
ATOM   4843 O  OD1 . ASP A 1 607 ? 7.944   49.933 79.376  1.00 20.21  ? 606  ASP A OD1 1 
ATOM   4844 O  OD2 . ASP A 1 607 ? 9.189   51.355 78.249  1.00 18.07  ? 606  ASP A OD2 1 
ATOM   4845 N  N   . LEU A 1 608 ? 5.974   54.207 81.306  1.00 16.61  ? 607  LEU A N   1 
ATOM   4846 C  CA  . LEU A 1 608 ? 5.863   55.352 82.211  1.00 20.64  ? 607  LEU A CA  1 
ATOM   4847 C  C   . LEU A 1 608 ? 4.586   55.384 83.026  1.00 27.05  ? 607  LEU A C   1 
ATOM   4848 O  O   . LEU A 1 608 ? 4.361   56.274 83.862  1.00 23.83  ? 607  LEU A O   1 
ATOM   4849 C  CB  . LEU A 1 608 ? 5.991   56.641 81.388  1.00 23.11  ? 607  LEU A CB  1 
ATOM   4850 C  CG  . LEU A 1 608 ? 7.377   57.301 81.464  1.00 28.84  ? 607  LEU A CG  1 
ATOM   4851 C  CD1 . LEU A 1 608 ? 8.508   56.323 81.711  1.00 29.33  ? 607  LEU A CD1 1 
ATOM   4852 C  CD2 . LEU A 1 608 ? 7.650   58.116 80.214  1.00 19.22  ? 607  LEU A CD2 1 
ATOM   4853 N  N   . LYS A 1 609 ? 3.739   54.409 82.739  1.00 21.45  ? 608  LYS A N   1 
ATOM   4854 C  CA  . LYS A 1 609 ? 2.504   54.308 83.446  1.00 22.51  ? 608  LYS A CA  1 
ATOM   4855 C  C   . LYS A 1 609 ? 1.657   55.529 83.202  1.00 31.79  ? 608  LYS A C   1 
ATOM   4856 O  O   . LYS A 1 609 ? 0.933   56.008 84.076  1.00 34.10  ? 608  LYS A O   1 
ATOM   4857 C  CB  . LYS A 1 609 ? 2.810   54.200 84.918  1.00 24.85  ? 608  LYS A CB  1 
ATOM   4858 C  CG  . LYS A 1 609 ? 3.190   52.782 85.308  1.00 45.51  ? 608  LYS A CG  1 
ATOM   4859 C  CD  . LYS A 1 609 ? 3.932   52.718 86.635  1.00 76.45  ? 608  LYS A CD  1 
ATOM   4860 C  CE  . LYS A 1 609 ? 4.251   51.291 87.078  1.00 100.00 ? 608  LYS A CE  1 
ATOM   4861 N  NZ  . LYS A 1 609 ? 4.137   51.050 88.533  1.00 100.00 ? 608  LYS A NZ  1 
ATOM   4862 N  N   . VAL A 1 610 ? 1.781   56.084 82.021  1.00 29.53  ? 609  VAL A N   1 
ATOM   4863 C  CA  . VAL A 1 610 ? 0.962   57.231 81.738  1.00 32.22  ? 609  VAL A CA  1 
ATOM   4864 C  C   . VAL A 1 610 ? -0.257  56.755 80.958  1.00 47.38  ? 609  VAL A C   1 
ATOM   4865 O  O   . VAL A 1 610 ? -0.150  55.800 80.186  1.00 49.22  ? 609  VAL A O   1 
ATOM   4866 C  CB  . VAL A 1 610 ? 1.679   58.328 80.966  1.00 38.27  ? 609  VAL A CB  1 
ATOM   4867 C  CG1 . VAL A 1 610 ? 3.188   58.240 81.067  1.00 38.12  ? 609  VAL A CG1 1 
ATOM   4868 C  CG2 . VAL A 1 610 ? 1.227   58.313 79.515  1.00 39.79  ? 609  VAL A CG2 1 
ATOM   4869 N  N   . ASP A 1 611 ? -1.402  57.415 81.173  1.00 49.29  ? 610  ASP A N   1 
ATOM   4870 C  CA  . ASP A 1 611 ? -2.675  57.124 80.510  1.00 98.66  ? 610  ASP A CA  1 
ATOM   4871 C  C   . ASP A 1 611 ? -3.541  56.207 81.365  1.00 100.00 ? 610  ASP A C   1 
ATOM   4872 O  O   . ASP A 1 611 ? -3.950  56.568 82.470  1.00 78.31  ? 610  ASP A O   1 
ATOM   4873 C  CB  . ASP A 1 611 ? -2.550  56.631 79.044  1.00 100.00 ? 610  ASP A CB  1 
ATOM   4874 C  CG  . ASP A 1 611 ? -1.930  57.631 78.091  1.00 100.00 ? 610  ASP A CG  1 
ATOM   4875 O  OD1 . ASP A 1 611 ? -2.251  58.807 78.062  1.00 99.48  ? 610  ASP A OD1 1 
ATOM   4876 O  OD2 . ASP A 1 611 ? -1.019  57.111 77.288  1.00 100.00 ? 610  ASP A OD2 1 
HETATM 4877 ZN ZN  . ZN  B 2 .   ? 16.972  39.340 64.102  1.00 16.33  ? 701  ZN  A ZN  1 
HETATM 4878 YB YB  . YB  C 3 .   ? 42.669  51.366 99.201  1.00 18.06  ? 801  YB  A YB  1 
HETATM 4879 YB YB  . YB  D 3 .   ? -13.732 57.497 52.155  0.50 46.53  ? 802  YB  A YB  1 
HETATM 4880 YB YB  . YB  E 3 .   ? -10.443 58.443 52.469  0.50 30.25  ? 803  YB  A YB  1 
HETATM 4881 C  C   . ACT F 4 .   ? 13.041  13.755 69.176  1.00 52.31  ? 1101 ACT A C   1 
HETATM 4882 O  O   . ACT F 4 .   ? 13.310  14.951 68.885  1.00 21.34  ? 1101 ACT A O   1 
HETATM 4883 O  OXT . ACT F 4 .   ? 12.075  13.324 69.958  1.00 27.10  ? 1101 ACT A OXT 1 
HETATM 4884 C  CH3 . ACT F 4 .   ? 13.753  12.531 68.686  1.00 39.29  ? 1101 ACT A CH3 1 
HETATM 4885 N  N2  . BES G 5 .   ? 13.712  41.186 63.145  1.00 25.72  ? 901  BES A N2  1 
HETATM 4886 C  C1  . BES G 5 .   ? 14.450  41.733 64.255  1.00 24.13  ? 901  BES A C1  1 
HETATM 4887 C  C6  . BES G 5 .   ? 13.749  42.939 64.880  1.00 23.84  ? 901  BES A C6  1 
HETATM 4888 C  C7  . BES G 5 .   ? 12.300  42.727 65.283  1.00 19.51  ? 901  BES A C7  1 
HETATM 4889 C  C8  . BES G 5 .   ? 11.297  43.571 64.799  1.00 18.42  ? 901  BES A C8  1 
HETATM 4890 C  C12 . BES G 5 .   ? 11.934  41.717 66.170  1.00 19.27  ? 901  BES A C12 1 
HETATM 4891 C  C9  . BES G 5 .   ? 9.990   43.454 65.227  1.00 16.90  ? 901  BES A C9  1 
HETATM 4892 C  C11 . BES G 5 .   ? 10.614  41.580 66.600  1.00 19.17  ? 901  BES A C11 1 
HETATM 4893 C  C10 . BES G 5 .   ? 9.639   42.451 66.135  1.00 18.42  ? 901  BES A C10 1 
HETATM 4894 C  C2  . BES G 5 .   ? 15.881  42.065 63.795  1.00 21.80  ? 901  BES A C2  1 
HETATM 4895 O  O2  . BES G 5 .   ? 16.369  41.004 62.999  1.00 18.60  ? 901  BES A O2  1 
HETATM 4896 C  C3  . BES G 5 .   ? 16.741  42.156 65.063  1.00 23.33  ? 901  BES A C3  1 
HETATM 4897 O  O3  . BES G 5 .   ? 16.932  41.185 65.803  1.00 25.68  ? 901  BES A O3  1 
HETATM 4898 N  N1  . BES G 5 .   ? 17.280  43.376 65.250  1.00 21.90  ? 901  BES A N1  1 
HETATM 4899 C  C4  . BES G 5 .   ? 18.157  43.613 66.390  1.00 24.18  ? 901  BES A C4  1 
HETATM 4900 C  C13 . BES G 5 .   ? 19.568  43.595 65.855  1.00 22.49  ? 901  BES A C13 1 
HETATM 4901 C  C14 . BES G 5 .   ? 20.669  42.812 66.576  1.00 24.23  ? 901  BES A C14 1 
HETATM 4902 C  C15 . BES G 5 .   ? 20.210  41.770 67.577  1.00 23.32  ? 901  BES A C15 1 
HETATM 4903 C  C16 . BES G 5 .   ? 21.692  42.287 65.590  1.00 22.52  ? 901  BES A C16 1 
HETATM 4904 C  C5  . BES G 5 .   ? 17.840  45.000 67.053  1.00 25.70  ? 901  BES A C5  1 
HETATM 4905 O  O1  . BES G 5 .   ? 17.160  45.848 66.348  1.00 22.63  ? 901  BES A O1  1 
HETATM 4906 O  O4  . BES G 5 .   ? 18.206  45.226 68.192  1.00 26.52  ? 901  BES A O4  1 
HETATM 4907 N  N1  . IMD H 6 .   ? 28.014  42.249 79.494  1.00 21.14  ? 1001 IMD A N1  1 
HETATM 4908 C  C2  . IMD H 6 .   ? 27.096  42.555 78.588  1.00 9.17   ? 1001 IMD A C2  1 
HETATM 4909 N  N3  . IMD H 6 .   ? 25.962  42.811 79.218  1.00 15.15  ? 1001 IMD A N3  1 
HETATM 4910 C  C4  . IMD H 6 .   ? 26.142  42.633 80.576  1.00 14.44  ? 1001 IMD A C4  1 
HETATM 4911 C  C5  . IMD H 6 .   ? 27.444  42.291 80.744  1.00 13.81  ? 1001 IMD A C5  1 
HETATM 4912 O  O   . HOH I 7 .   ? 23.792  34.258 75.188  1.00 13.41  ? 1102 HOH A O   1 
HETATM 4913 O  O   . HOH I 7 .   ? 41.402  41.645 77.736  1.00 18.41  ? 1103 HOH A O   1 
HETATM 4914 O  O   . HOH I 7 .   ? 21.452  48.008 79.289  1.00 14.29  ? 1104 HOH A O   1 
HETATM 4915 O  O   . HOH I 7 .   ? 7.395   22.508 68.980  1.00 15.42  ? 1105 HOH A O   1 
HETATM 4916 O  O   . HOH I 7 .   ? 8.875   45.610 71.521  1.00 15.01  ? 1106 HOH A O   1 
HETATM 4917 O  O   . HOH I 7 .   ? 18.318  15.775 81.560  1.00 42.99  ? 1107 HOH A O   1 
HETATM 4918 O  O   . HOH I 7 .   ? 30.607  45.406 73.230  1.00 16.49  ? 1108 HOH A O   1 
HETATM 4919 O  O   . HOH I 7 .   ? 2.151   35.326 56.132  1.00 20.69  ? 1109 HOH A O   1 
HETATM 4920 O  O   . HOH I 7 .   ? 26.371  45.237 72.729  1.00 32.21  ? 1110 HOH A O   1 
HETATM 4921 O  O   . HOH I 7 .   ? 10.117  47.411 58.465  1.00 19.66  ? 1111 HOH A O   1 
HETATM 4922 O  O   . HOH I 7 .   ? 24.576  45.901 81.764  1.00 15.98  ? 1112 HOH A O   1 
HETATM 4923 O  O   . HOH I 7 .   ? 21.400  39.522 70.350  1.00 17.59  ? 1113 HOH A O   1 
HETATM 4924 O  O   . HOH I 7 .   ? 32.755  39.688 76.763  1.00 14.73  ? 1114 HOH A O   1 
HETATM 4925 O  O   . HOH I 7 .   ? 15.723  43.292 73.593  1.00 28.15  ? 1115 HOH A O   1 
HETATM 4926 O  O   . HOH I 7 .   ? 33.012  53.990 68.029  1.00 20.61  ? 1116 HOH A O   1 
HETATM 4927 O  O   . HOH I 7 .   ? 21.672  48.368 86.318  1.00 18.35  ? 1117 HOH A O   1 
HETATM 4928 O  O   . HOH I 7 .   ? 11.843  66.293 86.775  1.00 20.28  ? 1118 HOH A O   1 
HETATM 4929 O  O   . HOH I 7 .   ? -7.370  39.258 72.858  1.00 100.00 ? 1119 HOH A O   1 
HETATM 4930 O  O   . HOH I 7 .   ? 10.951  58.853 90.712  1.00 31.18  ? 1120 HOH A O   1 
HETATM 4931 O  O   . HOH I 7 .   ? 7.991   67.991 69.688  1.00 51.29  ? 1121 HOH A O   1 
HETATM 4932 O  O   . HOH I 7 .   ? 27.534  25.933 83.686  1.00 30.42  ? 1122 HOH A O   1 
HETATM 4933 O  O   . HOH I 7 .   ? 14.754  47.886 81.192  1.00 91.59  ? 1123 HOH A O   1 
HETATM 4934 O  O   . HOH I 7 .   ? 35.638  66.681 74.616  1.00 18.43  ? 1124 HOH A O   1 
HETATM 4935 O  O   . HOH I 7 .   ? 14.917  46.651 71.292  1.00 29.09  ? 1125 HOH A O   1 
HETATM 4936 O  O   . HOH I 7 .   ? 24.339  72.545 82.858  1.00 27.38  ? 1126 HOH A O   1 
HETATM 4937 O  O   . HOH I 7 .   ? 3.954   59.653 64.218  1.00 29.75  ? 1127 HOH A O   1 
HETATM 4938 O  O   . HOH I 7 .   ? 0.174   30.326 72.099  1.00 20.53  ? 1128 HOH A O   1 
HETATM 4939 O  O   . HOH I 7 .   ? 17.250  55.520 87.251  1.00 15.14  ? 1129 HOH A O   1 
HETATM 4940 O  O   . HOH I 7 .   ? 2.640   38.007 61.525  1.00 15.01  ? 1130 HOH A O   1 
HETATM 4941 O  O   . HOH I 7 .   ? 10.861  36.115 89.266  1.00 26.76  ? 1131 HOH A O   1 
HETATM 4942 O  O   . HOH I 7 .   ? 30.988  44.243 70.800  1.00 37.98  ? 1132 HOH A O   1 
HETATM 4943 O  O   . HOH I 7 .   ? 9.095   44.675 75.314  1.00 24.97  ? 1133 HOH A O   1 
HETATM 4944 O  O   . HOH I 7 .   ? 29.917  47.569 70.312  1.00 33.43  ? 1134 HOH A O   1 
HETATM 4945 O  O   . HOH I 7 .   ? 23.537  45.186 73.070  1.00 21.89  ? 1135 HOH A O   1 
HETATM 4946 O  O   . HOH I 7 .   ? 13.919  30.086 87.520  1.00 27.60  ? 1136 HOH A O   1 
HETATM 4947 O  O   . HOH I 7 .   ? 24.004  28.230 84.950  1.00 54.91  ? 1137 HOH A O   1 
HETATM 4948 O  O   . HOH I 7 .   ? 44.740  56.907 93.797  1.00 39.70  ? 1138 HOH A O   1 
HETATM 4949 O  O   . HOH I 7 .   ? 36.453  36.919 75.700  1.00 12.06  ? 1139 HOH A O   1 
HETATM 4950 O  O   . HOH I 7 .   ? 27.587  65.302 75.920  1.00 21.02  ? 1140 HOH A O   1 
HETATM 4951 O  O   . HOH I 7 .   ? 23.077  39.811 87.155  1.00 38.48  ? 1141 HOH A O   1 
HETATM 4952 O  O   . HOH I 7 .   ? 3.661   37.055 59.039  1.00 17.86  ? 1142 HOH A O   1 
HETATM 4953 O  O   . HOH I 7 .   ? 21.794  20.673 79.219  1.00 20.60  ? 1143 HOH A O   1 
HETATM 4954 O  O   . HOH I 7 .   ? 6.324   36.055 87.167  1.00 30.35  ? 1144 HOH A O   1 
HETATM 4955 O  O   . HOH I 7 .   ? 24.649  34.194 44.975  1.00 52.51  ? 1145 HOH A O   1 
HETATM 4956 O  O   . HOH I 7 .   ? 20.611  44.717 78.685  1.00 27.41  ? 1146 HOH A O   1 
HETATM 4957 O  O   . HOH I 7 .   ? 19.969  50.884 89.461  1.00 29.62  ? 1147 HOH A O   1 
HETATM 4958 O  O   . HOH I 7 .   ? 30.940  66.808 78.811  1.00 15.76  ? 1148 HOH A O   1 
HETATM 4959 O  O   . HOH I 7 .   ? 26.539  55.260 66.886  1.00 19.97  ? 1149 HOH A O   1 
HETATM 4960 O  O   . HOH I 7 .   ? 7.314   45.436 77.867  1.00 35.07  ? 1150 HOH A O   1 
HETATM 4961 O  O   . HOH I 7 .   ? 10.579  54.800 67.603  1.00 15.62  ? 1151 HOH A O   1 
HETATM 4962 O  O   . HOH I 7 .   ? 28.138  31.371 66.611  1.00 15.08  ? 1152 HOH A O   1 
HETATM 4963 O  O   . HOH I 7 .   ? 26.292  33.348 75.129  1.00 15.49  ? 1153 HOH A O   1 
HETATM 4964 O  O   . HOH I 7 .   ? 15.204  48.508 69.331  1.00 16.03  ? 1154 HOH A O   1 
HETATM 4965 O  O   . HOH I 7 .   ? 9.451   57.282 68.158  1.00 20.39  ? 1155 HOH A O   1 
HETATM 4966 O  O   . HOH I 7 .   ? 34.923  67.738 77.001  1.00 15.06  ? 1156 HOH A O   1 
HETATM 4967 O  O   . HOH I 7 .   ? 10.193  53.763 78.443  1.00 19.23  ? 1157 HOH A O   1 
HETATM 4968 O  O   . HOH I 7 .   ? 35.246  32.562 64.227  1.00 27.89  ? 1158 HOH A O   1 
HETATM 4969 O  O   . HOH I 7 .   ? 7.230   48.517 65.509  1.00 17.57  ? 1159 HOH A O   1 
HETATM 4970 O  O   . HOH I 7 .   ? 15.707  29.269 62.146  1.00 16.76  ? 1160 HOH A O   1 
HETATM 4971 O  O   . HOH I 7 .   ? 22.703  46.209 83.610  1.00 14.72  ? 1161 HOH A O   1 
HETATM 4972 O  O   . HOH I 7 .   ? -5.573  31.742 67.048  1.00 67.53  ? 1162 HOH A O   1 
HETATM 4973 O  O   . HOH I 7 .   ? 23.958  46.448 79.118  1.00 14.95  ? 1163 HOH A O   1 
HETATM 4974 O  O   . HOH I 7 .   ? -4.387  51.289 59.224  1.00 29.13  ? 1164 HOH A O   1 
HETATM 4975 O  O   . HOH I 7 .   ? 1.494   43.916 68.255  1.00 21.32  ? 1165 HOH A O   1 
HETATM 4976 O  O   . HOH I 7 .   ? 15.236  37.185 89.202  1.00 24.71  ? 1166 HOH A O   1 
HETATM 4977 O  O   . HOH I 7 .   ? 8.901   44.256 58.842  1.00 22.41  ? 1167 HOH A O   1 
HETATM 4978 O  O   . HOH I 7 .   ? 8.741   44.059 69.410  1.00 19.23  ? 1168 HOH A O   1 
HETATM 4979 O  O   . HOH I 7 .   ? 10.536  31.361 71.130  1.00 17.26  ? 1169 HOH A O   1 
HETATM 4980 O  O   . HOH I 7 .   ? 14.270  66.977 85.494  1.00 24.71  ? 1170 HOH A O   1 
HETATM 4981 O  O   . HOH I 7 .   ? 19.324  33.013 51.120  1.00 31.37  ? 1171 HOH A O   1 
HETATM 4982 O  O   . HOH I 7 .   ? 22.888  42.589 71.900  1.00 32.53  ? 1172 HOH A O   1 
HETATM 4983 O  O   . HOH I 7 .   ? 18.199  19.792 50.850  1.00 95.99  ? 1173 HOH A O   1 
HETATM 4984 O  O   . HOH I 7 .   ? -2.766  36.708 53.654  1.00 25.61  ? 1174 HOH A O   1 
HETATM 4985 O  O   . HOH I 7 .   ? 40.154  44.352 89.098  1.00 18.04  ? 1175 HOH A O   1 
HETATM 4986 O  O   . HOH I 7 .   ? 43.798  45.414 76.216  1.00 42.09  ? 1176 HOH A O   1 
HETATM 4987 O  O   . HOH I 7 .   ? 2.095   33.636 67.241  1.00 16.77  ? 1177 HOH A O   1 
HETATM 4988 O  O   . HOH I 7 .   ? 17.697  47.834 68.674  1.00 15.55  ? 1178 HOH A O   1 
HETATM 4989 O  O   . HOH I 7 .   ? 0.487   49.526 68.994  1.00 40.71  ? 1179 HOH A O   1 
HETATM 4990 O  O   . HOH I 7 .   ? 24.958  57.027 93.315  1.00 15.83  ? 1180 HOH A O   1 
HETATM 4991 O  O   . HOH I 7 .   ? 16.157  27.572 83.036  1.00 20.90  ? 1181 HOH A O   1 
HETATM 4992 O  O   . HOH I 7 .   ? 5.222   49.330 63.415  1.00 17.36  ? 1182 HOH A O   1 
HETATM 4993 O  O   . HOH I 7 .   ? 16.211  37.941 52.836  1.00 19.88  ? 1183 HOH A O   1 
HETATM 4994 O  O   . HOH I 7 .   ? 32.789  43.179 86.654  1.00 20.34  ? 1184 HOH A O   1 
HETATM 4995 O  O   . HOH I 7 .   ? 9.298   48.075 81.153  1.00 54.83  ? 1185 HOH A O   1 
HETATM 4996 O  O   . HOH I 7 .   ? 29.454  36.152 82.527  1.00 29.31  ? 1186 HOH A O   1 
HETATM 4997 O  O   . HOH I 7 .   ? 41.926  50.859 91.024  1.00 26.91  ? 1187 HOH A O   1 
HETATM 4998 O  O   . HOH I 7 .   ? 42.353  47.486 84.905  1.00 21.77  ? 1188 HOH A O   1 
HETATM 4999 O  O   . HOH I 7 .   ? 7.099   45.738 66.261  1.00 16.80  ? 1189 HOH A O   1 
HETATM 5000 O  O   . HOH I 7 .   ? -7.189  40.950 62.864  1.00 18.87  ? 1190 HOH A O   1 
HETATM 5001 O  O   . HOH I 7 .   ? -0.532  35.957 55.006  1.00 30.96  ? 1191 HOH A O   1 
HETATM 5002 O  O   . HOH I 7 .   ? 2.498   58.239 62.223  1.00 33.64  ? 1192 HOH A O   1 
HETATM 5003 O  O   . HOH I 7 .   ? 8.030   54.347 85.172  1.00 36.67  ? 1193 HOH A O   1 
HETATM 5004 O  O   . HOH I 7 .   ? -9.086  47.257 64.010  1.00 25.14  ? 1194 HOH A O   1 
HETATM 5005 O  O   . HOH I 7 .   ? 7.634   23.157 71.565  1.00 26.48  ? 1195 HOH A O   1 
HETATM 5006 O  O   . HOH I 7 .   ? 36.802  57.687 75.942  1.00 33.51  ? 1196 HOH A O   1 
HETATM 5007 O  O   . HOH I 7 .   ? 31.266  28.847 81.561  1.00 33.78  ? 1197 HOH A O   1 
HETATM 5008 O  O   . HOH I 7 .   ? 42.718  53.265 90.455  1.00 18.15  ? 1198 HOH A O   1 
HETATM 5009 O  O   . HOH I 7 .   ? 25.175  49.362 94.064  1.00 38.55  ? 1199 HOH A O   1 
HETATM 5010 O  O   . HOH I 7 .   ? -1.458  36.897 71.377  1.00 21.47  ? 1200 HOH A O   1 
HETATM 5011 O  O   . HOH I 7 .   ? 36.955  22.462 67.101  1.00 62.30  ? 1201 HOH A O   1 
HETATM 5012 O  O   . HOH I 7 .   ? 17.777  47.785 75.841  1.00 20.17  ? 1202 HOH A O   1 
HETATM 5013 O  O   . HOH I 7 .   ? 17.194  41.841 54.112  1.00 16.39  ? 1203 HOH A O   1 
HETATM 5014 O  O   . HOH I 7 .   ? -1.972  55.370 57.254  1.00 25.11  ? 1204 HOH A O   1 
HETATM 5015 O  O   . HOH I 7 .   ? 27.602  40.677 72.586  1.00 21.30  ? 1205 HOH A O   1 
HETATM 5016 O  O   . HOH I 7 .   ? 37.435  51.467 61.104  1.00 65.38  ? 1206 HOH A O   1 
HETATM 5017 O  O   . HOH I 7 .   ? 1.256   32.447 69.628  1.00 23.44  ? 1207 HOH A O   1 
HETATM 5018 O  O   . HOH I 7 .   ? 9.241   16.192 63.327  1.00 48.00  ? 1208 HOH A O   1 
HETATM 5019 O  O   . HOH I 7 .   ? 0.854   36.054 64.035  1.00 18.60  ? 1209 HOH A O   1 
HETATM 5020 O  O   . HOH I 7 .   ? 18.727  44.131 84.651  1.00 24.89  ? 1210 HOH A O   1 
HETATM 5021 O  O   . HOH I 7 .   ? 26.098  18.961 78.803  1.00 24.48  ? 1211 HOH A O   1 
HETATM 5022 O  O   . HOH I 7 .   ? 19.158  42.699 78.273  1.00 28.07  ? 1212 HOH A O   1 
HETATM 5023 O  O   . HOH I 7 .   ? 38.525  39.961 90.164  1.00 49.63  ? 1213 HOH A O   1 
HETATM 5024 O  O   . HOH I 7 .   ? 18.603  45.487 82.264  1.00 21.64  ? 1214 HOH A O   1 
HETATM 5025 O  O   . HOH I 7 .   ? -9.935  47.106 60.568  1.00 27.24  ? 1215 HOH A O   1 
HETATM 5026 O  O   . HOH I 7 .   ? 12.837  36.710 59.433  1.00 15.13  ? 1216 HOH A O   1 
HETATM 5027 O  O   . HOH I 7 .   ? 33.438  65.032 85.997  1.00 32.21  ? 1217 HOH A O   1 
HETATM 5028 O  O   . HOH I 7 .   ? 38.122  36.535 73.494  1.00 12.50  ? 1218 HOH A O   1 
HETATM 5029 O  O   . HOH I 7 .   ? 28.342  66.963 78.047  1.00 18.65  ? 1219 HOH A O   1 
HETATM 5030 O  O   . HOH I 7 .   ? 6.554   34.671 88.987  1.00 15.86  ? 1220 HOH A O   1 
HETATM 5031 O  O   . HOH I 7 .   ? 13.095  46.874 73.346  1.00 30.35  ? 1221 HOH A O   1 
HETATM 5032 O  O   . HOH I 7 .   ? 32.660  36.335 82.732  1.00 35.47  ? 1222 HOH A O   1 
HETATM 5033 O  O   . HOH I 7 .   ? 43.405  38.140 78.295  1.00 19.15  ? 1223 HOH A O   1 
HETATM 5034 O  O   . HOH I 7 .   ? 27.330  46.500 69.982  1.00 28.22  ? 1224 HOH A O   1 
HETATM 5035 O  O   . HOH I 7 .   ? 21.495  44.397 85.333  1.00 27.70  ? 1225 HOH A O   1 
HETATM 5036 O  O   . HOH I 7 .   ? 25.964  67.884 90.313  1.00 24.59  ? 1226 HOH A O   1 
HETATM 5037 O  O   . HOH I 7 .   ? 39.654  61.279 78.612  1.00 34.08  ? 1227 HOH A O   1 
HETATM 5038 O  O   . HOH I 7 .   ? 28.830  50.839 62.528  1.00 22.84  ? 1228 HOH A O   1 
HETATM 5039 O  O   . HOH I 7 .   ? -2.192  25.904 60.928  1.00 48.99  ? 1229 HOH A O   1 
HETATM 5040 O  O   . HOH I 7 .   ? 12.941  37.733 62.998  1.00 17.09  ? 1230 HOH A O   1 
HETATM 5041 O  O   . HOH I 7 .   ? 17.656  39.494 55.302  1.00 23.77  ? 1231 HOH A O   1 
HETATM 5042 O  O   . HOH I 7 .   ? 5.616   31.767 78.251  1.00 22.11  ? 1232 HOH A O   1 
HETATM 5043 O  O   . HOH I 7 .   ? 11.134  59.317 68.286  1.00 24.37  ? 1233 HOH A O   1 
HETATM 5044 O  O   . HOH I 7 .   ? 7.669   46.689 57.186  1.00 19.15  ? 1234 HOH A O   1 
HETATM 5045 O  O   . HOH I 7 .   ? 24.475  34.718 86.839  1.00 32.19  ? 1235 HOH A O   1 
HETATM 5046 O  O   . HOH I 7 .   ? 23.517  44.933 68.463  1.00 20.25  ? 1236 HOH A O   1 
HETATM 5047 O  O   . HOH I 7 .   ? 26.942  39.752 68.390  1.00 15.96  ? 1237 HOH A O   1 
HETATM 5048 O  O   . HOH I 7 .   ? 41.829  46.617 82.332  1.00 16.28  ? 1238 HOH A O   1 
HETATM 5049 O  O   . HOH I 7 .   ? -0.771  45.529 78.260  1.00 68.55  ? 1239 HOH A O   1 
HETATM 5050 O  O   . HOH I 7 .   ? 44.023  49.889 77.980  1.00 30.04  ? 1240 HOH A O   1 
HETATM 5051 O  O   . HOH I 7 .   ? 26.786  62.061 81.604  1.00 16.85  ? 1241 HOH A O   1 
HETATM 5052 O  O   . HOH I 7 .   ? 13.879  47.676 76.209  1.00 46.91  ? 1242 HOH A O   1 
HETATM 5053 O  O   . HOH I 7 .   ? 25.840  58.036 65.771  1.00 54.37  ? 1243 HOH A O   1 
HETATM 5054 O  O   . HOH I 7 .   ? 10.922  53.966 85.792  1.00 18.98  ? 1244 HOH A O   1 
HETATM 5055 O  O   . HOH I 7 .   ? -12.182 45.374 45.449  1.00 33.96  ? 1245 HOH A O   1 
HETATM 5056 O  O   . HOH I 7 .   ? 31.206  39.579 79.369  1.00 15.60  ? 1246 HOH A O   1 
HETATM 5057 O  O   . HOH I 7 .   ? 15.440  42.222 77.590  1.00 25.43  ? 1247 HOH A O   1 
HETATM 5058 O  O   . HOH I 7 .   ? 0.824   56.052 62.386  1.00 26.41  ? 1248 HOH A O   1 
HETATM 5059 O  O   . HOH I 7 .   ? 44.978  53.578 86.262  1.00 22.60  ? 1249 HOH A O   1 
HETATM 5060 O  O   . HOH I 7 .   ? 17.898  31.967 86.834  1.00 19.51  ? 1250 HOH A O   1 
HETATM 5061 O  O   . HOH I 7 .   ? 15.892  63.944 61.374  1.00 54.27  ? 1251 HOH A O   1 
HETATM 5062 O  O   . HOH I 7 .   ? 29.311  44.330 75.316  1.00 39.02  ? 1252 HOH A O   1 
HETATM 5063 O  O   . HOH I 7 .   ? 11.678  62.566 52.561  1.00 27.61  ? 1253 HOH A O   1 
HETATM 5064 O  O   . HOH I 7 .   ? 26.748  53.479 95.785  1.00 45.53  ? 1254 HOH A O   1 
HETATM 5065 O  O   . HOH I 7 .   ? 35.164  39.157 88.454  1.00 33.28  ? 1255 HOH A O   1 
HETATM 5066 O  O   . HOH I 7 .   ? 13.599  30.411 61.539  1.00 16.55  ? 1256 HOH A O   1 
HETATM 5067 O  O   . HOH I 7 .   ? 2.955   41.496 60.167  1.00 26.41  ? 1257 HOH A O   1 
HETATM 5068 O  O   . HOH I 7 .   ? 21.013  47.058 81.902  1.00 24.07  ? 1258 HOH A O   1 
HETATM 5069 O  O   . HOH I 7 .   ? 7.082   15.804 68.963  1.00 13.64  ? 1259 HOH A O   1 
HETATM 5070 O  O   . HOH I 7 .   ? 43.659  51.565 97.228  1.00 13.91  ? 1260 HOH A O   1 
HETATM 5071 O  O   . HOH I 7 .   ? 25.728  46.521 67.857  1.00 15.18  ? 1261 HOH A O   1 
HETATM 5072 O  O   . HOH I 7 .   ? 16.336  27.429 80.519  1.00 13.58  ? 1262 HOH A O   1 
HETATM 5073 O  O   . HOH I 7 .   ? 13.506  27.963 78.488  1.00 11.63  ? 1263 HOH A O   1 
HETATM 5074 O  O   . HOH I 7 .   ? -1.826  28.836 60.633  1.00 18.21  ? 1264 HOH A O   1 
HETATM 5075 O  O   . HOH I 7 .   ? 2.041   28.523 68.718  1.00 19.80  ? 1265 HOH A O   1 
HETATM 5076 O  O   . HOH I 7 .   ? 39.832  50.082 92.567  1.00 15.76  ? 1266 HOH A O   1 
HETATM 5077 O  O   . HOH I 7 .   ? 20.417  35.797 44.686  1.00 23.98  ? 1267 HOH A O   1 
HETATM 5078 O  O   . HOH I 7 .   ? 36.272  60.259 74.993  1.00 26.08  ? 1268 HOH A O   1 
HETATM 5079 O  O   . HOH I 7 .   ? 5.426   61.205 63.338  1.00 23.06  ? 1269 HOH A O   1 
HETATM 5080 O  O   . HOH I 7 .   ? 17.667  67.608 77.116  1.00 28.66  ? 1270 HOH A O   1 
HETATM 5081 O  O   . HOH I 7 .   ? 5.631   18.160 69.508  1.00 19.48  ? 1271 HOH A O   1 
HETATM 5082 O  O   . HOH I 7 .   ? 22.328  62.979 93.415  1.00 25.81  ? 1272 HOH A O   1 
HETATM 5083 O  O   . HOH I 7 .   ? 40.390  48.175 94.855  1.00 47.37  ? 1273 HOH A O   1 
HETATM 5084 O  O   . HOH I 7 .   ? 17.444  40.095 51.789  1.00 18.19  ? 1274 HOH A O   1 
HETATM 5085 O  O   . HOH I 7 .   ? 29.587  24.011 76.681  1.00 24.09  ? 1275 HOH A O   1 
HETATM 5086 O  O   . HOH I 7 .   ? 6.778   26.010 80.637  1.00 26.64  ? 1276 HOH A O   1 
HETATM 5087 O  O   . HOH I 7 .   ? 43.821  42.250 81.895  1.00 24.88  ? 1277 HOH A O   1 
HETATM 5088 O  O   . HOH I 7 .   ? 28.198  18.300 60.474  1.00 24.14  ? 1278 HOH A O   1 
HETATM 5089 O  O   . HOH I 7 .   ? 22.788  46.771 90.209  1.00 24.26  ? 1279 HOH A O   1 
HETATM 5090 O  O   . HOH I 7 .   ? 29.931  24.564 79.534  1.00 31.74  ? 1280 HOH A O   1 
HETATM 5091 O  O   . HOH I 7 .   ? 10.739  18.587 70.209  1.00 34.82  ? 1281 HOH A O   1 
HETATM 5092 O  O   . HOH I 7 .   ? 3.737   42.980 66.727  1.00 18.45  ? 1282 HOH A O   1 
HETATM 5093 O  O   . HOH I 7 .   ? 10.657  69.135 86.850  1.00 30.21  ? 1283 HOH A O   1 
HETATM 5094 O  O   . HOH I 7 .   ? 23.612  39.959 68.861  1.00 20.99  ? 1284 HOH A O   1 
HETATM 5095 O  O   . HOH I 7 .   ? 30.240  50.378 93.511  1.00 31.76  ? 1285 HOH A O   1 
HETATM 5096 O  O   . HOH I 7 .   ? 24.407  42.363 69.680  1.00 23.63  ? 1286 HOH A O   1 
HETATM 5097 O  O   . HOH I 7 .   ? 3.121   26.698 57.992  1.00 26.26  ? 1287 HOH A O   1 
HETATM 5098 O  O   . HOH I 7 .   ? 6.662   51.993 60.872  1.00 21.24  ? 1288 HOH A O   1 
HETATM 5099 O  O   . HOH I 7 .   ? 10.549  31.727 52.631  1.00 21.12  ? 1289 HOH A O   1 
HETATM 5100 O  O   . HOH I 7 .   ? 7.213   14.560 66.229  1.00 19.68  ? 1290 HOH A O   1 
HETATM 5101 O  O   . HOH I 7 .   ? 10.944  37.995 74.849  1.00 26.21  ? 1291 HOH A O   1 
HETATM 5102 O  O   . HOH I 7 .   ? 29.009  38.268 80.361  1.00 21.40  ? 1292 HOH A O   1 
HETATM 5103 O  O   . HOH I 7 .   ? 8.720   37.803 87.790  1.00 25.70  ? 1293 HOH A O   1 
HETATM 5104 O  O   . HOH I 7 .   ? 30.731  47.721 57.132  1.00 25.12  ? 1294 HOH A O   1 
HETATM 5105 O  O   . HOH I 7 .   ? 21.085  45.693 69.052  1.00 27.11  ? 1295 HOH A O   1 
HETATM 5106 O  O   . HOH I 7 .   ? 37.609  50.318 68.349  1.00 33.12  ? 1296 HOH A O   1 
HETATM 5107 O  O   . HOH I 7 .   ? -4.270  35.004 72.084  1.00 23.92  ? 1297 HOH A O   1 
HETATM 5108 O  O   . HOH I 7 .   ? 38.619  67.647 73.848  1.00 28.81  ? 1298 HOH A O   1 
HETATM 5109 O  O   . HOH I 7 .   ? 0.963   27.263 54.964  1.00 25.61  ? 1299 HOH A O   1 
HETATM 5110 O  O   . HOH I 7 .   ? 32.881  53.350 97.969  1.00 72.92  ? 1300 HOH A O   1 
HETATM 5111 O  O   . HOH I 7 .   ? 16.605  54.411 65.120  1.00 21.12  ? 1301 HOH A O   1 
HETATM 5112 O  O   . HOH I 7 .   ? 19.780  53.463 90.814  1.00 25.04  ? 1302 HOH A O   1 
HETATM 5113 O  O   . HOH I 7 .   ? -7.941  56.718 56.011  1.00 40.98  ? 1303 HOH A O   1 
HETATM 5114 O  O   . HOH I 7 .   ? 8.373   35.496 71.320  1.00 34.46  ? 1304 HOH A O   1 
HETATM 5115 O  O   . HOH I 7 .   ? 30.102  60.104 96.117  1.00 23.15  ? 1305 HOH A O   1 
HETATM 5116 O  O   . HOH I 7 .   ? 28.927  39.455 66.453  1.00 21.12  ? 1306 HOH A O   1 
HETATM 5117 O  O   . HOH I 7 .   ? 39.689  41.335 88.297  1.00 27.24  ? 1307 HOH A O   1 
HETATM 5118 O  O   . HOH I 7 .   ? 33.916  37.626 52.438  1.00 33.19  ? 1308 HOH A O   1 
HETATM 5119 O  O   . HOH I 7 .   ? 1.622   50.963 82.588  1.00 50.35  ? 1309 HOH A O   1 
HETATM 5120 O  O   . HOH I 7 .   ? 16.333  60.146 56.900  1.00 29.60  ? 1310 HOH A O   1 
HETATM 5121 O  O   . HOH I 7 .   ? 39.242  45.128 91.725  1.00 22.90  ? 1311 HOH A O   1 
HETATM 5122 O  O   . HOH I 7 .   ? 14.399  30.418 45.430  1.00 34.78  ? 1312 HOH A O   1 
HETATM 5123 O  O   . HOH I 7 .   ? 29.888  42.111 88.891  1.00 34.76  ? 1313 HOH A O   1 
HETATM 5124 O  O   . HOH I 7 .   ? 18.346  26.212 50.297  1.00 44.21  ? 1314 HOH A O   1 
HETATM 5125 O  O   . HOH I 7 .   ? 22.864  63.026 74.711  1.00 29.30  ? 1315 HOH A O   1 
HETATM 5126 O  O   . HOH I 7 .   ? 20.113  37.220 85.926  1.00 24.06  ? 1316 HOH A O   1 
HETATM 5127 O  O   . HOH I 7 .   ? 23.298  70.540 87.208  1.00 35.89  ? 1317 HOH A O   1 
HETATM 5128 O  O   . HOH I 7 .   ? 26.970  41.872 69.933  1.00 28.60  ? 1318 HOH A O   1 
HETATM 5129 O  O   . HOH I 7 .   ? -4.296  44.927 43.216  1.00 33.90  ? 1319 HOH A O   1 
HETATM 5130 O  O   . HOH I 7 .   ? 12.321  60.082 62.828  1.00 28.33  ? 1320 HOH A O   1 
HETATM 5131 O  O   . HOH I 7 .   ? 13.873  37.878 45.419  1.00 43.55  ? 1321 HOH A O   1 
HETATM 5132 O  O   . HOH I 7 .   ? 30.748  40.180 83.791  1.00 37.04  ? 1322 HOH A O   1 
HETATM 5133 O  O   . HOH I 7 .   ? 15.784  58.732 93.087  1.00 23.80  ? 1323 HOH A O   1 
HETATM 5134 O  O   . HOH I 7 .   ? 35.311  18.767 63.462  1.00 49.24  ? 1324 HOH A O   1 
HETATM 5135 O  O   . HOH I 7 .   ? -0.325  33.536 77.400  1.00 28.59  ? 1325 HOH A O   1 
HETATM 5136 O  O   . HOH I 7 .   ? 9.312   60.280 65.861  1.00 37.85  ? 1326 HOH A O   1 
HETATM 5137 O  O   . HOH I 7 .   ? 20.424  20.146 83.661  1.00 32.68  ? 1327 HOH A O   1 
HETATM 5138 O  O   . HOH I 7 .   ? 10.879  65.256 88.761  1.00 28.17  ? 1328 HOH A O   1 
HETATM 5139 O  O   . HOH I 7 .   ? 6.481   11.890 66.154  1.00 13.58  ? 1329 HOH A O   1 
HETATM 5140 O  O   . HOH I 7 .   ? 11.493  12.304 65.667  1.00 31.38  ? 1330 HOH A O   1 
HETATM 5141 O  O   . HOH I 7 .   ? 23.893  48.760 67.764  1.00 19.58  ? 1331 HOH A O   1 
HETATM 5142 O  O   . HOH I 7 .   ? 11.826  33.465 74.498  1.00 16.87  ? 1332 HOH A O   1 
HETATM 5143 O  O   . HOH I 7 .   ? 20.228  48.799 84.083  1.00 14.10  ? 1333 HOH A O   1 
HETATM 5144 O  O   . HOH I 7 .   ? 8.333   25.989 83.238  1.00 20.03  ? 1334 HOH A O   1 
HETATM 5145 O  O   . HOH I 7 .   ? 24.244  65.422 90.512  1.00 18.61  ? 1335 HOH A O   1 
HETATM 5146 O  O   . HOH I 7 .   ? 29.682  43.395 86.674  1.00 29.99  ? 1336 HOH A O   1 
HETATM 5147 O  O   . HOH I 7 .   ? 32.122  38.935 81.421  1.00 21.98  ? 1337 HOH A O   1 
HETATM 5148 O  O   . HOH I 7 .   ? 38.098  44.260 70.626  1.00 23.18  ? 1338 HOH A O   1 
HETATM 5149 O  O   . HOH I 7 .   ? 17.172  68.773 81.829  1.00 33.19  ? 1339 HOH A O   1 
HETATM 5150 O  O   . HOH I 7 .   ? 22.056  41.676 85.707  1.00 27.98  ? 1340 HOH A O   1 
HETATM 5151 O  O   . HOH I 7 .   ? 10.609  35.835 76.035  1.00 26.77  ? 1341 HOH A O   1 
HETATM 5152 O  O   . HOH I 7 .   ? 5.895   48.362 80.563  1.00 35.27  ? 1342 HOH A O   1 
HETATM 5153 O  O   . HOH I 7 .   ? 38.010  28.385 76.446  1.00 62.63  ? 1343 HOH A O   1 
HETATM 5154 O  O   . HOH I 7 .   ? 27.505  26.048 57.570  1.00 34.59  ? 1344 HOH A O   1 
HETATM 5155 O  O   . HOH I 7 .   ? 40.199  29.895 75.610  1.00 30.81  ? 1345 HOH A O   1 
HETATM 5156 O  O   . HOH I 7 .   ? 41.069  35.070 67.073  1.00 25.75  ? 1346 HOH A O   1 
HETATM 5157 O  O   . HOH I 7 .   ? 18.209  43.386 70.174  1.00 24.27  ? 1347 HOH A O   1 
HETATM 5158 O  O   . HOH I 7 .   ? 22.994  40.780 73.297  1.00 35.20  ? 1348 HOH A O   1 
HETATM 5159 O  O   . HOH I 7 .   ? 11.980  17.646 61.687  1.00 24.63  ? 1349 HOH A O   1 
HETATM 5160 O  O   . HOH I 7 .   ? 17.092  44.230 71.974  1.00 27.55  ? 1350 HOH A O   1 
HETATM 5161 O  O   . HOH I 7 .   ? 29.907  45.909 50.610  1.00 33.85  ? 1351 HOH A O   1 
HETATM 5162 O  O   . HOH I 7 .   ? 25.337  41.587 74.020  1.00 31.92  ? 1352 HOH A O   1 
HETATM 5163 O  O   . HOH I 7 .   ? 34.320  29.393 64.417  1.00 34.88  ? 1353 HOH A O   1 
HETATM 5164 O  O   . HOH I 7 .   ? 16.366  57.688 55.311  1.00 30.35  ? 1354 HOH A O   1 
HETATM 5165 O  O   . HOH I 7 .   ? 25.295  70.347 83.432  1.00 44.62  ? 1355 HOH A O   1 
HETATM 5166 O  O   . HOH I 7 .   ? 28.780  44.083 69.312  1.00 38.06  ? 1356 HOH A O   1 
HETATM 5167 O  O   . HOH I 7 .   ? 43.987  44.841 81.855  1.00 26.92  ? 1357 HOH A O   1 
HETATM 5168 O  O   . HOH I 7 .   ? 10.694  22.780 82.399  1.00 40.18  ? 1358 HOH A O   1 
HETATM 5169 O  O   . HOH I 7 .   ? 3.209   26.059 69.842  1.00 50.02  ? 1359 HOH A O   1 
HETATM 5170 O  O   . HOH I 7 .   ? 25.123  69.880 90.995  1.00 32.08  ? 1360 HOH A O   1 
HETATM 5171 O  O   . HOH I 7 .   ? 10.460  60.937 72.334  1.00 28.48  ? 1361 HOH A O   1 
HETATM 5172 O  O   . HOH I 7 .   ? 35.272  43.014 54.933  1.00 35.32  ? 1362 HOH A O   1 
HETATM 5173 O  O   . HOH I 7 .   ? 31.555  49.428 69.261  1.00 30.03  ? 1363 HOH A O   1 
HETATM 5174 O  O   . HOH I 7 .   ? 18.455  45.339 74.865  1.00 22.60  ? 1364 HOH A O   1 
HETATM 5175 O  O   . HOH I 7 .   ? 0.397   52.925 76.187  1.00 26.73  ? 1365 HOH A O   1 
HETATM 5176 O  O   . HOH I 7 .   ? 24.642  68.564 81.573  1.00 27.40  ? 1366 HOH A O   1 
HETATM 5177 O  O   . HOH I 7 .   ? 25.734  20.393 55.492  1.00 32.87  ? 1367 HOH A O   1 
HETATM 5178 O  O   . HOH I 7 .   ? 11.923  58.720 70.763  1.00 21.77  ? 1368 HOH A O   1 
HETATM 5179 O  O   . HOH I 7 .   ? 30.308  43.013 67.201  1.00 35.32  ? 1369 HOH A O   1 
HETATM 5180 O  O   . HOH I 7 .   ? 39.640  38.126 67.437  1.00 28.94  ? 1370 HOH A O   1 
HETATM 5181 O  O   . HOH I 7 .   ? 10.397  50.110 41.557  1.00 28.07  ? 1371 HOH A O   1 
HETATM 5182 O  O   . HOH I 7 .   ? 33.290  46.466 61.539  1.00 27.30  ? 1372 HOH A O   1 
HETATM 5183 O  O   . HOH I 7 .   ? 0.016   42.090 76.502  1.00 32.33  ? 1373 HOH A O   1 
HETATM 5184 O  O   . HOH I 7 .   ? 26.563  45.481 40.291  1.00 47.85  ? 1374 HOH A O   1 
HETATM 5185 O  O   . HOH I 7 .   ? 30.451  15.205 70.110  1.00 33.04  ? 1375 HOH A O   1 
HETATM 5186 O  O   . HOH I 7 .   ? 0.678   54.618 69.973  1.00 30.37  ? 1376 HOH A O   1 
HETATM 5187 O  O   . HOH I 7 .   ? 31.009  22.826 58.292  1.00 38.03  ? 1377 HOH A O   1 
HETATM 5188 O  O   . HOH I 7 .   ? 11.598  18.077 78.103  1.00 32.86  ? 1378 HOH A O   1 
HETATM 5189 O  O   . HOH I 7 .   ? 42.789  49.257 82.276  1.00 38.27  ? 1379 HOH A O   1 
HETATM 5190 O  O   . HOH I 7 .   ? 22.610  37.483 44.945  1.00 36.88  ? 1380 HOH A O   1 
HETATM 5191 O  O   . HOH I 7 .   ? 19.095  19.104 54.480  1.00 29.52  ? 1381 HOH A O   1 
HETATM 5192 O  O   . HOH I 7 .   ? -17.217 39.695 36.067  1.00 33.38  ? 1382 HOH A O   1 
HETATM 5193 O  O   . HOH I 7 .   ? 6.068   42.637 67.543  1.00 33.87  ? 1383 HOH A O   1 
HETATM 5194 O  O   . HOH I 7 .   ? 20.639  46.522 87.847  1.00 36.70  ? 1384 HOH A O   1 
HETATM 5195 O  O   . HOH I 7 .   ? -8.870  56.242 58.240  1.00 50.62  ? 1385 HOH A O   1 
HETATM 5196 O  O   . HOH I 7 .   ? 16.582  61.670 59.151  1.00 38.20  ? 1386 HOH A O   1 
HETATM 5197 O  O   . HOH I 7 .   ? 42.501  43.301 75.886  1.00 27.81  ? 1387 HOH A O   1 
HETATM 5198 O  O   . HOH I 7 .   ? 25.604  33.439 84.786  1.00 21.08  ? 1388 HOH A O   1 
HETATM 5199 O  O   . HOH I 7 .   ? 13.520  67.352 52.561  1.00 39.75  ? 1389 HOH A O   1 
HETATM 5200 O  O   . HOH I 7 .   ? 9.627   28.198 45.908  1.00 37.35  ? 1390 HOH A O   1 
HETATM 5201 O  O   . HOH I 7 .   ? 18.134  36.512 88.493  1.00 43.01  ? 1391 HOH A O   1 
HETATM 5202 O  O   . HOH I 7 .   ? 22.300  20.482 81.874  1.00 37.81  ? 1392 HOH A O   1 
HETATM 5203 O  O   . HOH I 7 .   ? 44.203  41.289 79.602  1.00 27.00  ? 1393 HOH A O   1 
HETATM 5204 O  O   . HOH I 7 .   ? 44.462  52.335 93.395  1.00 32.88  ? 1394 HOH A O   1 
HETATM 5205 O  O   . HOH I 7 .   ? -2.968  37.813 43.815  1.00 39.42  ? 1395 HOH A O   1 
HETATM 5206 O  O   . HOH I 7 .   ? 14.615  50.638 83.483  1.00 40.84  ? 1396 HOH A O   1 
HETATM 5207 O  O   . HOH I 7 .   ? 17.655  48.236 85.049  1.00 38.41  ? 1397 HOH A O   1 
HETATM 5208 O  O   . HOH I 7 .   ? 25.105  58.534 70.338  1.00 45.37  ? 1398 HOH A O   1 
HETATM 5209 O  O   . HOH I 7 .   ? 6.153   22.174 58.465  1.00 51.17  ? 1399 HOH A O   1 
HETATM 5210 O  O   . HOH I 7 .   ? 14.099  45.045 75.129  1.00 38.12  ? 1400 HOH A O   1 
HETATM 5211 O  O   . HOH I 7 .   ? 3.614   33.798 78.265  1.00 33.77  ? 1401 HOH A O   1 
HETATM 5212 O  O   . HOH I 7 .   ? 10.974  62.101 70.086  1.00 31.30  ? 1402 HOH A O   1 
HETATM 5213 O  O   . HOH I 7 .   ? 7.585   38.532 71.479  1.00 35.66  ? 1403 HOH A O   1 
HETATM 5214 O  O   . HOH I 7 .   ? 20.998  44.178 74.359  1.00 37.38  ? 1404 HOH A O   1 
HETATM 5215 O  O   . HOH I 7 .   ? 11.918  38.385 43.252  1.00 35.61  ? 1405 HOH A O   1 
HETATM 5216 O  O   . HOH I 7 .   ? 34.337  29.948 80.309  1.00 36.78  ? 1406 HOH A O   1 
HETATM 5217 O  O   . HOH I 7 .   ? 39.120  63.630 75.316  1.00 43.48  ? 1407 HOH A O   1 
HETATM 5218 O  O   . HOH I 7 .   ? 36.491  64.702 80.717  1.00 19.64  ? 1408 HOH A O   1 
HETATM 5219 O  O   . HOH I 7 .   ? -11.598 58.968 55.040  1.00 54.59  ? 1409 HOH A O   1 
HETATM 5220 O  O   . HOH I 7 .   ? 18.873  53.508 93.447  1.00 29.42  ? 1410 HOH A O   1 
HETATM 5221 O  O   . HOH I 7 .   ? 7.673   37.412 69.273  1.00 30.92  ? 1411 HOH A O   1 
HETATM 5222 O  O   . HOH I 7 .   ? 38.494  29.355 71.433  1.00 35.92  ? 1412 HOH A O   1 
HETATM 5223 O  O   . HOH I 7 .   ? 2.378   64.614 72.106  1.00 23.68  ? 1413 HOH A O   1 
HETATM 5224 O  O   . HOH I 7 .   ? 34.055  22.747 70.419  1.00 47.42  ? 1414 HOH A O   1 
HETATM 5225 O  O   . HOH I 7 .   ? 6.517   15.338 63.891  1.00 39.21  ? 1415 HOH A O   1 
HETATM 5226 O  O   . HOH I 7 .   ? 33.135  58.667 95.357  1.00 38.27  ? 1416 HOH A O   1 
HETATM 5227 O  O   . HOH I 7 .   ? 7.877   41.088 68.810  1.00 30.88  ? 1417 HOH A O   1 
HETATM 5228 O  O   . HOH I 7 .   ? 4.500   63.686 62.465  1.00 40.54  ? 1418 HOH A O   1 
HETATM 5229 O  O   . HOH I 7 .   ? 32.594  44.212 51.619  1.00 28.18  ? 1419 HOH A O   1 
HETATM 5230 O  O   . HOH I 7 .   ? 19.892  28.363 50.295  1.00 37.48  ? 1420 HOH A O   1 
HETATM 5231 O  O   . HOH I 7 .   ? 38.121  42.209 58.482  1.00 35.42  ? 1421 HOH A O   1 
HETATM 5232 O  O   . HOH I 7 .   ? 18.953  60.209 59.879  1.00 32.37  ? 1422 HOH A O   1 
HETATM 5233 O  O   . HOH I 7 .   ? -1.038  45.854 73.695  1.00 33.19  ? 1423 HOH A O   1 
HETATM 5234 O  O   . HOH I 7 .   ? 27.077  35.055 88.571  1.00 48.52  ? 1424 HOH A O   1 
HETATM 5235 O  O   . HOH I 7 .   ? 20.123  41.413 71.190  1.00 40.23  ? 1425 HOH A O   1 
HETATM 5236 O  O   . HOH I 7 .   ? 5.380   25.588 55.751  1.00 26.30  ? 1426 HOH A O   1 
HETATM 5237 O  O   . HOH I 7 .   ? -8.946  53.154 58.636  1.00 33.33  ? 1427 HOH A O   1 
HETATM 5238 O  O   . HOH I 7 .   ? 5.224   20.615 65.617  1.00 38.04  ? 1428 HOH A O   1 
HETATM 5239 O  O   . HOH I 7 .   ? -0.951  44.688 66.660  1.00 48.71  ? 1429 HOH A O   1 
HETATM 5240 O  O   . HOH I 7 .   ? 9.548   17.972 61.116  1.00 38.57  ? 1430 HOH A O   1 
HETATM 5241 O  O   . HOH I 7 .   ? 16.170  45.478 46.564  1.00 33.55  ? 1431 HOH A O   1 
HETATM 5242 O  O   . HOH I 7 .   ? 28.152  31.228 86.919  1.00 66.11  ? 1432 HOH A O   1 
HETATM 5243 O  O   . HOH I 7 .   ? -4.227  32.608 61.396  1.00 29.03  ? 1433 HOH A O   1 
HETATM 5244 O  O   . HOH I 7 .   ? 23.532  69.913 79.399  1.00 40.45  ? 1434 HOH A O   1 
HETATM 5245 O  O   . HOH I 7 .   ? 16.943  25.394 84.026  1.00 35.64  ? 1435 HOH A O   1 
HETATM 5246 O  O   . HOH I 7 .   ? -6.097  33.164 72.143  1.00 47.23  ? 1436 HOH A O   1 
HETATM 5247 O  O   . HOH I 7 .   ? 26.639  58.545 95.902  1.00 30.17  ? 1437 HOH A O   1 
HETATM 5248 O  O   . HOH I 7 .   ? 18.090  14.281 77.183  1.00 34.77  ? 1438 HOH A O   1 
HETATM 5249 O  O   . HOH I 7 .   ? 16.783  69.158 79.498  1.00 41.04  ? 1439 HOH A O   1 
HETATM 5250 O  O   . HOH I 7 .   ? 44.586  50.422 83.945  1.00 37.92  ? 1440 HOH A O   1 
HETATM 5251 O  O   . HOH I 7 .   ? 11.828  51.361 43.560  1.00 42.10  ? 1441 HOH A O   1 
HETATM 5252 O  O   . HOH I 7 .   ? 22.773  36.745 86.817  1.00 38.07  ? 1442 HOH A O   1 
HETATM 5253 O  O   . HOH I 7 .   ? 26.608  43.969 74.943  1.00 32.64  ? 1443 HOH A O   1 
HETATM 5254 O  O   . HOH I 7 .   ? 14.797  17.437 79.901  1.00 37.80  ? 1444 HOH A O   1 
HETATM 5255 O  O   . HOH I 7 .   ? 32.755  40.414 86.886  1.00 53.20  ? 1445 HOH A O   1 
HETATM 5256 O  O   . HOH I 7 .   ? 23.938  65.851 93.231  1.00 38.25  ? 1446 HOH A O   1 
HETATM 5257 O  O   . HOH I 7 .   ? 34.689  68.947 70.635  1.00 32.36  ? 1447 HOH A O   1 
HETATM 5258 O  O   . HOH I 7 .   ? 32.902  14.779 66.467  1.00 55.05  ? 1448 HOH A O   1 
HETATM 5259 O  O   . HOH I 7 .   ? -0.197  59.892 61.918  1.00 41.09  ? 1449 HOH A O   1 
HETATM 5260 O  O   . HOH I 7 .   ? 35.933  50.743 66.825  1.00 29.14  ? 1450 HOH A O   1 
HETATM 5261 O  O   . HOH I 7 .   ? 21.451  70.196 84.069  1.00 37.63  ? 1451 HOH A O   1 
HETATM 5262 O  O   . HOH I 7 .   ? 10.392  34.055 71.909  1.00 37.36  ? 1452 HOH A O   1 
HETATM 5263 O  O   . HOH I 7 .   ? 16.118  48.288 46.594  1.00 33.56  ? 1453 HOH A O   1 
HETATM 5264 O  O   . HOH I 7 .   ? 2.277   58.481 67.819  1.00 45.09  ? 1454 HOH A O   1 
HETATM 5265 O  O   . HOH I 7 .   ? -21.140 42.970 52.987  1.00 38.49  ? 1455 HOH A O   1 
HETATM 5266 O  O   . HOH I 7 .   ? 0.364   56.797 65.209  1.00 34.76  ? 1456 HOH A O   1 
HETATM 5267 O  O   . HOH I 7 .   ? 9.763   37.511 72.464  1.00 36.84  ? 1457 HOH A O   1 
HETATM 5268 O  O   . HOH I 7 .   ? -3.293  29.651 64.159  1.00 48.44  ? 1458 HOH A O   1 
HETATM 5269 O  O   . HOH I 7 .   ? 18.653  59.497 55.820  1.00 41.32  ? 1459 HOH A O   1 
HETATM 5270 O  O   . HOH I 7 .   ? 18.360  56.858 89.365  1.00 16.20  ? 1460 HOH A O   1 
HETATM 5271 O  O   . HOH I 7 .   ? 19.264  58.334 58.324  1.00 24.32  ? 1461 HOH A O   1 
HETATM 5272 O  O   . HOH I 7 .   ? 19.786  68.920 85.535  1.00 36.46  ? 1462 HOH A O   1 
HETATM 5273 O  O   . HOH I 7 .   ? 0.891   46.454 70.028  1.00 49.40  ? 1463 HOH A O   1 
HETATM 5274 O  O   . HOH I 7 .   ? 13.401  15.156 61.247  1.00 32.90  ? 1464 HOH A O   1 
HETATM 5275 O  O   . HOH I 7 .   ? 29.937  41.912 73.484  1.00 34.92  ? 1465 HOH A O   1 
HETATM 5276 O  O   . HOH I 7 .   ? 28.117  39.053 82.612  1.00 29.94  ? 1466 HOH A O   1 
HETATM 5277 O  O   . HOH I 7 .   ? 17.060  44.064 76.687  1.00 31.64  ? 1467 HOH A O   1 
HETATM 5278 O  O   . HOH I 7 .   ? 7.781   32.331 42.244  1.00 54.33  ? 1468 HOH A O   1 
HETATM 5279 O  O   . HOH I 7 .   ? 13.484  60.143 67.092  1.00 36.32  ? 1469 HOH A O   1 
HETATM 5280 O  O   . HOH I 7 .   ? 4.972   65.695 69.472  1.00 30.93  ? 1470 HOH A O   1 
HETATM 5281 O  O   . HOH I 7 .   ? 20.859  55.364 94.926  1.00 35.05  ? 1471 HOH A O   1 
HETATM 5282 O  O   . HOH I 7 .   ? 29.891  64.316 94.062  1.00 32.43  ? 1472 HOH A O   1 
HETATM 5283 O  O   . HOH I 7 .   ? 31.636  50.857 46.407  1.00 75.60  ? 1473 HOH A O   1 
HETATM 5284 O  O   . HOH I 7 .   ? 24.022  31.723 43.768  1.00 56.74  ? 1474 HOH A O   1 
HETATM 5285 O  O   . HOH I 7 .   ? 14.152  12.701 64.957  1.00 23.80  ? 1475 HOH A O   1 
HETATM 5286 O  O   . HOH I 7 .   ? 35.419  45.143 64.442  1.00 36.74  ? 1476 HOH A O   1 
HETATM 5287 O  O   . HOH I 7 .   ? 34.839  57.375 97.888  1.00 34.34  ? 1477 HOH A O   1 
HETATM 5288 O  O   . HOH I 7 .   ? 35.027  44.946 53.379  1.00 45.25  ? 1478 HOH A O   1 
HETATM 5289 O  O   . HOH I 7 .   ? 10.904  44.942 78.238  1.00 46.33  ? 1479 HOH A O   1 
HETATM 5290 O  O   . HOH I 7 .   ? 2.265   29.749 79.673  1.00 55.34  ? 1480 HOH A O   1 
HETATM 5291 O  O   . HOH I 7 .   ? 38.376  37.663 83.485  1.00 48.83  ? 1481 HOH A O   1 
HETATM 5292 O  O   . HOH I 7 .   ? 7.069   18.511 64.588  1.00 42.75  ? 1482 HOH A O   1 
HETATM 5293 O  O   . HOH I 7 .   ? 10.013  63.184 65.119  1.00 51.27  ? 1483 HOH A O   1 
HETATM 5294 O  O   . HOH I 7 .   ? 26.880  67.265 80.460  1.00 29.17  ? 1484 HOH A O   1 
HETATM 5295 O  O   . HOH I 7 .   ? 5.435   44.858 39.529  1.00 44.09  ? 1485 HOH A O   1 
HETATM 5296 O  O   . HOH I 7 .   ? 12.020  76.116 49.503  1.00 57.08  ? 1486 HOH A O   1 
HETATM 5297 O  O   . HOH I 7 .   ? 4.495   69.223 72.134  1.00 39.49  ? 1487 HOH A O   1 
HETATM 5298 O  O   . HOH I 7 .   ? 34.373  34.834 52.407  1.00 45.73  ? 1488 HOH A O   1 
HETATM 5299 O  O   . HOH I 7 .   ? -0.366  52.210 68.045  1.00 56.86  ? 1489 HOH A O   1 
HETATM 5300 O  O   . HOH I 7 .   ? 15.108  39.899 89.165  1.00 30.62  ? 1490 HOH A O   1 
HETATM 5301 O  O   . HOH I 7 .   ? 20.977  60.725 61.985  1.00 42.08  ? 1491 HOH A O   1 
HETATM 5302 O  O   . HOH I 7 .   ? 29.038  14.547 63.725  1.00 33.69  ? 1492 HOH A O   1 
HETATM 5303 O  O   . HOH I 7 .   ? 34.064  66.637 81.988  1.00 37.83  ? 1493 HOH A O   1 
HETATM 5304 O  O   . HOH I 7 .   ? 8.669   71.915 54.348  1.00 40.01  ? 1494 HOH A O   1 
HETATM 5305 O  O   . HOH I 7 .   ? 4.823   29.577 79.259  1.00 42.09  ? 1495 HOH A O   1 
HETATM 5306 O  O   . HOH I 7 .   ? -11.055 33.821 41.322  1.00 50.18  ? 1496 HOH A O   1 
HETATM 5307 O  O   . HOH I 7 .   ? 0.658   29.749 51.236  1.00 30.86  ? 1497 HOH A O   1 
HETATM 5308 O  O   . HOH I 7 .   ? 3.793   58.214 86.346  1.00 62.42  ? 1498 HOH A O   1 
HETATM 5309 O  O   . HOH I 7 .   ? 12.206  40.564 89.850  1.00 39.66  ? 1499 HOH A O   1 
HETATM 5310 O  O   . HOH I 7 .   ? 21.573  25.561 53.053  1.00 34.62  ? 1500 HOH A O   1 
HETATM 5311 O  O   . HOH I 7 .   ? 30.197  56.551 58.739  1.00 40.16  ? 1501 HOH A O   1 
HETATM 5312 O  O   . HOH I 7 .   ? 20.406  59.350 64.941  1.00 33.97  ? 1502 HOH A O   1 
HETATM 5313 O  O   . HOH I 7 .   ? 16.956  52.960 87.724  1.00 54.35  ? 1503 HOH A O   1 
HETATM 5314 O  O   . HOH I 7 .   ? 36.719  27.459 68.822  1.00 42.51  ? 1504 HOH A O   1 
HETATM 5315 O  O   . HOH I 7 .   ? 7.458   27.206 77.481  1.00 46.67  ? 1505 HOH A O   1 
HETATM 5316 O  O   . HOH I 7 .   ? 36.220  64.298 90.593  1.00 51.29  ? 1506 HOH A O   1 
HETATM 5317 O  O   . HOH I 7 .   ? -17.985 43.406 48.900  1.00 41.71  ? 1507 HOH A O   1 
HETATM 5318 O  O   . HOH I 7 .   ? 1.914   29.246 53.120  1.00 38.28  ? 1508 HOH A O   1 
HETATM 5319 O  O   . HOH I 7 .   ? -4.267  29.328 73.970  1.00 34.50  ? 1509 HOH A O   1 
HETATM 5320 O  O   . HOH I 7 .   ? 14.000  53.360 42.218  1.00 42.56  ? 1510 HOH A O   1 
HETATM 5321 O  O   . HOH I 7 .   ? 5.615   22.345 61.668  1.00 59.03  ? 1511 HOH A O   1 
HETATM 5322 O  O   . HOH I 7 .   ? -3.455  50.442 63.951  1.00 44.90  ? 1512 HOH A O   1 
HETATM 5323 O  O   . HOH I 7 .   ? 29.002  38.811 44.563  1.00 43.27  ? 1513 HOH A O   1 
HETATM 5324 O  O   . HOH I 7 .   ? 37.416  55.208 61.603  1.00 42.90  ? 1514 HOH A O   1 
HETATM 5325 O  O   . HOH I 7 .   ? 14.459  14.960 73.514  1.00 42.33  ? 1515 HOH A O   1 
HETATM 5326 O  O   . HOH I 7 .   ? 35.076  48.768 98.233  1.00 41.69  ? 1516 HOH A O   1 
HETATM 5327 O  O   . HOH I 7 .   ? 6.452   56.342 86.263  1.00 34.79  ? 1517 HOH A O   1 
HETATM 5328 O  O   . HOH I 7 .   ? 35.573  17.694 66.735  1.00 40.65  ? 1518 HOH A O   1 
HETATM 5329 O  O   . HOH I 7 .   ? 28.756  59.314 74.937  1.00 35.85  ? 1519 HOH A O   1 
HETATM 5330 O  O   . HOH I 7 .   ? 12.955  64.913 53.664  1.00 37.44  ? 1520 HOH A O   1 
HETATM 5331 O  O   . HOH I 7 .   ? 23.309  24.474 50.751  1.00 45.73  ? 1521 HOH A O   1 
HETATM 5332 O  O   . HOH I 7 .   ? 4.924   27.771 55.010  1.00 38.46  ? 1522 HOH A O   1 
HETATM 5333 O  O   . HOH I 7 .   ? 19.668  63.675 93.111  1.00 41.69  ? 1523 HOH A O   1 
HETATM 5334 O  O   . HOH I 7 .   ? 29.343  46.551 40.650  1.00 45.12  ? 1524 HOH A O   1 
HETATM 5335 O  O   . HOH I 7 .   ? 28.230  48.770 60.385  1.00 40.19  ? 1525 HOH A O   1 
HETATM 5336 O  O   . HOH I 7 .   ? 14.292  23.244 85.078  1.00 32.92  ? 1526 HOH A O   1 
HETATM 5337 O  O   . HOH I 7 .   ? 7.179   66.298 48.617  1.00 47.43  ? 1527 HOH A O   1 
HETATM 5338 O  O   . HOH I 7 .   ? -11.542 35.315 64.224  1.00 45.74  ? 1528 HOH A O   1 
HETATM 5339 O  O   . HOH I 7 .   ? -0.665  52.874 80.688  1.00 44.47  ? 1529 HOH A O   1 
HETATM 5340 O  O   . HOH I 7 .   ? 1.483   66.063 44.508  1.00 88.79  ? 1530 HOH A O   1 
HETATM 5341 O  O   . HOH I 7 .   ? 13.367  66.767 63.127  1.00 62.36  ? 1531 HOH A O   1 
HETATM 5342 O  O   . HOH I 7 .   ? 35.060  48.549 63.034  1.00 39.85  ? 1532 HOH A O   1 
HETATM 5343 O  O   . HOH I 7 .   ? 11.721  60.705 42.372  1.00 56.11  ? 1533 HOH A O   1 
HETATM 5344 O  O   . HOH I 7 .   ? 14.261  27.588 85.980  1.00 51.35  ? 1534 HOH A O   1 
HETATM 5345 O  O   . HOH I 7 .   ? 38.915  34.680 61.103  1.00 45.58  ? 1535 HOH A O   1 
HETATM 5346 O  O   . HOH I 7 .   ? 23.421  46.416 42.605  1.00 43.02  ? 1536 HOH A O   1 
HETATM 5347 O  O   . HOH I 7 .   ? 19.154  28.435 86.238  1.00 47.30  ? 1537 HOH A O   1 
HETATM 5348 O  O   . HOH I 7 .   ? 26.658  43.571 47.275  1.00 34.55  ? 1538 HOH A O   1 
HETATM 5349 O  O   . HOH I 7 .   ? 15.725  45.758 43.317  1.00 43.06  ? 1539 HOH A O   1 
HETATM 5350 O  O   . HOH I 7 .   ? 36.546  66.825 82.882  1.00 30.83  ? 1540 HOH A O   1 
HETATM 5351 O  O   . HOH I 7 .   ? 8.498   74.001 52.039  1.00 46.91  ? 1541 HOH A O   1 
HETATM 5352 O  O   . HOH I 7 .   ? 27.161  71.692 92.146  1.00 39.00  ? 1542 HOH A O   1 
HETATM 5353 O  O   . HOH I 7 .   ? 27.946  33.322 85.163  1.00 33.09  ? 1543 HOH A O   1 
HETATM 5354 O  O   . HOH I 7 .   ? 15.310  10.169 65.089  1.00 63.51  ? 1544 HOH A O   1 
HETATM 5355 O  O   . HOH I 7 .   ? -13.474 41.923 71.321  1.00 44.29  ? 1545 HOH A O   1 
HETATM 5356 O  O   . HOH I 7 .   ? -6.593  61.419 56.587  1.00 36.57  ? 1546 HOH A O   1 
HETATM 5357 O  O   . HOH I 7 .   ? -4.107  19.122 50.753  1.00 80.39  ? 1547 HOH A O   1 
HETATM 5358 O  O   . HOH I 7 .   ? 21.809  59.754 43.571  1.00 64.03  ? 1548 HOH A O   1 
HETATM 5359 O  O   . HOH I 7 .   ? 32.503  55.926 51.478  1.00 51.13  ? 1549 HOH A O   1 
HETATM 5360 O  O   . HOH I 7 .   ? 17.433  44.251 80.196  1.00 52.95  ? 1550 HOH A O   1 
HETATM 5361 O  O   . HOH I 7 .   ? -2.882  28.319 76.738  1.00 57.32  ? 1551 HOH A O   1 
HETATM 5362 O  O   . HOH I 7 .   ? 8.921   18.143 71.756  1.00 45.59  ? 1552 HOH A O   1 
HETATM 5363 O  O   . HOH I 7 .   ? 46.415  37.408 72.673  1.00 74.61  ? 1553 HOH A O   1 
HETATM 5364 O  O   . HOH I 7 .   ? 46.612  53.365 82.940  1.00 41.92  ? 1554 HOH A O   1 
HETATM 5365 O  O   . HOH I 7 .   ? 39.885  53.691 74.043  1.00 45.59  ? 1555 HOH A O   1 
HETATM 5366 O  O   . HOH I 7 .   ? 28.187  69.890 80.215  1.00 33.51  ? 1556 HOH A O   1 
HETATM 5367 O  O   . HOH I 7 .   ? 10.557  47.292 72.599  1.00 14.04  ? 1557 HOH A O   1 
HETATM 5368 O  O   . HOH I 7 .   ? 0.687   71.963 70.644  1.00 40.63  ? 1558 HOH A O   1 
HETATM 5369 O  O   . HOH I 7 .   ? 33.335  31.445 62.420  1.00 32.53  ? 1559 HOH A O   1 
HETATM 5370 O  O   . HOH I 7 .   ? 26.658  39.474 43.256  1.00 32.50  ? 1560 HOH A O   1 
HETATM 5371 O  O   . HOH I 7 .   ? 30.185  25.893 82.542  1.00 45.40  ? 1561 HOH A O   1 
HETATM 5372 O  O   . HOH I 7 .   ? -13.020 27.130 42.607  1.00 60.63  ? 1562 HOH A O   1 
HETATM 5373 O  O   . HOH I 7 .   ? -13.804 40.073 67.421  1.00 42.25  ? 1563 HOH A O   1 
HETATM 5374 O  O   . HOH I 7 .   ? 1.328   41.371 78.681  1.00 56.39  ? 1564 HOH A O   1 
HETATM 5375 O  O   . HOH I 7 .   ? 33.554  26.796 70.488  1.00 37.48  ? 1565 HOH A O   1 
HETATM 5376 O  O   . HOH I 7 .   ? 34.317  54.835 70.139  1.00 57.37  ? 1566 HOH A O   1 
HETATM 5377 O  O   . HOH I 7 .   ? 35.581  54.971 99.979  1.00 47.25  ? 1567 HOH A O   1 
HETATM 5378 O  O   . HOH I 7 .   ? 13.278  63.141 46.031  1.00 57.79  ? 1568 HOH A O   1 
HETATM 5379 O  O   . HOH I 7 .   ? 37.787  55.035 100.999 1.00 53.08  ? 1569 HOH A O   1 
HETATM 5380 O  O   . HOH I 7 .   ? 13.794  19.603 83.707  1.00 47.87  ? 1570 HOH A O   1 
HETATM 5381 O  O   . HOH I 7 .   ? 25.470  45.716 93.468  1.00 36.66  ? 1571 HOH A O   1 
HETATM 5382 O  O   . HOH I 7 .   ? 10.578  17.685 75.291  1.00 37.43  ? 1572 HOH A O   1 
HETATM 5383 O  O   . HOH I 7 .   ? 52.811  39.642 69.739  1.00 44.12  ? 1573 HOH A O   1 
HETATM 5384 O  O   . HOH I 7 .   ? 23.329  56.116 94.868  1.00 47.73  ? 1574 HOH A O   1 
HETATM 5385 O  O   . HOH I 7 .   ? 35.936  48.711 65.428  1.00 58.05  ? 1575 HOH A O   1 
HETATM 5386 O  O   . HOH I 7 .   ? 28.119  66.507 82.635  1.00 41.75  ? 1576 HOH A O   1 
HETATM 5387 O  O   . HOH I 7 .   ? -0.565  54.408 74.299  1.00 50.86  ? 1577 HOH A O   1 
HETATM 5388 O  O   . HOH I 7 .   ? 4.072   70.416 58.486  1.00 35.45  ? 1578 HOH A O   1 
HETATM 5389 O  O   . HOH I 7 .   ? -3.762  26.579 63.779  1.00 53.91  ? 1579 HOH A O   1 
HETATM 5390 O  O   . HOH I 7 .   ? 19.595  35.426 41.883  1.00 51.58  ? 1580 HOH A O   1 
HETATM 5391 O  O   . HOH I 7 .   ? 24.800  7.578  70.043  1.00 41.13  ? 1581 HOH A O   1 
HETATM 5392 O  O   . HOH I 7 .   ? 17.947  10.147 65.643  1.00 58.35  ? 1582 HOH A O   1 
HETATM 5393 O  O   . HOH I 7 .   ? 31.312  44.348 64.437  1.00 48.49  ? 1583 HOH A O   1 
HETATM 5394 O  O   . HOH I 7 .   ? 46.224  50.030 81.043  1.00 53.87  ? 1584 HOH A O   1 
HETATM 5395 O  O   . HOH I 7 .   ? 35.129  52.464 51.431  1.00 54.76  ? 1585 HOH A O   1 
HETATM 5396 O  O   . HOH I 7 .   ? 5.885   65.189 84.813  1.00 83.91  ? 1586 HOH A O   1 
HETATM 5397 O  O   . HOH I 7 .   ? 20.281  16.200 55.863  1.00 46.25  ? 1587 HOH A O   1 
HETATM 5398 O  O   . HOH I 7 .   ? -5.180  21.053 56.028  1.00 37.00  ? 1588 HOH A O   1 
HETATM 5399 O  O   . HOH I 7 .   ? -11.188 38.067 41.229  1.00 69.22  ? 1589 HOH A O   1 
HETATM 5400 O  O   . HOH I 7 .   ? 15.256  67.180 75.313  1.00 51.22  ? 1590 HOH A O   1 
HETATM 5401 O  O   . HOH I 7 .   ? 3.374   63.019 56.672  1.00 42.46  ? 1591 HOH A O   1 
HETATM 5402 O  O   . HOH I 7 .   ? 30.082  15.975 73.952  1.00 49.06  ? 1592 HOH A O   1 
HETATM 5403 O  O   . HOH I 7 .   ? -7.562  32.348 64.350  1.00 53.88  ? 1593 HOH A O   1 
HETATM 5404 O  O   . HOH I 7 .   ? 14.504  69.382 77.201  1.00 79.52  ? 1594 HOH A O   1 
HETATM 5405 O  O   . HOH I 7 .   ? 37.374  41.179 54.837  1.00 41.94  ? 1595 HOH A O   1 
HETATM 5406 O  O   . HOH I 7 .   ? 22.651  62.725 71.998  1.00 46.62  ? 1596 HOH A O   1 
HETATM 5407 O  O   . HOH I 7 .   ? 13.052  47.941 46.569  1.00 50.14  ? 1597 HOH A O   1 
HETATM 5408 O  O   . HOH I 7 .   ? -1.906  45.997 36.480  1.00 62.33  ? 1598 HOH A O   1 
HETATM 5409 O  O   . HOH I 7 .   ? 35.740  52.464 53.693  1.00 55.17  ? 1599 HOH A O   1 
HETATM 5410 O  O   . HOH I 7 .   ? 30.727  32.353 49.843  1.00 56.92  ? 1600 HOH A O   1 
HETATM 5411 O  O   . HOH I 7 .   ? 0.025   32.686 42.604  1.00 48.23  ? 1601 HOH A O   1 
HETATM 5412 O  O   . HOH I 7 .   ? 47.830  56.735 86.611  1.00 47.42  ? 1602 HOH A O   1 
HETATM 5413 O  O   . HOH I 7 .   ? 18.095  60.627 94.715  1.00 65.28  ? 1603 HOH A O   1 
HETATM 5414 O  O   . HOH I 7 .   ? 2.306   31.026 81.802  1.00 37.32  ? 1604 HOH A O   1 
HETATM 5415 O  O   . HOH I 7 .   ? 25.104  38.760 87.563  1.00 46.99  ? 1605 HOH A O   1 
HETATM 5416 O  O   . HOH I 7 .   ? 22.034  70.217 89.142  1.00 47.15  ? 1606 HOH A O   1 
HETATM 5417 O  O   . HOH I 7 .   ? 22.136  73.412 87.005  1.00 38.47  ? 1607 HOH A O   1 
HETATM 5418 O  O   . HOH I 7 .   ? -0.926  26.674 74.129  1.00 58.76  ? 1608 HOH A O   1 
HETATM 5419 O  O   . HOH I 7 .   ? -6.108  48.377 71.102  1.00 64.56  ? 1609 HOH A O   1 
HETATM 5420 O  O   . HOH I 7 .   ? 39.520  39.424 56.576  1.00 72.80  ? 1610 HOH A O   1 
HETATM 5421 O  O   . HOH I 7 .   ? -4.081  58.518 47.377  1.00 60.65  ? 1611 HOH A O   1 
HETATM 5422 O  O   . HOH I 7 .   ? 34.434  23.876 75.179  1.00 48.53  ? 1612 HOH A O   1 
HETATM 5423 O  O   . HOH I 7 .   ? 17.400  63.380 50.267  1.00 40.76  ? 1613 HOH A O   1 
HETATM 5424 O  O   . HOH I 7 .   ? 9.647   61.533 68.296  1.00 46.31  ? 1614 HOH A O   1 
HETATM 5425 O  O   . HOH I 7 .   ? 41.430  58.961 99.800  1.00 49.23  ? 1615 HOH A O   1 
HETATM 5426 O  O   . HOH I 7 .   ? 23.725  20.340 53.830  1.00 51.65  ? 1616 HOH A O   1 
HETATM 5427 O  O   . HOH I 7 .   ? 15.576  16.190 78.131  1.00 61.27  ? 1617 HOH A O   1 
HETATM 5428 O  O   . HOH I 7 .   ? 29.334  21.375 75.882  1.00 44.80  ? 1618 HOH A O   1 
HETATM 5429 O  O   . HOH I 7 .   ? -1.624  50.514 39.683  1.00 49.85  ? 1619 HOH A O   1 
HETATM 5430 O  O   . HOH I 7 .   ? 8.771   69.104 72.705  1.00 47.81  ? 1620 HOH A O   1 
HETATM 5431 O  O   . HOH I 7 .   ? -21.311 45.001 55.217  1.00 64.01  ? 1621 HOH A O   1 
HETATM 5432 O  O   . HOH I 7 .   ? -1.392  54.790 67.171  1.00 53.90  ? 1622 HOH A O   1 
HETATM 5433 O  O   . HOH I 7 .   ? 38.464  56.277 74.548  1.00 63.93  ? 1623 HOH A O   1 
HETATM 5434 O  O   . HOH I 7 .   ? 33.977  32.491 81.832  1.00 50.18  ? 1624 HOH A O   1 
HETATM 5435 O  O   . HOH I 7 .   ? 16.060  54.317 91.714  1.00 61.57  ? 1625 HOH A O   1 
HETATM 5436 O  O   . HOH I 7 .   ? 21.009  33.700 89.176  1.00 65.31  ? 1626 HOH A O   1 
HETATM 5437 O  O   . HOH I 7 .   ? 28.726  36.253 85.146  1.00 34.76  ? 1627 HOH A O   1 
HETATM 5438 O  O   . HOH I 7 .   ? 24.767  40.641 41.912  1.00 44.57  ? 1628 HOH A O   1 
HETATM 5439 O  O   . HOH I 7 .   ? 26.892  64.239 83.251  1.00 39.08  ? 1629 HOH A O   1 
HETATM 5440 O  O   . HOH I 7 .   ? 28.264  48.404 92.814  1.00 34.64  ? 1630 HOH A O   1 
HETATM 5441 O  O   . HOH I 7 .   ? 19.375  61.177 66.689  1.00 44.16  ? 1631 HOH A O   1 
HETATM 5442 O  O   . HOH I 7 .   ? 6.639   42.598 82.079  1.00 100.00 ? 1632 HOH A O   1 
HETATM 5443 O  O   . HOH I 7 .   ? 40.403  33.306 64.502  1.00 45.36  ? 1633 HOH A O   1 
HETATM 5444 O  O   . HOH I 7 .   ? 16.172  18.117 52.264  1.00 44.76  ? 1634 HOH A O   1 
HETATM 5445 O  O   . HOH I 7 .   ? 33.899  42.310 48.851  1.00 52.28  ? 1635 HOH A O   1 
HETATM 5446 O  O   . HOH I 7 .   ? 22.675  9.894  76.942  1.00 51.28  ? 1636 HOH A O   1 
HETATM 5447 O  O   . HOH I 7 .   ? -11.295 52.730 60.674  1.00 76.16  ? 1637 HOH A O   1 
HETATM 5448 O  O   . HOH I 7 .   ? 20.605  66.466 58.378  1.00 61.62  ? 1638 HOH A O   1 
HETATM 5449 O  O   . HOH I 7 .   ? 35.282  26.341 50.576  1.00 58.72  ? 1639 HOH A O   1 
HETATM 5450 O  O   . HOH I 7 .   ? -0.234  39.225 40.255  1.00 54.13  ? 1640 HOH A O   1 
HETATM 5451 O  O   . HOH I 7 .   ? 36.597  43.931 57.481  1.00 43.52  ? 1641 HOH A O   1 
HETATM 5452 O  O   . HOH I 7 .   ? 20.374  41.951 74.120  1.00 47.12  ? 1642 HOH A O   1 
HETATM 5453 O  O   . HOH I 7 .   ? 31.857  31.721 82.689  1.00 46.66  ? 1643 HOH A O   1 
HETATM 5454 O  O   . HOH I 7 .   ? 34.733  63.213 92.164  1.00 55.58  ? 1644 HOH A O   1 
HETATM 5455 O  O   . HOH I 7 .   ? -20.506 26.471 44.860  1.00 73.89  ? 1645 HOH A O   1 
HETATM 5456 O  O   . HOH I 7 .   ? 37.699  32.453 62.558  1.00 46.00  ? 1646 HOH A O   1 
HETATM 5457 O  O   . HOH I 7 .   ? 8.296   38.910 67.642  1.00 39.42  ? 1647 HOH A O   1 
HETATM 5458 O  O   . HOH I 7 .   ? -0.194  63.829 72.188  1.00 47.07  ? 1648 HOH A O   1 
HETATM 5459 O  O   . HOH I 7 .   ? 32.212  52.268 51.134  1.00 52.82  ? 1649 HOH A O   1 
HETATM 5460 O  O   . HOH I 7 .   ? 33.917  21.004 64.439  1.00 26.12  ? 1650 HOH A O   1 
HETATM 5461 O  O   . HOH I 7 .   ? 42.573  58.916 95.252  1.00 20.78  ? 1651 HOH A O   1 
HETATM 5462 O  O   . HOH I 7 .   ? 34.529  66.786 72.611  1.00 36.24  ? 1652 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   PRO 2   1   1   PRO PRO A . n 
A 1 3   GLU 3   2   2   GLU GLU A . n 
A 1 4   ILE 4   3   3   ILE ILE A . n 
A 1 5   VAL 5   4   4   VAL VAL A . n 
A 1 6   ASP 6   5   5   ASP ASP A . n 
A 1 7   THR 7   6   6   THR THR A . n 
A 1 8   CYS 8   7   7   CYS CYS A . n 
A 1 9   SER 9   8   8   SER SER A . n 
A 1 10  LEU 10  9   9   LEU LEU A . n 
A 1 11  ALA 11  10  10  ALA ALA A . n 
A 1 12  SER 12  11  11  SER SER A . n 
A 1 13  PRO 13  12  12  PRO PRO A . n 
A 1 14  ALA 14  13  13  ALA ALA A . n 
A 1 15  SER 15  14  14  SER SER A . n 
A 1 16  VAL 16  15  15  VAL VAL A . n 
A 1 17  CYS 17  16  16  CYS CYS A . n 
A 1 18  ARG 18  17  17  ARG ARG A . n 
A 1 19  THR 19  18  18  THR THR A . n 
A 1 20  LYS 20  19  19  LYS LYS A . n 
A 1 21  HIS 21  20  20  HIS HIS A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  HIS 23  22  22  HIS HIS A . n 
A 1 24  LEU 24  23  23  LEU LEU A . n 
A 1 25  ARG 25  24  24  ARG ARG A . n 
A 1 26  CYS 26  25  25  CYS CYS A . n 
A 1 27  SER 27  26  26  SER SER A . n 
A 1 28  VAL 28  27  27  VAL VAL A . n 
A 1 29  ASP 29  28  28  ASP ASP A . n 
A 1 30  PHE 30  29  29  PHE PHE A . n 
A 1 31  THR 31  30  30  THR THR A . n 
A 1 32  ARG 32  31  31  ARG ARG A . n 
A 1 33  ARG 33  32  32  ARG ARG A . n 
A 1 34  THR 34  33  33  THR THR A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  THR 36  35  35  THR THR A . n 
A 1 37  GLY 37  36  36  GLY GLY A . n 
A 1 38  THR 38  37  37  THR THR A . n 
A 1 39  ALA 39  38  38  ALA ALA A . n 
A 1 40  ALA 40  39  39  ALA ALA A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  VAL 43  42  42  VAL VAL A . n 
A 1 44  GLN 44  43  43  GLN GLN A . n 
A 1 45  SER 45  44  44  SER SER A . n 
A 1 46  GLN 46  45  45  GLN GLN A . n 
A 1 47  GLU 47  46  46  GLU GLU A . n 
A 1 48  ASP 48  47  47  ASP ASP A . n 
A 1 49  ASN 49  48  48  ASN ASN A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  ARG 51  50  50  ARG ARG A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  LEU 53  52  52  LEU LEU A . n 
A 1 54  VAL 54  53  53  VAL VAL A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  ASP 56  55  55  ASP ASP A . n 
A 1 57  THR 57  56  56  THR THR A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  ASP 59  58  58  ASP ASP A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  THR 61  60  60  THR THR A . n 
A 1 62  ILE 62  61  61  ILE ILE A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  LYS 64  63  63  LYS LYS A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  VAL 66  65  65  VAL VAL A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  GLY 69  68  68  GLY GLY A . n 
A 1 70  GLN 70  69  69  GLN GLN A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  VAL 72  71  71  VAL VAL A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  TYR 74  73  73  TYR TYR A . n 
A 1 75  ALA 75  74  74  ALA ALA A . n 
A 1 76  LEU 76  75  75  LEU LEU A . n 
A 1 77  GLY 77  76  76  GLY GLY A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  ARG 79  78  78  ARG ARG A . n 
A 1 80  GLN 80  79  79  GLN GLN A . n 
A 1 81  SER 81  80  80  SER SER A . n 
A 1 82  TYR 82  81  81  TYR TYR A . n 
A 1 83  LYS 83  82  82  LYS LYS A . n 
A 1 84  GLY 84  83  83  GLY GLY A . n 
A 1 85  SER 85  84  84  SER SER A . n 
A 1 86  PRO 86  85  85  PRO PRO A . n 
A 1 87  MET 87  86  86  MET MET A . n 
A 1 88  GLU 88  87  87  GLU GLU A . n 
A 1 89  ILE 89  88  88  ILE ILE A . n 
A 1 90  SER 90  89  89  SER SER A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  PRO 92  91  91  PRO PRO A . n 
A 1 93  ILE 93  92  92  ILE ILE A . n 
A 1 94  ALA 94  93  93  ALA ALA A . n 
A 1 95  LEU 95  94  94  LEU LEU A . n 
A 1 96  SER 96  95  95  SER SER A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  ASN 98  97  97  ASN ASN A . n 
A 1 99  GLN 99  98  98  GLN GLN A . n 
A 1 100 GLU 100 99  99  GLU GLU A . n 
A 1 101 ILE 101 100 100 ILE ILE A . n 
A 1 102 VAL 102 101 101 VAL VAL A . n 
A 1 103 ILE 103 102 102 ILE ILE A . n 
A 1 104 GLU 104 103 103 GLU GLU A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 SER 106 105 105 SER SER A . n 
A 1 107 PHE 107 106 106 PHE PHE A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 THR 109 108 108 THR THR A . n 
A 1 110 SER 110 109 109 SER SER A . n 
A 1 111 PRO 111 110 110 PRO PRO A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 SER 113 112 112 SER SER A . n 
A 1 114 SER 114 113 113 SER SER A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 GLN 117 116 116 GLN GLN A . n 
A 1 118 TRP 118 117 117 TRP TRP A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 THR 120 119 119 THR THR A . n 
A 1 121 PRO 121 120 120 PRO PRO A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 GLN 123 122 122 GLN GLN A . n 
A 1 124 THR 124 123 123 THR THR A . n 
A 1 125 SER 125 124 124 SER SER A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 LYS 127 126 126 LYS LYS A . n 
A 1 128 GLU 128 127 127 GLU GLU A . n 
A 1 129 HIS 129 128 128 HIS HIS A . n 
A 1 130 PRO 130 129 129 PRO PRO A . n 
A 1 131 TYR 131 130 130 TYR TYR A . n 
A 1 132 LEU 132 131 131 LEU LEU A . n 
A 1 133 PHE 133 132 132 PHE PHE A . n 
A 1 134 SER 134 133 133 SER SER A . n 
A 1 135 GLN 135 134 134 GLN GLN A . n 
A 1 136 CYS 136 135 135 CYS CYS A . n 
A 1 137 GLN 137 136 136 GLN GLN A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 ILE 139 138 138 ILE ILE A . n 
A 1 140 HIS 140 139 139 HIS HIS A . n 
A 1 141 CYS 141 140 140 CYS CYS A . n 
A 1 142 ARG 142 141 141 ARG ARG A . n 
A 1 143 ALA 143 142 142 ALA ALA A . n 
A 1 144 ILE 144 143 143 ILE ILE A . n 
A 1 145 LEU 145 144 144 LEU LEU A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 CYS 147 146 146 CYS CYS A . n 
A 1 148 GLN 148 147 147 GLN GLN A . n 
A 1 149 ASP 149 148 148 ASP ASP A . n 
A 1 150 THR 150 149 149 THR THR A . n 
A 1 151 PRO 151 150 150 PRO PRO A . n 
A 1 152 SER 152 151 151 SER SER A . n 
A 1 153 VAL 153 152 152 VAL VAL A . n 
A 1 154 LYS 154 153 153 LYS LYS A . n 
A 1 155 LEU 155 154 154 LEU LEU A . n 
A 1 156 THR 156 155 155 THR THR A . n 
A 1 157 TYR 157 156 156 TYR TYR A . n 
A 1 158 THR 158 157 157 THR THR A . n 
A 1 159 ALA 159 158 158 ALA ALA A . n 
A 1 160 GLU 160 159 159 GLU GLU A . n 
A 1 161 VAL 161 160 160 VAL VAL A . n 
A 1 162 SER 162 161 161 SER SER A . n 
A 1 163 VAL 163 162 162 VAL VAL A . n 
A 1 164 PRO 164 163 163 PRO PRO A . n 
A 1 165 LYS 165 164 164 LYS LYS A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 VAL 168 167 167 VAL VAL A . n 
A 1 169 ALA 169 168 168 ALA ALA A . n 
A 1 170 LEU 170 169 169 LEU LEU A . n 
A 1 171 MET 171 170 170 MET MET A . n 
A 1 172 SER 172 171 171 SER SER A . n 
A 1 173 ALA 173 172 172 ALA ALA A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 ARG 175 174 174 ARG ARG A . n 
A 1 176 ASP 176 175 175 ASP ASP A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 GLU 178 177 177 GLU GLU A . n 
A 1 179 THR 179 178 178 THR THR A . n 
A 1 180 PRO 180 179 179 PRO PRO A . n 
A 1 181 ASP 181 180 180 ASP ASP A . n 
A 1 182 PRO 182 181 181 PRO PRO A . n 
A 1 183 GLU 183 182 182 GLU GLU A . n 
A 1 184 ASP 184 183 183 ASP ASP A . n 
A 1 185 PRO 185 184 184 PRO PRO A . n 
A 1 186 SER 186 185 185 SER SER A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 LYS 188 187 187 LYS LYS A . n 
A 1 189 ILE 189 188 188 ILE ILE A . n 
A 1 190 TYR 190 189 189 TYR TYR A . n 
A 1 191 LYS 191 190 190 LYS LYS A . n 
A 1 192 PHE 192 191 191 PHE PHE A . n 
A 1 193 ILE 193 192 192 ILE ILE A . n 
A 1 194 GLN 194 193 193 GLN GLN A . n 
A 1 195 LYS 195 194 194 LYS LYS A . n 
A 1 196 VAL 196 195 195 VAL VAL A . n 
A 1 197 PRO 197 196 196 PRO PRO A . n 
A 1 198 ILE 198 197 197 ILE ILE A . n 
A 1 199 PRO 199 198 198 PRO PRO A . n 
A 1 200 CYS 200 199 199 CYS CYS A . n 
A 1 201 TYR 201 200 200 TYR TYR A . n 
A 1 202 LEU 202 201 201 LEU LEU A . n 
A 1 203 ILE 203 202 202 ILE ILE A . n 
A 1 204 ALA 204 203 203 ALA ALA A . n 
A 1 205 LEU 205 204 204 LEU LEU A . n 
A 1 206 VAL 206 205 205 VAL VAL A . n 
A 1 207 VAL 207 206 206 VAL VAL A . n 
A 1 208 GLY 208 207 207 GLY GLY A . n 
A 1 209 ALA 209 208 208 ALA ALA A . n 
A 1 210 LEU 210 209 209 LEU LEU A . n 
A 1 211 GLU 211 210 210 GLU GLU A . n 
A 1 212 SER 212 211 211 SER SER A . n 
A 1 213 ARG 213 212 212 ARG ARG A . n 
A 1 214 GLN 214 213 213 GLN GLN A . n 
A 1 215 ILE 215 214 214 ILE ILE A . n 
A 1 216 GLY 216 215 215 GLY GLY A . n 
A 1 217 PRO 217 216 216 PRO PRO A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 THR 219 218 218 THR THR A . n 
A 1 220 LEU 220 219 219 LEU LEU A . n 
A 1 221 VAL 221 220 220 VAL VAL A . n 
A 1 222 TRP 222 221 221 TRP TRP A . n 
A 1 223 SER 223 222 222 SER SER A . n 
A 1 224 GLU 224 223 223 GLU GLU A . n 
A 1 225 LYS 225 224 224 LYS LYS A . n 
A 1 226 GLU 226 225 225 GLU GLU A . n 
A 1 227 GLN 227 226 226 GLN GLN A . n 
A 1 228 VAL 228 227 227 VAL VAL A . n 
A 1 229 GLU 229 228 228 GLU GLU A . n 
A 1 230 LYS 230 229 229 LYS LYS A . n 
A 1 231 SER 231 230 230 SER SER A . n 
A 1 232 ALA 232 231 231 ALA ALA A . n 
A 1 233 TYR 233 232 232 TYR TYR A . n 
A 1 234 GLU 234 233 233 GLU GLU A . n 
A 1 235 PHE 235 234 234 PHE PHE A . n 
A 1 236 SER 236 235 235 SER SER A . n 
A 1 237 GLU 237 236 236 GLU GLU A . n 
A 1 238 THR 238 237 237 THR THR A . n 
A 1 239 GLU 239 238 238 GLU GLU A . n 
A 1 240 SER 240 239 239 SER SER A . n 
A 1 241 MET 241 240 240 MET MET A . n 
A 1 242 LEU 242 241 241 LEU LEU A . n 
A 1 243 LYS 243 242 242 LYS LYS A . n 
A 1 244 ILE 244 243 243 ILE ILE A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 GLU 246 245 245 GLU GLU A . n 
A 1 247 ASP 247 246 246 ASP ASP A . n 
A 1 248 LEU 248 247 247 LEU LEU A . n 
A 1 249 GLY 249 248 248 GLY GLY A . n 
A 1 250 GLY 250 249 249 GLY GLY A . n 
A 1 251 PRO 251 250 250 PRO PRO A . n 
A 1 252 TYR 252 251 251 TYR TYR A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 TRP 254 253 253 TRP TRP A . n 
A 1 255 GLY 255 254 254 GLY GLY A . n 
A 1 256 GLN 256 255 255 GLN GLN A . n 
A 1 257 TYR 257 256 256 TYR TYR A . n 
A 1 258 ASP 258 257 257 ASP ASP A . n 
A 1 259 LEU 259 258 258 LEU LEU A . n 
A 1 260 LEU 260 259 259 LEU LEU A . n 
A 1 261 VAL 261 260 260 VAL VAL A . n 
A 1 262 LEU 262 261 261 LEU LEU A . n 
A 1 263 PRO 263 262 262 PRO PRO A . n 
A 1 264 PRO 264 263 263 PRO PRO A . n 
A 1 265 SER 265 264 264 SER SER A . n 
A 1 266 PHE 266 265 265 PHE PHE A . n 
A 1 267 PRO 267 266 266 PRO PRO A . n 
A 1 268 TYR 268 267 267 TYR TYR A . n 
A 1 269 GLY 269 268 268 GLY GLY A . n 
A 1 270 GLY 270 269 269 GLY GLY A . n 
A 1 271 MET 271 270 270 MET MET A . n 
A 1 272 GLU 272 271 271 GLU GLU A . n 
A 1 273 ASN 273 272 272 ASN ASN A . n 
A 1 274 PRO 274 273 273 PRO PRO A . n 
A 1 275 CYS 275 274 274 CYS CYS A . n 
A 1 276 LEU 276 275 275 LEU LEU A . n 
A 1 277 THR 277 276 276 THR THR A . n 
A 1 278 PHE 278 277 277 PHE PHE A . n 
A 1 279 VAL 279 278 278 VAL VAL A . n 
A 1 280 THR 280 279 279 THR THR A . n 
A 1 281 PRO 281 280 280 PRO PRO A . n 
A 1 282 THR 282 281 281 THR THR A . n 
A 1 283 LEU 283 282 282 LEU LEU A . n 
A 1 284 LEU 284 283 283 LEU LEU A . n 
A 1 285 ALA 285 284 284 ALA ALA A . n 
A 1 286 GLY 286 285 285 GLY GLY A . n 
A 1 287 ASP 287 286 286 ASP ASP A . n 
A 1 288 LYS 288 287 287 LYS LYS A . n 
A 1 289 SER 289 288 288 SER SER A . n 
A 1 290 LEU 290 289 289 LEU LEU A . n 
A 1 291 SER 291 290 290 SER SER A . n 
A 1 292 ASN 292 291 291 ASN ASN A . n 
A 1 293 VAL 293 292 292 VAL VAL A . n 
A 1 294 ILE 294 293 293 ILE ILE A . n 
A 1 295 ALA 295 294 294 ALA ALA A . n 
A 1 296 HIS 296 295 295 HIS HIS A . n 
A 1 297 GLU 297 296 296 GLU GLU A . n 
A 1 298 ILE 298 297 297 ILE ILE A . n 
A 1 299 SER 299 298 298 SER SER A . n 
A 1 300 HIS 300 299 299 HIS HIS A . n 
A 1 301 SER 301 300 300 SER SER A . n 
A 1 302 TRP 302 301 301 TRP TRP A . n 
A 1 303 THR 303 302 302 THR THR A . n 
A 1 304 GLY 304 303 303 GLY GLY A . n 
A 1 305 ASN 305 304 304 ASN ASN A . n 
A 1 306 LEU 306 305 305 LEU LEU A . n 
A 1 307 VAL 307 306 306 VAL VAL A . n 
A 1 308 THR 308 307 307 THR THR A . n 
A 1 309 ASN 309 308 308 ASN ASN A . n 
A 1 310 LYS 310 309 309 LYS LYS A . n 
A 1 311 THR 311 310 310 THR THR A . n 
A 1 312 TRP 312 311 311 TRP TRP A . n 
A 1 313 ASP 313 312 312 ASP ASP A . n 
A 1 314 HIS 314 313 313 HIS HIS A . n 
A 1 315 PHE 315 314 314 PHE PHE A . n 
A 1 316 TRP 316 315 315 TRP TRP A . n 
A 1 317 LEU 317 316 316 LEU LEU A . n 
A 1 318 ASN 318 317 317 ASN ASN A . n 
A 1 319 GLU 319 318 318 GLU GLU A . n 
A 1 320 GLY 320 319 319 GLY GLY A . n 
A 1 321 HIS 321 320 320 HIS HIS A . n 
A 1 322 THR 322 321 321 THR THR A . n 
A 1 323 VAL 323 322 322 VAL VAL A . n 
A 1 324 TYR 324 323 323 TYR TYR A . n 
A 1 325 LEU 325 324 324 LEU LEU A . n 
A 1 326 GLU 326 325 325 GLU GLU A . n 
A 1 327 ARG 327 326 326 ARG ARG A . n 
A 1 328 HIS 328 327 327 HIS HIS A . n 
A 1 329 ILE 329 328 328 ILE ILE A . n 
A 1 330 CYS 330 329 329 CYS CYS A . n 
A 1 331 GLY 331 330 330 GLY GLY A . n 
A 1 332 ARG 332 331 331 ARG ARG A . n 
A 1 333 LEU 333 332 332 LEU LEU A . n 
A 1 334 PHE 334 333 333 PHE PHE A . n 
A 1 335 GLY 335 334 334 GLY GLY A . n 
A 1 336 GLU 336 335 335 GLU GLU A . n 
A 1 337 LYS 337 336 336 LYS LYS A . n 
A 1 338 PHE 338 337 337 PHE PHE A . n 
A 1 339 ARG 339 338 338 ARG ARG A . n 
A 1 340 HIS 340 339 339 HIS HIS A . n 
A 1 341 PHE 341 340 340 PHE PHE A . n 
A 1 342 ASN 342 341 341 ASN ASN A . n 
A 1 343 ALA 343 342 342 ALA ALA A . n 
A 1 344 LEU 344 343 343 LEU LEU A . n 
A 1 345 GLY 345 344 344 GLY GLY A . n 
A 1 346 GLY 346 345 345 GLY GLY A . n 
A 1 347 TRP 347 346 346 TRP TRP A . n 
A 1 348 GLY 348 347 347 GLY GLY A . n 
A 1 349 GLU 349 348 348 GLU GLU A . n 
A 1 350 LEU 350 349 349 LEU LEU A . n 
A 1 351 GLN 351 350 350 GLN GLN A . n 
A 1 352 ASN 352 351 351 ASN ASN A . n 
A 1 353 SER 353 352 352 SER SER A . n 
A 1 354 VAL 354 353 353 VAL VAL A . n 
A 1 355 LYS 355 354 354 LYS LYS A . n 
A 1 356 THR 356 355 355 THR THR A . n 
A 1 357 PHE 357 356 356 PHE PHE A . n 
A 1 358 GLY 358 357 357 GLY GLY A . n 
A 1 359 GLU 359 358 358 GLU GLU A . n 
A 1 360 THR 360 359 359 THR THR A . n 
A 1 361 HIS 361 360 360 HIS HIS A . n 
A 1 362 PRO 362 361 361 PRO PRO A . n 
A 1 363 PHE 363 362 362 PHE PHE A . n 
A 1 364 THR 364 363 363 THR THR A . n 
A 1 365 LYS 365 364 364 LYS LYS A . n 
A 1 366 LEU 366 365 365 LEU LEU A . n 
A 1 367 VAL 367 366 366 VAL VAL A . n 
A 1 368 VAL 368 367 367 VAL VAL A . n 
A 1 369 ASP 369 368 368 ASP ASP A . n 
A 1 370 LEU 370 369 369 LEU LEU A . n 
A 1 371 THR 371 370 370 THR THR A . n 
A 1 372 ASP 372 371 371 ASP ASP A . n 
A 1 373 ILE 373 372 372 ILE ILE A . n 
A 1 374 ASP 374 373 373 ASP ASP A . n 
A 1 375 PRO 375 374 374 PRO PRO A . n 
A 1 376 ASP 376 375 375 ASP ASP A . n 
A 1 377 VAL 377 376 376 VAL VAL A . n 
A 1 378 ALA 378 377 377 ALA ALA A . n 
A 1 379 TYR 379 378 378 TYR TYR A . n 
A 1 380 SER 380 379 379 SER SER A . n 
A 1 381 SER 381 380 380 SER SER A . n 
A 1 382 VAL 382 381 381 VAL VAL A . n 
A 1 383 PRO 383 382 382 PRO PRO A . n 
A 1 384 TYR 384 383 383 TYR TYR A . n 
A 1 385 GLU 385 384 384 GLU GLU A . n 
A 1 386 LYS 386 385 385 LYS LYS A . n 
A 1 387 GLY 387 386 386 GLY GLY A . n 
A 1 388 PHE 388 387 387 PHE PHE A . n 
A 1 389 ALA 389 388 388 ALA ALA A . n 
A 1 390 LEU 390 389 389 LEU LEU A . n 
A 1 391 LEU 391 390 390 LEU LEU A . n 
A 1 392 PHE 392 391 391 PHE PHE A . n 
A 1 393 TYR 393 392 392 TYR TYR A . n 
A 1 394 LEU 394 393 393 LEU LEU A . n 
A 1 395 GLU 395 394 394 GLU GLU A . n 
A 1 396 GLN 396 395 395 GLN GLN A . n 
A 1 397 LEU 397 396 396 LEU LEU A . n 
A 1 398 LEU 398 397 397 LEU LEU A . n 
A 1 399 GLY 399 398 398 GLY GLY A . n 
A 1 400 GLY 400 399 399 GLY GLY A . n 
A 1 401 PRO 401 400 400 PRO PRO A . n 
A 1 402 GLU 402 401 401 GLU GLU A . n 
A 1 403 ILE 403 402 402 ILE ILE A . n 
A 1 404 PHE 404 403 403 PHE PHE A . n 
A 1 405 LEU 405 404 404 LEU LEU A . n 
A 1 406 GLY 406 405 405 GLY GLY A . n 
A 1 407 PHE 407 406 406 PHE PHE A . n 
A 1 408 LEU 408 407 407 LEU LEU A . n 
A 1 409 LYS 409 408 408 LYS LYS A . n 
A 1 410 ALA 410 409 409 ALA ALA A . n 
A 1 411 TYR 411 410 410 TYR TYR A . n 
A 1 412 VAL 412 411 411 VAL VAL A . n 
A 1 413 GLU 413 412 412 GLU GLU A . n 
A 1 414 LYS 414 413 413 LYS LYS A . n 
A 1 415 PHE 415 414 414 PHE PHE A . n 
A 1 416 SER 416 415 415 SER SER A . n 
A 1 417 TYR 417 416 416 TYR TYR A . n 
A 1 418 LYS 418 417 417 LYS LYS A . n 
A 1 419 SER 419 418 418 SER SER A . n 
A 1 420 ILE 420 419 419 ILE ILE A . n 
A 1 421 THR 421 420 420 THR THR A . n 
A 1 422 THR 422 421 421 THR THR A . n 
A 1 423 ASP 423 422 422 ASP ASP A . n 
A 1 424 ASP 424 423 423 ASP ASP A . n 
A 1 425 TRP 425 424 424 TRP TRP A . n 
A 1 426 LYS 426 425 425 LYS LYS A . n 
A 1 427 ASP 427 426 426 ASP ASP A . n 
A 1 428 PHE 428 427 427 PHE PHE A . n 
A 1 429 LEU 429 428 428 LEU LEU A . n 
A 1 430 TYR 430 429 429 TYR TYR A . n 
A 1 431 SER 431 430 430 SER SER A . n 
A 1 432 TYR 432 431 431 TYR TYR A . n 
A 1 433 PHE 433 432 432 PHE PHE A . n 
A 1 434 LYS 434 433 433 LYS LYS A . n 
A 1 435 ASP 435 434 434 ASP ASP A . n 
A 1 436 LYS 436 435 435 LYS LYS A . n 
A 1 437 VAL 437 436 436 VAL VAL A . n 
A 1 438 ASP 438 437 437 ASP ASP A . n 
A 1 439 VAL 439 438 438 VAL VAL A . n 
A 1 440 LEU 440 439 439 LEU LEU A . n 
A 1 441 ASN 441 440 440 ASN ASN A . n 
A 1 442 GLN 442 441 441 GLN GLN A . n 
A 1 443 VAL 443 442 442 VAL VAL A . n 
A 1 444 ASP 444 443 443 ASP ASP A . n 
A 1 445 TRP 445 444 444 TRP TRP A . n 
A 1 446 ASN 446 445 445 ASN ASN A . n 
A 1 447 ALA 447 446 446 ALA ALA A . n 
A 1 448 TRP 448 447 447 TRP TRP A . n 
A 1 449 LEU 449 448 448 LEU LEU A . n 
A 1 450 TYR 450 449 449 TYR TYR A . n 
A 1 451 SER 451 450 450 SER SER A . n 
A 1 452 PRO 452 451 451 PRO PRO A . n 
A 1 453 GLY 453 452 452 GLY GLY A . n 
A 1 454 LEU 454 453 453 LEU LEU A . n 
A 1 455 PRO 455 454 454 PRO PRO A . n 
A 1 456 PRO 456 455 455 PRO PRO A . n 
A 1 457 ILE 457 456 456 ILE ILE A . n 
A 1 458 LYS 458 457 457 LYS LYS A . n 
A 1 459 PRO 459 458 458 PRO PRO A . n 
A 1 460 ASN 460 459 459 ASN ASN A . n 
A 1 461 TYR 461 460 460 TYR TYR A . n 
A 1 462 ASP 462 461 461 ASP ASP A . n 
A 1 463 MET 463 462 462 MET MET A . n 
A 1 464 THR 464 463 463 THR THR A . n 
A 1 465 LEU 465 464 464 LEU LEU A . n 
A 1 466 THR 466 465 465 THR THR A . n 
A 1 467 ASN 467 466 466 ASN ASN A . n 
A 1 468 ALA 468 467 467 ALA ALA A . n 
A 1 469 CYS 469 468 468 CYS CYS A . n 
A 1 470 ILE 470 469 469 ILE ILE A . n 
A 1 471 ALA 471 470 470 ALA ALA A . n 
A 1 472 LEU 472 471 471 LEU LEU A . n 
A 1 473 SER 473 472 472 SER SER A . n 
A 1 474 GLN 474 473 473 GLN GLN A . n 
A 1 475 ARG 475 474 474 ARG ARG A . n 
A 1 476 TRP 476 475 475 TRP TRP A . n 
A 1 477 ILE 477 476 476 ILE ILE A . n 
A 1 478 THR 478 477 477 THR THR A . n 
A 1 479 ALA 479 478 478 ALA ALA A . n 
A 1 480 LYS 480 479 479 LYS LYS A . n 
A 1 481 GLU 481 480 480 GLU GLU A . n 
A 1 482 ASP 482 481 481 ASP ASP A . n 
A 1 483 ASP 483 482 482 ASP ASP A . n 
A 1 484 LEU 484 483 483 LEU LEU A . n 
A 1 485 ASN 485 484 484 ASN ASN A . n 
A 1 486 SER 486 485 485 SER SER A . n 
A 1 487 PHE 487 486 486 PHE PHE A . n 
A 1 488 ASN 488 487 487 ASN ASN A . n 
A 1 489 ALA 489 488 488 ALA ALA A . n 
A 1 490 THR 490 489 489 THR THR A . n 
A 1 491 ASP 491 490 490 ASP ASP A . n 
A 1 492 LEU 492 491 491 LEU LEU A . n 
A 1 493 LYS 493 492 492 LYS LYS A . n 
A 1 494 ASP 494 493 493 ASP ASP A . n 
A 1 495 LEU 495 494 494 LEU LEU A . n 
A 1 496 SER 496 495 495 SER SER A . n 
A 1 497 SER 497 496 496 SER SER A . n 
A 1 498 HIS 498 497 497 HIS HIS A . n 
A 1 499 GLN 499 498 498 GLN GLN A . n 
A 1 500 LEU 500 499 499 LEU LEU A . n 
A 1 501 ASN 501 500 500 ASN ASN A . n 
A 1 502 GLU 502 501 501 GLU GLU A . n 
A 1 503 PHE 503 502 502 PHE PHE A . n 
A 1 504 LEU 504 503 503 LEU LEU A . n 
A 1 505 ALA 505 504 504 ALA ALA A . n 
A 1 506 GLN 506 505 505 GLN GLN A . n 
A 1 507 THR 507 506 506 THR THR A . n 
A 1 508 LEU 508 507 507 LEU LEU A . n 
A 1 509 GLN 509 508 508 GLN GLN A . n 
A 1 510 ARG 510 509 509 ARG ARG A . n 
A 1 511 ALA 511 510 510 ALA ALA A . n 
A 1 512 PRO 512 511 511 PRO PRO A . n 
A 1 513 LEU 513 512 512 LEU LEU A . n 
A 1 514 PRO 514 513 513 PRO PRO A . n 
A 1 515 LEU 515 514 514 LEU LEU A . n 
A 1 516 GLY 516 515 515 GLY GLY A . n 
A 1 517 HIS 517 516 516 HIS HIS A . n 
A 1 518 ILE 518 517 517 ILE ILE A . n 
A 1 519 LYS 519 518 518 LYS LYS A . n 
A 1 520 ARG 520 519 519 ARG ARG A . n 
A 1 521 MET 521 520 520 MET MET A . n 
A 1 522 GLN 522 521 521 GLN GLN A . n 
A 1 523 GLU 523 522 522 GLU GLU A . n 
A 1 524 VAL 524 523 523 VAL VAL A . n 
A 1 525 TYR 525 524 524 TYR TYR A . n 
A 1 526 ASN 526 525 525 ASN ASN A . n 
A 1 527 PHE 527 526 526 PHE PHE A . n 
A 1 528 ASN 528 527 527 ASN ASN A . n 
A 1 529 ALA 529 528 528 ALA ALA A . n 
A 1 530 ILE 530 529 529 ILE ILE A . n 
A 1 531 ASN 531 530 530 ASN ASN A . n 
A 1 532 ASN 532 531 531 ASN ASN A . n 
A 1 533 SER 533 532 532 SER SER A . n 
A 1 534 GLU 534 533 533 GLU GLU A . n 
A 1 535 ILE 535 534 534 ILE ILE A . n 
A 1 536 ARG 536 535 535 ARG ARG A . n 
A 1 537 PHE 537 536 536 PHE PHE A . n 
A 1 538 ARG 538 537 537 ARG ARG A . n 
A 1 539 TRP 539 538 538 TRP TRP A . n 
A 1 540 LEU 540 539 539 LEU LEU A . n 
A 1 541 ARG 541 540 540 ARG ARG A . n 
A 1 542 LEU 542 541 541 LEU LEU A . n 
A 1 543 CYS 543 542 542 CYS CYS A . n 
A 1 544 ILE 544 543 543 ILE ILE A . n 
A 1 545 GLN 545 544 544 GLN GLN A . n 
A 1 546 SER 546 545 545 SER SER A . n 
A 1 547 LYS 547 546 546 LYS LYS A . n 
A 1 548 TRP 548 547 547 TRP TRP A . n 
A 1 549 GLU 549 548 548 GLU GLU A . n 
A 1 550 ASP 550 549 549 ASP ASP A . n 
A 1 551 ALA 551 550 550 ALA ALA A . n 
A 1 552 ILE 552 551 551 ILE ILE A . n 
A 1 553 PRO 553 552 552 PRO PRO A . n 
A 1 554 LEU 554 553 553 LEU LEU A . n 
A 1 555 ALA 555 554 554 ALA ALA A . n 
A 1 556 LEU 556 555 555 LEU LEU A . n 
A 1 557 LYS 557 556 556 LYS LYS A . n 
A 1 558 MET 558 557 557 MET MET A . n 
A 1 559 ALA 559 558 558 ALA ALA A . n 
A 1 560 THR 560 559 559 THR THR A . n 
A 1 561 GLU 561 560 560 GLU GLU A . n 
A 1 562 GLN 562 561 561 GLN GLN A . n 
A 1 563 GLY 563 562 562 GLY GLY A . n 
A 1 564 ARG 564 563 563 ARG ARG A . n 
A 1 565 MET 565 564 564 MET MET A . n 
A 1 566 LYS 566 565 565 LYS LYS A . n 
A 1 567 PHE 567 566 566 PHE PHE A . n 
A 1 568 THR 568 567 567 THR THR A . n 
A 1 569 ARG 569 568 568 ARG ARG A . n 
A 1 570 PRO 570 569 569 PRO PRO A . n 
A 1 571 LEU 571 570 570 LEU LEU A . n 
A 1 572 PHE 572 571 571 PHE PHE A . n 
A 1 573 LYS 573 572 572 LYS LYS A . n 
A 1 574 ASP 574 573 573 ASP ASP A . n 
A 1 575 LEU 575 574 574 LEU LEU A . n 
A 1 576 ALA 576 575 575 ALA ALA A . n 
A 1 577 ALA 577 576 576 ALA ALA A . n 
A 1 578 PHE 578 577 577 PHE PHE A . n 
A 1 579 ASP 579 578 578 ASP ASP A . n 
A 1 580 LYS 580 579 579 LYS LYS A . n 
A 1 581 SER 581 580 580 SER SER A . n 
A 1 582 HIS 582 581 581 HIS HIS A . n 
A 1 583 ASP 583 582 582 ASP ASP A . n 
A 1 584 GLN 584 583 583 GLN GLN A . n 
A 1 585 ALA 585 584 584 ALA ALA A . n 
A 1 586 VAL 586 585 585 VAL VAL A . n 
A 1 587 ARG 587 586 586 ARG ARG A . n 
A 1 588 THR 588 587 587 THR THR A . n 
A 1 589 TYR 589 588 588 TYR TYR A . n 
A 1 590 GLN 590 589 589 GLN GLN A . n 
A 1 591 GLU 591 590 590 GLU GLU A . n 
A 1 592 HIS 592 591 591 HIS HIS A . n 
A 1 593 LYS 593 592 592 LYS LYS A . n 
A 1 594 ALA 594 593 593 ALA ALA A . n 
A 1 595 SER 595 594 594 SER SER A . n 
A 1 596 MET 596 595 595 MET MET A . n 
A 1 597 HIS 597 596 596 HIS HIS A . n 
A 1 598 PRO 598 597 597 PRO PRO A . n 
A 1 599 VAL 599 598 598 VAL VAL A . n 
A 1 600 THR 600 599 599 THR THR A . n 
A 1 601 ALA 601 600 600 ALA ALA A . n 
A 1 602 MET 602 601 601 MET MET A . n 
A 1 603 LEU 603 602 602 LEU LEU A . n 
A 1 604 VAL 604 603 603 VAL VAL A . n 
A 1 605 GLY 605 604 604 GLY GLY A . n 
A 1 606 LYS 606 605 605 LYS LYS A . n 
A 1 607 ASP 607 606 606 ASP ASP A . n 
A 1 608 LEU 608 607 607 LEU LEU A . n 
A 1 609 LYS 609 608 608 LYS LYS A . n 
A 1 610 VAL 610 609 609 VAL VAL A . n 
A 1 611 ASP 611 610 610 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   701  1   ZN  ZN  A . 
C 3 YB  1   801  1   YB  YB  A . 
D 3 YB  1   802  2   YB  YB  A . 
E 3 YB  1   803  3   YB  YB  A . 
F 4 ACT 1   1101 1   ACT ACE A . 
G 5 BES 1   901  1   BES BES A . 
H 6 IMD 1   1001 1   IMD IMD A . 
I 7 HOH 1   1102 1   HOH HOH A . 
I 7 HOH 2   1103 2   HOH HOH A . 
I 7 HOH 3   1104 3   HOH HOH A . 
I 7 HOH 4   1105 4   HOH HOH A . 
I 7 HOH 5   1106 5   HOH HOH A . 
I 7 HOH 6   1107 6   HOH HOH A . 
I 7 HOH 7   1108 7   HOH HOH A . 
I 7 HOH 8   1109 8   HOH HOH A . 
I 7 HOH 9   1110 9   HOH HOH A . 
I 7 HOH 10  1111 10  HOH HOH A . 
I 7 HOH 11  1112 11  HOH HOH A . 
I 7 HOH 12  1113 12  HOH HOH A . 
I 7 HOH 13  1114 13  HOH HOH A . 
I 7 HOH 14  1115 14  HOH HOH A . 
I 7 HOH 15  1116 15  HOH HOH A . 
I 7 HOH 16  1117 16  HOH HOH A . 
I 7 HOH 17  1118 17  HOH HOH A . 
I 7 HOH 18  1119 18  HOH HOH A . 
I 7 HOH 19  1120 19  HOH HOH A . 
I 7 HOH 20  1121 20  HOH HOH A . 
I 7 HOH 21  1122 21  HOH HOH A . 
I 7 HOH 22  1123 22  HOH HOH A . 
I 7 HOH 23  1124 23  HOH HOH A . 
I 7 HOH 24  1125 24  HOH HOH A . 
I 7 HOH 25  1126 25  HOH HOH A . 
I 7 HOH 26  1127 26  HOH HOH A . 
I 7 HOH 27  1128 27  HOH HOH A . 
I 7 HOH 28  1129 28  HOH HOH A . 
I 7 HOH 29  1130 29  HOH HOH A . 
I 7 HOH 30  1131 30  HOH HOH A . 
I 7 HOH 31  1132 31  HOH HOH A . 
I 7 HOH 32  1133 32  HOH HOH A . 
I 7 HOH 33  1134 33  HOH HOH A . 
I 7 HOH 34  1135 34  HOH HOH A . 
I 7 HOH 35  1136 35  HOH HOH A . 
I 7 HOH 36  1137 36  HOH HOH A . 
I 7 HOH 37  1138 37  HOH HOH A . 
I 7 HOH 38  1139 38  HOH HOH A . 
I 7 HOH 39  1140 39  HOH HOH A . 
I 7 HOH 40  1141 40  HOH HOH A . 
I 7 HOH 41  1142 41  HOH HOH A . 
I 7 HOH 42  1143 42  HOH HOH A . 
I 7 HOH 43  1144 43  HOH HOH A . 
I 7 HOH 44  1145 44  HOH HOH A . 
I 7 HOH 45  1146 45  HOH HOH A . 
I 7 HOH 46  1147 46  HOH HOH A . 
I 7 HOH 47  1148 47  HOH HOH A . 
I 7 HOH 48  1149 48  HOH HOH A . 
I 7 HOH 49  1150 49  HOH HOH A . 
I 7 HOH 50  1151 50  HOH HOH A . 
I 7 HOH 51  1152 51  HOH HOH A . 
I 7 HOH 52  1153 52  HOH HOH A . 
I 7 HOH 53  1154 53  HOH HOH A . 
I 7 HOH 54  1155 54  HOH HOH A . 
I 7 HOH 55  1156 55  HOH HOH A . 
I 7 HOH 56  1157 56  HOH HOH A . 
I 7 HOH 57  1158 57  HOH HOH A . 
I 7 HOH 58  1159 58  HOH HOH A . 
I 7 HOH 59  1160 59  HOH HOH A . 
I 7 HOH 60  1161 60  HOH HOH A . 
I 7 HOH 61  1162 61  HOH HOH A . 
I 7 HOH 62  1163 62  HOH HOH A . 
I 7 HOH 63  1164 63  HOH HOH A . 
I 7 HOH 64  1165 64  HOH HOH A . 
I 7 HOH 65  1166 65  HOH HOH A . 
I 7 HOH 66  1167 66  HOH HOH A . 
I 7 HOH 67  1168 67  HOH HOH A . 
I 7 HOH 68  1169 68  HOH HOH A . 
I 7 HOH 69  1170 69  HOH HOH A . 
I 7 HOH 70  1171 70  HOH HOH A . 
I 7 HOH 71  1172 71  HOH HOH A . 
I 7 HOH 72  1173 72  HOH HOH A . 
I 7 HOH 73  1174 73  HOH HOH A . 
I 7 HOH 74  1175 74  HOH HOH A . 
I 7 HOH 75  1176 75  HOH HOH A . 
I 7 HOH 76  1177 76  HOH HOH A . 
I 7 HOH 77  1178 77  HOH HOH A . 
I 7 HOH 78  1179 78  HOH HOH A . 
I 7 HOH 79  1180 79  HOH HOH A . 
I 7 HOH 80  1181 80  HOH HOH A . 
I 7 HOH 81  1182 81  HOH HOH A . 
I 7 HOH 82  1183 82  HOH HOH A . 
I 7 HOH 83  1184 83  HOH HOH A . 
I 7 HOH 84  1185 84  HOH HOH A . 
I 7 HOH 85  1186 85  HOH HOH A . 
I 7 HOH 86  1187 86  HOH HOH A . 
I 7 HOH 87  1188 87  HOH HOH A . 
I 7 HOH 88  1189 88  HOH HOH A . 
I 7 HOH 89  1190 89  HOH HOH A . 
I 7 HOH 90  1191 90  HOH HOH A . 
I 7 HOH 91  1192 91  HOH HOH A . 
I 7 HOH 92  1193 92  HOH HOH A . 
I 7 HOH 93  1194 93  HOH HOH A . 
I 7 HOH 94  1195 94  HOH HOH A . 
I 7 HOH 95  1196 95  HOH HOH A . 
I 7 HOH 96  1197 96  HOH HOH A . 
I 7 HOH 97  1198 97  HOH HOH A . 
I 7 HOH 98  1199 98  HOH HOH A . 
I 7 HOH 99  1200 99  HOH HOH A . 
I 7 HOH 100 1201 100 HOH HOH A . 
I 7 HOH 101 1202 101 HOH HOH A . 
I 7 HOH 102 1203 102 HOH HOH A . 
I 7 HOH 103 1204 103 HOH HOH A . 
I 7 HOH 104 1205 104 HOH HOH A . 
I 7 HOH 105 1206 105 HOH HOH A . 
I 7 HOH 106 1207 106 HOH HOH A . 
I 7 HOH 107 1208 107 HOH HOH A . 
I 7 HOH 108 1209 108 HOH HOH A . 
I 7 HOH 109 1210 109 HOH HOH A . 
I 7 HOH 110 1211 110 HOH HOH A . 
I 7 HOH 111 1212 111 HOH HOH A . 
I 7 HOH 112 1213 112 HOH HOH A . 
I 7 HOH 113 1214 113 HOH HOH A . 
I 7 HOH 114 1215 114 HOH HOH A . 
I 7 HOH 115 1216 115 HOH HOH A . 
I 7 HOH 116 1217 116 HOH HOH A . 
I 7 HOH 117 1218 117 HOH HOH A . 
I 7 HOH 118 1219 118 HOH HOH A . 
I 7 HOH 119 1220 119 HOH HOH A . 
I 7 HOH 120 1221 120 HOH HOH A . 
I 7 HOH 121 1222 121 HOH HOH A . 
I 7 HOH 122 1223 122 HOH HOH A . 
I 7 HOH 123 1224 123 HOH HOH A . 
I 7 HOH 124 1225 124 HOH HOH A . 
I 7 HOH 125 1226 125 HOH HOH A . 
I 7 HOH 126 1227 126 HOH HOH A . 
I 7 HOH 127 1228 127 HOH HOH A . 
I 7 HOH 128 1229 128 HOH HOH A . 
I 7 HOH 129 1230 129 HOH HOH A . 
I 7 HOH 130 1231 130 HOH HOH A . 
I 7 HOH 131 1232 131 HOH HOH A . 
I 7 HOH 132 1233 132 HOH HOH A . 
I 7 HOH 133 1234 133 HOH HOH A . 
I 7 HOH 134 1235 134 HOH HOH A . 
I 7 HOH 135 1236 135 HOH HOH A . 
I 7 HOH 136 1237 136 HOH HOH A . 
I 7 HOH 137 1238 137 HOH HOH A . 
I 7 HOH 138 1239 138 HOH HOH A . 
I 7 HOH 139 1240 139 HOH HOH A . 
I 7 HOH 140 1241 140 HOH HOH A . 
I 7 HOH 141 1242 141 HOH HOH A . 
I 7 HOH 142 1243 142 HOH HOH A . 
I 7 HOH 143 1244 143 HOH HOH A . 
I 7 HOH 144 1245 144 HOH HOH A . 
I 7 HOH 145 1246 145 HOH HOH A . 
I 7 HOH 146 1247 146 HOH HOH A . 
I 7 HOH 147 1248 147 HOH HOH A . 
I 7 HOH 148 1249 148 HOH HOH A . 
I 7 HOH 149 1250 149 HOH HOH A . 
I 7 HOH 150 1251 150 HOH HOH A . 
I 7 HOH 151 1252 151 HOH HOH A . 
I 7 HOH 152 1253 152 HOH HOH A . 
I 7 HOH 153 1254 153 HOH HOH A . 
I 7 HOH 154 1255 154 HOH HOH A . 
I 7 HOH 155 1256 155 HOH HOH A . 
I 7 HOH 156 1257 156 HOH HOH A . 
I 7 HOH 157 1258 157 HOH HOH A . 
I 7 HOH 158 1259 158 HOH HOH A . 
I 7 HOH 159 1260 159 HOH HOH A . 
I 7 HOH 160 1261 160 HOH HOH A . 
I 7 HOH 161 1262 161 HOH HOH A . 
I 7 HOH 162 1263 162 HOH HOH A . 
I 7 HOH 163 1264 163 HOH HOH A . 
I 7 HOH 164 1265 164 HOH HOH A . 
I 7 HOH 165 1266 165 HOH HOH A . 
I 7 HOH 166 1267 166 HOH HOH A . 
I 7 HOH 167 1268 167 HOH HOH A . 
I 7 HOH 168 1269 168 HOH HOH A . 
I 7 HOH 169 1270 169 HOH HOH A . 
I 7 HOH 170 1271 170 HOH HOH A . 
I 7 HOH 171 1272 171 HOH HOH A . 
I 7 HOH 172 1273 172 HOH HOH A . 
I 7 HOH 173 1274 173 HOH HOH A . 
I 7 HOH 174 1275 174 HOH HOH A . 
I 7 HOH 175 1276 175 HOH HOH A . 
I 7 HOH 176 1277 176 HOH HOH A . 
I 7 HOH 177 1278 177 HOH HOH A . 
I 7 HOH 178 1279 178 HOH HOH A . 
I 7 HOH 179 1280 179 HOH HOH A . 
I 7 HOH 180 1281 180 HOH HOH A . 
I 7 HOH 181 1282 181 HOH HOH A . 
I 7 HOH 182 1283 182 HOH HOH A . 
I 7 HOH 183 1284 183 HOH HOH A . 
I 7 HOH 184 1285 184 HOH HOH A . 
I 7 HOH 185 1286 185 HOH HOH A . 
I 7 HOH 186 1287 186 HOH HOH A . 
I 7 HOH 187 1288 187 HOH HOH A . 
I 7 HOH 188 1289 188 HOH HOH A . 
I 7 HOH 189 1290 189 HOH HOH A . 
I 7 HOH 190 1291 190 HOH HOH A . 
I 7 HOH 191 1292 191 HOH HOH A . 
I 7 HOH 192 1293 192 HOH HOH A . 
I 7 HOH 193 1294 193 HOH HOH A . 
I 7 HOH 194 1295 194 HOH HOH A . 
I 7 HOH 195 1296 195 HOH HOH A . 
I 7 HOH 196 1297 196 HOH HOH A . 
I 7 HOH 197 1298 197 HOH HOH A . 
I 7 HOH 198 1299 198 HOH HOH A . 
I 7 HOH 199 1300 199 HOH HOH A . 
I 7 HOH 200 1301 200 HOH HOH A . 
I 7 HOH 201 1302 201 HOH HOH A . 
I 7 HOH 202 1303 202 HOH HOH A . 
I 7 HOH 203 1304 203 HOH HOH A . 
I 7 HOH 204 1305 204 HOH HOH A . 
I 7 HOH 205 1306 205 HOH HOH A . 
I 7 HOH 206 1307 206 HOH HOH A . 
I 7 HOH 207 1308 207 HOH HOH A . 
I 7 HOH 208 1309 208 HOH HOH A . 
I 7 HOH 209 1310 209 HOH HOH A . 
I 7 HOH 210 1311 210 HOH HOH A . 
I 7 HOH 211 1312 211 HOH HOH A . 
I 7 HOH 212 1313 212 HOH HOH A . 
I 7 HOH 213 1314 213 HOH HOH A . 
I 7 HOH 214 1315 214 HOH HOH A . 
I 7 HOH 215 1316 215 HOH HOH A . 
I 7 HOH 216 1317 216 HOH HOH A . 
I 7 HOH 217 1318 217 HOH HOH A . 
I 7 HOH 218 1319 218 HOH HOH A . 
I 7 HOH 219 1320 219 HOH HOH A . 
I 7 HOH 220 1321 220 HOH HOH A . 
I 7 HOH 221 1322 221 HOH HOH A . 
I 7 HOH 222 1323 222 HOH HOH A . 
I 7 HOH 223 1324 223 HOH HOH A . 
I 7 HOH 224 1325 224 HOH HOH A . 
I 7 HOH 225 1326 225 HOH HOH A . 
I 7 HOH 226 1327 226 HOH HOH A . 
I 7 HOH 227 1328 227 HOH HOH A . 
I 7 HOH 228 1329 228 HOH HOH A . 
I 7 HOH 229 1330 229 HOH HOH A . 
I 7 HOH 230 1331 230 HOH HOH A . 
I 7 HOH 231 1332 231 HOH HOH A . 
I 7 HOH 232 1333 232 HOH HOH A . 
I 7 HOH 233 1334 233 HOH HOH A . 
I 7 HOH 234 1335 234 HOH HOH A . 
I 7 HOH 235 1336 235 HOH HOH A . 
I 7 HOH 236 1337 236 HOH HOH A . 
I 7 HOH 237 1338 237 HOH HOH A . 
I 7 HOH 238 1339 238 HOH HOH A . 
I 7 HOH 239 1340 239 HOH HOH A . 
I 7 HOH 240 1341 240 HOH HOH A . 
I 7 HOH 241 1342 241 HOH HOH A . 
I 7 HOH 242 1343 242 HOH HOH A . 
I 7 HOH 243 1344 243 HOH HOH A . 
I 7 HOH 244 1345 244 HOH HOH A . 
I 7 HOH 245 1346 245 HOH HOH A . 
I 7 HOH 246 1347 246 HOH HOH A . 
I 7 HOH 247 1348 247 HOH HOH A . 
I 7 HOH 248 1349 248 HOH HOH A . 
I 7 HOH 249 1350 249 HOH HOH A . 
I 7 HOH 250 1351 250 HOH HOH A . 
I 7 HOH 251 1352 251 HOH HOH A . 
I 7 HOH 252 1353 252 HOH HOH A . 
I 7 HOH 253 1354 253 HOH HOH A . 
I 7 HOH 254 1355 254 HOH HOH A . 
I 7 HOH 255 1356 255 HOH HOH A . 
I 7 HOH 256 1357 256 HOH HOH A . 
I 7 HOH 257 1358 257 HOH HOH A . 
I 7 HOH 258 1359 258 HOH HOH A . 
I 7 HOH 259 1360 259 HOH HOH A . 
I 7 HOH 260 1361 260 HOH HOH A . 
I 7 HOH 261 1362 261 HOH HOH A . 
I 7 HOH 262 1363 262 HOH HOH A . 
I 7 HOH 263 1364 263 HOH HOH A . 
I 7 HOH 264 1365 264 HOH HOH A . 
I 7 HOH 265 1366 265 HOH HOH A . 
I 7 HOH 266 1367 266 HOH HOH A . 
I 7 HOH 267 1368 267 HOH HOH A . 
I 7 HOH 268 1369 268 HOH HOH A . 
I 7 HOH 269 1370 269 HOH HOH A . 
I 7 HOH 270 1371 270 HOH HOH A . 
I 7 HOH 271 1372 271 HOH HOH A . 
I 7 HOH 272 1373 272 HOH HOH A . 
I 7 HOH 273 1374 273 HOH HOH A . 
I 7 HOH 274 1375 274 HOH HOH A . 
I 7 HOH 275 1376 275 HOH HOH A . 
I 7 HOH 276 1377 276 HOH HOH A . 
I 7 HOH 277 1378 277 HOH HOH A . 
I 7 HOH 278 1379 278 HOH HOH A . 
I 7 HOH 279 1380 279 HOH HOH A . 
I 7 HOH 280 1381 280 HOH HOH A . 
I 7 HOH 281 1382 281 HOH HOH A . 
I 7 HOH 282 1383 282 HOH HOH A . 
I 7 HOH 283 1384 283 HOH HOH A . 
I 7 HOH 284 1385 284 HOH HOH A . 
I 7 HOH 285 1386 285 HOH HOH A . 
I 7 HOH 286 1387 286 HOH HOH A . 
I 7 HOH 287 1388 287 HOH HOH A . 
I 7 HOH 288 1389 288 HOH HOH A . 
I 7 HOH 289 1390 289 HOH HOH A . 
I 7 HOH 290 1391 290 HOH HOH A . 
I 7 HOH 291 1392 291 HOH HOH A . 
I 7 HOH 292 1393 292 HOH HOH A . 
I 7 HOH 293 1394 293 HOH HOH A . 
I 7 HOH 294 1395 294 HOH HOH A . 
I 7 HOH 295 1396 295 HOH HOH A . 
I 7 HOH 296 1397 296 HOH HOH A . 
I 7 HOH 297 1398 297 HOH HOH A . 
I 7 HOH 298 1399 298 HOH HOH A . 
I 7 HOH 299 1400 299 HOH HOH A . 
I 7 HOH 300 1401 300 HOH HOH A . 
I 7 HOH 301 1402 301 HOH HOH A . 
I 7 HOH 302 1403 302 HOH HOH A . 
I 7 HOH 303 1404 303 HOH HOH A . 
I 7 HOH 304 1405 304 HOH HOH A . 
I 7 HOH 305 1406 305 HOH HOH A . 
I 7 HOH 306 1407 306 HOH HOH A . 
I 7 HOH 307 1408 307 HOH HOH A . 
I 7 HOH 308 1409 308 HOH HOH A . 
I 7 HOH 309 1410 309 HOH HOH A . 
I 7 HOH 310 1411 310 HOH HOH A . 
I 7 HOH 311 1412 311 HOH HOH A . 
I 7 HOH 312 1413 312 HOH HOH A . 
I 7 HOH 313 1414 313 HOH HOH A . 
I 7 HOH 314 1415 314 HOH HOH A . 
I 7 HOH 315 1416 315 HOH HOH A . 
I 7 HOH 316 1417 316 HOH HOH A . 
I 7 HOH 317 1418 317 HOH HOH A . 
I 7 HOH 318 1419 318 HOH HOH A . 
I 7 HOH 319 1420 319 HOH HOH A . 
I 7 HOH 320 1421 320 HOH HOH A . 
I 7 HOH 321 1422 321 HOH HOH A . 
I 7 HOH 322 1423 322 HOH HOH A . 
I 7 HOH 323 1424 323 HOH HOH A . 
I 7 HOH 324 1425 324 HOH HOH A . 
I 7 HOH 325 1426 325 HOH HOH A . 
I 7 HOH 326 1427 326 HOH HOH A . 
I 7 HOH 327 1428 327 HOH HOH A . 
I 7 HOH 328 1429 328 HOH HOH A . 
I 7 HOH 329 1430 329 HOH HOH A . 
I 7 HOH 330 1431 330 HOH HOH A . 
I 7 HOH 331 1432 331 HOH HOH A . 
I 7 HOH 332 1433 332 HOH HOH A . 
I 7 HOH 333 1434 333 HOH HOH A . 
I 7 HOH 334 1435 334 HOH HOH A . 
I 7 HOH 335 1436 335 HOH HOH A . 
I 7 HOH 336 1437 336 HOH HOH A . 
I 7 HOH 337 1438 337 HOH HOH A . 
I 7 HOH 338 1439 338 HOH HOH A . 
I 7 HOH 339 1440 339 HOH HOH A . 
I 7 HOH 340 1441 340 HOH HOH A . 
I 7 HOH 341 1442 341 HOH HOH A . 
I 7 HOH 342 1443 342 HOH HOH A . 
I 7 HOH 343 1444 343 HOH HOH A . 
I 7 HOH 344 1445 344 HOH HOH A . 
I 7 HOH 345 1446 345 HOH HOH A . 
I 7 HOH 346 1447 346 HOH HOH A . 
I 7 HOH 347 1448 347 HOH HOH A . 
I 7 HOH 348 1449 348 HOH HOH A . 
I 7 HOH 349 1450 349 HOH HOH A . 
I 7 HOH 350 1451 350 HOH HOH A . 
I 7 HOH 351 1452 351 HOH HOH A . 
I 7 HOH 352 1453 352 HOH HOH A . 
I 7 HOH 353 1454 353 HOH HOH A . 
I 7 HOH 354 1455 354 HOH HOH A . 
I 7 HOH 355 1456 355 HOH HOH A . 
I 7 HOH 356 1457 356 HOH HOH A . 
I 7 HOH 357 1458 357 HOH HOH A . 
I 7 HOH 358 1459 358 HOH HOH A . 
I 7 HOH 359 1460 359 HOH HOH A . 
I 7 HOH 360 1461 360 HOH HOH A . 
I 7 HOH 361 1462 361 HOH HOH A . 
I 7 HOH 362 1463 362 HOH HOH A . 
I 7 HOH 363 1464 363 HOH HOH A . 
I 7 HOH 364 1465 364 HOH HOH A . 
I 7 HOH 365 1466 365 HOH HOH A . 
I 7 HOH 366 1467 366 HOH HOH A . 
I 7 HOH 367 1468 367 HOH HOH A . 
I 7 HOH 368 1469 368 HOH HOH A . 
I 7 HOH 369 1470 369 HOH HOH A . 
I 7 HOH 370 1471 370 HOH HOH A . 
I 7 HOH 371 1472 371 HOH HOH A . 
I 7 HOH 372 1473 372 HOH HOH A . 
I 7 HOH 373 1474 373 HOH HOH A . 
I 7 HOH 374 1475 374 HOH HOH A . 
I 7 HOH 375 1476 375 HOH HOH A . 
I 7 HOH 376 1477 376 HOH HOH A . 
I 7 HOH 377 1478 377 HOH HOH A . 
I 7 HOH 378 1479 378 HOH HOH A . 
I 7 HOH 379 1480 379 HOH HOH A . 
I 7 HOH 380 1481 380 HOH HOH A . 
I 7 HOH 381 1482 381 HOH HOH A . 
I 7 HOH 382 1483 382 HOH HOH A . 
I 7 HOH 383 1484 383 HOH HOH A . 
I 7 HOH 384 1485 384 HOH HOH A . 
I 7 HOH 385 1486 385 HOH HOH A . 
I 7 HOH 386 1487 386 HOH HOH A . 
I 7 HOH 387 1488 387 HOH HOH A . 
I 7 HOH 388 1489 388 HOH HOH A . 
I 7 HOH 389 1490 389 HOH HOH A . 
I 7 HOH 390 1491 390 HOH HOH A . 
I 7 HOH 391 1492 391 HOH HOH A . 
I 7 HOH 392 1493 392 HOH HOH A . 
I 7 HOH 393 1494 393 HOH HOH A . 
I 7 HOH 394 1495 394 HOH HOH A . 
I 7 HOH 395 1496 395 HOH HOH A . 
I 7 HOH 396 1497 396 HOH HOH A . 
I 7 HOH 397 1498 397 HOH HOH A . 
I 7 HOH 398 1499 398 HOH HOH A . 
I 7 HOH 399 1500 399 HOH HOH A . 
I 7 HOH 400 1501 400 HOH HOH A . 
I 7 HOH 401 1502 401 HOH HOH A . 
I 7 HOH 402 1503 402 HOH HOH A . 
I 7 HOH 403 1504 403 HOH HOH A . 
I 7 HOH 404 1505 404 HOH HOH A . 
I 7 HOH 405 1506 405 HOH HOH A . 
I 7 HOH 406 1507 406 HOH HOH A . 
I 7 HOH 407 1508 407 HOH HOH A . 
I 7 HOH 408 1509 408 HOH HOH A . 
I 7 HOH 409 1510 409 HOH HOH A . 
I 7 HOH 410 1511 410 HOH HOH A . 
I 7 HOH 411 1512 411 HOH HOH A . 
I 7 HOH 412 1513 412 HOH HOH A . 
I 7 HOH 413 1514 413 HOH HOH A . 
I 7 HOH 414 1515 414 HOH HOH A . 
I 7 HOH 415 1516 415 HOH HOH A . 
I 7 HOH 416 1517 416 HOH HOH A . 
I 7 HOH 417 1518 417 HOH HOH A . 
I 7 HOH 418 1519 418 HOH HOH A . 
I 7 HOH 419 1520 419 HOH HOH A . 
I 7 HOH 420 1521 420 HOH HOH A . 
I 7 HOH 421 1522 421 HOH HOH A . 
I 7 HOH 422 1523 422 HOH HOH A . 
I 7 HOH 423 1524 423 HOH HOH A . 
I 7 HOH 424 1525 424 HOH HOH A . 
I 7 HOH 425 1526 425 HOH HOH A . 
I 7 HOH 426 1527 426 HOH HOH A . 
I 7 HOH 427 1528 427 HOH HOH A . 
I 7 HOH 428 1529 428 HOH HOH A . 
I 7 HOH 429 1530 429 HOH HOH A . 
I 7 HOH 430 1531 430 HOH HOH A . 
I 7 HOH 431 1532 431 HOH HOH A . 
I 7 HOH 432 1533 432 HOH HOH A . 
I 7 HOH 433 1534 433 HOH HOH A . 
I 7 HOH 434 1535 434 HOH HOH A . 
I 7 HOH 435 1536 435 HOH HOH A . 
I 7 HOH 436 1537 436 HOH HOH A . 
I 7 HOH 437 1538 437 HOH HOH A . 
I 7 HOH 438 1539 438 HOH HOH A . 
I 7 HOH 439 1540 439 HOH HOH A . 
I 7 HOH 440 1541 440 HOH HOH A . 
I 7 HOH 441 1542 441 HOH HOH A . 
I 7 HOH 442 1543 442 HOH HOH A . 
I 7 HOH 443 1544 443 HOH HOH A . 
I 7 HOH 444 1545 444 HOH HOH A . 
I 7 HOH 445 1546 445 HOH HOH A . 
I 7 HOH 446 1547 446 HOH HOH A . 
I 7 HOH 447 1548 447 HOH HOH A . 
I 7 HOH 448 1549 448 HOH HOH A . 
I 7 HOH 449 1550 449 HOH HOH A . 
I 7 HOH 450 1551 450 HOH HOH A . 
I 7 HOH 451 1552 451 HOH HOH A . 
I 7 HOH 452 1553 452 HOH HOH A . 
I 7 HOH 453 1554 453 HOH HOH A . 
I 7 HOH 454 1555 454 HOH HOH A . 
I 7 HOH 455 1556 455 HOH HOH A . 
I 7 HOH 456 1557 456 HOH HOH A . 
I 7 HOH 457 1558 457 HOH HOH A . 
I 7 HOH 458 1559 458 HOH HOH A . 
I 7 HOH 459 1560 459 HOH HOH A . 
I 7 HOH 460 1561 460 HOH HOH A . 
I 7 HOH 461 1562 461 HOH HOH A . 
I 7 HOH 462 1563 462 HOH HOH A . 
I 7 HOH 463 1564 463 HOH HOH A . 
I 7 HOH 464 1565 464 HOH HOH A . 
I 7 HOH 465 1566 465 HOH HOH A . 
I 7 HOH 466 1567 466 HOH HOH A . 
I 7 HOH 467 1568 467 HOH HOH A . 
I 7 HOH 468 1569 468 HOH HOH A . 
I 7 HOH 469 1570 469 HOH HOH A . 
I 7 HOH 470 1571 470 HOH HOH A . 
I 7 HOH 471 1572 471 HOH HOH A . 
I 7 HOH 472 1573 472 HOH HOH A . 
I 7 HOH 473 1574 473 HOH HOH A . 
I 7 HOH 474 1575 474 HOH HOH A . 
I 7 HOH 475 1576 475 HOH HOH A . 
I 7 HOH 476 1577 476 HOH HOH A . 
I 7 HOH 477 1578 477 HOH HOH A . 
I 7 HOH 478 1579 478 HOH HOH A . 
I 7 HOH 479 1580 479 HOH HOH A . 
I 7 HOH 480 1581 480 HOH HOH A . 
I 7 HOH 481 1582 481 HOH HOH A . 
I 7 HOH 482 1583 482 HOH HOH A . 
I 7 HOH 483 1584 483 HOH HOH A . 
I 7 HOH 484 1585 484 HOH HOH A . 
I 7 HOH 485 1586 485 HOH HOH A . 
I 7 HOH 486 1587 486 HOH HOH A . 
I 7 HOH 487 1588 487 HOH HOH A . 
I 7 HOH 488 1589 488 HOH HOH A . 
I 7 HOH 489 1590 489 HOH HOH A . 
I 7 HOH 490 1591 490 HOH HOH A . 
I 7 HOH 491 1592 491 HOH HOH A . 
I 7 HOH 492 1593 492 HOH HOH A . 
I 7 HOH 493 1594 493 HOH HOH A . 
I 7 HOH 494 1595 494 HOH HOH A . 
I 7 HOH 495 1596 495 HOH HOH A . 
I 7 HOH 496 1597 496 HOH HOH A . 
I 7 HOH 497 1598 497 HOH HOH A . 
I 7 HOH 498 1599 498 HOH HOH A . 
I 7 HOH 499 1600 499 HOH HOH A . 
I 7 HOH 500 1601 500 HOH HOH A . 
I 7 HOH 501 1602 501 HOH HOH A . 
I 7 HOH 502 1603 502 HOH HOH A . 
I 7 HOH 503 1604 503 HOH HOH A . 
I 7 HOH 504 1605 504 HOH HOH A . 
I 7 HOH 505 1606 505 HOH HOH A . 
I 7 HOH 506 1607 506 HOH HOH A . 
I 7 HOH 507 1608 507 HOH HOH A . 
I 7 HOH 508 1609 508 HOH HOH A . 
I 7 HOH 509 1610 509 HOH HOH A . 
I 7 HOH 510 1611 510 HOH HOH A . 
I 7 HOH 511 1612 511 HOH HOH A . 
I 7 HOH 512 1613 512 HOH HOH A . 
I 7 HOH 513 1614 513 HOH HOH A . 
I 7 HOH 514 1615 514 HOH HOH A . 
I 7 HOH 515 1616 515 HOH HOH A . 
I 7 HOH 516 1617 516 HOH HOH A . 
I 7 HOH 517 1618 517 HOH HOH A . 
I 7 HOH 518 1619 518 HOH HOH A . 
I 7 HOH 519 1620 519 HOH HOH A . 
I 7 HOH 520 1621 520 HOH HOH A . 
I 7 HOH 521 1622 521 HOH HOH A . 
I 7 HOH 522 1623 522 HOH HOH A . 
I 7 HOH 523 1624 523 HOH HOH A . 
I 7 HOH 524 1625 524 HOH HOH A . 
I 7 HOH 525 1626 525 HOH HOH A . 
I 7 HOH 526 1627 526 HOH HOH A . 
I 7 HOH 527 1628 527 HOH HOH A . 
I 7 HOH 528 1629 528 HOH HOH A . 
I 7 HOH 529 1630 529 HOH HOH A . 
I 7 HOH 530 1631 530 HOH HOH A . 
I 7 HOH 531 1632 531 HOH HOH A . 
I 7 HOH 532 1633 532 HOH HOH A . 
I 7 HOH 533 1634 533 HOH HOH A . 
I 7 HOH 534 1635 534 HOH HOH A . 
I 7 HOH 535 1636 535 HOH HOH A . 
I 7 HOH 536 1637 536 HOH HOH A . 
I 7 HOH 537 1638 537 HOH HOH A . 
I 7 HOH 538 1639 538 HOH HOH A . 
I 7 HOH 539 1640 539 HOH HOH A . 
I 7 HOH 540 1641 540 HOH HOH A . 
I 7 HOH 541 1642 541 HOH HOH A . 
I 7 HOH 542 1643 542 HOH HOH A . 
I 7 HOH 543 1644 543 HOH HOH A . 
I 7 HOH 544 1645 544 HOH HOH A . 
I 7 HOH 545 1646 545 HOH HOH A . 
I 7 HOH 546 1647 546 HOH HOH A . 
I 7 HOH 547 1648 547 HOH HOH A . 
I 7 HOH 548 1649 548 HOH HOH A . 
I 7 HOH 549 1650 549 HOH HOH A . 
I 7 HOH 550 1651 550 HOH HOH A . 
I 7 HOH 551 1652 551 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE2 ? A GLU 108 ? A GLU 107  ? 1_555 53.4  ? 
2  OE1 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1409 ? 1_555 121.1 ? 
3  OE2 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1409 ? 1_555 77.2  ? 
4  OE1 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE1 ? A GLU 128 ? A GLU 127  ? 1_555 117.7 ? 
5  OE2 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE1 ? A GLU 128 ? A GLU 127  ? 1_555 109.6 ? 
6  O   ? I HOH .   ? A HOH 1409 ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE1 ? A GLU 128 ? A GLU 127  ? 1_555 106.9 ? 
7  OE1 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 118.8 ? 
8  OE2 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 107.3 ? 
9  O   ? I HOH .   ? A HOH 1409 ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 103.8 ? 
10 OE1 ? A GLU 128 ? A GLU 127  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 3.7   ? 
11 OE1 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1541 ? 2_565 109.8 ? 
12 OE2 ? A GLU 108 ? A GLU 107  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1541 ? 2_565 108.8 ? 
13 O   ? I HOH .   ? A HOH 1409 ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1541 ? 2_565 115.6 ? 
14 OE1 ? A GLU 128 ? A GLU 127  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1541 ? 2_565 8.9   ? 
15 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 YB ? E YB . ? A YB 803 ? 1_555 O   ? I HOH .   ? A HOH 1541 ? 2_565 11.9  ? 
16 NE2 ? A HIS 296 ? A HIS 295  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 300 ? A HIS 299  ? 1_555 103.3 ? 
17 NE2 ? A HIS 296 ? A HIS 295  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OE1 ? A GLU 319 ? A GLU 318  ? 1_555 101.5 ? 
18 NE2 ? A HIS 300 ? A HIS 299  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 OE1 ? A GLU 319 ? A GLU 318  ? 1_555 100.5 ? 
19 NE2 ? A HIS 296 ? A HIS 295  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O2  ? G BES .   ? A BES 901  ? 1_555 105.0 ? 
20 NE2 ? A HIS 300 ? A HIS 299  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O2  ? G BES .   ? A BES 901  ? 1_555 90.6  ? 
21 OE1 ? A GLU 319 ? A GLU 318  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O2  ? G BES .   ? A BES 901  ? 1_555 148.0 ? 
22 NE2 ? A HIS 296 ? A HIS 295  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O3  ? G BES .   ? A BES 901  ? 1_555 85.9  ? 
23 NE2 ? A HIS 300 ? A HIS 299  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O3  ? G BES .   ? A BES 901  ? 1_555 165.9 ? 
24 OE1 ? A GLU 319 ? A GLU 318  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O3  ? G BES .   ? A BES 901  ? 1_555 87.9  ? 
25 O2  ? G BES .   ? A BES 901  ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 O3  ? G BES .   ? A BES 901  ? 1_555 76.5  ? 
26 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 56.6  ? 
27 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1260 ? 1_555 71.6  ? 
28 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1260 ? 1_555 83.1  ? 
29 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 97.2  ? 
30 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 152.5 ? 
31 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 80.1  ? 
32 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 96.1  ? 
33 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 151.5 ? 
34 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 79.9  ? 
35 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 1.1   ? 
36 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 98.8  ? 
37 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 153.3 ? 
38 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 78.6  ? 
39 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 2.7   ? 
40 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 3.6   ? 
41 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 97.4  ? 
42 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 152.0 ? 
43 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 78.2  ? 
44 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 2.1   ? 
45 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 2.5   ? 
46 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 1.4   ? 
47 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 72.0  ? 
48 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 128.7 ? 
49 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 80.5  ? 
50 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 26.6  ? 
51 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 25.5  ? 
52 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 28.9  ? 
53 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1259 ? 4_557 27.5  ? 
54 OD1 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 74.3  ? 
55 OD2 ? A ASP 482 ? A ASP 481  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 84.8  ? 
56 O   ? I HOH .   ? A HOH 1260 ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 145.0 ? 
57 OD1 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 96.8  ? 
58 OD2 ? A ASP 423 ? A ASP 422  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 96.4  ? 
59 OD1 ? A ASP 427 ? A ASP 426  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 99.3  ? 
60 OD2 ? A ASP 427 ? A ASP 426  ? 1_555 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 98.8  ? 
61 O   ? I HOH .   ? A HOH 1259 ? 4_557 YB ? C YB . ? A YB 801 ? 1_555 O   ? I HOH .   ? A HOH 1290 ? 4_557 81.9  ? 
62 OE2 ? A GLU 128 ? A GLU 127  ? 1_555 YB ? D YB . ? A YB 802 ? 2_565 O   ? I HOH .   ? A HOH 1486 ? 2_565 38.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-24 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_struct_conn_angle 
2 4 'Structure model' struct_conn            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          . ? 1 
SHARP     phasing          . ? 2 
TNT       refinement       . ? 3 
DENZO     'data reduction' . ? 4 
SCALEPACK 'data scaling'   . ? 5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 1493 ? ? 1_555 O A HOH 1493 ? ? 2_665 0.57 
2 1 O A HOH 1652 ? ? 1_555 O A HOH 1652 ? ? 2_665 1.46 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 2   ? ? OE2 A GLU 2   ? ? 1.320 1.252 0.068 0.011 N 
2 1 CD A GLU 62  ? ? OE2 A GLU 62  ? ? 1.322 1.252 0.070 0.011 N 
3 1 CD A GLU 77  ? ? OE2 A GLU 77  ? ? 1.322 1.252 0.070 0.011 N 
4 1 CD A GLU 233 ? ? OE2 A GLU 233 ? ? 1.322 1.252 0.070 0.011 N 
5 1 CD A GLU 296 ? ? OE2 A GLU 296 ? ? 1.320 1.252 0.068 0.011 N 
6 1 CD A GLU 401 ? ? OE2 A GLU 401 ? ? 1.323 1.252 0.071 0.011 N 
7 1 CD A GLU 590 ? ? OE2 A GLU 590 ? ? 1.320 1.252 0.068 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 24  ? ? CZ A ARG 24  ? ? NH1 A ARG 24  ? ? 123.76 120.30 3.46   0.50 N 
2  1 CB A ASP 28  ? ? CG A ASP 28  ? ? OD1 A ASP 28  ? ? 124.26 118.30 5.96   0.90 N 
3  1 CB A ASP 28  ? ? CG A ASP 28  ? ? OD2 A ASP 28  ? ? 111.94 118.30 -6.36  0.90 N 
4  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD2 A ASP 47  ? ? 111.88 118.30 -6.42  0.90 N 
5  1 CB A ASP 55  ? ? CG A ASP 55  ? ? OD1 A ASP 55  ? ? 125.04 118.30 6.74   0.90 N 
6  1 CB A ASP 55  ? ? CG A ASP 55  ? ? OD2 A ASP 55  ? ? 110.98 118.30 -7.32  0.90 N 
7  1 CB A ASP 58  ? ? CG A ASP 58  ? ? OD2 A ASP 58  ? ? 112.84 118.30 -5.46  0.90 N 
8  1 CB A ASP 148 ? ? CG A ASP 148 ? ? OD1 A ASP 148 ? ? 124.24 118.30 5.94   0.90 N 
9  1 CB A ASP 148 ? ? CG A ASP 148 ? ? OD2 A ASP 148 ? ? 112.69 118.30 -5.61  0.90 N 
10 1 NE A ARG 174 ? ? CZ A ARG 174 ? ? NH2 A ARG 174 ? ? 117.10 120.30 -3.20  0.50 N 
11 1 CB A ASP 175 ? ? CG A ASP 175 ? ? OD1 A ASP 175 ? ? 124.13 118.30 5.83   0.90 N 
12 1 CB A ASP 175 ? ? CG A ASP 175 ? ? OD2 A ASP 175 ? ? 110.68 118.30 -7.62  0.90 N 
13 1 C  A ASP 180 ? ? N  A PRO 181 ? ? CD  A PRO 181 ? ? 85.55  128.40 -42.85 2.10 Y 
14 1 CB A ILE 188 ? ? CA A ILE 188 ? ? C   A ILE 188 ? ? 125.03 111.60 13.43  2.00 N 
15 1 CB A ASP 246 ? ? CG A ASP 246 ? ? OD1 A ASP 246 ? ? 124.37 118.30 6.07   0.90 N 
16 1 CB A ASP 246 ? ? CG A ASP 246 ? ? OD2 A ASP 246 ? ? 112.14 118.30 -6.16  0.90 N 
17 1 CB A ASP 257 ? ? CG A ASP 257 ? ? OD1 A ASP 257 ? ? 123.97 118.30 5.67   0.90 N 
18 1 CB A ASP 257 ? ? CG A ASP 257 ? ? OD2 A ASP 257 ? ? 112.41 118.30 -5.89  0.90 N 
19 1 CB A ASP 312 ? ? CG A ASP 312 ? ? OD1 A ASP 312 ? ? 124.20 118.30 5.90   0.90 N 
20 1 NE A ARG 331 ? ? CZ A ARG 331 ? ? NH1 A ARG 331 ? ? 124.16 120.30 3.86   0.50 N 
21 1 NE A ARG 338 ? ? CZ A ARG 338 ? ? NH1 A ARG 338 ? ? 124.56 120.30 4.26   0.50 N 
22 1 CB A ASP 368 ? ? CG A ASP 368 ? ? OD1 A ASP 368 ? ? 124.93 118.30 6.63   0.90 N 
23 1 CB A ASP 371 ? ? CG A ASP 371 ? ? OD1 A ASP 371 ? ? 124.07 118.30 5.77   0.90 N 
24 1 CB A ASP 371 ? ? CG A ASP 371 ? ? OD2 A ASP 371 ? ? 110.44 118.30 -7.86  0.90 N 
25 1 CB A ASP 373 ? ? CG A ASP 373 ? ? OD1 A ASP 373 ? ? 124.55 118.30 6.25   0.90 N 
26 1 CB A ASP 373 ? ? CG A ASP 373 ? ? OD2 A ASP 373 ? ? 112.70 118.30 -5.60  0.90 N 
27 1 CB A PHE 432 ? ? CG A PHE 432 ? ? CD2 A PHE 432 ? ? 125.67 120.80 4.87   0.70 N 
28 1 CB A PHE 432 ? ? CG A PHE 432 ? ? CD1 A PHE 432 ? ? 116.32 120.80 -4.48  0.70 N 
29 1 CB A ASP 434 ? ? CG A ASP 434 ? ? OD1 A ASP 434 ? ? 125.52 118.30 7.22   0.90 N 
30 1 CB A ASP 434 ? ? CG A ASP 434 ? ? OD2 A ASP 434 ? ? 112.05 118.30 -6.25  0.90 N 
31 1 CB A ASP 437 ? ? CG A ASP 437 ? ? OD2 A ASP 437 ? ? 111.59 118.30 -6.71  0.90 N 
32 1 CB A ASP 443 ? ? CG A ASP 443 ? ? OD2 A ASP 443 ? ? 111.68 118.30 -6.62  0.90 N 
33 1 CB A ASP 481 ? ? CG A ASP 481 ? ? OD1 A ASP 481 ? ? 127.44 118.30 9.14   0.90 N 
34 1 CB A ASP 481 ? ? CG A ASP 481 ? ? OD2 A ASP 481 ? ? 110.71 118.30 -7.59  0.90 N 
35 1 CB A ASP 482 ? ? CG A ASP 482 ? ? OD1 A ASP 482 ? ? 123.83 118.30 5.53   0.90 N 
36 1 CB A ASP 490 ? ? CG A ASP 490 ? ? OD1 A ASP 490 ? ? 124.48 118.30 6.18   0.90 N 
37 1 CB A ASP 493 ? ? CG A ASP 493 ? ? OD2 A ASP 493 ? ? 112.11 118.30 -6.19  0.90 N 
38 1 NE A ARG 509 ? ? CZ A ARG 509 ? ? NH1 A ARG 509 ? ? 125.83 120.30 5.53   0.50 N 
39 1 NE A ARG 509 ? ? CZ A ARG 509 ? ? NH2 A ARG 509 ? ? 116.61 120.30 -3.69  0.50 N 
40 1 NE A ARG 535 ? ? CZ A ARG 535 ? ? NH1 A ARG 535 ? ? 123.52 120.30 3.22   0.50 N 
41 1 CB A ASP 549 ? ? CG A ASP 549 ? ? OD1 A ASP 549 ? ? 124.53 118.30 6.23   0.90 N 
42 1 CB A ASP 578 ? ? CG A ASP 578 ? ? OD1 A ASP 578 ? ? 124.83 118.30 6.53   0.90 N 
43 1 CB A ASP 578 ? ? CG A ASP 578 ? ? OD2 A ASP 578 ? ? 110.56 118.30 -7.74  0.90 N 
44 1 NE A ARG 586 ? ? CZ A ARG 586 ? ? NH2 A ARG 586 ? ? 117.29 120.30 -3.01  0.50 N 
45 1 CB A ASP 606 ? ? CG A ASP 606 ? ? OD1 A ASP 606 ? ? 123.86 118.30 5.56   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 79  ? ? -116.50 69.85   
2  1 SER A 80  ? ? 38.04   -118.46 
3  1 ASN A 97  ? ? 58.66   2.82    
4  1 LYS A 126 ? ? 73.76   -7.19   
5  1 GLU A 182 ? ? -162.81 48.86   
6  1 GLU A 271 ? ? -64.97  40.89   
7  1 CYS A 274 ? ? 78.25   -12.57  
8  1 SER A 300 ? ? -57.95  -9.27   
9  1 TRP A 301 ? ? -121.37 -68.29  
10 1 PHE A 432 ? ? -92.89  38.53   
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      0 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                            ZN  
3 'YTTERBIUM (III) ION'                                                 YB  
4 'ACETATE ION'                                                         ACT 
5 '2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID' BES 
6 IMIDAZOLE                                                             IMD 
7 water                                                                 HOH 
#