data_1HTI
# 
_entry.id   1HTI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HTI         
WWPDB D_1000174015 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HTI 
_pdbx_database_status.recvd_initial_deposition_date   1994-10-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mande, S.C.' 1 
'Hol, W.G.J.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of recombinant human triosephosphate isomerase at 2.8 A resolution. Triosephosphate isomerase-related human genetic disorders and comparison with the trypanosomal enzyme.
;
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            3 
_citation.page_first                810 
_citation.page_last                 821 
_citation.year                      1994 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8061610 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mande, S.C.'   1 
primary 'Mainfroid, V.' 2 
primary 'Kalk, K.H.'    3 
primary 'Goraj, K.'     4 
primary 'Martial, J.A.' 5 
primary 'Hol, W.G.'     6 
# 
_cell.entry_id           1HTI 
_cell.length_a           65.810 
_cell.length_b           75.390 
_cell.length_c           92.810 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HTI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TRIOSEPHOSPHATE ISOMERASE' 26570.270 2 5.3.1.1 ? ? ? 
2 non-polymer man '2-PHOSPHOGLYCOLIC ACID'    156.031   1 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISP
GMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKV
VLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEF
VDIINAKQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISP
GMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKV
VLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEF
VDIINAKQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   SER n 
1 4   ARG n 
1 5   LYS n 
1 6   PHE n 
1 7   PHE n 
1 8   VAL n 
1 9   GLY n 
1 10  GLY n 
1 11  ASN n 
1 12  TRP n 
1 13  LYS n 
1 14  MET n 
1 15  ASN n 
1 16  GLY n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  SER n 
1 21  LEU n 
1 22  GLY n 
1 23  GLU n 
1 24  LEU n 
1 25  ILE n 
1 26  GLY n 
1 27  THR n 
1 28  LEU n 
1 29  ASN n 
1 30  ALA n 
1 31  ALA n 
1 32  LYS n 
1 33  VAL n 
1 34  PRO n 
1 35  ALA n 
1 36  ASP n 
1 37  THR n 
1 38  GLU n 
1 39  VAL n 
1 40  VAL n 
1 41  CYS n 
1 42  ALA n 
1 43  PRO n 
1 44  PRO n 
1 45  THR n 
1 46  ALA n 
1 47  TYR n 
1 48  ILE n 
1 49  ASP n 
1 50  PHE n 
1 51  ALA n 
1 52  ARG n 
1 53  GLN n 
1 54  LYS n 
1 55  LEU n 
1 56  ASP n 
1 57  PRO n 
1 58  LYS n 
1 59  ILE n 
1 60  ALA n 
1 61  VAL n 
1 62  ALA n 
1 63  ALA n 
1 64  GLN n 
1 65  ASN n 
1 66  CYS n 
1 67  TYR n 
1 68  LYS n 
1 69  VAL n 
1 70  THR n 
1 71  ASN n 
1 72  GLY n 
1 73  ALA n 
1 74  PHE n 
1 75  THR n 
1 76  GLY n 
1 77  GLU n 
1 78  ILE n 
1 79  SER n 
1 80  PRO n 
1 81  GLY n 
1 82  MET n 
1 83  ILE n 
1 84  LYS n 
1 85  ASP n 
1 86  CYS n 
1 87  GLY n 
1 88  ALA n 
1 89  THR n 
1 90  TRP n 
1 91  VAL n 
1 92  VAL n 
1 93  LEU n 
1 94  GLY n 
1 95  HIS n 
1 96  SER n 
1 97  GLU n 
1 98  ARG n 
1 99  ARG n 
1 100 HIS n 
1 101 VAL n 
1 102 PHE n 
1 103 GLY n 
1 104 GLU n 
1 105 SER n 
1 106 ASP n 
1 107 GLU n 
1 108 LEU n 
1 109 ILE n 
1 110 GLY n 
1 111 GLN n 
1 112 LYS n 
1 113 VAL n 
1 114 ALA n 
1 115 HIS n 
1 116 ALA n 
1 117 LEU n 
1 118 ALA n 
1 119 GLU n 
1 120 GLY n 
1 121 LEU n 
1 122 GLY n 
1 123 VAL n 
1 124 ILE n 
1 125 ALA n 
1 126 CYS n 
1 127 ILE n 
1 128 GLY n 
1 129 GLU n 
1 130 LYS n 
1 131 LEU n 
1 132 ASP n 
1 133 GLU n 
1 134 ARG n 
1 135 GLU n 
1 136 ALA n 
1 137 GLY n 
1 138 ILE n 
1 139 THR n 
1 140 GLU n 
1 141 LYS n 
1 142 VAL n 
1 143 VAL n 
1 144 PHE n 
1 145 GLU n 
1 146 GLN n 
1 147 THR n 
1 148 LYS n 
1 149 VAL n 
1 150 ILE n 
1 151 ALA n 
1 152 ASP n 
1 153 ASN n 
1 154 VAL n 
1 155 LYS n 
1 156 ASP n 
1 157 TRP n 
1 158 SER n 
1 159 LYS n 
1 160 VAL n 
1 161 VAL n 
1 162 LEU n 
1 163 ALA n 
1 164 TYR n 
1 165 GLU n 
1 166 PRO n 
1 167 VAL n 
1 168 TRP n 
1 169 ALA n 
1 170 ILE n 
1 171 GLY n 
1 172 THR n 
1 173 GLY n 
1 174 LYS n 
1 175 THR n 
1 176 ALA n 
1 177 THR n 
1 178 PRO n 
1 179 GLN n 
1 180 GLN n 
1 181 ALA n 
1 182 GLN n 
1 183 GLU n 
1 184 VAL n 
1 185 HIS n 
1 186 GLU n 
1 187 LYS n 
1 188 LEU n 
1 189 ARG n 
1 190 GLY n 
1 191 TRP n 
1 192 LEU n 
1 193 LYS n 
1 194 SER n 
1 195 ASN n 
1 196 VAL n 
1 197 SER n 
1 198 ASP n 
1 199 ALA n 
1 200 VAL n 
1 201 ALA n 
1 202 GLN n 
1 203 SER n 
1 204 THR n 
1 205 ARG n 
1 206 ILE n 
1 207 ILE n 
1 208 TYR n 
1 209 GLY n 
1 210 GLY n 
1 211 SER n 
1 212 VAL n 
1 213 THR n 
1 214 GLY n 
1 215 ALA n 
1 216 THR n 
1 217 CYS n 
1 218 LYS n 
1 219 GLU n 
1 220 LEU n 
1 221 ALA n 
1 222 SER n 
1 223 GLN n 
1 224 PRO n 
1 225 ASP n 
1 226 VAL n 
1 227 ASP n 
1 228 GLY n 
1 229 PHE n 
1 230 LEU n 
1 231 VAL n 
1 232 GLY n 
1 233 GLY n 
1 234 ALA n 
1 235 SER n 
1 236 LEU n 
1 237 LYS n 
1 238 PRO n 
1 239 GLU n 
1 240 PHE n 
1 241 VAL n 
1 242 ASP n 
1 243 ILE n 
1 244 ILE n 
1 245 ASN n 
1 246 ALA n 
1 247 LYS n 
1 248 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TPIS_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P60174 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;APSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISP
GMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKV
VLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEF
VDIINAKQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HTI A 1 ? 248 ? P60174 1 ? 248 ? 1 248 
2 1 1HTI B 1 ? 248 ? P60174 1 ? 248 ? 1 248 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PGA non-polymer         . '2-PHOSPHOGLYCOLIC ACID' ? 'C2 H5 O6 P'     156.031 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HTI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.20 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1HTI 
_refine.ls_number_reflns_obs                     9625 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    85.5 
_refine.ls_R_factor_obs                          0.1670000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1670000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3736 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3745 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.846117 
_struct_ncs_oper.matrix[1][2]   0.286613 
_struct_ncs_oper.matrix[1][3]   0.449375 
_struct_ncs_oper.matrix[2][1]   0.277795 
_struct_ncs_oper.matrix[2][2]   -0.482405 
_struct_ncs_oper.matrix[2][3]   0.830732 
_struct_ncs_oper.matrix[3][1]   0.454880 
_struct_ncs_oper.matrix[3][2]   0.827731 
_struct_ncs_oper.matrix[3][3]   0.328551 
_struct_ncs_oper.vector[1]      -0.96038 
_struct_ncs_oper.vector[2]      4.19242 
_struct_ncs_oper.vector[3]      -2.36742 
# 
_struct.entry_id                  1HTI 
_struct.title                     
;CRYSTAL STRUCTURE OF RECOMBINANT HUMAN TRIOSEPHOSPHATE ISOMERASE AT 2.8 ANGSTROMS RESOLUTION. TRIOSEPHOSPHATE ISOMERASE RELATED HUMAN GENETIC DISORDERS AND COMPARISON WITH THE TRYPANOSOMAL ENZYME
;
_struct.pdbx_descriptor           'TRIOSEPHOSPHATE ISOMERASE (TIM) (E.C.5.3.1.1) COMPLEXED WITH 2-PHOSPHOGLYCOLIC ACID' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HTI 
_struct_keywords.pdbx_keywords   'ISOMERASE(INTRAMOLECULAR OXIDOREDUCTASE)' 
_struct_keywords.text            'ISOMERASE(INTRAMOLECULAR OXIDOREDUCTASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;TIM IS A DIMERIC ENZYME.  THERE IS ONE DIMER IN THE
ASYMMETRIC UNIT.  THE COORDINATES COMPRISE RESIDUES 1 -
248 FOR MONOMER A, RESIDUES 1 - 248 FOR MONOMER B AND
INHIBITOR BOUND IN MONOMER B.

MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO          TRANSFORMED TO
 MTRIX   CHAIN  RESIDUES       CHAIN  RESIDUES     RMSD
   M1   B    1  -  B  248     A    1  -  A  248    1.40
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 17  ? ALA A 31  ? ARG A 17  ALA A 31  1 ? 15 
HELX_P HELX_P2  2  PRO A 44  ? ALA A 46  ? PRO A 44  ALA A 46  5 ? 3  
HELX_P HELX_P3  3  TYR A 47  ? LEU A 55  ? TYR A 47  LEU A 55  1 ? 9  
HELX_P HELX_P4  4  SER A 79  ? CYS A 86  ? SER A 79  CYS A 86  1 ? 8  
HELX_P HELX_P5  5  HIS A 95  ? VAL A 101 ? HIS A 95  VAL A 101 1 ? 7  
HELX_P HELX_P6  6  SER A 105 ? GLU A 119 ? SER A 105 GLU A 119 1 ? 15 
HELX_P HELX_P7  7  LYS A 130 ? ALA A 136 ? LYS A 130 ALA A 136 1 ? 7  
HELX_P HELX_P8  8  ILE A 138 ? ASP A 152 ? ILE A 138 ASP A 152 1 ? 15 
HELX_P HELX_P9  9  THR A 177 ? VAL A 196 ? THR A 177 VAL A 196 1 ? 20 
HELX_P HELX_P10 10 SER A 197 ? GLN A 202 ? SER A 197 GLN A 202 1 ? 6  
HELX_P HELX_P11 11 THR A 216 ? SER A 222 ? THR A 216 SER A 222 1 ? 7  
HELX_P HELX_P12 12 GLY A 233 ? LYS A 237 ? GLY A 233 LYS A 237 5 ? 5  
HELX_P HELX_P13 13 PRO A 238 ? ASN A 245 ? PRO A 238 ASN A 245 1 ? 8  
HELX_P HELX_P14 14 ALA A 246 ? GLN A 248 ? ALA A 246 GLN A 248 5 ? 3  
HELX_P HELX_P15 15 ARG B 17  ? ASN B 29  ? ARG B 17  ASN B 29  1 ? 13 
HELX_P HELX_P16 16 PRO B 44  ? ALA B 46  ? PRO B 44  ALA B 46  5 ? 3  
HELX_P HELX_P17 17 TYR B 47  ? LEU B 55  ? TYR B 47  LEU B 55  1 ? 9  
HELX_P HELX_P18 18 SER B 79  ? GLY B 87  ? SER B 79  GLY B 87  1 ? 9  
HELX_P HELX_P19 19 HIS B 95  ? VAL B 101 ? HIS B 95  VAL B 101 1 ? 7  
HELX_P HELX_P20 20 SER B 105 ? GLU B 119 ? SER B 105 GLU B 119 1 ? 15 
HELX_P HELX_P21 21 LYS B 130 ? ALA B 136 ? LYS B 130 ALA B 136 1 ? 7  
HELX_P HELX_P22 22 ILE B 138 ? ASN B 153 ? ILE B 138 ASN B 153 1 ? 16 
HELX_P HELX_P23 23 ASP B 156 ? SER B 158 ? ASP B 156 SER B 158 5 ? 3  
HELX_P HELX_P24 24 PRO B 166 ? ILE B 170 ? PRO B 166 ILE B 170 5 ? 5  
HELX_P HELX_P25 25 THR B 177 ? VAL B 196 ? THR B 177 VAL B 196 1 ? 20 
HELX_P HELX_P26 26 SER B 197 ? THR B 204 ? SER B 197 THR B 204 1 ? 8  
HELX_P HELX_P27 27 THR B 216 ? ALA B 221 ? THR B 216 ALA B 221 1 ? 6  
HELX_P HELX_P28 28 GLY B 233 ? PRO B 238 ? GLY B 233 PRO B 238 5 ? 6  
HELX_P HELX_P29 29 GLU B 239 ? ASN B 245 ? GLU B 239 ASN B 245 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
A 8 9 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
B 8 9 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 6   ? ASN A 11  ? PHE A 6   ASN A 11  
A 2 THR A 37  ? ALA A 42  ? THR A 37  ALA A 42  
A 3 ALA A 60  ? ALA A 63  ? ALA A 60  ALA A 63  
A 4 TRP A 90  ? LEU A 93  ? TRP A 90  LEU A 93  
A 5 GLY A 122 ? ILE A 127 ? GLY A 122 ILE A 127 
A 6 VAL A 160 ? TYR A 164 ? VAL A 160 TYR A 164 
A 7 ILE A 206 ? TYR A 208 ? ILE A 206 TYR A 208 
A 8 GLY A 228 ? VAL A 231 ? GLY A 228 VAL A 231 
A 9 PHE A 6   ? ASN A 11  ? PHE A 6   ASN A 11  
B 1 PHE B 6   ? ASN B 11  ? PHE B 6   ASN B 11  
B 2 THR B 37  ? ALA B 42  ? THR B 37  ALA B 42  
B 3 ILE B 59  ? ALA B 63  ? ILE B 59  ALA B 63  
B 4 TRP B 90  ? LEU B 93  ? TRP B 90  LEU B 93  
B 5 GLY B 122 ? ILE B 127 ? GLY B 122 ILE B 127 
B 6 VAL B 160 ? TYR B 164 ? VAL B 160 TYR B 164 
B 7 ILE B 206 ? GLY B 210 ? ILE B 206 GLY B 210 
B 8 GLY B 228 ? VAL B 231 ? GLY B 228 VAL B 231 
B 9 PHE B 6   ? ASN B 11  ? PHE B 6   ASN B 11  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 6   ? O PHE A 6   N GLU A 38  ? N GLU A 38  
A 2 3 N CYS A 41  ? N CYS A 41  O ALA A 60  ? O ALA A 60  
A 3 4 N ALA A 63  ? N ALA A 63  O TRP A 90  ? O TRP A 90  
A 4 5 N VAL A 91  ? N VAL A 91  O GLY A 122 ? O GLY A 122 
A 5 6 N ALA A 125 ? N ALA A 125 O VAL A 161 ? O VAL A 161 
A 6 7 O LEU A 162 ? O LEU A 162 N ILE A 207 ? N ILE A 207 
A 7 8 N TYR A 208 ? N TYR A 208 O GLY A 228 ? O GLY A 228 
A 8 9 N PHE A 229 ? N PHE A 229 O PHE A 7   ? O PHE A 7   
B 1 2 O PHE B 6   ? O PHE B 6   N GLU B 38  ? N GLU B 38  
B 2 3 N CYS B 41  ? N CYS B 41  O ALA B 60  ? O ALA B 60  
B 3 4 N ALA B 63  ? N ALA B 63  O TRP B 90  ? O TRP B 90  
B 4 5 N VAL B 91  ? N VAL B 91  O GLY B 122 ? O GLY B 122 
B 5 6 N ALA B 125 ? N ALA B 125 O VAL B 161 ? O VAL B 161 
B 6 7 O LEU B 162 ? O LEU B 162 N ILE B 207 ? N ILE B 207 
B 7 8 N TYR B 208 ? N TYR B 208 O GLY B 228 ? O GLY B 228 
B 8 9 N PHE B 229 ? N PHE B 229 O PHE B 7   ? O PHE B 7   
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE PGA B 549' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ASN B 11  ? ASN B 11  . ? 1_555 ? 
2  AC1 12 LYS B 13  ? LYS B 13  . ? 1_555 ? 
3  AC1 12 HIS B 95  ? HIS B 95  . ? 1_555 ? 
4  AC1 12 GLU B 165 ? GLU B 165 . ? 1_555 ? 
5  AC1 12 ALA B 169 ? ALA B 169 . ? 1_555 ? 
6  AC1 12 ILE B 170 ? ILE B 170 . ? 1_555 ? 
7  AC1 12 GLY B 171 ? GLY B 171 . ? 1_555 ? 
8  AC1 12 GLY B 210 ? GLY B 210 . ? 1_555 ? 
9  AC1 12 SER B 211 ? SER B 211 . ? 1_555 ? 
10 AC1 12 LEU B 230 ? LEU B 230 . ? 1_555 ? 
11 AC1 12 GLY B 232 ? GLY B 232 . ? 1_555 ? 
12 AC1 12 GLY B 233 ? GLY B 233 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HTI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HTI 
_atom_sites.fract_transf_matrix[1][1]   0.015195 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013264 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010775 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 4.853   35.693  -23.265 1.00 60.16 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 3.600   34.943  -23.158 1.00 59.14 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 3.987   33.499  -23.450 1.00 57.98 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 4.933   33.337  -24.232 1.00 58.72 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 2.557   35.326  -24.214 1.00 58.72 ? 1   ALA A CB  1 
ATOM   6    N N   . PRO A 1 2   ? 3.399   32.472  -22.822 1.00 56.87 ? 2   PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? 3.812   31.074  -22.996 1.00 56.05 ? 2   PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? 3.090   30.120  -23.966 1.00 55.12 ? 2   PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? 2.000   30.337  -24.519 1.00 55.23 ? 2   PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? 3.802   30.553  -21.572 1.00 54.86 ? 2   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? 2.559   31.211  -21.008 1.00 56.53 ? 2   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? 2.618   32.624  -21.585 1.00 55.74 ? 2   PRO A CD  1 
ATOM   13   N N   . SER A 1 3   ? 3.779   28.991  -24.074 1.00 53.34 ? 3   SER A N   1 
ATOM   14   C CA  . SER A 1 3   ? 3.288   27.819  -24.764 1.00 51.00 ? 3   SER A CA  1 
ATOM   15   C C   . SER A 1 3   ? 3.235   26.793  -23.610 1.00 47.52 ? 3   SER A C   1 
ATOM   16   O O   . SER A 1 3   ? 3.794   25.685  -23.636 1.00 48.54 ? 3   SER A O   1 
ATOM   17   C CB  . SER A 1 3   ? 4.296   27.418  -25.889 1.00 53.44 ? 3   SER A CB  1 
ATOM   18   O OG  . SER A 1 3   ? 4.709   28.498  -26.748 1.00 54.19 ? 3   SER A OG  1 
ATOM   19   N N   . ARG A 1 4   ? 2.576   27.231  -22.529 1.00 42.56 ? 4   ARG A N   1 
ATOM   20   C CA  . ARG A 1 4   ? 2.359   26.442  -21.318 1.00 36.45 ? 4   ARG A CA  1 
ATOM   21   C C   . ARG A 1 4   ? 1.089   25.667  -21.673 1.00 33.36 ? 4   ARG A C   1 
ATOM   22   O O   . ARG A 1 4   ? 0.035   26.271  -21.968 1.00 33.54 ? 4   ARG A O   1 
ATOM   23   C CB  . ARG A 1 4   ? 2.118   27.383  -20.118 1.00 34.70 ? 4   ARG A CB  1 
ATOM   24   C CG  . ARG A 1 4   ? 2.733   26.922  -18.828 1.00 31.62 ? 4   ARG A CG  1 
ATOM   25   C CD  . ARG A 1 4   ? 3.938   27.727  -18.457 1.00 28.74 ? 4   ARG A CD  1 
ATOM   26   N NE  . ARG A 1 4   ? 3.583   28.429  -17.246 1.00 30.75 ? 4   ARG A NE  1 
ATOM   27   C CZ  . ARG A 1 4   ? 3.572   29.761  -17.217 1.00 32.88 ? 4   ARG A CZ  1 
ATOM   28   N NH1 . ARG A 1 4   ? 3.915   30.518  -18.242 1.00 38.35 ? 4   ARG A NH1 1 
ATOM   29   N NH2 . ARG A 1 4   ? 2.978   30.399  -16.243 1.00 31.14 ? 4   ARG A NH2 1 
ATOM   30   N N   . LYS A 1 5   ? 1.287   24.352  -21.815 1.00 28.76 ? 5   LYS A N   1 
ATOM   31   C CA  . LYS A 1 5   ? 0.203   23.438  -22.139 1.00 25.94 ? 5   LYS A CA  1 
ATOM   32   C C   . LYS A 1 5   ? -0.669  23.307  -20.880 1.00 24.12 ? 5   LYS A C   1 
ATOM   33   O O   . LYS A 1 5   ? -0.162  23.227  -19.746 1.00 25.27 ? 5   LYS A O   1 
ATOM   34   C CB  . LYS A 1 5   ? 0.853   22.154  -22.578 1.00 25.56 ? 5   LYS A CB  1 
ATOM   35   C CG  . LYS A 1 5   ? -0.038  20.956  -22.878 1.00 28.52 ? 5   LYS A CG  1 
ATOM   36   C CD  . LYS A 1 5   ? 0.668   20.201  -23.985 1.00 31.49 ? 5   LYS A CD  1 
ATOM   37   C CE  . LYS A 1 5   ? -0.130  19.092  -24.667 1.00 36.78 ? 5   LYS A CE  1 
ATOM   38   N NZ  . LYS A 1 5   ? -0.006  17.817  -23.994 1.00 41.02 ? 5   LYS A NZ  1 
ATOM   39   N N   . PHE A 1 6   ? -1.987  23.397  -21.086 1.00 18.95 ? 6   PHE A N   1 
ATOM   40   C CA  . PHE A 1 6   ? -2.910  23.458  -19.969 1.00 16.42 ? 6   PHE A CA  1 
ATOM   41   C C   . PHE A 1 6   ? -2.884  22.060  -19.399 1.00 13.16 ? 6   PHE A C   1 
ATOM   42   O O   . PHE A 1 6   ? -2.948  21.086  -20.155 1.00 10.68 ? 6   PHE A O   1 
ATOM   43   C CB  . PHE A 1 6   ? -4.327  23.889  -20.478 1.00 14.66 ? 6   PHE A CB  1 
ATOM   44   C CG  . PHE A 1 6   ? -5.473  24.095  -19.462 1.00 14.94 ? 6   PHE A CG  1 
ATOM   45   C CD1 . PHE A 1 6   ? -5.348  24.927  -18.354 1.00 9.26  ? 6   PHE A CD1 1 
ATOM   46   C CD2 . PHE A 1 6   ? -6.742  23.501  -19.678 1.00 18.08 ? 6   PHE A CD2 1 
ATOM   47   C CE1 . PHE A 1 6   ? -6.457  25.163  -17.515 1.00 11.54 ? 6   PHE A CE1 1 
ATOM   48   C CE2 . PHE A 1 6   ? -7.848  23.742  -18.826 1.00 15.58 ? 6   PHE A CE2 1 
ATOM   49   C CZ  . PHE A 1 6   ? -7.707  24.586  -17.734 1.00 8.56  ? 6   PHE A CZ  1 
ATOM   50   N N   . PHE A 1 7   ? -2.730  21.966  -18.092 1.00 11.15 ? 7   PHE A N   1 
ATOM   51   C CA  . PHE A 1 7   ? -2.669  20.669  -17.464 1.00 9.95  ? 7   PHE A CA  1 
ATOM   52   C C   . PHE A 1 7   ? -3.919  20.492  -16.625 1.00 8.12  ? 7   PHE A C   1 
ATOM   53   O O   . PHE A 1 7   ? -4.337  21.487  -16.028 1.00 12.25 ? 7   PHE A O   1 
ATOM   54   C CB  . PHE A 1 7   ? -1.377  20.629  -16.619 1.00 8.90  ? 7   PHE A CB  1 
ATOM   55   C CG  . PHE A 1 7   ? -1.090  19.271  -15.982 1.00 7.22  ? 7   PHE A CG  1 
ATOM   56   C CD1 . PHE A 1 7   ? -0.361  18.317  -16.699 1.00 7.32  ? 7   PHE A CD1 1 
ATOM   57   C CD2 . PHE A 1 7   ? -1.575  18.967  -14.713 1.00 2.00  ? 7   PHE A CD2 1 
ATOM   58   C CE1 . PHE A 1 7   ? -0.134  17.067  -16.134 1.00 7.01  ? 7   PHE A CE1 1 
ATOM   59   C CE2 . PHE A 1 7   ? -1.340  17.718  -14.169 1.00 2.00  ? 7   PHE A CE2 1 
ATOM   60   C CZ  . PHE A 1 7   ? -0.626  16.763  -14.867 1.00 2.00  ? 7   PHE A CZ  1 
ATOM   61   N N   . VAL A 1 8   ? -4.603  19.363  -16.512 1.00 3.28  ? 8   VAL A N   1 
ATOM   62   C CA  . VAL A 1 8   ? -5.684  19.265  -15.546 1.00 2.00  ? 8   VAL A CA  1 
ATOM   63   C C   . VAL A 1 8   ? -5.817  17.807  -15.269 1.00 2.34  ? 8   VAL A C   1 
ATOM   64   O O   . VAL A 1 8   ? -6.167  16.967  -16.113 1.00 2.00  ? 8   VAL A O   1 
ATOM   65   C CB  . VAL A 1 8   ? -7.080  19.907  -16.066 1.00 5.68  ? 8   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 8   ? -7.355  19.645  -17.530 1.00 4.85  ? 8   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 8   ? -8.263  19.324  -15.268 1.00 7.29  ? 8   VAL A CG2 1 
ATOM   68   N N   . GLY A 1 9   ? -5.408  17.517  -14.053 1.00 2.05  ? 9   GLY A N   1 
ATOM   69   C CA  . GLY A 1 9   ? -5.429  16.143  -13.643 1.00 2.46  ? 9   GLY A CA  1 
ATOM   70   C C   . GLY A 1 9   ? -6.540  15.919  -12.675 1.00 2.00  ? 9   GLY A C   1 
ATOM   71   O O   . GLY A 1 9   ? -6.892  16.838  -11.957 1.00 2.00  ? 9   GLY A O   1 
ATOM   72   N N   . GLY A 1 10  ? -7.069  14.709  -12.580 1.00 3.56  ? 10  GLY A N   1 
ATOM   73   C CA  . GLY A 1 10  ? -8.085  14.345  -11.580 1.00 4.54  ? 10  GLY A CA  1 
ATOM   74   C C   . GLY A 1 10  ? -7.557  13.369  -10.538 1.00 2.00  ? 10  GLY A C   1 
ATOM   75   O O   . GLY A 1 10  ? -6.985  12.315  -10.799 1.00 2.00  ? 10  GLY A O   1 
ATOM   76   N N   . ASN A 1 11  ? -7.725  13.719  -9.299  1.00 2.21  ? 11  ASN A N   1 
ATOM   77   C CA  . ASN A 1 11  ? -7.280  12.884  -8.224  1.00 2.00  ? 11  ASN A CA  1 
ATOM   78   C C   . ASN A 1 11  ? -8.530  12.119  -7.784  1.00 3.74  ? 11  ASN A C   1 
ATOM   79   O O   . ASN A 1 11  ? -9.429  12.761  -7.221  1.00 6.26  ? 11  ASN A O   1 
ATOM   80   C CB  . ASN A 1 11  ? -6.743  13.831  -7.199  1.00 2.00  ? 11  ASN A CB  1 
ATOM   81   C CG  . ASN A 1 11  ? -6.113  13.164  -6.004  1.00 3.12  ? 11  ASN A CG  1 
ATOM   82   O OD1 . ASN A 1 11  ? -5.617  12.043  -6.028  1.00 2.37  ? 11  ASN A OD1 1 
ATOM   83   N ND2 . ASN A 1 11  ? -6.101  13.821  -4.859  1.00 5.17  ? 11  ASN A ND2 1 
ATOM   84   N N   . TRP A 1 12  ? -8.681  10.803  -8.043  1.00 2.00  ? 12  TRP A N   1 
ATOM   85   C CA  . TRP A 1 12  ? -9.852  10.063  -7.625  1.00 2.00  ? 12  TRP A CA  1 
ATOM   86   C C   . TRP A 1 12  ? -9.881  9.817   -6.105  1.00 5.38  ? 12  TRP A C   1 
ATOM   87   O O   . TRP A 1 12  ? -10.913 9.619   -5.447  1.00 6.81  ? 12  TRP A O   1 
ATOM   88   C CB  . TRP A 1 12  ? -9.850  8.787   -8.392  1.00 2.00  ? 12  TRP A CB  1 
ATOM   89   C CG  . TRP A 1 12  ? -10.070 9.006   -9.867  1.00 2.00  ? 12  TRP A CG  1 
ATOM   90   C CD1 . TRP A 1 12  ? -10.250 10.265  -10.354 1.00 2.43  ? 12  TRP A CD1 1 
ATOM   91   C CD2 . TRP A 1 12  ? -10.063 8.085   -10.874 1.00 2.00  ? 12  TRP A CD2 1 
ATOM   92   N NE1 . TRP A 1 12  ? -10.338 10.174  -11.644 1.00 3.27  ? 12  TRP A NE1 1 
ATOM   93   C CE2 . TRP A 1 12  ? -10.240 8.896   -11.996 1.00 2.00  ? 12  TRP A CE2 1 
ATOM   94   C CE3 . TRP A 1 12  ? -9.948  6.718   -11.089 1.00 3.56  ? 12  TRP A CE3 1 
ATOM   95   C CZ2 . TRP A 1 12  ? -10.279 8.399   -13.304 1.00 2.36  ? 12  TRP A CZ2 1 
ATOM   96   C CZ3 . TRP A 1 12  ? -10.003 6.195   -12.395 1.00 4.85  ? 12  TRP A CZ3 1 
ATOM   97   C CH2 . TRP A 1 12  ? -10.150 7.035   -13.498 1.00 2.00  ? 12  TRP A CH2 1 
ATOM   98   N N   . LYS A 1 13  ? -8.706  9.870   -5.442  1.00 6.47  ? 13  LYS A N   1 
ATOM   99   C CA  . LYS A 1 13  ? -8.490  9.630   -4.012  1.00 4.23  ? 13  LYS A CA  1 
ATOM   100  C C   . LYS A 1 13  ? -8.706  8.177   -3.582  1.00 4.73  ? 13  LYS A C   1 
ATOM   101  O O   . LYS A 1 13  ? -8.286  7.261   -4.281  1.00 3.95  ? 13  LYS A O   1 
ATOM   102  C CB  . LYS A 1 13  ? -9.385  10.607  -3.235  1.00 3.32  ? 13  LYS A CB  1 
ATOM   103  C CG  . LYS A 1 13  ? -8.849  11.969  -3.576  1.00 2.00  ? 13  LYS A CG  1 
ATOM   104  C CD  . LYS A 1 13  ? -9.363  12.935  -2.590  1.00 2.91  ? 13  LYS A CD  1 
ATOM   105  C CE  . LYS A 1 13  ? -8.633  14.226  -2.800  1.00 3.42  ? 13  LYS A CE  1 
ATOM   106  N NZ  . LYS A 1 13  ? -9.151  15.240  -1.912  1.00 5.07  ? 13  LYS A NZ  1 
ATOM   107  N N   . MET A 1 14  ? -9.318  7.813   -2.474  1.00 8.49  ? 14  MET A N   1 
ATOM   108  C CA  . MET A 1 14  ? -9.503  6.413   -2.136  1.00 9.71  ? 14  MET A CA  1 
ATOM   109  C C   . MET A 1 14  ? -10.975 6.354   -2.445  1.00 11.86 ? 14  MET A C   1 
ATOM   110  O O   . MET A 1 14  ? -11.843 6.497   -1.578  1.00 13.28 ? 14  MET A O   1 
ATOM   111  C CB  . MET A 1 14  ? -9.239  6.161   -0.654  1.00 8.70  ? 14  MET A CB  1 
ATOM   112  C CG  . MET A 1 14  ? -9.669  4.788   -0.237  1.00 7.75  ? 14  MET A CG  1 
ATOM   113  S SD  . MET A 1 14  ? -9.103  4.456   1.427   1.00 14.95 ? 14  MET A SD  1 
ATOM   114  C CE  . MET A 1 14  ? -10.049 5.597   2.386   1.00 12.72 ? 14  MET A CE  1 
ATOM   115  N N   . ASN A 1 15  ? -11.248 6.251   -3.731  1.00 10.75 ? 15  ASN A N   1 
ATOM   116  C CA  . ASN A 1 15  ? -12.606 6.236   -4.158  1.00 6.03  ? 15  ASN A CA  1 
ATOM   117  C C   . ASN A 1 15  ? -12.703 5.451   -5.401  1.00 4.00  ? 15  ASN A C   1 
ATOM   118  O O   . ASN A 1 15  ? -11.953 5.665   -6.358  1.00 2.00  ? 15  ASN A O   1 
ATOM   119  C CB  . ASN A 1 15  ? -13.154 7.587   -4.473  1.00 2.00  ? 15  ASN A CB  1 
ATOM   120  C CG  . ASN A 1 15  ? -13.558 8.415   -3.278  1.00 2.63  ? 15  ASN A CG  1 
ATOM   121  O OD1 . ASN A 1 15  ? -14.507 8.175   -2.531  1.00 2.00  ? 15  ASN A OD1 1 
ATOM   122  N ND2 . ASN A 1 15  ? -12.811 9.489   -3.124  1.00 7.49  ? 15  ASN A ND2 1 
ATOM   123  N N   . GLY A 1 16  ? -13.555 4.461   -5.176  1.00 3.99  ? 16  GLY A N   1 
ATOM   124  C CA  . GLY A 1 16  ? -14.090 3.702   -6.259  1.00 6.57  ? 16  GLY A CA  1 
ATOM   125  C C   . GLY A 1 16  ? -13.793 2.231   -6.231  1.00 6.11  ? 16  GLY A C   1 
ATOM   126  O O   . GLY A 1 16  ? -12.922 1.791   -5.494  1.00 8.33  ? 16  GLY A O   1 
ATOM   127  N N   . ARG A 1 17  ? -14.566 1.465   -7.006  1.00 4.65  ? 17  ARG A N   1 
ATOM   128  C CA  . ARG A 1 17  ? -14.317 0.051   -7.228  1.00 4.00  ? 17  ARG A CA  1 
ATOM   129  C C   . ARG A 1 17  ? -14.368 -0.090  -8.758  1.00 5.36  ? 17  ARG A C   1 
ATOM   130  O O   . ARG A 1 17  ? -14.720 0.870   -9.482  1.00 2.00  ? 17  ARG A O   1 
ATOM   131  C CB  . ARG A 1 17  ? -15.383 -0.768  -6.628  1.00 2.46  ? 17  ARG A CB  1 
ATOM   132  C CG  . ARG A 1 17  ? -15.890 -0.303  -5.279  1.00 2.49  ? 17  ARG A CG  1 
ATOM   133  C CD  . ARG A 1 17  ? -15.118 -1.024  -4.213  1.00 2.89  ? 17  ARG A CD  1 
ATOM   134  N NE  . ARG A 1 17  ? -15.300 -0.465  -2.883  1.00 3.38  ? 17  ARG A NE  1 
ATOM   135  C CZ  . ARG A 1 17  ? -14.947 0.776   -2.513  1.00 2.00  ? 17  ARG A CZ  1 
ATOM   136  N NH1 . ARG A 1 17  ? -14.402 1.680   -3.309  1.00 2.00  ? 17  ARG A NH1 1 
ATOM   137  N NH2 . ARG A 1 17  ? -15.055 1.061   -1.236  1.00 2.00  ? 17  ARG A NH2 1 
ATOM   138  N N   . LYS A 1 18  ? -14.066 -1.278  -9.290  1.00 6.76  ? 18  LYS A N   1 
ATOM   139  C CA  . LYS A 1 18  ? -14.017 -1.427  -10.751 1.00 9.17  ? 18  LYS A CA  1 
ATOM   140  C C   . LYS A 1 18  ? -15.321 -1.236  -11.541 1.00 11.53 ? 18  LYS A C   1 
ATOM   141  O O   . LYS A 1 18  ? -15.252 -1.149  -12.767 1.00 10.43 ? 18  LYS A O   1 
ATOM   142  C CB  . LYS A 1 18  ? -13.502 -2.777  -11.144 1.00 5.82  ? 18  LYS A CB  1 
ATOM   143  C CG  . LYS A 1 18  ? -12.115 -3.110  -10.703 1.00 8.20  ? 18  LYS A CG  1 
ATOM   144  C CD  . LYS A 1 18  ? -11.841 -4.582  -10.990 1.00 4.73  ? 18  LYS A CD  1 
ATOM   145  C CE  . LYS A 1 18  ? -10.435 -4.982  -10.652 1.00 5.76  ? 18  LYS A CE  1 
ATOM   146  N NZ  . LYS A 1 18  ? -10.086 -6.127  -11.461 1.00 4.05  ? 18  LYS A NZ  1 
ATOM   147  N N   . GLN A 1 19  ? -16.538 -1.197  -10.959 1.00 14.44 ? 19  GLN A N   1 
ATOM   148  C CA  . GLN A 1 19  ? -17.767 -0.959  -11.736 1.00 15.99 ? 19  GLN A CA  1 
ATOM   149  C C   . GLN A 1 19  ? -17.835 0.506   -12.072 1.00 13.87 ? 19  GLN A C   1 
ATOM   150  O O   . GLN A 1 19  ? -17.815 0.925   -13.229 1.00 15.10 ? 19  GLN A O   1 
ATOM   151  C CB  . GLN A 1 19  ? -19.069 -1.247  -10.983 1.00 22.15 ? 19  GLN A CB  1 
ATOM   152  C CG  . GLN A 1 19  ? -19.859 -2.561  -11.173 1.00 29.98 ? 19  GLN A CG  1 
ATOM   153  C CD  . GLN A 1 19  ? -20.795 -2.857  -9.971  1.00 36.08 ? 19  GLN A CD  1 
ATOM   154  O OE1 . GLN A 1 19  ? -21.552 -3.827  -9.979  1.00 38.31 ? 19  GLN A OE1 1 
ATOM   155  N NE2 . GLN A 1 19  ? -20.823 -2.135  -8.843  1.00 35.69 ? 19  GLN A NE2 1 
ATOM   156  N N   . SER A 1 20  ? -17.865 1.283   -11.005 1.00 7.76  ? 20  SER A N   1 
ATOM   157  C CA  . SER A 1 20  ? -17.990 2.723   -11.095 1.00 5.66  ? 20  SER A CA  1 
ATOM   158  C C   . SER A 1 20  ? -16.898 3.460   -11.881 1.00 2.33  ? 20  SER A C   1 
ATOM   159  O O   . SER A 1 20  ? -17.082 4.346   -12.703 1.00 2.00  ? 20  SER A O   1 
ATOM   160  C CB  . SER A 1 20  ? -18.083 3.160   -9.646  1.00 5.58  ? 20  SER A CB  1 
ATOM   161  O OG  . SER A 1 20  ? -17.300 2.299   -8.799  1.00 7.87  ? 20  SER A OG  1 
ATOM   162  N N   . LEU A 1 21  ? -15.704 3.013   -11.596 1.00 3.43  ? 21  LEU A N   1 
ATOM   163  C CA  . LEU A 1 21  ? -14.489 3.584   -12.100 1.00 3.14  ? 21  LEU A CA  1 
ATOM   164  C C   . LEU A 1 21  ? -14.434 3.244   -13.540 1.00 4.57  ? 21  LEU A C   1 
ATOM   165  O O   . LEU A 1 21  ? -14.199 4.146   -14.315 1.00 6.47  ? 21  LEU A O   1 
ATOM   166  C CB  . LEU A 1 21  ? -13.300 3.006   -11.341 1.00 2.38  ? 21  LEU A CB  1 
ATOM   167  C CG  . LEU A 1 21  ? -12.271 4.058   -10.957 1.00 3.64  ? 21  LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 21  ? -12.832 5.011   -9.923  1.00 3.33  ? 21  LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 21  ? -11.061 3.374   -10.388 1.00 7.55  ? 21  LEU A CD2 1 
ATOM   170  N N   . GLY A 1 22  ? -14.713 2.006   -13.921 1.00 5.80  ? 22  GLY A N   1 
ATOM   171  C CA  . GLY A 1 22  ? -14.816 1.635   -15.304 1.00 9.13  ? 22  GLY A CA  1 
ATOM   172  C C   . GLY A 1 22  ? -15.872 2.502   -15.990 1.00 14.08 ? 22  GLY A C   1 
ATOM   173  O O   . GLY A 1 22  ? -15.646 3.022   -17.096 1.00 15.52 ? 22  GLY A O   1 
ATOM   174  N N   . GLU A 1 23  ? -17.024 2.730   -15.343 1.00 15.58 ? 23  GLU A N   1 
ATOM   175  C CA  . GLU A 1 23  ? -18.044 3.598   -15.918 1.00 15.24 ? 23  GLU A CA  1 
ATOM   176  C C   . GLU A 1 23  ? -17.454 4.993   -16.123 1.00 13.62 ? 23  GLU A C   1 
ATOM   177  O O   . GLU A 1 23  ? -17.542 5.527   -17.229 1.00 16.68 ? 23  GLU A O   1 
ATOM   178  C CB  . GLU A 1 23  ? -19.286 3.678   -15.009 1.00 19.35 ? 23  GLU A CB  1 
ATOM   179  C CG  . GLU A 1 23  ? -20.050 2.345   -14.929 1.00 30.27 ? 23  GLU A CG  1 
ATOM   180  C CD  . GLU A 1 23  ? -21.499 2.340   -14.391 1.00 36.89 ? 23  GLU A CD  1 
ATOM   181  O OE1 . GLU A 1 23  ? -21.897 3.277   -13.670 1.00 41.84 ? 23  GLU A OE1 1 
ATOM   182  O OE2 . GLU A 1 23  ? -22.228 1.376   -14.706 1.00 36.38 ? 23  GLU A OE2 1 
ATOM   183  N N   . LEU A 1 24  ? -16.742 5.612   -15.187 1.00 10.75 ? 24  LEU A N   1 
ATOM   184  C CA  . LEU A 1 24  ? -16.199 6.924   -15.442 1.00 6.49  ? 24  LEU A CA  1 
ATOM   185  C C   . LEU A 1 24  ? -15.141 6.836   -16.541 1.00 3.86  ? 24  LEU A C   1 
ATOM   186  O O   . LEU A 1 24  ? -15.174 7.647   -17.449 1.00 4.41  ? 24  LEU A O   1 
ATOM   187  C CB  . LEU A 1 24  ? -15.666 7.460   -14.093 1.00 3.99  ? 24  LEU A CB  1 
ATOM   188  C CG  . LEU A 1 24  ? -14.828 8.744   -14.112 1.00 5.42  ? 24  LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 24  ? -15.546 9.952   -14.690 1.00 2.00  ? 24  LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 24  ? -14.416 8.966   -12.709 1.00 2.73  ? 24  LEU A CD2 1 
ATOM   191  N N   . ILE A 1 25  ? -14.261 5.860   -16.603 1.00 4.31  ? 25  ILE A N   1 
ATOM   192  C CA  . ILE A 1 25  ? -13.257 5.741   -17.644 1.00 6.35  ? 25  ILE A CA  1 
ATOM   193  C C   . ILE A 1 25  ? -13.956 5.827   -18.995 1.00 10.68 ? 25  ILE A C   1 
ATOM   194  O O   . ILE A 1 25  ? -13.539 6.581   -19.889 1.00 14.03 ? 25  ILE A O   1 
ATOM   195  C CB  . ILE A 1 25  ? -12.505 4.387   -17.483 1.00 6.73  ? 25  ILE A CB  1 
ATOM   196  C CG1 . ILE A 1 25  ? -11.792 4.239   -16.131 1.00 3.54  ? 25  ILE A CG1 1 
ATOM   197  C CG2 . ILE A 1 25  ? -11.480 4.304   -18.588 1.00 6.53  ? 25  ILE A CG2 1 
ATOM   198  C CD1 . ILE A 1 25  ? -11.143 2.859   -15.946 1.00 2.52  ? 25  ILE A CD1 1 
ATOM   199  N N   . GLY A 1 26  ? -15.123 5.170   -19.086 1.00 14.25 ? 26  GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? -15.977 5.172   -20.276 1.00 14.95 ? 26  GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? -16.329 6.575   -20.776 1.00 16.70 ? 26  GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? -16.026 6.925   -21.935 1.00 18.10 ? 26  GLY A O   1 
ATOM   203  N N   . THR A 1 27  ? -16.897 7.392   -19.880 1.00 14.12 ? 27  THR A N   1 
ATOM   204  C CA  . THR A 1 27  ? -17.281 8.737   -20.219 1.00 13.93 ? 27  THR A CA  1 
ATOM   205  C C   . THR A 1 27  ? -16.091 9.509   -20.760 1.00 19.10 ? 27  THR A C   1 
ATOM   206  O O   . THR A 1 27  ? -16.078 10.030  -21.907 1.00 20.67 ? 27  THR A O   1 
ATOM   207  C CB  . THR A 1 27  ? -17.851 9.348   -18.955 1.00 11.88 ? 27  THR A CB  1 
ATOM   208  O OG1 . THR A 1 27  ? -19.157 8.802   -18.788 1.00 14.11 ? 27  THR A OG1 1 
ATOM   209  C CG2 . THR A 1 27  ? -17.874 10.847  -18.999 1.00 12.40 ? 27  THR A CG2 1 
ATOM   210  N N   . LEU A 1 28  ? -15.074 9.404   -19.884 1.00 21.21 ? 28  LEU A N   1 
ATOM   211  C CA  . LEU A 1 28  ? -13.786 10.060  -20.030 1.00 24.04 ? 28  LEU A CA  1 
ATOM   212  C C   . LEU A 1 28  ? -13.063 9.857   -21.359 1.00 24.13 ? 28  LEU A C   1 
ATOM   213  O O   . LEU A 1 28  ? -12.310 10.737  -21.774 1.00 20.26 ? 28  LEU A O   1 
ATOM   214  C CB  . LEU A 1 28  ? -12.846 9.603   -18.938 1.00 25.21 ? 28  LEU A CB  1 
ATOM   215  C CG  . LEU A 1 28  ? -12.585 10.483  -17.749 1.00 27.08 ? 28  LEU A CG  1 
ATOM   216  C CD1 . LEU A 1 28  ? -11.472 9.853   -16.908 1.00 27.30 ? 28  LEU A CD1 1 
ATOM   217  C CD2 . LEU A 1 28  ? -12.136 11.850  -18.208 1.00 26.92 ? 28  LEU A CD2 1 
ATOM   218  N N   . ASN A 1 29  ? -13.319 8.677   -21.955 1.00 26.57 ? 29  ASN A N   1 
ATOM   219  C CA  . ASN A 1 29  ? -12.819 8.217   -23.258 1.00 27.09 ? 29  ASN A CA  1 
ATOM   220  C C   . ASN A 1 29  ? -13.621 8.676   -24.491 1.00 27.38 ? 29  ASN A C   1 
ATOM   221  O O   . ASN A 1 29  ? -13.135 8.647   -25.625 1.00 27.96 ? 29  ASN A O   1 
ATOM   222  C CB  . ASN A 1 29  ? -12.806 6.705   -23.306 1.00 24.79 ? 29  ASN A CB  1 
ATOM   223  C CG  . ASN A 1 29  ? -11.737 6.023   -22.498 1.00 25.44 ? 29  ASN A CG  1 
ATOM   224  O OD1 . ASN A 1 29  ? -10.877 6.626   -21.851 1.00 28.07 ? 29  ASN A OD1 1 
ATOM   225  N ND2 . ASN A 1 29  ? -11.743 4.694   -22.557 1.00 26.43 ? 29  ASN A ND2 1 
ATOM   226  N N   . ALA A 1 30  ? -14.913 8.961   -24.322 1.00 27.75 ? 30  ALA A N   1 
ATOM   227  C CA  . ALA A 1 30  ? -15.731 9.439   -25.421 1.00 28.09 ? 30  ALA A CA  1 
ATOM   228  C C   . ALA A 1 30  ? -15.733 10.960  -25.437 1.00 28.19 ? 30  ALA A C   1 
ATOM   229  O O   . ALA A 1 30  ? -16.276 11.632  -26.333 1.00 29.64 ? 30  ALA A O   1 
ATOM   230  C CB  . ALA A 1 30  ? -17.135 8.961   -25.248 1.00 30.97 ? 30  ALA A CB  1 
ATOM   231  N N   . ALA A 1 31  ? -15.222 11.492  -24.317 1.00 23.83 ? 31  ALA A N   1 
ATOM   232  C CA  . ALA A 1 31  ? -14.917 12.896  -24.218 1.00 18.32 ? 31  ALA A CA  1 
ATOM   233  C C   . ALA A 1 31  ? -13.777 13.273  -25.172 1.00 15.99 ? 31  ALA A C   1 
ATOM   234  O O   . ALA A 1 31  ? -13.010 12.412  -25.570 1.00 10.08 ? 31  ALA A O   1 
ATOM   235  C CB  . ALA A 1 31  ? -14.506 13.150  -22.810 1.00 18.31 ? 31  ALA A CB  1 
ATOM   236  N N   . LYS A 1 32  ? -13.591 14.533  -25.573 1.00 20.20 ? 32  LYS A N   1 
ATOM   237  C CA  . LYS A 1 32  ? -12.440 14.953  -26.367 1.00 23.80 ? 32  LYS A CA  1 
ATOM   238  C C   . LYS A 1 32  ? -11.681 16.061  -25.680 1.00 25.24 ? 32  LYS A C   1 
ATOM   239  O O   . LYS A 1 32  ? -12.284 17.047  -25.254 1.00 24.09 ? 32  LYS A O   1 
ATOM   240  C CB  . LYS A 1 32  ? -12.836 15.467  -27.713 1.00 27.30 ? 32  LYS A CB  1 
ATOM   241  C CG  . LYS A 1 32  ? -13.906 16.557  -27.800 1.00 34.07 ? 32  LYS A CG  1 
ATOM   242  C CD  . LYS A 1 32  ? -14.666 16.364  -29.121 1.00 39.98 ? 32  LYS A CD  1 
ATOM   243  C CE  . LYS A 1 32  ? -13.716 16.567  -30.287 1.00 44.91 ? 32  LYS A CE  1 
ATOM   244  N NZ  . LYS A 1 32  ? -14.321 16.206  -31.556 1.00 51.47 ? 32  LYS A NZ  1 
ATOM   245  N N   . VAL A 1 33  ? -10.369 15.835  -25.500 1.00 28.31 ? 33  VAL A N   1 
ATOM   246  C CA  . VAL A 1 33  ? -9.489  16.850  -24.920 1.00 29.58 ? 33  VAL A CA  1 
ATOM   247  C C   . VAL A 1 33  ? -9.135  17.794  -26.096 1.00 31.43 ? 33  VAL A C   1 
ATOM   248  O O   . VAL A 1 33  ? -9.066  17.425  -27.298 1.00 33.15 ? 33  VAL A O   1 
ATOM   249  C CB  . VAL A 1 33  ? -8.127  16.257  -24.243 1.00 28.97 ? 33  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 33  ? -8.393  14.879  -23.683 1.00 27.92 ? 33  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 33  ? -6.973  16.067  -25.212 1.00 32.64 ? 33  VAL A CG2 1 
ATOM   252  N N   . PRO A 1 34  ? -9.055  19.083  -25.749 1.00 30.60 ? 34  PRO A N   1 
ATOM   253  C CA  . PRO A 1 34  ? -8.362  20.097  -26.521 1.00 29.66 ? 34  PRO A CA  1 
ATOM   254  C C   . PRO A 1 34  ? -6.930  19.734  -26.876 1.00 31.71 ? 34  PRO A C   1 
ATOM   255  O O   . PRO A 1 34  ? -6.284  18.900  -26.251 1.00 30.30 ? 34  PRO A O   1 
ATOM   256  C CB  . PRO A 1 34  ? -8.455  21.307  -25.651 1.00 30.84 ? 34  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 34  ? -9.763  21.131  -24.889 1.00 29.23 ? 34  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 34  ? -9.810  19.654  -24.636 1.00 28.46 ? 34  PRO A CD  1 
ATOM   259  N N   . ALA A 1 35  ? -6.359  20.457  -27.834 1.00 34.78 ? 35  ALA A N   1 
ATOM   260  C CA  . ALA A 1 35  ? -4.993  20.197  -28.264 1.00 35.65 ? 35  ALA A CA  1 
ATOM   261  C C   . ALA A 1 35  ? -3.973  20.900  -27.412 1.00 36.10 ? 35  ALA A C   1 
ATOM   262  O O   . ALA A 1 35  ? -2.791  20.575  -27.390 1.00 39.80 ? 35  ALA A O   1 
ATOM   263  C CB  . ALA A 1 35  ? -4.805  20.666  -29.683 1.00 39.64 ? 35  ALA A CB  1 
ATOM   264  N N   . ASP A 1 36  ? -4.436  21.975  -26.805 1.00 35.05 ? 36  ASP A N   1 
ATOM   265  C CA  . ASP A 1 36  ? -3.607  22.717  -25.886 1.00 33.94 ? 36  ASP A CA  1 
ATOM   266  C C   . ASP A 1 36  ? -3.578  21.877  -24.601 1.00 30.58 ? 36  ASP A C   1 
ATOM   267  O O   . ASP A 1 36  ? -2.644  22.081  -23.833 1.00 31.51 ? 36  ASP A O   1 
ATOM   268  C CB  . ASP A 1 36  ? -4.279  24.137  -25.748 1.00 38.14 ? 36  ASP A CB  1 
ATOM   269  C CG  . ASP A 1 36  ? -3.828  25.210  -24.718 1.00 43.00 ? 36  ASP A CG  1 
ATOM   270  O OD1 . ASP A 1 36  ? -2.632  25.533  -24.619 1.00 44.41 ? 36  ASP A OD1 1 
ATOM   271  O OD2 . ASP A 1 36  ? -4.699  25.766  -24.021 1.00 46.29 ? 36  ASP A OD2 1 
ATOM   272  N N   . THR A 1 37  ? -4.489  20.937  -24.295 1.00 25.50 ? 37  THR A N   1 
ATOM   273  C CA  . THR A 1 37  ? -4.486  20.332  -22.980 1.00 23.39 ? 37  THR A CA  1 
ATOM   274  C C   . THR A 1 37  ? -4.048  18.891  -22.767 1.00 21.84 ? 37  THR A C   1 
ATOM   275  O O   . THR A 1 37  ? -4.102  17.985  -23.612 1.00 22.28 ? 37  THR A O   1 
ATOM   276  C CB  . THR A 1 37  ? -5.882  20.541  -22.369 1.00 25.49 ? 37  THR A CB  1 
ATOM   277  O OG1 . THR A 1 37  ? -6.864  19.855  -23.112 1.00 25.60 ? 37  THR A OG1 1 
ATOM   278  C CG2 . THR A 1 37  ? -6.272  21.990  -22.457 1.00 28.62 ? 37  THR A CG2 1 
ATOM   279  N N   . GLU A 1 38  ? -3.610  18.736  -21.520 1.00 18.96 ? 38  GLU A N   1 
ATOM   280  C CA  . GLU A 1 38  ? -3.014  17.533  -20.990 1.00 18.11 ? 38  GLU A CA  1 
ATOM   281  C C   . GLU A 1 38  ? -3.777  16.994  -19.770 1.00 16.77 ? 38  GLU A C   1 
ATOM   282  O O   . GLU A 1 38  ? -3.685  17.537  -18.668 1.00 17.02 ? 38  GLU A O   1 
ATOM   283  C CB  . GLU A 1 38  ? -1.571  17.954  -20.716 1.00 18.85 ? 38  GLU A CB  1 
ATOM   284  C CG  . GLU A 1 38  ? -0.579  17.017  -20.018 1.00 22.97 ? 38  GLU A CG  1 
ATOM   285  C CD  . GLU A 1 38  ? 0.874   17.141  -20.483 1.00 24.74 ? 38  GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 38  ? 1.243   18.174  -21.057 1.00 25.31 ? 38  GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 38  ? 1.625   16.179  -20.300 1.00 24.81 ? 38  GLU A OE2 1 
ATOM   288  N N   . VAL A 1 39  ? -4.582  15.941  -19.929 1.00 15.23 ? 39  VAL A N   1 
ATOM   289  C CA  . VAL A 1 39  ? -5.342  15.326  -18.826 1.00 13.59 ? 39  VAL A CA  1 
ATOM   290  C C   . VAL A 1 39  ? -4.637  14.147  -18.108 1.00 15.40 ? 39  VAL A C   1 
ATOM   291  O O   . VAL A 1 39  ? -4.165  13.175  -18.735 1.00 19.21 ? 39  VAL A O   1 
ATOM   292  C CB  . VAL A 1 39  ? -6.699  14.849  -19.380 1.00 9.62  ? 39  VAL A CB  1 
ATOM   293  C CG1 . VAL A 1 39  ? -7.502  14.075  -18.326 1.00 4.18  ? 39  VAL A CG1 1 
ATOM   294  C CG2 . VAL A 1 39  ? -7.388  16.105  -19.951 1.00 3.73  ? 39  VAL A CG2 1 
ATOM   295  N N   . VAL A 1 40  ? -4.543  14.144  -16.783 1.00 11.97 ? 40  VAL A N   1 
ATOM   296  C CA  . VAL A 1 40  ? -3.946  13.010  -16.108 1.00 10.13 ? 40  VAL A CA  1 
ATOM   297  C C   . VAL A 1 40  ? -4.949  12.472  -15.064 1.00 10.26 ? 40  VAL A C   1 
ATOM   298  O O   . VAL A 1 40  ? -5.642  13.275  -14.415 1.00 7.61  ? 40  VAL A O   1 
ATOM   299  C CB  . VAL A 1 40  ? -2.619  13.521  -15.506 1.00 9.21  ? 40  VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 40  ? -1.894  12.397  -14.886 1.00 11.93 ? 40  VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 40  ? -1.598  13.838  -16.551 1.00 9.72  ? 40  VAL A CG2 1 
ATOM   302  N N   . CYS A 1 41  ? -5.159  11.160  -14.864 1.00 9.11  ? 41  CYS A N   1 
ATOM   303  C CA  . CYS A 1 41  ? -6.035  10.663  -13.785 1.00 9.08  ? 41  CYS A CA  1 
ATOM   304  C C   . CYS A 1 41  ? -5.252  9.929   -12.725 1.00 6.10  ? 41  CYS A C   1 
ATOM   305  O O   . CYS A 1 41  ? -4.301  9.205   -13.034 1.00 5.13  ? 41  CYS A O   1 
ATOM   306  C CB  . CYS A 1 41  ? -7.082  9.702   -14.291 1.00 9.43  ? 41  CYS A CB  1 
ATOM   307  S SG  . CYS A 1 41  ? -7.949  10.798  -15.415 1.00 15.43 ? 41  CYS A SG  1 
ATOM   308  N N   . ALA A 1 42  ? -5.671  10.097  -11.486 1.00 2.00  ? 42  ALA A N   1 
ATOM   309  C CA  . ALA A 1 42  ? -4.972  9.519   -10.376 1.00 3.35  ? 42  ALA A CA  1 
ATOM   310  C C   . ALA A 1 42  ? -5.725  8.405   -9.662  1.00 3.49  ? 42  ALA A C   1 
ATOM   311  O O   . ALA A 1 42  ? -6.370  8.690   -8.646  1.00 3.61  ? 42  ALA A O   1 
ATOM   312  C CB  . ALA A 1 42  ? -4.670  10.652  -9.438  1.00 6.26  ? 42  ALA A CB  1 
ATOM   313  N N   . PRO A 1 43  ? -5.760  7.147   -10.126 1.00 2.69  ? 43  PRO A N   1 
ATOM   314  C CA  . PRO A 1 43  ? -6.446  6.049   -9.455  1.00 3.40  ? 43  PRO A CA  1 
ATOM   315  C C   . PRO A 1 43  ? -6.024  5.654   -8.006  1.00 2.79  ? 43  PRO A C   1 
ATOM   316  O O   . PRO A 1 43  ? -4.833  5.829   -7.702  1.00 2.43  ? 43  PRO A O   1 
ATOM   317  C CB  . PRO A 1 43  ? -6.290  4.941   -10.540 1.00 4.85  ? 43  PRO A CB  1 
ATOM   318  C CG  . PRO A 1 43  ? -6.183  5.663   -11.848 1.00 2.00  ? 43  PRO A CG  1 
ATOM   319  C CD  . PRO A 1 43  ? -5.222  6.701   -11.410 1.00 2.00  ? 43  PRO A CD  1 
ATOM   320  N N   . PRO A 1 44  ? -6.871  5.139   -7.046  1.00 3.81  ? 44  PRO A N   1 
ATOM   321  C CA  . PRO A 1 44  ? -6.463  4.417   -5.817  1.00 5.45  ? 44  PRO A CA  1 
ATOM   322  C C   . PRO A 1 44  ? -5.401  3.430   -6.221  1.00 7.70  ? 44  PRO A C   1 
ATOM   323  O O   . PRO A 1 44  ? -5.666  2.659   -7.137  1.00 10.53 ? 44  PRO A O   1 
ATOM   324  C CB  . PRO A 1 44  ? -7.695  3.725   -5.306  1.00 2.00  ? 44  PRO A CB  1 
ATOM   325  C CG  . PRO A 1 44  ? -8.769  4.693   -5.675  1.00 2.00  ? 44  PRO A CG  1 
ATOM   326  C CD  . PRO A 1 44  ? -8.335  5.195   -7.056  1.00 4.35  ? 44  PRO A CD  1 
ATOM   327  N N   . THR A 1 45  ? -4.230  3.363   -5.605  1.00 10.51 ? 45  THR A N   1 
ATOM   328  C CA  . THR A 1 45  ? -3.109  2.479   -5.949  1.00 7.17  ? 45  THR A CA  1 
ATOM   329  C C   . THR A 1 45  ? -3.459  1.071   -6.486  1.00 7.48  ? 45  THR A C   1 
ATOM   330  O O   . THR A 1 45  ? -2.736  0.469   -7.279  1.00 7.87  ? 45  THR A O   1 
ATOM   331  C CB  . THR A 1 45  ? -2.271  2.407   -4.651  1.00 3.61  ? 45  THR A CB  1 
ATOM   332  O OG1 . THR A 1 45  ? -2.080  3.731   -4.185  1.00 7.12  ? 45  THR A OG1 1 
ATOM   333  C CG2 . THR A 1 45  ? -0.979  1.758   -4.852  1.00 2.00  ? 45  THR A CG2 1 
ATOM   334  N N   . ALA A 1 46  ? -4.595  0.540   -6.007  1.00 7.35  ? 46  ALA A N   1 
ATOM   335  C CA  . ALA A 1 46  ? -5.047  -0.805  -6.277  1.00 7.30  ? 46  ALA A CA  1 
ATOM   336  C C   . ALA A 1 46  ? -5.482  -1.000  -7.717  1.00 5.89  ? 46  ALA A C   1 
ATOM   337  O O   . ALA A 1 46  ? -5.458  -2.132  -8.209  1.00 6.22  ? 46  ALA A O   1 
ATOM   338  C CB  . ALA A 1 46  ? -6.220  -1.139  -5.360  1.00 5.52  ? 46  ALA A CB  1 
ATOM   339  N N   . TYR A 1 47  ? -5.850  0.102   -8.375  1.00 2.59  ? 47  TYR A N   1 
ATOM   340  C CA  . TYR A 1 47  ? -6.411  0.109   -9.702  1.00 2.00  ? 47  TYR A CA  1 
ATOM   341  C C   . TYR A 1 47  ? -5.510  0.856   -10.648 1.00 5.75  ? 47  TYR A C   1 
ATOM   342  O O   . TYR A 1 47  ? -6.034  1.330   -11.665 1.00 7.55  ? 47  TYR A O   1 
ATOM   343  C CB  . TYR A 1 47  ? -7.765  0.805   -9.740  1.00 2.00  ? 47  TYR A CB  1 
ATOM   344  C CG  . TYR A 1 47  ? -8.838  0.225   -8.831  1.00 4.00  ? 47  TYR A CG  1 
ATOM   345  C CD1 . TYR A 1 47  ? -9.214  -1.134  -8.968  1.00 5.91  ? 47  TYR A CD1 1 
ATOM   346  C CD2 . TYR A 1 47  ? -9.442  1.048   -7.860  1.00 2.00  ? 47  TYR A CD2 1 
ATOM   347  C CE1 . TYR A 1 47  ? -10.172 -1.692  -8.133  1.00 2.00  ? 47  TYR A CE1 1 
ATOM   348  C CE2 . TYR A 1 47  ? -10.399 0.501   -7.026  1.00 2.00  ? 47  TYR A CE2 1 
ATOM   349  C CZ  . TYR A 1 47  ? -10.757 -0.850  -7.200  1.00 2.00  ? 47  TYR A CZ  1 
ATOM   350  O OH  . TYR A 1 47  ? -11.795 -1.345  -6.471  1.00 8.84  ? 47  TYR A OH  1 
ATOM   351  N N   . ILE A 1 48  ? -4.187  1.012   -10.436 1.00 6.36  ? 48  ILE A N   1 
ATOM   352  C CA  . ILE A 1 48  ? -3.416  1.778   -11.409 1.00 6.90  ? 48  ILE A CA  1 
ATOM   353  C C   . ILE A 1 48  ? -3.258  0.874   -12.627 1.00 11.35 ? 48  ILE A C   1 
ATOM   354  O O   . ILE A 1 48  ? -3.114  1.383   -13.749 1.00 10.14 ? 48  ILE A O   1 
ATOM   355  C CB  . ILE A 1 48  ? -2.013  2.214   -10.848 1.00 5.96  ? 48  ILE A CB  1 
ATOM   356  C CG1 . ILE A 1 48  ? -2.213  3.279   -9.832  1.00 3.52  ? 48  ILE A CG1 1 
ATOM   357  C CG2 . ILE A 1 48  ? -1.136  2.991   -11.847 1.00 6.06  ? 48  ILE A CG2 1 
ATOM   358  C CD1 . ILE A 1 48  ? -0.971  3.245   -8.915  1.00 4.75  ? 48  ILE A CD1 1 
ATOM   359  N N   . ASP A 1 49  ? -3.363  -0.464  -12.458 1.00 14.75 ? 49  ASP A N   1 
ATOM   360  C CA  . ASP A 1 49  ? -3.222  -1.355  -13.612 1.00 17.29 ? 49  ASP A CA  1 
ATOM   361  C C   . ASP A 1 49  ? -4.517  -1.389  -14.363 1.00 14.41 ? 49  ASP A C   1 
ATOM   362  O O   . ASP A 1 49  ? -4.542  -1.024  -15.532 1.00 14.82 ? 49  ASP A O   1 
ATOM   363  C CB  . ASP A 1 49  ? -2.880  -2.794  -13.214 1.00 26.80 ? 49  ASP A CB  1 
ATOM   364  C CG  . ASP A 1 49  ? -2.097  -3.618  -14.261 1.00 32.82 ? 49  ASP A CG  1 
ATOM   365  O OD1 . ASP A 1 49  ? -1.508  -3.001  -15.170 1.00 38.98 ? 49  ASP A OD1 1 
ATOM   366  O OD2 . ASP A 1 49  ? -2.065  -4.867  -14.156 1.00 33.67 ? 49  ASP A OD2 1 
ATOM   367  N N   . PHE A 1 50  ? -5.586  -1.705  -13.616 1.00 12.80 ? 50  PHE A N   1 
ATOM   368  C CA  . PHE A 1 50  ? -6.941  -1.797  -14.155 1.00 11.43 ? 50  PHE A CA  1 
ATOM   369  C C   . PHE A 1 50  ? -7.242  -0.563  -14.981 1.00 11.77 ? 50  PHE A C   1 
ATOM   370  O O   . PHE A 1 50  ? -7.601  -0.771  -16.160 1.00 12.04 ? 50  PHE A O   1 
ATOM   371  C CB  . PHE A 1 50  ? -7.979  -1.976  -12.995 1.00 7.84  ? 50  PHE A CB  1 
ATOM   372  C CG  . PHE A 1 50  ? -9.402  -1.532  -13.269 1.00 8.84  ? 50  PHE A CG  1 
ATOM   373  C CD1 . PHE A 1 50  ? -10.247 -2.265  -14.071 1.00 11.11 ? 50  PHE A CD1 1 
ATOM   374  C CD2 . PHE A 1 50  ? -9.876  -0.308  -12.769 1.00 15.50 ? 50  PHE A CD2 1 
ATOM   375  C CE1 . PHE A 1 50  ? -11.534 -1.789  -14.383 1.00 10.27 ? 50  PHE A CE1 1 
ATOM   376  C CE2 . PHE A 1 50  ? -11.160 0.168   -13.082 1.00 11.88 ? 50  PHE A CE2 1 
ATOM   377  C CZ  . PHE A 1 50  ? -11.986 -0.581  -13.895 1.00 8.88  ? 50  PHE A CZ  1 
ATOM   378  N N   . ALA A 1 51  ? -6.989  0.655   -14.395 1.00 9.19  ? 51  ALA A N   1 
ATOM   379  C CA  . ALA A 1 51  ? -7.251  1.937   -15.073 1.00 5.22  ? 51  ALA A CA  1 
ATOM   380  C C   . ALA A 1 51  ? -6.440  2.161   -16.358 1.00 7.30  ? 51  ALA A C   1 
ATOM   381  O O   . ALA A 1 51  ? -7.004  2.421   -17.426 1.00 5.84  ? 51  ALA A O   1 
ATOM   382  C CB  . ALA A 1 51  ? -6.979  3.060   -14.130 1.00 2.00  ? 51  ALA A CB  1 
ATOM   383  N N   . ARG A 1 52  ? -5.119  1.957   -16.348 1.00 9.57  ? 52  ARG A N   1 
ATOM   384  C CA  . ARG A 1 52  ? -4.296  2.090   -17.537 1.00 7.74  ? 52  ARG A CA  1 
ATOM   385  C C   . ARG A 1 52  ? -4.721  1.100   -18.609 1.00 6.31  ? 52  ARG A C   1 
ATOM   386  O O   . ARG A 1 52  ? -4.707  1.387   -19.808 1.00 6.35  ? 52  ARG A O   1 
ATOM   387  C CB  . ARG A 1 52  ? -2.812  1.875   -17.156 1.00 7.61  ? 52  ARG A CB  1 
ATOM   388  C CG  . ARG A 1 52  ? -1.800  2.115   -18.281 1.00 3.76  ? 52  ARG A CG  1 
ATOM   389  C CD  . ARG A 1 52  ? -1.799  3.512   -18.997 1.00 7.37  ? 52  ARG A CD  1 
ATOM   390  N NE  . ARG A 1 52  ? -2.969  3.961   -19.773 1.00 2.00  ? 52  ARG A NE  1 
ATOM   391  C CZ  . ARG A 1 52  ? -3.126  5.255   -20.118 1.00 2.00  ? 52  ARG A CZ  1 
ATOM   392  N NH1 . ARG A 1 52  ? -2.233  6.204   -19.817 1.00 2.00  ? 52  ARG A NH1 1 
ATOM   393  N NH2 . ARG A 1 52  ? -4.268  5.631   -20.708 1.00 2.00  ? 52  ARG A NH2 1 
ATOM   394  N N   . GLN A 1 53  ? -5.117  -0.080  -18.214 1.00 5.80  ? 53  GLN A N   1 
ATOM   395  C CA  . GLN A 1 53  ? -5.588  -0.992  -19.201 1.00 11.81 ? 53  GLN A CA  1 
ATOM   396  C C   . GLN A 1 53  ? -6.853  -0.490  -19.863 1.00 16.10 ? 53  GLN A C   1 
ATOM   397  O O   . GLN A 1 53  ? -6.877  -0.656  -21.089 1.00 23.10 ? 53  GLN A O   1 
ATOM   398  C CB  . GLN A 1 53  ? -5.862  -2.319  -18.611 1.00 13.02 ? 53  GLN A CB  1 
ATOM   399  C CG  . GLN A 1 53  ? -4.549  -3.035  -18.444 1.00 16.53 ? 53  GLN A CG  1 
ATOM   400  C CD  . GLN A 1 53  ? -4.755  -4.382  -17.797 1.00 18.33 ? 53  GLN A CD  1 
ATOM   401  O OE1 . GLN A 1 53  ? -4.504  -4.568  -16.621 1.00 24.09 ? 53  GLN A OE1 1 
ATOM   402  N NE2 . GLN A 1 53  ? -5.255  -5.378  -18.504 1.00 23.24 ? 53  GLN A NE2 1 
ATOM   403  N N   . LYS A 1 54  ? -7.856  0.112   -19.198 1.00 16.12 ? 54  LYS A N   1 
ATOM   404  C CA  . LYS A 1 54  ? -9.086  0.608   -19.846 1.00 12.40 ? 54  LYS A CA  1 
ATOM   405  C C   . LYS A 1 54  ? -9.033  2.025   -20.367 1.00 12.15 ? 54  LYS A C   1 
ATOM   406  O O   . LYS A 1 54  ? -9.979  2.443   -21.052 1.00 15.75 ? 54  LYS A O   1 
ATOM   407  C CB  . LYS A 1 54  ? -10.324 0.594   -18.915 1.00 10.61 ? 54  LYS A CB  1 
ATOM   408  C CG  . LYS A 1 54  ? -10.593 -0.833  -18.616 1.00 12.99 ? 54  LYS A CG  1 
ATOM   409  C CD  . LYS A 1 54  ? -11.886 -1.088  -17.928 1.00 21.43 ? 54  LYS A CD  1 
ATOM   410  C CE  . LYS A 1 54  ? -12.036 -2.605  -18.043 1.00 25.88 ? 54  LYS A CE  1 
ATOM   411  N NZ  . LYS A 1 54  ? -13.317 -3.080  -17.534 1.00 32.96 ? 54  LYS A NZ  1 
ATOM   412  N N   . LEU A 1 55  ? -8.024  2.837   -20.097 1.00 9.78  ? 55  LEU A N   1 
ATOM   413  C CA  . LEU A 1 55  ? -8.194  4.227   -20.422 1.00 8.93  ? 55  LEU A CA  1 
ATOM   414  C C   . LEU A 1 55  ? -7.541  4.580   -21.722 1.00 9.37  ? 55  LEU A C   1 
ATOM   415  O O   . LEU A 1 55  ? -6.525  4.004   -22.098 1.00 10.61 ? 55  LEU A O   1 
ATOM   416  C CB  . LEU A 1 55  ? -7.659  5.014   -19.201 1.00 9.06  ? 55  LEU A CB  1 
ATOM   417  C CG  . LEU A 1 55  ? -7.979  6.482   -18.823 1.00 6.76  ? 55  LEU A CG  1 
ATOM   418  C CD1 . LEU A 1 55  ? -9.446  6.873   -18.932 1.00 6.16  ? 55  LEU A CD1 1 
ATOM   419  C CD2 . LEU A 1 55  ? -7.583  6.623   -17.383 1.00 2.00  ? 55  LEU A CD2 1 
ATOM   420  N N   . ASP A 1 56  ? -8.159  5.500   -22.457 1.00 9.61  ? 56  ASP A N   1 
ATOM   421  C CA  . ASP A 1 56  ? -7.545  5.984   -23.677 1.00 13.02 ? 56  ASP A CA  1 
ATOM   422  C C   . ASP A 1 56  ? -6.165  6.619   -23.428 1.00 14.33 ? 56  ASP A C   1 
ATOM   423  O O   . ASP A 1 56  ? -6.136  7.524   -22.607 1.00 18.52 ? 56  ASP A O   1 
ATOM   424  C CB  . ASP A 1 56  ? -8.443  7.009   -24.285 1.00 15.99 ? 56  ASP A CB  1 
ATOM   425  C CG  . ASP A 1 56  ? -8.488  6.922   -25.795 1.00 20.01 ? 56  ASP A CG  1 
ATOM   426  O OD1 . ASP A 1 56  ? -9.108  5.986   -26.295 1.00 23.49 ? 56  ASP A OD1 1 
ATOM   427  O OD2 . ASP A 1 56  ? -7.920  7.776   -26.470 1.00 21.36 ? 56  ASP A OD2 1 
ATOM   428  N N   . PRO A 1 57  ? -5.010  6.329   -24.060 1.00 14.06 ? 57  PRO A N   1 
ATOM   429  C CA  . PRO A 1 57  ? -3.724  6.994   -23.872 1.00 14.50 ? 57  PRO A CA  1 
ATOM   430  C C   . PRO A 1 57  ? -3.774  8.468   -24.089 1.00 18.45 ? 57  PRO A C   1 
ATOM   431  O O   . PRO A 1 57  ? -2.834  9.118   -23.676 1.00 25.56 ? 57  PRO A O   1 
ATOM   432  C CB  . PRO A 1 57  ? -2.777  6.419   -24.834 1.00 9.93  ? 57  PRO A CB  1 
ATOM   433  C CG  . PRO A 1 57  ? -3.723  6.153   -25.961 1.00 13.26 ? 57  PRO A CG  1 
ATOM   434  C CD  . PRO A 1 57  ? -4.870  5.471   -25.215 1.00 14.02 ? 57  PRO A CD  1 
ATOM   435  N N   . LYS A 1 58  ? -4.767  9.079   -24.735 1.00 19.27 ? 58  LYS A N   1 
ATOM   436  C CA  . LYS A 1 58  ? -4.795  10.516  -24.780 1.00 18.64 ? 58  LYS A CA  1 
ATOM   437  C C   . LYS A 1 58  ? -5.058  11.028  -23.359 1.00 18.63 ? 58  LYS A C   1 
ATOM   438  O O   . LYS A 1 58  ? -5.175  12.237  -23.194 1.00 23.16 ? 58  LYS A O   1 
ATOM   439  C CB  . LYS A 1 58  ? -5.884  10.972  -25.723 1.00 22.20 ? 58  LYS A CB  1 
ATOM   440  C CG  . LYS A 1 58  ? -7.292  10.704  -25.192 1.00 32.16 ? 58  LYS A CG  1 
ATOM   441  C CD  . LYS A 1 58  ? -8.325  11.508  -25.997 1.00 35.73 ? 58  LYS A CD  1 
ATOM   442  C CE  . LYS A 1 58  ? -9.631  11.502  -25.215 1.00 37.53 ? 58  LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 58  ? -10.597 12.308  -25.903 1.00 32.97 ? 58  LYS A NZ  1 
ATOM   444  N N   . ILE A 1 59  ? -5.284  10.157  -22.354 1.00 16.54 ? 59  ILE A N   1 
ATOM   445  C CA  . ILE A 1 59  ? -5.379  10.444  -20.931 1.00 10.64 ? 59  ILE A CA  1 
ATOM   446  C C   . ILE A 1 59  ? -4.255  9.598   -20.300 1.00 9.98  ? 59  ILE A C   1 
ATOM   447  O O   . ILE A 1 59  ? -4.039  8.409   -20.596 1.00 9.14  ? 59  ILE A O   1 
ATOM   448  C CB  . ILE A 1 59  ? -6.753  10.008  -20.426 1.00 10.30 ? 59  ILE A CB  1 
ATOM   449  C CG1 . ILE A 1 59  ? -7.920  10.625  -21.267 1.00 8.18  ? 59  ILE A CG1 1 
ATOM   450  C CG2 . ILE A 1 59  ? -6.754  10.346  -18.943 1.00 9.01  ? 59  ILE A CG2 1 
ATOM   451  C CD1 . ILE A 1 59  ? -9.304  10.725  -20.555 1.00 5.75  ? 59  ILE A CD1 1 
ATOM   452  N N   . ALA A 1 60  ? -3.455  10.220  -19.439 1.00 8.83  ? 60  ALA A N   1 
ATOM   453  C CA  . ALA A 1 60  ? -2.330  9.541   -18.766 1.00 7.85  ? 60  ALA A CA  1 
ATOM   454  C C   . ALA A 1 60  ? -2.661  9.091   -17.368 1.00 5.18  ? 60  ALA A C   1 
ATOM   455  O O   . ALA A 1 60  ? -3.292  9.817   -16.605 1.00 7.48  ? 60  ALA A O   1 
ATOM   456  C CB  . ALA A 1 60  ? -1.085  10.396  -18.524 1.00 8.78  ? 60  ALA A CB  1 
ATOM   457  N N   . VAL A 1 61  ? -2.216  7.925   -17.012 1.00 2.00  ? 61  VAL A N   1 
ATOM   458  C CA  . VAL A 1 61  ? -2.505  7.498   -15.721 1.00 2.00  ? 61  VAL A CA  1 
ATOM   459  C C   . VAL A 1 61  ? -1.421  8.030   -14.814 1.00 4.60  ? 61  VAL A C   1 
ATOM   460  O O   . VAL A 1 61  ? -0.332  8.396   -15.251 1.00 7.66  ? 61  VAL A O   1 
ATOM   461  C CB  . VAL A 1 61  ? -2.647  6.035   -15.922 1.00 2.00  ? 61  VAL A CB  1 
ATOM   462  C CG1 . VAL A 1 61  ? -2.613  5.098   -14.732 1.00 2.00  ? 61  VAL A CG1 1 
ATOM   463  C CG2 . VAL A 1 61  ? -4.114  6.053   -16.354 1.00 3.27  ? 61  VAL A CG2 1 
ATOM   464  N N   . ALA A 1 62  ? -1.717  8.161   -13.534 1.00 3.40  ? 62  ALA A N   1 
ATOM   465  C CA  . ALA A 1 62  ? -0.817  8.735   -12.594 1.00 2.00  ? 62  ALA A CA  1 
ATOM   466  C C   . ALA A 1 62  ? -1.002  7.923   -11.335 1.00 3.32  ? 62  ALA A C   1 
ATOM   467  O O   . ALA A 1 62  ? -2.137  7.443   -11.138 1.00 4.42  ? 62  ALA A O   1 
ATOM   468  C CB  . ALA A 1 62  ? -1.242  10.169  -12.359 1.00 2.00  ? 62  ALA A CB  1 
ATOM   469  N N   . ALA A 1 63  ? 0.047   7.731   -10.499 1.00 2.00  ? 63  ALA A N   1 
ATOM   470  C CA  . ALA A 1 63  ? -0.151  7.124   -9.180  1.00 2.00  ? 63  ALA A CA  1 
ATOM   471  C C   . ALA A 1 63  ? -0.403  8.267   -8.215  1.00 2.00  ? 63  ALA A C   1 
ATOM   472  O O   . ALA A 1 63  ? -0.020  9.411   -8.475  1.00 2.00  ? 63  ALA A O   1 
ATOM   473  C CB  . ALA A 1 63  ? 1.069   6.389   -8.657  1.00 2.00  ? 63  ALA A CB  1 
ATOM   474  N N   . GLN A 1 64  ? -1.057  7.994   -7.091  1.00 3.50  ? 64  GLN A N   1 
ATOM   475  C CA  . GLN A 1 64  ? -1.275  9.017   -6.052  1.00 5.74  ? 64  GLN A CA  1 
ATOM   476  C C   . GLN A 1 64  ? -0.184  9.174   -5.004  1.00 5.22  ? 64  GLN A C   1 
ATOM   477  O O   . GLN A 1 64  ? -0.385  9.985   -4.099  1.00 8.38  ? 64  GLN A O   1 
ATOM   478  C CB  . GLN A 1 64  ? -2.574  8.779   -5.223  1.00 7.65  ? 64  GLN A CB  1 
ATOM   479  C CG  . GLN A 1 64  ? -3.935  8.828   -5.916  1.00 5.91  ? 64  GLN A CG  1 
ATOM   480  C CD  . GLN A 1 64  ? -5.073  8.201   -5.119  1.00 9.20  ? 64  GLN A CD  1 
ATOM   481  O OE1 . GLN A 1 64  ? -5.050  7.747   -3.952  1.00 4.12  ? 64  GLN A OE1 1 
ATOM   482  N NE2 . GLN A 1 64  ? -6.143  8.188   -5.884  1.00 9.70  ? 64  GLN A NE2 1 
ATOM   483  N N   . ASN A 1 65  ? 0.851   8.322   -4.985  1.00 5.00  ? 65  ASN A N   1 
ATOM   484  C CA  . ASN A 1 65  ? 2.002   8.405   -4.071  1.00 4.82  ? 65  ASN A CA  1 
ATOM   485  C C   . ASN A 1 65  ? 3.016   7.303   -4.384  1.00 4.43  ? 65  ASN A C   1 
ATOM   486  O O   . ASN A 1 65  ? 2.530   6.303   -4.951  1.00 7.28  ? 65  ASN A O   1 
ATOM   487  C CB  . ASN A 1 65  ? 1.473   8.256   -2.665  1.00 2.93  ? 65  ASN A CB  1 
ATOM   488  C CG  . ASN A 1 65  ? 2.515   8.329   -1.598  1.00 2.00  ? 65  ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 65  ? 3.520   8.990   -1.706  1.00 2.56  ? 65  ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 65  ? 2.295   7.541   -0.587  1.00 2.00  ? 65  ASN A ND2 1 
ATOM   491  N N   . CYS A 1 66  ? 4.326   7.358   -4.021  1.00 3.81  ? 66  CYS A N   1 
ATOM   492  C CA  . CYS A 1 66  ? 5.381   6.301   -4.284  1.00 4.01  ? 66  CYS A CA  1 
ATOM   493  C C   . CYS A 1 66  ? 6.482   6.400   -3.212  1.00 5.41  ? 66  CYS A C   1 
ATOM   494  O O   . CYS A 1 66  ? 6.475   7.383   -2.443  1.00 5.73  ? 66  CYS A O   1 
ATOM   495  C CB  . CYS A 1 66  ? 6.117   6.469   -5.620  1.00 2.00  ? 66  CYS A CB  1 
ATOM   496  S SG  . CYS A 1 66  ? 6.867   8.128   -5.763  1.00 2.00  ? 66  CYS A SG  1 
ATOM   497  N N   . TYR A 1 67  ? 7.424   5.452   -3.057  1.00 5.54  ? 67  TYR A N   1 
ATOM   498  C CA  . TYR A 1 67  ? 8.461   5.618   -2.036  1.00 4.92  ? 67  TYR A CA  1 
ATOM   499  C C   . TYR A 1 67  ? 9.744   5.993   -2.727  1.00 5.64  ? 67  TYR A C   1 
ATOM   500  O O   . TYR A 1 67  ? 9.862   5.920   -3.962  1.00 10.65 ? 67  TYR A O   1 
ATOM   501  C CB  . TYR A 1 67  ? 8.746   4.363   -1.205  1.00 3.94  ? 67  TYR A CB  1 
ATOM   502  C CG  . TYR A 1 67  ? 9.305   4.676   0.187   1.00 2.00  ? 67  TYR A CG  1 
ATOM   503  C CD1 . TYR A 1 67  ? 8.756   5.671   0.999   1.00 2.00  ? 67  TYR A CD1 1 
ATOM   504  C CD2 . TYR A 1 67  ? 10.362  3.935   0.671   1.00 2.00  ? 67  TYR A CD2 1 
ATOM   505  C CE1 . TYR A 1 67  ? 9.303   5.942   2.261   1.00 4.44  ? 67  TYR A CE1 1 
ATOM   506  C CE2 . TYR A 1 67  ? 10.901  4.199   1.931   1.00 4.06  ? 67  TYR A CE2 1 
ATOM   507  C CZ  . TYR A 1 67  ? 10.371  5.180   2.770   1.00 6.58  ? 67  TYR A CZ  1 
ATOM   508  O OH  . TYR A 1 67  ? 10.903  5.348   4.081   1.00 6.86  ? 67  TYR A OH  1 
ATOM   509  N N   . LYS A 1 68  ? 10.715  6.400   -1.903  1.00 5.28  ? 68  LYS A N   1 
ATOM   510  C CA  . LYS A 1 68  ? 11.959  6.994   -2.356  1.00 3.67  ? 68  LYS A CA  1 
ATOM   511  C C   . LYS A 1 68  ? 13.069  6.051   -2.789  1.00 3.15  ? 68  LYS A C   1 
ATOM   512  O O   . LYS A 1 68  ? 14.124  6.505   -3.163  1.00 2.12  ? 68  LYS A O   1 
ATOM   513  C CB  . LYS A 1 68  ? 12.415  7.922   -1.229  1.00 5.15  ? 68  LYS A CB  1 
ATOM   514  C CG  . LYS A 1 68  ? 13.025  7.191   -0.026  1.00 8.35  ? 68  LYS A CG  1 
ATOM   515  C CD  . LYS A 1 68  ? 13.672  8.152   0.955   1.00 7.34  ? 68  LYS A CD  1 
ATOM   516  C CE  . LYS A 1 68  ? 14.613  7.320   1.803   1.00 12.17 ? 68  LYS A CE  1 
ATOM   517  N NZ  . LYS A 1 68  ? 15.133  8.046   2.952   1.00 16.74 ? 68  LYS A NZ  1 
ATOM   518  N N   . VAL A 1 69  ? 12.853  4.735   -2.844  1.00 6.88  ? 69  VAL A N   1 
ATOM   519  C CA  . VAL A 1 69  ? 13.819  3.670   -3.126  1.00 5.24  ? 69  VAL A CA  1 
ATOM   520  C C   . VAL A 1 69  ? 13.209  2.822   -4.245  1.00 9.05  ? 69  VAL A C   1 
ATOM   521  O O   . VAL A 1 69  ? 12.022  3.053   -4.530  1.00 11.41 ? 69  VAL A O   1 
ATOM   522  C CB  . VAL A 1 69  ? 13.963  2.986   -1.772  1.00 2.00  ? 69  VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 69  ? 14.206  1.501   -1.748  1.00 2.42  ? 69  VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 69  ? 15.178  3.643   -1.219  1.00 2.00  ? 69  VAL A CG2 1 
ATOM   525  N N   . THR A 1 70  ? 13.945  1.912   -4.927  1.00 8.56  ? 70  THR A N   1 
ATOM   526  C CA  . THR A 1 70  ? 13.435  1.078   -6.021  1.00 7.06  ? 70  THR A CA  1 
ATOM   527  C C   . THR A 1 70  ? 12.677  -0.108  -5.565  1.00 7.35  ? 70  THR A C   1 
ATOM   528  O O   . THR A 1 70  ? 11.813  -0.553  -6.299  1.00 7.23  ? 70  THR A O   1 
ATOM   529  C CB  . THR A 1 70  ? 14.439  0.373   -6.903  1.00 7.99  ? 70  THR A CB  1 
ATOM   530  O OG1 . THR A 1 70  ? 15.653  0.669   -6.239  1.00 15.84 ? 70  THR A OG1 1 
ATOM   531  C CG2 . THR A 1 70  ? 14.383  0.693   -8.373  1.00 6.54  ? 70  THR A CG2 1 
ATOM   532  N N   . ASN A 1 71  ? 13.149  -0.707  -4.479  1.00 11.61 ? 71  ASN A N   1 
ATOM   533  C CA  . ASN A 1 71  ? 12.593  -1.939  -3.891  1.00 15.67 ? 71  ASN A CA  1 
ATOM   534  C C   . ASN A 1 71  ? 13.047  -2.062  -2.442  1.00 14.88 ? 71  ASN A C   1 
ATOM   535  O O   . ASN A 1 71  ? 14.165  -1.656  -2.104  1.00 17.09 ? 71  ASN A O   1 
ATOM   536  C CB  . ASN A 1 71  ? 13.053  -3.244  -4.611  1.00 16.87 ? 71  ASN A CB  1 
ATOM   537  C CG  . ASN A 1 71  ? 12.343  -3.548  -5.928  1.00 20.76 ? 71  ASN A CG  1 
ATOM   538  O OD1 . ASN A 1 71  ? 11.149  -3.813  -6.026  1.00 23.27 ? 71  ASN A OD1 1 
ATOM   539  N ND2 . ASN A 1 71  ? 13.005  -3.577  -7.059  1.00 26.39 ? 71  ASN A ND2 1 
ATOM   540  N N   . GLY A 1 72  ? 12.246  -2.532  -1.507  1.00 15.37 ? 72  GLY A N   1 
ATOM   541  C CA  . GLY A 1 72  ? 12.730  -2.638  -0.142  1.00 12.11 ? 72  GLY A CA  1 
ATOM   542  C C   . GLY A 1 72  ? 11.727  -3.259  0.788   1.00 10.33 ? 72  GLY A C   1 
ATOM   543  O O   . GLY A 1 72  ? 10.636  -3.701  0.472   1.00 13.02 ? 72  GLY A O   1 
ATOM   544  N N   . ALA A 1 73  ? 12.070  -3.253  2.040   1.00 12.76 ? 73  ALA A N   1 
ATOM   545  C CA  . ALA A 1 73  ? 11.222  -3.759  3.093   1.00 11.53 ? 73  ALA A CA  1 
ATOM   546  C C   . ALA A 1 73  ? 10.433  -2.531  3.494   1.00 10.81 ? 73  ALA A C   1 
ATOM   547  O O   . ALA A 1 73  ? 10.776  -1.834  4.468   1.00 10.12 ? 73  ALA A O   1 
ATOM   548  C CB  . ALA A 1 73  ? 12.061  -4.239  4.276   1.00 9.31  ? 73  ALA A CB  1 
ATOM   549  N N   . PHE A 1 74  ? 9.504   -2.197  2.586   1.00 7.05  ? 74  PHE A N   1 
ATOM   550  C CA  . PHE A 1 74  ? 8.553   -1.143  2.879   1.00 5.45  ? 74  PHE A CA  1 
ATOM   551  C C   . PHE A 1 74  ? 7.138   -1.594  2.560   1.00 7.08  ? 74  PHE A C   1 
ATOM   552  O O   . PHE A 1 74  ? 6.538   -1.151  1.585   1.00 6.38  ? 74  PHE A O   1 
ATOM   553  C CB  . PHE A 1 74  ? 8.869   0.047   2.097   1.00 2.00  ? 74  PHE A CB  1 
ATOM   554  C CG  . PHE A 1 74  ? 10.219  0.499   2.530   1.00 2.00  ? 74  PHE A CG  1 
ATOM   555  C CD1 . PHE A 1 74  ? 10.349  1.211   3.721   1.00 2.00  ? 74  PHE A CD1 1 
ATOM   556  C CD2 . PHE A 1 74  ? 11.324  0.143   1.756   1.00 2.00  ? 74  PHE A CD2 1 
ATOM   557  C CE1 . PHE A 1 74  ? 11.621  1.566   4.153   1.00 2.00  ? 74  PHE A CE1 1 
ATOM   558  C CE2 . PHE A 1 74  ? 12.583  0.500   2.212   1.00 2.00  ? 74  PHE A CE2 1 
ATOM   559  C CZ  . PHE A 1 74  ? 12.739  1.209   3.411   1.00 2.00  ? 74  PHE A CZ  1 
ATOM   560  N N   . THR A 1 75  ? 6.644   -2.553  3.381   1.00 5.80  ? 75  THR A N   1 
ATOM   561  C CA  . THR A 1 75  ? 5.299   -3.128  3.334   1.00 3.79  ? 75  THR A CA  1 
ATOM   562  C C   . THR A 1 75  ? 4.384   -1.948  3.297   1.00 3.99  ? 75  THR A C   1 
ATOM   563  O O   . THR A 1 75  ? 4.601   -1.068  4.135   1.00 7.19  ? 75  THR A O   1 
ATOM   564  C CB  . THR A 1 75  ? 5.010   -3.983  4.614   1.00 2.83  ? 75  THR A CB  1 
ATOM   565  O OG1 . THR A 1 75  ? 5.925   -5.087  4.580   1.00 3.02  ? 75  THR A OG1 1 
ATOM   566  C CG2 . THR A 1 75  ? 3.622   -4.523  4.707   1.00 2.00  ? 75  THR A CG2 1 
ATOM   567  N N   . GLY A 1 76  ? 3.523   -1.900  2.273   1.00 2.95  ? 76  GLY A N   1 
ATOM   568  C CA  . GLY A 1 76  ? 2.576   -0.826  2.149   1.00 2.00  ? 76  GLY A CA  1 
ATOM   569  C C   . GLY A 1 76  ? 2.884   0.026   0.952   1.00 3.67  ? 76  GLY A C   1 
ATOM   570  O O   . GLY A 1 76  ? 1.970   0.575   0.320   1.00 2.00  ? 76  GLY A O   1 
ATOM   571  N N   . GLU A 1 77  ? 4.175   0.051   0.578   1.00 7.98  ? 77  GLU A N   1 
ATOM   572  C CA  . GLU A 1 77  ? 4.696   0.924   -0.479  1.00 7.82  ? 77  GLU A CA  1 
ATOM   573  C C   . GLU A 1 77  ? 4.789   0.379   -1.880  1.00 7.66  ? 77  GLU A C   1 
ATOM   574  O O   . GLU A 1 77  ? 4.725   -0.835  -2.099  1.00 9.14  ? 77  GLU A O   1 
ATOM   575  C CB  . GLU A 1 77  ? 6.074   1.424   -0.081  1.00 7.48  ? 77  GLU A CB  1 
ATOM   576  C CG  . GLU A 1 77  ? 6.020   2.059   1.310   1.00 10.30 ? 77  GLU A CG  1 
ATOM   577  C CD  . GLU A 1 77  ? 5.021   3.214   1.437   1.00 11.29 ? 77  GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 77  ? 4.965   4.074   0.542   1.00 8.86  ? 77  GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 77  ? 4.276   3.219   2.418   1.00 7.04  ? 77  GLU A OE2 1 
ATOM   580  N N   . ILE A 1 78  ? 4.775   1.342   -2.817  1.00 7.29  ? 78  ILE A N   1 
ATOM   581  C CA  . ILE A 1 78  ? 5.024   1.091   -4.236  1.00 4.73  ? 78  ILE A CA  1 
ATOM   582  C C   . ILE A 1 78  ? 6.091   2.122   -4.657  1.00 3.59  ? 78  ILE A C   1 
ATOM   583  O O   . ILE A 1 78  ? 6.237   3.248   -4.136  1.00 2.00  ? 78  ILE A O   1 
ATOM   584  C CB  . ILE A 1 78  ? 3.708   1.229   -5.191  1.00 4.78  ? 78  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 78  ? 3.005   2.528   -5.123  1.00 3.50  ? 78  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 78  ? 2.638   0.262   -4.759  1.00 2.00  ? 78  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 78  ? 2.335   2.595   -6.489  1.00 5.51  ? 78  ILE A CD1 1 
ATOM   588  N N   . SER A 1 79  ? 6.887   1.686   -5.622  1.00 4.55  ? 79  SER A N   1 
ATOM   589  C CA  . SER A 1 79  ? 8.032   2.465   -6.091  1.00 4.32  ? 79  SER A CA  1 
ATOM   590  C C   . SER A 1 79  ? 7.793   3.028   -7.494  1.00 5.52  ? 79  SER A C   1 
ATOM   591  O O   . SER A 1 79  ? 7.043   2.396   -8.266  1.00 7.46  ? 79  SER A O   1 
ATOM   592  C CB  . SER A 1 79  ? 9.283   1.540   -6.047  1.00 2.00  ? 79  SER A CB  1 
ATOM   593  O OG  . SER A 1 79  ? 9.261   0.454   -6.972  1.00 2.00  ? 79  SER A OG  1 
ATOM   594  N N   . PRO A 1 80  ? 8.373   4.177   -7.916  1.00 7.62  ? 80  PRO A N   1 
ATOM   595  C CA  . PRO A 1 80  ? 8.297   4.700   -9.307  1.00 5.72  ? 80  PRO A CA  1 
ATOM   596  C C   . PRO A 1 80  ? 8.368   3.657   -10.436 1.00 4.50  ? 80  PRO A C   1 
ATOM   597  O O   . PRO A 1 80  ? 7.663   3.691   -11.448 1.00 4.86  ? 80  PRO A O   1 
ATOM   598  C CB  . PRO A 1 80  ? 9.430   5.715   -9.351  1.00 4.48  ? 80  PRO A CB  1 
ATOM   599  C CG  . PRO A 1 80  ? 9.416   6.300   -7.950  1.00 9.84  ? 80  PRO A CG  1 
ATOM   600  C CD  . PRO A 1 80  ? 9.219   5.048   -7.071  1.00 8.52  ? 80  PRO A CD  1 
ATOM   601  N N   . GLY A 1 81  ? 9.230   2.686   -10.268 1.00 2.00  ? 81  GLY A N   1 
ATOM   602  C CA  . GLY A 1 81  ? 9.297   1.581   -11.206 1.00 3.92  ? 81  GLY A CA  1 
ATOM   603  C C   . GLY A 1 81  ? 8.012   0.767   -11.275 1.00 4.83  ? 81  GLY A C   1 
ATOM   604  O O   . GLY A 1 81  ? 7.539   0.453   -12.369 1.00 2.75  ? 81  GLY A O   1 
ATOM   605  N N   . MET A 1 82  ? 7.445   0.423   -10.101 1.00 5.72  ? 82  MET A N   1 
ATOM   606  C CA  . MET A 1 82  ? 6.193   -0.314  -9.994  1.00 2.52  ? 82  MET A CA  1 
ATOM   607  C C   . MET A 1 82  ? 5.212   0.504   -10.708 1.00 2.00  ? 82  MET A C   1 
ATOM   608  O O   . MET A 1 82  ? 4.633   -0.079  -11.582 1.00 2.00  ? 82  MET A O   1 
ATOM   609  C CB  . MET A 1 82  ? 5.738   -0.498  -8.560  1.00 3.60  ? 82  MET A CB  1 
ATOM   610  C CG  . MET A 1 82  ? 6.407   -1.769  -8.066  1.00 7.00  ? 82  MET A CG  1 
ATOM   611  S SD  . MET A 1 82  ? 6.410   -2.117  -6.294  1.00 3.16  ? 82  MET A SD  1 
ATOM   612  C CE  . MET A 1 82  ? 8.121   -2.548  -6.190  1.00 2.00  ? 82  MET A CE  1 
ATOM   613  N N   . ILE A 1 83  ? 5.113   1.817   -10.500 1.00 2.70  ? 83  ILE A N   1 
ATOM   614  C CA  . ILE A 1 83  ? 4.190   2.682   -11.274 1.00 6.04  ? 83  ILE A CA  1 
ATOM   615  C C   . ILE A 1 83  ? 4.381   2.649   -12.801 1.00 9.05  ? 83  ILE A C   1 
ATOM   616  O O   . ILE A 1 83  ? 3.442   2.468   -13.595 1.00 9.86  ? 83  ILE A O   1 
ATOM   617  C CB  . ILE A 1 83  ? 4.327   4.120   -10.853 1.00 2.00  ? 83  ILE A CB  1 
ATOM   618  C CG1 . ILE A 1 83  ? 4.047   4.198   -9.400  1.00 2.00  ? 83  ILE A CG1 1 
ATOM   619  C CG2 . ILE A 1 83  ? 3.373   4.986   -11.588 1.00 2.00  ? 83  ILE A CG2 1 
ATOM   620  C CD1 . ILE A 1 83  ? 4.522   5.484   -8.720  1.00 5.16  ? 83  ILE A CD1 1 
ATOM   621  N N   . LYS A 1 84  ? 5.644   2.772   -13.204 1.00 10.33 ? 84  LYS A N   1 
ATOM   622  C CA  . LYS A 1 84  ? 6.024   2.817   -14.592 1.00 9.56  ? 84  LYS A CA  1 
ATOM   623  C C   . LYS A 1 84  ? 5.782   1.451   -15.212 1.00 11.26 ? 84  LYS A C   1 
ATOM   624  O O   . LYS A 1 84  ? 5.392   1.320   -16.377 1.00 13.71 ? 84  LYS A O   1 
ATOM   625  C CB  . LYS A 1 84  ? 7.459   3.259   -14.582 1.00 6.75  ? 84  LYS A CB  1 
ATOM   626  C CG  . LYS A 1 84  ? 7.921   4.292   -15.597 1.00 3.80  ? 84  LYS A CG  1 
ATOM   627  C CD  . LYS A 1 84  ? 9.323   4.679   -15.180 1.00 5.72  ? 84  LYS A CD  1 
ATOM   628  C CE  . LYS A 1 84  ? 10.301  3.495   -15.019 1.00 4.19  ? 84  LYS A CE  1 
ATOM   629  N NZ  . LYS A 1 84  ? 11.371  3.831   -14.096 1.00 10.99 ? 84  LYS A NZ  1 
ATOM   630  N N   . ASP A 1 85  ? 5.840   0.388   -14.423 1.00 14.00 ? 85  ASP A N   1 
ATOM   631  C CA  . ASP A 1 85  ? 5.591   -0.978  -14.917 1.00 16.72 ? 85  ASP A CA  1 
ATOM   632  C C   . ASP A 1 85  ? 4.122   -1.218  -15.198 1.00 14.22 ? 85  ASP A C   1 
ATOM   633  O O   . ASP A 1 85  ? 3.769   -2.144  -15.906 1.00 14.64 ? 85  ASP A O   1 
ATOM   634  C CB  . ASP A 1 85  ? 6.079   -1.990  -13.884 1.00 19.44 ? 85  ASP A CB  1 
ATOM   635  C CG  . ASP A 1 85  ? 6.245   -3.441  -14.319 1.00 23.54 ? 85  ASP A CG  1 
ATOM   636  O OD1 . ASP A 1 85  ? 6.948   -3.759  -15.297 1.00 22.26 ? 85  ASP A OD1 1 
ATOM   637  O OD2 . ASP A 1 85  ? 5.675   -4.264  -13.610 1.00 25.38 ? 85  ASP A OD2 1 
ATOM   638  N N   . CYS A 1 86  ? 3.267   -0.376  -14.622 1.00 12.84 ? 86  CYS A N   1 
ATOM   639  C CA  . CYS A 1 86  ? 1.851   -0.429  -14.836 1.00 8.01  ? 86  CYS A CA  1 
ATOM   640  C C   . CYS A 1 86  ? 1.424   0.408   -16.020 1.00 9.00  ? 86  CYS A C   1 
ATOM   641  O O   . CYS A 1 86  ? 0.278   0.347   -16.472 1.00 9.61  ? 86  CYS A O   1 
ATOM   642  C CB  . CYS A 1 86  ? 1.239   0.012   -13.565 1.00 3.61  ? 86  CYS A CB  1 
ATOM   643  S SG  . CYS A 1 86  ? 1.311   -1.534  -12.650 1.00 2.00  ? 86  CYS A SG  1 
ATOM   644  N N   . GLY A 1 87  ? 2.407   1.124   -16.582 1.00 8.93  ? 87  GLY A N   1 
ATOM   645  C CA  . GLY A 1 87  ? 2.210   2.004   -17.723 1.00 9.58  ? 87  GLY A CA  1 
ATOM   646  C C   . GLY A 1 87  ? 1.851   3.431   -17.342 1.00 9.31  ? 87  GLY A C   1 
ATOM   647  O O   . GLY A 1 87  ? 1.481   4.245   -18.207 1.00 5.49  ? 87  GLY A O   1 
ATOM   648  N N   . ALA A 1 88  ? 1.978   3.726   -16.035 1.00 9.13  ? 88  ALA A N   1 
ATOM   649  C CA  . ALA A 1 88  ? 1.609   5.033   -15.522 1.00 8.91  ? 88  ALA A CA  1 
ATOM   650  C C   . ALA A 1 88  ? 2.833   5.892   -15.567 1.00 10.17 ? 88  ALA A C   1 
ATOM   651  O O   . ALA A 1 88  ? 3.956   5.416   -15.444 1.00 12.85 ? 88  ALA A O   1 
ATOM   652  C CB  . ALA A 1 88  ? 1.142   4.938   -14.113 1.00 7.27  ? 88  ALA A CB  1 
ATOM   653  N N   . THR A 1 89  ? 2.604   7.161   -15.791 1.00 10.73 ? 89  THR A N   1 
ATOM   654  C CA  . THR A 1 89  ? 3.678   8.082   -16.058 1.00 11.27 ? 89  THR A CA  1 
ATOM   655  C C   . THR A 1 89  ? 3.810   9.281   -15.113 1.00 9.90  ? 89  THR A C   1 
ATOM   656  O O   . THR A 1 89  ? 4.749   10.068  -15.253 1.00 10.53 ? 89  THR A O   1 
ATOM   657  C CB  . THR A 1 89  ? 3.445   8.484   -17.551 1.00 13.74 ? 89  THR A CB  1 
ATOM   658  O OG1 . THR A 1 89  ? 2.089   8.931   -17.701 1.00 14.19 ? 89  THR A OG1 1 
ATOM   659  C CG2 . THR A 1 89  ? 3.677   7.304   -18.496 1.00 15.13 ? 89  THR A CG2 1 
ATOM   660  N N   . TRP A 1 90  ? 2.918   9.476   -14.141 1.00 5.83  ? 90  TRP A N   1 
ATOM   661  C CA  . TRP A 1 90  ? 2.978   10.623  -13.274 1.00 2.00  ? 90  TRP A CA  1 
ATOM   662  C C   . TRP A 1 90  ? 2.914   10.242  -11.815 1.00 2.00  ? 90  TRP A C   1 
ATOM   663  O O   . TRP A 1 90  ? 2.336   9.213   -11.548 1.00 2.00  ? 90  TRP A O   1 
ATOM   664  C CB  . TRP A 1 90  ? 1.828   11.519  -13.599 1.00 2.00  ? 90  TRP A CB  1 
ATOM   665  C CG  . TRP A 1 90  ? 1.947   12.327  -14.857 1.00 2.67  ? 90  TRP A CG  1 
ATOM   666  C CD1 . TRP A 1 90  ? 1.400   11.956  -16.066 1.00 6.10  ? 90  TRP A CD1 1 
ATOM   667  C CD2 . TRP A 1 90  ? 2.568   13.529  -14.909 1.00 3.48  ? 90  TRP A CD2 1 
ATOM   668  N NE1 . TRP A 1 90  ? 1.664   12.950  -16.892 1.00 4.23  ? 90  TRP A NE1 1 
ATOM   669  C CE2 . TRP A 1 90  ? 2.356   13.909  -16.242 1.00 5.40  ? 90  TRP A CE2 1 
ATOM   670  C CE3 . TRP A 1 90  ? 3.248   14.342  -14.017 1.00 2.00  ? 90  TRP A CE3 1 
ATOM   671  C CZ2 . TRP A 1 90  ? 2.857   15.142  -16.655 1.00 5.93  ? 90  TRP A CZ2 1 
ATOM   672  C CZ3 . TRP A 1 90  ? 3.723   15.550  -14.439 1.00 2.00  ? 90  TRP A CZ3 1 
ATOM   673  C CH2 . TRP A 1 90  ? 3.542   15.950  -15.738 1.00 2.00  ? 90  TRP A CH2 1 
ATOM   674  N N   . VAL A 1 91  ? 3.484   10.881  -10.806 1.00 2.00  ? 91  VAL A N   1 
ATOM   675  C CA  . VAL A 1 91  ? 3.120   10.569  -9.445  1.00 2.00  ? 91  VAL A CA  1 
ATOM   676  C C   . VAL A 1 91  ? 2.622   11.921  -8.955  1.00 2.00  ? 91  VAL A C   1 
ATOM   677  O O   . VAL A 1 91  ? 3.110   12.987  -9.355  1.00 2.00  ? 91  VAL A O   1 
ATOM   678  C CB  . VAL A 1 91  ? 4.240   10.224  -8.460  1.00 2.00  ? 91  VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 91  ? 3.520   9.482   -7.399  1.00 3.91  ? 91  VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 91  ? 5.330   9.320   -8.898  1.00 2.00  ? 91  VAL A CG2 1 
ATOM   681  N N   . VAL A 1 92  ? 1.614   11.881  -8.102  1.00 3.96  ? 92  VAL A N   1 
ATOM   682  C CA  . VAL A 1 92  ? 1.128   13.032  -7.350  1.00 7.19  ? 92  VAL A CA  1 
ATOM   683  C C   . VAL A 1 92  ? 1.890   12.825  -6.051  1.00 8.73  ? 92  VAL A C   1 
ATOM   684  O O   . VAL A 1 92  ? 1.762   11.752  -5.445  1.00 7.34  ? 92  VAL A O   1 
ATOM   685  C CB  . VAL A 1 92  ? -0.417  12.952  -7.093  1.00 8.12  ? 92  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 92  ? -0.945  14.186  -6.371  1.00 7.17  ? 92  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 92  ? -1.122  12.815  -8.434  1.00 10.82 ? 92  VAL A CG2 1 
ATOM   688  N N   . LEU A 1 93  ? 2.750   13.778  -5.637  1.00 12.94 ? 93  LEU A N   1 
ATOM   689  C CA  . LEU A 1 93  ? 3.537   13.654  -4.384  1.00 13.96 ? 93  LEU A CA  1 
ATOM   690  C C   . LEU A 1 93  ? 3.406   14.907  -3.549  1.00 11.00 ? 93  LEU A C   1 
ATOM   691  O O   . LEU A 1 93  ? 3.090   15.981  -4.077  1.00 12.57 ? 93  LEU A O   1 
ATOM   692  C CB  . LEU A 1 93  ? 5.066   13.462  -4.594  1.00 12.69 ? 93  LEU A CB  1 
ATOM   693  C CG  . LEU A 1 93  ? 5.646   12.161  -5.133  1.00 13.13 ? 93  LEU A CG  1 
ATOM   694  C CD1 . LEU A 1 93  ? 7.056   12.489  -5.481  1.00 14.43 ? 93  LEU A CD1 1 
ATOM   695  C CD2 . LEU A 1 93  ? 5.644   10.999  -4.163  1.00 12.64 ? 93  LEU A CD2 1 
ATOM   696  N N   . GLY A 1 94  ? 3.649   14.768  -2.250  1.00 6.78  ? 94  GLY A N   1 
ATOM   697  C CA  . GLY A 1 94  ? 3.543   15.895  -1.338  1.00 9.33  ? 94  GLY A CA  1 
ATOM   698  C C   . GLY A 1 94  ? 2.124   16.448  -1.209  1.00 9.59  ? 94  GLY A C   1 
ATOM   699  O O   . GLY A 1 94  ? 1.888   17.612  -0.925  1.00 11.04 ? 94  GLY A O   1 
ATOM   700  N N   . HIS A 1 95  ? 1.133   15.599  -1.449  1.00 9.86  ? 95  HIS A N   1 
ATOM   701  C CA  . HIS A 1 95  ? -0.262  15.982  -1.389  1.00 7.35  ? 95  HIS A CA  1 
ATOM   702  C C   . HIS A 1 95  ? -0.637  16.110  0.095   1.00 5.83  ? 95  HIS A C   1 
ATOM   703  O O   . HIS A 1 95  ? -0.278  15.265  0.906   1.00 2.00  ? 95  HIS A O   1 
ATOM   704  C CB  . HIS A 1 95  ? -1.071  14.896  -2.131  1.00 7.29  ? 95  HIS A CB  1 
ATOM   705  C CG  . HIS A 1 95  ? -2.556  15.163  -2.242  1.00 4.83  ? 95  HIS A CG  1 
ATOM   706  N ND1 . HIS A 1 95  ? -3.493  15.058  -1.312  1.00 3.09  ? 95  HIS A ND1 1 
ATOM   707  C CD2 . HIS A 1 95  ? -3.134  15.724  -3.366  1.00 8.15  ? 95  HIS A CD2 1 
ATOM   708  C CE1 . HIS A 1 95  ? -4.595  15.572  -1.826  1.00 5.59  ? 95  HIS A CE1 1 
ATOM   709  N NE2 . HIS A 1 95  ? -4.382  15.965  -3.058  1.00 6.53  ? 95  HIS A NE2 1 
ATOM   710  N N   . SER A 1 96  ? -1.464  17.113  0.388   1.00 4.21  ? 96  SER A N   1 
ATOM   711  C CA  . SER A 1 96  ? -1.880  17.513  1.690   1.00 2.65  ? 96  SER A CA  1 
ATOM   712  C C   . SER A 1 96  ? -2.346  16.422  2.582   1.00 2.00  ? 96  SER A C   1 
ATOM   713  O O   . SER A 1 96  ? -2.111  16.492  3.782   1.00 2.00  ? 96  SER A O   1 
ATOM   714  C CB  . SER A 1 96  ? -2.979  18.563  1.548   1.00 6.92  ? 96  SER A CB  1 
ATOM   715  O OG  . SER A 1 96  ? -3.953  18.273  0.541   1.00 12.72 ? 96  SER A OG  1 
ATOM   716  N N   . GLU A 1 97  ? -2.993  15.437  2.011   1.00 2.00  ? 97  GLU A N   1 
ATOM   717  C CA  . GLU A 1 97  ? -3.527  14.373  2.838   1.00 6.11  ? 97  GLU A CA  1 
ATOM   718  C C   . GLU A 1 97  ? -2.468  13.446  3.374   1.00 7.19  ? 97  GLU A C   1 
ATOM   719  O O   . GLU A 1 97  ? -2.636  12.867  4.444   1.00 7.53  ? 97  GLU A O   1 
ATOM   720  C CB  . GLU A 1 97  ? -4.574  13.579  2.057   1.00 7.83  ? 97  GLU A CB  1 
ATOM   721  C CG  . GLU A 1 97  ? -5.787  14.483  1.892   1.00 4.36  ? 97  GLU A CG  1 
ATOM   722  C CD  . GLU A 1 97  ? -6.774  14.182  0.771   1.00 7.22  ? 97  GLU A CD  1 
ATOM   723  O OE1 . GLU A 1 97  ? -6.588  13.242  -0.025  1.00 2.00  ? 97  GLU A OE1 1 
ATOM   724  O OE2 . GLU A 1 97  ? -7.755  14.944  0.718   1.00 8.17  ? 97  GLU A OE2 1 
ATOM   725  N N   . ARG A 1 98  ? -1.333  13.430  2.681   1.00 8.52  ? 98  ARG A N   1 
ATOM   726  C CA  . ARG A 1 98  ? -0.136  12.698  3.086   1.00 8.01  ? 98  ARG A CA  1 
ATOM   727  C C   . ARG A 1 98  ? 0.581   13.537  4.158   1.00 7.39  ? 98  ARG A C   1 
ATOM   728  O O   . ARG A 1 98  ? 0.878   13.101  5.276   1.00 6.14  ? 98  ARG A O   1 
ATOM   729  C CB  . ARG A 1 98  ? 0.802   12.487  1.860   1.00 8.67  ? 98  ARG A CB  1 
ATOM   730  C CG  . ARG A 1 98  ? 0.240   11.885  0.565   1.00 7.64  ? 98  ARG A CG  1 
ATOM   731  C CD  . ARG A 1 98  ? -0.543  10.637  0.902   1.00 7.49  ? 98  ARG A CD  1 
ATOM   732  N NE  . ARG A 1 98  ? 0.243   9.669   1.644   1.00 5.68  ? 98  ARG A NE  1 
ATOM   733  C CZ  . ARG A 1 98  ? -0.299  8.575   2.176   1.00 6.52  ? 98  ARG A CZ  1 
ATOM   734  N NH1 . ARG A 1 98  ? -1.591  8.282   2.115   1.00 8.64  ? 98  ARG A NH1 1 
ATOM   735  N NH2 . ARG A 1 98  ? 0.476   7.743   2.844   1.00 10.07 ? 98  ARG A NH2 1 
ATOM   736  N N   . ARG A 1 99  ? 0.775   14.811  3.831   1.00 6.46  ? 99  ARG A N   1 
ATOM   737  C CA  . ARG A 1 99  ? 1.480   15.805  4.651   1.00 6.79  ? 99  ARG A CA  1 
ATOM   738  C C   . ARG A 1 99  ? 0.799   16.196  5.937   1.00 5.44  ? 99  ARG A C   1 
ATOM   739  O O   . ARG A 1 99  ? 1.356   16.854  6.816   1.00 6.03  ? 99  ARG A O   1 
ATOM   740  C CB  . ARG A 1 99  ? 1.710   17.144  3.896   1.00 7.83  ? 99  ARG A CB  1 
ATOM   741  C CG  . ARG A 1 99  ? 2.524   17.168  2.594   1.00 4.41  ? 99  ARG A CG  1 
ATOM   742  C CD  . ARG A 1 99  ? 2.495   18.630  2.278   1.00 2.00  ? 99  ARG A CD  1 
ATOM   743  N NE  . ARG A 1 99  ? 3.246   18.977  1.096   1.00 2.00  ? 99  ARG A NE  1 
ATOM   744  C CZ  . ARG A 1 99  ? 4.525   19.333  1.166   1.00 4.66  ? 99  ARG A CZ  1 
ATOM   745  N NH1 . ARG A 1 99  ? 5.232   19.317  2.312   1.00 2.00  ? 99  ARG A NH1 1 
ATOM   746  N NH2 . ARG A 1 99  ? 5.139   19.663  0.037   1.00 10.87 ? 99  ARG A NH2 1 
ATOM   747  N N   . HIS A 1 100 ? -0.496  15.946  5.970   1.00 8.58  ? 100 HIS A N   1 
ATOM   748  C CA  . HIS A 1 100 ? -1.267  16.300  7.140   1.00 8.60  ? 100 HIS A CA  1 
ATOM   749  C C   . HIS A 1 100 ? -1.969  15.133  7.725   1.00 6.32  ? 100 HIS A C   1 
ATOM   750  O O   . HIS A 1 100 ? -2.020  15.074  8.951   1.00 7.40  ? 100 HIS A O   1 
ATOM   751  C CB  . HIS A 1 100 ? -2.314  17.329  6.863   1.00 9.80  ? 100 HIS A CB  1 
ATOM   752  C CG  . HIS A 1 100 ? -1.737  18.626  6.351   1.00 14.23 ? 100 HIS A CG  1 
ATOM   753  N ND1 . HIS A 1 100 ? -2.101  19.262  5.241   1.00 19.24 ? 100 HIS A ND1 1 
ATOM   754  C CD2 . HIS A 1 100 ? -0.729  19.337  6.935   1.00 16.82 ? 100 HIS A CD2 1 
ATOM   755  C CE1 . HIS A 1 100 ? -1.365  20.338  5.102   1.00 19.67 ? 100 HIS A CE1 1 
ATOM   756  N NE2 . HIS A 1 100 ? -0.549  20.365  6.132   1.00 21.75 ? 100 HIS A NE2 1 
ATOM   757  N N   . VAL A 1 101 ? -2.531  14.216  6.946   1.00 4.80  ? 101 VAL A N   1 
ATOM   758  C CA  . VAL A 1 101 ? -3.188  13.123  7.643   1.00 3.54  ? 101 VAL A CA  1 
ATOM   759  C C   . VAL A 1 101 ? -2.066  12.126  7.867   1.00 3.87  ? 101 VAL A C   1 
ATOM   760  O O   . VAL A 1 101 ? -1.942  11.578  8.977   1.00 7.83  ? 101 VAL A O   1 
ATOM   761  C CB  . VAL A 1 101 ? -4.329  12.513  6.804   1.00 2.00  ? 101 VAL A CB  1 
ATOM   762  C CG1 . VAL A 1 101 ? -5.260  11.629  7.570   1.00 2.00  ? 101 VAL A CG1 1 
ATOM   763  C CG2 . VAL A 1 101 ? -5.231  13.618  6.392   1.00 4.34  ? 101 VAL A CG2 1 
ATOM   764  N N   . PHE A 1 102 ? -1.153  11.922  6.915   1.00 2.43  ? 102 PHE A N   1 
ATOM   765  C CA  . PHE A 1 102 ? -0.174  10.862  7.086   1.00 2.00  ? 102 PHE A CA  1 
ATOM   766  C C   . PHE A 1 102 ? 1.193   11.283  7.476   1.00 2.00  ? 102 PHE A C   1 
ATOM   767  O O   . PHE A 1 102 ? 2.105   10.593  7.145   1.00 4.80  ? 102 PHE A O   1 
ATOM   768  C CB  . PHE A 1 102 ? -0.122  10.042  5.801   1.00 2.00  ? 102 PHE A CB  1 
ATOM   769  C CG  . PHE A 1 102 ? -1.484  9.409   5.612   1.00 3.77  ? 102 PHE A CG  1 
ATOM   770  C CD1 . PHE A 1 102 ? -1.910  8.428   6.523   1.00 2.00  ? 102 PHE A CD1 1 
ATOM   771  C CD2 . PHE A 1 102 ? -2.319  9.891   4.607   1.00 2.00  ? 102 PHE A CD2 1 
ATOM   772  C CE1 . PHE A 1 102 ? -3.200  7.950   6.424   1.00 2.00  ? 102 PHE A CE1 1 
ATOM   773  C CE2 . PHE A 1 102 ? -3.601  9.399   4.517   1.00 2.00  ? 102 PHE A CE2 1 
ATOM   774  C CZ  . PHE A 1 102 ? -4.040  8.439   5.427   1.00 2.83  ? 102 PHE A CZ  1 
ATOM   775  N N   . GLY A 1 103 ? 1.447   12.362  8.168   1.00 7.75  ? 103 GLY A N   1 
ATOM   776  C CA  . GLY A 1 103 ? 2.786   12.791  8.529   1.00 12.50 ? 103 GLY A CA  1 
ATOM   777  C C   . GLY A 1 103 ? 3.898   12.788  7.445   1.00 16.90 ? 103 GLY A C   1 
ATOM   778  O O   . GLY A 1 103 ? 5.059   12.615  7.859   1.00 21.83 ? 103 GLY A O   1 
ATOM   779  N N   . GLU A 1 104 ? 3.705   12.938  6.102   1.00 14.52 ? 104 GLU A N   1 
ATOM   780  C CA  . GLU A 1 104 ? 4.842   13.018  5.207   1.00 11.39 ? 104 GLU A CA  1 
ATOM   781  C C   . GLU A 1 104 ? 5.471   14.360  5.332   1.00 13.37 ? 104 GLU A C   1 
ATOM   782  O O   . GLU A 1 104 ? 4.876   15.432  5.144   1.00 13.28 ? 104 GLU A O   1 
ATOM   783  C CB  . GLU A 1 104 ? 4.457   12.817  3.794   1.00 10.93 ? 104 GLU A CB  1 
ATOM   784  C CG  . GLU A 1 104 ? 4.021   11.376  3.740   1.00 10.32 ? 104 GLU A CG  1 
ATOM   785  C CD  . GLU A 1 104 ? 3.843   10.758  2.384   1.00 13.46 ? 104 GLU A CD  1 
ATOM   786  O OE1 . GLU A 1 104 ? 4.001   11.390  1.331   1.00 15.82 ? 104 GLU A OE1 1 
ATOM   787  O OE2 . GLU A 1 104 ? 3.530   9.578   2.419   1.00 19.90 ? 104 GLU A OE2 1 
ATOM   788  N N   . SER A 1 105 ? 6.701   14.170  5.789   1.00 15.61 ? 105 SER A N   1 
ATOM   789  C CA  . SER A 1 105 ? 7.662   15.229  6.085   1.00 17.48 ? 105 SER A CA  1 
ATOM   790  C C   . SER A 1 105 ? 8.262   15.938  4.862   1.00 17.36 ? 105 SER A C   1 
ATOM   791  O O   . SER A 1 105 ? 8.470   15.306  3.823   1.00 20.11 ? 105 SER A O   1 
ATOM   792  C CB  . SER A 1 105 ? 8.730   14.528  6.993   1.00 22.81 ? 105 SER A CB  1 
ATOM   793  O OG  . SER A 1 105 ? 9.002   13.110  6.820   1.00 22.24 ? 105 SER A OG  1 
ATOM   794  N N   . ASP A 1 106 ? 8.667   17.205  4.874   1.00 18.02 ? 106 ASP A N   1 
ATOM   795  C CA  . ASP A 1 106 ? 9.186   17.863  3.662   1.00 17.10 ? 106 ASP A CA  1 
ATOM   796  C C   . ASP A 1 106 ? 10.456  17.285  3.014   1.00 17.20 ? 106 ASP A C   1 
ATOM   797  O O   . ASP A 1 106 ? 10.602  17.199  1.776   1.00 12.58 ? 106 ASP A O   1 
ATOM   798  C CB  . ASP A 1 106 ? 9.415   19.320  3.984   1.00 18.64 ? 106 ASP A CB  1 
ATOM   799  C CG  . ASP A 1 106 ? 8.349   20.268  3.443   1.00 21.71 ? 106 ASP A CG  1 
ATOM   800  O OD1 . ASP A 1 106 ? 8.120   20.299  2.211   1.00 21.73 ? 106 ASP A OD1 1 
ATOM   801  O OD2 . ASP A 1 106 ? 7.779   20.982  4.281   1.00 23.25 ? 106 ASP A OD2 1 
ATOM   802  N N   . GLU A 1 107 ? 11.375  16.870  3.914   1.00 15.49 ? 107 GLU A N   1 
ATOM   803  C CA  . GLU A 1 107 ? 12.608  16.228  3.490   1.00 14.61 ? 107 GLU A CA  1 
ATOM   804  C C   . GLU A 1 107 ? 12.310  14.958  2.744   1.00 12.26 ? 107 GLU A C   1 
ATOM   805  O O   . GLU A 1 107 ? 12.910  14.699  1.695   1.00 11.62 ? 107 GLU A O   1 
ATOM   806  C CB  . GLU A 1 107 ? 13.526  15.844  4.669   1.00 17.27 ? 107 GLU A CB  1 
ATOM   807  C CG  . GLU A 1 107 ? 14.895  16.548  4.709   1.00 21.34 ? 107 GLU A CG  1 
ATOM   808  C CD  . GLU A 1 107 ? 14.846  18.090  4.801   1.00 23.33 ? 107 GLU A CD  1 
ATOM   809  O OE1 . GLU A 1 107 ? 14.771  18.652  5.909   1.00 20.14 ? 107 GLU A OE1 1 
ATOM   810  O OE2 . GLU A 1 107 ? 14.908  18.727  3.741   1.00 27.17 ? 107 GLU A OE2 1 
ATOM   811  N N   . LEU A 1 108 ? 11.377  14.189  3.316   1.00 11.22 ? 108 LEU A N   1 
ATOM   812  C CA  . LEU A 1 108 ? 11.024  12.906  2.745   1.00 10.33 ? 108 LEU A CA  1 
ATOM   813  C C   . LEU A 1 108 ? 10.275  13.111  1.440   1.00 11.95 ? 108 LEU A C   1 
ATOM   814  O O   . LEU A 1 108 ? 10.575  12.355  0.514   1.00 15.52 ? 108 LEU A O   1 
ATOM   815  C CB  . LEU A 1 108 ? 10.211  12.145  3.746   1.00 5.70  ? 108 LEU A CB  1 
ATOM   816  C CG  . LEU A 1 108 ? 9.434   10.869  3.463   1.00 5.78  ? 108 LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 108 ? 8.045   11.385  3.220   1.00 7.58  ? 108 LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 108 ? 10.005  9.961   2.374   1.00 2.40  ? 108 LEU A CD2 1 
ATOM   819  N N   . ILE A 1 109 ? 9.350   14.064  1.282   1.00 9.10  ? 109 ILE A N   1 
ATOM   820  C CA  . ILE A 1 109 ? 8.750   14.331  -0.027  1.00 6.44  ? 109 ILE A CA  1 
ATOM   821  C C   . ILE A 1 109 ? 9.853   14.652  -1.062  1.00 7.11  ? 109 ILE A C   1 
ATOM   822  O O   . ILE A 1 109 ? 9.866   14.001  -2.114  1.00 7.32  ? 109 ILE A O   1 
ATOM   823  C CB  . ILE A 1 109 ? 7.767   15.506  0.130   1.00 3.88  ? 109 ILE A CB  1 
ATOM   824  C CG1 . ILE A 1 109 ? 6.610   15.013  0.934   1.00 2.00  ? 109 ILE A CG1 1 
ATOM   825  C CG2 . ILE A 1 109 ? 7.370   16.087  -1.218  1.00 2.00  ? 109 ILE A CG2 1 
ATOM   826  C CD1 . ILE A 1 109 ? 6.167   16.057  1.953   1.00 2.00  ? 109 ILE A CD1 1 
ATOM   827  N N   . GLY A 1 110 ? 10.792  15.598  -0.796  1.00 6.34  ? 110 GLY A N   1 
ATOM   828  C CA  . GLY A 1 110 ? 11.862  15.995  -1.711  1.00 3.99  ? 110 GLY A CA  1 
ATOM   829  C C   . GLY A 1 110 ? 12.685  14.761  -2.097  1.00 8.54  ? 110 GLY A C   1 
ATOM   830  O O   . GLY A 1 110 ? 12.994  14.575  -3.280  1.00 9.59  ? 110 GLY A O   1 
ATOM   831  N N   . GLN A 1 111 ? 13.030  13.862  -1.160  1.00 5.38  ? 111 GLN A N   1 
ATOM   832  C CA  . GLN A 1 111 ? 13.683  12.631  -1.511  1.00 2.00  ? 111 GLN A CA  1 
ATOM   833  C C   . GLN A 1 111 ? 12.896  11.736  -2.445  1.00 2.74  ? 111 GLN A C   1 
ATOM   834  O O   . GLN A 1 111 ? 13.491  10.859  -3.089  1.00 4.13  ? 111 GLN A O   1 
ATOM   835  C CB  . GLN A 1 111 ? 13.960  11.854  -0.324  1.00 2.00  ? 111 GLN A CB  1 
ATOM   836  C CG  . GLN A 1 111 ? 15.163  12.412  0.354   1.00 3.91  ? 111 GLN A CG  1 
ATOM   837  C CD  . GLN A 1 111 ? 15.227  11.887  1.765   1.00 7.91  ? 111 GLN A CD  1 
ATOM   838  O OE1 . GLN A 1 111 ? 15.347  10.695  2.012   1.00 6.54  ? 111 GLN A OE1 1 
ATOM   839  N NE2 . GLN A 1 111 ? 15.021  12.730  2.769   1.00 15.87 ? 111 GLN A NE2 1 
ATOM   840  N N   . LYS A 1 112 ? 11.576  11.920  -2.563  1.00 2.00  ? 112 LYS A N   1 
ATOM   841  C CA  . LYS A 1 112 ? 10.757  11.151  -3.477  1.00 2.00  ? 112 LYS A CA  1 
ATOM   842  C C   . LYS A 1 112 ? 10.636  11.953  -4.785  1.00 2.00  ? 112 LYS A C   1 
ATOM   843  O O   . LYS A 1 112 ? 10.550  11.405  -5.874  1.00 2.00  ? 112 LYS A O   1 
ATOM   844  C CB  . LYS A 1 112 ? 9.403   10.919  -2.849  1.00 2.00  ? 112 LYS A CB  1 
ATOM   845  C CG  . LYS A 1 112 ? 9.200   10.171  -1.504  1.00 2.38  ? 112 LYS A CG  1 
ATOM   846  C CD  . LYS A 1 112 ? 7.656   9.994   -1.291  1.00 2.00  ? 112 LYS A CD  1 
ATOM   847  C CE  . LYS A 1 112 ? 7.087   10.138  0.109   1.00 2.00  ? 112 LYS A CE  1 
ATOM   848  N NZ  . LYS A 1 112 ? 6.141   9.070   0.350   1.00 2.00  ? 112 LYS A NZ  1 
ATOM   849  N N   . VAL A 1 113 ? 10.680  13.280  -4.760  1.00 2.00  ? 113 VAL A N   1 
ATOM   850  C CA  . VAL A 1 113 ? 10.660  14.108  -5.951  1.00 2.00  ? 113 VAL A CA  1 
ATOM   851  C C   . VAL A 1 113 ? 11.953  13.816  -6.724  1.00 3.53  ? 113 VAL A C   1 
ATOM   852  O O   . VAL A 1 113 ? 11.943  13.433  -7.887  1.00 3.63  ? 113 VAL A O   1 
ATOM   853  C CB  . VAL A 1 113 ? 10.505  15.544  -5.433  1.00 2.00  ? 113 VAL A CB  1 
ATOM   854  C CG1 . VAL A 1 113 ? 11.058  16.601  -6.345  1.00 2.00  ? 113 VAL A CG1 1 
ATOM   855  C CG2 . VAL A 1 113 ? 9.024   15.775  -5.288  1.00 2.00  ? 113 VAL A CG2 1 
ATOM   856  N N   . ALA A 1 114 ? 13.126  13.830  -6.103  1.00 6.40  ? 114 ALA A N   1 
ATOM   857  C CA  . ALA A 1 114 ? 14.368  13.482  -6.750  1.00 4.79  ? 114 ALA A CA  1 
ATOM   858  C C   . ALA A 1 114 ? 14.345  12.066  -7.310  1.00 7.66  ? 114 ALA A C   1 
ATOM   859  O O   . ALA A 1 114 ? 14.660  11.778  -8.481  1.00 7.73  ? 114 ALA A O   1 
ATOM   860  C CB  . ALA A 1 114 ? 15.451  13.586  -5.750  1.00 4.64  ? 114 ALA A CB  1 
ATOM   861  N N   . HIS A 1 115 ? 13.928  11.131  -6.463  1.00 7.70  ? 115 HIS A N   1 
ATOM   862  C CA  . HIS A 1 115 ? 13.843  9.762   -6.950  1.00 9.94  ? 115 HIS A CA  1 
ATOM   863  C C   . HIS A 1 115 ? 12.739  9.415   -8.004  1.00 8.97  ? 115 HIS A C   1 
ATOM   864  O O   . HIS A 1 115 ? 12.974  8.584   -8.874  1.00 8.91  ? 115 HIS A O   1 
ATOM   865  C CB  . HIS A 1 115 ? 13.739  8.917   -5.702  1.00 10.09 ? 115 HIS A CB  1 
ATOM   866  C CG  . HIS A 1 115 ? 13.742  7.462   -6.073  1.00 12.10 ? 115 HIS A CG  1 
ATOM   867  N ND1 . HIS A 1 115 ? 12.756  6.580   -5.931  1.00 16.20 ? 115 HIS A ND1 1 
ATOM   868  C CD2 . HIS A 1 115 ? 14.793  6.839   -6.659  1.00 11.05 ? 115 HIS A CD2 1 
ATOM   869  C CE1 . HIS A 1 115 ? 13.152  5.439   -6.407  1.00 12.86 ? 115 HIS A CE1 1 
ATOM   870  N NE2 . HIS A 1 115 ? 14.373  5.622   -6.832  1.00 15.08 ? 115 HIS A NE2 1 
ATOM   871  N N   . ALA A 1 116 ? 11.523  9.952   -8.005  1.00 7.28  ? 116 ALA A N   1 
ATOM   872  C CA  . ALA A 1 116 ? 10.507  9.671   -8.990  1.00 4.08  ? 116 ALA A CA  1 
ATOM   873  C C   . ALA A 1 116 ? 10.965  10.258  -10.276 1.00 3.00  ? 116 ALA A C   1 
ATOM   874  O O   . ALA A 1 116 ? 10.793  9.663   -11.343 1.00 6.52  ? 116 ALA A O   1 
ATOM   875  C CB  . ALA A 1 116 ? 9.206   10.337  -8.670  1.00 6.79  ? 116 ALA A CB  1 
ATOM   876  N N   . LEU A 1 117 ? 11.511  11.463  -10.163 1.00 3.80  ? 117 LEU A N   1 
ATOM   877  C CA  . LEU A 1 117 ? 12.146  12.124  -11.299 1.00 4.87  ? 117 LEU A CA  1 
ATOM   878  C C   . LEU A 1 117 ? 13.403  11.329  -11.822 1.00 4.74  ? 117 LEU A C   1 
ATOM   879  O O   . LEU A 1 117 ? 13.496  11.091  -13.022 1.00 2.00  ? 117 LEU A O   1 
ATOM   880  C CB  . LEU A 1 117 ? 12.450  13.544  -10.818 1.00 2.00  ? 117 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 117 ? 11.273  14.476  -10.687 1.00 2.00  ? 117 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 117 ? 11.733  15.769  -10.029 1.00 2.00  ? 117 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 117 ? 10.655  14.704  -12.054 1.00 2.00  ? 117 LEU A CD2 1 
ATOM   884  N N   . ALA A 1 118 ? 14.369  10.817  -11.035 1.00 4.10  ? 118 ALA A N   1 
ATOM   885  C CA  . ALA A 1 118 ? 15.386  9.878   -11.481 1.00 2.00  ? 118 ALA A CA  1 
ATOM   886  C C   . ALA A 1 118 ? 14.801  8.720   -12.306 1.00 2.80  ? 118 ALA A C   1 
ATOM   887  O O   . ALA A 1 118 ? 15.434  8.282   -13.281 1.00 7.29  ? 118 ALA A O   1 
ATOM   888  C CB  . ALA A 1 118 ? 16.111  9.240   -10.311 1.00 2.00  ? 118 ALA A CB  1 
ATOM   889  N N   . GLU A 1 119 ? 13.589  8.204   -12.015 1.00 2.02  ? 119 GLU A N   1 
ATOM   890  C CA  . GLU A 1 119 ? 13.025  7.082   -12.753 1.00 2.00  ? 119 GLU A CA  1 
ATOM   891  C C   . GLU A 1 119 ? 12.244  7.509   -13.965 1.00 2.00  ? 119 GLU A C   1 
ATOM   892  O O   . GLU A 1 119 ? 11.653  6.661   -14.608 1.00 2.15  ? 119 GLU A O   1 
ATOM   893  C CB  . GLU A 1 119 ? 12.101  6.245   -11.929 1.00 2.00  ? 119 GLU A CB  1 
ATOM   894  C CG  . GLU A 1 119 ? 12.814  5.875   -10.682 1.00 8.00  ? 119 GLU A CG  1 
ATOM   895  C CD  . GLU A 1 119 ? 13.228  4.431   -10.614 1.00 11.37 ? 119 GLU A CD  1 
ATOM   896  O OE1 . GLU A 1 119 ? 14.274  4.121   -11.179 1.00 13.04 ? 119 GLU A OE1 1 
ATOM   897  O OE2 . GLU A 1 119 ? 12.513  3.648   -9.967  1.00 16.81 ? 119 GLU A OE2 1 
ATOM   898  N N   . GLY A 1 120 ? 12.168  8.764   -14.342 1.00 2.00  ? 120 GLY A N   1 
ATOM   899  C CA  . GLY A 1 120 ? 11.612  9.066   -15.642 1.00 5.55  ? 120 GLY A CA  1 
ATOM   900  C C   . GLY A 1 120 ? 10.113  9.211   -15.615 1.00 9.70  ? 120 GLY A C   1 
ATOM   901  O O   . GLY A 1 120 ? 9.428   9.140   -16.642 1.00 13.74 ? 120 GLY A O   1 
ATOM   902  N N   . LEU A 1 121 ? 9.611   9.423   -14.409 1.00 9.42  ? 121 LEU A N   1 
ATOM   903  C CA  . LEU A 1 121 ? 8.191   9.604   -14.174 1.00 7.99  ? 121 LEU A CA  1 
ATOM   904  C C   . LEU A 1 121 ? 8.089   11.104  -14.053 1.00 6.94  ? 121 LEU A C   1 
ATOM   905  O O   . LEU A 1 121 ? 9.087   11.732  -13.673 1.00 11.34 ? 121 LEU A O   1 
ATOM   906  C CB  . LEU A 1 121 ? 7.861   8.964   -12.871 1.00 7.60  ? 121 LEU A CB  1 
ATOM   907  C CG  . LEU A 1 121 ? 6.581   8.274   -12.516 1.00 8.04  ? 121 LEU A CG  1 
ATOM   908  C CD1 . LEU A 1 121 ? 6.136   7.169   -13.462 1.00 5.81  ? 121 LEU A CD1 1 
ATOM   909  C CD2 . LEU A 1 121 ? 6.908   7.629   -11.200 1.00 4.83  ? 121 LEU A CD2 1 
ATOM   910  N N   . GLY A 1 122 ? 6.967   11.696  -14.371 1.00 4.03  ? 122 GLY A N   1 
ATOM   911  C CA  . GLY A 1 122 ? 6.776   13.105  -14.102 1.00 4.95  ? 122 GLY A CA  1 
ATOM   912  C C   . GLY A 1 122 ? 6.219   13.298  -12.676 1.00 5.16  ? 122 GLY A C   1 
ATOM   913  O O   . GLY A 1 122 ? 5.796   12.337  -12.014 1.00 8.00  ? 122 GLY A O   1 
ATOM   914  N N   . VAL A 1 123 ? 6.159   14.491  -12.092 1.00 4.29  ? 123 VAL A N   1 
ATOM   915  C CA  . VAL A 1 123 ? 5.696   14.642  -10.723 1.00 3.63  ? 123 VAL A CA  1 
ATOM   916  C C   . VAL A 1 123 ? 4.831   15.912  -10.577 1.00 3.44  ? 123 VAL A C   1 
ATOM   917  O O   . VAL A 1 123 ? 5.200   16.989  -11.028 1.00 2.00  ? 123 VAL A O   1 
ATOM   918  C CB  . VAL A 1 123 ? 6.951   14.652  -9.809  1.00 2.00  ? 123 VAL A CB  1 
ATOM   919  C CG1 . VAL A 1 123 ? 6.529   14.740  -8.375  1.00 6.20  ? 123 VAL A CG1 1 
ATOM   920  C CG2 . VAL A 1 123 ? 7.670   13.326  -9.803  1.00 2.00  ? 123 VAL A CG2 1 
ATOM   921  N N   . ILE A 1 124 ? 3.585   15.798  -10.097 1.00 2.33  ? 124 ILE A N   1 
ATOM   922  C CA  . ILE A 1 124 ? 2.767   16.934  -9.727  1.00 4.26  ? 124 ILE A CA  1 
ATOM   923  C C   . ILE A 1 124 ? 3.145   17.099  -8.235  1.00 6.23  ? 124 ILE A C   1 
ATOM   924  O O   . ILE A 1 124 ? 2.792   16.235  -7.400  1.00 8.10  ? 124 ILE A O   1 
ATOM   925  C CB  . ILE A 1 124 ? 1.269   16.605  -9.833  1.00 4.50  ? 124 ILE A CB  1 
ATOM   926  C CG1 . ILE A 1 124 ? 1.050   16.086  -11.216 1.00 3.25  ? 124 ILE A CG1 1 
ATOM   927  C CG2 . ILE A 1 124 ? 0.371   17.820  -9.468  1.00 2.00  ? 124 ILE A CG2 1 
ATOM   928  C CD1 . ILE A 1 124 ? -0.281  15.323  -11.297 1.00 5.63  ? 124 ILE A CD1 1 
ATOM   929  N N   . ALA A 1 125 ? 3.912   18.131  -7.838  1.00 6.80  ? 125 ALA A N   1 
ATOM   930  C CA  . ALA A 1 125 ? 4.336   18.278  -6.442  1.00 6.01  ? 125 ALA A CA  1 
ATOM   931  C C   . ALA A 1 125 ? 3.458   19.285  -5.748  1.00 4.09  ? 125 ALA A C   1 
ATOM   932  O O   . ALA A 1 125 ? 3.315   20.382  -6.272  1.00 5.76  ? 125 ALA A O   1 
ATOM   933  C CB  . ALA A 1 125 ? 5.744   18.773  -6.348  1.00 3.69  ? 125 ALA A CB  1 
ATOM   934  N N   . CYS A 1 126 ? 2.880   18.956  -4.609  1.00 3.12  ? 126 CYS A N   1 
ATOM   935  C CA  . CYS A 1 126 ? 1.931   19.804  -3.919  1.00 5.17  ? 126 CYS A CA  1 
ATOM   936  C C   . CYS A 1 126 ? 2.414   20.625  -2.717  1.00 4.33  ? 126 CYS A C   1 
ATOM   937  O O   . CYS A 1 126 ? 3.178   20.142  -1.880  1.00 4.34  ? 126 CYS A O   1 
ATOM   938  C CB  . CYS A 1 126 ? 0.798   18.946  -3.450  1.00 5.76  ? 126 CYS A CB  1 
ATOM   939  S SG  . CYS A 1 126 ? 0.133   17.808  -4.669  1.00 2.00  ? 126 CYS A SG  1 
ATOM   940  N N   . ILE A 1 127 ? 1.928   21.860  -2.561  1.00 4.57  ? 127 ILE A N   1 
ATOM   941  C CA  . ILE A 1 127 ? 2.328   22.774  -1.495  1.00 5.95  ? 127 ILE A CA  1 
ATOM   942  C C   . ILE A 1 127 ? 1.103   23.565  -1.051  1.00 3.44  ? 127 ILE A C   1 
ATOM   943  O O   . ILE A 1 127 ? 0.241   23.740  -1.907  1.00 3.36  ? 127 ILE A O   1 
ATOM   944  C CB  . ILE A 1 127 ? 3.504   23.852  -1.929  1.00 8.91  ? 127 ILE A CB  1 
ATOM   945  C CG1 . ILE A 1 127 ? 3.175   24.876  -3.091  1.00 8.41  ? 127 ILE A CG1 1 
ATOM   946  C CG2 . ILE A 1 127 ? 4.704   22.987  -2.337  1.00 11.17 ? 127 ILE A CG2 1 
ATOM   947  C CD1 . ILE A 1 127 ? 3.701   24.567  -4.528  1.00 2.00  ? 127 ILE A CD1 1 
ATOM   948  N N   . GLY A 1 128 ? 0.993   24.068  0.199   1.00 4.16  ? 128 GLY A N   1 
ATOM   949  C CA  . GLY A 1 128 ? -0.105  24.900  0.670   1.00 4.88  ? 128 GLY A CA  1 
ATOM   950  C C   . GLY A 1 128 ? -0.084  25.086  2.197   1.00 9.23  ? 128 GLY A C   1 
ATOM   951  O O   . GLY A 1 128 ? 0.180   24.187  3.024   1.00 12.34 ? 128 GLY A O   1 
ATOM   952  N N   . GLU A 1 129 ? -0.463  26.284  2.636   1.00 11.27 ? 129 GLU A N   1 
ATOM   953  C CA  . GLU A 1 129 ? -0.494  26.666  4.039   1.00 10.66 ? 129 GLU A CA  1 
ATOM   954  C C   . GLU A 1 129 ? -1.891  26.408  4.549   1.00 12.39 ? 129 GLU A C   1 
ATOM   955  O O   . GLU A 1 129 ? -2.887  26.636  3.848   1.00 13.61 ? 129 GLU A O   1 
ATOM   956  C CB  . GLU A 1 129 ? -0.211  28.112  4.229   1.00 12.61 ? 129 GLU A CB  1 
ATOM   957  C CG  . GLU A 1 129 ? -1.238  29.119  3.761   1.00 13.89 ? 129 GLU A CG  1 
ATOM   958  C CD  . GLU A 1 129 ? -1.428  29.348  2.262   1.00 21.37 ? 129 GLU A CD  1 
ATOM   959  O OE1 . GLU A 1 129 ? -0.822  28.692  1.419   1.00 22.92 ? 129 GLU A OE1 1 
ATOM   960  O OE2 . GLU A 1 129 ? -2.214  30.227  1.908   1.00 25.09 ? 129 GLU A OE2 1 
ATOM   961  N N   . LYS A 1 130 ? -1.956  25.850  5.751   1.00 10.81 ? 130 LYS A N   1 
ATOM   962  C CA  . LYS A 1 130 ? -3.209  25.529  6.380   1.00 9.11  ? 130 LYS A CA  1 
ATOM   963  C C   . LYS A 1 130 ? -3.887  26.787  6.913   1.00 9.36  ? 130 LYS A C   1 
ATOM   964  O O   . LYS A 1 130 ? -3.323  27.860  6.747   1.00 7.61  ? 130 LYS A O   1 
ATOM   965  C CB  . LYS A 1 130 ? -2.956  24.561  7.478   1.00 11.15 ? 130 LYS A CB  1 
ATOM   966  C CG  . LYS A 1 130 ? -2.236  23.313  7.038   1.00 10.75 ? 130 LYS A CG  1 
ATOM   967  C CD  . LYS A 1 130 ? -2.164  22.438  8.273   1.00 18.50 ? 130 LYS A CD  1 
ATOM   968  C CE  . LYS A 1 130 ? -1.117  22.847  9.316   1.00 23.60 ? 130 LYS A CE  1 
ATOM   969  N NZ  . LYS A 1 130 ? 0.215   22.556  8.827   1.00 27.65 ? 130 LYS A NZ  1 
ATOM   970  N N   . LEU A 1 131 ? -5.041  26.741  7.584   1.00 10.04 ? 131 LEU A N   1 
ATOM   971  C CA  . LEU A 1 131 ? -5.805  27.952  7.845   1.00 11.20 ? 131 LEU A CA  1 
ATOM   972  C C   . LEU A 1 131 ? -5.057  28.899  8.703   1.00 13.14 ? 131 LEU A C   1 
ATOM   973  O O   . LEU A 1 131 ? -4.911  30.071  8.366   1.00 11.48 ? 131 LEU A O   1 
ATOM   974  C CB  . LEU A 1 131 ? -7.144  27.655  8.544   1.00 11.88 ? 131 LEU A CB  1 
ATOM   975  C CG  . LEU A 1 131 ? -8.151  28.774  8.872   1.00 7.98  ? 131 LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 131 ? -8.660  29.475  7.595   1.00 8.36  ? 131 LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 131 ? -9.280  28.144  9.655   1.00 4.48  ? 131 LEU A CD2 1 
ATOM   978  N N   . ASP A 1 132 ? -4.565  28.281  9.778   1.00 16.73 ? 132 ASP A N   1 
ATOM   979  C CA  . ASP A 1 132 ? -3.782  28.976  10.781  1.00 22.86 ? 132 ASP A CA  1 
ATOM   980  C C   . ASP A 1 132 ? -2.732  29.908  10.141  1.00 23.74 ? 132 ASP A C   1 
ATOM   981  O O   . ASP A 1 132 ? -2.808  31.128  10.252  1.00 26.77 ? 132 ASP A O   1 
ATOM   982  C CB  . ASP A 1 132 ? -3.172  27.875  11.700  1.00 26.87 ? 132 ASP A CB  1 
ATOM   983  C CG  . ASP A 1 132 ? -4.184  27.207  12.691  1.00 33.08 ? 132 ASP A CG  1 
ATOM   984  O OD1 . ASP A 1 132 ? -5.070  27.900  13.226  1.00 32.92 ? 132 ASP A OD1 1 
ATOM   985  O OD2 . ASP A 1 132 ? -4.074  25.991  12.951  1.00 33.27 ? 132 ASP A OD2 1 
ATOM   986  N N   . GLU A 1 133 ? -1.842  29.360  9.317   1.00 23.08 ? 133 GLU A N   1 
ATOM   987  C CA  . GLU A 1 133 ? -0.786  30.036  8.583   1.00 18.26 ? 133 GLU A CA  1 
ATOM   988  C C   . GLU A 1 133 ? -1.270  30.958  7.505   1.00 17.65 ? 133 GLU A C   1 
ATOM   989  O O   . GLU A 1 133 ? -0.451  31.752  7.066   1.00 19.12 ? 133 GLU A O   1 
ATOM   990  C CB  . GLU A 1 133 ? 0.113   29.007  7.949   1.00 19.78 ? 133 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 133 ? 0.632   28.007  8.972   1.00 23.54 ? 133 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 133 ? 1.069   26.671  8.385   1.00 26.47 ? 133 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 133 ? 0.313   26.076  7.627   1.00 28.22 ? 133 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 133 ? 2.172   26.211  8.694   1.00 29.84 ? 133 GLU A OE2 1 
ATOM   995  N N   . ARG A 1 134 ? -2.505  30.887  6.992   1.00 20.10 ? 134 ARG A N   1 
ATOM   996  C CA  . ARG A 1 134 ? -3.042  31.817  5.986   1.00 19.04 ? 134 ARG A CA  1 
ATOM   997  C C   . ARG A 1 134 ? -3.235  33.111  6.712   1.00 21.78 ? 134 ARG A C   1 
ATOM   998  O O   . ARG A 1 134 ? -2.762  34.149  6.243   1.00 23.12 ? 134 ARG A O   1 
ATOM   999  C CB  . ARG A 1 134 ? -4.403  31.441  5.466   1.00 14.76 ? 134 ARG A CB  1 
ATOM   1000 C CG  . ARG A 1 134 ? -4.944  32.474  4.499   1.00 17.04 ? 134 ARG A CG  1 
ATOM   1001 C CD  . ARG A 1 134 ? -4.362  32.221  3.147   1.00 22.02 ? 134 ARG A CD  1 
ATOM   1002 N NE  . ARG A 1 134 ? -4.726  33.182  2.111   1.00 28.58 ? 134 ARG A NE  1 
ATOM   1003 C CZ  . ARG A 1 134 ? -4.489  32.940  0.798   1.00 31.69 ? 134 ARG A CZ  1 
ATOM   1004 N NH1 . ARG A 1 134 ? -3.939  31.792  0.370   1.00 31.35 ? 134 ARG A NH1 1 
ATOM   1005 N NH2 . ARG A 1 134 ? -4.756  33.876  -0.124  1.00 31.51 ? 134 ARG A NH2 1 
ATOM   1006 N N   . GLU A 1 135 ? -3.906  32.900  7.878   1.00 24.47 ? 135 GLU A N   1 
ATOM   1007 C CA  . GLU A 1 135 ? -4.306  33.895  8.855   1.00 26.47 ? 135 GLU A CA  1 
ATOM   1008 C C   . GLU A 1 135 ? -3.106  34.491  9.545   1.00 26.98 ? 135 GLU A C   1 
ATOM   1009 O O   . GLU A 1 135 ? -3.015  35.721  9.520   1.00 30.94 ? 135 GLU A O   1 
ATOM   1010 C CB  . GLU A 1 135 ? -5.205  33.342  9.987   1.00 31.33 ? 135 GLU A CB  1 
ATOM   1011 C CG  . GLU A 1 135 ? -6.577  32.738  9.652   1.00 40.56 ? 135 GLU A CG  1 
ATOM   1012 C CD  . GLU A 1 135 ? -7.505  33.600  8.752   1.00 45.22 ? 135 GLU A CD  1 
ATOM   1013 O OE1 . GLU A 1 135 ? -8.194  34.466  9.308   1.00 49.06 ? 135 GLU A OE1 1 
ATOM   1014 O OE2 . GLU A 1 135 ? -7.551  33.397  7.521   1.00 44.43 ? 135 GLU A OE2 1 
ATOM   1015 N N   . ALA A 1 136 ? -2.141  33.739  10.100  1.00 23.99 ? 136 ALA A N   1 
ATOM   1016 C CA  . ALA A 1 136 ? -0.968  34.293  10.757  1.00 23.33 ? 136 ALA A CA  1 
ATOM   1017 C C   . ALA A 1 136 ? -0.082  35.154  9.859   1.00 23.49 ? 136 ALA A C   1 
ATOM   1018 O O   . ALA A 1 136 ? 0.936   35.674  10.315  1.00 27.03 ? 136 ALA A O   1 
ATOM   1019 C CB  . ALA A 1 136 ? -0.116  33.172  11.318  1.00 23.69 ? 136 ALA A CB  1 
ATOM   1020 N N   . GLY A 1 137 ? -0.403  35.310  8.569   1.00 23.14 ? 137 GLY A N   1 
ATOM   1021 C CA  . GLY A 1 137 ? 0.325   36.135  7.612   1.00 23.02 ? 137 GLY A CA  1 
ATOM   1022 C C   . GLY A 1 137 ? 1.409   35.356  6.881   1.00 23.93 ? 137 GLY A C   1 
ATOM   1023 O O   . GLY A 1 137 ? 1.876   35.781  5.815   1.00 21.59 ? 137 GLY A O   1 
ATOM   1024 N N   . ILE A 1 138 ? 1.702   34.187  7.497   1.00 23.81 ? 138 ILE A N   1 
ATOM   1025 C CA  . ILE A 1 138 ? 2.772   33.237  7.234   1.00 23.37 ? 138 ILE A CA  1 
ATOM   1026 C C   . ILE A 1 138 ? 2.671   32.506  5.890   1.00 25.16 ? 138 ILE A C   1 
ATOM   1027 O O   . ILE A 1 138 ? 3.657   31.831  5.573   1.00 28.07 ? 138 ILE A O   1 
ATOM   1028 C CB  . ILE A 1 138 ? 2.785   32.261  8.500   1.00 22.52 ? 138 ILE A CB  1 
ATOM   1029 C CG1 . ILE A 1 138 ? 3.396   33.033  9.662   1.00 21.05 ? 138 ILE A CG1 1 
ATOM   1030 C CG2 . ILE A 1 138 ? 3.585   30.962  8.312   1.00 23.19 ? 138 ILE A CG2 1 
ATOM   1031 C CD1 . ILE A 1 138 ? 3.661   32.235  10.968  1.00 18.46 ? 138 ILE A CD1 1 
ATOM   1032 N N   . THR A 1 139 ? 1.623   32.606  5.061   1.00 24.67 ? 139 THR A N   1 
ATOM   1033 C CA  . THR A 1 139 ? 1.477   31.875  3.794   1.00 25.76 ? 139 THR A CA  1 
ATOM   1034 C C   . THR A 1 139 ? 2.791   31.605  3.069   1.00 27.34 ? 139 THR A C   1 
ATOM   1035 O O   . THR A 1 139 ? 3.250   30.449  2.973   1.00 28.51 ? 139 THR A O   1 
ATOM   1036 C CB  . THR A 1 139 ? 0.449   32.700  2.970   1.00 24.41 ? 139 THR A CB  1 
ATOM   1037 O OG1 . THR A 1 139 ? -0.720  32.199  3.573   1.00 26.06 ? 139 THR A OG1 1 
ATOM   1038 C CG2 . THR A 1 139 ? 0.339   32.577  1.458   1.00 22.00 ? 139 THR A CG2 1 
ATOM   1039 N N   . GLU A 1 140 ? 3.422   32.761  2.816   1.00 26.14 ? 140 GLU A N   1 
ATOM   1040 C CA  . GLU A 1 140 ? 4.744   32.928  2.249   1.00 25.94 ? 140 GLU A CA  1 
ATOM   1041 C C   . GLU A 1 140 ? 5.791   31.873  2.602   1.00 26.31 ? 140 GLU A C   1 
ATOM   1042 O O   . GLU A 1 140 ? 6.213   31.060  1.788   1.00 23.60 ? 140 GLU A O   1 
ATOM   1043 C CB  . GLU A 1 140 ? 5.218   34.278  2.703   1.00 26.20 ? 140 GLU A CB  1 
ATOM   1044 C CG  . GLU A 1 140 ? 4.484   35.369  1.999   1.00 28.93 ? 140 GLU A CG  1 
ATOM   1045 C CD  . GLU A 1 140 ? 5.248   35.657  0.736   1.00 33.15 ? 140 GLU A CD  1 
ATOM   1046 O OE1 . GLU A 1 140 ? 5.093   34.898  -0.228  1.00 33.45 ? 140 GLU A OE1 1 
ATOM   1047 O OE2 . GLU A 1 140 ? 6.011   36.630  0.730   1.00 37.41 ? 140 GLU A OE2 1 
ATOM   1048 N N   . LYS A 1 141 ? 6.137   31.910  3.893   1.00 27.47 ? 141 LYS A N   1 
ATOM   1049 C CA  . LYS A 1 141 ? 7.097   31.058  4.563   1.00 25.05 ? 141 LYS A CA  1 
ATOM   1050 C C   . LYS A 1 141 ? 6.864   29.635  4.205   1.00 22.76 ? 141 LYS A C   1 
ATOM   1051 O O   . LYS A 1 141 ? 7.729   29.033  3.597   1.00 24.04 ? 141 LYS A O   1 
ATOM   1052 C CB  . LYS A 1 141 ? 6.986   31.085  6.066   1.00 25.67 ? 141 LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 141 ? 7.438   32.346  6.718   1.00 32.13 ? 141 LYS A CG  1 
ATOM   1054 C CD  . LYS A 1 141 ? 8.202   32.033  8.009   1.00 37.52 ? 141 LYS A CD  1 
ATOM   1055 C CE  . LYS A 1 141 ? 7.394   31.342  9.102   1.00 41.19 ? 141 LYS A CE  1 
ATOM   1056 N NZ  . LYS A 1 141 ? 7.485   29.905  8.904   1.00 44.57 ? 141 LYS A NZ  1 
ATOM   1057 N N   . VAL A 1 142 ? 5.650   29.168  4.489   1.00 21.63 ? 142 VAL A N   1 
ATOM   1058 C CA  . VAL A 1 142 ? 5.310   27.759  4.379   1.00 17.69 ? 142 VAL A CA  1 
ATOM   1059 C C   . VAL A 1 142 ? 5.375   27.337  2.940   1.00 14.58 ? 142 VAL A C   1 
ATOM   1060 O O   . VAL A 1 142 ? 5.999   26.355  2.575   1.00 14.65 ? 142 VAL A O   1 
ATOM   1061 C CB  . VAL A 1 142 ? 3.888   27.462  4.905   1.00 16.20 ? 142 VAL A CB  1 
ATOM   1062 C CG1 . VAL A 1 142 ? 3.844   25.981  5.197   1.00 12.76 ? 142 VAL A CG1 1 
ATOM   1063 C CG2 . VAL A 1 142 ? 3.546   28.199  6.188   1.00 16.92 ? 142 VAL A CG2 1 
ATOM   1064 N N   . VAL A 1 143 ? 4.835   28.152  2.083   1.00 14.67 ? 143 VAL A N   1 
ATOM   1065 C CA  . VAL A 1 143 ? 4.756   27.811  0.670   1.00 14.22 ? 143 VAL A CA  1 
ATOM   1066 C C   . VAL A 1 143 ? 6.125   27.806  -0.005  1.00 14.45 ? 143 VAL A C   1 
ATOM   1067 O O   . VAL A 1 143 ? 6.459   26.932  -0.793  1.00 13.47 ? 143 VAL A O   1 
ATOM   1068 C CB  . VAL A 1 143 ? 3.721   28.822  0.176   1.00 10.42 ? 143 VAL A CB  1 
ATOM   1069 C CG1 . VAL A 1 143 ? 3.832   29.081  -1.277  1.00 5.18  ? 143 VAL A CG1 1 
ATOM   1070 C CG2 . VAL A 1 143 ? 2.375   28.282  0.668   1.00 2.00  ? 143 VAL A CG2 1 
ATOM   1071 N N   . PHE A 1 144 ? 6.978   28.712  0.446   1.00 18.07 ? 144 PHE A N   1 
ATOM   1072 C CA  . PHE A 1 144 ? 8.343   28.888  -0.019  1.00 17.56 ? 144 PHE A CA  1 
ATOM   1073 C C   . PHE A 1 144 ? 9.270   27.818  0.461   1.00 15.06 ? 144 PHE A C   1 
ATOM   1074 O O   . PHE A 1 144 ? 10.074  27.314  -0.327  1.00 14.43 ? 144 PHE A O   1 
ATOM   1075 C CB  . PHE A 1 144 ? 8.802   30.271  0.424   1.00 21.51 ? 144 PHE A CB  1 
ATOM   1076 C CG  . PHE A 1 144 ? 8.232   31.360  -0.514  1.00 27.00 ? 144 PHE A CG  1 
ATOM   1077 C CD1 . PHE A 1 144 ? 7.709   31.030  -1.791  1.00 26.56 ? 144 PHE A CD1 1 
ATOM   1078 C CD2 . PHE A 1 144 ? 8.263   32.704  -0.106  1.00 26.94 ? 144 PHE A CD2 1 
ATOM   1079 C CE1 . PHE A 1 144 ? 7.222   32.031  -2.639  1.00 28.45 ? 144 PHE A CE1 1 
ATOM   1080 C CE2 . PHE A 1 144 ? 7.779   33.694  -0.969  1.00 29.21 ? 144 PHE A CE2 1 
ATOM   1081 C CZ  . PHE A 1 144 ? 7.258   33.366  -2.230  1.00 30.76 ? 144 PHE A CZ  1 
ATOM   1082 N N   . GLU A 1 145 ? 9.074   27.448  1.720   1.00 13.62 ? 145 GLU A N   1 
ATOM   1083 C CA  . GLU A 1 145 ? 9.753   26.336  2.381   1.00 14.94 ? 145 GLU A CA  1 
ATOM   1084 C C   . GLU A 1 145 ? 9.555   25.045  1.637   1.00 12.74 ? 145 GLU A C   1 
ATOM   1085 O O   . GLU A 1 145 ? 10.479  24.283  1.346   1.00 15.23 ? 145 GLU A O   1 
ATOM   1086 C CB  . GLU A 1 145 ? 9.238   26.022  3.768   1.00 19.02 ? 145 GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 145 ? 10.207  26.310  4.886   1.00 27.87 ? 145 GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 145 ? 9.669   27.440  5.739   1.00 34.93 ? 145 GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 145 ? 8.672   27.216  6.458   1.00 35.98 ? 145 GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 145 ? 10.253  28.533  5.637   1.00 37.69 ? 145 GLU A OE2 1 
ATOM   1091 N N   . GLN A 1 146 ? 8.281   24.845  1.415   1.00 7.65  ? 146 GLN A N   1 
ATOM   1092 C CA  . GLN A 1 146 ? 7.821   23.724  0.724   1.00 7.15  ? 146 GLN A CA  1 
ATOM   1093 C C   . GLN A 1 146 ? 8.332   23.750  -0.699  1.00 9.22  ? 146 GLN A C   1 
ATOM   1094 O O   . GLN A 1 146 ? 8.933   22.750  -1.079  1.00 11.63 ? 146 GLN A O   1 
ATOM   1095 C CB  . GLN A 1 146 ? 6.327   23.772  0.824   1.00 8.36  ? 146 GLN A CB  1 
ATOM   1096 C CG  . GLN A 1 146 ? 5.963   23.266  2.188   1.00 8.74  ? 146 GLN A CG  1 
ATOM   1097 C CD  . GLN A 1 146 ? 4.493   23.393  2.535   1.00 9.19  ? 146 GLN A CD  1 
ATOM   1098 O OE1 . GLN A 1 146 ? 3.648   23.854  1.760   1.00 10.83 ? 146 GLN A OE1 1 
ATOM   1099 N NE2 . GLN A 1 146 ? 4.166   22.973  3.753   1.00 6.65  ? 146 GLN A NE2 1 
ATOM   1100 N N   . THR A 1 147 ? 8.187   24.786  -1.525  1.00 8.47  ? 147 THR A N   1 
ATOM   1101 C CA  . THR A 1 147 ? 8.665   24.697  -2.891  1.00 9.36  ? 147 THR A CA  1 
ATOM   1102 C C   . THR A 1 147 ? 10.156  24.414  -2.857  1.00 14.25 ? 147 THR A C   1 
ATOM   1103 O O   . THR A 1 147 ? 10.609  23.495  -3.540  1.00 15.94 ? 147 THR A O   1 
ATOM   1104 C CB  . THR A 1 147 ? 8.471   26.001  -3.678  1.00 7.05  ? 147 THR A CB  1 
ATOM   1105 O OG1 . THR A 1 147 ? 7.169   26.424  -3.326  1.00 5.14  ? 147 THR A OG1 1 
ATOM   1106 C CG2 . THR A 1 147 ? 8.621   25.880  -5.196  1.00 2.00  ? 147 THR A CG2 1 
ATOM   1107 N N   . LYS A 1 148 ? 10.882  25.145  -1.987  1.00 17.36 ? 148 LYS A N   1 
ATOM   1108 C CA  . LYS A 1 148 ? 12.339  25.100  -1.801  1.00 15.88 ? 148 LYS A CA  1 
ATOM   1109 C C   . LYS A 1 148 ? 12.870  23.681  -1.861  1.00 14.35 ? 148 LYS A C   1 
ATOM   1110 O O   . LYS A 1 148 ? 13.603  23.307  -2.751  1.00 12.43 ? 148 LYS A O   1 
ATOM   1111 C CB  . LYS A 1 148 ? 12.662  25.699  -0.457  1.00 16.02 ? 148 LYS A CB  1 
ATOM   1112 C CG  . LYS A 1 148 ? 14.111  25.776  -0.242  1.00 18.60 ? 148 LYS A CG  1 
ATOM   1113 C CD  . LYS A 1 148 ? 14.380  25.885  1.243   1.00 19.74 ? 148 LYS A CD  1 
ATOM   1114 C CE  . LYS A 1 148 ? 15.904  26.063  1.486   1.00 20.23 ? 148 LYS A CE  1 
ATOM   1115 N NZ  . LYS A 1 148 ? 16.683  24.910  1.024   1.00 19.47 ? 148 LYS A NZ  1 
ATOM   1116 N N   . VAL A 1 149 ? 12.369  22.837  -0.986  1.00 13.12 ? 149 VAL A N   1 
ATOM   1117 C CA  . VAL A 1 149 ? 12.797  21.478  -0.849  1.00 11.66 ? 149 VAL A CA  1 
ATOM   1118 C C   . VAL A 1 149 ? 12.399  20.598  -2.000  1.00 11.24 ? 149 VAL A C   1 
ATOM   1119 O O   . VAL A 1 149 ? 13.042  19.560  -2.196  1.00 9.43  ? 149 VAL A O   1 
ATOM   1120 C CB  . VAL A 1 149 ? 12.226  21.018  0.461   1.00 15.93 ? 149 VAL A CB  1 
ATOM   1121 C CG1 . VAL A 1 149 ? 12.674  19.598  0.785   1.00 17.77 ? 149 VAL A CG1 1 
ATOM   1122 C CG2 . VAL A 1 149 ? 12.717  21.998  1.562   1.00 20.94 ? 149 VAL A CG2 1 
ATOM   1123 N N   . ILE A 1 150 ? 11.360  20.966  -2.757  1.00 11.25 ? 150 ILE A N   1 
ATOM   1124 C CA  . ILE A 1 150 ? 11.023  20.264  -4.001  1.00 12.92 ? 150 ILE A CA  1 
ATOM   1125 C C   . ILE A 1 150 ? 12.087  20.708  -4.963  1.00 13.19 ? 150 ILE A C   1 
ATOM   1126 O O   . ILE A 1 150 ? 12.719  19.854  -5.578  1.00 14.38 ? 150 ILE A O   1 
ATOM   1127 C CB  . ILE A 1 150 ? 9.595   20.613  -4.649  1.00 12.76 ? 150 ILE A CB  1 
ATOM   1128 C CG1 . ILE A 1 150 ? 8.447   19.800  -3.999  1.00 12.93 ? 150 ILE A CG1 1 
ATOM   1129 C CG2 . ILE A 1 150 ? 9.536   20.179  -6.104  1.00 4.83  ? 150 ILE A CG2 1 
ATOM   1130 C CD1 . ILE A 1 150 ? 8.357   19.659  -2.446  1.00 14.92 ? 150 ILE A CD1 1 
ATOM   1131 N N   . ALA A 1 151 ? 12.371  22.007  -4.991  1.00 14.94 ? 151 ALA A N   1 
ATOM   1132 C CA  . ALA A 1 151 ? 13.346  22.585  -5.901  1.00 15.59 ? 151 ALA A CA  1 
ATOM   1133 C C   . ALA A 1 151 ? 14.746  22.023  -5.628  1.00 14.73 ? 151 ALA A C   1 
ATOM   1134 O O   . ALA A 1 151 ? 15.398  21.568  -6.568  1.00 15.20 ? 151 ALA A O   1 
ATOM   1135 C CB  . ALA A 1 151 ? 13.281  24.102  -5.749  1.00 11.62 ? 151 ALA A CB  1 
ATOM   1136 N N   . ASP A 1 152 ? 15.198  21.863  -4.385  1.00 14.62 ? 152 ASP A N   1 
ATOM   1137 C CA  . ASP A 1 152 ? 16.439  21.182  -4.062  1.00 14.52 ? 152 ASP A CA  1 
ATOM   1138 C C   . ASP A 1 152 ? 16.475  19.745  -4.544  1.00 13.86 ? 152 ASP A C   1 
ATOM   1139 O O   . ASP A 1 152 ? 17.460  19.066  -4.245  1.00 17.10 ? 152 ASP A O   1 
ATOM   1140 C CB  . ASP A 1 152 ? 16.704  21.060  -2.586  1.00 16.34 ? 152 ASP A CB  1 
ATOM   1141 C CG  . ASP A 1 152 ? 17.063  22.311  -1.822  1.00 21.09 ? 152 ASP A CG  1 
ATOM   1142 O OD1 . ASP A 1 152 ? 17.884  23.117  -2.291  1.00 15.55 ? 152 ASP A OD1 1 
ATOM   1143 O OD2 . ASP A 1 152 ? 16.503  22.434  -0.722  1.00 25.84 ? 152 ASP A OD2 1 
ATOM   1144 N N   . ASN A 1 153 ? 15.428  19.201  -5.182  1.00 11.60 ? 153 ASN A N   1 
ATOM   1145 C CA  . ASN A 1 153 ? 15.442  17.845  -5.711  1.00 6.59  ? 153 ASN A CA  1 
ATOM   1146 C C   . ASN A 1 153 ? 15.040  17.765  -7.139  1.00 6.73  ? 153 ASN A C   1 
ATOM   1147 O O   . ASN A 1 153 ? 14.762  16.688  -7.622  1.00 6.67  ? 153 ASN A O   1 
ATOM   1148 C CB  . ASN A 1 153 ? 14.526  17.000  -4.941  1.00 2.15  ? 153 ASN A CB  1 
ATOM   1149 C CG  . ASN A 1 153 ? 15.249  16.815  -3.667  1.00 3.56  ? 153 ASN A CG  1 
ATOM   1150 O OD1 . ASN A 1 153 ? 16.263  16.131  -3.602  1.00 5.46  ? 153 ASN A OD1 1 
ATOM   1151 N ND2 . ASN A 1 153 ? 14.788  17.490  -2.629  1.00 6.78  ? 153 ASN A ND2 1 
ATOM   1152 N N   . VAL A 1 154 ? 14.970  18.833  -7.914  1.00 9.70  ? 154 VAL A N   1 
ATOM   1153 C CA  . VAL A 1 154 ? 14.466  18.719  -9.278  1.00 10.46 ? 154 VAL A CA  1 
ATOM   1154 C C   . VAL A 1 154 ? 15.665  19.032  -10.152 1.00 12.78 ? 154 VAL A C   1 
ATOM   1155 O O   . VAL A 1 154 ? 16.295  20.071  -10.037 1.00 10.93 ? 154 VAL A O   1 
ATOM   1156 C CB  . VAL A 1 154 ? 13.293  19.751  -9.539  1.00 8.02  ? 154 VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 154 ? 12.562  19.469  -10.848 1.00 2.00  ? 154 VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 154 ? 12.308  19.679  -8.422  1.00 2.00  ? 154 VAL A CG2 1 
ATOM   1159 N N   . LYS A 1 155 ? 16.029  18.123  -11.037 1.00 18.28 ? 155 LYS A N   1 
ATOM   1160 C CA  . LYS A 1 155 ? 17.160  18.396  -11.911 1.00 21.78 ? 155 LYS A CA  1 
ATOM   1161 C C   . LYS A 1 155 ? 16.524  18.939  -13.155 1.00 20.47 ? 155 LYS A C   1 
ATOM   1162 O O   . LYS A 1 155 ? 16.914  19.999  -13.601 1.00 21.02 ? 155 LYS A O   1 
ATOM   1163 C CB  . LYS A 1 155 ? 17.932  17.102  -12.183 1.00 27.35 ? 155 LYS A CB  1 
ATOM   1164 C CG  . LYS A 1 155 ? 18.300  16.281  -10.908 1.00 28.93 ? 155 LYS A CG  1 
ATOM   1165 C CD  . LYS A 1 155 ? 19.273  16.990  -9.979  1.00 32.32 ? 155 LYS A CD  1 
ATOM   1166 C CE  . LYS A 1 155 ? 20.691  17.185  -10.558 1.00 33.43 ? 155 LYS A CE  1 
ATOM   1167 N NZ  . LYS A 1 155 ? 21.417  15.926  -10.584 1.00 34.23 ? 155 LYS A NZ  1 
ATOM   1168 N N   . ASP A 1 156 ? 15.521  18.252  -13.699 1.00 21.09 ? 156 ASP A N   1 
ATOM   1169 C CA  . ASP A 1 156 ? 14.759  18.769  -14.828 1.00 22.26 ? 156 ASP A CA  1 
ATOM   1170 C C   . ASP A 1 156 ? 13.248  19.016  -14.585 1.00 21.40 ? 156 ASP A C   1 
ATOM   1171 O O   . ASP A 1 156 ? 12.303  18.196  -14.631 1.00 17.17 ? 156 ASP A O   1 
ATOM   1172 C CB  . ASP A 1 156 ? 14.944  17.825  -16.024 1.00 27.17 ? 156 ASP A CB  1 
ATOM   1173 C CG  . ASP A 1 156 ? 14.194  18.190  -17.324 1.00 31.41 ? 156 ASP A CG  1 
ATOM   1174 O OD1 . ASP A 1 156 ? 14.075  19.368  -17.694 1.00 33.47 ? 156 ASP A OD1 1 
ATOM   1175 O OD2 . ASP A 1 156 ? 13.728  17.257  -17.980 1.00 35.29 ? 156 ASP A OD2 1 
ATOM   1176 N N   . TRP A 1 157 ? 13.104  20.325  -14.455 1.00 21.45 ? 157 TRP A N   1 
ATOM   1177 C CA  . TRP A 1 157 ? 11.856  21.009  -14.272 1.00 21.39 ? 157 TRP A CA  1 
ATOM   1178 C C   . TRP A 1 157 ? 10.909  20.887  -15.452 1.00 21.23 ? 157 TRP A C   1 
ATOM   1179 O O   . TRP A 1 157 ? 9.924   21.602  -15.507 1.00 23.40 ? 157 TRP A O   1 
ATOM   1180 C CB  . TRP A 1 157 ? 12.147  22.468  -13.975 1.00 20.68 ? 157 TRP A CB  1 
ATOM   1181 C CG  . TRP A 1 157 ? 12.666  22.683  -12.551 1.00 24.72 ? 157 TRP A CG  1 
ATOM   1182 C CD1 . TRP A 1 157 ? 14.017  22.681  -12.282 1.00 26.78 ? 157 TRP A CD1 1 
ATOM   1183 C CD2 . TRP A 1 157 ? 11.910  22.933  -11.410 1.00 25.91 ? 157 TRP A CD2 1 
ATOM   1184 N NE1 . TRP A 1 157 ? 14.135  22.941  -10.987 1.00 30.65 ? 157 TRP A NE1 1 
ATOM   1185 C CE2 . TRP A 1 157 ? 12.917  23.101  -10.430 1.00 26.85 ? 157 TRP A CE2 1 
ATOM   1186 C CE3 . TRP A 1 157 ? 10.559  23.038  -11.049 1.00 23.69 ? 157 TRP A CE3 1 
ATOM   1187 C CZ2 . TRP A 1 157 ? 12.601  23.374  -9.105  1.00 21.07 ? 157 TRP A CZ2 1 
ATOM   1188 C CZ3 . TRP A 1 157 ? 10.239  23.299  -9.721  1.00 22.14 ? 157 TRP A CZ3 1 
ATOM   1189 C CH2 . TRP A 1 157 ? 11.250  23.462  -8.764  1.00 23.91 ? 157 TRP A CH2 1 
ATOM   1190 N N   . SER A 1 158 ? 11.123  20.041  -16.453 1.00 20.83 ? 158 SER A N   1 
ATOM   1191 C CA  . SER A 1 158 ? 10.105  19.868  -17.472 1.00 19.58 ? 158 SER A CA  1 
ATOM   1192 C C   . SER A 1 158 ? 9.145   18.743  -17.071 1.00 18.19 ? 158 SER A C   1 
ATOM   1193 O O   . SER A 1 158 ? 8.051   18.547  -17.610 1.00 19.16 ? 158 SER A O   1 
ATOM   1194 C CB  . SER A 1 158 ? 10.819  19.576  -18.823 1.00 18.80 ? 158 SER A CB  1 
ATOM   1195 O OG  . SER A 1 158 ? 11.616  18.406  -18.944 1.00 16.48 ? 158 SER A OG  1 
ATOM   1196 N N   . LYS A 1 159 ? 9.651   17.966  -16.116 1.00 17.86 ? 159 LYS A N   1 
ATOM   1197 C CA  . LYS A 1 159 ? 9.082   16.735  -15.618 1.00 16.34 ? 159 LYS A CA  1 
ATOM   1198 C C   . LYS A 1 159 ? 8.214   16.977  -14.388 1.00 13.26 ? 159 LYS A C   1 
ATOM   1199 O O   . LYS A 1 159 ? 7.798   16.043  -13.715 1.00 11.10 ? 159 LYS A O   1 
ATOM   1200 C CB  . LYS A 1 159 ? 10.289  15.835  -15.316 1.00 21.20 ? 159 LYS A CB  1 
ATOM   1201 C CG  . LYS A 1 159 ? 11.158  15.452  -16.520 1.00 28.05 ? 159 LYS A CG  1 
ATOM   1202 C CD  . LYS A 1 159 ? 10.378  14.597  -17.577 1.00 33.00 ? 159 LYS A CD  1 
ATOM   1203 C CE  . LYS A 1 159 ? 11.083  13.278  -18.059 1.00 35.15 ? 159 LYS A CE  1 
ATOM   1204 N NZ  . LYS A 1 159 ? 11.497  12.370  -16.988 1.00 34.71 ? 159 LYS A NZ  1 
ATOM   1205 N N   . VAL A 1 160 ? 7.961   18.228  -14.050 1.00 9.42  ? 160 VAL A N   1 
ATOM   1206 C CA  . VAL A 1 160 ? 7.264   18.578  -12.852 1.00 7.58  ? 160 VAL A CA  1 
ATOM   1207 C C   . VAL A 1 160 ? 6.273   19.703  -13.151 1.00 8.45  ? 160 VAL A C   1 
ATOM   1208 O O   . VAL A 1 160 ? 6.452   20.474  -14.103 1.00 6.96  ? 160 VAL A O   1 
ATOM   1209 C CB  . VAL A 1 160 ? 8.346   18.973  -11.793 1.00 7.77  ? 160 VAL A CB  1 
ATOM   1210 C CG1 . VAL A 1 160 ? 8.998   20.184  -12.350 1.00 7.66  ? 160 VAL A CG1 1 
ATOM   1211 C CG2 . VAL A 1 160 ? 7.810   19.282  -10.361 1.00 4.57  ? 160 VAL A CG2 1 
ATOM   1212 N N   . VAL A 1 161 ? 5.178   19.691  -12.378 1.00 7.10  ? 161 VAL A N   1 
ATOM   1213 C CA  . VAL A 1 161 ? 4.201   20.749  -12.343 1.00 3.94  ? 161 VAL A CA  1 
ATOM   1214 C C   . VAL A 1 161 ? 3.977   20.824  -10.831 1.00 3.38  ? 161 VAL A C   1 
ATOM   1215 O O   . VAL A 1 161 ? 4.177   19.870  -10.076 1.00 2.00  ? 161 VAL A O   1 
ATOM   1216 C CB  . VAL A 1 161 ? 2.911   20.400  -13.177 1.00 2.00  ? 161 VAL A CB  1 
ATOM   1217 C CG1 . VAL A 1 161 ? 3.125   19.312  -14.198 1.00 2.00  ? 161 VAL A CG1 1 
ATOM   1218 C CG2 . VAL A 1 161 ? 1.854   19.949  -12.273 1.00 5.71  ? 161 VAL A CG2 1 
ATOM   1219 N N   . LEU A 1 162 ? 3.763   22.074  -10.427 1.00 6.93  ? 162 LEU A N   1 
ATOM   1220 C CA  . LEU A 1 162 ? 3.576   22.584  -9.069  1.00 5.61  ? 162 LEU A CA  1 
ATOM   1221 C C   . LEU A 1 162 ? 2.081   22.812  -8.886  1.00 6.99  ? 162 LEU A C   1 
ATOM   1222 O O   . LEU A 1 162 ? 1.421   23.307  -9.803  1.00 6.60  ? 162 LEU A O   1 
ATOM   1223 C CB  . LEU A 1 162 ? 4.268   23.924  -8.878  1.00 4.88  ? 162 LEU A CB  1 
ATOM   1224 C CG  . LEU A 1 162 ? 5.734   23.997  -8.460  1.00 11.14 ? 162 LEU A CG  1 
ATOM   1225 C CD1 . LEU A 1 162 ? 6.056   25.439  -8.107  1.00 13.00 ? 162 LEU A CD1 1 
ATOM   1226 C CD2 . LEU A 1 162 ? 6.001   23.255  -7.117  1.00 14.92 ? 162 LEU A CD2 1 
ATOM   1227 N N   . ALA A 1 163 ? 1.520   22.481  -7.729  1.00 5.94  ? 163 ALA A N   1 
ATOM   1228 C CA  . ALA A 1 163 ? 0.101   22.543  -7.504  1.00 2.62  ? 163 ALA A CA  1 
ATOM   1229 C C   . ALA A 1 163 ? -0.126  23.188  -6.169  1.00 3.12  ? 163 ALA A C   1 
ATOM   1230 O O   . ALA A 1 163 ? 0.343   22.769  -5.100  1.00 2.00  ? 163 ALA A O   1 
ATOM   1231 C CB  . ALA A 1 163 ? -0.534  21.127  -7.481  1.00 3.17  ? 163 ALA A CB  1 
ATOM   1232 N N   . TYR A 1 164 ? -0.846  24.273  -6.274  1.00 3.37  ? 164 TYR A N   1 
ATOM   1233 C CA  . TYR A 1 164 ? -1.171  24.960  -5.055  1.00 5.57  ? 164 TYR A CA  1 
ATOM   1234 C C   . TYR A 1 164 ? -2.516  24.445  -4.513  1.00 7.65  ? 164 TYR A C   1 
ATOM   1235 O O   . TYR A 1 164 ? -3.633  24.648  -5.048  1.00 7.42  ? 164 TYR A O   1 
ATOM   1236 C CB  . TYR A 1 164 ? -1.212  26.522  -5.293  1.00 5.26  ? 164 TYR A CB  1 
ATOM   1237 C CG  . TYR A 1 164 ? -1.636  27.244  -3.997  1.00 9.37  ? 164 TYR A CG  1 
ATOM   1238 C CD1 . TYR A 1 164 ? -0.913  27.050  -2.793  1.00 12.58 ? 164 TYR A CD1 1 
ATOM   1239 C CD2 . TYR A 1 164 ? -2.801  28.026  -3.991  1.00 10.29 ? 164 TYR A CD2 1 
ATOM   1240 C CE1 . TYR A 1 164 ? -1.344  27.600  -1.588  1.00 13.47 ? 164 TYR A CE1 1 
ATOM   1241 C CE2 . TYR A 1 164 ? -3.237  28.586  -2.805  1.00 14.20 ? 164 TYR A CE2 1 
ATOM   1242 C CZ  . TYR A 1 164 ? -2.509  28.367  -1.613  1.00 17.75 ? 164 TYR A CZ  1 
ATOM   1243 O OH  . TYR A 1 164 ? -3.002  28.915  -0.437  1.00 18.40 ? 164 TYR A OH  1 
ATOM   1244 N N   . GLU A 1 165 ? -2.386  23.768  -3.397  1.00 5.71  ? 165 GLU A N   1 
ATOM   1245 C CA  . GLU A 1 165 ? -3.578  23.402  -2.686  1.00 6.39  ? 165 GLU A CA  1 
ATOM   1246 C C   . GLU A 1 165 ? -3.878  24.510  -1.683  1.00 5.73  ? 165 GLU A C   1 
ATOM   1247 O O   . GLU A 1 165 ? -3.078  24.647  -0.746  1.00 5.67  ? 165 GLU A O   1 
ATOM   1248 C CB  . GLU A 1 165 ? -3.375  22.113  -1.926  1.00 7.34  ? 165 GLU A CB  1 
ATOM   1249 C CG  . GLU A 1 165 ? -2.999  20.972  -2.803  1.00 8.05  ? 165 GLU A CG  1 
ATOM   1250 C CD  . GLU A 1 165 ? -2.864  19.713  -1.978  1.00 12.19 ? 165 GLU A CD  1 
ATOM   1251 O OE1 . GLU A 1 165 ? -1.936  19.547  -1.161  1.00 8.61  ? 165 GLU A OE1 1 
ATOM   1252 O OE2 . GLU A 1 165 ? -3.743  18.888  -2.198  1.00 21.04 ? 165 GLU A OE2 1 
ATOM   1253 N N   . PRO A 1 166 ? -4.944  25.341  -1.724  1.00 6.53  ? 166 PRO A N   1 
ATOM   1254 C CA  . PRO A 1 166 ? -5.275  26.261  -0.652  1.00 4.14  ? 166 PRO A CA  1 
ATOM   1255 C C   . PRO A 1 166 ? -5.906  25.431  0.418   1.00 5.91  ? 166 PRO A C   1 
ATOM   1256 O O   . PRO A 1 166 ? -7.119  25.440  0.655   1.00 6.86  ? 166 PRO A O   1 
ATOM   1257 C CB  . PRO A 1 166 ? -6.189  27.248  -1.260  1.00 2.00  ? 166 PRO A CB  1 
ATOM   1258 C CG  . PRO A 1 166 ? -6.879  26.439  -2.276  1.00 2.00  ? 166 PRO A CG  1 
ATOM   1259 C CD  . PRO A 1 166 ? -5.759  25.646  -2.879  1.00 4.17  ? 166 PRO A CD  1 
ATOM   1260 N N   . VAL A 1 167 ? -4.991  24.751  1.109   1.00 4.75  ? 167 VAL A N   1 
ATOM   1261 C CA  . VAL A 1 167 ? -5.341  23.882  2.219   1.00 5.81  ? 167 VAL A CA  1 
ATOM   1262 C C   . VAL A 1 167 ? -6.110  24.661  3.320   1.00 8.01  ? 167 VAL A C   1 
ATOM   1263 O O   . VAL A 1 167 ? -6.896  24.072  4.061   1.00 8.76  ? 167 VAL A O   1 
ATOM   1264 C CB  . VAL A 1 167 ? -4.043  23.306  2.789   1.00 3.96  ? 167 VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 167 ? -4.402  22.255  3.805   1.00 2.00  ? 167 VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 167 ? -3.151  22.786  1.697   1.00 2.92  ? 167 VAL A CG2 1 
ATOM   1267 N N   . TRP A 1 168 ? -5.848  25.981  3.493   1.00 8.19  ? 168 TRP A N   1 
ATOM   1268 C CA  . TRP A 1 168 ? -6.552  26.815  4.453   1.00 9.59  ? 168 TRP A CA  1 
ATOM   1269 C C   . TRP A 1 168 ? -8.037  26.945  4.161   1.00 14.46 ? 168 TRP A C   1 
ATOM   1270 O O   . TRP A 1 168 ? -8.832  27.293  5.011   1.00 15.67 ? 168 TRP A O   1 
ATOM   1271 C CB  . TRP A 1 168 ? -5.961  28.199  4.468   1.00 6.90  ? 168 TRP A CB  1 
ATOM   1272 C CG  . TRP A 1 168 ? -6.031  28.970  3.175   1.00 4.37  ? 168 TRP A CG  1 
ATOM   1273 C CD1 . TRP A 1 168 ? -5.025  28.910  2.273   1.00 6.29  ? 168 TRP A CD1 1 
ATOM   1274 C CD2 . TRP A 1 168 ? -7.072  29.736  2.744   1.00 8.13  ? 168 TRP A CD2 1 
ATOM   1275 N NE1 . TRP A 1 168 ? -5.409  29.617  1.246   1.00 8.63  ? 168 TRP A NE1 1 
ATOM   1276 C CE2 . TRP A 1 168 ? -6.625  30.134  1.465   1.00 6.43  ? 168 TRP A CE2 1 
ATOM   1277 C CE3 . TRP A 1 168 ? -8.318  30.153  3.241   1.00 8.19  ? 168 TRP A CE3 1 
ATOM   1278 C CZ2 . TRP A 1 168 ? -7.401  30.941  0.641   1.00 2.00  ? 168 TRP A CZ2 1 
ATOM   1279 C CZ3 . TRP A 1 168 ? -9.081  30.971  2.413   1.00 8.89  ? 168 TRP A CZ3 1 
ATOM   1280 C CH2 . TRP A 1 168 ? -8.629  31.349  1.130   1.00 4.28  ? 168 TRP A CH2 1 
ATOM   1281 N N   . ALA A 1 169 ? -8.384  26.862  2.881   1.00 16.68 ? 169 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 169 ? -9.749  26.972  2.433   1.00 12.55 ? 169 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 169 ? -10.364 25.599  2.444   1.00 11.51 ? 169 ALA A C   1 
ATOM   1284 O O   . ALA A 1 169 ? -11.523 25.548  2.836   1.00 14.95 ? 169 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 169 ? -9.821  27.541  1.009   1.00 5.26  ? 169 ALA A CB  1 
ATOM   1286 N N   . ILE A 1 170 ? -9.757  24.456  2.086   1.00 11.73 ? 170 ILE A N   1 
ATOM   1287 C CA  . ILE A 1 170 ? -10.586 23.247  2.129   1.00 13.00 ? 170 ILE A CA  1 
ATOM   1288 C C   . ILE A 1 170 ? -10.865 22.828  3.584   1.00 16.42 ? 170 ILE A C   1 
ATOM   1289 O O   . ILE A 1 170 ? -10.115 23.134  4.502   1.00 17.58 ? 170 ILE A O   1 
ATOM   1290 C CB  . ILE A 1 170 ? -9.995  22.043  1.258   1.00 11.02 ? 170 ILE A CB  1 
ATOM   1291 C CG1 . ILE A 1 170 ? -9.748  20.787  2.105   1.00 7.42  ? 170 ILE A CG1 1 
ATOM   1292 C CG2 . ILE A 1 170 ? -8.792  22.555  0.462   1.00 11.21 ? 170 ILE A CG2 1 
ATOM   1293 C CD1 . ILE A 1 170 ? -10.034 19.512  1.256   1.00 8.19  ? 170 ILE A CD1 1 
ATOM   1294 N N   . GLY A 1 171 ? -11.993 22.125  3.788   1.00 20.44 ? 171 GLY A N   1 
ATOM   1295 C CA  . GLY A 1 171 ? -12.729 21.841  5.028   1.00 18.97 ? 171 GLY A CA  1 
ATOM   1296 C C   . GLY A 1 171 ? -13.048 22.988  5.958   1.00 17.40 ? 171 GLY A C   1 
ATOM   1297 O O   . GLY A 1 171 ? -14.102 22.987  6.594   1.00 20.27 ? 171 GLY A O   1 
ATOM   1298 N N   . THR A 1 172 ? -12.220 24.015  6.045   1.00 17.10 ? 172 THR A N   1 
ATOM   1299 C CA  . THR A 1 172 ? -12.239 25.084  7.044   1.00 16.62 ? 172 THR A CA  1 
ATOM   1300 C C   . THR A 1 172 ? -13.429 25.992  7.284   1.00 14.87 ? 172 THR A C   1 
ATOM   1301 O O   . THR A 1 172 ? -13.670 26.413  8.417   1.00 17.11 ? 172 THR A O   1 
ATOM   1302 C CB  . THR A 1 172 ? -11.062 25.960  6.771   1.00 15.80 ? 172 THR A CB  1 
ATOM   1303 O OG1 . THR A 1 172 ? -11.298 26.434  5.443   1.00 18.32 ? 172 THR A OG1 1 
ATOM   1304 C CG2 . THR A 1 172 ? -9.750  25.273  6.875   1.00 15.79 ? 172 THR A CG2 1 
ATOM   1305 N N   . GLY A 1 173 ? -14.052 26.457  6.217   1.00 11.11 ? 173 GLY A N   1 
ATOM   1306 C CA  . GLY A 1 173 ? -15.083 27.444  6.419   1.00 10.82 ? 173 GLY A CA  1 
ATOM   1307 C C   . GLY A 1 173 ? -14.771 28.740  5.691   1.00 10.04 ? 173 GLY A C   1 
ATOM   1308 O O   . GLY A 1 173 ? -15.639 29.604  5.500   1.00 6.67  ? 173 GLY A O   1 
ATOM   1309 N N   . LYS A 1 174 ? -13.509 28.866  5.295   1.00 11.65 ? 174 LYS A N   1 
ATOM   1310 C CA  . LYS A 1 174 ? -13.083 30.026  4.559   1.00 13.80 ? 174 LYS A CA  1 
ATOM   1311 C C   . LYS A 1 174 ? -13.090 29.649  3.083   1.00 14.47 ? 174 LYS A C   1 
ATOM   1312 O O   . LYS A 1 174 ? -13.283 28.483  2.730   1.00 13.66 ? 174 LYS A O   1 
ATOM   1313 C CB  . LYS A 1 174 ? -11.708 30.439  5.090   1.00 16.95 ? 174 LYS A CB  1 
ATOM   1314 C CG  . LYS A 1 174 ? -11.709 31.426  6.304   1.00 20.70 ? 174 LYS A CG  1 
ATOM   1315 C CD  . LYS A 1 174 ? -12.149 31.004  7.750   1.00 24.09 ? 174 LYS A CD  1 
ATOM   1316 C CE  . LYS A 1 174 ? -11.871 32.229  8.692   1.00 30.18 ? 174 LYS A CE  1 
ATOM   1317 N NZ  . LYS A 1 174 ? -12.212 32.142  10.123  1.00 30.51 ? 174 LYS A NZ  1 
ATOM   1318 N N   . THR A 1 175 ? -12.938 30.603  2.172   1.00 16.21 ? 175 THR A N   1 
ATOM   1319 C CA  . THR A 1 175 ? -13.028 30.318  0.748   1.00 20.28 ? 175 THR A CA  1 
ATOM   1320 C C   . THR A 1 175 ? -12.144 31.142  -0.206  1.00 18.14 ? 175 THR A C   1 
ATOM   1321 O O   . THR A 1 175 ? -11.941 32.366  -0.077  1.00 18.54 ? 175 THR A O   1 
ATOM   1322 C CB  . THR A 1 175 ? -14.525 30.450  0.376   1.00 27.38 ? 175 THR A CB  1 
ATOM   1323 O OG1 . THR A 1 175 ? -15.147 31.303  1.358   1.00 36.03 ? 175 THR A OG1 1 
ATOM   1324 C CG2 . THR A 1 175 ? -15.178 29.078  0.248   1.00 28.56 ? 175 THR A CG2 1 
ATOM   1325 N N   . ALA A 1 176 ? -11.563 30.417  -1.157  1.00 14.09 ? 176 ALA A N   1 
ATOM   1326 C CA  . ALA A 1 176 ? -10.669 31.070  -2.091  1.00 15.65 ? 176 ALA A CA  1 
ATOM   1327 C C   . ALA A 1 176 ? -11.335 31.582  -3.346  1.00 13.96 ? 176 ALA A C   1 
ATOM   1328 O O   . ALA A 1 176 ? -11.976 30.871  -4.140  1.00 10.18 ? 176 ALA A O   1 
ATOM   1329 C CB  . ALA A 1 176 ? -9.521  30.159  -2.594  1.00 17.44 ? 176 ALA A CB  1 
ATOM   1330 N N   . THR A 1 177 ? -11.143 32.887  -3.457  1.00 11.48 ? 177 THR A N   1 
ATOM   1331 C CA  . THR A 1 177 ? -11.583 33.537  -4.651  1.00 12.53 ? 177 THR A CA  1 
ATOM   1332 C C   . THR A 1 177 ? -10.549 33.229  -5.731  1.00 14.30 ? 177 THR A C   1 
ATOM   1333 O O   . THR A 1 177 ? -9.356  33.019  -5.406  1.00 16.86 ? 177 THR A O   1 
ATOM   1334 C CB  . THR A 1 177 ? -11.765 35.075  -4.387  1.00 10.63 ? 177 THR A CB  1 
ATOM   1335 O OG1 . THR A 1 177 ? -10.552 35.846  -4.396  1.00 14.59 ? 177 THR A OG1 1 
ATOM   1336 C CG2 . THR A 1 177 ? -12.550 35.140  -3.092  1.00 10.69 ? 177 THR A CG2 1 
ATOM   1337 N N   . PRO A 1 178 ? -10.921 33.212  -7.021  1.00 12.50 ? 178 PRO A N   1 
ATOM   1338 C CA  . PRO A 1 178 ? -10.044 32.889  -8.108  1.00 12.20 ? 178 PRO A CA  1 
ATOM   1339 C C   . PRO A 1 178 ? -8.966  33.909  -7.973  1.00 14.95 ? 178 PRO A C   1 
ATOM   1340 O O   . PRO A 1 178 ? -7.836  33.456  -7.950  1.00 20.12 ? 178 PRO A O   1 
ATOM   1341 C CB  . PRO A 1 178 ? -10.890 33.027  -9.342  1.00 14.60 ? 178 PRO A CB  1 
ATOM   1342 C CG  . PRO A 1 178 ? -11.978 33.979  -8.953  1.00 12.47 ? 178 PRO A CG  1 
ATOM   1343 C CD  . PRO A 1 178 ? -12.233 33.521  -7.533  1.00 11.91 ? 178 PRO A CD  1 
ATOM   1344 N N   . GLN A 1 179 ? -9.270  35.196  -7.714  1.00 14.78 ? 179 GLN A N   1 
ATOM   1345 C CA  . GLN A 1 179 ? -8.288  36.254  -7.532  1.00 16.85 ? 179 GLN A CA  1 
ATOM   1346 C C   . GLN A 1 179 ? -7.250  35.984  -6.448  1.00 20.05 ? 179 GLN A C   1 
ATOM   1347 O O   . GLN A 1 179 ? -6.081  36.410  -6.586  1.00 18.30 ? 179 GLN A O   1 
ATOM   1348 C CB  . GLN A 1 179 ? -8.928  37.567  -7.155  1.00 18.62 ? 179 GLN A CB  1 
ATOM   1349 C CG  . GLN A 1 179 ? -9.293  38.493  -8.285  1.00 22.70 ? 179 GLN A CG  1 
ATOM   1350 C CD  . GLN A 1 179 ? -10.540 38.064  -9.028  1.00 28.59 ? 179 GLN A CD  1 
ATOM   1351 O OE1 . GLN A 1 179 ? -10.554 37.991  -10.255 1.00 33.43 ? 179 GLN A OE1 1 
ATOM   1352 N NE2 . GLN A 1 179 ? -11.647 37.740  -8.351  1.00 31.22 ? 179 GLN A NE2 1 
ATOM   1353 N N   . GLN A 1 180 ? -7.681  35.302  -5.355  1.00 20.84 ? 180 GLN A N   1 
ATOM   1354 C CA  . GLN A 1 180 ? -6.749  35.045  -4.291  1.00 21.03 ? 180 GLN A CA  1 
ATOM   1355 C C   . GLN A 1 180 ? -5.987  33.734  -4.471  1.00 21.62 ? 180 GLN A C   1 
ATOM   1356 O O   . GLN A 1 180 ? -4.922  33.510  -3.870  1.00 20.63 ? 180 GLN A O   1 
ATOM   1357 C CB  . GLN A 1 180 ? -7.536  35.161  -2.989  1.00 19.63 ? 180 GLN A CB  1 
ATOM   1358 C CG  . GLN A 1 180 ? -8.419  34.121  -2.435  1.00 26.70 ? 180 GLN A CG  1 
ATOM   1359 C CD  . GLN A 1 180 ? -8.874  34.464  -1.017  1.00 31.62 ? 180 GLN A CD  1 
ATOM   1360 O OE1 . GLN A 1 180 ? -9.894  35.105  -0.811  1.00 36.59 ? 180 GLN A OE1 1 
ATOM   1361 N NE2 . GLN A 1 180 ? -8.199  34.089  0.052   1.00 32.51 ? 180 GLN A NE2 1 
ATOM   1362 N N   . ALA A 1 181 ? -6.481  32.900  -5.393  1.00 21.85 ? 181 ALA A N   1 
ATOM   1363 C CA  . ALA A 1 181 ? -5.735  31.733  -5.856  1.00 23.46 ? 181 ALA A CA  1 
ATOM   1364 C C   . ALA A 1 181 ? -4.590  32.246  -6.722  1.00 25.85 ? 181 ALA A C   1 
ATOM   1365 O O   . ALA A 1 181 ? -3.412  31.885  -6.553  1.00 31.71 ? 181 ALA A O   1 
ATOM   1366 C CB  . ALA A 1 181 ? -6.543  30.844  -6.741  1.00 19.89 ? 181 ALA A CB  1 
ATOM   1367 N N   . GLN A 1 182 ? -4.884  33.126  -7.674  1.00 26.10 ? 182 GLN A N   1 
ATOM   1368 C CA  . GLN A 1 182 ? -3.888  33.752  -8.534  1.00 26.34 ? 182 GLN A CA  1 
ATOM   1369 C C   . GLN A 1 182 ? -2.738  34.422  -7.794  1.00 26.18 ? 182 GLN A C   1 
ATOM   1370 O O   . GLN A 1 182 ? -1.615  34.258  -8.252  1.00 26.89 ? 182 GLN A O   1 
ATOM   1371 C CB  . GLN A 1 182 ? -4.629  34.753  -9.431  1.00 26.26 ? 182 GLN A CB  1 
ATOM   1372 C CG  . GLN A 1 182 ? -3.905  35.732  -10.335 1.00 21.07 ? 182 GLN A CG  1 
ATOM   1373 C CD  . GLN A 1 182 ? -2.875  35.085  -11.215 1.00 20.74 ? 182 GLN A CD  1 
ATOM   1374 O OE1 . GLN A 1 182 ? -3.087  34.095  -11.918 1.00 19.05 ? 182 GLN A OE1 1 
ATOM   1375 N NE2 . GLN A 1 182 ? -1.691  35.651  -11.156 1.00 17.82 ? 182 GLN A NE2 1 
ATOM   1376 N N   . GLU A 1 183 ? -2.896  35.091  -6.650  1.00 27.75 ? 183 GLU A N   1 
ATOM   1377 C CA  . GLU A 1 183 ? -1.805  35.821  -6.009  1.00 29.37 ? 183 GLU A CA  1 
ATOM   1378 C C   . GLU A 1 183 ? -0.697  34.980  -5.418  1.00 27.76 ? 183 GLU A C   1 
ATOM   1379 O O   . GLU A 1 183 ? 0.412   35.415  -5.128  1.00 27.27 ? 183 GLU A O   1 
ATOM   1380 C CB  . GLU A 1 183 ? -2.346  36.734  -4.908  1.00 34.29 ? 183 GLU A CB  1 
ATOM   1381 C CG  . GLU A 1 183 ? -2.812  36.121  -3.586  1.00 42.05 ? 183 GLU A CG  1 
ATOM   1382 C CD  . GLU A 1 183 ? -3.103  37.178  -2.509  1.00 47.63 ? 183 GLU A CD  1 
ATOM   1383 O OE1 . GLU A 1 183 ? -2.207  37.998  -2.207  1.00 46.98 ? 183 GLU A OE1 1 
ATOM   1384 O OE2 . GLU A 1 183 ? -4.230  37.161  -1.976  1.00 49.08 ? 183 GLU A OE2 1 
ATOM   1385 N N   . VAL A 1 184 ? -1.002  33.728  -5.227  1.00 28.42 ? 184 VAL A N   1 
ATOM   1386 C CA  . VAL A 1 184 ? 0.000   32.808  -4.776  1.00 27.45 ? 184 VAL A CA  1 
ATOM   1387 C C   . VAL A 1 184 ? 0.466   32.099  -6.042  1.00 26.02 ? 184 VAL A C   1 
ATOM   1388 O O   . VAL A 1 184 ? 1.586   31.588  -6.043  1.00 26.49 ? 184 VAL A O   1 
ATOM   1389 C CB  . VAL A 1 184 ? -0.700  31.960  -3.728  1.00 27.00 ? 184 VAL A CB  1 
ATOM   1390 C CG1 . VAL A 1 184 ? 0.101   30.777  -3.240  1.00 26.97 ? 184 VAL A CG1 1 
ATOM   1391 C CG2 . VAL A 1 184 ? -0.900  32.900  -2.544  1.00 28.20 ? 184 VAL A CG2 1 
ATOM   1392 N N   . HIS A 1 185 ? -0.272  32.038  -7.162  1.00 22.28 ? 185 HIS A N   1 
ATOM   1393 C CA  . HIS A 1 185 ? 0.360   31.569  -8.396  1.00 19.65 ? 185 HIS A CA  1 
ATOM   1394 C C   . HIS A 1 185 ? 1.386   32.563  -8.906  1.00 20.38 ? 185 HIS A C   1 
ATOM   1395 O O   . HIS A 1 185 ? 2.304   32.206  -9.628  1.00 17.20 ? 185 HIS A O   1 
ATOM   1396 C CB  . HIS A 1 185 ? -0.632  31.350  -9.483  1.00 15.83 ? 185 HIS A CB  1 
ATOM   1397 C CG  . HIS A 1 185 ? -1.228  29.963  -9.298  1.00 14.62 ? 185 HIS A CG  1 
ATOM   1398 N ND1 . HIS A 1 185 ? -1.330  28.959  -10.164 1.00 13.86 ? 185 HIS A ND1 1 
ATOM   1399 C CD2 . HIS A 1 185 ? -1.800  29.529  -8.134  1.00 12.48 ? 185 HIS A CD2 1 
ATOM   1400 C CE1 . HIS A 1 185 ? -1.931  27.958  -9.604  1.00 13.11 ? 185 HIS A CE1 1 
ATOM   1401 N NE2 . HIS A 1 185 ? -2.206  28.316  -8.385  1.00 14.65 ? 185 HIS A NE2 1 
ATOM   1402 N N   . GLU A 1 186 ? 1.257   33.825  -8.487  1.00 25.20 ? 186 GLU A N   1 
ATOM   1403 C CA  . GLU A 1 186 ? 2.183   34.924  -8.787  1.00 27.25 ? 186 GLU A CA  1 
ATOM   1404 C C   . GLU A 1 186 ? 3.395   34.786  -7.854  1.00 24.83 ? 186 GLU A C   1 
ATOM   1405 O O   . GLU A 1 186 ? 4.504   34.640  -8.343  1.00 23.76 ? 186 GLU A O   1 
ATOM   1406 C CB  . GLU A 1 186 ? 1.385   36.223  -8.587  1.00 31.13 ? 186 GLU A CB  1 
ATOM   1407 C CG  . GLU A 1 186 ? 1.769   37.420  -9.460  1.00 40.06 ? 186 GLU A CG  1 
ATOM   1408 C CD  . GLU A 1 186 ? 0.632   38.404  -9.804  1.00 44.29 ? 186 GLU A CD  1 
ATOM   1409 O OE1 . GLU A 1 186 ? 0.317   39.307  -9.011  1.00 43.58 ? 186 GLU A OE1 1 
ATOM   1410 O OE2 . GLU A 1 186 ? 0.074   38.264  -10.900 1.00 48.43 ? 186 GLU A OE2 1 
ATOM   1411 N N   . LYS A 1 187 ? 3.266   34.760  -6.516  1.00 25.40 ? 187 LYS A N   1 
ATOM   1412 C CA  . LYS A 1 187 ? 4.369   34.506  -5.573  1.00 23.59 ? 187 LYS A CA  1 
ATOM   1413 C C   . LYS A 1 187 ? 5.285   33.319  -5.891  1.00 22.01 ? 187 LYS A C   1 
ATOM   1414 O O   . LYS A 1 187 ? 6.500   33.458  -5.859  1.00 25.34 ? 187 LYS A O   1 
ATOM   1415 C CB  . LYS A 1 187 ? 3.815   34.301  -4.157  1.00 23.45 ? 187 LYS A CB  1 
ATOM   1416 C CG  . LYS A 1 187 ? 3.341   35.654  -3.657  1.00 25.50 ? 187 LYS A CG  1 
ATOM   1417 C CD  . LYS A 1 187 ? 2.828   35.683  -2.203  1.00 25.68 ? 187 LYS A CD  1 
ATOM   1418 C CE  . LYS A 1 187 ? 2.913   37.147  -1.641  1.00 21.91 ? 187 LYS A CE  1 
ATOM   1419 N NZ  . LYS A 1 187 ? 2.652   37.272  -0.222  1.00 18.53 ? 187 LYS A NZ  1 
ATOM   1420 N N   . LEU A 1 188 ? 4.743   32.150  -6.232  1.00 19.16 ? 188 LEU A N   1 
ATOM   1421 C CA  . LEU A 1 188 ? 5.468   30.934  -6.541  1.00 12.15 ? 188 LEU A CA  1 
ATOM   1422 C C   . LEU A 1 188 ? 6.153   31.158  -7.833  1.00 11.28 ? 188 LEU A C   1 
ATOM   1423 O O   . LEU A 1 188 ? 7.279   30.690  -7.934  1.00 14.66 ? 188 LEU A O   1 
ATOM   1424 C CB  . LEU A 1 188 ? 4.554   29.723  -6.711  1.00 7.93  ? 188 LEU A CB  1 
ATOM   1425 C CG  . LEU A 1 188 ? 4.037   28.899  -5.542  1.00 6.00  ? 188 LEU A CG  1 
ATOM   1426 C CD1 . LEU A 1 188 ? 3.662   29.815  -4.429  1.00 3.88  ? 188 LEU A CD1 1 
ATOM   1427 C CD2 . LEU A 1 188 ? 2.790   28.106  -5.936  1.00 4.00  ? 188 LEU A CD2 1 
ATOM   1428 N N   . ARG A 1 189 ? 5.577   31.841  -8.808  1.00 9.91  ? 189 ARG A N   1 
ATOM   1429 C CA  . ARG A 1 189 ? 6.290   32.072  -10.055 1.00 12.87 ? 189 ARG A CA  1 
ATOM   1430 C C   . ARG A 1 189 ? 7.488   33.001  -9.787  1.00 17.02 ? 189 ARG A C   1 
ATOM   1431 O O   . ARG A 1 189 ? 8.649   32.769  -10.158 1.00 20.28 ? 189 ARG A O   1 
ATOM   1432 C CB  . ARG A 1 189 ? 5.360   32.709  -11.045 1.00 13.75 ? 189 ARG A CB  1 
ATOM   1433 C CG  . ARG A 1 189 ? 5.880   32.324  -12.386 1.00 17.43 ? 189 ARG A CG  1 
ATOM   1434 C CD  . ARG A 1 189 ? 4.903   32.623  -13.513 1.00 23.45 ? 189 ARG A CD  1 
ATOM   1435 N NE  . ARG A 1 189 ? 3.695   31.843  -13.395 1.00 26.64 ? 189 ARG A NE  1 
ATOM   1436 C CZ  . ARG A 1 189 ? 3.650   30.531  -13.606 1.00 28.37 ? 189 ARG A CZ  1 
ATOM   1437 N NH1 . ARG A 1 189 ? 4.707   29.821  -13.951 1.00 30.08 ? 189 ARG A NH1 1 
ATOM   1438 N NH2 . ARG A 1 189 ? 2.477   29.902  -13.545 1.00 33.00 ? 189 ARG A NH2 1 
ATOM   1439 N N   . GLY A 1 190 ? 7.221   34.044  -9.026  1.00 18.38 ? 190 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 190 ? 8.208   34.990  -8.607  1.00 20.92 ? 190 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 190 ? 9.254   34.361  -7.700  1.00 23.35 ? 190 GLY A C   1 
ATOM   1442 O O   . GLY A 1 190 ? 10.350  34.916  -7.565  1.00 26.37 ? 190 GLY A O   1 
ATOM   1443 N N   . TRP A 1 191 ? 8.963   33.257  -7.027  1.00 22.29 ? 191 TRP A N   1 
ATOM   1444 C CA  . TRP A 1 191 ? 9.961   32.536  -6.294  1.00 21.47 ? 191 TRP A CA  1 
ATOM   1445 C C   . TRP A 1 191 ? 10.856  31.810  -7.275  1.00 24.87 ? 191 TRP A C   1 
ATOM   1446 O O   . TRP A 1 191 ? 12.057  31.673  -6.978  1.00 26.01 ? 191 TRP A O   1 
ATOM   1447 C CB  . TRP A 1 191 ? 9.351   31.516  -5.443  1.00 19.79 ? 191 TRP A CB  1 
ATOM   1448 C CG  . TRP A 1 191 ? 10.398  30.822  -4.623  1.00 22.28 ? 191 TRP A CG  1 
ATOM   1449 C CD1 . TRP A 1 191 ? 10.626  31.239  -3.346  1.00 24.98 ? 191 TRP A CD1 1 
ATOM   1450 C CD2 . TRP A 1 191 ? 11.119  29.717  -4.974  1.00 22.31 ? 191 TRP A CD2 1 
ATOM   1451 N NE1 . TRP A 1 191 ? 11.489  30.390  -2.860  1.00 28.45 ? 191 TRP A NE1 1 
ATOM   1452 C CE2 . TRP A 1 191 ? 11.818  29.476  -3.787  1.00 26.27 ? 191 TRP A CE2 1 
ATOM   1453 C CE3 . TRP A 1 191 ? 11.308  28.900  -6.075  1.00 19.88 ? 191 TRP A CE3 1 
ATOM   1454 C CZ2 . TRP A 1 191 ? 12.698  28.405  -3.668  1.00 24.27 ? 191 TRP A CZ2 1 
ATOM   1455 C CZ3 . TRP A 1 191 ? 12.187  27.835  -5.974  1.00 23.43 ? 191 TRP A CZ3 1 
ATOM   1456 C CH2 . TRP A 1 191 ? 12.863  27.588  -4.779  1.00 24.38 ? 191 TRP A CH2 1 
ATOM   1457 N N   . LEU A 1 192 ? 10.286  31.257  -8.374  1.00 25.74 ? 192 LEU A N   1 
ATOM   1458 C CA  . LEU A 1 192 ? 11.062  30.408  -9.269  1.00 26.21 ? 192 LEU A CA  1 
ATOM   1459 C C   . LEU A 1 192 ? 12.181  31.150  -9.969  1.00 28.15 ? 192 LEU A C   1 
ATOM   1460 O O   . LEU A 1 192 ? 13.287  30.629  -10.074 1.00 25.50 ? 192 LEU A O   1 
ATOM   1461 C CB  . LEU A 1 192 ? 10.146  29.719  -10.309 1.00 23.80 ? 192 LEU A CB  1 
ATOM   1462 C CG  . LEU A 1 192 ? 9.406   28.397  -9.945  1.00 21.60 ? 192 LEU A CG  1 
ATOM   1463 C CD1 . LEU A 1 192 ? 8.710   27.833  -11.183 1.00 19.35 ? 192 LEU A CD1 1 
ATOM   1464 C CD2 . LEU A 1 192 ? 10.382  27.358  -9.436  1.00 13.32 ? 192 LEU A CD2 1 
ATOM   1465 N N   . LYS A 1 193 ? 11.900  32.403  -10.317 1.00 32.26 ? 193 LYS A N   1 
ATOM   1466 C CA  . LYS A 1 193 ? 12.835  33.361  -10.887 1.00 35.89 ? 193 LYS A CA  1 
ATOM   1467 C C   . LYS A 1 193 ? 13.963  33.781  -9.916  1.00 36.98 ? 193 LYS A C   1 
ATOM   1468 O O   . LYS A 1 193 ? 15.147  33.542  -10.197 1.00 37.89 ? 193 LYS A O   1 
ATOM   1469 C CB  . LYS A 1 193 ? 12.040  34.563  -11.281 1.00 38.56 ? 193 LYS A CB  1 
ATOM   1470 C CG  . LYS A 1 193 ? 11.187  34.511  -12.533 1.00 42.51 ? 193 LYS A CG  1 
ATOM   1471 C CD  . LYS A 1 193 ? 11.682  35.604  -13.505 1.00 44.31 ? 193 LYS A CD  1 
ATOM   1472 C CE  . LYS A 1 193 ? 11.797  37.067  -13.021 1.00 47.02 ? 193 LYS A CE  1 
ATOM   1473 N NZ  . LYS A 1 193 ? 12.761  37.331  -11.950 1.00 47.05 ? 193 LYS A NZ  1 
ATOM   1474 N N   . SER A 1 194 ? 13.588  34.392  -8.773  1.00 34.11 ? 194 SER A N   1 
ATOM   1475 C CA  . SER A 1 194 ? 14.489  34.878  -7.732  1.00 34.12 ? 194 SER A CA  1 
ATOM   1476 C C   . SER A 1 194 ? 15.393  33.828  -7.029  1.00 32.43 ? 194 SER A C   1 
ATOM   1477 O O   . SER A 1 194 ? 16.394  34.120  -6.318  1.00 29.80 ? 194 SER A O   1 
ATOM   1478 C CB  . SER A 1 194 ? 13.699  35.596  -6.570  1.00 37.52 ? 194 SER A CB  1 
ATOM   1479 O OG  . SER A 1 194 ? 12.888  34.535  -6.073  1.00 42.59 ? 194 SER A OG  1 
ATOM   1480 N N   . ASN A 1 195 ? 14.837  32.619  -7.054  1.00 29.08 ? 195 ASN A N   1 
ATOM   1481 C CA  . ASN A 1 195 ? 15.486  31.501  -6.431  1.00 27.54 ? 195 ASN A CA  1 
ATOM   1482 C C   . ASN A 1 195 ? 16.086  30.413  -7.316  1.00 28.91 ? 195 ASN A C   1 
ATOM   1483 O O   . ASN A 1 195 ? 17.034  29.732  -6.872  1.00 28.69 ? 195 ASN A O   1 
ATOM   1484 C CB  . ASN A 1 195 ? 14.534  30.862  -5.535  1.00 23.80 ? 195 ASN A CB  1 
ATOM   1485 C CG  . ASN A 1 195 ? 14.546  31.523  -4.215  1.00 22.11 ? 195 ASN A CG  1 
ATOM   1486 O OD1 . ASN A 1 195 ? 14.950  30.931  -3.224  1.00 22.16 ? 195 ASN A OD1 1 
ATOM   1487 N ND2 . ASN A 1 195 ? 14.043  32.742  -4.133  1.00 21.92 ? 195 ASN A ND2 1 
ATOM   1488 N N   . VAL A 1 196 ? 15.554  30.158  -8.523  1.00 25.16 ? 196 VAL A N   1 
ATOM   1489 C CA  . VAL A 1 196 ? 16.137  29.102  -9.306  1.00 24.24 ? 196 VAL A CA  1 
ATOM   1490 C C   . VAL A 1 196 ? 16.558  29.722  -10.613 1.00 24.52 ? 196 VAL A C   1 
ATOM   1491 O O   . VAL A 1 196 ? 17.750  29.904  -10.855 1.00 25.05 ? 196 VAL A O   1 
ATOM   1492 C CB  . VAL A 1 196 ? 15.120  27.941  -9.542  1.00 24.18 ? 196 VAL A CB  1 
ATOM   1493 C CG1 . VAL A 1 196 ? 15.782  26.916  -10.458 1.00 25.85 ? 196 VAL A CG1 1 
ATOM   1494 C CG2 . VAL A 1 196 ? 14.767  27.204  -8.263  1.00 19.77 ? 196 VAL A CG2 1 
ATOM   1495 N N   . SER A 1 197 ? 15.555  30.048  -11.434 1.00 25.67 ? 197 SER A N   1 
ATOM   1496 C CA  . SER A 1 197 ? 15.692  30.601  -12.754 1.00 23.00 ? 197 SER A CA  1 
ATOM   1497 C C   . SER A 1 197 ? 14.346  31.125  -13.287 1.00 25.21 ? 197 SER A C   1 
ATOM   1498 O O   . SER A 1 197 ? 13.247  30.704  -12.889 1.00 25.75 ? 197 SER A O   1 
ATOM   1499 C CB  . SER A 1 197 ? 16.289  29.447  -13.501 1.00 19.69 ? 197 SER A CB  1 
ATOM   1500 O OG  . SER A 1 197 ? 16.110  29.366  -14.886 1.00 21.43 ? 197 SER A OG  1 
ATOM   1501 N N   . ASP A 1 198 ? 14.395  32.065  -14.242 1.00 27.95 ? 198 ASP A N   1 
ATOM   1502 C CA  . ASP A 1 198 ? 13.208  32.537  -14.987 1.00 27.93 ? 198 ASP A CA  1 
ATOM   1503 C C   . ASP A 1 198 ? 12.957  31.564  -16.108 1.00 25.52 ? 198 ASP A C   1 
ATOM   1504 O O   . ASP A 1 198 ? 11.883  31.507  -16.701 1.00 24.27 ? 198 ASP A O   1 
ATOM   1505 C CB  . ASP A 1 198 ? 13.286  33.823  -15.808 1.00 31.93 ? 198 ASP A CB  1 
ATOM   1506 C CG  . ASP A 1 198 ? 14.321  34.906  -15.550 1.00 36.22 ? 198 ASP A CG  1 
ATOM   1507 O OD1 . ASP A 1 198 ? 15.016  34.913  -14.527 1.00 38.93 ? 198 ASP A OD1 1 
ATOM   1508 O OD2 . ASP A 1 198 ? 14.411  35.764  -16.425 1.00 38.68 ? 198 ASP A OD2 1 
ATOM   1509 N N   . ALA A 1 199 ? 13.999  30.827  -16.455 1.00 27.88 ? 199 ALA A N   1 
ATOM   1510 C CA  . ALA A 1 199 ? 13.873  29.778  -17.445 1.00 32.94 ? 199 ALA A CA  1 
ATOM   1511 C C   . ALA A 1 199 ? 12.948  28.694  -16.893 1.00 33.56 ? 199 ALA A C   1 
ATOM   1512 O O   . ALA A 1 199 ? 12.359  27.925  -17.653 1.00 38.90 ? 199 ALA A O   1 
ATOM   1513 C CB  . ALA A 1 199 ? 15.227  29.119  -17.753 1.00 35.79 ? 199 ALA A CB  1 
ATOM   1514 N N   . VAL A 1 200 ? 12.799  28.614  -15.572 1.00 30.77 ? 200 VAL A N   1 
ATOM   1515 C CA  . VAL A 1 200 ? 11.909  27.643  -15.016 1.00 28.37 ? 200 VAL A CA  1 
ATOM   1516 C C   . VAL A 1 200 ? 10.574  28.330  -15.002 1.00 26.28 ? 200 VAL A C   1 
ATOM   1517 O O   . VAL A 1 200 ? 9.702   27.881  -15.719 1.00 22.73 ? 200 VAL A O   1 
ATOM   1518 C CB  . VAL A 1 200 ? 12.205  27.258  -13.581 1.00 32.09 ? 200 VAL A CB  1 
ATOM   1519 C CG1 . VAL A 1 200 ? 11.695  25.842  -13.526 1.00 32.12 ? 200 VAL A CG1 1 
ATOM   1520 C CG2 . VAL A 1 200 ? 13.650  27.315  -13.138 1.00 30.68 ? 200 VAL A CG2 1 
ATOM   1521 N N   . ALA A 1 201 ? 10.385  29.436  -14.258 1.00 27.42 ? 201 ALA A N   1 
ATOM   1522 C CA  . ALA A 1 201 ? 9.089   30.135  -14.110 1.00 26.48 ? 201 ALA A CA  1 
ATOM   1523 C C   . ALA A 1 201 ? 8.277   30.289  -15.387 1.00 26.38 ? 201 ALA A C   1 
ATOM   1524 O O   . ALA A 1 201 ? 7.080   30.068  -15.386 1.00 30.16 ? 201 ALA A O   1 
ATOM   1525 C CB  . ALA A 1 201 ? 9.258   31.564  -13.538 1.00 23.13 ? 201 ALA A CB  1 
ATOM   1526 N N   . GLN A 1 202 ? 8.840   30.547  -16.553 1.00 26.39 ? 202 GLN A N   1 
ATOM   1527 C CA  . GLN A 1 202 ? 8.008   30.748  -17.725 1.00 25.80 ? 202 GLN A CA  1 
ATOM   1528 C C   . GLN A 1 202 ? 7.608   29.421  -18.334 1.00 24.16 ? 202 GLN A C   1 
ATOM   1529 O O   . GLN A 1 202 ? 6.843   29.364  -19.299 1.00 26.16 ? 202 GLN A O   1 
ATOM   1530 C CB  . GLN A 1 202 ? 8.801   31.595  -18.723 1.00 29.49 ? 202 GLN A CB  1 
ATOM   1531 C CG  . GLN A 1 202 ? 8.036   32.737  -19.391 1.00 30.48 ? 202 GLN A CG  1 
ATOM   1532 C CD  . GLN A 1 202 ? 6.907   32.328  -20.347 1.00 33.05 ? 202 GLN A CD  1 
ATOM   1533 O OE1 . GLN A 1 202 ? 5.761   32.789  -20.186 1.00 32.38 ? 202 GLN A OE1 1 
ATOM   1534 N NE2 . GLN A 1 202 ? 7.170   31.555  -21.420 1.00 31.56 ? 202 GLN A NE2 1 
ATOM   1535 N N   . SER A 1 203 ? 8.135   28.359  -17.768 1.00 21.55 ? 203 SER A N   1 
ATOM   1536 C CA  . SER A 1 203 ? 8.050   27.040  -18.337 1.00 21.73 ? 203 SER A CA  1 
ATOM   1537 C C   . SER A 1 203 ? 7.216   26.143  -17.437 1.00 22.14 ? 203 SER A C   1 
ATOM   1538 O O   . SER A 1 203 ? 6.291   25.523  -17.983 1.00 24.87 ? 203 SER A O   1 
ATOM   1539 C CB  . SER A 1 203 ? 9.476   26.595  -18.480 1.00 22.19 ? 203 SER A CB  1 
ATOM   1540 O OG  . SER A 1 203 ? 9.787   25.435  -19.222 1.00 27.77 ? 203 SER A OG  1 
ATOM   1541 N N   . THR A 1 204 ? 7.462   26.047  -16.110 1.00 19.25 ? 204 THR A N   1 
ATOM   1542 C CA  . THR A 1 204 ? 6.685   25.212  -15.192 1.00 16.36 ? 204 THR A CA  1 
ATOM   1543 C C   . THR A 1 204 ? 5.197   25.696  -15.050 1.00 15.91 ? 204 THR A C   1 
ATOM   1544 O O   . THR A 1 204 ? 4.805   26.876  -14.890 1.00 10.63 ? 204 THR A O   1 
ATOM   1545 C CB  . THR A 1 204 ? 7.431   25.193  -13.764 1.00 17.58 ? 204 THR A CB  1 
ATOM   1546 O OG1 . THR A 1 204 ? 8.806   25.111  -14.057 1.00 20.92 ? 204 THR A OG1 1 
ATOM   1547 C CG2 . THR A 1 204 ? 7.200   23.998  -12.835 1.00 13.10 ? 204 THR A CG2 1 
ATOM   1548 N N   . ARG A 1 205 ? 4.322   24.689  -15.184 1.00 13.92 ? 205 ARG A N   1 
ATOM   1549 C CA  . ARG A 1 205 ? 2.909   24.838  -14.871 1.00 13.85 ? 205 ARG A CA  1 
ATOM   1550 C C   . ARG A 1 205 ? 2.865   24.896  -13.355 1.00 16.13 ? 205 ARG A C   1 
ATOM   1551 O O   . ARG A 1 205 ? 3.664   24.241  -12.658 1.00 15.89 ? 205 ARG A O   1 
ATOM   1552 C CB  . ARG A 1 205 ? 2.028   23.653  -15.245 1.00 7.95  ? 205 ARG A CB  1 
ATOM   1553 C CG  . ARG A 1 205 ? 1.750   23.494  -16.725 1.00 7.37  ? 205 ARG A CG  1 
ATOM   1554 C CD  . ARG A 1 205 ? 2.867   22.793  -17.498 1.00 6.19  ? 205 ARG A CD  1 
ATOM   1555 N NE  . ARG A 1 205 ? 2.146   22.044  -18.497 1.00 5.75  ? 205 ARG A NE  1 
ATOM   1556 C CZ  . ARG A 1 205 ? 2.174   20.710  -18.520 1.00 6.48  ? 205 ARG A CZ  1 
ATOM   1557 N NH1 . ARG A 1 205 ? 2.902   19.988  -17.672 1.00 3.90  ? 205 ARG A NH1 1 
ATOM   1558 N NH2 . ARG A 1 205 ? 1.279   20.060  -19.265 1.00 5.01  ? 205 ARG A NH2 1 
ATOM   1559 N N   . ILE A 1 206 ? 1.890   25.676  -12.889 1.00 16.91 ? 206 ILE A N   1 
ATOM   1560 C CA  . ILE A 1 206 ? 1.588   25.863  -11.470 1.00 15.11 ? 206 ILE A CA  1 
ATOM   1561 C C   . ILE A 1 206 ? 0.096   25.691  -11.579 1.00 14.12 ? 206 ILE A C   1 
ATOM   1562 O O   . ILE A 1 206 ? -0.575  26.581  -12.132 1.00 15.34 ? 206 ILE A O   1 
ATOM   1563 C CB  . ILE A 1 206 ? 1.874   27.309  -10.884 1.00 12.70 ? 206 ILE A CB  1 
ATOM   1564 C CG1 . ILE A 1 206 ? 3.291   27.784  -11.126 1.00 5.73  ? 206 ILE A CG1 1 
ATOM   1565 C CG2 . ILE A 1 206 ? 1.616   27.240  -9.368  1.00 10.17 ? 206 ILE A CG2 1 
ATOM   1566 C CD1 . ILE A 1 206 ? 3.370   29.189  -10.632 1.00 2.00  ? 206 ILE A CD1 1 
ATOM   1567 N N   . ILE A 1 207 ? -0.410  24.528  -11.169 1.00 13.68 ? 207 ILE A N   1 
ATOM   1568 C CA  . ILE A 1 207 ? -1.829  24.165  -11.213 1.00 13.03 ? 207 ILE A CA  1 
ATOM   1569 C C   . ILE A 1 207 ? -2.567  24.221  -9.878  1.00 9.22  ? 207 ILE A C   1 
ATOM   1570 O O   . ILE A 1 207 ? -2.059  23.857  -8.837  1.00 11.82 ? 207 ILE A O   1 
ATOM   1571 C CB  . ILE A 1 207 ? -1.976  22.747  -11.839 1.00 12.76 ? 207 ILE A CB  1 
ATOM   1572 C CG1 . ILE A 1 207 ? -1.384  21.680  -10.944 1.00 9.01  ? 207 ILE A CG1 1 
ATOM   1573 C CG2 . ILE A 1 207 ? -1.332  22.783  -13.244 1.00 9.46  ? 207 ILE A CG2 1 
ATOM   1574 C CD1 . ILE A 1 207 ? -1.902  20.297  -11.315 1.00 9.04  ? 207 ILE A CD1 1 
ATOM   1575 N N   . TYR A 1 208 ? -3.734  24.798  -9.833  1.00 7.12  ? 208 TYR A N   1 
ATOM   1576 C CA  . TYR A 1 208 ? -4.529  24.893  -8.634  1.00 8.21  ? 208 TYR A CA  1 
ATOM   1577 C C   . TYR A 1 208 ? -5.287  23.618  -8.194  1.00 7.53  ? 208 TYR A C   1 
ATOM   1578 O O   . TYR A 1 208 ? -5.988  22.922  -8.929  1.00 7.98  ? 208 TYR A O   1 
ATOM   1579 C CB  . TYR A 1 208 ? -5.453  26.041  -8.902  1.00 10.21 ? 208 TYR A CB  1 
ATOM   1580 C CG  . TYR A 1 208 ? -6.378  26.398  -7.767  1.00 8.68  ? 208 TYR A CG  1 
ATOM   1581 C CD1 . TYR A 1 208 ? -5.850  27.114  -6.703  1.00 9.38  ? 208 TYR A CD1 1 
ATOM   1582 C CD2 . TYR A 1 208 ? -7.739  26.074  -7.833  1.00 9.09  ? 208 TYR A CD2 1 
ATOM   1583 C CE1 . TYR A 1 208 ? -6.692  27.524  -5.678  1.00 11.54 ? 208 TYR A CE1 1 
ATOM   1584 C CE2 . TYR A 1 208 ? -8.581  26.487  -6.806  1.00 8.99  ? 208 TYR A CE2 1 
ATOM   1585 C CZ  . TYR A 1 208 ? -8.049  27.210  -5.735  1.00 9.25  ? 208 TYR A CZ  1 
ATOM   1586 O OH  . TYR A 1 208 ? -8.845  27.609  -4.678  1.00 10.96 ? 208 TYR A OH  1 
ATOM   1587 N N   . GLY A 1 209 ? -5.176  23.349  -6.921  1.00 6.03  ? 209 GLY A N   1 
ATOM   1588 C CA  . GLY A 1 209 ? -5.832  22.229  -6.296  1.00 8.09  ? 209 GLY A CA  1 
ATOM   1589 C C   . GLY A 1 209 ? -6.795  22.684  -5.191  1.00 9.62  ? 209 GLY A C   1 
ATOM   1590 O O   . GLY A 1 209 ? -6.614  22.321  -4.035  1.00 10.21 ? 209 GLY A O   1 
ATOM   1591 N N   . GLY A 1 210 ? -7.744  23.593  -5.473  1.00 9.73  ? 210 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 210 ? -8.822  23.956  -4.596  1.00 5.51  ? 210 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 210 ? -10.052 23.299  -5.206  1.00 10.76 ? 210 GLY A C   1 
ATOM   1594 O O   . GLY A 1 210 ? -10.041 22.318  -5.989  1.00 13.27 ? 210 GLY A O   1 
ATOM   1595 N N   . SER A 1 211 ? -11.161 23.916  -4.819  1.00 11.77 ? 211 SER A N   1 
ATOM   1596 C CA  . SER A 1 211 ? -12.491 23.468  -5.174  1.00 10.31 ? 211 SER A CA  1 
ATOM   1597 C C   . SER A 1 211 ? -12.694 23.991  -6.564  1.00 12.02 ? 211 SER A C   1 
ATOM   1598 O O   . SER A 1 211 ? -12.848 25.210  -6.699  1.00 15.41 ? 211 SER A O   1 
ATOM   1599 C CB  . SER A 1 211 ? -13.484 24.100  -4.253  1.00 10.30 ? 211 SER A CB  1 
ATOM   1600 O OG  . SER A 1 211 ? -14.843 23.646  -4.238  1.00 14.29 ? 211 SER A OG  1 
ATOM   1601 N N   . VAL A 1 212 ? -12.632 23.128  -7.577  1.00 12.87 ? 212 VAL A N   1 
ATOM   1602 C CA  . VAL A 1 212 ? -12.908 23.494  -8.967  1.00 10.38 ? 212 VAL A CA  1 
ATOM   1603 C C   . VAL A 1 212 ? -14.118 22.712  -9.467  1.00 9.38  ? 212 VAL A C   1 
ATOM   1604 O O   . VAL A 1 212 ? -14.004 21.483  -9.595  1.00 10.11 ? 212 VAL A O   1 
ATOM   1605 C CB  . VAL A 1 212 ? -11.727 23.158  -9.877  1.00 10.01 ? 212 VAL A CB  1 
ATOM   1606 C CG1 . VAL A 1 212 ? -11.961 24.088  -11.031 1.00 10.79 ? 212 VAL A CG1 1 
ATOM   1607 C CG2 . VAL A 1 212 ? -10.324 23.286  -9.229  1.00 11.29 ? 212 VAL A CG2 1 
ATOM   1608 N N   . THR A 1 213 ? -15.297 23.300  -9.688  1.00 5.58  ? 213 THR A N   1 
ATOM   1609 C CA  . THR A 1 213 ? -16.375 22.545  -10.281 1.00 4.16  ? 213 THR A CA  1 
ATOM   1610 C C   . THR A 1 213 ? -16.690 23.111  -11.654 1.00 7.94  ? 213 THR A C   1 
ATOM   1611 O O   . THR A 1 213 ? -16.021 24.053  -12.165 1.00 10.65 ? 213 THR A O   1 
ATOM   1612 C CB  . THR A 1 213 ? -17.602 22.576  -9.357  1.00 5.43  ? 213 THR A CB  1 
ATOM   1613 O OG1 . THR A 1 213 ? -18.089 23.916  -9.158  1.00 10.86 ? 213 THR A OG1 1 
ATOM   1614 C CG2 . THR A 1 213 ? -17.215 21.856  -8.070  1.00 2.00  ? 213 THR A CG2 1 
ATOM   1615 N N   . GLY A 1 214 ? -17.742 22.586  -12.278 1.00 6.03  ? 214 GLY A N   1 
ATOM   1616 C CA  . GLY A 1 214 ? -18.087 23.010  -13.636 1.00 10.45 ? 214 GLY A CA  1 
ATOM   1617 C C   . GLY A 1 214 ? -18.420 24.497  -13.787 1.00 11.02 ? 214 GLY A C   1 
ATOM   1618 O O   . GLY A 1 214 ? -18.259 25.142  -14.823 1.00 11.43 ? 214 GLY A O   1 
ATOM   1619 N N   . ALA A 1 215 ? -18.917 24.986  -12.675 1.00 12.76 ? 215 ALA A N   1 
ATOM   1620 C CA  . ALA A 1 215 ? -19.198 26.376  -12.488 1.00 16.83 ? 215 ALA A CA  1 
ATOM   1621 C C   . ALA A 1 215 ? -17.975 27.253  -12.254 1.00 20.90 ? 215 ALA A C   1 
ATOM   1622 O O   . ALA A 1 215 ? -17.805 28.331  -12.864 1.00 24.29 ? 215 ALA A O   1 
ATOM   1623 C CB  . ALA A 1 215 ? -20.107 26.500  -11.318 1.00 17.98 ? 215 ALA A CB  1 
ATOM   1624 N N   . THR A 1 216 ? -17.066 26.821  -11.380 1.00 21.80 ? 216 THR A N   1 
ATOM   1625 C CA  . THR A 1 216 ? -15.975 27.729  -11.091 1.00 23.78 ? 216 THR A CA  1 
ATOM   1626 C C   . THR A 1 216 ? -14.796 27.681  -12.079 1.00 24.22 ? 216 THR A C   1 
ATOM   1627 O O   . THR A 1 216 ? -14.057 28.662  -12.278 1.00 21.89 ? 216 THR A O   1 
ATOM   1628 C CB  . THR A 1 216 ? -15.631 27.427  -9.590  1.00 25.21 ? 216 THR A CB  1 
ATOM   1629 O OG1 . THR A 1 216 ? -15.403 26.037  -9.382  1.00 26.34 ? 216 THR A OG1 1 
ATOM   1630 C CG2 . THR A 1 216 ? -16.812 27.850  -8.700  1.00 21.17 ? 216 THR A CG2 1 
ATOM   1631 N N   . CYS A 1 217 ? -14.696 26.576  -12.834 1.00 27.11 ? 217 CYS A N   1 
ATOM   1632 C CA  . CYS A 1 217 ? -13.522 26.332  -13.654 1.00 28.60 ? 217 CYS A CA  1 
ATOM   1633 C C   . CYS A 1 217 ? -13.152 27.428  -14.659 1.00 29.41 ? 217 CYS A C   1 
ATOM   1634 O O   . CYS A 1 217 ? -11.977 27.784  -14.742 1.00 28.86 ? 217 CYS A O   1 
ATOM   1635 C CB  . CYS A 1 217 ? -13.711 24.941  -14.315 1.00 26.67 ? 217 CYS A CB  1 
ATOM   1636 S SG  . CYS A 1 217 ? -14.636 24.775  -15.855 1.00 24.62 ? 217 CYS A SG  1 
ATOM   1637 N N   . LYS A 1 218 ? -14.100 28.112  -15.303 1.00 33.02 ? 218 LYS A N   1 
ATOM   1638 C CA  . LYS A 1 218 ? -13.834 29.207  -16.245 1.00 34.30 ? 218 LYS A CA  1 
ATOM   1639 C C   . LYS A 1 218 ? -13.283 30.482  -15.624 1.00 33.14 ? 218 LYS A C   1 
ATOM   1640 O O   . LYS A 1 218 ? -12.470 31.151  -16.248 1.00 32.08 ? 218 LYS A O   1 
ATOM   1641 C CB  . LYS A 1 218 ? -15.094 29.631  -16.965 1.00 38.94 ? 218 LYS A CB  1 
ATOM   1642 C CG  . LYS A 1 218 ? -15.083 29.464  -18.488 1.00 41.74 ? 218 LYS A CG  1 
ATOM   1643 C CD  . LYS A 1 218 ? -15.402 28.032  -18.908 1.00 42.06 ? 218 LYS A CD  1 
ATOM   1644 C CE  . LYS A 1 218 ? -16.849 27.721  -18.611 1.00 42.79 ? 218 LYS A CE  1 
ATOM   1645 N NZ  . LYS A 1 218 ? -16.932 26.418  -17.977 1.00 45.45 ? 218 LYS A NZ  1 
ATOM   1646 N N   . GLU A 1 219 ? -13.763 30.821  -14.413 1.00 33.11 ? 219 GLU A N   1 
ATOM   1647 C CA  . GLU A 1 219 ? -13.429 32.021  -13.646 1.00 31.67 ? 219 GLU A CA  1 
ATOM   1648 C C   . GLU A 1 219 ? -12.048 31.906  -12.988 1.00 32.48 ? 219 GLU A C   1 
ATOM   1649 O O   . GLU A 1 219 ? -11.457 32.912  -12.535 1.00 32.25 ? 219 GLU A O   1 
ATOM   1650 C CB  . GLU A 1 219 ? -14.515 32.242  -12.567 1.00 32.00 ? 219 GLU A CB  1 
ATOM   1651 C CG  . GLU A 1 219 ? -16.035 32.198  -12.983 1.00 33.59 ? 219 GLU A CG  1 
ATOM   1652 C CD  . GLU A 1 219 ? -17.123 32.128  -11.875 1.00 35.54 ? 219 GLU A CD  1 
ATOM   1653 O OE1 . GLU A 1 219 ? -17.359 33.166  -11.224 1.00 34.78 ? 219 GLU A OE1 1 
ATOM   1654 O OE2 . GLU A 1 219 ? -17.734 31.046  -11.670 1.00 30.12 ? 219 GLU A OE2 1 
ATOM   1655 N N   . LEU A 1 220 ? -11.567 30.645  -12.910 1.00 30.45 ? 220 LEU A N   1 
ATOM   1656 C CA  . LEU A 1 220 ? -10.256 30.348  -12.376 1.00 28.07 ? 220 LEU A CA  1 
ATOM   1657 C C   . LEU A 1 220 ? -9.269  30.055  -13.489 1.00 28.19 ? 220 LEU A C   1 
ATOM   1658 O O   . LEU A 1 220 ? -8.180  30.596  -13.353 1.00 27.81 ? 220 LEU A O   1 
ATOM   1659 C CB  . LEU A 1 220 ? -10.360 29.176  -11.411 1.00 28.33 ? 220 LEU A CB  1 
ATOM   1660 C CG  . LEU A 1 220 ? -10.447 29.516  -9.899  1.00 29.61 ? 220 LEU A CG  1 
ATOM   1661 C CD1 . LEU A 1 220 ? -11.163 28.422  -9.130  1.00 32.09 ? 220 LEU A CD1 1 
ATOM   1662 C CD2 . LEU A 1 220 ? -9.061  29.650  -9.317  1.00 28.66 ? 220 LEU A CD2 1 
ATOM   1663 N N   . ALA A 1 221 ? -9.541  29.284  -14.583 1.00 27.67 ? 221 ALA A N   1 
ATOM   1664 C CA  . ALA A 1 221 ? -8.639  29.112  -15.750 1.00 25.01 ? 221 ALA A CA  1 
ATOM   1665 C C   . ALA A 1 221 ? -8.312  30.461  -16.422 1.00 24.77 ? 221 ALA A C   1 
ATOM   1666 O O   . ALA A 1 221 ? -7.304  30.650  -17.100 1.00 26.10 ? 221 ALA A O   1 
ATOM   1667 C CB  . ALA A 1 221 ? -9.267  28.212  -16.831 1.00 20.77 ? 221 ALA A CB  1 
ATOM   1668 N N   . SER A 1 222 ? -9.161  31.469  -16.278 1.00 24.32 ? 222 SER A N   1 
ATOM   1669 C CA  . SER A 1 222 ? -8.851  32.791  -16.768 1.00 25.04 ? 222 SER A CA  1 
ATOM   1670 C C   . SER A 1 222 ? -7.674  33.463  -16.070 1.00 25.98 ? 222 SER A C   1 
ATOM   1671 O O   . SER A 1 222 ? -7.019  34.295  -16.692 1.00 28.78 ? 222 SER A O   1 
ATOM   1672 C CB  . SER A 1 222 ? -10.051 33.678  -16.601 1.00 26.03 ? 222 SER A CB  1 
ATOM   1673 O OG  . SER A 1 222 ? -10.325 33.917  -15.218 1.00 28.18 ? 222 SER A OG  1 
ATOM   1674 N N   . GLN A 1 223 ? -7.418  33.225  -14.783 1.00 26.49 ? 223 GLN A N   1 
ATOM   1675 C CA  . GLN A 1 223 ? -6.325  33.875  -14.093 1.00 27.54 ? 223 GLN A CA  1 
ATOM   1676 C C   . GLN A 1 223 ? -4.949  33.569  -14.725 1.00 30.31 ? 223 GLN A C   1 
ATOM   1677 O O   . GLN A 1 223 ? -4.655  32.445  -15.147 1.00 30.47 ? 223 GLN A O   1 
ATOM   1678 C CB  . GLN A 1 223 ? -6.277  33.454  -12.647 1.00 28.71 ? 223 GLN A CB  1 
ATOM   1679 C CG  . GLN A 1 223 ? -7.569  33.600  -11.872 1.00 31.27 ? 223 GLN A CG  1 
ATOM   1680 C CD  . GLN A 1 223 ? -8.080  35.017  -11.775 1.00 29.40 ? 223 GLN A CD  1 
ATOM   1681 O OE1 . GLN A 1 223 ? -7.331  35.983  -11.672 1.00 29.34 ? 223 GLN A OE1 1 
ATOM   1682 N NE2 . GLN A 1 223 ? -9.387  35.176  -11.810 1.00 30.12 ? 223 GLN A NE2 1 
ATOM   1683 N N   . PRO A 1 224 ? -4.059  34.570  -14.818 1.00 31.53 ? 224 PRO A N   1 
ATOM   1684 C CA  . PRO A 1 224 ? -2.761  34.513  -15.468 1.00 30.06 ? 224 PRO A CA  1 
ATOM   1685 C C   . PRO A 1 224 ? -1.853  33.317  -15.273 1.00 28.46 ? 224 PRO A C   1 
ATOM   1686 O O   . PRO A 1 224 ? -1.311  32.684  -16.185 1.00 32.12 ? 224 PRO A O   1 
ATOM   1687 C CB  . PRO A 1 224 ? -2.112  35.780  -14.996 1.00 32.20 ? 224 PRO A CB  1 
ATOM   1688 C CG  . PRO A 1 224 ? -3.232  36.781  -15.036 1.00 33.49 ? 224 PRO A CG  1 
ATOM   1689 C CD  . PRO A 1 224 ? -4.350  35.956  -14.433 1.00 34.35 ? 224 PRO A CD  1 
ATOM   1690 N N   . ASP A 1 225 ? -1.610  33.067  -14.022 1.00 23.22 ? 225 ASP A N   1 
ATOM   1691 C CA  . ASP A 1 225 ? -0.669  32.047  -13.659 1.00 19.03 ? 225 ASP A CA  1 
ATOM   1692 C C   . ASP A 1 225 ? -1.406  30.754  -13.237 1.00 16.81 ? 225 ASP A C   1 
ATOM   1693 O O   . ASP A 1 225 ? -0.850  29.932  -12.517 1.00 15.13 ? 225 ASP A O   1 
ATOM   1694 C CB  . ASP A 1 225 ? 0.191   32.711  -12.576 1.00 21.04 ? 225 ASP A CB  1 
ATOM   1695 C CG  . ASP A 1 225 ? 0.679   34.155  -12.823 1.00 21.90 ? 225 ASP A CG  1 
ATOM   1696 O OD1 . ASP A 1 225 ? 0.856   34.561  -13.981 1.00 20.71 ? 225 ASP A OD1 1 
ATOM   1697 O OD2 . ASP A 1 225 ? 0.859   34.879  -11.828 1.00 19.72 ? 225 ASP A OD2 1 
ATOM   1698 N N   . VAL A 1 226 ? -2.671  30.479  -13.604 1.00 13.60 ? 226 VAL A N   1 
ATOM   1699 C CA  . VAL A 1 226 ? -3.399  29.277  -13.252 1.00 9.55  ? 226 VAL A CA  1 
ATOM   1700 C C   . VAL A 1 226 ? -3.458  28.513  -14.597 1.00 13.93 ? 226 VAL A C   1 
ATOM   1701 O O   . VAL A 1 226 ? -4.204  28.768  -15.583 1.00 12.00 ? 226 VAL A O   1 
ATOM   1702 C CB  . VAL A 1 226 ? -4.836  29.620  -12.693 1.00 7.37  ? 226 VAL A CB  1 
ATOM   1703 C CG1 . VAL A 1 226 ? -5.553  28.331  -12.235 1.00 5.12  ? 226 VAL A CG1 1 
ATOM   1704 C CG2 . VAL A 1 226 ? -4.732  30.566  -11.489 1.00 4.78  ? 226 VAL A CG2 1 
ATOM   1705 N N   . ASP A 1 227 ? -2.527  27.522  -14.534 1.00 14.49 ? 227 ASP A N   1 
ATOM   1706 C CA  . ASP A 1 227 ? -2.169  26.624  -15.646 1.00 11.98 ? 227 ASP A CA  1 
ATOM   1707 C C   . ASP A 1 227 ? -2.965  25.319  -15.689 1.00 11.97 ? 227 ASP A C   1 
ATOM   1708 O O   . ASP A 1 227 ? -2.772  24.424  -16.542 1.00 10.76 ? 227 ASP A O   1 
ATOM   1709 C CB  . ASP A 1 227 ? -0.653  26.331  -15.539 1.00 12.17 ? 227 ASP A CB  1 
ATOM   1710 C CG  . ASP A 1 227 ? 0.249   27.561  -15.433 1.00 11.79 ? 227 ASP A CG  1 
ATOM   1711 O OD1 . ASP A 1 227 ? 0.285   28.302  -16.397 1.00 11.53 ? 227 ASP A OD1 1 
ATOM   1712 O OD2 . ASP A 1 227 ? 0.905   27.803  -14.420 1.00 6.87  ? 227 ASP A OD2 1 
ATOM   1713 N N   . GLY A 1 228 ? -3.853  25.195  -14.701 1.00 10.21 ? 228 GLY A N   1 
ATOM   1714 C CA  . GLY A 1 228 ? -4.709  24.042  -14.640 1.00 8.37  ? 228 GLY A CA  1 
ATOM   1715 C C   . GLY A 1 228 ? -5.120  23.762  -13.231 1.00 7.68  ? 228 GLY A C   1 
ATOM   1716 O O   . GLY A 1 228 ? -4.868  24.578  -12.329 1.00 8.83  ? 228 GLY A O   1 
ATOM   1717 N N   . PHE A 1 229 ? -5.703  22.579  -13.092 1.00 5.80  ? 229 PHE A N   1 
ATOM   1718 C CA  . PHE A 1 229 ? -6.337  22.109  -11.860 1.00 4.29  ? 229 PHE A CA  1 
ATOM   1719 C C   . PHE A 1 229 ? -5.913  20.663  -11.517 1.00 5.85  ? 229 PHE A C   1 
ATOM   1720 O O   . PHE A 1 229 ? -5.615  19.890  -12.462 1.00 6.03  ? 229 PHE A O   1 
ATOM   1721 C CB  . PHE A 1 229 ? -7.882  22.145  -12.025 1.00 2.00  ? 229 PHE A CB  1 
ATOM   1722 C CG  . PHE A 1 229 ? -8.467  23.433  -12.618 1.00 2.00  ? 229 PHE A CG  1 
ATOM   1723 C CD1 . PHE A 1 229 ? -8.690  24.537  -11.815 1.00 2.00  ? 229 PHE A CD1 1 
ATOM   1724 C CD2 . PHE A 1 229 ? -8.683  23.534  -13.975 1.00 2.00  ? 229 PHE A CD2 1 
ATOM   1725 C CE1 . PHE A 1 229 ? -9.098  25.731  -12.357 1.00 2.00  ? 229 PHE A CE1 1 
ATOM   1726 C CE2 . PHE A 1 229 ? -9.093  24.716  -14.523 1.00 2.00  ? 229 PHE A CE2 1 
ATOM   1727 C CZ  . PHE A 1 229 ? -9.286  25.818  -13.718 1.00 2.00  ? 229 PHE A CZ  1 
ATOM   1728 N N   . LEU A 1 230 ? -5.815  20.323  -10.192 1.00 4.96  ? 230 LEU A N   1 
ATOM   1729 C CA  . LEU A 1 230 ? -5.658  18.954  -9.622  1.00 2.00  ? 230 LEU A CA  1 
ATOM   1730 C C   . LEU A 1 230 ? -6.980  18.987  -8.899  1.00 2.00  ? 230 LEU A C   1 
ATOM   1731 O O   . LEU A 1 230 ? -7.146  19.742  -7.959  1.00 2.94  ? 230 LEU A O   1 
ATOM   1732 C CB  . LEU A 1 230 ? -4.559  18.843  -8.599  1.00 2.00  ? 230 LEU A CB  1 
ATOM   1733 C CG  . LEU A 1 230 ? -4.213  17.593  -7.846  1.00 2.00  ? 230 LEU A CG  1 
ATOM   1734 C CD1 . LEU A 1 230 ? -4.024  16.433  -8.750  1.00 2.00  ? 230 LEU A CD1 1 
ATOM   1735 C CD2 . LEU A 1 230 ? -2.899  17.815  -7.176  1.00 2.00  ? 230 LEU A CD2 1 
ATOM   1736 N N   . VAL A 1 231 ? -7.946  18.296  -9.498  1.00 3.20  ? 231 VAL A N   1 
ATOM   1737 C CA  . VAL A 1 231 ? -9.375  18.306  -9.249  1.00 2.00  ? 231 VAL A CA  1 
ATOM   1738 C C   . VAL A 1 231 ? -9.666  17.170  -8.279  1.00 4.25  ? 231 VAL A C   1 
ATOM   1739 O O   . VAL A 1 231 ? -9.132  16.059  -8.377  1.00 6.80  ? 231 VAL A O   1 
ATOM   1740 C CB  . VAL A 1 231 ? -10.058 18.103  -10.630 1.00 2.00  ? 231 VAL A CB  1 
ATOM   1741 C CG1 . VAL A 1 231 ? -11.424 18.549  -10.409 1.00 2.30  ? 231 VAL A CG1 1 
ATOM   1742 C CG2 . VAL A 1 231 ? -9.578  18.951  -11.806 1.00 2.00  ? 231 VAL A CG2 1 
ATOM   1743 N N   . GLY A 1 232 ? -10.526 17.335  -7.312  1.00 5.77  ? 232 GLY A N   1 
ATOM   1744 C CA  . GLY A 1 232 ? -10.788 16.270  -6.358  1.00 9.75  ? 232 GLY A CA  1 
ATOM   1745 C C   . GLY A 1 232 ? -11.914 15.335  -6.794  1.00 12.82 ? 232 GLY A C   1 
ATOM   1746 O O   . GLY A 1 232 ? -11.786 14.490  -7.670  1.00 13.35 ? 232 GLY A O   1 
ATOM   1747 N N   . GLY A 1 233 ? -13.066 15.619  -6.184  1.00 14.30 ? 233 GLY A N   1 
ATOM   1748 C CA  . GLY A 1 233 ? -14.298 14.870  -6.327  1.00 13.90 ? 233 GLY A CA  1 
ATOM   1749 C C   . GLY A 1 233 ? -15.090 15.221  -7.547  1.00 13.69 ? 233 GLY A C   1 
ATOM   1750 O O   . GLY A 1 233 ? -15.830 14.379  -8.028  1.00 20.79 ? 233 GLY A O   1 
ATOM   1751 N N   . ALA A 1 234 ? -14.969 16.418  -8.113  1.00 12.32 ? 234 ALA A N   1 
ATOM   1752 C CA  . ALA A 1 234 ? -15.659 16.778  -9.340  1.00 7.27  ? 234 ALA A CA  1 
ATOM   1753 C C   . ALA A 1 234 ? -15.209 15.834  -10.473 1.00 9.31  ? 234 ALA A C   1 
ATOM   1754 O O   . ALA A 1 234 ? -15.931 15.546  -11.437 1.00 12.23 ? 234 ALA A O   1 
ATOM   1755 C CB  . ALA A 1 234 ? -15.287 18.199  -9.577  1.00 2.00  ? 234 ALA A CB  1 
ATOM   1756 N N   . SER A 1 235 ? -14.013 15.252  -10.271 1.00 8.77  ? 235 SER A N   1 
ATOM   1757 C CA  . SER A 1 235 ? -13.321 14.381  -11.189 1.00 7.14  ? 235 SER A CA  1 
ATOM   1758 C C   . SER A 1 235 ? -13.871 12.983  -11.242 1.00 7.82  ? 235 SER A C   1 
ATOM   1759 O O   . SER A 1 235 ? -13.607 12.240  -12.177 1.00 12.39 ? 235 SER A O   1 
ATOM   1760 C CB  . SER A 1 235 ? -11.840 14.324  -10.806 1.00 7.28  ? 235 SER A CB  1 
ATOM   1761 O OG  . SER A 1 235 ? -11.532 13.299  -9.898  1.00 2.63  ? 235 SER A OG  1 
ATOM   1762 N N   . LEU A 1 236 ? -14.623 12.574  -10.247 1.00 7.84  ? 236 LEU A N   1 
ATOM   1763 C CA  . LEU A 1 236 ? -15.228 11.274  -10.293 1.00 6.63  ? 236 LEU A CA  1 
ATOM   1764 C C   . LEU A 1 236 ? -16.523 11.358  -11.068 1.00 10.67 ? 236 LEU A C   1 
ATOM   1765 O O   . LEU A 1 236 ? -17.281 10.389  -11.014 1.00 12.46 ? 236 LEU A O   1 
ATOM   1766 C CB  . LEU A 1 236 ? -15.486 10.847  -8.919  1.00 2.00  ? 236 LEU A CB  1 
ATOM   1767 C CG  . LEU A 1 236 ? -14.295 10.229  -8.320  1.00 2.00  ? 236 LEU A CG  1 
ATOM   1768 C CD1 . LEU A 1 236 ? -14.236 10.541  -6.858  1.00 2.00  ? 236 LEU A CD1 1 
ATOM   1769 C CD2 . LEU A 1 236 ? -14.323 8.745   -8.698  1.00 2.00  ? 236 LEU A CD2 1 
ATOM   1770 N N   . LYS A 1 237 ? -16.793 12.471  -11.790 1.00 12.28 ? 237 LYS A N   1 
ATOM   1771 C CA  . LYS A 1 237 ? -18.079 12.776  -12.425 1.00 11.59 ? 237 LYS A CA  1 
ATOM   1772 C C   . LYS A 1 237 ? -17.810 13.322  -13.820 1.00 6.21  ? 237 LYS A C   1 
ATOM   1773 O O   . LYS A 1 237 ? -16.657 13.713  -14.035 1.00 4.00  ? 237 LYS A O   1 
ATOM   1774 C CB  . LYS A 1 237 ? -18.867 13.872  -11.633 1.00 16.49 ? 237 LYS A CB  1 
ATOM   1775 C CG  . LYS A 1 237 ? -19.172 13.777  -10.135 1.00 21.71 ? 237 LYS A CG  1 
ATOM   1776 C CD  . LYS A 1 237 ? -19.585 15.203  -9.794  1.00 28.97 ? 237 LYS A CD  1 
ATOM   1777 C CE  . LYS A 1 237 ? -19.239 15.721  -8.385  1.00 34.04 ? 237 LYS A CE  1 
ATOM   1778 N NZ  . LYS A 1 237 ? -19.704 17.101  -8.241  1.00 38.19 ? 237 LYS A NZ  1 
ATOM   1779 N N   . PRO A 1 238 ? -18.801 13.472  -14.747 1.00 4.13  ? 238 PRO A N   1 
ATOM   1780 C CA  . PRO A 1 238 ? -18.671 13.949  -16.139 1.00 4.96  ? 238 PRO A CA  1 
ATOM   1781 C C   . PRO A 1 238 ? -18.418 15.434  -16.278 1.00 4.37  ? 238 PRO A C   1 
ATOM   1782 O O   . PRO A 1 238 ? -18.007 15.926  -17.311 1.00 5.45  ? 238 PRO A O   1 
ATOM   1783 C CB  . PRO A 1 238 ? -19.938 13.548  -16.832 1.00 4.69  ? 238 PRO A CB  1 
ATOM   1784 C CG  . PRO A 1 238 ? -20.446 12.480  -15.920 1.00 2.00  ? 238 PRO A CG  1 
ATOM   1785 C CD  . PRO A 1 238 ? -20.201 13.136  -14.584 1.00 2.97  ? 238 PRO A CD  1 
ATOM   1786 N N   . GLU A 1 239 ? -18.597 16.116  -15.157 1.00 5.54  ? 239 GLU A N   1 
ATOM   1787 C CA  . GLU A 1 239 ? -18.148 17.465  -14.882 1.00 5.92  ? 239 GLU A CA  1 
ATOM   1788 C C   . GLU A 1 239 ? -16.659 17.631  -15.162 1.00 5.94  ? 239 GLU A C   1 
ATOM   1789 O O   . GLU A 1 239 ? -16.228 18.672  -15.654 1.00 7.56  ? 239 GLU A O   1 
ATOM   1790 C CB  . GLU A 1 239 ? -18.484 17.699  -13.435 1.00 8.30  ? 239 GLU A CB  1 
ATOM   1791 C CG  . GLU A 1 239 ? -17.888 18.917  -12.758 1.00 12.46 ? 239 GLU A CG  1 
ATOM   1792 C CD  . GLU A 1 239 ? -18.901 19.464  -11.771 1.00 17.70 ? 239 GLU A CD  1 
ATOM   1793 O OE1 . GLU A 1 239 ? -19.064 18.909  -10.663 1.00 18.36 ? 239 GLU A OE1 1 
ATOM   1794 O OE2 . GLU A 1 239 ? -19.549 20.447  -12.154 1.00 18.96 ? 239 GLU A OE2 1 
ATOM   1795 N N   . PHE A 1 240 ? -15.818 16.653  -14.847 1.00 4.68  ? 240 PHE A N   1 
ATOM   1796 C CA  . PHE A 1 240 ? -14.422 16.697  -15.225 1.00 7.56  ? 240 PHE A CA  1 
ATOM   1797 C C   . PHE A 1 240 ? -14.320 17.069  -16.694 1.00 10.48 ? 240 PHE A C   1 
ATOM   1798 O O   . PHE A 1 240 ? -13.487 17.912  -17.014 1.00 14.09 ? 240 PHE A O   1 
ATOM   1799 C CB  . PHE A 1 240 ? -13.749 15.354  -15.056 1.00 6.89  ? 240 PHE A CB  1 
ATOM   1800 C CG  . PHE A 1 240 ? -12.217 15.340  -15.082 1.00 7.13  ? 240 PHE A CG  1 
ATOM   1801 C CD1 . PHE A 1 240 ? -11.441 16.220  -14.307 1.00 9.82  ? 240 PHE A CD1 1 
ATOM   1802 C CD2 . PHE A 1 240 ? -11.571 14.366  -15.831 1.00 8.50  ? 240 PHE A CD2 1 
ATOM   1803 C CE1 . PHE A 1 240 ? -10.036 16.114  -14.281 1.00 9.64  ? 240 PHE A CE1 1 
ATOM   1804 C CE2 . PHE A 1 240 ? -10.181 14.252  -15.815 1.00 9.50  ? 240 PHE A CE2 1 
ATOM   1805 C CZ  . PHE A 1 240 ? -9.415  15.126  -15.036 1.00 10.55 ? 240 PHE A CZ  1 
ATOM   1806 N N   . VAL A 1 241 ? -15.211 16.610  -17.584 1.00 9.17  ? 241 VAL A N   1 
ATOM   1807 C CA  . VAL A 1 241 ? -15.101 16.929  -18.999 1.00 9.60  ? 241 VAL A CA  1 
ATOM   1808 C C   . VAL A 1 241 ? -15.305 18.409  -19.244 1.00 10.27 ? 241 VAL A C   1 
ATOM   1809 O O   . VAL A 1 241 ? -14.666 19.042  -20.074 1.00 11.60 ? 241 VAL A O   1 
ATOM   1810 C CB  . VAL A 1 241 ? -16.119 16.097  -19.790 1.00 8.55  ? 241 VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 241 ? -16.013 16.240  -21.322 1.00 4.05  ? 241 VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 241 ? -15.812 14.662  -19.432 1.00 7.53  ? 241 VAL A CG2 1 
ATOM   1813 N N   . ASP A 1 242 ? -16.109 19.033  -18.432 1.00 12.21 ? 242 ASP A N   1 
ATOM   1814 C CA  . ASP A 1 242 ? -16.322 20.462  -18.505 1.00 14.61 ? 242 ASP A CA  1 
ATOM   1815 C C   . ASP A 1 242 ? -15.141 21.251  -17.960 1.00 16.05 ? 242 ASP A C   1 
ATOM   1816 O O   . ASP A 1 242 ? -14.827 22.346  -18.448 1.00 18.80 ? 242 ASP A O   1 
ATOM   1817 C CB  . ASP A 1 242 ? -17.632 20.719  -17.758 1.00 17.70 ? 242 ASP A CB  1 
ATOM   1818 C CG  . ASP A 1 242 ? -18.775 19.953  -18.469 1.00 21.21 ? 242 ASP A CG  1 
ATOM   1819 O OD1 . ASP A 1 242 ? -18.783 19.933  -19.716 1.00 20.72 ? 242 ASP A OD1 1 
ATOM   1820 O OD2 . ASP A 1 242 ? -19.636 19.372  -17.784 1.00 22.97 ? 242 ASP A OD2 1 
ATOM   1821 N N   . ILE A 1 243 ? -14.437 20.676  -16.974 1.00 14.90 ? 243 ILE A N   1 
ATOM   1822 C CA  . ILE A 1 243 ? -13.222 21.278  -16.397 1.00 12.70 ? 243 ILE A CA  1 
ATOM   1823 C C   . ILE A 1 243 ? -12.038 21.223  -17.409 1.00 11.85 ? 243 ILE A C   1 
ATOM   1824 O O   . ILE A 1 243 ? -11.301 22.189  -17.629 1.00 11.22 ? 243 ILE A O   1 
ATOM   1825 C CB  . ILE A 1 243 ? -13.021 20.482  -15.071 1.00 10.63 ? 243 ILE A CB  1 
ATOM   1826 C CG1 . ILE A 1 243 ? -14.124 20.887  -14.049 1.00 7.51  ? 243 ILE A CG1 1 
ATOM   1827 C CG2 . ILE A 1 243 ? -11.610 20.711  -14.564 1.00 10.26 ? 243 ILE A CG2 1 
ATOM   1828 C CD1 . ILE A 1 243 ? -14.195 20.160  -12.726 1.00 2.00  ? 243 ILE A CD1 1 
ATOM   1829 N N   . ILE A 1 244 ? -11.889 20.071  -18.078 1.00 9.45  ? 244 ILE A N   1 
ATOM   1830 C CA  . ILE A 1 244 ? -10.966 19.831  -19.174 1.00 8.18  ? 244 ILE A CA  1 
ATOM   1831 C C   . ILE A 1 244 ? -11.203 20.897  -20.219 1.00 10.40 ? 244 ILE A C   1 
ATOM   1832 O O   . ILE A 1 244 ? -10.248 21.563  -20.662 1.00 12.95 ? 244 ILE A O   1 
ATOM   1833 C CB  . ILE A 1 244 ? -11.225 18.416  -19.727 1.00 7.53  ? 244 ILE A CB  1 
ATOM   1834 C CG1 . ILE A 1 244 ? -10.658 17.379  -18.747 1.00 3.92  ? 244 ILE A CG1 1 
ATOM   1835 C CG2 . ILE A 1 244 ? -10.613 18.257  -21.092 1.00 7.64  ? 244 ILE A CG2 1 
ATOM   1836 C CD1 . ILE A 1 244 ? -10.972 15.950  -19.203 1.00 2.00  ? 244 ILE A CD1 1 
ATOM   1837 N N   . ASN A 1 245 ? -12.476 21.178  -20.532 1.00 11.63 ? 245 ASN A N   1 
ATOM   1838 C CA  . ASN A 1 245 ? -12.718 22.185  -21.538 1.00 11.94 ? 245 ASN A CA  1 
ATOM   1839 C C   . ASN A 1 245 ? -12.828 23.560  -21.010 1.00 13.47 ? 245 ASN A C   1 
ATOM   1840 O O   . ASN A 1 245 ? -13.262 24.452  -21.710 1.00 13.64 ? 245 ASN A O   1 
ATOM   1841 C CB  . ASN A 1 245 ? -13.938 21.878  -22.304 1.00 11.89 ? 245 ASN A CB  1 
ATOM   1842 C CG  . ASN A 1 245 ? -13.716 20.573  -23.045 1.00 18.34 ? 245 ASN A CG  1 
ATOM   1843 O OD1 . ASN A 1 245 ? -12.615 20.165  -23.406 1.00 20.01 ? 245 ASN A OD1 1 
ATOM   1844 N ND2 . ASN A 1 245 ? -14.765 19.805  -23.265 1.00 24.28 ? 245 ASN A ND2 1 
ATOM   1845 N N   . ALA A 1 246 ? -12.249 23.822  -19.855 1.00 17.24 ? 246 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 246 ? -12.406 25.131  -19.276 1.00 21.30 ? 246 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 246 ? -11.725 26.264  -20.010 1.00 23.14 ? 246 ALA A C   1 
ATOM   1848 O O   . ALA A 1 246 ? -11.960 27.421  -19.665 1.00 23.77 ? 246 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 246 ? -11.896 25.089  -17.849 1.00 20.30 ? 246 ALA A CB  1 
ATOM   1850 N N   . LYS A 1 247 ? -10.827 25.924  -20.951 1.00 28.15 ? 247 LYS A N   1 
ATOM   1851 C CA  . LYS A 1 247 ? -10.004 26.900  -21.706 1.00 31.89 ? 247 LYS A CA  1 
ATOM   1852 C C   . LYS A 1 247 ? -10.513 27.124  -23.154 1.00 31.53 ? 247 LYS A C   1 
ATOM   1853 O O   . LYS A 1 247 ? -9.891  27.792  -24.001 1.00 30.36 ? 247 LYS A O   1 
ATOM   1854 C CB  . LYS A 1 247 ? -8.527  26.378  -21.676 1.00 33.68 ? 247 LYS A CB  1 
ATOM   1855 C CG  . LYS A 1 247 ? -7.334  27.359  -21.796 1.00 38.39 ? 247 LYS A CG  1 
ATOM   1856 C CD  . LYS A 1 247 ? -7.282  28.418  -20.649 1.00 43.47 ? 247 LYS A CD  1 
ATOM   1857 C CE  . LYS A 1 247 ? -6.032  29.378  -20.569 1.00 46.06 ? 247 LYS A CE  1 
ATOM   1858 N NZ  . LYS A 1 247 ? -5.079  29.146  -19.469 1.00 45.49 ? 247 LYS A NZ  1 
ATOM   1859 N N   . GLN A 1 248 ? -11.600 26.398  -23.432 1.00 31.00 ? 248 GLN A N   1 
ATOM   1860 C CA  . GLN A 1 248 ? -12.293 26.553  -24.677 1.00 30.68 ? 248 GLN A CA  1 
ATOM   1861 C C   . GLN A 1 248 ? -13.446 27.482  -24.312 1.00 33.61 ? 248 GLN A C   1 
ATOM   1862 O O   . GLN A 1 248 ? -14.147 27.912  -25.236 1.00 39.86 ? 248 GLN A O   1 
ATOM   1863 C CB  . GLN A 1 248 ? -12.833 25.231  -25.197 1.00 28.10 ? 248 GLN A CB  1 
ATOM   1864 C CG  . GLN A 1 248 ? -11.781 24.336  -25.863 1.00 29.57 ? 248 GLN A CG  1 
ATOM   1865 C CD  . GLN A 1 248 ? -12.309 23.442  -27.015 1.00 31.30 ? 248 GLN A CD  1 
ATOM   1866 O OE1 . GLN A 1 248 ? -13.248 23.809  -27.731 1.00 32.92 ? 248 GLN A OE1 1 
ATOM   1867 N NE2 . GLN A 1 248 ? -11.765 22.255  -27.316 1.00 26.18 ? 248 GLN A NE2 1 
ATOM   1868 O OXT . GLN A 1 248 ? -13.614 27.818  -23.127 1.00 32.88 ? 248 GLN A OXT 1 
ATOM   1869 N N   . ALA B 1 1   ? -12.780 -24.606 14.854  1.00 63.62 ? 1   ALA B N   1 
ATOM   1870 C CA  . ALA B 1 1   ? -12.922 -25.878 14.169  1.00 63.65 ? 1   ALA B CA  1 
ATOM   1871 C C   . ALA B 1 1   ? -11.887 -26.817 14.858  1.00 64.11 ? 1   ALA B C   1 
ATOM   1872 O O   . ALA B 1 1   ? -11.304 -26.339 15.856  1.00 63.14 ? 1   ALA B O   1 
ATOM   1873 C CB  . ALA B 1 1   ? -12.605 -25.654 12.691  1.00 62.98 ? 1   ALA B CB  1 
ATOM   1874 N N   . PRO B 1 2   ? -11.644 -28.110 14.493  1.00 62.39 ? 2   PRO B N   1 
ATOM   1875 C CA  . PRO B 1 2   ? -10.512 -28.896 15.001  1.00 59.36 ? 2   PRO B CA  1 
ATOM   1876 C C   . PRO B 1 2   ? -9.194  -28.217 14.628  1.00 57.65 ? 2   PRO B C   1 
ATOM   1877 O O   . PRO B 1 2   ? -9.197  -27.297 13.799  1.00 57.86 ? 2   PRO B O   1 
ATOM   1878 C CB  . PRO B 1 2   ? -10.692 -30.264 14.372  1.00 60.47 ? 2   PRO B CB  1 
ATOM   1879 C CG  . PRO B 1 2   ? -12.187 -30.371 14.184  1.00 62.25 ? 2   PRO B CG  1 
ATOM   1880 C CD  . PRO B 1 2   ? -12.534 -28.966 13.697  1.00 61.86 ? 2   PRO B CD  1 
ATOM   1881 N N   . SER B 1 3   ? -8.113  -28.732 15.230  1.00 55.10 ? 3   SER B N   1 
ATOM   1882 C CA  . SER B 1 3   ? -6.716  -28.267 15.173  1.00 50.57 ? 3   SER B CA  1 
ATOM   1883 C C   . SER B 1 3   ? -6.192  -27.262 14.146  1.00 46.91 ? 3   SER B C   1 
ATOM   1884 O O   . SER B 1 3   ? -6.222  -27.481 12.928  1.00 48.31 ? 3   SER B O   1 
ATOM   1885 C CB  . SER B 1 3   ? -5.796  -29.489 15.102  1.00 50.55 ? 3   SER B CB  1 
ATOM   1886 O OG  . SER B 1 3   ? -6.522  -30.722 15.149  1.00 51.94 ? 3   SER B OG  1 
ATOM   1887 N N   . ARG B 1 4   ? -5.544  -26.260 14.730  1.00 42.47 ? 4   ARG B N   1 
ATOM   1888 C CA  . ARG B 1 4   ? -4.943  -25.101 14.087  1.00 37.41 ? 4   ARG B CA  1 
ATOM   1889 C C   . ARG B 1 4   ? -4.139  -25.382 12.822  1.00 33.60 ? 4   ARG B C   1 
ATOM   1890 O O   . ARG B 1 4   ? -2.960  -25.786 12.875  1.00 32.53 ? 4   ARG B O   1 
ATOM   1891 C CB  . ARG B 1 4   ? -4.085  -24.391 15.083  1.00 38.14 ? 4   ARG B CB  1 
ATOM   1892 C CG  . ARG B 1 4   ? -4.730  -23.245 15.762  1.00 40.16 ? 4   ARG B CG  1 
ATOM   1893 C CD  . ARG B 1 4   ? -4.416  -23.244 17.260  1.00 41.45 ? 4   ARG B CD  1 
ATOM   1894 N NE  . ARG B 1 4   ? -3.088  -23.719 17.647  1.00 41.77 ? 4   ARG B NE  1 
ATOM   1895 C CZ  . ARG B 1 4   ? -2.873  -24.271 18.838  1.00 40.48 ? 4   ARG B CZ  1 
ATOM   1896 N NH1 . ARG B 1 4   ? -3.833  -24.393 19.755  1.00 39.10 ? 4   ARG B NH1 1 
ATOM   1897 N NH2 . ARG B 1 4   ? -1.658  -24.692 19.129  1.00 41.55 ? 4   ARG B NH2 1 
ATOM   1898 N N   . LYS B 1 5   ? -4.894  -25.169 11.745  1.00 28.68 ? 5   LYS B N   1 
ATOM   1899 C CA  . LYS B 1 5   ? -4.478  -25.287 10.358  1.00 22.60 ? 5   LYS B CA  1 
ATOM   1900 C C   . LYS B 1 5   ? -3.162  -24.502 10.102  1.00 19.09 ? 5   LYS B C   1 
ATOM   1901 O O   . LYS B 1 5   ? -3.063  -23.325 10.487  1.00 17.03 ? 5   LYS B O   1 
ATOM   1902 C CB  . LYS B 1 5   ? -5.683  -24.807 9.571   1.00 19.67 ? 5   LYS B CB  1 
ATOM   1903 C CG  . LYS B 1 5   ? -5.553  -25.264 8.148   1.00 23.96 ? 5   LYS B CG  1 
ATOM   1904 C CD  . LYS B 1 5   ? -6.594  -24.789 7.135   1.00 21.77 ? 5   LYS B CD  1 
ATOM   1905 C CE  . LYS B 1 5   ? -6.267  -25.656 5.918   1.00 21.75 ? 5   LYS B CE  1 
ATOM   1906 N NZ  . LYS B 1 5   ? -6.988  -25.285 4.728   1.00 20.99 ? 5   LYS B NZ  1 
ATOM   1907 N N   . PHE B 1 6   ? -2.111  -25.068 9.513   1.00 14.50 ? 6   PHE B N   1 
ATOM   1908 C CA  . PHE B 1 6   ? -0.853  -24.331 9.418   1.00 13.10 ? 6   PHE B CA  1 
ATOM   1909 C C   . PHE B 1 6   ? -0.964  -23.176 8.394   1.00 13.73 ? 6   PHE B C   1 
ATOM   1910 O O   . PHE B 1 6   ? -1.605  -23.265 7.330   1.00 14.26 ? 6   PHE B O   1 
ATOM   1911 C CB  . PHE B 1 6   ? 0.201   -25.359 9.055   1.00 14.34 ? 6   PHE B CB  1 
ATOM   1912 C CG  . PHE B 1 6   ? 1.700   -25.013 9.085   1.00 12.86 ? 6   PHE B CG  1 
ATOM   1913 C CD1 . PHE B 1 6   ? 2.364   -24.853 10.310  1.00 9.65  ? 6   PHE B CD1 1 
ATOM   1914 C CD2 . PHE B 1 6   ? 2.419   -24.915 7.879   1.00 12.98 ? 6   PHE B CD2 1 
ATOM   1915 C CE1 . PHE B 1 6   ? 3.721   -24.607 10.350  1.00 5.70  ? 6   PHE B CE1 1 
ATOM   1916 C CE2 . PHE B 1 6   ? 3.785   -24.658 7.931   1.00 10.51 ? 6   PHE B CE2 1 
ATOM   1917 C CZ  . PHE B 1 6   ? 4.423   -24.511 9.159   1.00 9.40  ? 6   PHE B CZ  1 
ATOM   1918 N N   . PHE B 1 7   ? -0.328  -22.059 8.754   1.00 10.76 ? 7   PHE B N   1 
ATOM   1919 C CA  . PHE B 1 7   ? -0.426  -20.827 8.035   1.00 5.19  ? 7   PHE B CA  1 
ATOM   1920 C C   . PHE B 1 7   ? 0.924   -20.347 7.602   1.00 5.96  ? 7   PHE B C   1 
ATOM   1921 O O   . PHE B 1 7   ? 1.828   -20.164 8.413   1.00 2.00  ? 7   PHE B O   1 
ATOM   1922 C CB  . PHE B 1 7   ? -1.005  -19.822 8.925   1.00 3.36  ? 7   PHE B CB  1 
ATOM   1923 C CG  . PHE B 1 7   ? -1.689  -18.686 8.182   1.00 8.15  ? 7   PHE B CG  1 
ATOM   1924 C CD1 . PHE B 1 7   ? -2.939  -18.870 7.592   1.00 9.23  ? 7   PHE B CD1 1 
ATOM   1925 C CD2 . PHE B 1 7   ? -1.135  -17.410 8.231   1.00 7.83  ? 7   PHE B CD2 1 
ATOM   1926 C CE1 . PHE B 1 7   ? -3.626  -17.788 7.094   1.00 5.81  ? 7   PHE B CE1 1 
ATOM   1927 C CE2 . PHE B 1 7   ? -1.818  -16.320 7.731   1.00 5.63  ? 7   PHE B CE2 1 
ATOM   1928 C CZ  . PHE B 1 7   ? -3.066  -16.521 7.173   1.00 8.54  ? 7   PHE B CZ  1 
ATOM   1929 N N   . VAL B 1 8   ? 1.121   -20.159 6.306   1.00 6.95  ? 8   VAL B N   1 
ATOM   1930 C CA  . VAL B 1 8   ? 2.338   -19.509 5.857   1.00 5.29  ? 8   VAL B CA  1 
ATOM   1931 C C   . VAL B 1 8   ? 1.893   -18.426 4.899   1.00 2.67  ? 8   VAL B C   1 
ATOM   1932 O O   . VAL B 1 8   ? 1.218   -18.681 3.916   1.00 2.90  ? 8   VAL B O   1 
ATOM   1933 C CB  . VAL B 1 8   ? 3.380   -20.569 5.219   1.00 4.18  ? 8   VAL B CB  1 
ATOM   1934 C CG1 . VAL B 1 8   ? 2.691   -21.675 4.542   1.00 2.00  ? 8   VAL B CG1 1 
ATOM   1935 C CG2 . VAL B 1 8   ? 4.295   -19.906 4.204   1.00 2.00  ? 8   VAL B CG2 1 
ATOM   1936 N N   . GLY B 1 9   ? 2.160   -17.197 5.294   1.00 2.00  ? 9   GLY B N   1 
ATOM   1937 C CA  . GLY B 1 9   ? 1.856   -16.104 4.449   1.00 2.00  ? 9   GLY B CA  1 
ATOM   1938 C C   . GLY B 1 9   ? 3.171   -15.544 3.951   1.00 2.00  ? 9   GLY B C   1 
ATOM   1939 O O   . GLY B 1 9   ? 4.109   -15.440 4.737   1.00 5.02  ? 9   GLY B O   1 
ATOM   1940 N N   . GLY B 1 10  ? 3.327   -15.144 2.709   1.00 2.00  ? 10  GLY B N   1 
ATOM   1941 C CA  . GLY B 1 10  ? 4.534   -14.468 2.282   1.00 3.34  ? 10  GLY B CA  1 
ATOM   1942 C C   . GLY B 1 10  ? 4.341   -13.005 1.822   1.00 3.42  ? 10  GLY B C   1 
ATOM   1943 O O   . GLY B 1 10  ? 3.650   -12.674 0.843   1.00 2.00  ? 10  GLY B O   1 
ATOM   1944 N N   . ASN B 1 11  ? 4.985   -12.096 2.529   1.00 3.03  ? 11  ASN B N   1 
ATOM   1945 C CA  . ASN B 1 11  ? 4.901   -10.667 2.289   1.00 4.83  ? 11  ASN B CA  1 
ATOM   1946 C C   . ASN B 1 11  ? 6.036   -10.268 1.339   1.00 9.73  ? 11  ASN B C   1 
ATOM   1947 O O   . ASN B 1 11  ? 7.224   -10.392 1.692   1.00 13.54 ? 11  ASN B O   1 
ATOM   1948 C CB  . ASN B 1 11  ? 5.010   -10.042 3.649   1.00 2.00  ? 11  ASN B CB  1 
ATOM   1949 C CG  . ASN B 1 11  ? 5.105   -8.554  3.740   1.00 2.53  ? 11  ASN B CG  1 
ATOM   1950 O OD1 . ASN B 1 11  ? 4.912   -7.762  2.809   1.00 4.03  ? 11  ASN B OD1 1 
ATOM   1951 N ND2 . ASN B 1 11  ? 5.421   -8.130  4.946   1.00 4.74  ? 11  ASN B ND2 1 
ATOM   1952 N N   . TRP B 1 12  ? 5.730   -9.825  0.104   1.00 10.40 ? 12  TRP B N   1 
ATOM   1953 C CA  . TRP B 1 12  ? 6.777   -9.472  -0.833  1.00 10.47 ? 12  TRP B CA  1 
ATOM   1954 C C   . TRP B 1 12  ? 7.257   -8.019  -0.654  1.00 12.19 ? 12  TRP B C   1 
ATOM   1955 O O   . TRP B 1 12  ? 8.236   -7.557  -1.257  1.00 13.46 ? 12  TRP B O   1 
ATOM   1956 C CB  . TRP B 1 12  ? 6.273   -9.709  -2.249  1.00 11.24 ? 12  TRP B CB  1 
ATOM   1957 C CG  . TRP B 1 12  ? 5.799   -11.134 -2.562  1.00 10.45 ? 12  TRP B CG  1 
ATOM   1958 C CD1 . TRP B 1 12  ? 6.060   -12.210 -1.758  1.00 8.52  ? 12  TRP B CD1 1 
ATOM   1959 C CD2 . TRP B 1 12  ? 5.024   -11.476 -3.637  1.00 10.08 ? 12  TRP B CD2 1 
ATOM   1960 N NE1 . TRP B 1 12  ? 5.441   -13.226 -2.305  1.00 6.29  ? 12  TRP B NE1 1 
ATOM   1961 C CE2 . TRP B 1 12  ? 4.812   -12.842 -3.412  1.00 11.33 ? 12  TRP B CE2 1 
ATOM   1962 C CE3 . TRP B 1 12  ? 4.479   -10.838 -4.748  1.00 8.37  ? 12  TRP B CE3 1 
ATOM   1963 C CZ2 . TRP B 1 12  ? 4.035   -13.603 -4.295  1.00 17.88 ? 12  TRP B CZ2 1 
ATOM   1964 C CZ3 . TRP B 1 12  ? 3.711   -11.591 -5.621  1.00 13.48 ? 12  TRP B CZ3 1 
ATOM   1965 C CH2 . TRP B 1 12  ? 3.485   -12.961 -5.407  1.00 15.91 ? 12  TRP B CH2 1 
ATOM   1966 N N   . LYS B 1 13  ? 6.673   -7.250  0.274   1.00 10.63 ? 13  LYS B N   1 
ATOM   1967 C CA  . LYS B 1 13  ? 7.118   -5.889  0.608   1.00 8.27  ? 13  LYS B CA  1 
ATOM   1968 C C   . LYS B 1 13  ? 7.198   -5.060  -0.677  1.00 7.13  ? 13  LYS B C   1 
ATOM   1969 O O   . LYS B 1 13  ? 6.452   -5.363  -1.626  1.00 7.26  ? 13  LYS B O   1 
ATOM   1970 C CB  . LYS B 1 13  ? 8.461   -6.023  1.379   1.00 5.31  ? 13  LYS B CB  1 
ATOM   1971 C CG  . LYS B 1 13  ? 8.380   -7.251  2.320   1.00 5.24  ? 13  LYS B CG  1 
ATOM   1972 C CD  . LYS B 1 13  ? 9.358   -7.519  3.437   1.00 9.47  ? 13  LYS B CD  1 
ATOM   1973 C CE  . LYS B 1 13  ? 8.955   -6.640  4.631   1.00 12.40 ? 13  LYS B CE  1 
ATOM   1974 N NZ  . LYS B 1 13  ? 9.894   -6.563  5.759   1.00 5.94  ? 13  LYS B NZ  1 
ATOM   1975 N N   . MET B 1 14  ? 8.015   -4.052  -0.865  1.00 5.34  ? 14  MET B N   1 
ATOM   1976 C CA  . MET B 1 14  ? 7.950   -3.298  -2.115  1.00 3.32  ? 14  MET B CA  1 
ATOM   1977 C C   . MET B 1 14  ? 8.991   -3.873  -3.050  1.00 3.33  ? 14  MET B C   1 
ATOM   1978 O O   . MET B 1 14  ? 9.975   -3.226  -3.387  1.00 2.00  ? 14  MET B O   1 
ATOM   1979 C CB  . MET B 1 14  ? 8.214   -1.869  -1.740  1.00 4.22  ? 14  MET B CB  1 
ATOM   1980 C CG  . MET B 1 14  ? 8.339   -0.790  -2.767  1.00 4.06  ? 14  MET B CG  1 
ATOM   1981 S SD  . MET B 1 14  ? 8.797   0.646   -1.802  1.00 4.14  ? 14  MET B SD  1 
ATOM   1982 C CE  . MET B 1 14  ? 10.497  0.920   -2.217  1.00 3.72  ? 14  MET B CE  1 
ATOM   1983 N N   . ASN B 1 15  ? 8.859   -5.137  -3.399  1.00 3.31  ? 15  ASN B N   1 
ATOM   1984 C CA  . ASN B 1 15  ? 9.817   -5.767  -4.264  1.00 2.58  ? 15  ASN B CA  1 
ATOM   1985 C C   . ASN B 1 15  ? 9.068   -6.274  -5.473  1.00 3.15  ? 15  ASN B C   1 
ATOM   1986 O O   . ASN B 1 15  ? 7.888   -6.619  -5.420  1.00 4.21  ? 15  ASN B O   1 
ATOM   1987 C CB  . ASN B 1 15  ? 10.536  -6.955  -3.578  1.00 3.69  ? 15  ASN B CB  1 
ATOM   1988 C CG  . ASN B 1 15  ? 11.639  -6.708  -2.517  1.00 8.26  ? 15  ASN B CG  1 
ATOM   1989 O OD1 . ASN B 1 15  ? 12.822  -6.417  -2.745  1.00 10.13 ? 15  ASN B OD1 1 
ATOM   1990 N ND2 . ASN B 1 15  ? 11.378  -6.838  -1.238  1.00 11.95 ? 15  ASN B ND2 1 
ATOM   1991 N N   . GLY B 1 16  ? 9.708   -6.178  -6.633  1.00 4.80  ? 16  GLY B N   1 
ATOM   1992 C CA  . GLY B 1 16  ? 9.228   -6.840  -7.825  1.00 2.00  ? 16  GLY B CA  1 
ATOM   1993 C C   . GLY B 1 16  ? 8.401   -6.102  -8.832  1.00 2.00  ? 16  GLY B C   1 
ATOM   1994 O O   . GLY B 1 16  ? 7.641   -5.181  -8.589  1.00 3.06  ? 16  GLY B O   1 
ATOM   1995 N N   . ARG B 1 17  ? 8.667   -6.524  -10.047 1.00 2.37  ? 17  ARG B N   1 
ATOM   1996 C CA  . ARG B 1 17  ? 7.872   -6.044  -11.143 1.00 8.30  ? 17  ARG B CA  1 
ATOM   1997 C C   . ARG B 1 17  ? 7.020   -7.227  -11.599 1.00 10.49 ? 17  ARG B C   1 
ATOM   1998 O O   . ARG B 1 17  ? 7.051   -8.315  -11.010 1.00 7.88  ? 17  ARG B O   1 
ATOM   1999 C CB  . ARG B 1 17  ? 8.742   -5.541  -12.309 1.00 4.29  ? 17  ARG B CB  1 
ATOM   2000 C CG  . ARG B 1 17  ? 9.710   -4.468  -11.977 1.00 2.00  ? 17  ARG B CG  1 
ATOM   2001 C CD  . ARG B 1 17  ? 9.056   -3.305  -11.318 1.00 2.57  ? 17  ARG B CD  1 
ATOM   2002 N NE  . ARG B 1 17  ? 10.054  -2.360  -10.826 1.00 9.61  ? 17  ARG B NE  1 
ATOM   2003 C CZ  . ARG B 1 17  ? 10.561  -2.406  -9.585  1.00 10.47 ? 17  ARG B CZ  1 
ATOM   2004 N NH1 . ARG B 1 17  ? 10.162  -3.328  -8.700  1.00 11.96 ? 17  ARG B NH1 1 
ATOM   2005 N NH2 . ARG B 1 17  ? 11.534  -1.561  -9.250  1.00 9.27  ? 17  ARG B NH2 1 
ATOM   2006 N N   . LYS B 1 18  ? 6.260   -7.049  -12.687 1.00 12.48 ? 18  LYS B N   1 
ATOM   2007 C CA  . LYS B 1 18  ? 5.406   -8.081  -13.238 1.00 13.44 ? 18  LYS B CA  1 
ATOM   2008 C C   . LYS B 1 18  ? 6.165   -9.274  -13.775 1.00 17.23 ? 18  LYS B C   1 
ATOM   2009 O O   . LYS B 1 18  ? 5.579   -10.343 -13.757 1.00 21.92 ? 18  LYS B O   1 
ATOM   2010 C CB  . LYS B 1 18  ? 4.547   -7.505  -14.360 1.00 10.80 ? 18  LYS B CB  1 
ATOM   2011 C CG  . LYS B 1 18  ? 3.446   -6.657  -13.778 1.00 6.13  ? 18  LYS B CG  1 
ATOM   2012 C CD  . LYS B 1 18  ? 2.647   -6.104  -14.859 1.00 2.00  ? 18  LYS B CD  1 
ATOM   2013 C CE  . LYS B 1 18  ? 1.425   -5.484  -14.244 1.00 2.00  ? 18  LYS B CE  1 
ATOM   2014 N NZ  . LYS B 1 18  ? 0.643   -4.822  -15.276 1.00 2.00  ? 18  LYS B NZ  1 
ATOM   2015 N N   . GLN B 1 19  ? 7.428   -9.143  -14.236 1.00 19.85 ? 19  GLN B N   1 
ATOM   2016 C CA  . GLN B 1 19  ? 8.282   -10.202 -14.808 1.00 19.14 ? 19  GLN B CA  1 
ATOM   2017 C C   . GLN B 1 19  ? 8.876   -11.135 -13.741 1.00 16.94 ? 19  GLN B C   1 
ATOM   2018 O O   . GLN B 1 19  ? 8.739   -12.362 -13.759 1.00 13.24 ? 19  GLN B O   1 
ATOM   2019 C CB  . GLN B 1 19  ? 9.347   -9.457  -15.610 1.00 23.65 ? 19  GLN B CB  1 
ATOM   2020 C CG  . GLN B 1 19  ? 10.066  -10.183 -16.764 1.00 28.32 ? 19  GLN B CG  1 
ATOM   2021 C CD  . GLN B 1 19  ? 11.547  -10.427 -16.473 1.00 33.10 ? 19  GLN B CD  1 
ATOM   2022 O OE1 . GLN B 1 19  ? 11.925  -10.674 -15.313 1.00 33.28 ? 19  GLN B OE1 1 
ATOM   2023 N NE2 . GLN B 1 19  ? 12.405  -10.356 -17.502 1.00 34.02 ? 19  GLN B NE2 1 
ATOM   2024 N N   . SER B 1 20  ? 9.554   -10.552 -12.774 1.00 16.42 ? 20  SER B N   1 
ATOM   2025 C CA  . SER B 1 20  ? 9.946   -11.306 -11.604 1.00 18.48 ? 20  SER B CA  1 
ATOM   2026 C C   . SER B 1 20  ? 8.744   -11.918 -10.885 1.00 19.34 ? 20  SER B C   1 
ATOM   2027 O O   . SER B 1 20  ? 8.828   -13.068 -10.419 1.00 18.57 ? 20  SER B O   1 
ATOM   2028 C CB  . SER B 1 20  ? 10.691  -10.391 -10.666 1.00 19.07 ? 20  SER B CB  1 
ATOM   2029 O OG  . SER B 1 20  ? 10.308  -9.023  -10.784 1.00 17.10 ? 20  SER B OG  1 
ATOM   2030 N N   . LEU B 1 21  ? 7.627   -11.156 -10.820 1.00 19.48 ? 21  LEU B N   1 
ATOM   2031 C CA  . LEU B 1 21  ? 6.399   -11.596 -10.139 1.00 20.57 ? 21  LEU B CA  1 
ATOM   2032 C C   . LEU B 1 21  ? 5.701   -12.722 -10.831 1.00 20.88 ? 21  LEU B C   1 
ATOM   2033 O O   . LEU B 1 21  ? 5.406   -13.742 -10.222 1.00 19.92 ? 21  LEU B O   1 
ATOM   2034 C CB  . LEU B 1 21  ? 5.371   -10.491 -10.003 1.00 18.81 ? 21  LEU B CB  1 
ATOM   2035 C CG  . LEU B 1 21  ? 5.204   -9.873  -8.621  1.00 18.03 ? 21  LEU B CG  1 
ATOM   2036 C CD1 . LEU B 1 21  ? 6.461   -9.984  -7.727  1.00 11.91 ? 21  LEU B CD1 1 
ATOM   2037 C CD2 . LEU B 1 21  ? 4.749   -8.455  -8.899  1.00 15.71 ? 21  LEU B CD2 1 
ATOM   2038 N N   . GLY B 1 22  ? 5.517   -12.495 -12.123 1.00 21.73 ? 22  GLY B N   1 
ATOM   2039 C CA  . GLY B 1 22  ? 4.994   -13.448 -13.068 1.00 21.77 ? 22  GLY B CA  1 
ATOM   2040 C C   . GLY B 1 22  ? 5.825   -14.686 -12.887 1.00 21.91 ? 22  GLY B C   1 
ATOM   2041 O O   . GLY B 1 22  ? 5.240   -15.675 -12.480 1.00 26.38 ? 22  GLY B O   1 
ATOM   2042 N N   . GLU B 1 23  ? 7.150   -14.682 -13.008 1.00 22.78 ? 23  GLU B N   1 
ATOM   2043 C CA  . GLU B 1 23  ? 7.917   -15.904 -12.814 1.00 24.27 ? 23  GLU B CA  1 
ATOM   2044 C C   . GLU B 1 23  ? 7.785   -16.574 -11.434 1.00 24.80 ? 23  GLU B C   1 
ATOM   2045 O O   . GLU B 1 23  ? 7.533   -17.789 -11.379 1.00 26.67 ? 23  GLU B O   1 
ATOM   2046 C CB  . GLU B 1 23  ? 9.346   -15.571 -13.152 1.00 24.77 ? 23  GLU B CB  1 
ATOM   2047 C CG  . GLU B 1 23  ? 9.817   -16.266 -14.465 1.00 29.95 ? 23  GLU B CG  1 
ATOM   2048 C CD  . GLU B 1 23  ? 9.012   -16.185 -15.780 1.00 30.66 ? 23  GLU B CD  1 
ATOM   2049 O OE1 . GLU B 1 23  ? 8.520   -15.111 -16.174 1.00 29.89 ? 23  GLU B OE1 1 
ATOM   2050 O OE2 . GLU B 1 23  ? 8.906   -17.236 -16.421 1.00 30.60 ? 23  GLU B OE2 1 
ATOM   2051 N N   . LEU B 1 24  ? 7.833   -15.845 -10.310 1.00 22.13 ? 24  LEU B N   1 
ATOM   2052 C CA  . LEU B 1 24  ? 7.559   -16.381 -8.967  1.00 19.17 ? 24  LEU B CA  1 
ATOM   2053 C C   . LEU B 1 24  ? 6.183   -17.032 -8.833  1.00 18.82 ? 24  LEU B C   1 
ATOM   2054 O O   . LEU B 1 24  ? 5.992   -18.050 -8.135  1.00 19.07 ? 24  LEU B O   1 
ATOM   2055 C CB  . LEU B 1 24  ? 7.662   -15.240 -7.958  1.00 20.76 ? 24  LEU B CB  1 
ATOM   2056 C CG  . LEU B 1 24  ? 7.240   -15.238 -6.481  1.00 17.64 ? 24  LEU B CG  1 
ATOM   2057 C CD1 . LEU B 1 24  ? 7.834   -16.398 -5.670  1.00 17.63 ? 24  LEU B CD1 1 
ATOM   2058 C CD2 . LEU B 1 24  ? 7.694   -13.884 -5.950  1.00 16.00 ? 24  LEU B CD2 1 
ATOM   2059 N N   . ILE B 1 25  ? 5.195   -16.379 -9.480  1.00 15.84 ? 25  ILE B N   1 
ATOM   2060 C CA  . ILE B 1 25  ? 3.851   -16.894 -9.543  1.00 10.57 ? 25  ILE B CA  1 
ATOM   2061 C C   . ILE B 1 25  ? 3.957   -18.218 -10.277 1.00 12.77 ? 25  ILE B C   1 
ATOM   2062 O O   . ILE B 1 25  ? 3.283   -19.145 -9.850  1.00 15.85 ? 25  ILE B O   1 
ATOM   2063 C CB  . ILE B 1 25  ? 2.997   -15.839 -10.226 1.00 4.61  ? 25  ILE B CB  1 
ATOM   2064 C CG1 . ILE B 1 25  ? 2.755   -14.704 -9.195  1.00 4.60  ? 25  ILE B CG1 1 
ATOM   2065 C CG2 . ILE B 1 25  ? 1.685   -16.413 -10.659 1.00 6.33  ? 25  ILE B CG2 1 
ATOM   2066 C CD1 . ILE B 1 25  ? 1.942   -13.407 -9.445  1.00 2.00  ? 25  ILE B CD1 1 
ATOM   2067 N N   . GLY B 1 26  ? 4.846   -18.440 -11.251 1.00 11.85 ? 26  GLY B N   1 
ATOM   2068 C CA  . GLY B 1 26  ? 5.001   -19.731 -11.899 1.00 13.63 ? 26  GLY B CA  1 
ATOM   2069 C C   . GLY B 1 26  ? 5.568   -20.790 -10.946 1.00 14.99 ? 26  GLY B C   1 
ATOM   2070 O O   . GLY B 1 26  ? 5.050   -21.900 -10.892 1.00 14.31 ? 26  GLY B O   1 
ATOM   2071 N N   . THR B 1 27  ? 6.624   -20.517 -10.190 1.00 16.79 ? 27  THR B N   1 
ATOM   2072 C CA  . THR B 1 27  ? 7.210   -21.422 -9.209  1.00 19.71 ? 27  THR B CA  1 
ATOM   2073 C C   . THR B 1 27  ? 6.104   -21.885 -8.258  1.00 21.71 ? 27  THR B C   1 
ATOM   2074 O O   . THR B 1 27  ? 5.910   -23.086 -8.086  1.00 23.57 ? 27  THR B O   1 
ATOM   2075 C CB  . THR B 1 27  ? 8.294   -20.679 -8.377  1.00 23.14 ? 27  THR B CB  1 
ATOM   2076 O OG1 . THR B 1 27  ? 9.012   -19.841 -9.275  1.00 26.56 ? 27  THR B OG1 1 
ATOM   2077 C CG2 . THR B 1 27  ? 9.280   -21.594 -7.692  1.00 26.74 ? 27  THR B CG2 1 
ATOM   2078 N N   . LEU B 1 28  ? 5.335   -20.951 -7.657  1.00 23.07 ? 28  LEU B N   1 
ATOM   2079 C CA  . LEU B 1 28  ? 4.292   -21.252 -6.672  1.00 22.42 ? 28  LEU B CA  1 
ATOM   2080 C C   . LEU B 1 28  ? 3.100   -22.018 -7.212  1.00 20.77 ? 28  LEU B C   1 
ATOM   2081 O O   . LEU B 1 28  ? 2.607   -22.997 -6.654  1.00 21.72 ? 28  LEU B O   1 
ATOM   2082 C CB  . LEU B 1 28  ? 3.707   -19.990 -6.022  1.00 22.95 ? 28  LEU B CB  1 
ATOM   2083 C CG  . LEU B 1 28  ? 4.481   -19.067 -5.076  1.00 20.59 ? 28  LEU B CG  1 
ATOM   2084 C CD1 . LEU B 1 28  ? 3.458   -18.556 -4.093  1.00 20.30 ? 28  LEU B CD1 1 
ATOM   2085 C CD2 . LEU B 1 28  ? 5.529   -19.758 -4.247  1.00 20.23 ? 28  LEU B CD2 1 
ATOM   2086 N N   . ASN B 1 29  ? 2.658   -21.603 -8.370  1.00 19.47 ? 29  ASN B N   1 
ATOM   2087 C CA  . ASN B 1 29  ? 1.577   -22.272 -9.021  1.00 20.01 ? 29  ASN B CA  1 
ATOM   2088 C C   . ASN B 1 29  ? 2.032   -23.681 -9.384  1.00 23.73 ? 29  ASN B C   1 
ATOM   2089 O O   . ASN B 1 29  ? 1.248   -24.443 -9.940  1.00 26.41 ? 29  ASN B O   1 
ATOM   2090 C CB  . ASN B 1 29  ? 1.173   -21.464 -10.263 1.00 15.57 ? 29  ASN B CB  1 
ATOM   2091 C CG  . ASN B 1 29  ? 0.170   -20.320 -10.080 1.00 16.91 ? 29  ASN B CG  1 
ATOM   2092 O OD1 . ASN B 1 29  ? -0.093  -19.748 -9.018  1.00 14.21 ? 29  ASN B OD1 1 
ATOM   2093 N ND2 . ASN B 1 29  ? -0.490  -19.926 -11.152 1.00 20.18 ? 29  ASN B ND2 1 
ATOM   2094 N N   . ALA B 1 30  ? 3.283   -24.089 -9.148  1.00 28.00 ? 30  ALA B N   1 
ATOM   2095 C CA  . ALA B 1 30  ? 3.757   -25.419 -9.479  1.00 31.88 ? 30  ALA B CA  1 
ATOM   2096 C C   . ALA B 1 30  ? 4.495   -26.090 -8.336  1.00 34.03 ? 30  ALA B C   1 
ATOM   2097 O O   . ALA B 1 30  ? 5.129   -27.137 -8.491  1.00 36.40 ? 30  ALA B O   1 
ATOM   2098 C CB  . ALA B 1 30  ? 4.686   -25.333 -10.674 1.00 33.94 ? 30  ALA B CB  1 
ATOM   2099 N N   . ALA B 1 31  ? 4.476   -25.504 -7.154  1.00 36.98 ? 31  ALA B N   1 
ATOM   2100 C CA  . ALA B 1 31  ? 5.069   -26.157 -6.001  1.00 39.14 ? 31  ALA B CA  1 
ATOM   2101 C C   . ALA B 1 31  ? 3.939   -27.009 -5.371  1.00 41.47 ? 31  ALA B C   1 
ATOM   2102 O O   . ALA B 1 31  ? 2.734   -26.755 -5.585  1.00 40.41 ? 31  ALA B O   1 
ATOM   2103 C CB  . ALA B 1 31  ? 5.580   -25.088 -5.025  1.00 38.08 ? 31  ALA B CB  1 
ATOM   2104 N N   . LYS B 1 32  ? 4.278   -28.063 -4.592  1.00 43.38 ? 32  LYS B N   1 
ATOM   2105 C CA  . LYS B 1 32  ? 3.263   -28.942 -4.013  1.00 42.28 ? 32  LYS B CA  1 
ATOM   2106 C C   . LYS B 1 32  ? 2.855   -28.239 -2.760  1.00 42.44 ? 32  LYS B C   1 
ATOM   2107 O O   . LYS B 1 32  ? 3.723   -27.954 -1.922  1.00 40.45 ? 32  LYS B O   1 
ATOM   2108 C CB  . LYS B 1 32  ? 3.796   -30.297 -3.589  1.00 43.14 ? 32  LYS B CB  1 
ATOM   2109 C CG  . LYS B 1 32  ? 2.676   -31.241 -3.131  1.00 43.79 ? 32  LYS B CG  1 
ATOM   2110 C CD  . LYS B 1 32  ? 3.239   -32.465 -2.403  1.00 42.63 ? 32  LYS B CD  1 
ATOM   2111 C CE  . LYS B 1 32  ? 2.669   -32.575 -0.998  1.00 41.20 ? 32  LYS B CE  1 
ATOM   2112 N NZ  . LYS B 1 32  ? 1.249   -32.850 -1.059  1.00 41.03 ? 32  LYS B NZ  1 
ATOM   2113 N N   . VAL B 1 33  ? 1.577   -27.879 -2.715  1.00 43.53 ? 33  VAL B N   1 
ATOM   2114 C CA  . VAL B 1 33  ? 1.105   -27.313 -1.478  1.00 47.23 ? 33  VAL B CA  1 
ATOM   2115 C C   . VAL B 1 33  ? 0.295   -28.360 -0.728  1.00 48.80 ? 33  VAL B C   1 
ATOM   2116 O O   . VAL B 1 33  ? -0.715  -28.854 -1.264  1.00 47.88 ? 33  VAL B O   1 
ATOM   2117 C CB  . VAL B 1 33  ? 0.289   -26.044 -1.782  1.00 47.31 ? 33  VAL B CB  1 
ATOM   2118 C CG1 . VAL B 1 33  ? -0.824  -25.686 -0.752  1.00 48.89 ? 33  VAL B CG1 1 
ATOM   2119 C CG2 . VAL B 1 33  ? 1.364   -24.956 -1.747  1.00 46.01 ? 33  VAL B CG2 1 
ATOM   2120 N N   . PRO B 1 34  ? 0.747   -28.733 0.501   1.00 49.66 ? 34  PRO B N   1 
ATOM   2121 C CA  . PRO B 1 34  ? 0.036   -29.695 1.337   1.00 51.52 ? 34  PRO B CA  1 
ATOM   2122 C C   . PRO B 1 34  ? -1.307  -29.152 1.837   1.00 51.36 ? 34  PRO B C   1 
ATOM   2123 O O   . PRO B 1 34  ? -1.368  -27.983 2.194   1.00 54.82 ? 34  PRO B O   1 
ATOM   2124 C CB  . PRO B 1 34  ? 1.016   -30.035 2.476   1.00 50.28 ? 34  PRO B CB  1 
ATOM   2125 C CG  . PRO B 1 34  ? 2.168   -29.065 2.412   1.00 49.36 ? 34  PRO B CG  1 
ATOM   2126 C CD  . PRO B 1 34  ? 1.933   -28.194 1.178   1.00 48.26 ? 34  PRO B CD  1 
ATOM   2127 N N   . ALA B 1 35  ? -2.413  -29.900 1.947   1.00 50.53 ? 35  ALA B N   1 
ATOM   2128 C CA  . ALA B 1 35  ? -3.652  -29.355 2.524   1.00 50.35 ? 35  ALA B CA  1 
ATOM   2129 C C   . ALA B 1 35  ? -3.525  -29.112 4.029   1.00 49.85 ? 35  ALA B C   1 
ATOM   2130 O O   . ALA B 1 35  ? -4.457  -28.767 4.750   1.00 51.05 ? 35  ALA B O   1 
ATOM   2131 C CB  . ALA B 1 35  ? -4.810  -30.304 2.319   1.00 51.74 ? 35  ALA B CB  1 
ATOM   2132 N N   . ASP B 1 36  ? -2.331  -29.484 4.485   1.00 46.34 ? 36  ASP B N   1 
ATOM   2133 C CA  . ASP B 1 36  ? -1.767  -29.163 5.769   1.00 43.73 ? 36  ASP B CA  1 
ATOM   2134 C C   . ASP B 1 36  ? -1.895  -27.658 5.966   1.00 40.01 ? 36  ASP B C   1 
ATOM   2135 O O   . ASP B 1 36  ? -2.346  -27.112 6.980   1.00 40.90 ? 36  ASP B O   1 
ATOM   2136 C CB  . ASP B 1 36  ? -0.308  -29.636 5.685   1.00 47.45 ? 36  ASP B CB  1 
ATOM   2137 C CG  . ASP B 1 36  ? 0.608   -29.565 6.910   1.00 51.27 ? 36  ASP B CG  1 
ATOM   2138 O OD1 . ASP B 1 36  ? 1.135   -28.482 7.200   1.00 51.49 ? 36  ASP B OD1 1 
ATOM   2139 O OD2 . ASP B 1 36  ? 0.819   -30.613 7.544   1.00 52.37 ? 36  ASP B OD2 1 
ATOM   2140 N N   . THR B 1 37  ? -1.512  -27.033 4.881   1.00 35.81 ? 37  THR B N   1 
ATOM   2141 C CA  . THR B 1 37  ? -1.285  -25.632 4.832   1.00 32.04 ? 37  THR B CA  1 
ATOM   2142 C C   . THR B 1 37  ? -2.289  -24.768 4.070   1.00 28.97 ? 37  THR B C   1 
ATOM   2143 O O   . THR B 1 37  ? -2.943  -25.140 3.095   1.00 28.60 ? 37  THR B O   1 
ATOM   2144 C CB  . THR B 1 37  ? 0.157   -25.596 4.323   1.00 32.77 ? 37  THR B CB  1 
ATOM   2145 O OG1 . THR B 1 37  ? 0.945   -26.526 5.060   1.00 33.28 ? 37  THR B OG1 1 
ATOM   2146 C CG2 . THR B 1 37  ? 0.787   -24.281 4.576   1.00 36.61 ? 37  THR B CG2 1 
ATOM   2147 N N   . GLU B 1 38  ? -2.385  -23.559 4.594   1.00 26.50 ? 38  GLU B N   1 
ATOM   2148 C CA  . GLU B 1 38  ? -3.152  -22.454 4.076   1.00 24.33 ? 38  GLU B CA  1 
ATOM   2149 C C   . GLU B 1 38  ? -2.087  -21.402 3.840   1.00 22.90 ? 38  GLU B C   1 
ATOM   2150 O O   . GLU B 1 38  ? -1.428  -20.923 4.775   1.00 23.44 ? 38  GLU B O   1 
ATOM   2151 C CB  . GLU B 1 38  ? -4.088  -21.997 5.127   1.00 29.70 ? 38  GLU B CB  1 
ATOM   2152 C CG  . GLU B 1 38  ? -5.096  -20.898 4.833   1.00 33.30 ? 38  GLU B CG  1 
ATOM   2153 C CD  . GLU B 1 38  ? -5.915  -20.558 6.085   1.00 34.84 ? 38  GLU B CD  1 
ATOM   2154 O OE1 . GLU B 1 38  ? -6.239  -21.439 6.884   1.00 35.38 ? 38  GLU B OE1 1 
ATOM   2155 O OE2 . GLU B 1 38  ? -6.230  -19.391 6.278   1.00 37.89 ? 38  GLU B OE2 1 
ATOM   2156 N N   . VAL B 1 39  ? -1.894  -21.094 2.564   1.00 20.23 ? 39  VAL B N   1 
ATOM   2157 C CA  . VAL B 1 39  ? -0.903  -20.130 2.102   1.00 16.08 ? 39  VAL B CA  1 
ATOM   2158 C C   . VAL B 1 39  ? -1.531  -18.871 1.534   1.00 13.98 ? 39  VAL B C   1 
ATOM   2159 O O   . VAL B 1 39  ? -2.426  -18.909 0.685   1.00 15.32 ? 39  VAL B O   1 
ATOM   2160 C CB  . VAL B 1 39  ? 0.043   -20.673 0.978   1.00 12.75 ? 39  VAL B CB  1 
ATOM   2161 C CG1 . VAL B 1 39  ? 1.121   -21.442 1.596   1.00 7.98  ? 39  VAL B CG1 1 
ATOM   2162 C CG2 . VAL B 1 39  ? -0.666  -21.614 0.028   1.00 11.33 ? 39  VAL B CG2 1 
ATOM   2163 N N   . VAL B 1 40  ? -1.010  -17.734 1.962   1.00 12.57 ? 40  VAL B N   1 
ATOM   2164 C CA  . VAL B 1 40  ? -1.482  -16.427 1.508   1.00 10.31 ? 40  VAL B CA  1 
ATOM   2165 C C   . VAL B 1 40  ? -0.255  -15.667 1.018   1.00 7.07  ? 40  VAL B C   1 
ATOM   2166 O O   . VAL B 1 40  ? 0.850   -15.815 1.522   1.00 5.92  ? 40  VAL B O   1 
ATOM   2167 C CB  . VAL B 1 40  ? -2.176  -15.634 2.682   1.00 9.46  ? 40  VAL B CB  1 
ATOM   2168 C CG1 . VAL B 1 40  ? -2.996  -14.534 2.083   1.00 4.83  ? 40  VAL B CG1 1 
ATOM   2169 C CG2 . VAL B 1 40  ? -3.115  -16.505 3.492   1.00 5.95  ? 40  VAL B CG2 1 
ATOM   2170 N N   . CYS B 1 41  ? -0.399  -14.807 0.053   1.00 6.59  ? 41  CYS B N   1 
ATOM   2171 C CA  . CYS B 1 41  ? 0.711   -14.062 -0.456  1.00 6.45  ? 41  CYS B CA  1 
ATOM   2172 C C   . CYS B 1 41  ? 0.331   -12.592 -0.513  1.00 4.36  ? 41  CYS B C   1 
ATOM   2173 O O   . CYS B 1 41  ? -0.624  -12.264 -1.210  1.00 2.23  ? 41  CYS B O   1 
ATOM   2174 C CB  . CYS B 1 41  ? 1.066   -14.509 -1.876  1.00 9.53  ? 41  CYS B CB  1 
ATOM   2175 S SG  . CYS B 1 41  ? 2.016   -16.015 -2.177  1.00 12.21 ? 41  CYS B SG  1 
ATOM   2176 N N   . ALA B 1 42  ? 1.061   -11.727 0.179   1.00 2.60  ? 42  ALA B N   1 
ATOM   2177 C CA  . ALA B 1 42  ? 0.959   -10.305 0.049   1.00 2.24  ? 42  ALA B CA  1 
ATOM   2178 C C   . ALA B 1 42  ? 1.805   -9.760  -1.155  1.00 3.74  ? 42  ALA B C   1 
ATOM   2179 O O   . ALA B 1 42  ? 3.048   -9.671  -1.080  1.00 3.87  ? 42  ALA B O   1 
ATOM   2180 C CB  . ALA B 1 42  ? 1.405   -9.768  1.398   1.00 2.00  ? 42  ALA B CB  1 
ATOM   2181 N N   . PRO B 1 43  ? 1.278   -9.432  -2.354  1.00 3.83  ? 43  PRO B N   1 
ATOM   2182 C CA  . PRO B 1 43  ? 2.034   -8.755  -3.410  1.00 4.69  ? 43  PRO B CA  1 
ATOM   2183 C C   . PRO B 1 43  ? 2.229   -7.288  -3.047  1.00 7.09  ? 43  PRO B C   1 
ATOM   2184 O O   . PRO B 1 43  ? 1.639   -6.897  -2.040  1.00 11.24 ? 43  PRO B O   1 
ATOM   2185 C CB  . PRO B 1 43  ? 1.224   -8.990  -4.644  1.00 2.00  ? 43  PRO B CB  1 
ATOM   2186 C CG  . PRO B 1 43  ? -0.145  -8.990  -4.067  1.00 3.21  ? 43  PRO B CG  1 
ATOM   2187 C CD  . PRO B 1 43  ? -0.030  -9.822  -2.841  1.00 2.00  ? 43  PRO B CD  1 
ATOM   2188 N N   . PRO B 1 44  ? 3.087   -6.440  -3.669  1.00 7.81  ? 44  PRO B N   1 
ATOM   2189 C CA  . PRO B 1 44  ? 3.073   -4.996  -3.479  1.00 6.38  ? 44  PRO B CA  1 
ATOM   2190 C C   . PRO B 1 44  ? 1.737   -4.514  -3.960  1.00 6.97  ? 44  PRO B C   1 
ATOM   2191 O O   . PRO B 1 44  ? 1.215   -5.078  -4.928  1.00 10.81 ? 44  PRO B O   1 
ATOM   2192 C CB  . PRO B 1 44  ? 4.226   -4.486  -4.289  1.00 5.48  ? 44  PRO B CB  1 
ATOM   2193 C CG  . PRO B 1 44  ? 4.632   -5.635  -5.202  1.00 5.94  ? 44  PRO B CG  1 
ATOM   2194 C CD  . PRO B 1 44  ? 4.326   -6.837  -4.347  1.00 7.74  ? 44  PRO B CD  1 
ATOM   2195 N N   . THR B 1 45  ? 1.199   -3.474  -3.364  1.00 5.31  ? 45  THR B N   1 
ATOM   2196 C CA  . THR B 1 45  ? -0.110  -2.979  -3.725  1.00 4.97  ? 45  THR B CA  1 
ATOM   2197 C C   . THR B 1 45  ? -0.366  -2.546  -5.181  1.00 5.84  ? 45  THR B C   1 
ATOM   2198 O O   . THR B 1 45  ? -1.492  -2.651  -5.658  1.00 11.49 ? 45  THR B O   1 
ATOM   2199 C CB  . THR B 1 45  ? -0.343  -1.898  -2.695  1.00 2.00  ? 45  THR B CB  1 
ATOM   2200 O OG1 . THR B 1 45  ? -0.192  -2.676  -1.506  1.00 11.05 ? 45  THR B OG1 1 
ATOM   2201 C CG2 . THR B 1 45  ? -1.666  -1.158  -2.681  1.00 2.00  ? 45  THR B CG2 1 
ATOM   2202 N N   . ALA B 1 46  ? 0.547   -2.076  -6.011  1.00 4.45  ? 46  ALA B N   1 
ATOM   2203 C CA  . ALA B 1 46  ? 0.199   -1.809  -7.391  1.00 4.43  ? 46  ALA B CA  1 
ATOM   2204 C C   . ALA B 1 46  ? -0.222  -3.141  -8.034  1.00 6.81  ? 46  ALA B C   1 
ATOM   2205 O O   . ALA B 1 46  ? -1.096  -3.132  -8.899  1.00 9.11  ? 46  ALA B O   1 
ATOM   2206 C CB  . ALA B 1 46  ? 1.412   -1.214  -8.125  1.00 2.00  ? 46  ALA B CB  1 
ATOM   2207 N N   . TYR B 1 47  ? 0.265   -4.325  -7.586  1.00 7.88  ? 47  TYR B N   1 
ATOM   2208 C CA  . TYR B 1 47  ? -0.110  -5.584  -8.227  1.00 6.69  ? 47  TYR B CA  1 
ATOM   2209 C C   . TYR B 1 47  ? -0.996  -6.554  -7.406  1.00 6.11  ? 47  TYR B C   1 
ATOM   2210 O O   . TYR B 1 47  ? -0.841  -7.791  -7.526  1.00 3.66  ? 47  TYR B O   1 
ATOM   2211 C CB  . TYR B 1 47  ? 1.142   -6.368  -8.692  1.00 5.89  ? 47  TYR B CB  1 
ATOM   2212 C CG  . TYR B 1 47  ? 2.289   -5.599  -9.340  1.00 10.22 ? 47  TYR B CG  1 
ATOM   2213 C CD1 . TYR B 1 47  ? 2.242   -5.167  -10.673 1.00 10.21 ? 47  TYR B CD1 1 
ATOM   2214 C CD2 . TYR B 1 47  ? 3.416   -5.287  -8.565  1.00 8.95  ? 47  TYR B CD2 1 
ATOM   2215 C CE1 . TYR B 1 47  ? 3.313   -4.456  -11.224 1.00 3.55  ? 47  TYR B CE1 1 
ATOM   2216 C CE2 . TYR B 1 47  ? 4.488   -4.589  -9.114  1.00 5.17  ? 47  TYR B CE2 1 
ATOM   2217 C CZ  . TYR B 1 47  ? 4.404   -4.179  -10.424 1.00 6.02  ? 47  TYR B CZ  1 
ATOM   2218 O OH  . TYR B 1 47  ? 5.477   -3.531  -10.944 1.00 10.74 ? 47  TYR B OH  1 
ATOM   2219 N N   . ILE B 1 48  ? -2.021  -6.133  -6.637  1.00 2.74  ? 48  ILE B N   1 
ATOM   2220 C CA  . ILE B 1 48  ? -2.864  -7.141  -5.971  1.00 2.00  ? 48  ILE B CA  1 
ATOM   2221 C C   . ILE B 1 48  ? -3.659  -7.869  -7.040  1.00 2.00  ? 48  ILE B C   1 
ATOM   2222 O O   . ILE B 1 48  ? -3.752  -9.095  -7.002  1.00 2.00  ? 48  ILE B O   1 
ATOM   2223 C CB  . ILE B 1 48  ? -3.863  -6.504  -4.979  1.00 4.97  ? 48  ILE B CB  1 
ATOM   2224 C CG1 . ILE B 1 48  ? -3.076  -5.965  -3.822  1.00 3.76  ? 48  ILE B CG1 1 
ATOM   2225 C CG2 . ILE B 1 48  ? -4.957  -7.489  -4.497  1.00 5.38  ? 48  ILE B CG2 1 
ATOM   2226 C CD1 . ILE B 1 48  ? -3.709  -4.563  -3.599  1.00 2.00  ? 48  ILE B CD1 1 
ATOM   2227 N N   . ASP B 1 49  ? -4.232  -7.128  -8.007  1.00 2.00  ? 49  ASP B N   1 
ATOM   2228 C CA  . ASP B 1 49  ? -5.037  -7.736  -9.080  1.00 4.95  ? 49  ASP B CA  1 
ATOM   2229 C C   . ASP B 1 49  ? -4.295  -8.647  -10.070 1.00 4.46  ? 49  ASP B C   1 
ATOM   2230 O O   . ASP B 1 49  ? -4.733  -9.776  -10.301 1.00 2.41  ? 49  ASP B O   1 
ATOM   2231 C CB  . ASP B 1 49  ? -5.751  -6.622  -9.834  1.00 7.92  ? 49  ASP B CB  1 
ATOM   2232 C CG  . ASP B 1 49  ? -6.944  -7.007  -10.718 1.00 13.96 ? 49  ASP B CG  1 
ATOM   2233 O OD1 . ASP B 1 49  ? -7.714  -7.957  -10.412 1.00 11.58 ? 49  ASP B OD1 1 
ATOM   2234 O OD2 . ASP B 1 49  ? -7.098  -6.286  -11.721 1.00 16.21 ? 49  ASP B OD2 1 
ATOM   2235 N N   . PHE B 1 50  ? -3.185  -8.173  -10.648 1.00 4.26  ? 50  PHE B N   1 
ATOM   2236 C CA  . PHE B 1 50  ? -2.243  -8.930  -11.466 1.00 5.50  ? 50  PHE B CA  1 
ATOM   2237 C C   . PHE B 1 50  ? -2.079  -10.336 -10.936 1.00 7.35  ? 50  PHE B C   1 
ATOM   2238 O O   . PHE B 1 50  ? -2.224  -11.356 -11.606 1.00 6.82  ? 50  PHE B O   1 
ATOM   2239 C CB  . PHE B 1 50  ? -0.843  -8.262  -11.437 1.00 7.59  ? 50  PHE B CB  1 
ATOM   2240 C CG  . PHE B 1 50  ? 0.299   -9.052  -12.093 1.00 9.84  ? 50  PHE B CG  1 
ATOM   2241 C CD1 . PHE B 1 50  ? 0.436   -9.070  -13.491 1.00 9.19  ? 50  PHE B CD1 1 
ATOM   2242 C CD2 . PHE B 1 50  ? 1.192   -9.790  -11.309 1.00 7.93  ? 50  PHE B CD2 1 
ATOM   2243 C CE1 . PHE B 1 50  ? 1.459   -9.827  -14.057 1.00 8.46  ? 50  PHE B CE1 1 
ATOM   2244 C CE2 . PHE B 1 50  ? 2.206   -10.547 -11.902 1.00 8.27  ? 50  PHE B CE2 1 
ATOM   2245 C CZ  . PHE B 1 50  ? 2.347   -10.571 -13.273 1.00 6.82  ? 50  PHE B CZ  1 
ATOM   2246 N N   . ALA B 1 51  ? -1.669  -10.252 -9.668  1.00 9.03  ? 51  ALA B N   1 
ATOM   2247 C CA  . ALA B 1 51  ? -1.307  -11.379 -8.855  1.00 6.18  ? 51  ALA B CA  1 
ATOM   2248 C C   . ALA B 1 51  ? -2.500  -12.237 -8.689  1.00 4.18  ? 51  ALA B C   1 
ATOM   2249 O O   . ALA B 1 51  ? -2.360  -13.437 -8.861  1.00 2.45  ? 51  ALA B O   1 
ATOM   2250 C CB  . ALA B 1 51  ? -0.824  -10.930 -7.461  1.00 8.27  ? 51  ALA B CB  1 
ATOM   2251 N N   . ARG B 1 52  ? -3.668  -11.661 -8.410  1.00 6.18  ? 52  ARG B N   1 
ATOM   2252 C CA  . ARG B 1 52  ? -4.814  -12.505 -8.189  1.00 6.31  ? 52  ARG B CA  1 
ATOM   2253 C C   . ARG B 1 52  ? -5.210  -13.128 -9.471  1.00 5.93  ? 52  ARG B C   1 
ATOM   2254 O O   . ARG B 1 52  ? -5.527  -14.276 -9.391  1.00 9.63  ? 52  ARG B O   1 
ATOM   2255 C CB  . ARG B 1 52  ? -5.972  -11.728 -7.624  1.00 8.66  ? 52  ARG B CB  1 
ATOM   2256 C CG  . ARG B 1 52  ? -7.257  -12.522 -7.250  1.00 11.81 ? 52  ARG B CG  1 
ATOM   2257 C CD  . ARG B 1 52  ? -7.161  -13.671 -6.249  1.00 11.12 ? 52  ARG B CD  1 
ATOM   2258 N NE  . ARG B 1 52  ? -6.388  -14.787 -6.797  1.00 13.77 ? 52  ARG B NE  1 
ATOM   2259 C CZ  . ARG B 1 52  ? -5.880  -15.749 -5.998  1.00 17.44 ? 52  ARG B CZ  1 
ATOM   2260 N NH1 . ARG B 1 52  ? -6.101  -15.703 -4.654  1.00 18.39 ? 52  ARG B NH1 1 
ATOM   2261 N NH2 . ARG B 1 52  ? -5.113  -16.723 -6.535  1.00 12.39 ? 52  ARG B NH2 1 
ATOM   2262 N N   . GLN B 1 53  ? -5.163  -12.489 -10.625 1.00 8.35  ? 53  GLN B N   1 
ATOM   2263 C CA  . GLN B 1 53  ? -5.455  -13.065 -11.928 1.00 7.94  ? 53  GLN B CA  1 
ATOM   2264 C C   . GLN B 1 53  ? -4.585  -14.284 -12.157 1.00 9.98  ? 53  GLN B C   1 
ATOM   2265 O O   . GLN B 1 53  ? -5.040  -15.358 -12.470 1.00 12.88 ? 53  GLN B O   1 
ATOM   2266 C CB  . GLN B 1 53  ? -5.150  -12.048 -13.023 1.00 9.03  ? 53  GLN B CB  1 
ATOM   2267 C CG  . GLN B 1 53  ? -5.925  -10.743 -12.989 1.00 12.11 ? 53  GLN B CG  1 
ATOM   2268 C CD  . GLN B 1 53  ? -5.313  -9.564  -13.760 1.00 18.23 ? 53  GLN B CD  1 
ATOM   2269 O OE1 . GLN B 1 53  ? -4.228  -9.492  -14.364 1.00 17.44 ? 53  GLN B OE1 1 
ATOM   2270 N NE2 . GLN B 1 53  ? -6.112  -8.514  -13.728 1.00 25.86 ? 53  GLN B NE2 1 
ATOM   2271 N N   . LYS B 1 54  ? -3.283  -14.106 -12.071 1.00 13.48 ? 54  LYS B N   1 
ATOM   2272 C CA  . LYS B 1 54  ? -2.287  -15.139 -12.250 1.00 14.05 ? 54  LYS B CA  1 
ATOM   2273 C C   . LYS B 1 54  ? -2.231  -16.289 -11.237 1.00 15.68 ? 54  LYS B C   1 
ATOM   2274 O O   . LYS B 1 54  ? -2.057  -17.468 -11.585 1.00 21.14 ? 54  LYS B O   1 
ATOM   2275 C CB  . LYS B 1 54  ? -0.916  -14.492 -12.276 1.00 13.23 ? 54  LYS B CB  1 
ATOM   2276 C CG  . LYS B 1 54  ? -0.736  -13.449 -13.344 1.00 15.73 ? 54  LYS B CG  1 
ATOM   2277 C CD  . LYS B 1 54  ? -0.575  -13.993 -14.745 1.00 14.90 ? 54  LYS B CD  1 
ATOM   2278 C CE  . LYS B 1 54  ? -1.303  -12.930 -15.525 1.00 17.12 ? 54  LYS B CE  1 
ATOM   2279 N NZ  . LYS B 1 54  ? -1.482  -13.286 -16.911 1.00 18.67 ? 54  LYS B NZ  1 
ATOM   2280 N N   . LEU B 1 55  ? -2.271  -16.026 -9.957  1.00 14.29 ? 55  LEU B N   1 
ATOM   2281 C CA  . LEU B 1 55  ? -2.063  -17.078 -8.981  1.00 12.96 ? 55  LEU B CA  1 
ATOM   2282 C C   . LEU B 1 55  ? -3.114  -18.186 -8.972  1.00 13.93 ? 55  LEU B C   1 
ATOM   2283 O O   . LEU B 1 55  ? -4.277  -18.049 -9.410  1.00 10.46 ? 55  LEU B O   1 
ATOM   2284 C CB  . LEU B 1 55  ? -1.977  -16.366 -7.698  1.00 7.08  ? 55  LEU B CB  1 
ATOM   2285 C CG  . LEU B 1 55  ? -1.106  -16.845 -6.632  1.00 5.72  ? 55  LEU B CG  1 
ATOM   2286 C CD1 . LEU B 1 55  ? 0.296   -17.311 -7.000  1.00 6.18  ? 55  LEU B CD1 1 
ATOM   2287 C CD2 . LEU B 1 55  ? -0.989  -15.602 -5.835  1.00 8.69  ? 55  LEU B CD2 1 
ATOM   2288 N N   . ASP B 1 56  ? -2.642  -19.340 -8.495  1.00 16.08 ? 56  ASP B N   1 
ATOM   2289 C CA  . ASP B 1 56  ? -3.568  -20.457 -8.368  1.00 20.27 ? 56  ASP B CA  1 
ATOM   2290 C C   . ASP B 1 56  ? -4.617  -20.089 -7.297  1.00 19.59 ? 56  ASP B C   1 
ATOM   2291 O O   . ASP B 1 56  ? -4.244  -19.563 -6.240  1.00 19.24 ? 56  ASP B O   1 
ATOM   2292 C CB  . ASP B 1 56  ? -2.875  -21.806 -7.928  1.00 20.33 ? 56  ASP B CB  1 
ATOM   2293 C CG  . ASP B 1 56  ? -3.741  -23.043 -8.296  1.00 21.79 ? 56  ASP B CG  1 
ATOM   2294 O OD1 . ASP B 1 56  ? -3.726  -23.475 -9.457  1.00 19.73 ? 56  ASP B OD1 1 
ATOM   2295 O OD2 . ASP B 1 56  ? -4.480  -23.551 -7.444  1.00 20.95 ? 56  ASP B OD2 1 
ATOM   2296 N N   . PRO B 1 57  ? -5.917  -20.414 -7.483  1.00 19.09 ? 57  PRO B N   1 
ATOM   2297 C CA  . PRO B 1 57  ? -6.975  -20.343 -6.472  1.00 16.58 ? 57  PRO B CA  1 
ATOM   2298 C C   . PRO B 1 57  ? -6.601  -20.839 -5.105  1.00 15.36 ? 57  PRO B C   1 
ATOM   2299 O O   . PRO B 1 57  ? -7.307  -20.580 -4.151  1.00 16.87 ? 57  PRO B O   1 
ATOM   2300 C CB  . PRO B 1 57  ? -8.101  -21.150 -7.030  1.00 18.13 ? 57  PRO B CB  1 
ATOM   2301 C CG  . PRO B 1 57  ? -8.006  -21.001 -8.524  1.00 20.59 ? 57  PRO B CG  1 
ATOM   2302 C CD  . PRO B 1 57  ? -6.501  -20.784 -8.789  1.00 20.51 ? 57  PRO B CD  1 
ATOM   2303 N N   . LYS B 1 58  ? -5.560  -21.634 -4.966  1.00 14.63 ? 58  LYS B N   1 
ATOM   2304 C CA  . LYS B 1 58  ? -5.191  -22.134 -3.667  1.00 15.11 ? 58  LYS B CA  1 
ATOM   2305 C C   . LYS B 1 58  ? -4.173  -21.344 -2.899  1.00 16.59 ? 58  LYS B C   1 
ATOM   2306 O O   . LYS B 1 58  ? -3.779  -21.724 -1.781  1.00 17.97 ? 58  LYS B O   1 
ATOM   2307 C CB  . LYS B 1 58  ? -4.724  -23.546 -3.811  1.00 16.15 ? 58  LYS B CB  1 
ATOM   2308 C CG  . LYS B 1 58  ? -5.982  -24.342 -4.168  1.00 22.01 ? 58  LYS B CG  1 
ATOM   2309 C CD  . LYS B 1 58  ? -7.167  -24.082 -3.212  1.00 20.61 ? 58  LYS B CD  1 
ATOM   2310 C CE  . LYS B 1 58  ? -8.515  -24.535 -3.837  1.00 25.65 ? 58  LYS B CE  1 
ATOM   2311 N NZ  . LYS B 1 58  ? -8.817  -23.883 -5.106  1.00 23.09 ? 58  LYS B NZ  1 
ATOM   2312 N N   . ILE B 1 59  ? -3.683  -20.266 -3.507  1.00 13.75 ? 59  ILE B N   1 
ATOM   2313 C CA  . ILE B 1 59  ? -2.851  -19.371 -2.758  1.00 10.48 ? 59  ILE B CA  1 
ATOM   2314 C C   . ILE B 1 59  ? -3.773  -18.132 -2.731  1.00 12.24 ? 59  ILE B C   1 
ATOM   2315 O O   . ILE B 1 59  ? -4.350  -17.664 -3.724  1.00 10.42 ? 59  ILE B O   1 
ATOM   2316 C CB  . ILE B 1 59  ? -1.518  -19.197 -3.514  1.00 7.29  ? 59  ILE B CB  1 
ATOM   2317 C CG1 . ILE B 1 59  ? -0.768  -20.469 -3.702  1.00 5.12  ? 59  ILE B CG1 1 
ATOM   2318 C CG2 . ILE B 1 59  ? -0.563  -18.484 -2.630  1.00 4.67  ? 59  ILE B CG2 1 
ATOM   2319 C CD1 . ILE B 1 59  ? -0.449  -20.736 -5.148  1.00 5.03  ? 59  ILE B CD1 1 
ATOM   2320 N N   . ALA B 1 60  ? -4.036  -17.704 -1.496  1.00 13.23 ? 60  ALA B N   1 
ATOM   2321 C CA  . ALA B 1 60  ? -4.844  -16.520 -1.199  1.00 14.82 ? 60  ALA B CA  1 
ATOM   2322 C C   . ALA B 1 60  ? -4.039  -15.224 -1.413  1.00 14.01 ? 60  ALA B C   1 
ATOM   2323 O O   . ALA B 1 60  ? -2.850  -15.209 -1.059  1.00 16.33 ? 60  ALA B O   1 
ATOM   2324 C CB  . ALA B 1 60  ? -5.304  -16.566 0.251   1.00 11.49 ? 60  ALA B CB  1 
ATOM   2325 N N   . VAL B 1 61  ? -4.606  -14.147 -1.980  1.00 9.68  ? 61  VAL B N   1 
ATOM   2326 C CA  . VAL B 1 61  ? -3.891  -12.902 -2.166  1.00 6.45  ? 61  VAL B CA  1 
ATOM   2327 C C   . VAL B 1 61  ? -4.271  -12.056 -0.975  1.00 5.00  ? 61  VAL B C   1 
ATOM   2328 O O   . VAL B 1 61  ? -5.437  -12.059 -0.576  1.00 5.84  ? 61  VAL B O   1 
ATOM   2329 C CB  . VAL B 1 61  ? -4.304  -12.203 -3.492  1.00 7.15  ? 61  VAL B CB  1 
ATOM   2330 C CG1 . VAL B 1 61  ? -3.740  -10.822 -3.720  1.00 4.04  ? 61  VAL B CG1 1 
ATOM   2331 C CG2 . VAL B 1 61  ? -3.663  -13.025 -4.565  1.00 8.52  ? 61  VAL B CG2 1 
ATOM   2332 N N   . ALA B 1 62  ? -3.271  -11.362 -0.431  1.00 2.98  ? 62  ALA B N   1 
ATOM   2333 C CA  . ALA B 1 62  ? -3.327  -10.503 0.723   1.00 4.69  ? 62  ALA B CA  1 
ATOM   2334 C C   . ALA B 1 62  ? -2.792  -9.103  0.412   1.00 7.22  ? 62  ALA B C   1 
ATOM   2335 O O   . ALA B 1 62  ? -1.834  -8.993  -0.340  1.00 8.22  ? 62  ALA B O   1 
ATOM   2336 C CB  . ALA B 1 62  ? -2.500  -11.093 1.792   1.00 2.00  ? 62  ALA B CB  1 
ATOM   2337 N N   . ALA B 1 63  ? -3.372  -7.976  0.868   1.00 11.77 ? 63  ALA B N   1 
ATOM   2338 C CA  . ALA B 1 63  ? -2.855  -6.645  0.528   1.00 10.39 ? 63  ALA B CA  1 
ATOM   2339 C C   . ALA B 1 63  ? -1.929  -6.274  1.662   1.00 11.19 ? 63  ALA B C   1 
ATOM   2340 O O   . ALA B 1 63  ? -2.088  -6.856  2.747   1.00 12.81 ? 63  ALA B O   1 
ATOM   2341 C CB  . ALA B 1 63  ? -3.942  -5.652  0.497   1.00 8.42  ? 63  ALA B CB  1 
ATOM   2342 N N   . GLN B 1 64  ? -0.963  -5.361  1.493   1.00 9.59  ? 64  GLN B N   1 
ATOM   2343 C CA  . GLN B 1 64  ? -0.029  -5.099  2.600   1.00 7.66  ? 64  GLN B CA  1 
ATOM   2344 C C   . GLN B 1 64  ? -0.395  -4.137  3.708   1.00 4.86  ? 64  GLN B C   1 
ATOM   2345 O O   . GLN B 1 64  ? 0.264   -4.067  4.727   1.00 4.53  ? 64  GLN B O   1 
ATOM   2346 C CB  . GLN B 1 64  ? 1.289   -4.654  2.021   1.00 6.24  ? 64  GLN B CB  1 
ATOM   2347 C CG  . GLN B 1 64  ? 2.084   -5.787  1.445   1.00 4.45  ? 64  GLN B CG  1 
ATOM   2348 C CD  . GLN B 1 64  ? 3.066   -5.223  0.467   1.00 9.60  ? 64  GLN B CD  1 
ATOM   2349 O OE1 . GLN B 1 64  ? 3.126   -4.002  0.153   1.00 11.78 ? 64  GLN B OE1 1 
ATOM   2350 N NE2 . GLN B 1 64  ? 3.836   -6.196  -0.009  1.00 9.65  ? 64  GLN B NE2 1 
ATOM   2351 N N   . ASN B 1 65  ? -1.367  -3.303  3.441   1.00 5.43  ? 65  ASN B N   1 
ATOM   2352 C CA  . ASN B 1 65  ? -1.930  -2.369  4.386   1.00 3.45  ? 65  ASN B CA  1 
ATOM   2353 C C   . ASN B 1 65  ? -3.226  -1.870  3.753   1.00 6.09  ? 65  ASN B C   1 
ATOM   2354 O O   . ASN B 1 65  ? -3.379  -2.048  2.534   1.00 8.40  ? 65  ASN B O   1 
ATOM   2355 C CB  . ASN B 1 65  ? -1.044  -1.199  4.586   1.00 2.00  ? 65  ASN B CB  1 
ATOM   2356 C CG  . ASN B 1 65  ? -1.538  -0.433  5.769   1.00 2.00  ? 65  ASN B CG  1 
ATOM   2357 O OD1 . ASN B 1 65  ? -2.433  -0.874  6.470   1.00 9.66  ? 65  ASN B OD1 1 
ATOM   2358 N ND2 . ASN B 1 65  ? -1.031  0.737   6.095   1.00 5.03  ? 65  ASN B ND2 1 
ATOM   2359 N N   . CYS B 1 66  ? -4.188  -1.270  4.466   1.00 6.82  ? 66  CYS B N   1 
ATOM   2360 C CA  . CYS B 1 66  ? -5.428  -0.700  3.929   1.00 3.11  ? 66  CYS B CA  1 
ATOM   2361 C C   . CYS B 1 66  ? -5.802  0.423   4.914   1.00 3.74  ? 66  CYS B C   1 
ATOM   2362 O O   . CYS B 1 66  ? -5.135  0.584   5.962   1.00 2.00  ? 66  CYS B O   1 
ATOM   2363 C CB  . CYS B 1 66  ? -6.491  -1.773  3.907   1.00 2.00  ? 66  CYS B CB  1 
ATOM   2364 S SG  . CYS B 1 66  ? -7.004  -2.368  5.550   1.00 6.51  ? 66  CYS B SG  1 
ATOM   2365 N N   . TYR B 1 67  ? -6.827  1.233   4.577   1.00 3.95  ? 67  TYR B N   1 
ATOM   2366 C CA  . TYR B 1 67  ? -7.304  2.280   5.456   1.00 2.75  ? 67  TYR B CA  1 
ATOM   2367 C C   . TYR B 1 67  ? -8.667  1.922   6.100   1.00 5.35  ? 67  TYR B C   1 
ATOM   2368 O O   . TYR B 1 67  ? -9.375  0.984   5.692   1.00 4.93  ? 67  TYR B O   1 
ATOM   2369 C CB  . TYR B 1 67  ? -7.372  3.527   4.642   1.00 2.00  ? 67  TYR B CB  1 
ATOM   2370 C CG  . TYR B 1 67  ? -7.323  4.728   5.563   1.00 3.98  ? 67  TYR B CG  1 
ATOM   2371 C CD1 . TYR B 1 67  ? -6.203  4.982   6.361   1.00 2.00  ? 67  TYR B CD1 1 
ATOM   2372 C CD2 . TYR B 1 67  ? -8.430  5.584   5.625   1.00 7.58  ? 67  TYR B CD2 1 
ATOM   2373 C CE1 . TYR B 1 67  ? -6.183  6.085   7.219   1.00 2.00  ? 67  TYR B CE1 1 
ATOM   2374 C CE2 . TYR B 1 67  ? -8.409  6.677   6.494   1.00 6.72  ? 67  TYR B CE2 1 
ATOM   2375 C CZ  . TYR B 1 67  ? -7.291  6.927   7.295   1.00 3.81  ? 67  TYR B CZ  1 
ATOM   2376 O OH  . TYR B 1 67  ? -7.343  7.956   8.224   1.00 2.13  ? 67  TYR B OH  1 
ATOM   2377 N N   . LYS B 1 68  ? -8.959  2.670   7.192   1.00 6.98  ? 68  LYS B N   1 
ATOM   2378 C CA  . LYS B 1 68  ? -10.137 2.687   8.090   1.00 6.80  ? 68  LYS B CA  1 
ATOM   2379 C C   . LYS B 1 68  ? -11.508 2.937   7.504   1.00 7.48  ? 68  LYS B C   1 
ATOM   2380 O O   . LYS B 1 68  ? -12.453 2.528   8.156   1.00 10.38 ? 68  LYS B O   1 
ATOM   2381 C CB  . LYS B 1 68  ? -10.143 3.758   9.128   1.00 5.49  ? 68  LYS B CB  1 
ATOM   2382 C CG  . LYS B 1 68  ? -8.970  3.888   10.008  1.00 14.88 ? 68  LYS B CG  1 
ATOM   2383 C CD  . LYS B 1 68  ? -8.903  5.371   10.397  1.00 21.26 ? 68  LYS B CD  1 
ATOM   2384 C CE  . LYS B 1 68  ? -10.175 5.933   11.065  1.00 24.14 ? 68  LYS B CE  1 
ATOM   2385 N NZ  . LYS B 1 68  ? -9.820  7.053   11.921  1.00 26.04 ? 68  LYS B NZ  1 
ATOM   2386 N N   . VAL B 1 69  ? -11.737 3.621   6.386   1.00 6.44  ? 69  VAL B N   1 
ATOM   2387 C CA  . VAL B 1 69  ? -13.077 3.865   5.887   1.00 5.29  ? 69  VAL B CA  1 
ATOM   2388 C C   . VAL B 1 69  ? -13.210 3.151   4.568   1.00 5.88  ? 69  VAL B C   1 
ATOM   2389 O O   . VAL B 1 69  ? -12.183 2.728   4.023   1.00 5.63  ? 69  VAL B O   1 
ATOM   2390 C CB  . VAL B 1 69  ? -13.336 5.379   5.701   1.00 5.22  ? 69  VAL B CB  1 
ATOM   2391 C CG1 . VAL B 1 69  ? -13.405 6.126   7.018   1.00 2.00  ? 69  VAL B CG1 1 
ATOM   2392 C CG2 . VAL B 1 69  ? -12.168 5.951   4.943   1.00 8.75  ? 69  VAL B CG2 1 
ATOM   2393 N N   . THR B 1 70  ? -14.453 2.959   4.085   1.00 7.79  ? 70  THR B N   1 
ATOM   2394 C CA  . THR B 1 70  ? -14.679 2.282   2.815   1.00 8.71  ? 70  THR B CA  1 
ATOM   2395 C C   . THR B 1 70  ? -14.231 3.121   1.643   1.00 6.84  ? 70  THR B C   1 
ATOM   2396 O O   . THR B 1 70  ? -13.613 2.576   0.717   1.00 4.66  ? 70  THR B O   1 
ATOM   2397 C CB  . THR B 1 70  ? -16.145 1.957   2.583   1.00 12.32 ? 70  THR B CB  1 
ATOM   2398 O OG1 . THR B 1 70  ? -16.843 3.163   2.755   1.00 19.13 ? 70  THR B OG1 1 
ATOM   2399 C CG2 . THR B 1 70  ? -16.729 1.007   3.578   1.00 19.96 ? 70  THR B CG2 1 
ATOM   2400 N N   . ASN B 1 71  ? -14.594 4.411   1.651   1.00 4.85  ? 71  ASN B N   1 
ATOM   2401 C CA  . ASN B 1 71  ? -14.130 5.332   0.607   1.00 4.38  ? 71  ASN B CA  1 
ATOM   2402 C C   . ASN B 1 71  ? -13.934 6.716   1.179   1.00 2.00  ? 71  ASN B C   1 
ATOM   2403 O O   . ASN B 1 71  ? -14.716 7.158   2.009   1.00 2.00  ? 71  ASN B O   1 
ATOM   2404 C CB  . ASN B 1 71  ? -15.089 5.571   -0.537  1.00 6.20  ? 71  ASN B CB  1 
ATOM   2405 C CG  . ASN B 1 71  ? -15.323 4.494   -1.574  1.00 7.78  ? 71  ASN B CG  1 
ATOM   2406 O OD1 . ASN B 1 71  ? -14.448 4.113   -2.340  1.00 8.41  ? 71  ASN B OD1 1 
ATOM   2407 N ND2 . ASN B 1 71  ? -16.551 4.019   -1.773  1.00 9.82  ? 71  ASN B ND2 1 
ATOM   2408 N N   . GLY B 1 72  ? -12.869 7.416   0.827   1.00 2.00  ? 72  GLY B N   1 
ATOM   2409 C CA  . GLY B 1 72  ? -12.680 8.814   1.182   1.00 2.04  ? 72  GLY B CA  1 
ATOM   2410 C C   . GLY B 1 72  ? -11.500 9.508   0.522   1.00 3.12  ? 72  GLY B C   1 
ATOM   2411 O O   . GLY B 1 72  ? -10.686 9.057   -0.317  1.00 2.00  ? 72  GLY B O   1 
ATOM   2412 N N   . ALA B 1 73  ? -11.549 10.763  0.839   1.00 2.00  ? 73  ALA B N   1 
ATOM   2413 C CA  . ALA B 1 73  ? -10.442 11.586  0.563   1.00 2.68  ? 73  ALA B CA  1 
ATOM   2414 C C   . ALA B 1 73  ? -9.084  11.158  1.143   1.00 5.70  ? 73  ALA B C   1 
ATOM   2415 O O   . ALA B 1 73  ? -8.565  11.918  1.977   1.00 11.93 ? 73  ALA B O   1 
ATOM   2416 C CB  . ALA B 1 73  ? -10.795 12.995  1.055   1.00 2.00  ? 73  ALA B CB  1 
ATOM   2417 N N   . PHE B 1 74  ? -8.376  10.034  0.923   1.00 3.80  ? 74  PHE B N   1 
ATOM   2418 C CA  . PHE B 1 74  ? -7.083  9.874   1.592   1.00 3.41  ? 74  PHE B CA  1 
ATOM   2419 C C   . PHE B 1 74  ? -6.224  9.299   0.519   1.00 2.03  ? 74  PHE B C   1 
ATOM   2420 O O   . PHE B 1 74  ? -6.287  8.102   0.307   1.00 2.00  ? 74  PHE B O   1 
ATOM   2421 C CB  . PHE B 1 74  ? -7.150  8.916   2.840   1.00 3.02  ? 74  PHE B CB  1 
ATOM   2422 C CG  . PHE B 1 74  ? -8.278  9.239   3.823   1.00 2.35  ? 74  PHE B CG  1 
ATOM   2423 C CD1 . PHE B 1 74  ? -8.141  10.273  4.744   1.00 7.27  ? 74  PHE B CD1 1 
ATOM   2424 C CD2 . PHE B 1 74  ? -9.481  8.538   3.775   1.00 2.00  ? 74  PHE B CD2 1 
ATOM   2425 C CE1 . PHE B 1 74  ? -9.216  10.601  5.594   1.00 8.51  ? 74  PHE B CE1 1 
ATOM   2426 C CE2 . PHE B 1 74  ? -10.525 8.882   4.620   1.00 2.00  ? 74  PHE B CE2 1 
ATOM   2427 C CZ  . PHE B 1 74  ? -10.419 9.913   5.543   1.00 2.00  ? 74  PHE B CZ  1 
ATOM   2428 N N   . THR B 1 75  ? -5.580  10.228  -0.201  1.00 2.67  ? 75  THR B N   1 
ATOM   2429 C CA  . THR B 1 75  ? -4.667  9.987   -1.312  1.00 2.00  ? 75  THR B CA  1 
ATOM   2430 C C   . THR B 1 75  ? -3.555  9.007   -0.952  1.00 2.00  ? 75  THR B C   1 
ATOM   2431 O O   . THR B 1 75  ? -2.984  9.135   0.115   1.00 2.00  ? 75  THR B O   1 
ATOM   2432 C CB  . THR B 1 75  ? -4.111  11.336  -1.699  1.00 2.00  ? 75  THR B CB  1 
ATOM   2433 O OG1 . THR B 1 75  ? -5.286  12.115  -1.886  1.00 2.00  ? 75  THR B OG1 1 
ATOM   2434 C CG2 . THR B 1 75  ? -3.205  11.360  -2.925  1.00 2.00  ? 75  THR B CG2 1 
ATOM   2435 N N   . GLY B 1 76  ? -3.222  7.999   -1.747  1.00 2.00  ? 76  GLY B N   1 
ATOM   2436 C CA  . GLY B 1 76  ? -2.209  7.071   -1.381  1.00 2.00  ? 76  GLY B CA  1 
ATOM   2437 C C   . GLY B 1 76  ? -2.844  5.885   -0.721  1.00 5.09  ? 76  GLY B C   1 
ATOM   2438 O O   . GLY B 1 76  ? -2.209  4.811   -0.702  1.00 7.19  ? 76  GLY B O   1 
ATOM   2439 N N   . GLU B 1 77  ? -4.060  5.991   -0.132  1.00 6.45  ? 77  GLU B N   1 
ATOM   2440 C CA  . GLU B 1 77  ? -4.690  4.808   0.441   1.00 4.30  ? 77  GLU B CA  1 
ATOM   2441 C C   . GLU B 1 77  ? -5.609  4.032   -0.530  1.00 3.54  ? 77  GLU B C   1 
ATOM   2442 O O   . GLU B 1 77  ? -5.960  4.427   -1.649  1.00 2.57  ? 77  GLU B O   1 
ATOM   2443 C CB  . GLU B 1 77  ? -5.491  5.176   1.750   1.00 5.91  ? 77  GLU B CB  1 
ATOM   2444 C CG  . GLU B 1 77  ? -4.787  5.585   3.072   1.00 10.26 ? 77  GLU B CG  1 
ATOM   2445 C CD  . GLU B 1 77  ? -3.388  5.034   3.467   1.00 16.29 ? 77  GLU B CD  1 
ATOM   2446 O OE1 . GLU B 1 77  ? -3.206  3.875   3.915   1.00 18.66 ? 77  GLU B OE1 1 
ATOM   2447 O OE2 . GLU B 1 77  ? -2.442  5.823   3.341   1.00 16.19 ? 77  GLU B OE2 1 
ATOM   2448 N N   . ILE B 1 78  ? -5.837  2.813   -0.018  1.00 2.82  ? 78  ILE B N   1 
ATOM   2449 C CA  . ILE B 1 78  ? -6.644  1.708   -0.462  1.00 2.00  ? 78  ILE B CA  1 
ATOM   2450 C C   . ILE B 1 78  ? -7.611  1.411   0.705   1.00 4.77  ? 78  ILE B C   1 
ATOM   2451 O O   . ILE B 1 78  ? -7.353  1.722   1.873   1.00 8.40  ? 78  ILE B O   1 
ATOM   2452 C CB  . ILE B 1 78  ? -5.640  0.605   -0.735  1.00 2.00  ? 78  ILE B CB  1 
ATOM   2453 C CG1 . ILE B 1 78  ? -5.018  1.016   -2.034  1.00 2.82  ? 78  ILE B CG1 1 
ATOM   2454 C CG2 . ILE B 1 78  ? -6.164  -0.813  -0.771  1.00 2.00  ? 78  ILE B CG2 1 
ATOM   2455 C CD1 . ILE B 1 78  ? -5.823  1.733   -3.121  1.00 2.00  ? 78  ILE B CD1 1 
ATOM   2456 N N   . SER B 1 79  ? -8.762  0.809   0.472   1.00 6.56  ? 79  SER B N   1 
ATOM   2457 C CA  . SER B 1 79  ? -9.730  0.433   1.486   1.00 6.15  ? 79  SER B CA  1 
ATOM   2458 C C   . SER B 1 79  ? -9.942  -1.075  1.416   1.00 4.91  ? 79  SER B C   1 
ATOM   2459 O O   . SER B 1 79  ? -9.627  -1.693  0.394   1.00 4.70  ? 79  SER B O   1 
ATOM   2460 C CB  . SER B 1 79  ? -11.044 1.172   1.213   1.00 9.93  ? 79  SER B CB  1 
ATOM   2461 O OG  . SER B 1 79  ? -11.599 0.946   -0.082  1.00 6.13  ? 79  SER B OG  1 
ATOM   2462 N N   . PRO B 1 80  ? -10.472 -1.759  2.436   1.00 3.43  ? 80  PRO B N   1 
ATOM   2463 C CA  . PRO B 1 80  ? -10.879 -3.157  2.336   1.00 4.59  ? 80  PRO B CA  1 
ATOM   2464 C C   . PRO B 1 80  ? -11.763 -3.505  1.090   1.00 9.15  ? 80  PRO B C   1 
ATOM   2465 O O   . PRO B 1 80  ? -11.413 -4.386  0.281   1.00 9.81  ? 80  PRO B O   1 
ATOM   2466 C CB  . PRO B 1 80  ? -11.530 -3.342  3.644   1.00 2.61  ? 80  PRO B CB  1 
ATOM   2467 C CG  . PRO B 1 80  ? -10.782 -2.458  4.588   1.00 2.65  ? 80  PRO B CG  1 
ATOM   2468 C CD  . PRO B 1 80  ? -10.677 -1.216  3.759   1.00 2.00  ? 80  PRO B CD  1 
ATOM   2469 N N   . GLY B 1 81  ? -12.857 -2.764  0.827   1.00 5.19  ? 81  GLY B N   1 
ATOM   2470 C CA  . GLY B 1 81  ? -13.743 -3.012  -0.276  1.00 2.00  ? 81  GLY B CA  1 
ATOM   2471 C C   . GLY B 1 81  ? -13.027 -3.111  -1.586  1.00 3.19  ? 81  GLY B C   1 
ATOM   2472 O O   . GLY B 1 81  ? -13.395 -3.949  -2.400  1.00 7.85  ? 81  GLY B O   1 
ATOM   2473 N N   . MET B 1 82  ? -12.013 -2.283  -1.823  1.00 5.22  ? 82  MET B N   1 
ATOM   2474 C CA  . MET B 1 82  ? -11.128 -2.364  -3.002  1.00 2.60  ? 82  MET B CA  1 
ATOM   2475 C C   . MET B 1 82  ? -10.255 -3.608  -2.890  1.00 3.66  ? 82  MET B C   1 
ATOM   2476 O O   . MET B 1 82  ? -9.939  -4.230  -3.903  1.00 3.47  ? 82  MET B O   1 
ATOM   2477 C CB  . MET B 1 82  ? -10.194 -1.160  -3.094  1.00 2.00  ? 82  MET B CB  1 
ATOM   2478 C CG  . MET B 1 82  ? -10.873 0.165   -3.384  1.00 2.01  ? 82  MET B CG  1 
ATOM   2479 S SD  . MET B 1 82  ? -9.842  1.618   -3.149  1.00 2.00  ? 82  MET B SD  1 
ATOM   2480 C CE  . MET B 1 82  ? -11.107 2.858   -3.053  1.00 2.00  ? 82  MET B CE  1 
ATOM   2481 N N   . ILE B 1 83  ? -9.846  -4.045  -1.700  1.00 2.00  ? 83  ILE B N   1 
ATOM   2482 C CA  . ILE B 1 83  ? -9.032  -5.257  -1.609  1.00 5.71  ? 83  ILE B CA  1 
ATOM   2483 C C   . ILE B 1 83  ? -9.855  -6.494  -2.049  1.00 8.07  ? 83  ILE B C   1 
ATOM   2484 O O   . ILE B 1 83  ? -9.424  -7.347  -2.844  1.00 6.39  ? 83  ILE B O   1 
ATOM   2485 C CB  . ILE B 1 83  ? -8.490  -5.385  -0.140  1.00 3.28  ? 83  ILE B CB  1 
ATOM   2486 C CG1 . ILE B 1 83  ? -7.905  -4.047  0.277   1.00 2.00  ? 83  ILE B CG1 1 
ATOM   2487 C CG2 . ILE B 1 83  ? -7.453  -6.478  -0.046  1.00 2.00  ? 83  ILE B CG2 1 
ATOM   2488 C CD1 . ILE B 1 83  ? -6.768  -3.914  1.263   1.00 2.00  ? 83  ILE B CD1 1 
ATOM   2489 N N   . LYS B 1 84  ? -11.117 -6.509  -1.585  1.00 11.65 ? 84  LYS B N   1 
ATOM   2490 C CA  . LYS B 1 84  ? -12.163 -7.500  -1.868  1.00 12.11 ? 84  LYS B CA  1 
ATOM   2491 C C   . LYS B 1 84  ? -12.500 -7.451  -3.340  1.00 10.67 ? 84  LYS B C   1 
ATOM   2492 O O   . LYS B 1 84  ? -12.472 -8.509  -3.968  1.00 9.10  ? 84  LYS B O   1 
ATOM   2493 C CB  . LYS B 1 84  ? -13.388 -7.157  -1.049  1.00 16.77 ? 84  LYS B CB  1 
ATOM   2494 C CG  . LYS B 1 84  ? -14.011 -8.198  -0.140  1.00 21.21 ? 84  LYS B CG  1 
ATOM   2495 C CD  . LYS B 1 84  ? -15.101 -7.475  0.693   1.00 27.56 ? 84  LYS B CD  1 
ATOM   2496 C CE  . LYS B 1 84  ? -16.586 -7.935  0.458   1.00 29.72 ? 84  LYS B CE  1 
ATOM   2497 N NZ  . LYS B 1 84  ? -17.567 -7.227  1.299   1.00 26.21 ? 84  LYS B NZ  1 
ATOM   2498 N N   . ASP B 1 85  ? -12.735 -6.237  -3.892  1.00 9.97  ? 85  ASP B N   1 
ATOM   2499 C CA  . ASP B 1 85  ? -12.999 -6.043  -5.317  1.00 11.44 ? 85  ASP B CA  1 
ATOM   2500 C C   . ASP B 1 85  ? -11.857 -6.527  -6.197  1.00 12.04 ? 85  ASP B C   1 
ATOM   2501 O O   . ASP B 1 85  ? -12.083 -7.042  -7.287  1.00 14.23 ? 85  ASP B O   1 
ATOM   2502 C CB  . ASP B 1 85  ? -13.273 -4.571  -5.629  1.00 11.94 ? 85  ASP B CB  1 
ATOM   2503 C CG  . ASP B 1 85  ? -13.610 -4.244  -7.096  1.00 14.27 ? 85  ASP B CG  1 
ATOM   2504 O OD1 . ASP B 1 85  ? -14.706 -4.561  -7.577  1.00 17.67 ? 85  ASP B OD1 1 
ATOM   2505 O OD2 . ASP B 1 85  ? -12.774 -3.647  -7.770  1.00 14.82 ? 85  ASP B OD2 1 
ATOM   2506 N N   . CYS B 1 86  ? -10.603 -6.389  -5.786  1.00 14.14 ? 86  CYS B N   1 
ATOM   2507 C CA  . CYS B 1 86  ? -9.497  -6.943  -6.549  1.00 13.87 ? 86  CYS B CA  1 
ATOM   2508 C C   . CYS B 1 86  ? -9.427  -8.448  -6.346  1.00 13.46 ? 86  CYS B C   1 
ATOM   2509 O O   . CYS B 1 86  ? -8.886  -9.113  -7.214  1.00 14.98 ? 86  CYS B O   1 
ATOM   2510 C CB  . CYS B 1 86  ? -8.187  -6.263  -6.122  1.00 13.63 ? 86  CYS B CB  1 
ATOM   2511 S SG  . CYS B 1 86  ? -8.127  -4.652  -6.945  1.00 12.59 ? 86  CYS B SG  1 
ATOM   2512 N N   . GLY B 1 87  ? -9.938  -9.053  -5.269  1.00 14.26 ? 87  GLY B N   1 
ATOM   2513 C CA  . GLY B 1 87  ? -10.000 -10.513 -5.162  1.00 14.01 ? 87  GLY B CA  1 
ATOM   2514 C C   . GLY B 1 87  ? -9.198  -11.130 -4.044  1.00 11.61 ? 87  GLY B C   1 
ATOM   2515 O O   . GLY B 1 87  ? -9.185  -12.340 -3.867  1.00 10.11 ? 87  GLY B O   1 
ATOM   2516 N N   . ALA B 1 88  ? -8.557  -10.241 -3.295  1.00 13.31 ? 88  ALA B N   1 
ATOM   2517 C CA  . ALA B 1 88  ? -7.675  -10.557 -2.202  1.00 11.94 ? 88  ALA B CA  1 
ATOM   2518 C C   . ALA B 1 88  ? -8.533  -10.625 -0.985  1.00 15.08 ? 88  ALA B C   1 
ATOM   2519 O O   . ALA B 1 88  ? -9.233  -9.692  -0.597  1.00 16.06 ? 88  ALA B O   1 
ATOM   2520 C CB  . ALA B 1 88  ? -6.674  -9.469  -1.963  1.00 10.96 ? 88  ALA B CB  1 
ATOM   2521 N N   . THR B 1 89  ? -8.431  -11.748 -0.329  1.00 18.37 ? 89  THR B N   1 
ATOM   2522 C CA  . THR B 1 89  ? -9.230  -12.013 0.841   1.00 17.09 ? 89  THR B CA  1 
ATOM   2523 C C   . THR B 1 89  ? -8.607  -11.669 2.178   1.00 15.32 ? 89  THR B C   1 
ATOM   2524 O O   . THR B 1 89  ? -9.228  -11.920 3.218   1.00 17.48 ? 89  THR B O   1 
ATOM   2525 C CB  . THR B 1 89  ? -9.592  -13.483 0.663   1.00 20.46 ? 89  THR B CB  1 
ATOM   2526 O OG1 . THR B 1 89  ? -8.612  -14.303 -0.037  1.00 25.24 ? 89  THR B OG1 1 
ATOM   2527 C CG2 . THR B 1 89  ? -10.857 -13.400 -0.155  1.00 25.52 ? 89  THR B CG2 1 
ATOM   2528 N N   . TRP B 1 90  ? -7.377  -11.120 2.201   1.00 12.15 ? 90  TRP B N   1 
ATOM   2529 C CA  . TRP B 1 90  ? -6.682  -10.807 3.439   1.00 7.38  ? 90  TRP B CA  1 
ATOM   2530 C C   . TRP B 1 90  ? -6.025  -9.456  3.386   1.00 6.29  ? 90  TRP B C   1 
ATOM   2531 O O   . TRP B 1 90  ? -5.757  -8.886  2.324   1.00 5.62  ? 90  TRP B O   1 
ATOM   2532 C CB  . TRP B 1 90  ? -5.569  -11.792 3.719   1.00 7.58  ? 90  TRP B CB  1 
ATOM   2533 C CG  . TRP B 1 90  ? -5.987  -13.220 4.045   1.00 2.91  ? 90  TRP B CG  1 
ATOM   2534 C CD1 . TRP B 1 90  ? -6.325  -14.115 3.082   1.00 2.00  ? 90  TRP B CD1 1 
ATOM   2535 C CD2 . TRP B 1 90  ? -6.066  -13.725 5.299   1.00 2.99  ? 90  TRP B CD2 1 
ATOM   2536 N NE1 . TRP B 1 90  ? -6.634  -15.195 3.729   1.00 2.00  ? 90  TRP B NE1 1 
ATOM   2537 C CE2 . TRP B 1 90  ? -6.503  -15.024 5.044   1.00 3.02  ? 90  TRP B CE2 1 
ATOM   2538 C CE3 . TRP B 1 90  ? -5.835  -13.280 6.601   1.00 5.63  ? 90  TRP B CE3 1 
ATOM   2539 C CZ2 . TRP B 1 90  ? -6.721  -15.910 6.107   1.00 4.82  ? 90  TRP B CZ2 1 
ATOM   2540 C CZ3 . TRP B 1 90  ? -6.049  -14.154 7.665   1.00 6.64  ? 90  TRP B CZ3 1 
ATOM   2541 C CH2 . TRP B 1 90  ? -6.488  -15.462 7.415   1.00 5.25  ? 90  TRP B CH2 1 
ATOM   2542 N N   . VAL B 1 91  ? -5.699  -8.939  4.540   1.00 4.80  ? 91  VAL B N   1 
ATOM   2543 C CA  . VAL B 1 91  ? -4.873  -7.772  4.580   1.00 4.20  ? 91  VAL B CA  1 
ATOM   2544 C C   . VAL B 1 91  ? -3.878  -8.029  5.725   1.00 5.25  ? 91  VAL B C   1 
ATOM   2545 O O   . VAL B 1 91  ? -4.133  -8.787  6.657   1.00 6.63  ? 91  VAL B O   1 
ATOM   2546 C CB  . VAL B 1 91  ? -5.781  -6.581  4.794   1.00 2.00  ? 91  VAL B CB  1 
ATOM   2547 C CG1 . VAL B 1 91  ? -6.505  -6.793  6.086   1.00 2.66  ? 91  VAL B CG1 1 
ATOM   2548 C CG2 . VAL B 1 91  ? -5.013  -5.285  4.884   1.00 2.00  ? 91  VAL B CG2 1 
ATOM   2549 N N   . VAL B 1 92  ? -2.686  -7.481  5.629   1.00 5.45  ? 92  VAL B N   1 
ATOM   2550 C CA  . VAL B 1 92  ? -1.627  -7.573  6.612   1.00 7.01  ? 92  VAL B CA  1 
ATOM   2551 C C   . VAL B 1 92  ? -1.775  -6.226  7.374   1.00 9.02  ? 92  VAL B C   1 
ATOM   2552 O O   . VAL B 1 92  ? -1.776  -5.116  6.783   1.00 9.61  ? 92  VAL B O   1 
ATOM   2553 C CB  . VAL B 1 92  ? -0.202  -7.693  5.868   1.00 6.04  ? 92  VAL B CB  1 
ATOM   2554 C CG1 . VAL B 1 92  ? 0.831   -8.246  6.803   1.00 2.00  ? 92  VAL B CG1 1 
ATOM   2555 C CG2 . VAL B 1 92  ? -0.237  -8.642  4.702   1.00 4.31  ? 92  VAL B CG2 1 
ATOM   2556 N N   . LEU B 1 93  ? -1.984  -6.255  8.688   1.00 7.19  ? 93  LEU B N   1 
ATOM   2557 C CA  . LEU B 1 93  ? -2.051  -4.994  9.403   1.00 6.22  ? 93  LEU B CA  1 
ATOM   2558 C C   . LEU B 1 93  ? -1.100  -4.989  10.547  1.00 3.00  ? 93  LEU B C   1 
ATOM   2559 O O   . LEU B 1 93  ? -0.630  -6.009  11.000  1.00 2.00  ? 93  LEU B O   1 
ATOM   2560 C CB  . LEU B 1 93  ? -3.437  -4.689  9.972   1.00 7.85  ? 93  LEU B CB  1 
ATOM   2561 C CG  . LEU B 1 93  ? -4.603  -4.413  9.072   1.00 5.17  ? 93  LEU B CG  1 
ATOM   2562 C CD1 . LEU B 1 93  ? -5.819  -4.590  9.897   1.00 2.00  ? 93  LEU B CD1 1 
ATOM   2563 C CD2 . LEU B 1 93  ? -4.439  -3.075  8.375   1.00 2.00  ? 93  LEU B CD2 1 
ATOM   2564 N N   . GLY B 1 94  ? -0.755  -3.809  10.987  1.00 5.97  ? 94  GLY B N   1 
ATOM   2565 C CA  . GLY B 1 94  ? 0.199   -3.620  12.048  1.00 9.69  ? 94  GLY B CA  1 
ATOM   2566 C C   . GLY B 1 94  ? 1.583   -4.126  11.736  1.00 9.44  ? 94  GLY B C   1 
ATOM   2567 O O   . GLY B 1 94  ? 2.341   -4.391  12.653  1.00 15.38 ? 94  GLY B O   1 
ATOM   2568 N N   . HIS B 1 95  ? 1.989   -4.325  10.499  1.00 10.58 ? 95  HIS B N   1 
ATOM   2569 C CA  . HIS B 1 95  ? 3.319   -4.826  10.218  1.00 11.11 ? 95  HIS B CA  1 
ATOM   2570 C C   . HIS B 1 95  ? 4.251   -3.664  10.572  1.00 14.11 ? 95  HIS B C   1 
ATOM   2571 O O   . HIS B 1 95  ? 4.054   -2.491  10.227  1.00 12.41 ? 95  HIS B O   1 
ATOM   2572 C CB  . HIS B 1 95  ? 3.433   -5.225  8.727   1.00 7.32  ? 95  HIS B CB  1 
ATOM   2573 C CG  . HIS B 1 95  ? 4.733   -5.924  8.417   1.00 7.53  ? 95  HIS B CG  1 
ATOM   2574 N ND1 . HIS B 1 95  ? 6.004   -5.463  8.467   1.00 6.89  ? 95  HIS B ND1 1 
ATOM   2575 C CD2 . HIS B 1 95  ? 4.776   -7.262  8.123   1.00 5.20  ? 95  HIS B CD2 1 
ATOM   2576 C CE1 . HIS B 1 95  ? 6.797   -6.493  8.253   1.00 2.96  ? 95  HIS B CE1 1 
ATOM   2577 N NE2 . HIS B 1 95  ? 6.049   -7.537  8.035   1.00 5.22  ? 95  HIS B NE2 1 
ATOM   2578 N N   . SER B 1 96  ? 5.301   -4.066  11.275  1.00 15.35 ? 96  SER B N   1 
ATOM   2579 C CA  . SER B 1 96  ? 6.385   -3.214  11.772  1.00 16.72 ? 96  SER B CA  1 
ATOM   2580 C C   . SER B 1 96  ? 6.911   -2.008  10.976  1.00 16.48 ? 96  SER B C   1 
ATOM   2581 O O   . SER B 1 96  ? 7.381   -0.997  11.528  1.00 19.53 ? 96  SER B O   1 
ATOM   2582 C CB  . SER B 1 96  ? 7.522   -4.161  12.069  1.00 18.87 ? 96  SER B CB  1 
ATOM   2583 O OG  . SER B 1 96  ? 7.491   -5.193  11.070  1.00 24.23 ? 96  SER B OG  1 
ATOM   2584 N N   . GLU B 1 97  ? 6.920   -2.109  9.658   1.00 12.88 ? 97  GLU B N   1 
ATOM   2585 C CA  . GLU B 1 97  ? 7.352   -1.013  8.834   1.00 9.16  ? 97  GLU B CA  1 
ATOM   2586 C C   . GLU B 1 97  ? 6.349   0.110   8.887   1.00 5.60  ? 97  GLU B C   1 
ATOM   2587 O O   . GLU B 1 97  ? 6.719   1.267   8.985   1.00 3.20  ? 97  GLU B O   1 
ATOM   2588 C CB  . GLU B 1 97  ? 7.511   -1.532  7.449   1.00 12.27 ? 97  GLU B CB  1 
ATOM   2589 C CG  . GLU B 1 97  ? 8.907   -2.049  7.372   1.00 11.04 ? 97  GLU B CG  1 
ATOM   2590 C CD  . GLU B 1 97  ? 8.989   -3.371  6.663   1.00 16.49 ? 97  GLU B CD  1 
ATOM   2591 O OE1 . GLU B 1 97  ? 8.190   -3.606  5.755   1.00 13.75 ? 97  GLU B OE1 1 
ATOM   2592 O OE2 . GLU B 1 97  ? 9.879   -4.143  7.044   1.00 19.86 ? 97  GLU B OE2 1 
ATOM   2593 N N   . ARG B 1 98  ? 5.083   -0.250  8.908   1.00 3.48  ? 98  ARG B N   1 
ATOM   2594 C CA  . ARG B 1 98  ? 3.991   0.677   9.020   1.00 4.77  ? 98  ARG B CA  1 
ATOM   2595 C C   . ARG B 1 98  ? 4.143   1.476   10.293  1.00 5.14  ? 98  ARG B C   1 
ATOM   2596 O O   . ARG B 1 98  ? 4.194   2.713   10.293  1.00 3.95  ? 98  ARG B O   1 
ATOM   2597 C CB  . ARG B 1 98  ? 2.676   -0.081  9.081   1.00 7.77  ? 98  ARG B CB  1 
ATOM   2598 C CG  . ARG B 1 98  ? 1.894   -0.482  7.827   1.00 7.77  ? 98  ARG B CG  1 
ATOM   2599 C CD  . ARG B 1 98  ? 2.740   -0.662  6.614   1.00 4.89  ? 98  ARG B CD  1 
ATOM   2600 N NE  . ARG B 1 98  ? 2.865   0.420   5.641   1.00 2.55  ? 98  ARG B NE  1 
ATOM   2601 C CZ  . ARG B 1 98  ? 2.607   1.702   5.726   1.00 2.00  ? 98  ARG B CZ  1 
ATOM   2602 N NH1 . ARG B 1 98  ? 2.153   2.288   6.787   1.00 2.00  ? 98  ARG B NH1 1 
ATOM   2603 N NH2 . ARG B 1 98  ? 2.826   2.418   4.651   1.00 2.00  ? 98  ARG B NH2 1 
ATOM   2604 N N   . ARG B 1 99  ? 4.262   0.691   11.363  1.00 4.90  ? 99  ARG B N   1 
ATOM   2605 C CA  . ARG B 1 99  ? 4.414   1.211   12.712  1.00 6.48  ? 99  ARG B CA  1 
ATOM   2606 C C   . ARG B 1 99  ? 5.696   1.978   12.957  1.00 5.65  ? 99  ARG B C   1 
ATOM   2607 O O   . ARG B 1 99  ? 5.633   3.095   13.463  1.00 6.11  ? 99  ARG B O   1 
ATOM   2608 C CB  . ARG B 1 99  ? 4.374   0.097   13.771  1.00 6.73  ? 99  ARG B CB  1 
ATOM   2609 C CG  . ARG B 1 99  ? 3.026   -0.505  14.147  1.00 6.60  ? 99  ARG B CG  1 
ATOM   2610 C CD  . ARG B 1 99  ? 3.309   -1.797  14.932  1.00 5.88  ? 99  ARG B CD  1 
ATOM   2611 N NE  . ARG B 1 99  ? 2.470   -1.873  16.125  1.00 6.36  ? 99  ARG B NE  1 
ATOM   2612 C CZ  . ARG B 1 99  ? 1.421   -2.691  16.203  1.00 5.68  ? 99  ARG B CZ  1 
ATOM   2613 N NH1 . ARG B 1 99  ? 1.101   -3.488  15.190  1.00 8.51  ? 99  ARG B NH1 1 
ATOM   2614 N NH2 . ARG B 1 99  ? 0.605   -2.668  17.263  1.00 7.01  ? 99  ARG B NH2 1 
ATOM   2615 N N   . HIS B 1 100 ? 6.870   1.461   12.612  1.00 6.17  ? 100 HIS B N   1 
ATOM   2616 C CA  . HIS B 1 100 ? 8.094   2.125   13.019  1.00 11.70 ? 100 HIS B CA  1 
ATOM   2617 C C   . HIS B 1 100 ? 8.867   2.894   11.934  1.00 14.79 ? 100 HIS B C   1 
ATOM   2618 O O   . HIS B 1 100 ? 9.838   3.610   12.238  1.00 18.22 ? 100 HIS B O   1 
ATOM   2619 C CB  . HIS B 1 100 ? 8.979   1.055   13.740  1.00 9.34  ? 100 HIS B CB  1 
ATOM   2620 C CG  . HIS B 1 100 ? 8.298   0.499   14.993  1.00 11.36 ? 100 HIS B CG  1 
ATOM   2621 N ND1 . HIS B 1 100 ? 8.061   -0.783  15.311  1.00 12.86 ? 100 HIS B ND1 1 
ATOM   2622 C CD2 . HIS B 1 100 ? 7.686   1.266   15.990  1.00 13.51 ? 100 HIS B CD2 1 
ATOM   2623 C CE1 . HIS B 1 100 ? 7.334   -0.800  16.424  1.00 15.03 ? 100 HIS B CE1 1 
ATOM   2624 N NE2 . HIS B 1 100 ? 7.104   0.437   16.834  1.00 11.19 ? 100 HIS B NE2 1 
ATOM   2625 N N   . VAL B 1 101 ? 8.484   2.758   10.655  1.00 16.59 ? 101 VAL B N   1 
ATOM   2626 C CA  . VAL B 1 101 ? 9.058   3.556   9.553   1.00 13.26 ? 101 VAL B CA  1 
ATOM   2627 C C   . VAL B 1 101 ? 7.995   4.582   9.154   1.00 15.03 ? 101 VAL B C   1 
ATOM   2628 O O   . VAL B 1 101 ? 8.288   5.721   8.766   1.00 15.55 ? 101 VAL B O   1 
ATOM   2629 C CB  . VAL B 1 101 ? 9.389   2.681   8.335   1.00 8.60  ? 101 VAL B CB  1 
ATOM   2630 C CG1 . VAL B 1 101 ? 9.928   3.531   7.243   1.00 5.65  ? 101 VAL B CG1 1 
ATOM   2631 C CG2 . VAL B 1 101 ? 10.441  1.656   8.674   1.00 8.43  ? 101 VAL B CG2 1 
ATOM   2632 N N   . PHE B 1 102 ? 6.716   4.213   9.258   1.00 14.20 ? 102 PHE B N   1 
ATOM   2633 C CA  . PHE B 1 102 ? 5.693   5.146   8.842   1.00 11.46 ? 102 PHE B CA  1 
ATOM   2634 C C   . PHE B 1 102 ? 4.783   5.573   10.011  1.00 12.45 ? 102 PHE B C   1 
ATOM   2635 O O   . PHE B 1 102 ? 3.775   6.266   9.825   1.00 13.72 ? 102 PHE B O   1 
ATOM   2636 C CB  . PHE B 1 102 ? 4.962   4.463   7.671   1.00 4.59  ? 102 PHE B CB  1 
ATOM   2637 C CG  . PHE B 1 102 ? 5.812   4.090   6.441   1.00 3.06  ? 102 PHE B CG  1 
ATOM   2638 C CD1 . PHE B 1 102 ? 6.249   5.074   5.547   1.00 2.00  ? 102 PHE B CD1 1 
ATOM   2639 C CD2 . PHE B 1 102 ? 6.112   2.728   6.164   1.00 5.15  ? 102 PHE B CD2 1 
ATOM   2640 C CE1 . PHE B 1 102 ? 6.949   4.727   4.400   1.00 2.00  ? 102 PHE B CE1 1 
ATOM   2641 C CE2 . PHE B 1 102 ? 6.822   2.371   5.018   1.00 2.00  ? 102 PHE B CE2 1 
ATOM   2642 C CZ  . PHE B 1 102 ? 7.230   3.394   4.142   1.00 2.00  ? 102 PHE B CZ  1 
ATOM   2643 N N   . GLY B 1 103 ? 5.088   5.191   11.258  1.00 11.30 ? 103 GLY B N   1 
ATOM   2644 C CA  . GLY B 1 103 ? 4.358   5.717   12.415  1.00 8.64  ? 103 GLY B CA  1 
ATOM   2645 C C   . GLY B 1 103 ? 2.893   5.315   12.725  1.00 7.41  ? 103 GLY B C   1 
ATOM   2646 O O   . GLY B 1 103 ? 2.257   6.015   13.555  1.00 4.75  ? 103 GLY B O   1 
ATOM   2647 N N   . GLU B 1 104 ? 2.342   4.250   12.101  1.00 3.19  ? 104 GLU B N   1 
ATOM   2648 C CA  . GLU B 1 104 ? 1.006   3.743   12.442  1.00 3.57  ? 104 GLU B CA  1 
ATOM   2649 C C   . GLU B 1 104 ? 0.931   3.328   13.889  1.00 2.86  ? 104 GLU B C   1 
ATOM   2650 O O   . GLU B 1 104 ? 1.561   2.374   14.369  1.00 2.79  ? 104 GLU B O   1 
ATOM   2651 C CB  . GLU B 1 104 ? 0.524   2.459   11.730  1.00 3.41  ? 104 GLU B CB  1 
ATOM   2652 C CG  . GLU B 1 104 ? 0.737   2.599   10.284  1.00 7.38  ? 104 GLU B CG  1 
ATOM   2653 C CD  . GLU B 1 104 ? -0.300  2.028   9.366   1.00 9.42  ? 104 GLU B CD  1 
ATOM   2654 O OE1 . GLU B 1 104 ? -0.882  0.992   9.677   1.00 13.80 ? 104 GLU B OE1 1 
ATOM   2655 O OE2 . GLU B 1 104 ? -0.490  2.625   8.302   1.00 12.57 ? 104 GLU B OE2 1 
ATOM   2656 N N   . SER B 1 105 ? 0.043   4.078   14.513  1.00 4.43  ? 105 SER B N   1 
ATOM   2657 C CA  . SER B 1 105 ? -0.252  3.896   15.896  1.00 5.69  ? 105 SER B CA  1 
ATOM   2658 C C   . SER B 1 105 ? -1.181  2.743   16.040  1.00 6.52  ? 105 SER B C   1 
ATOM   2659 O O   . SER B 1 105 ? -1.954  2.403   15.154  1.00 7.74  ? 105 SER B O   1 
ATOM   2660 C CB  . SER B 1 105 ? -0.886  5.161   16.442  1.00 8.10  ? 105 SER B CB  1 
ATOM   2661 O OG  . SER B 1 105 ? -2.233  5.454   16.098  1.00 13.07 ? 105 SER B OG  1 
ATOM   2662 N N   . ASP B 1 106 ? -1.166  2.220   17.240  1.00 10.09 ? 106 ASP B N   1 
ATOM   2663 C CA  . ASP B 1 106 ? -2.072  1.152   17.640  1.00 16.13 ? 106 ASP B CA  1 
ATOM   2664 C C   . ASP B 1 106 ? -3.559  1.463   17.471  1.00 19.03 ? 106 ASP B C   1 
ATOM   2665 O O   . ASP B 1 106 ? -4.367  0.592   17.120  1.00 14.51 ? 106 ASP B O   1 
ATOM   2666 C CB  . ASP B 1 106 ? -1.835  0.838   19.063  1.00 18.89 ? 106 ASP B CB  1 
ATOM   2667 C CG  . ASP B 1 106 ? -0.368  0.566   19.312  1.00 24.12 ? 106 ASP B CG  1 
ATOM   2668 O OD1 . ASP B 1 106 ? 0.046   -0.539  18.953  1.00 28.07 ? 106 ASP B OD1 1 
ATOM   2669 O OD2 . ASP B 1 106 ? 0.326   1.454   19.844  1.00 24.59 ? 106 ASP B OD2 1 
ATOM   2670 N N   . GLU B 1 107 ? -3.913  2.755   17.710  1.00 22.80 ? 107 GLU B N   1 
ATOM   2671 C CA  . GLU B 1 107 ? -5.305  3.228   17.540  1.00 21.62 ? 107 GLU B CA  1 
ATOM   2672 C C   . GLU B 1 107 ? -5.602  3.223   16.027  1.00 19.07 ? 107 GLU B C   1 
ATOM   2673 O O   . GLU B 1 107 ? -6.730  2.848   15.675  1.00 20.70 ? 107 GLU B O   1 
ATOM   2674 C CB  . GLU B 1 107 ? -5.509  4.665   18.147  1.00 21.63 ? 107 GLU B CB  1 
ATOM   2675 C CG  . GLU B 1 107 ? -6.971  4.908   18.618  1.00 23.92 ? 107 GLU B CG  1 
ATOM   2676 C CD  . GLU B 1 107 ? -7.535  6.352   18.701  1.00 25.68 ? 107 GLU B CD  1 
ATOM   2677 O OE1 . GLU B 1 107 ? -7.036  7.294   18.066  1.00 26.91 ? 107 GLU B OE1 1 
ATOM   2678 O OE2 . GLU B 1 107 ? -8.531  6.547   19.402  1.00 27.11 ? 107 GLU B OE2 1 
ATOM   2679 N N   . LEU B 1 108 ? -4.631  3.520   15.126  1.00 13.37 ? 108 LEU B N   1 
ATOM   2680 C CA  . LEU B 1 108 ? -4.870  3.356   13.707  1.00 10.01 ? 108 LEU B CA  1 
ATOM   2681 C C   . LEU B 1 108 ? -5.037  1.889   13.417  1.00 6.45  ? 108 LEU B C   1 
ATOM   2682 O O   . LEU B 1 108 ? -6.020  1.510   12.788  1.00 6.97  ? 108 LEU B O   1 
ATOM   2683 C CB  . LEU B 1 108 ? -3.746  3.788   12.811  1.00 8.25  ? 108 LEU B CB  1 
ATOM   2684 C CG  . LEU B 1 108 ? -4.113  4.787   11.732  1.00 10.04 ? 108 LEU B CG  1 
ATOM   2685 C CD1 . LEU B 1 108 ? -2.930  4.766   10.818  1.00 10.95 ? 108 LEU B CD1 1 
ATOM   2686 C CD2 . LEU B 1 108 ? -5.428  4.496   10.988  1.00 7.03  ? 108 LEU B CD2 1 
ATOM   2687 N N   . ILE B 1 109 ? -4.158  1.025   13.909  1.00 3.60  ? 109 ILE B N   1 
ATOM   2688 C CA  . ILE B 1 109 ? -4.272  -0.402  13.627  1.00 3.84  ? 109 ILE B CA  1 
ATOM   2689 C C   . ILE B 1 109 ? -5.513  -1.062  14.190  1.00 3.31  ? 109 ILE B C   1 
ATOM   2690 O O   . ILE B 1 109 ? -6.015  -2.077  13.715  1.00 2.39  ? 109 ILE B O   1 
ATOM   2691 C CB  . ILE B 1 109 ? -3.005  -1.056  14.129  1.00 4.29  ? 109 ILE B CB  1 
ATOM   2692 C CG1 . ILE B 1 109 ? -1.917  -0.530  13.236  1.00 2.00  ? 109 ILE B CG1 1 
ATOM   2693 C CG2 . ILE B 1 109 ? -3.015  -2.608  14.041  1.00 9.42  ? 109 ILE B CG2 1 
ATOM   2694 C CD1 . ILE B 1 109 ? -0.637  -0.374  14.065  1.00 8.23  ? 109 ILE B CD1 1 
ATOM   2695 N N   . GLY B 1 110 ? -6.061  -0.449  15.211  1.00 6.41  ? 110 GLY B N   1 
ATOM   2696 C CA  . GLY B 1 110 ? -7.314  -0.910  15.791  1.00 8.15  ? 110 GLY B CA  1 
ATOM   2697 C C   . GLY B 1 110 ? -8.402  -0.637  14.791  1.00 8.72  ? 110 GLY B C   1 
ATOM   2698 O O   . GLY B 1 110 ? -9.031  -1.534  14.215  1.00 10.38 ? 110 GLY B O   1 
ATOM   2699 N N   . GLN B 1 111 ? -8.454  0.646   14.470  1.00 8.51  ? 111 GLN B N   1 
ATOM   2700 C CA  . GLN B 1 111 ? -9.421  1.167   13.536  1.00 7.62  ? 111 GLN B CA  1 
ATOM   2701 C C   . GLN B 1 111 ? -9.437  0.477   12.193  1.00 5.92  ? 111 GLN B C   1 
ATOM   2702 O O   . GLN B 1 111 ? -10.507 0.291   11.613  1.00 7.43  ? 111 GLN B O   1 
ATOM   2703 C CB  . GLN B 1 111 ? -9.139  2.639   13.433  1.00 11.31 ? 111 GLN B CB  1 
ATOM   2704 C CG  . GLN B 1 111 ? -9.625  3.196   14.780  1.00 19.55 ? 111 GLN B CG  1 
ATOM   2705 C CD  . GLN B 1 111 ? -9.423  4.682   14.997  1.00 21.59 ? 111 GLN B CD  1 
ATOM   2706 O OE1 . GLN B 1 111 ? -8.341  5.236   14.772  1.00 24.63 ? 111 GLN B OE1 1 
ATOM   2707 N NE2 . GLN B 1 111 ? -10.467 5.360   15.467  1.00 19.44 ? 111 GLN B NE2 1 
ATOM   2708 N N   . LYS B 1 112 ? -8.275  0.012   11.736  1.00 5.32  ? 112 LYS B N   1 
ATOM   2709 C CA  . LYS B 1 112 ? -8.124  -0.756  10.518  1.00 2.00  ? 112 LYS B CA  1 
ATOM   2710 C C   . LYS B 1 112 ? -8.602  -2.176  10.656  1.00 2.00  ? 112 LYS B C   1 
ATOM   2711 O O   . LYS B 1 112 ? -9.338  -2.674  9.794   1.00 2.00  ? 112 LYS B O   1 
ATOM   2712 C CB  . LYS B 1 112 ? -6.699  -0.800  10.101  1.00 2.00  ? 112 LYS B CB  1 
ATOM   2713 C CG  . LYS B 1 112 ? -6.224  0.536   9.643   1.00 2.00  ? 112 LYS B CG  1 
ATOM   2714 C CD  . LYS B 1 112 ? -4.877  0.297   9.113   1.00 2.00  ? 112 LYS B CD  1 
ATOM   2715 C CE  . LYS B 1 112 ? -4.427  1.683   8.840   1.00 6.55  ? 112 LYS B CE  1 
ATOM   2716 N NZ  . LYS B 1 112 ? -3.341  1.665   7.885   1.00 12.32 ? 112 LYS B NZ  1 
ATOM   2717 N N   . VAL B 1 113 ? -8.220  -2.818  11.766  1.00 2.00  ? 113 VAL B N   1 
ATOM   2718 C CA  . VAL B 1 113 ? -8.622  -4.196  12.007  1.00 6.43  ? 113 VAL B CA  1 
ATOM   2719 C C   . VAL B 1 113 ? -10.129 -4.342  11.915  1.00 6.84  ? 113 VAL B C   1 
ATOM   2720 O O   . VAL B 1 113 ? -10.607 -5.126  11.072  1.00 6.51  ? 113 VAL B O   1 
ATOM   2721 C CB  . VAL B 1 113 ? -8.113  -4.688  13.410  1.00 10.00 ? 113 VAL B CB  1 
ATOM   2722 C CG1 . VAL B 1 113 ? -8.768  -5.988  13.957  1.00 8.04  ? 113 VAL B CG1 1 
ATOM   2723 C CG2 . VAL B 1 113 ? -6.644  -5.014  13.191  1.00 13.48 ? 113 VAL B CG2 1 
ATOM   2724 N N   . ALA B 1 114 ? -10.774 -3.462  12.737  1.00 6.26  ? 114 ALA B N   1 
ATOM   2725 C CA  . ALA B 1 114 ? -12.223 -3.354  12.898  1.00 3.78  ? 114 ALA B CA  1 
ATOM   2726 C C   . ALA B 1 114 ? -12.841 -3.103  11.567  1.00 3.21  ? 114 ALA B C   1 
ATOM   2727 O O   . ALA B 1 114 ? -13.732 -3.854  11.196  1.00 10.05 ? 114 ALA B O   1 
ATOM   2728 C CB  . ALA B 1 114 ? -12.672 -2.197  13.775  1.00 2.00  ? 114 ALA B CB  1 
ATOM   2729 N N   . HIS B 1 115 ? -12.379 -2.128  10.789  1.00 2.64  ? 115 HIS B N   1 
ATOM   2730 C CA  . HIS B 1 115 ? -13.000 -1.871  9.543   1.00 2.00  ? 115 HIS B CA  1 
ATOM   2731 C C   . HIS B 1 115 ? -12.803 -3.002  8.577   1.00 5.74  ? 115 HIS B C   1 
ATOM   2732 O O   . HIS B 1 115 ? -13.733 -3.272  7.815   1.00 6.39  ? 115 HIS B O   1 
ATOM   2733 C CB  . HIS B 1 115 ? -12.456 -0.613  8.959   1.00 2.00  ? 115 HIS B CB  1 
ATOM   2734 C CG  . HIS B 1 115 ? -13.203 -0.326  7.639   1.00 4.46  ? 115 HIS B CG  1 
ATOM   2735 N ND1 . HIS B 1 115 ? -12.723 -0.293  6.398   1.00 4.39  ? 115 HIS B ND1 1 
ATOM   2736 C CD2 . HIS B 1 115 ? -14.555 -0.057  7.538   1.00 3.50  ? 115 HIS B CD2 1 
ATOM   2737 C CE1 . HIS B 1 115 ? -13.699 -0.020  5.583   1.00 2.58  ? 115 HIS B CE1 1 
ATOM   2738 N NE2 . HIS B 1 115 ? -14.788 0.118   6.272   1.00 3.38  ? 115 HIS B NE2 1 
ATOM   2739 N N   . ALA B 1 116 ? -11.628 -3.645  8.566   1.00 8.55  ? 116 ALA B N   1 
ATOM   2740 C CA  . ALA B 1 116 ? -11.319 -4.681  7.593   1.00 7.53  ? 116 ALA B CA  1 
ATOM   2741 C C   . ALA B 1 116 ? -12.246 -5.858  7.800   1.00 7.94  ? 116 ALA B C   1 
ATOM   2742 O O   . ALA B 1 116 ? -12.866 -6.409  6.869   1.00 8.05  ? 116 ALA B O   1 
ATOM   2743 C CB  . ALA B 1 116 ? -9.893  -5.131  7.773   1.00 5.30  ? 116 ALA B CB  1 
ATOM   2744 N N   . LEU B 1 117 ? -12.367 -6.150  9.092   1.00 8.09  ? 117 LEU B N   1 
ATOM   2745 C CA  . LEU B 1 117 ? -13.221 -7.213  9.562   1.00 10.10 ? 117 LEU B CA  1 
ATOM   2746 C C   . LEU B 1 117 ? -14.718 -6.950  9.264   1.00 10.51 ? 117 LEU B C   1 
ATOM   2747 O O   . LEU B 1 117 ? -15.472 -7.855  8.861   1.00 10.07 ? 117 LEU B O   1 
ATOM   2748 C CB  . LEU B 1 117 ? -12.948 -7.369  11.041  1.00 9.20  ? 117 LEU B CB  1 
ATOM   2749 C CG  . LEU B 1 117 ? -11.778 -8.227  11.476  1.00 5.04  ? 117 LEU B CG  1 
ATOM   2750 C CD1 . LEU B 1 117 ? -11.588 -7.814  12.889  1.00 2.99  ? 117 LEU B CD1 1 
ATOM   2751 C CD2 . LEU B 1 117 ? -11.977 -9.748  11.357  1.00 2.00  ? 117 LEU B CD2 1 
ATOM   2752 N N   . ALA B 1 118 ? -15.161 -5.699  9.332   1.00 10.01 ? 118 ALA B N   1 
ATOM   2753 C CA  . ALA B 1 118 ? -16.510 -5.358  8.925   1.00 11.23 ? 118 ALA B CA  1 
ATOM   2754 C C   . ALA B 1 118 ? -16.782 -5.685  7.460   1.00 13.23 ? 118 ALA B C   1 
ATOM   2755 O O   . ALA B 1 118 ? -17.938 -5.892  7.062   1.00 17.53 ? 118 ALA B O   1 
ATOM   2756 C CB  . ALA B 1 118 ? -16.765 -3.892  9.107   1.00 10.82 ? 118 ALA B CB  1 
ATOM   2757 N N   . GLU B 1 119 ? -15.705 -5.759  6.659   1.00 13.06 ? 119 GLU B N   1 
ATOM   2758 C CA  . GLU B 1 119 ? -15.782 -5.993  5.234   1.00 8.52  ? 119 GLU B CA  1 
ATOM   2759 C C   . GLU B 1 119 ? -15.581 -7.409  4.861   1.00 7.10  ? 119 GLU B C   1 
ATOM   2760 O O   . GLU B 1 119 ? -15.828 -7.776  3.726   1.00 2.00  ? 119 GLU B O   1 
ATOM   2761 C CB  . GLU B 1 119 ? -14.760 -5.206  4.544   1.00 12.41 ? 119 GLU B CB  1 
ATOM   2762 C CG  . GLU B 1 119 ? -15.030 -3.720  4.516   1.00 18.92 ? 119 GLU B CG  1 
ATOM   2763 C CD  . GLU B 1 119 ? -16.057 -3.384  3.459   1.00 26.68 ? 119 GLU B CD  1 
ATOM   2764 O OE1 . GLU B 1 119 ? -15.986 -3.892  2.313   1.00 28.29 ? 119 GLU B OE1 1 
ATOM   2765 O OE2 . GLU B 1 119 ? -16.944 -2.609  3.823   1.00 30.23 ? 119 GLU B OE2 1 
ATOM   2766 N N   . GLY B 1 120 ? -15.019 -8.210  5.758   1.00 9.26  ? 120 GLY B N   1 
ATOM   2767 C CA  . GLY B 1 120 ? -14.931 -9.630  5.491   1.00 10.66 ? 120 GLY B CA  1 
ATOM   2768 C C   . GLY B 1 120 ? -13.688 -10.049 4.770   1.00 12.62 ? 120 GLY B C   1 
ATOM   2769 O O   . GLY B 1 120 ? -13.664 -10.986 3.961   1.00 14.21 ? 120 GLY B O   1 
ATOM   2770 N N   . LEU B 1 121 ? -12.637 -9.301  5.098   1.00 13.63 ? 121 LEU B N   1 
ATOM   2771 C CA  . LEU B 1 121 ? -11.302 -9.697  4.695   1.00 11.20 ? 121 LEU B CA  1 
ATOM   2772 C C   . LEU B 1 121 ? -10.680 -10.219 6.014   1.00 14.84 ? 121 LEU B C   1 
ATOM   2773 O O   . LEU B 1 121 ? -10.958 -9.695  7.121   1.00 15.92 ? 121 LEU B O   1 
ATOM   2774 C CB  . LEU B 1 121 ? -10.477 -8.556  4.280   1.00 5.34  ? 121 LEU B CB  1 
ATOM   2775 C CG  . LEU B 1 121 ? -10.949 -7.398  3.550   1.00 2.00  ? 121 LEU B CG  1 
ATOM   2776 C CD1 . LEU B 1 121 ? -9.795  -6.467  3.340   1.00 2.00  ? 121 LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 1 121 ? -11.388 -7.807  2.215   1.00 2.77  ? 121 LEU B CD2 1 
ATOM   2778 N N   . GLY B 1 122 ? -9.852  -11.270 5.928   1.00 17.25 ? 122 GLY B N   1 
ATOM   2779 C CA  . GLY B 1 122 ? -9.128  -11.807 7.080   1.00 15.95 ? 122 GLY B CA  1 
ATOM   2780 C C   . GLY B 1 122 ? -7.968  -10.871 7.402   1.00 14.90 ? 122 GLY B C   1 
ATOM   2781 O O   . GLY B 1 122 ? -7.388  -10.303 6.452   1.00 16.59 ? 122 GLY B O   1 
ATOM   2782 N N   . VAL B 1 123 ? -7.627  -10.638 8.685   1.00 14.15 ? 123 VAL B N   1 
ATOM   2783 C CA  . VAL B 1 123 ? -6.458  -9.816  9.021   1.00 10.26 ? 123 VAL B CA  1 
ATOM   2784 C C   . VAL B 1 123 ? -5.393  -10.754 9.591   1.00 9.62  ? 123 VAL B C   1 
ATOM   2785 O O   . VAL B 1 123 ? -5.693  -11.859 10.073  1.00 8.30  ? 123 VAL B O   1 
ATOM   2786 C CB  . VAL B 1 123 ? -6.720  -8.650  10.097  1.00 6.50  ? 123 VAL B CB  1 
ATOM   2787 C CG1 . VAL B 1 123 ? -8.098  -8.035  9.935   1.00 8.00  ? 123 VAL B CG1 1 
ATOM   2788 C CG2 . VAL B 1 123 ? -6.706  -9.150  11.479  1.00 7.25  ? 123 VAL B CG2 1 
ATOM   2789 N N   . ILE B 1 124 ? -4.146  -10.296 9.438   1.00 8.04  ? 124 ILE B N   1 
ATOM   2790 C CA  . ILE B 1 124 ? -2.929  -10.856 10.006  1.00 6.19  ? 124 ILE B CA  1 
ATOM   2791 C C   . ILE B 1 124 ? -2.570  -9.633  10.776  1.00 2.00  ? 124 ILE B C   1 
ATOM   2792 O O   . ILE B 1 124 ? -2.149  -8.642  10.203  1.00 3.59  ? 124 ILE B O   1 
ATOM   2793 C CB  . ILE B 1 124 ? -1.858  -11.158 8.926   1.00 7.39  ? 124 ILE B CB  1 
ATOM   2794 C CG1 . ILE B 1 124 ? -2.388  -12.336 8.103   1.00 8.38  ? 124 ILE B CG1 1 
ATOM   2795 C CG2 . ILE B 1 124 ? -0.467  -11.470 9.551   1.00 9.20  ? 124 ILE B CG2 1 
ATOM   2796 C CD1 . ILE B 1 124 ? -1.726  -12.548 6.735   1.00 10.79 ? 124 ILE B CD1 1 
ATOM   2797 N N   . ALA B 1 125 ? -2.929  -9.546  12.009  1.00 2.00  ? 125 ALA B N   1 
ATOM   2798 C CA  . ALA B 1 125 ? -2.541  -8.345  12.706  1.00 4.39  ? 125 ALA B CA  1 
ATOM   2799 C C   . ALA B 1 125 ? -1.149  -8.653  13.266  1.00 7.65  ? 125 ALA B C   1 
ATOM   2800 O O   . ALA B 1 125 ? -0.895  -9.753  13.801  1.00 13.57 ? 125 ALA B O   1 
ATOM   2801 C CB  . ALA B 1 125 ? -3.534  -8.086  13.802  1.00 2.13  ? 125 ALA B CB  1 
ATOM   2802 N N   . CYS B 1 126 ? -0.209  -7.737  13.102  1.00 6.11  ? 126 CYS B N   1 
ATOM   2803 C CA  . CYS B 1 126 ? 1.159   -7.885  13.547  1.00 4.58  ? 126 CYS B CA  1 
ATOM   2804 C C   . CYS B 1 126 ? 1.420   -7.136  14.843  1.00 6.12  ? 126 CYS B C   1 
ATOM   2805 O O   . CYS B 1 126 ? 0.805   -6.107  15.120  1.00 7.38  ? 126 CYS B O   1 
ATOM   2806 C CB  . CYS B 1 126 ? 2.049   -7.400  12.424  1.00 3.06  ? 126 CYS B CB  1 
ATOM   2807 S SG  . CYS B 1 126 ? 1.922   -8.336  10.853  1.00 2.00  ? 126 CYS B SG  1 
ATOM   2808 N N   . ILE B 1 127 ? 2.231   -7.740  15.725  1.00 9.98  ? 127 ILE B N   1 
ATOM   2809 C CA  . ILE B 1 127 ? 2.645   -7.233  17.054  1.00 11.06 ? 127 ILE B CA  1 
ATOM   2810 C C   . ILE B 1 127 ? 4.105   -7.628  17.219  1.00 12.45 ? 127 ILE B C   1 
ATOM   2811 O O   . ILE B 1 127 ? 4.497   -8.636  16.599  1.00 14.22 ? 127 ILE B O   1 
ATOM   2812 C CB  . ILE B 1 127 ? 1.862   -7.888  18.244  1.00 8.51  ? 127 ILE B CB  1 
ATOM   2813 C CG1 . ILE B 1 127 ? 1.840   -9.389  18.079  1.00 7.88  ? 127 ILE B CG1 1 
ATOM   2814 C CG2 . ILE B 1 127 ? 0.447   -7.349  18.296  1.00 13.25 ? 127 ILE B CG2 1 
ATOM   2815 C CD1 . ILE B 1 127 ? 0.847   -10.191 18.915  1.00 6.74  ? 127 ILE B CD1 1 
ATOM   2816 N N   . GLY B 1 128 ? 4.920   -6.951  18.031  1.00 12.04 ? 128 GLY B N   1 
ATOM   2817 C CA  . GLY B 1 128 ? 6.295   -7.354  18.283  1.00 10.05 ? 128 GLY B CA  1 
ATOM   2818 C C   . GLY B 1 128 ? 7.154   -6.224  18.808  1.00 13.04 ? 128 GLY B C   1 
ATOM   2819 O O   . GLY B 1 128 ? 7.047   -5.035  18.435  1.00 16.12 ? 128 GLY B O   1 
ATOM   2820 N N   . GLU B 1 129 ? 8.052   -6.617  19.692  1.00 14.69 ? 129 GLU B N   1 
ATOM   2821 C CA  . GLU B 1 129 ? 8.953   -5.703  20.378  1.00 17.20 ? 129 GLU B CA  1 
ATOM   2822 C C   . GLU B 1 129 ? 10.237  -5.498  19.612  1.00 22.53 ? 129 GLU B C   1 
ATOM   2823 O O   . GLU B 1 129 ? 10.747  -6.389  18.882  1.00 25.84 ? 129 GLU B O   1 
ATOM   2824 C CB  . GLU B 1 129 ? 9.325   -6.246  21.763  1.00 17.47 ? 129 GLU B CB  1 
ATOM   2825 C CG  . GLU B 1 129 ? 10.415  -7.334  22.009  1.00 10.97 ? 129 GLU B CG  1 
ATOM   2826 C CD  . GLU B 1 129 ? 10.348  -8.589  21.157  1.00 10.36 ? 129 GLU B CD  1 
ATOM   2827 O OE1 . GLU B 1 129 ? 9.260   -9.120  20.916  1.00 9.88  ? 129 GLU B OE1 1 
ATOM   2828 O OE2 . GLU B 1 129 ? 11.407  -9.027  20.718  1.00 8.66  ? 129 GLU B OE2 1 
ATOM   2829 N N   . LYS B 1 130 ? 10.763  -4.312  19.903  1.00 23.81 ? 130 LYS B N   1 
ATOM   2830 C CA  . LYS B 1 130 ? 12.069  -3.889  19.402  1.00 26.36 ? 130 LYS B CA  1 
ATOM   2831 C C   . LYS B 1 130 ? 13.134  -4.404  20.404  1.00 29.71 ? 130 LYS B C   1 
ATOM   2832 O O   . LYS B 1 130 ? 12.859  -5.033  21.455  1.00 28.68 ? 130 LYS B O   1 
ATOM   2833 C CB  . LYS B 1 130 ? 12.130  -2.350  19.316  1.00 22.16 ? 130 LYS B CB  1 
ATOM   2834 C CG  . LYS B 1 130 ? 10.852  -1.693  18.836  1.00 20.30 ? 130 LYS B CG  1 
ATOM   2835 C CD  . LYS B 1 130 ? 11.116  -0.528  17.930  1.00 18.39 ? 130 LYS B CD  1 
ATOM   2836 C CE  . LYS B 1 130 ? 11.358  0.723   18.691  1.00 19.58 ? 130 LYS B CE  1 
ATOM   2837 N NZ  . LYS B 1 130 ? 10.113  1.159   19.275  1.00 23.62 ? 130 LYS B NZ  1 
ATOM   2838 N N   . LEU B 1 131 ? 14.394  -4.037  20.128  1.00 33.89 ? 131 LEU B N   1 
ATOM   2839 C CA  . LEU B 1 131 ? 15.515  -4.442  20.976  1.00 34.03 ? 131 LEU B CA  1 
ATOM   2840 C C   . LEU B 1 131 ? 15.557  -3.720  22.306  1.00 29.54 ? 131 LEU B C   1 
ATOM   2841 O O   . LEU B 1 131 ? 15.759  -4.395  23.300  1.00 28.41 ? 131 LEU B O   1 
ATOM   2842 C CB  . LEU B 1 131 ? 16.838  -4.239  20.209  1.00 37.70 ? 131 LEU B CB  1 
ATOM   2843 C CG  . LEU B 1 131 ? 18.070  -4.999  20.741  1.00 41.82 ? 131 LEU B CG  1 
ATOM   2844 C CD1 . LEU B 1 131 ? 17.698  -6.459  21.116  1.00 40.70 ? 131 LEU B CD1 1 
ATOM   2845 C CD2 . LEU B 1 131 ? 19.179  -4.904  19.681  1.00 43.89 ? 131 LEU B CD2 1 
ATOM   2846 N N   . ASP B 1 132 ? 15.271  -2.426  22.386  1.00 28.67 ? 132 ASP B N   1 
ATOM   2847 C CA  . ASP B 1 132 ? 15.215  -1.698  23.647  1.00 31.31 ? 132 ASP B CA  1 
ATOM   2848 C C   . ASP B 1 132 ? 14.197  -2.297  24.658  1.00 31.78 ? 132 ASP B C   1 
ATOM   2849 O O   . ASP B 1 132 ? 14.222  -2.069  25.869  1.00 29.66 ? 132 ASP B O   1 
ATOM   2850 C CB  . ASP B 1 132 ? 14.873  -0.201  23.330  1.00 35.07 ? 132 ASP B CB  1 
ATOM   2851 C CG  . ASP B 1 132 ? 13.493  0.239   22.731  1.00 37.89 ? 132 ASP B CG  1 
ATOM   2852 O OD1 . ASP B 1 132 ? 13.364  0.317   21.511  1.00 39.17 ? 132 ASP B OD1 1 
ATOM   2853 O OD2 . ASP B 1 132 ? 12.544  0.577   23.459  1.00 35.87 ? 132 ASP B OD2 1 
ATOM   2854 N N   . GLU B 1 133 ? 13.300  -3.167  24.199  1.00 31.44 ? 133 GLU B N   1 
ATOM   2855 C CA  . GLU B 1 133 ? 12.228  -3.660  25.021  1.00 31.88 ? 133 GLU B CA  1 
ATOM   2856 C C   . GLU B 1 133 ? 12.556  -5.053  25.504  1.00 33.72 ? 133 GLU B C   1 
ATOM   2857 O O   . GLU B 1 133 ? 12.292  -5.403  26.660  1.00 34.92 ? 133 GLU B O   1 
ATOM   2858 C CB  . GLU B 1 133 ? 10.950  -3.662  24.207  1.00 32.12 ? 133 GLU B CB  1 
ATOM   2859 C CG  . GLU B 1 133 ? 10.856  -2.444  23.329  1.00 32.30 ? 133 GLU B CG  1 
ATOM   2860 C CD  . GLU B 1 133 ? 9.475   -2.119  22.838  1.00 31.89 ? 133 GLU B CD  1 
ATOM   2861 O OE1 . GLU B 1 133 ? 8.829   -1.405  23.577  1.00 34.92 ? 133 GLU B OE1 1 
ATOM   2862 O OE2 . GLU B 1 133 ? 9.056   -2.536  21.756  1.00 34.84 ? 133 GLU B OE2 1 
ATOM   2863 N N   . ARG B 1 134 ? 13.113  -5.868  24.610  1.00 33.57 ? 134 ARG B N   1 
ATOM   2864 C CA  . ARG B 1 134 ? 13.618  -7.194  24.956  1.00 34.68 ? 134 ARG B CA  1 
ATOM   2865 C C   . ARG B 1 134 ? 14.739  -7.009  25.976  1.00 36.89 ? 134 ARG B C   1 
ATOM   2866 O O   . ARG B 1 134 ? 14.928  -7.834  26.867  1.00 36.07 ? 134 ARG B O   1 
ATOM   2867 C CB  . ARG B 1 134 ? 14.166  -7.845  23.702  1.00 34.61 ? 134 ARG B CB  1 
ATOM   2868 C CG  . ARG B 1 134 ? 15.068  -9.085  23.763  1.00 29.85 ? 134 ARG B CG  1 
ATOM   2869 C CD  . ARG B 1 134 ? 14.398  -10.415 24.127  1.00 33.58 ? 134 ARG B CD  1 
ATOM   2870 N NE  . ARG B 1 134 ? 13.084  -10.598 23.520  1.00 30.09 ? 134 ARG B NE  1 
ATOM   2871 C CZ  . ARG B 1 134 ? 12.505  -11.774 23.334  1.00 26.78 ? 134 ARG B CZ  1 
ATOM   2872 N NH1 . ARG B 1 134 ? 13.028  -12.950 23.658  1.00 26.34 ? 134 ARG B NH1 1 
ATOM   2873 N NH2 . ARG B 1 134 ? 11.300  -11.728 22.827  1.00 29.60 ? 134 ARG B NH2 1 
ATOM   2874 N N   . GLU B 1 135 ? 15.486  -5.902  25.801  1.00 37.87 ? 135 GLU B N   1 
ATOM   2875 C CA  . GLU B 1 135 ? 16.572  -5.534  26.671  1.00 39.32 ? 135 GLU B CA  1 
ATOM   2876 C C   . GLU B 1 135 ? 15.927  -5.272  27.991  1.00 41.38 ? 135 GLU B C   1 
ATOM   2877 O O   . GLU B 1 135 ? 16.174  -6.003  28.941  1.00 45.85 ? 135 GLU B O   1 
ATOM   2878 C CB  . GLU B 1 135 ? 17.275  -4.271  26.219  1.00 38.96 ? 135 GLU B CB  1 
ATOM   2879 C CG  . GLU B 1 135 ? 18.781  -4.454  25.985  1.00 41.14 ? 135 GLU B CG  1 
ATOM   2880 C CD  . GLU B 1 135 ? 19.165  -5.417  24.848  1.00 41.95 ? 135 GLU B CD  1 
ATOM   2881 O OE1 . GLU B 1 135 ? 19.232  -6.633  25.090  1.00 43.58 ? 135 GLU B OE1 1 
ATOM   2882 O OE2 . GLU B 1 135 ? 19.419  -4.944  23.731  1.00 39.93 ? 135 GLU B OE2 1 
ATOM   2883 N N   . ALA B 1 136 ? 14.987  -4.345  28.067  1.00 42.09 ? 136 ALA B N   1 
ATOM   2884 C CA  . ALA B 1 136 ? 14.338  -4.093  29.339  1.00 42.12 ? 136 ALA B CA  1 
ATOM   2885 C C   . ALA B 1 136 ? 13.489  -5.278  29.828  1.00 41.96 ? 136 ALA B C   1 
ATOM   2886 O O   . ALA B 1 136 ? 12.897  -5.220  30.916  1.00 42.24 ? 136 ALA B O   1 
ATOM   2887 C CB  . ALA B 1 136 ? 13.469  -2.844  29.192  1.00 43.25 ? 136 ALA B CB  1 
ATOM   2888 N N   . GLY B 1 137 ? 13.397  -6.350  29.021  1.00 40.06 ? 137 GLY B N   1 
ATOM   2889 C CA  . GLY B 1 137 ? 12.627  -7.525  29.358  1.00 38.78 ? 137 GLY B CA  1 
ATOM   2890 C C   . GLY B 1 137 ? 11.151  -7.188  29.427  1.00 38.71 ? 137 GLY B C   1 
ATOM   2891 O O   . GLY B 1 137 ? 10.348  -8.017  29.858  1.00 40.80 ? 137 GLY B O   1 
ATOM   2892 N N   . ILE B 1 138 ? 10.709  -6.037  28.891  1.00 37.77 ? 138 ILE B N   1 
ATOM   2893 C CA  . ILE B 1 138 ? 9.312   -5.611  28.945  1.00 34.70 ? 138 ILE B CA  1 
ATOM   2894 C C   . ILE B 1 138 ? 8.549   -6.051  27.719  1.00 34.21 ? 138 ILE B C   1 
ATOM   2895 O O   . ILE B 1 138 ? 7.591   -5.439  27.261  1.00 34.63 ? 138 ILE B O   1 
ATOM   2896 C CB  . ILE B 1 138 ? 9.233   -4.089  29.083  1.00 33.20 ? 138 ILE B CB  1 
ATOM   2897 C CG1 . ILE B 1 138 ? 9.914   -3.369  27.921  1.00 30.11 ? 138 ILE B CG1 1 
ATOM   2898 C CG2 . ILE B 1 138 ? 9.837   -3.755  30.459  1.00 33.55 ? 138 ILE B CG2 1 
ATOM   2899 C CD1 . ILE B 1 138 ? 9.312   -1.998  27.557  1.00 26.95 ? 138 ILE B CD1 1 
ATOM   2900 N N   . THR B 1 139 ? 8.999   -7.175  27.209  1.00 34.82 ? 139 THR B N   1 
ATOM   2901 C CA  . THR B 1 139 ? 8.468   -7.859  26.068  1.00 34.95 ? 139 THR B CA  1 
ATOM   2902 C C   . THR B 1 139 ? 7.030   -8.094  26.435  1.00 35.36 ? 139 THR B C   1 
ATOM   2903 O O   . THR B 1 139 ? 6.177   -7.586  25.723  1.00 36.33 ? 139 THR B O   1 
ATOM   2904 C CB  . THR B 1 139 ? 9.316   -9.120  25.938  1.00 35.67 ? 139 THR B CB  1 
ATOM   2905 O OG1 . THR B 1 139 ? 10.630  -8.612  25.632  1.00 37.91 ? 139 THR B OG1 1 
ATOM   2906 C CG2 . THR B 1 139 ? 8.741   -10.159 24.981  1.00 34.95 ? 139 THR B CG2 1 
ATOM   2907 N N   . GLU B 1 140 ? 6.778   -8.713  27.604  1.00 36.31 ? 140 GLU B N   1 
ATOM   2908 C CA  . GLU B 1 140 ? 5.432   -9.016  28.111  1.00 34.42 ? 140 GLU B CA  1 
ATOM   2909 C C   . GLU B 1 140 ? 4.425   -7.897  27.955  1.00 30.34 ? 140 GLU B C   1 
ATOM   2910 O O   . GLU B 1 140 ? 3.420   -8.075  27.288  1.00 29.90 ? 140 GLU B O   1 
ATOM   2911 C CB  . GLU B 1 140 ? 5.453   -9.339  29.578  1.00 38.55 ? 140 GLU B CB  1 
ATOM   2912 C CG  . GLU B 1 140 ? 4.623   -10.581 29.843  1.00 44.62 ? 140 GLU B CG  1 
ATOM   2913 C CD  . GLU B 1 140 ? 5.425   -11.879 29.790  1.00 46.59 ? 140 GLU B CD  1 
ATOM   2914 O OE1 . GLU B 1 140 ? 6.143   -12.077 28.786  1.00 48.22 ? 140 GLU B OE1 1 
ATOM   2915 O OE2 . GLU B 1 140 ? 5.308   -12.657 30.762  1.00 42.97 ? 140 GLU B OE2 1 
ATOM   2916 N N   . LYS B 1 141 ? 4.702   -6.743  28.547  1.00 26.52 ? 141 LYS B N   1 
ATOM   2917 C CA  . LYS B 1 141 ? 3.882   -5.574  28.393  1.00 24.05 ? 141 LYS B CA  1 
ATOM   2918 C C   . LYS B 1 141 ? 3.863   -5.318  26.894  1.00 22.95 ? 141 LYS B C   1 
ATOM   2919 O O   . LYS B 1 141 ? 2.845   -5.649  26.319  1.00 28.38 ? 141 LYS B O   1 
ATOM   2920 C CB  . LYS B 1 141 ? 4.495   -4.390  29.154  1.00 26.04 ? 141 LYS B CB  1 
ATOM   2921 C CG  . LYS B 1 141 ? 3.806   -3.016  29.061  1.00 31.09 ? 141 LYS B CG  1 
ATOM   2922 C CD  . LYS B 1 141 ? 4.758   -1.893  29.572  1.00 35.16 ? 141 LYS B CD  1 
ATOM   2923 C CE  . LYS B 1 141 ? 4.375   -0.399  29.305  1.00 35.33 ? 141 LYS B CE  1 
ATOM   2924 N NZ  . LYS B 1 141 ? 4.345   -0.037  27.892  1.00 32.52 ? 141 LYS B NZ  1 
ATOM   2925 N N   . VAL B 1 142 ? 4.870   -4.954  26.124  1.00 18.96 ? 142 VAL B N   1 
ATOM   2926 C CA  . VAL B 1 142 ? 4.639   -4.533  24.756  1.00 17.16 ? 142 VAL B CA  1 
ATOM   2927 C C   . VAL B 1 142 ? 4.107   -5.523  23.726  1.00 15.71 ? 142 VAL B C   1 
ATOM   2928 O O   . VAL B 1 142 ? 3.612   -5.143  22.684  1.00 12.69 ? 142 VAL B O   1 
ATOM   2929 C CB  . VAL B 1 142 ? 5.924   -3.902  24.305  1.00 19.24 ? 142 VAL B CB  1 
ATOM   2930 C CG1 . VAL B 1 142 ? 6.254   -2.828  25.363  1.00 19.78 ? 142 VAL B CG1 1 
ATOM   2931 C CG2 . VAL B 1 142 ? 7.008   -4.928  24.081  1.00 18.33 ? 142 VAL B CG2 1 
ATOM   2932 N N   . VAL B 1 143 ? 4.129   -6.803  23.936  1.00 16.75 ? 143 VAL B N   1 
ATOM   2933 C CA  . VAL B 1 143 ? 3.362   -7.697  23.106  1.00 18.47 ? 143 VAL B CA  1 
ATOM   2934 C C   . VAL B 1 143 ? 1.935   -7.659  23.710  1.00 22.13 ? 143 VAL B C   1 
ATOM   2935 O O   . VAL B 1 143 ? 0.950   -7.455  22.993  1.00 23.19 ? 143 VAL B O   1 
ATOM   2936 C CB  . VAL B 1 143 ? 4.087   -9.066  23.172  1.00 16.94 ? 143 VAL B CB  1 
ATOM   2937 C CG1 . VAL B 1 143 ? 3.173   -10.263 23.069  1.00 19.21 ? 143 VAL B CG1 1 
ATOM   2938 C CG2 . VAL B 1 143 ? 4.981   -9.150  21.951  1.00 12.44 ? 143 VAL B CG2 1 
ATOM   2939 N N   . PHE B 1 144 ? 1.718   -7.760  25.032  1.00 23.70 ? 144 PHE B N   1 
ATOM   2940 C CA  . PHE B 1 144 ? 0.369   -7.744  25.574  1.00 22.60 ? 144 PHE B CA  1 
ATOM   2941 C C   . PHE B 1 144 ? -0.378  -6.435  25.388  1.00 23.91 ? 144 PHE B C   1 
ATOM   2942 O O   . PHE B 1 144 ? -1.581  -6.517  25.137  1.00 25.61 ? 144 PHE B O   1 
ATOM   2943 C CB  . PHE B 1 144 ? 0.392   -8.074  27.036  1.00 20.65 ? 144 PHE B CB  1 
ATOM   2944 C CG  . PHE B 1 144 ? 0.613   -9.554  27.373  1.00 22.64 ? 144 PHE B CG  1 
ATOM   2945 C CD1 . PHE B 1 144 ? 0.678   -10.561 26.393  1.00 24.84 ? 144 PHE B CD1 1 
ATOM   2946 C CD2 . PHE B 1 144 ? 0.773   -9.915  28.719  1.00 22.62 ? 144 PHE B CD2 1 
ATOM   2947 C CE1 . PHE B 1 144 ? 0.905   -11.894 26.770  1.00 25.74 ? 144 PHE B CE1 1 
ATOM   2948 C CE2 . PHE B 1 144 ? 0.991   -11.242 29.083  1.00 21.83 ? 144 PHE B CE2 1 
ATOM   2949 C CZ  . PHE B 1 144 ? 1.060   -12.230 28.113  1.00 22.70 ? 144 PHE B CZ  1 
ATOM   2950 N N   . GLU B 1 145 ? 0.235   -5.229  25.432  1.00 25.18 ? 145 GLU B N   1 
ATOM   2951 C CA  . GLU B 1 145 ? -0.441  -3.924  25.260  1.00 23.51 ? 145 GLU B CA  1 
ATOM   2952 C C   . GLU B 1 145 ? -0.960  -3.981  23.834  1.00 23.17 ? 145 GLU B C   1 
ATOM   2953 O O   . GLU B 1 145 ? -2.165  -3.887  23.537  1.00 22.79 ? 145 GLU B O   1 
ATOM   2954 C CB  . GLU B 1 145 ? 0.488   -2.648  25.377  1.00 25.27 ? 145 GLU B CB  1 
ATOM   2955 C CG  . GLU B 1 145 ? 0.837   -2.065  26.798  1.00 30.58 ? 145 GLU B CG  1 
ATOM   2956 C CD  . GLU B 1 145 ? 1.230   -0.556  27.013  1.00 32.24 ? 145 GLU B CD  1 
ATOM   2957 O OE1 . GLU B 1 145 ? 1.497   0.190   26.073  1.00 28.14 ? 145 GLU B OE1 1 
ATOM   2958 O OE2 . GLU B 1 145 ? 1.251   -0.085  28.160  1.00 33.36 ? 145 GLU B OE2 1 
ATOM   2959 N N   . GLN B 1 146 ? -0.014  -4.275  22.954  1.00 21.52 ? 146 GLN B N   1 
ATOM   2960 C CA  . GLN B 1 146 ? -0.352  -4.433  21.558  1.00 20.76 ? 146 GLN B CA  1 
ATOM   2961 C C   . GLN B 1 146 ? -1.532  -5.388  21.269  1.00 20.77 ? 146 GLN B C   1 
ATOM   2962 O O   . GLN B 1 146 ? -2.499  -4.974  20.592  1.00 19.73 ? 146 GLN B O   1 
ATOM   2963 C CB  . GLN B 1 146 ? 0.890   -4.904  20.845  1.00 17.37 ? 146 GLN B CB  1 
ATOM   2964 C CG  . GLN B 1 146 ? 1.897   -3.804  20.640  1.00 9.59  ? 146 GLN B CG  1 
ATOM   2965 C CD  . GLN B 1 146 ? 3.036   -4.247  19.731  1.00 6.49  ? 146 GLN B CD  1 
ATOM   2966 O OE1 . GLN B 1 146 ? 3.223   -5.418  19.385  1.00 2.00  ? 146 GLN B OE1 1 
ATOM   2967 N NE2 . GLN B 1 146 ? 3.807   -3.242  19.305  1.00 2.67  ? 146 GLN B NE2 1 
ATOM   2968 N N   . THR B 1 147 ? -1.505  -6.626  21.791  1.00 19.72 ? 147 THR B N   1 
ATOM   2969 C CA  . THR B 1 147 ? -2.616  -7.546  21.593  1.00 17.71 ? 147 THR B CA  1 
ATOM   2970 C C   . THR B 1 147 ? -3.892  -7.040  22.294  1.00 19.31 ? 147 THR B C   1 
ATOM   2971 O O   . THR B 1 147 ? -4.971  -7.410  21.789  1.00 20.64 ? 147 THR B O   1 
ATOM   2972 C CB  . THR B 1 147 ? -2.277  -8.952  22.117  1.00 13.50 ? 147 THR B CB  1 
ATOM   2973 O OG1 . THR B 1 147 ? -0.862  -9.108  21.960  1.00 14.33 ? 147 THR B OG1 1 
ATOM   2974 C CG2 . THR B 1 147 ? -2.982  -10.075 21.350  1.00 5.33  ? 147 THR B CG2 1 
ATOM   2975 N N   . LYS B 1 148 ? -3.899  -6.196  23.362  1.00 15.81 ? 148 LYS B N   1 
ATOM   2976 C CA  . LYS B 1 148 ? -5.167  -5.768  23.940  1.00 13.54 ? 148 LYS B CA  1 
ATOM   2977 C C   . LYS B 1 148 ? -5.913  -5.040  22.875  1.00 11.52 ? 148 LYS B C   1 
ATOM   2978 O O   . LYS B 1 148 ? -7.012  -5.481  22.561  1.00 10.20 ? 148 LYS B O   1 
ATOM   2979 C CB  . LYS B 1 148 ? -5.067  -4.787  25.067  1.00 17.18 ? 148 LYS B CB  1 
ATOM   2980 C CG  . LYS B 1 148 ? -5.778  -5.363  26.265  1.00 22.54 ? 148 LYS B CG  1 
ATOM   2981 C CD  . LYS B 1 148 ? -7.218  -4.934  26.556  1.00 25.02 ? 148 LYS B CD  1 
ATOM   2982 C CE  . LYS B 1 148 ? -7.317  -3.558  27.237  1.00 24.88 ? 148 LYS B CE  1 
ATOM   2983 N NZ  . LYS B 1 148 ? -8.640  -3.386  27.831  1.00 24.10 ? 148 LYS B NZ  1 
ATOM   2984 N N   . VAL B 1 149 ? -5.221  -4.047  22.295  1.00 8.01  ? 149 VAL B N   1 
ATOM   2985 C CA  . VAL B 1 149 ? -5.686  -3.165  21.216  1.00 6.88  ? 149 VAL B CA  1 
ATOM   2986 C C   . VAL B 1 149 ? -6.166  -3.850  19.913  1.00 6.67  ? 149 VAL B C   1 
ATOM   2987 O O   . VAL B 1 149 ? -7.300  -3.612  19.480  1.00 9.42  ? 149 VAL B O   1 
ATOM   2988 C CB  . VAL B 1 149 ? -4.520  -2.158  20.985  1.00 4.51  ? 149 VAL B CB  1 
ATOM   2989 C CG1 . VAL B 1 149 ? -4.781  -1.192  19.848  1.00 2.00  ? 149 VAL B CG1 1 
ATOM   2990 C CG2 . VAL B 1 149 ? -4.312  -1.406  22.322  1.00 4.09  ? 149 VAL B CG2 1 
ATOM   2991 N N   . ILE B 1 150 ? -5.421  -4.730  19.264  1.00 3.74  ? 150 ILE B N   1 
ATOM   2992 C CA  . ILE B 1 150 ? -5.948  -5.532  18.173  1.00 3.37  ? 150 ILE B CA  1 
ATOM   2993 C C   . ILE B 1 150 ? -7.179  -6.254  18.723  1.00 5.43  ? 150 ILE B C   1 
ATOM   2994 O O   . ILE B 1 150 ? -8.273  -5.945  18.261  1.00 4.37  ? 150 ILE B O   1 
ATOM   2995 C CB  . ILE B 1 150 ? -4.842  -6.555  17.641  1.00 2.00  ? 150 ILE B CB  1 
ATOM   2996 C CG1 . ILE B 1 150 ? -3.824  -5.943  16.644  1.00 2.00  ? 150 ILE B CG1 1 
ATOM   2997 C CG2 . ILE B 1 150 ? -5.540  -7.666  16.921  1.00 2.62  ? 150 ILE B CG2 1 
ATOM   2998 C CD1 . ILE B 1 150 ? -2.454  -5.300  17.151  1.00 4.40  ? 150 ILE B CD1 1 
ATOM   2999 N N   . ALA B 1 151 ? -7.069  -7.093  19.763  1.00 10.33 ? 151 ALA B N   1 
ATOM   3000 C CA  . ALA B 1 151 ? -8.176  -7.839  20.358  1.00 12.31 ? 151 ALA B CA  1 
ATOM   3001 C C   . ALA B 1 151 ? -9.432  -7.041  20.705  1.00 15.83 ? 151 ALA B C   1 
ATOM   3002 O O   . ALA B 1 151 ? -10.541 -7.482  20.454  1.00 17.06 ? 151 ALA B O   1 
ATOM   3003 C CB  . ALA B 1 151 ? -7.697  -8.513  21.625  1.00 11.81 ? 151 ALA B CB  1 
ATOM   3004 N N   . ASP B 1 152 ? -9.337  -5.832  21.247  1.00 21.51 ? 152 ASP B N   1 
ATOM   3005 C CA  . ASP B 1 152 ? -10.457 -4.920  21.517  1.00 24.39 ? 152 ASP B CA  1 
ATOM   3006 C C   . ASP B 1 152 ? -11.268 -4.536  20.256  1.00 27.12 ? 152 ASP B C   1 
ATOM   3007 O O   . ASP B 1 152 ? -12.413 -4.081  20.351  1.00 30.16 ? 152 ASP B O   1 
ATOM   3008 C CB  . ASP B 1 152 ? -9.961  -3.590  22.116  1.00 22.68 ? 152 ASP B CB  1 
ATOM   3009 C CG  . ASP B 1 152 ? -9.272  -3.623  23.460  1.00 19.20 ? 152 ASP B CG  1 
ATOM   3010 O OD1 . ASP B 1 152 ? -9.411  -4.596  24.184  1.00 15.41 ? 152 ASP B OD1 1 
ATOM   3011 O OD2 . ASP B 1 152 ? -8.576  -2.667  23.775  1.00 21.03 ? 152 ASP B OD2 1 
ATOM   3012 N N   . ASN B 1 153 ? -10.649 -4.551  19.069  1.00 26.42 ? 153 ASN B N   1 
ATOM   3013 C CA  . ASN B 1 153 ? -11.365 -4.255  17.847  1.00 25.11 ? 153 ASN B CA  1 
ATOM   3014 C C   . ASN B 1 153 ? -11.677 -5.554  17.126  1.00 23.02 ? 153 ASN B C   1 
ATOM   3015 O O   . ASN B 1 153 ? -12.205 -5.516  16.017  1.00 23.19 ? 153 ASN B O   1 
ATOM   3016 C CB  . ASN B 1 153 ? -10.527 -3.359  16.976  1.00 28.17 ? 153 ASN B CB  1 
ATOM   3017 C CG  . ASN B 1 153 ? -10.338 -2.000  17.639  1.00 30.42 ? 153 ASN B CG  1 
ATOM   3018 O OD1 . ASN B 1 153 ? -10.981 -0.997  17.310  1.00 31.57 ? 153 ASN B OD1 1 
ATOM   3019 N ND2 . ASN B 1 153 ? -9.395  -1.892  18.568  1.00 30.08 ? 153 ASN B ND2 1 
ATOM   3020 N N   . VAL B 1 154 ? -11.348 -6.749  17.640  1.00 19.55 ? 154 VAL B N   1 
ATOM   3021 C CA  . VAL B 1 154 ? -11.776 -7.971  16.973  1.00 15.19 ? 154 VAL B CA  1 
ATOM   3022 C C   . VAL B 1 154 ? -13.074 -8.262  17.675  1.00 17.12 ? 154 VAL B C   1 
ATOM   3023 O O   . VAL B 1 154 ? -13.286 -8.123  18.880  1.00 16.33 ? 154 VAL B O   1 
ATOM   3024 C CB  . VAL B 1 154 ? -10.896 -9.227  17.162  1.00 9.89  ? 154 VAL B CB  1 
ATOM   3025 C CG1 . VAL B 1 154 ? -11.486 -10.308 16.312  1.00 2.75  ? 154 VAL B CG1 1 
ATOM   3026 C CG2 . VAL B 1 154 ? -9.461  -8.995  16.776  1.00 3.81  ? 154 VAL B CG2 1 
ATOM   3027 N N   . LYS B 1 155 ? -13.924 -8.600  16.735  1.00 20.70 ? 155 LYS B N   1 
ATOM   3028 C CA  . LYS B 1 155 ? -15.288 -8.925  17.000  1.00 24.84 ? 155 LYS B CA  1 
ATOM   3029 C C   . LYS B 1 155 ? -15.551 -10.332 16.593  1.00 26.57 ? 155 LYS B C   1 
ATOM   3030 O O   . LYS B 1 155 ? -16.479 -10.875 17.157  1.00 31.87 ? 155 LYS B O   1 
ATOM   3031 C CB  . LYS B 1 155 ? -16.194 -7.995  16.223  1.00 26.98 ? 155 LYS B CB  1 
ATOM   3032 C CG  . LYS B 1 155 ? -16.100 -6.543  16.722  1.00 29.64 ? 155 LYS B CG  1 
ATOM   3033 C CD  . LYS B 1 155 ? -16.767 -6.379  18.099  1.00 27.52 ? 155 LYS B CD  1 
ATOM   3034 C CE  . LYS B 1 155 ? -16.710 -4.913  18.513  1.00 27.56 ? 155 LYS B CE  1 
ATOM   3035 N NZ  . LYS B 1 155 ? -17.822 -4.573  19.384  1.00 24.46 ? 155 LYS B NZ  1 
ATOM   3036 N N   . ASP B 1 156 ? -14.903 -10.932 15.590  1.00 27.23 ? 156 ASP B N   1 
ATOM   3037 C CA  . ASP B 1 156 ? -15.069 -12.359 15.303  1.00 28.02 ? 156 ASP B CA  1 
ATOM   3038 C C   . ASP B 1 156 ? -13.749 -12.966 14.819  1.00 27.95 ? 156 ASP B C   1 
ATOM   3039 O O   . ASP B 1 156 ? -13.349 -13.001 13.642  1.00 27.86 ? 156 ASP B O   1 
ATOM   3040 C CB  . ASP B 1 156 ? -16.148 -12.632 14.240  1.00 30.02 ? 156 ASP B CB  1 
ATOM   3041 C CG  . ASP B 1 156 ? -16.226 -14.096 13.746  1.00 34.74 ? 156 ASP B CG  1 
ATOM   3042 O OD1 . ASP B 1 156 ? -15.935 -15.060 14.480  1.00 32.93 ? 156 ASP B OD1 1 
ATOM   3043 O OD2 . ASP B 1 156 ? -16.566 -14.261 12.572  1.00 38.25 ? 156 ASP B OD2 1 
ATOM   3044 N N   . TRP B 1 157 ? -13.142 -13.571 15.839  1.00 26.40 ? 157 TRP B N   1 
ATOM   3045 C CA  . TRP B 1 157 ? -11.835 -14.150 15.729  1.00 24.08 ? 157 TRP B CA  1 
ATOM   3046 C C   . TRP B 1 157 ? -11.655 -15.128 14.584  1.00 25.27 ? 157 TRP B C   1 
ATOM   3047 O O   . TRP B 1 157 ? -10.524 -15.277 14.165  1.00 28.27 ? 157 TRP B O   1 
ATOM   3048 C CB  . TRP B 1 157 ? -11.501 -14.775 17.087  1.00 21.39 ? 157 TRP B CB  1 
ATOM   3049 C CG  . TRP B 1 157 ? -11.111 -13.689 18.093  1.00 18.14 ? 157 TRP B CG  1 
ATOM   3050 C CD1 . TRP B 1 157 ? -12.054 -13.047 18.866  1.00 20.67 ? 157 TRP B CD1 1 
ATOM   3051 C CD2 . TRP B 1 157 ? -9.855  -13.149 18.276  1.00 16.91 ? 157 TRP B CD2 1 
ATOM   3052 N NE1 . TRP B 1 157 ? -11.419 -12.096 19.524  1.00 13.97 ? 157 TRP B NE1 1 
ATOM   3053 C CE2 . TRP B 1 157 ? -10.119 -12.120 19.216  1.00 13.22 ? 157 TRP B CE2 1 
ATOM   3054 C CE3 . TRP B 1 157 ? -8.551  -13.352 17.806  1.00 13.41 ? 157 TRP B CE3 1 
ATOM   3055 C CZ2 . TRP B 1 157 ? -9.100  -11.284 19.693  1.00 10.11 ? 157 TRP B CZ2 1 
ATOM   3056 C CZ3 . TRP B 1 157 ? -7.542  -12.505 18.294  1.00 14.84 ? 157 TRP B CZ3 1 
ATOM   3057 C CH2 . TRP B 1 157 ? -7.805  -11.472 19.226  1.00 9.20  ? 157 TRP B CH2 1 
ATOM   3058 N N   . SER B 1 158 ? -12.676 -15.697 13.940  1.00 25.25 ? 158 SER B N   1 
ATOM   3059 C CA  . SER B 1 158 ? -12.504 -16.682 12.876  1.00 23.35 ? 158 SER B CA  1 
ATOM   3060 C C   . SER B 1 158 ? -11.608 -16.235 11.764  1.00 21.93 ? 158 SER B C   1 
ATOM   3061 O O   . SER B 1 158 ? -10.757 -16.949 11.247  1.00 24.20 ? 158 SER B O   1 
ATOM   3062 C CB  . SER B 1 158 ? -13.861 -17.040 12.267  1.00 27.08 ? 158 SER B CB  1 
ATOM   3063 O OG  . SER B 1 158 ? -14.724 -15.951 11.958  1.00 23.28 ? 158 SER B OG  1 
ATOM   3064 N N   . LYS B 1 159 ? -11.873 -14.996 11.412  1.00 21.19 ? 159 LYS B N   1 
ATOM   3065 C CA  . LYS B 1 159 ? -11.157 -14.351 10.338  1.00 19.15 ? 159 LYS B CA  1 
ATOM   3066 C C   . LYS B 1 159 ? -9.791  -13.775 10.713  1.00 11.94 ? 159 LYS B C   1 
ATOM   3067 O O   . LYS B 1 159 ? -9.134  -13.345 9.783   1.00 11.66 ? 159 LYS B O   1 
ATOM   3068 C CB  . LYS B 1 159 ? -12.112 -13.250 9.755   1.00 24.87 ? 159 LYS B CB  1 
ATOM   3069 C CG  . LYS B 1 159 ? -13.061 -13.641 8.587   1.00 26.35 ? 159 LYS B CG  1 
ATOM   3070 C CD  . LYS B 1 159 ? -12.443 -13.432 7.183   1.00 29.00 ? 159 LYS B CD  1 
ATOM   3071 C CE  . LYS B 1 159 ? -12.482 -14.617 6.168   1.00 30.03 ? 159 LYS B CE  1 
ATOM   3072 N NZ  . LYS B 1 159 ? -13.789 -14.966 5.606   1.00 25.53 ? 159 LYS B NZ  1 
ATOM   3073 N N   . VAL B 1 160 ? -9.286  -13.688 11.934  1.00 6.52  ? 160 VAL B N   1 
ATOM   3074 C CA  . VAL B 1 160 ? -8.004  -13.054 12.206  1.00 8.49  ? 160 VAL B CA  1 
ATOM   3075 C C   . VAL B 1 160 ? -6.886  -14.046 12.557  1.00 11.81 ? 160 VAL B C   1 
ATOM   3076 O O   . VAL B 1 160 ? -7.125  -15.127 13.090  1.00 13.82 ? 160 VAL B O   1 
ATOM   3077 C CB  . VAL B 1 160 ? -8.142  -11.944 13.366  1.00 8.60  ? 160 VAL B CB  1 
ATOM   3078 C CG1 . VAL B 1 160 ? -9.334  -12.288 14.212  1.00 10.69 ? 160 VAL B CG1 1 
ATOM   3079 C CG2 . VAL B 1 160 ? -6.964  -11.884 14.384  1.00 2.00  ? 160 VAL B CG2 1 
ATOM   3080 N N   . VAL B 1 161 ? -5.630  -13.668 12.221  1.00 12.45 ? 161 VAL B N   1 
ATOM   3081 C CA  . VAL B 1 161 ? -4.391  -14.386 12.506  1.00 7.32  ? 161 VAL B CA  1 
ATOM   3082 C C   . VAL B 1 161 ? -3.494  -13.427 13.267  1.00 6.48  ? 161 VAL B C   1 
ATOM   3083 O O   . VAL B 1 161 ? -3.572  -12.208 12.992  1.00 8.02  ? 161 VAL B O   1 
ATOM   3084 C CB  . VAL B 1 161 ? -3.741  -14.826 11.190  1.00 6.20  ? 161 VAL B CB  1 
ATOM   3085 C CG1 . VAL B 1 161 ? -2.471  -15.559 11.507  1.00 5.73  ? 161 VAL B CG1 1 
ATOM   3086 C CG2 . VAL B 1 161 ? -4.644  -15.800 10.440  1.00 5.41  ? 161 VAL B CG2 1 
ATOM   3087 N N   . LEU B 1 162 ? -2.693  -13.904 14.236  1.00 3.33  ? 162 LEU B N   1 
ATOM   3088 C CA  . LEU B 1 162 ? -1.799  -13.006 14.982  1.00 5.43  ? 162 LEU B CA  1 
ATOM   3089 C C   . LEU B 1 162 ? -0.404  -13.370 14.574  1.00 5.05  ? 162 LEU B C   1 
ATOM   3090 O O   . LEU B 1 162 ? -0.155  -14.573 14.485  1.00 7.73  ? 162 LEU B O   1 
ATOM   3091 C CB  . LEU B 1 162 ? -1.866  -13.189 16.494  1.00 5.51  ? 162 LEU B CB  1 
ATOM   3092 C CG  . LEU B 1 162 ? -3.181  -12.799 17.100  1.00 5.35  ? 162 LEU B CG  1 
ATOM   3093 C CD1 . LEU B 1 162 ? -3.457  -13.700 18.250  1.00 10.53 ? 162 LEU B CD1 1 
ATOM   3094 C CD2 . LEU B 1 162 ? -3.162  -11.363 17.508  1.00 5.78  ? 162 LEU B CD2 1 
ATOM   3095 N N   . ALA B 1 163 ? 0.494   -12.429 14.313  1.00 3.64  ? 163 ALA B N   1 
ATOM   3096 C CA  . ALA B 1 163 ? 1.815   -12.795 13.857  1.00 6.32  ? 163 ALA B CA  1 
ATOM   3097 C C   . ALA B 1 163 ? 2.739   -12.109 14.778  1.00 10.17 ? 163 ALA B C   1 
ATOM   3098 O O   . ALA B 1 163 ? 2.805   -10.877 14.883  1.00 14.29 ? 163 ALA B O   1 
ATOM   3099 C CB  . ALA B 1 163 ? 2.228   -12.266 12.522  1.00 4.96  ? 163 ALA B CB  1 
ATOM   3100 N N   . TYR B 1 164 ? 3.420   -12.967 15.490  1.00 12.93 ? 164 TYR B N   1 
ATOM   3101 C CA  . TYR B 1 164 ? 4.398   -12.466 16.392  1.00 17.41 ? 164 TYR B CA  1 
ATOM   3102 C C   . TYR B 1 164 ? 5.604   -12.140 15.526  1.00 22.53 ? 164 TYR B C   1 
ATOM   3103 O O   . TYR B 1 164 ? 6.117   -13.090 14.921  1.00 24.47 ? 164 TYR B O   1 
ATOM   3104 C CB  . TYR B 1 164 ? 4.762   -13.530 17.395  1.00 14.47 ? 164 TYR B CB  1 
ATOM   3105 C CG  . TYR B 1 164 ? 5.948   -13.037 18.218  1.00 12.50 ? 164 TYR B CG  1 
ATOM   3106 C CD1 . TYR B 1 164 ? 5.909   -11.741 18.797  1.00 8.76  ? 164 TYR B CD1 1 
ATOM   3107 C CD2 . TYR B 1 164 ? 7.062   -13.884 18.386  1.00 6.27  ? 164 TYR B CD2 1 
ATOM   3108 C CE1 . TYR B 1 164 ? 6.997   -11.317 19.574  1.00 8.06  ? 164 TYR B CE1 1 
ATOM   3109 C CE2 . TYR B 1 164 ? 8.121   -13.438 19.164  1.00 2.00  ? 164 TYR B CE2 1 
ATOM   3110 C CZ  . TYR B 1 164 ? 8.066   -12.178 19.741  1.00 2.00  ? 164 TYR B CZ  1 
ATOM   3111 O OH  . TYR B 1 164 ? 9.022   -11.795 20.599  1.00 2.00  ? 164 TYR B OH  1 
ATOM   3112 N N   . GLU B 1 165 ? 6.052   -10.885 15.505  1.00 26.09 ? 165 GLU B N   1 
ATOM   3113 C CA  . GLU B 1 165 ? 7.268   -10.475 14.801  1.00 29.21 ? 165 GLU B CA  1 
ATOM   3114 C C   . GLU B 1 165 ? 8.223   -9.812  15.824  1.00 29.72 ? 165 GLU B C   1 
ATOM   3115 O O   . GLU B 1 165 ? 8.002   -8.618  16.097  1.00 32.21 ? 165 GLU B O   1 
ATOM   3116 C CB  . GLU B 1 165 ? 6.953   -9.446  13.667  1.00 31.49 ? 165 GLU B CB  1 
ATOM   3117 C CG  . GLU B 1 165 ? 5.997   -9.842  12.527  1.00 36.06 ? 165 GLU B CG  1 
ATOM   3118 C CD  . GLU B 1 165 ? 5.855   -8.832  11.352  1.00 36.47 ? 165 GLU B CD  1 
ATOM   3119 O OE1 . GLU B 1 165 ? 5.622   -7.625  11.567  1.00 33.97 ? 165 GLU B OE1 1 
ATOM   3120 O OE2 . GLU B 1 165 ? 5.977   -9.290  10.208  1.00 31.85 ? 165 GLU B OE2 1 
ATOM   3121 N N   . PRO B 1 166 ? 9.263   -10.406 16.477  1.00 29.19 ? 166 PRO B N   1 
ATOM   3122 C CA  . PRO B 1 166 ? 10.197  -9.689  17.358  1.00 28.61 ? 166 PRO B CA  1 
ATOM   3123 C C   . PRO B 1 166 ? 10.953  -8.772  16.426  1.00 27.83 ? 166 PRO B C   1 
ATOM   3124 O O   . PRO B 1 166 ? 11.748  -9.305  15.661  1.00 28.80 ? 166 PRO B O   1 
ATOM   3125 C CB  . PRO B 1 166 ? 11.017  -10.808 17.982  1.00 27.51 ? 166 PRO B CB  1 
ATOM   3126 C CG  . PRO B 1 166 ? 11.011  -11.927 16.984  1.00 23.06 ? 166 PRO B CG  1 
ATOM   3127 C CD  . PRO B 1 166 ? 9.603   -11.828 16.434  1.00 28.39 ? 166 PRO B CD  1 
ATOM   3128 N N   . VAL B 1 167 ? 10.805  -7.457  16.423  1.00 27.62 ? 167 VAL B N   1 
ATOM   3129 C CA  . VAL B 1 167 ? 11.370  -6.573  15.394  1.00 28.60 ? 167 VAL B CA  1 
ATOM   3130 C C   . VAL B 1 167 ? 12.799  -6.876  14.891  1.00 30.99 ? 167 VAL B C   1 
ATOM   3131 O O   . VAL B 1 167 ? 12.999  -6.930  13.678  1.00 33.07 ? 167 VAL B O   1 
ATOM   3132 C CB  . VAL B 1 167 ? 11.190  -5.142  15.956  1.00 26.16 ? 167 VAL B CB  1 
ATOM   3133 C CG1 . VAL B 1 167 ? 11.734  -4.029  15.099  1.00 26.82 ? 167 VAL B CG1 1 
ATOM   3134 C CG2 . VAL B 1 167 ? 9.706   -4.884  15.909  1.00 26.88 ? 167 VAL B CG2 1 
ATOM   3135 N N   . TRP B 1 168 ? 13.763  -7.204  15.779  1.00 32.06 ? 168 TRP B N   1 
ATOM   3136 C CA  . TRP B 1 168 ? 15.138  -7.598  15.449  1.00 31.71 ? 168 TRP B CA  1 
ATOM   3137 C C   . TRP B 1 168 ? 15.355  -8.767  14.438  1.00 32.17 ? 168 TRP B C   1 
ATOM   3138 O O   . TRP B 1 168 ? 16.360  -8.878  13.689  1.00 31.10 ? 168 TRP B O   1 
ATOM   3139 C CB  . TRP B 1 168 ? 15.866  -7.875  16.812  1.00 30.24 ? 168 TRP B CB  1 
ATOM   3140 C CG  . TRP B 1 168 ? 15.130  -8.541  17.988  1.00 31.30 ? 168 TRP B CG  1 
ATOM   3141 C CD1 . TRP B 1 168 ? 14.545  -7.772  18.976  1.00 30.78 ? 168 TRP B CD1 1 
ATOM   3142 C CD2 . TRP B 1 168 ? 14.997  -9.901  18.222  1.00 30.50 ? 168 TRP B CD2 1 
ATOM   3143 N NE1 . TRP B 1 168 ? 14.049  -8.631  19.824  1.00 29.52 ? 168 TRP B NE1 1 
ATOM   3144 C CE2 . TRP B 1 168 ? 14.288  -9.893  19.440  1.00 28.97 ? 168 TRP B CE2 1 
ATOM   3145 C CE3 . TRP B 1 168 ? 15.366  -11.119 17.620  1.00 28.31 ? 168 TRP B CE3 1 
ATOM   3146 C CZ2 . TRP B 1 168 ? 13.923  -11.087 20.066  1.00 27.62 ? 168 TRP B CZ2 1 
ATOM   3147 C CZ3 . TRP B 1 168 ? 15.005  -12.311 18.246  1.00 29.22 ? 168 TRP B CZ3 1 
ATOM   3148 C CH2 . TRP B 1 168 ? 14.302  -12.295 19.469  1.00 27.69 ? 168 TRP B CH2 1 
ATOM   3149 N N   . ALA B 1 169 ? 14.338  -9.648  14.416  1.00 31.69 ? 169 ALA B N   1 
ATOM   3150 C CA  . ALA B 1 169 ? 14.343  -10.768 13.499  1.00 32.62 ? 169 ALA B CA  1 
ATOM   3151 C C   . ALA B 1 169 ? 13.876  -10.404 12.140  1.00 32.73 ? 169 ALA B C   1 
ATOM   3152 O O   . ALA B 1 169 ? 13.810  -11.299 11.300  1.00 31.72 ? 169 ALA B O   1 
ATOM   3153 C CB  . ALA B 1 169 ? 13.460  -11.929 13.965  1.00 28.95 ? 169 ALA B CB  1 
ATOM   3154 N N   . ILE B 1 170 ? 13.509  -9.165  11.882  1.00 34.74 ? 170 ILE B N   1 
ATOM   3155 C CA  . ILE B 1 170 ? 13.176  -8.796  10.537  1.00 39.87 ? 170 ILE B CA  1 
ATOM   3156 C C   . ILE B 1 170 ? 14.490  -8.515  9.859   1.00 44.78 ? 170 ILE B C   1 
ATOM   3157 O O   . ILE B 1 170 ? 15.268  -7.727  10.407  1.00 48.83 ? 170 ILE B O   1 
ATOM   3158 C CB  . ILE B 1 170 ? 12.335  -7.562  10.501  1.00 38.66 ? 170 ILE B CB  1 
ATOM   3159 C CG1 . ILE B 1 170 ? 10.982  -7.912  11.089  1.00 37.13 ? 170 ILE B CG1 1 
ATOM   3160 C CG2 . ILE B 1 170 ? 12.210  -7.017  9.070   1.00 42.10 ? 170 ILE B CG2 1 
ATOM   3161 C CD1 . ILE B 1 170 ? 10.251  -6.606  11.348  1.00 32.45 ? 170 ILE B CD1 1 
ATOM   3162 N N   . GLY B 1 171 ? 14.769  -9.162  8.721   1.00 47.15 ? 171 GLY B N   1 
ATOM   3163 C CA  . GLY B 1 171 ? 15.909  -8.781  7.911   1.00 49.58 ? 171 GLY B CA  1 
ATOM   3164 C C   . GLY B 1 171 ? 17.272  -9.298  8.302   1.00 50.00 ? 171 GLY B C   1 
ATOM   3165 O O   . GLY B 1 171 ? 18.173  -8.941  7.552   1.00 50.40 ? 171 GLY B O   1 
ATOM   3166 N N   . THR B 1 172 ? 17.523  -10.070 9.350   1.00 51.60 ? 172 THR B N   1 
ATOM   3167 C CA  . THR B 1 172 ? 18.833  -10.663 9.553   1.00 55.57 ? 172 THR B CA  1 
ATOM   3168 C C   . THR B 1 172 ? 18.542  -12.076 9.973   1.00 54.73 ? 172 THR B C   1 
ATOM   3169 O O   . THR B 1 172 ? 17.526  -12.281 10.623  1.00 57.50 ? 172 THR B O   1 
ATOM   3170 C CB  . THR B 1 172 ? 19.668  -10.042 10.712  1.00 57.52 ? 172 THR B CB  1 
ATOM   3171 O OG1 . THR B 1 172 ? 19.725  -8.646  10.443  1.00 64.90 ? 172 THR B OG1 1 
ATOM   3172 C CG2 . THR B 1 172 ? 21.122  -10.602 10.833  1.00 56.04 ? 172 THR B CG2 1 
ATOM   3173 N N   . GLY B 1 173 ? 19.413  -13.069 9.794   1.00 53.41 ? 173 GLY B N   1 
ATOM   3174 C CA  . GLY B 1 173 ? 19.179  -14.394 10.368  1.00 52.74 ? 173 GLY B CA  1 
ATOM   3175 C C   . GLY B 1 173 ? 19.120  -14.345 11.905  1.00 50.93 ? 173 GLY B C   1 
ATOM   3176 O O   . GLY B 1 173 ? 19.162  -15.375 12.574  1.00 51.79 ? 173 GLY B O   1 
ATOM   3177 N N   . LYS B 1 174 ? 19.199  -13.143 12.483  1.00 48.70 ? 174 LYS B N   1 
ATOM   3178 C CA  . LYS B 1 174 ? 18.938  -12.895 13.865  1.00 48.81 ? 174 LYS B CA  1 
ATOM   3179 C C   . LYS B 1 174 ? 17.473  -13.194 14.056  1.00 46.54 ? 174 LYS B C   1 
ATOM   3180 O O   . LYS B 1 174 ? 16.608  -12.396 13.752  1.00 45.25 ? 174 LYS B O   1 
ATOM   3181 C CB  . LYS B 1 174 ? 19.257  -11.442 14.180  1.00 52.33 ? 174 LYS B CB  1 
ATOM   3182 C CG  . LYS B 1 174 ? 20.575  -11.301 14.977  1.00 56.68 ? 174 LYS B CG  1 
ATOM   3183 C CD  . LYS B 1 174 ? 21.542  -10.216 14.441  1.00 57.51 ? 174 LYS B CD  1 
ATOM   3184 C CE  . LYS B 1 174 ? 22.625  -9.896  15.470  1.00 60.89 ? 174 LYS B CE  1 
ATOM   3185 N NZ  . LYS B 1 174 ? 22.878  -8.464  15.528  1.00 62.17 ? 174 LYS B NZ  1 
ATOM   3186 N N   . THR B 1 175 ? 17.241  -14.440 14.422  1.00 44.76 ? 175 THR B N   1 
ATOM   3187 C CA  . THR B 1 175 ? 15.944  -14.955 14.744  1.00 42.69 ? 175 THR B CA  1 
ATOM   3188 C C   . THR B 1 175 ? 15.853  -15.162 16.256  1.00 42.63 ? 175 THR B C   1 
ATOM   3189 O O   . THR B 1 175 ? 16.828  -15.179 17.038  1.00 42.78 ? 175 THR B O   1 
ATOM   3190 C CB  . THR B 1 175 ? 15.709  -16.316 13.999  1.00 42.16 ? 175 THR B CB  1 
ATOM   3191 O OG1 . THR B 1 175 ? 16.823  -17.183 14.217  1.00 42.61 ? 175 THR B OG1 1 
ATOM   3192 C CG2 . THR B 1 175 ? 15.566  -16.126 12.525  1.00 40.47 ? 175 THR B CG2 1 
ATOM   3193 N N   . ALA B 1 176 ? 14.580  -15.267 16.634  1.00 40.99 ? 176 ALA B N   1 
ATOM   3194 C CA  . ALA B 1 176 ? 14.191  -15.733 17.938  1.00 41.15 ? 176 ALA B CA  1 
ATOM   3195 C C   . ALA B 1 176 ? 14.474  -17.213 17.721  1.00 41.81 ? 176 ALA B C   1 
ATOM   3196 O O   . ALA B 1 176 ? 13.978  -17.791 16.752  1.00 43.89 ? 176 ALA B O   1 
ATOM   3197 C CB  . ALA B 1 176 ? 12.702  -15.527 18.166  1.00 37.94 ? 176 ALA B CB  1 
ATOM   3198 N N   . THR B 1 177 ? 15.324  -17.844 18.516  1.00 42.61 ? 177 THR B N   1 
ATOM   3199 C CA  . THR B 1 177 ? 15.629  -19.281 18.380  1.00 43.36 ? 177 THR B CA  1 
ATOM   3200 C C   . THR B 1 177 ? 14.442  -20.138 18.808  1.00 41.72 ? 177 THR B C   1 
ATOM   3201 O O   . THR B 1 177 ? 13.681  -19.626 19.634  1.00 42.57 ? 177 THR B O   1 
ATOM   3202 C CB  . THR B 1 177 ? 16.851  -19.516 19.227  1.00 44.23 ? 177 THR B CB  1 
ATOM   3203 O OG1 . THR B 1 177 ? 16.610  -19.161 20.607  1.00 46.44 ? 177 THR B OG1 1 
ATOM   3204 C CG2 . THR B 1 177 ? 17.967  -18.634 18.631  1.00 49.09 ? 177 THR B CG2 1 
ATOM   3205 N N   . PRO B 1 178 ? 14.151  -21.366 18.379  1.00 40.08 ? 178 PRO B N   1 
ATOM   3206 C CA  . PRO B 1 178 ? 12.869  -21.997 18.652  1.00 38.71 ? 178 PRO B CA  1 
ATOM   3207 C C   . PRO B 1 178 ? 12.300  -21.851 20.063  1.00 37.48 ? 178 PRO B C   1 
ATOM   3208 O O   . PRO B 1 178 ? 11.094  -21.653 20.217  1.00 39.15 ? 178 PRO B O   1 
ATOM   3209 C CB  . PRO B 1 178 ? 13.120  -23.416 18.200  1.00 38.00 ? 178 PRO B CB  1 
ATOM   3210 C CG  . PRO B 1 178 ? 13.851  -23.161 16.897  1.00 38.68 ? 178 PRO B CG  1 
ATOM   3211 C CD  . PRO B 1 178 ? 14.848  -22.068 17.300  1.00 40.66 ? 178 PRO B CD  1 
ATOM   3212 N N   . GLN B 1 179 ? 13.096  -21.849 21.124  1.00 35.38 ? 179 GLN B N   1 
ATOM   3213 C CA  . GLN B 1 179 ? 12.556  -21.645 22.459  1.00 33.93 ? 179 GLN B CA  1 
ATOM   3214 C C   . GLN B 1 179 ? 12.127  -20.201 22.630  1.00 31.59 ? 179 GLN B C   1 
ATOM   3215 O O   . GLN B 1 179 ? 11.088  -19.959 23.231  1.00 33.36 ? 179 GLN B O   1 
ATOM   3216 C CB  . GLN B 1 179 ? 13.566  -21.930 23.498  1.00 37.30 ? 179 GLN B CB  1 
ATOM   3217 C CG  . GLN B 1 179 ? 14.189  -23.301 23.267  1.00 46.31 ? 179 GLN B CG  1 
ATOM   3218 C CD  . GLN B 1 179 ? 15.282  -23.637 24.281  1.00 51.83 ? 179 GLN B CD  1 
ATOM   3219 O OE1 . GLN B 1 179 ? 15.802  -22.766 24.990  1.00 55.51 ? 179 GLN B OE1 1 
ATOM   3220 N NE2 . GLN B 1 179 ? 15.682  -24.902 24.390  1.00 51.90 ? 179 GLN B NE2 1 
ATOM   3221 N N   . GLN B 1 180 ? 12.865  -19.228 22.077  1.00 29.16 ? 180 GLN B N   1 
ATOM   3222 C CA  . GLN B 1 180 ? 12.566  -17.799 22.141  1.00 26.60 ? 180 GLN B CA  1 
ATOM   3223 C C   . GLN B 1 180 ? 11.200  -17.517 21.548  1.00 25.38 ? 180 GLN B C   1 
ATOM   3224 O O   . GLN B 1 180 ? 10.341  -16.857 22.120  1.00 24.05 ? 180 GLN B O   1 
ATOM   3225 C CB  . GLN B 1 180 ? 13.593  -16.995 21.371  1.00 24.44 ? 180 GLN B CB  1 
ATOM   3226 C CG  . GLN B 1 180 ? 14.779  -16.483 22.157  1.00 26.16 ? 180 GLN B CG  1 
ATOM   3227 C CD  . GLN B 1 180 ? 15.627  -15.548 21.304  1.00 29.90 ? 180 GLN B CD  1 
ATOM   3228 O OE1 . GLN B 1 180 ? 15.463  -14.329 21.249  1.00 30.53 ? 180 GLN B OE1 1 
ATOM   3229 N NE2 . GLN B 1 180 ? 16.565  -16.103 20.551  1.00 32.63 ? 180 GLN B NE2 1 
ATOM   3230 N N   . ALA B 1 181 ? 11.005  -18.090 20.375  1.00 27.04 ? 181 ALA B N   1 
ATOM   3231 C CA  . ALA B 1 181 ? 9.739   -18.041 19.660  1.00 26.35 ? 181 ALA B CA  1 
ATOM   3232 C C   . ALA B 1 181 ? 8.598   -18.518 20.584  1.00 25.84 ? 181 ALA B C   1 
ATOM   3233 O O   . ALA B 1 181 ? 7.645   -17.795 20.892  1.00 25.20 ? 181 ALA B O   1 
ATOM   3234 C CB  . ALA B 1 181 ? 9.857   -18.959 18.410  1.00 23.04 ? 181 ALA B CB  1 
ATOM   3235 N N   . GLN B 1 182 ? 8.690   -19.741 21.083  1.00 24.60 ? 182 GLN B N   1 
ATOM   3236 C CA  . GLN B 1 182 ? 7.658   -20.345 21.882  1.00 24.11 ? 182 GLN B CA  1 
ATOM   3237 C C   . GLN B 1 182 ? 7.444   -19.788 23.308  1.00 26.23 ? 182 GLN B C   1 
ATOM   3238 O O   . GLN B 1 182 ? 6.335   -20.000 23.845  1.00 25.09 ? 182 GLN B O   1 
ATOM   3239 C CB  . GLN B 1 182 ? 7.996   -21.827 21.853  1.00 23.32 ? 182 GLN B CB  1 
ATOM   3240 C CG  . GLN B 1 182 ? 7.184   -22.761 22.713  1.00 23.78 ? 182 GLN B CG  1 
ATOM   3241 C CD  . GLN B 1 182 ? 5.743   -22.802 22.292  1.00 28.63 ? 182 GLN B CD  1 
ATOM   3242 O OE1 . GLN B 1 182 ? 5.361   -23.105 21.164  1.00 30.60 ? 182 GLN B OE1 1 
ATOM   3243 N NE2 . GLN B 1 182 ? 4.863   -22.453 23.193  1.00 30.26 ? 182 GLN B NE2 1 
ATOM   3244 N N   . GLU B 1 183 ? 8.404   -19.101 23.973  1.00 24.77 ? 183 GLU B N   1 
ATOM   3245 C CA  . GLU B 1 183 ? 8.145   -18.513 25.296  1.00 23.52 ? 183 GLU B CA  1 
ATOM   3246 C C   . GLU B 1 183 ? 6.938   -17.609 25.147  1.00 20.84 ? 183 GLU B C   1 
ATOM   3247 O O   . GLU B 1 183 ? 5.884   -17.887 25.717  1.00 21.05 ? 183 GLU B O   1 
ATOM   3248 C CB  . GLU B 1 183 ? 9.315   -17.664 25.791  1.00 24.63 ? 183 GLU B CB  1 
ATOM   3249 C CG  . GLU B 1 183 ? 9.016   -16.787 27.006  1.00 30.45 ? 183 GLU B CG  1 
ATOM   3250 C CD  . GLU B 1 183 ? 10.154  -15.824 27.369  1.00 37.48 ? 183 GLU B CD  1 
ATOM   3251 O OE1 . GLU B 1 183 ? 11.151  -16.256 27.969  1.00 38.44 ? 183 GLU B OE1 1 
ATOM   3252 O OE2 . GLU B 1 183 ? 10.032  -14.626 27.064  1.00 42.80 ? 183 GLU B OE2 1 
ATOM   3253 N N   . VAL B 1 184 ? 7.141   -16.668 24.206  1.00 20.19 ? 184 VAL B N   1 
ATOM   3254 C CA  . VAL B 1 184 ? 6.238   -15.589 23.811  1.00 17.93 ? 184 VAL B CA  1 
ATOM   3255 C C   . VAL B 1 184 ? 5.012   -16.050 23.026  1.00 15.89 ? 184 VAL B C   1 
ATOM   3256 O O   . VAL B 1 184 ? 3.931   -15.569 23.311  1.00 14.07 ? 184 VAL B O   1 
ATOM   3257 C CB  . VAL B 1 184 ? 7.058   -14.511 23.008  1.00 17.49 ? 184 VAL B CB  1 
ATOM   3258 C CG1 . VAL B 1 184 ? 8.209   -13.942 23.830  1.00 15.26 ? 184 VAL B CG1 1 
ATOM   3259 C CG2 . VAL B 1 184 ? 7.757   -15.114 21.875  1.00 16.23 ? 184 VAL B CG2 1 
ATOM   3260 N N   . HIS B 1 185 ? 5.049   -17.005 22.094  1.00 16.43 ? 185 HIS B N   1 
ATOM   3261 C CA  . HIS B 1 185 ? 3.814   -17.537 21.493  1.00 17.12 ? 185 HIS B CA  1 
ATOM   3262 C C   . HIS B 1 185 ? 2.898   -18.110 22.555  1.00 19.12 ? 185 HIS B C   1 
ATOM   3263 O O   . HIS B 1 185 ? 1.753   -17.677 22.681  1.00 22.24 ? 185 HIS B O   1 
ATOM   3264 C CB  . HIS B 1 185 ? 4.081   -18.640 20.463  1.00 10.58 ? 185 HIS B CB  1 
ATOM   3265 C CG  . HIS B 1 185 ? 4.387   -18.052 19.075  1.00 12.00 ? 185 HIS B CG  1 
ATOM   3266 N ND1 . HIS B 1 185 ? 4.049   -18.511 17.886  1.00 11.58 ? 185 HIS B ND1 1 
ATOM   3267 C CD2 . HIS B 1 185 ? 5.113   -16.882 18.822  1.00 12.80 ? 185 HIS B CD2 1 
ATOM   3268 C CE1 . HIS B 1 185 ? 4.529   -17.701 16.971  1.00 11.87 ? 185 HIS B CE1 1 
ATOM   3269 N NE2 . HIS B 1 185 ? 5.171   -16.713 17.534  1.00 9.13  ? 185 HIS B NE2 1 
ATOM   3270 N N   . GLU B 1 186 ? 3.407   -19.005 23.399  1.00 22.46 ? 186 GLU B N   1 
ATOM   3271 C CA  . GLU B 1 186 ? 2.667   -19.572 24.517  1.00 22.19 ? 186 GLU B CA  1 
ATOM   3272 C C   . GLU B 1 186 ? 2.072   -18.486 25.420  1.00 21.21 ? 186 GLU B C   1 
ATOM   3273 O O   . GLU B 1 186 ? 0.840   -18.417 25.527  1.00 19.68 ? 186 GLU B O   1 
ATOM   3274 C CB  . GLU B 1 186 ? 3.648   -20.457 25.257  1.00 25.90 ? 186 GLU B CB  1 
ATOM   3275 C CG  . GLU B 1 186 ? 3.119   -21.426 26.318  1.00 31.72 ? 186 GLU B CG  1 
ATOM   3276 C CD  . GLU B 1 186 ? 4.171   -22.381 26.879  1.00 33.91 ? 186 GLU B CD  1 
ATOM   3277 O OE1 . GLU B 1 186 ? 5.264   -21.905 27.272  1.00 36.25 ? 186 GLU B OE1 1 
ATOM   3278 O OE2 . GLU B 1 186 ? 3.867   -23.591 26.889  1.00 32.98 ? 186 GLU B OE2 1 
ATOM   3279 N N   . LYS B 1 187 ? 2.884   -17.589 25.996  1.00 19.11 ? 187 LYS B N   1 
ATOM   3280 C CA  . LYS B 1 187 ? 2.439   -16.489 26.857  1.00 21.30 ? 187 LYS B CA  1 
ATOM   3281 C C   . LYS B 1 187 ? 1.278   -15.615 26.356  1.00 21.10 ? 187 LYS B C   1 
ATOM   3282 O O   . LYS B 1 187 ? 0.557   -14.923 27.089  1.00 19.72 ? 187 LYS B O   1 
ATOM   3283 C CB  . LYS B 1 187 ? 3.605   -15.559 27.123  1.00 25.19 ? 187 LYS B CB  1 
ATOM   3284 C CG  . LYS B 1 187 ? 4.572   -16.117 28.146  1.00 32.75 ? 187 LYS B CG  1 
ATOM   3285 C CD  . LYS B 1 187 ? 5.741   -15.177 28.452  1.00 33.75 ? 187 LYS B CD  1 
ATOM   3286 C CE  . LYS B 1 187 ? 6.411   -15.634 29.772  1.00 37.78 ? 187 LYS B CE  1 
ATOM   3287 N NZ  . LYS B 1 187 ? 7.395   -14.694 30.286  1.00 38.37 ? 187 LYS B NZ  1 
ATOM   3288 N N   . LEU B 1 188 ? 1.137   -15.659 25.037  1.00 19.41 ? 188 LEU B N   1 
ATOM   3289 C CA  . LEU B 1 188 ? 0.217   -14.872 24.273  1.00 16.38 ? 188 LEU B CA  1 
ATOM   3290 C C   . LEU B 1 188 ? -0.988  -15.738 24.001  1.00 17.90 ? 188 LEU B C   1 
ATOM   3291 O O   . LEU B 1 188 ? -2.102  -15.212 24.024  1.00 19.56 ? 188 LEU B O   1 
ATOM   3292 C CB  . LEU B 1 188 ? 1.033   -14.492 23.076  1.00 13.75 ? 188 LEU B CB  1 
ATOM   3293 C CG  . LEU B 1 188 ? 0.656   -13.600 21.939  1.00 13.59 ? 188 LEU B CG  1 
ATOM   3294 C CD1 . LEU B 1 188 ? 0.091   -12.284 22.419  1.00 9.99  ? 188 LEU B CD1 1 
ATOM   3295 C CD2 . LEU B 1 188 ? 1.909   -13.497 21.072  1.00 14.48 ? 188 LEU B CD2 1 
ATOM   3296 N N   . ARG B 1 189 ? -0.868  -17.047 23.755  1.00 18.35 ? 189 ARG B N   1 
ATOM   3297 C CA  . ARG B 1 189 ? -2.057  -17.856 23.597  1.00 19.82 ? 189 ARG B CA  1 
ATOM   3298 C C   . ARG B 1 189 ? -2.696  -17.891 24.989  1.00 21.65 ? 189 ARG B C   1 
ATOM   3299 O O   . ARG B 1 189 ? -3.908  -17.822 25.131  1.00 21.69 ? 189 ARG B O   1 
ATOM   3300 C CB  . ARG B 1 189 ? -1.691  -19.245 23.139  1.00 20.63 ? 189 ARG B CB  1 
ATOM   3301 C CG  . ARG B 1 189 ? -2.980  -20.065 22.908  1.00 24.44 ? 189 ARG B CG  1 
ATOM   3302 C CD  . ARG B 1 189 ? -2.813  -21.559 22.522  1.00 26.02 ? 189 ARG B CD  1 
ATOM   3303 N NE  . ARG B 1 189 ? -1.853  -21.781 21.436  1.00 26.14 ? 189 ARG B NE  1 
ATOM   3304 C CZ  . ARG B 1 189 ? -1.964  -21.469 20.134  1.00 24.00 ? 189 ARG B CZ  1 
ATOM   3305 N NH1 . ARG B 1 189 ? -3.051  -20.961 19.562  1.00 21.06 ? 189 ARG B NH1 1 
ATOM   3306 N NH2 . ARG B 1 189 ? -0.918  -21.777 19.379  1.00 23.04 ? 189 ARG B NH2 1 
ATOM   3307 N N   . GLY B 1 190 ? -1.908  -17.922 26.058  1.00 22.65 ? 190 GLY B N   1 
ATOM   3308 C CA  . GLY B 1 190 ? -2.402  -17.847 27.420  1.00 24.59 ? 190 GLY B CA  1 
ATOM   3309 C C   . GLY B 1 190 ? -3.106  -16.522 27.683  1.00 25.79 ? 190 GLY B C   1 
ATOM   3310 O O   . GLY B 1 190 ? -4.180  -16.608 28.287  1.00 27.31 ? 190 GLY B O   1 
ATOM   3311 N N   . TRP B 1 191 ? -2.584  -15.331 27.264  1.00 25.41 ? 191 TRP B N   1 
ATOM   3312 C CA  . TRP B 1 191 ? -3.252  -14.027 27.411  1.00 23.64 ? 191 TRP B CA  1 
ATOM   3313 C C   . TRP B 1 191 ? -4.628  -14.066 26.766  1.00 23.46 ? 191 TRP B C   1 
ATOM   3314 O O   . TRP B 1 191 ? -5.611  -13.589 27.365  1.00 23.99 ? 191 TRP B O   1 
ATOM   3315 C CB  . TRP B 1 191 ? -2.495  -12.908 26.740  1.00 24.73 ? 191 TRP B CB  1 
ATOM   3316 C CG  . TRP B 1 191 ? -3.146  -11.536 26.945  1.00 27.42 ? 191 TRP B CG  1 
ATOM   3317 C CD1 . TRP B 1 191 ? -2.906  -10.820 28.090  1.00 27.83 ? 191 TRP B CD1 1 
ATOM   3318 C CD2 . TRP B 1 191 ? -4.026  -10.889 26.095  1.00 26.87 ? 191 TRP B CD2 1 
ATOM   3319 N NE1 . TRP B 1 191 ? -3.633  -9.734  27.977  1.00 27.19 ? 191 TRP B NE1 1 
ATOM   3320 C CE2 . TRP B 1 191 ? -4.315  -9.723  26.824  1.00 25.39 ? 191 TRP B CE2 1 
ATOM   3321 C CE3 . TRP B 1 191 ? -4.633  -11.107 24.857  1.00 26.83 ? 191 TRP B CE3 1 
ATOM   3322 C CZ2 . TRP B 1 191 ? -5.201  -8.753  26.353  1.00 19.46 ? 191 TRP B CZ2 1 
ATOM   3323 C CZ3 . TRP B 1 191 ? -5.525  -10.143 24.389  1.00 26.44 ? 191 TRP B CZ3 1 
ATOM   3324 C CH2 . TRP B 1 191 ? -5.801  -8.980  25.135  1.00 23.84 ? 191 TRP B CH2 1 
ATOM   3325 N N   . LEU B 1 192 ? -4.726  -14.583 25.535  1.00 21.55 ? 192 LEU B N   1 
ATOM   3326 C CA  . LEU B 1 192 ? -6.035  -14.813 24.922  1.00 20.48 ? 192 LEU B CA  1 
ATOM   3327 C C   . LEU B 1 192 ? -6.966  -15.733 25.736  1.00 23.65 ? 192 LEU B C   1 
ATOM   3328 O O   . LEU B 1 192 ? -8.193  -15.667 25.549  1.00 25.72 ? 192 LEU B O   1 
ATOM   3329 C CB  . LEU B 1 192 ? -5.890  -15.438 23.562  1.00 13.65 ? 192 LEU B CB  1 
ATOM   3330 C CG  . LEU B 1 192 ? -5.171  -14.654 22.497  1.00 9.85  ? 192 LEU B CG  1 
ATOM   3331 C CD1 . LEU B 1 192 ? -5.273  -15.490 21.234  1.00 11.07 ? 192 LEU B CD1 1 
ATOM   3332 C CD2 . LEU B 1 192 ? -5.752  -13.277 22.299  1.00 2.00  ? 192 LEU B CD2 1 
ATOM   3333 N N   . LYS B 1 193 ? -6.451  -16.599 26.639  1.00 23.35 ? 193 LYS B N   1 
ATOM   3334 C CA  . LYS B 1 193 ? -7.296  -17.464 27.415  1.00 21.55 ? 193 LYS B CA  1 
ATOM   3335 C C   . LYS B 1 193 ? -7.778  -16.632 28.568  1.00 18.73 ? 193 LYS B C   1 
ATOM   3336 O O   . LYS B 1 193 ? -8.980  -16.487 28.653  1.00 18.49 ? 193 LYS B O   1 
ATOM   3337 C CB  . LYS B 1 193 ? -6.548  -18.671 27.920  1.00 25.18 ? 193 LYS B CB  1 
ATOM   3338 C CG  . LYS B 1 193 ? -7.597  -19.799 28.049  1.00 29.13 ? 193 LYS B CG  1 
ATOM   3339 C CD  . LYS B 1 193 ? -7.073  -21.101 28.660  1.00 29.12 ? 193 LYS B CD  1 
ATOM   3340 C CE  . LYS B 1 193 ? -7.204  -21.107 30.177  1.00 26.72 ? 193 LYS B CE  1 
ATOM   3341 N NZ  . LYS B 1 193 ? -7.768  -22.363 30.670  1.00 26.07 ? 193 LYS B NZ  1 
ATOM   3342 N N   . SER B 1 194 ? -6.924  -16.031 29.383  1.00 18.64 ? 194 SER B N   1 
ATOM   3343 C CA  . SER B 1 194 ? -7.248  -15.050 30.448  1.00 20.39 ? 194 SER B CA  1 
ATOM   3344 C C   . SER B 1 194 ? -8.378  -14.039 30.133  1.00 17.42 ? 194 SER B C   1 
ATOM   3345 O O   . SER B 1 194 ? -9.316  -13.816 30.898  1.00 15.58 ? 194 SER B O   1 
ATOM   3346 C CB  . SER B 1 194 ? -5.941  -14.193 30.801  1.00 24.34 ? 194 SER B CB  1 
ATOM   3347 O OG  . SER B 1 194 ? -4.840  -15.129 30.780  1.00 31.99 ? 194 SER B OG  1 
ATOM   3348 N N   . ASN B 1 195 ? -8.177  -13.452 28.947  1.00 15.82 ? 195 ASN B N   1 
ATOM   3349 C CA  . ASN B 1 195 ? -8.900  -12.328 28.439  1.00 12.30 ? 195 ASN B CA  1 
ATOM   3350 C C   . ASN B 1 195 ? -9.908  -12.566 27.354  1.00 14.14 ? 195 ASN B C   1 
ATOM   3351 O O   . ASN B 1 195 ? -10.815 -11.737 27.201  1.00 15.39 ? 195 ASN B O   1 
ATOM   3352 C CB  . ASN B 1 195 ? -7.894  -11.344 27.971  1.00 10.06 ? 195 ASN B CB  1 
ATOM   3353 C CG  . ASN B 1 195 ? -7.138  -10.854 29.182  1.00 14.04 ? 195 ASN B CG  1 
ATOM   3354 O OD1 . ASN B 1 195 ? -7.789  -10.366 30.092  1.00 18.83 ? 195 ASN B OD1 1 
ATOM   3355 N ND2 . ASN B 1 195 ? -5.823  -10.969 29.388  1.00 10.33 ? 195 ASN B ND2 1 
ATOM   3356 N N   . VAL B 1 196 ? -9.825  -13.588 26.513  1.00 12.61 ? 196 VAL B N   1 
ATOM   3357 C CA  . VAL B 1 196 ? -10.908 -13.681 25.557  1.00 13.51 ? 196 VAL B CA  1 
ATOM   3358 C C   . VAL B 1 196 ? -11.832 -14.891 25.758  1.00 16.91 ? 196 VAL B C   1 
ATOM   3359 O O   . VAL B 1 196 ? -12.993 -14.750 26.189  1.00 19.04 ? 196 VAL B O   1 
ATOM   3360 C CB  . VAL B 1 196 ? -10.309 -13.636 24.142  1.00 9.28  ? 196 VAL B CB  1 
ATOM   3361 C CG1 . VAL B 1 196 ? -11.470 -13.537 23.167  1.00 5.59  ? 196 VAL B CG1 1 
ATOM   3362 C CG2 . VAL B 1 196 ? -9.420  -12.397 23.944  1.00 11.72 ? 196 VAL B CG2 1 
ATOM   3363 N N   . SER B 1 197 ? -11.351 -16.090 25.452  1.00 14.95 ? 197 SER B N   1 
ATOM   3364 C CA  . SER B 1 197 ? -12.120 -17.274 25.642  1.00 12.62 ? 197 SER B CA  1 
ATOM   3365 C C   . SER B 1 197 ? -11.191 -18.387 25.212  1.00 15.44 ? 197 SER B C   1 
ATOM   3366 O O   . SER B 1 197 ? -10.292 -18.225 24.395  1.00 17.42 ? 197 SER B O   1 
ATOM   3367 C CB  . SER B 1 197 ? -13.309 -17.222 24.783  1.00 9.73  ? 197 SER B CB  1 
ATOM   3368 O OG  . SER B 1 197 ? -13.162 -17.859 23.545  1.00 12.52 ? 197 SER B OG  1 
ATOM   3369 N N   . ASP B 1 198 ? -11.441 -19.543 25.779  1.00 18.27 ? 198 ASP B N   1 
ATOM   3370 C CA  . ASP B 1 198 ? -10.688 -20.752 25.615  1.00 21.34 ? 198 ASP B CA  1 
ATOM   3371 C C   . ASP B 1 198 ? -10.822 -21.175 24.175  1.00 22.42 ? 198 ASP B C   1 
ATOM   3372 O O   . ASP B 1 198 ? -9.897  -21.716 23.586  1.00 22.28 ? 198 ASP B O   1 
ATOM   3373 C CB  . ASP B 1 198 ? -11.289 -21.773 26.586  1.00 24.12 ? 198 ASP B CB  1 
ATOM   3374 C CG  . ASP B 1 198 ? -10.363 -22.851 27.126  1.00 27.84 ? 198 ASP B CG  1 
ATOM   3375 O OD1 . ASP B 1 198 ? -9.628  -22.535 28.044  1.00 30.58 ? 198 ASP B OD1 1 
ATOM   3376 O OD2 . ASP B 1 198 ? -10.389 -24.000 26.676  1.00 30.31 ? 198 ASP B OD2 1 
ATOM   3377 N N   . ALA B 1 199 ? -11.981 -20.959 23.597  1.00 24.32 ? 199 ALA B N   1 
ATOM   3378 C CA  . ALA B 1 199 ? -12.185 -21.331 22.209  1.00 25.86 ? 199 ALA B CA  1 
ATOM   3379 C C   . ALA B 1 199 ? -11.432 -20.416 21.246  1.00 25.58 ? 199 ALA B C   1 
ATOM   3380 O O   . ALA B 1 199 ? -11.044 -20.902 20.176  1.00 26.58 ? 199 ALA B O   1 
ATOM   3381 C CB  . ALA B 1 199 ? -13.670 -21.277 21.894  1.00 30.77 ? 199 ALA B CB  1 
ATOM   3382 N N   . VAL B 1 200 ? -11.245 -19.115 21.584  1.00 22.25 ? 200 VAL B N   1 
ATOM   3383 C CA  . VAL B 1 200 ? -10.404 -18.230 20.778  1.00 20.28 ? 200 VAL B CA  1 
ATOM   3384 C C   . VAL B 1 200 ? -8.968  -18.714 20.933  1.00 21.11 ? 200 VAL B C   1 
ATOM   3385 O O   . VAL B 1 200 ? -8.430  -19.223 19.952  1.00 23.32 ? 200 VAL B O   1 
ATOM   3386 C CB  . VAL B 1 200 ? -10.568 -16.772 21.235  1.00 18.65 ? 200 VAL B CB  1 
ATOM   3387 C CG1 . VAL B 1 200 ? -9.405  -15.829 20.851  1.00 16.95 ? 200 VAL B CG1 1 
ATOM   3388 C CG2 . VAL B 1 200 ? -11.839 -16.296 20.523  1.00 12.90 ? 200 VAL B CG2 1 
ATOM   3389 N N   . ALA B 1 201 ? -8.382  -18.693 22.135  1.00 21.15 ? 201 ALA B N   1 
ATOM   3390 C CA  . ALA B 1 201 ? -7.066  -19.247 22.445  1.00 19.24 ? 201 ALA B CA  1 
ATOM   3391 C C   . ALA B 1 201 ? -6.836  -20.559 21.751  1.00 18.19 ? 201 ALA B C   1 
ATOM   3392 O O   . ALA B 1 201 ? -5.926  -20.686 20.947  1.00 21.15 ? 201 ALA B O   1 
ATOM   3393 C CB  . ALA B 1 201 ? -6.897  -19.552 23.908  1.00 18.00 ? 201 ALA B CB  1 
ATOM   3394 N N   . GLN B 1 202 ? -7.720  -21.511 21.937  1.00 17.42 ? 202 GLN B N   1 
ATOM   3395 C CA  . GLN B 1 202 ? -7.537  -22.799 21.303  1.00 17.72 ? 202 GLN B CA  1 
ATOM   3396 C C   . GLN B 1 202 ? -7.498  -22.734 19.815  1.00 13.40 ? 202 GLN B C   1 
ATOM   3397 O O   . GLN B 1 202 ? -6.726  -23.485 19.259  1.00 10.30 ? 202 GLN B O   1 
ATOM   3398 C CB  . GLN B 1 202 ? -8.645  -23.789 21.625  1.00 22.70 ? 202 GLN B CB  1 
ATOM   3399 C CG  . GLN B 1 202 ? -8.295  -24.982 22.501  1.00 28.32 ? 202 GLN B CG  1 
ATOM   3400 C CD  . GLN B 1 202 ? -7.522  -24.638 23.771  1.00 30.72 ? 202 GLN B CD  1 
ATOM   3401 O OE1 . GLN B 1 202 ? -6.380  -25.076 23.925  1.00 32.11 ? 202 GLN B OE1 1 
ATOM   3402 N NE2 . GLN B 1 202 ? -8.051  -23.841 24.704  1.00 32.32 ? 202 GLN B NE2 1 
ATOM   3403 N N   . SER B 1 203 ? -8.303  -21.902 19.182  1.00 13.32 ? 203 SER B N   1 
ATOM   3404 C CA  . SER B 1 203 ? -8.374  -21.998 17.749  1.00 18.09 ? 203 SER B CA  1 
ATOM   3405 C C   . SER B 1 203 ? -7.599  -20.946 16.989  1.00 18.76 ? 203 SER B C   1 
ATOM   3406 O O   . SER B 1 203 ? -7.413  -21.148 15.776  1.00 18.29 ? 203 SER B O   1 
ATOM   3407 C CB  . SER B 1 203 ? -9.826  -21.965 17.316  1.00 20.90 ? 203 SER B CB  1 
ATOM   3408 O OG  . SER B 1 203 ? -10.174 -22.903 16.279  1.00 24.63 ? 203 SER B OG  1 
ATOM   3409 N N   . THR B 1 204 ? -7.103  -19.894 17.650  1.00 16.80 ? 204 THR B N   1 
ATOM   3410 C CA  . THR B 1 204 ? -6.363  -18.863 16.972  1.00 17.84 ? 204 THR B CA  1 
ATOM   3411 C C   . THR B 1 204 ? -4.946  -19.254 16.603  1.00 18.22 ? 204 THR B C   1 
ATOM   3412 O O   . THR B 1 204 ? -4.093  -19.635 17.412  1.00 18.63 ? 204 THR B O   1 
ATOM   3413 C CB  . THR B 1 204 ? -6.265  -17.547 17.802  1.00 20.10 ? 204 THR B CB  1 
ATOM   3414 O OG1 . THR B 1 204 ? -7.581  -17.110 18.152  1.00 22.76 ? 204 THR B OG1 1 
ATOM   3415 C CG2 . THR B 1 204 ? -5.612  -16.427 16.994  1.00 19.67 ? 204 THR B CG2 1 
ATOM   3416 N N   . ARG B 1 205 ? -4.732  -19.079 15.296  1.00 18.25 ? 205 ARG B N   1 
ATOM   3417 C CA  . ARG B 1 205 ? -3.411  -19.170 14.727  1.00 15.60 ? 205 ARG B CA  1 
ATOM   3418 C C   . ARG B 1 205 ? -2.456  -18.033 15.167  1.00 13.46 ? 205 ARG B C   1 
ATOM   3419 O O   . ARG B 1 205 ? -2.727  -16.854 14.923  1.00 11.41 ? 205 ARG B O   1 
ATOM   3420 C CB  . ARG B 1 205 ? -3.556  -19.156 13.235  1.00 13.89 ? 205 ARG B CB  1 
ATOM   3421 C CG  . ARG B 1 205 ? -3.422  -20.487 12.540  1.00 10.64 ? 205 ARG B CG  1 
ATOM   3422 C CD  . ARG B 1 205 ? -4.746  -21.059 12.156  1.00 8.81  ? 205 ARG B CD  1 
ATOM   3423 N NE  . ARG B 1 205 ? -5.598  -20.144 11.405  1.00 6.05  ? 205 ARG B NE  1 
ATOM   3424 C CZ  . ARG B 1 205 ? -5.619  -20.103 10.094  1.00 2.79  ? 205 ARG B CZ  1 
ATOM   3425 N NH1 . ARG B 1 205 ? -4.768  -20.856 9.397   1.00 3.57  ? 205 ARG B NH1 1 
ATOM   3426 N NH2 . ARG B 1 205 ? -6.458  -19.246 9.503   1.00 2.00  ? 205 ARG B NH2 1 
ATOM   3427 N N   . ILE B 1 206 ? -1.365  -18.313 15.894  1.00 14.35 ? 206 ILE B N   1 
ATOM   3428 C CA  . ILE B 1 206 ? -0.292  -17.317 16.107  1.00 14.76 ? 206 ILE B CA  1 
ATOM   3429 C C   . ILE B 1 206 ? 0.931   -17.747 15.242  1.00 14.95 ? 206 ILE B C   1 
ATOM   3430 O O   . ILE B 1 206 ? 1.636   -18.743 15.524  1.00 15.84 ? 206 ILE B O   1 
ATOM   3431 C CB  . ILE B 1 206 ? 0.128   -17.222 17.591  1.00 11.80 ? 206 ILE B CB  1 
ATOM   3432 C CG1 . ILE B 1 206 ? -1.082  -17.415 18.500  1.00 11.88 ? 206 ILE B CG1 1 
ATOM   3433 C CG2 . ILE B 1 206 ? 0.749   -15.837 17.823  1.00 9.84  ? 206 ILE B CG2 1 
ATOM   3434 C CD1 . ILE B 1 206 ? -0.869  -16.914 19.926  1.00 12.19 ? 206 ILE B CD1 1 
ATOM   3435 N N   . ILE B 1 207 ? 1.179   -17.050 14.124  1.00 11.26 ? 207 ILE B N   1 
ATOM   3436 C CA  . ILE B 1 207 ? 2.229   -17.418 13.211  1.00 9.10  ? 207 ILE B CA  1 
ATOM   3437 C C   . ILE B 1 207 ? 3.495   -16.661 13.560  1.00 13.56 ? 207 ILE B C   1 
ATOM   3438 O O   . ILE B 1 207 ? 3.431   -15.683 14.333  1.00 17.36 ? 207 ILE B O   1 
ATOM   3439 C CB  . ILE B 1 207 ? 1.825   -17.131 11.782  1.00 2.00  ? 207 ILE B CB  1 
ATOM   3440 C CG1 . ILE B 1 207 ? 1.490   -15.743 11.506  1.00 2.00  ? 207 ILE B CG1 1 
ATOM   3441 C CG2 . ILE B 1 207 ? 0.654   -18.026 11.520  1.00 7.59  ? 207 ILE B CG2 1 
ATOM   3442 C CD1 . ILE B 1 207 ? 1.122   -15.667 10.026  1.00 2.00  ? 207 ILE B CD1 1 
ATOM   3443 N N   . TYR B 1 208 ? 4.672   -17.150 13.106  1.00 12.38 ? 208 TYR B N   1 
ATOM   3444 C CA  . TYR B 1 208 ? 5.892   -16.491 13.451  1.00 10.77 ? 208 TYR B CA  1 
ATOM   3445 C C   . TYR B 1 208 ? 6.470   -15.718 12.301  1.00 13.11 ? 208 TYR B C   1 
ATOM   3446 O O   . TYR B 1 208 ? 6.740   -16.198 11.204  1.00 11.59 ? 208 TYR B O   1 
ATOM   3447 C CB  . TYR B 1 208 ? 6.895   -17.508 13.951  1.00 11.54 ? 208 TYR B CB  1 
ATOM   3448 C CG  . TYR B 1 208 ? 8.228   -16.848 14.243  1.00 10.19 ? 208 TYR B CG  1 
ATOM   3449 C CD1 . TYR B 1 208 ? 8.337   -15.918 15.272  1.00 12.71 ? 208 TYR B CD1 1 
ATOM   3450 C CD2 . TYR B 1 208 ? 9.311   -17.137 13.415  1.00 12.01 ? 208 TYR B CD2 1 
ATOM   3451 C CE1 . TYR B 1 208 ? 9.540   -15.260 15.479  1.00 14.79 ? 208 TYR B CE1 1 
ATOM   3452 C CE2 . TYR B 1 208 ? 10.515  -16.485 13.608  1.00 15.84 ? 208 TYR B CE2 1 
ATOM   3453 C CZ  . TYR B 1 208 ? 10.612  -15.555 14.638  1.00 15.02 ? 208 TYR B CZ  1 
ATOM   3454 O OH  . TYR B 1 208 ? 11.819  -14.922 14.817  1.00 21.97 ? 208 TYR B OH  1 
ATOM   3455 N N   . GLY B 1 209 ? 6.705   -14.499 12.710  1.00 15.68 ? 209 GLY B N   1 
ATOM   3456 C CA  . GLY B 1 209 ? 7.273   -13.453 11.896  1.00 18.98 ? 209 GLY B CA  1 
ATOM   3457 C C   . GLY B 1 209 ? 8.646   -13.086 12.433  1.00 19.62 ? 209 GLY B C   1 
ATOM   3458 O O   . GLY B 1 209 ? 8.911   -12.790 13.603  1.00 14.23 ? 209 GLY B O   1 
ATOM   3459 N N   . GLY B 1 210 ? 9.527   -13.103 11.476  1.00 21.29 ? 210 GLY B N   1 
ATOM   3460 C CA  . GLY B 1 210 ? 10.914  -12.851 11.725  1.00 25.24 ? 210 GLY B CA  1 
ATOM   3461 C C   . GLY B 1 210 ? 11.598  -13.570 10.584  1.00 28.59 ? 210 GLY B C   1 
ATOM   3462 O O   . GLY B 1 210 ? 10.901  -13.845 9.565   1.00 31.13 ? 210 GLY B O   1 
ATOM   3463 N N   . SER B 1 211 ? 12.892  -13.938 10.764  1.00 25.55 ? 211 SER B N   1 
ATOM   3464 C CA  . SER B 1 211 ? 13.645  -14.456 9.635   1.00 21.97 ? 211 SER B CA  1 
ATOM   3465 C C   . SER B 1 211 ? 13.580  -15.944 9.432   1.00 22.88 ? 211 SER B C   1 
ATOM   3466 O O   . SER B 1 211 ? 14.483  -16.730 9.715   1.00 25.91 ? 211 SER B O   1 
ATOM   3467 C CB  . SER B 1 211 ? 15.082  -14.015 9.758   1.00 18.63 ? 211 SER B CB  1 
ATOM   3468 O OG  . SER B 1 211 ? 15.187  -12.610 9.610   1.00 18.31 ? 211 SER B OG  1 
ATOM   3469 N N   . VAL B 1 212 ? 12.448  -16.360 8.898   1.00 22.92 ? 212 VAL B N   1 
ATOM   3470 C CA  . VAL B 1 212 ? 12.248  -17.760 8.635   1.00 22.47 ? 212 VAL B CA  1 
ATOM   3471 C C   . VAL B 1 212 ? 13.110  -18.020 7.405   1.00 24.72 ? 212 VAL B C   1 
ATOM   3472 O O   . VAL B 1 212 ? 13.118  -17.210 6.467   1.00 27.11 ? 212 VAL B O   1 
ATOM   3473 C CB  . VAL B 1 212 ? 10.770  -18.009 8.356   1.00 18.91 ? 212 VAL B CB  1 
ATOM   3474 C CG1 . VAL B 1 212 ? 10.501  -19.467 8.569   1.00 19.42 ? 212 VAL B CG1 1 
ATOM   3475 C CG2 . VAL B 1 212 ? 9.885   -17.211 9.263   1.00 15.83 ? 212 VAL B CG2 1 
ATOM   3476 N N   . THR B 1 213 ? 13.919  -19.070 7.391   1.00 26.49 ? 213 THR B N   1 
ATOM   3477 C CA  . THR B 1 213 ? 14.674  -19.422 6.195   1.00 27.10 ? 213 THR B CA  1 
ATOM   3478 C C   . THR B 1 213 ? 14.352  -20.886 5.986   1.00 26.96 ? 213 THR B C   1 
ATOM   3479 O O   . THR B 1 213 ? 13.850  -21.573 6.896   1.00 28.42 ? 213 THR B O   1 
ATOM   3480 C CB  . THR B 1 213 ? 16.197  -19.284 6.377   1.00 27.42 ? 213 THR B CB  1 
ATOM   3481 O OG1 . THR B 1 213 ? 16.638  -20.317 7.258   1.00 30.32 ? 213 THR B OG1 1 
ATOM   3482 C CG2 . THR B 1 213 ? 16.584  -17.920 6.946   1.00 30.47 ? 213 THR B CG2 1 
ATOM   3483 N N   . GLY B 1 214 ? 14.741  -21.404 4.830   1.00 26.91 ? 214 GLY B N   1 
ATOM   3484 C CA  . GLY B 1 214 ? 14.564  -22.819 4.548   1.00 29.55 ? 214 GLY B CA  1 
ATOM   3485 C C   . GLY B 1 214 ? 15.248  -23.719 5.605   1.00 32.64 ? 214 GLY B C   1 
ATOM   3486 O O   . GLY B 1 214 ? 14.919  -24.911 5.711   1.00 35.60 ? 214 GLY B O   1 
ATOM   3487 N N   . ALA B 1 215 ? 16.198  -23.150 6.384   1.00 31.75 ? 215 ALA B N   1 
ATOM   3488 C CA  . ALA B 1 215 ? 16.947  -23.820 7.444   1.00 30.12 ? 215 ALA B CA  1 
ATOM   3489 C C   . ALA B 1 215 ? 16.136  -23.904 8.709   1.00 29.34 ? 215 ALA B C   1 
ATOM   3490 O O   . ALA B 1 215 ? 15.834  -24.949 9.295   1.00 28.42 ? 215 ALA B O   1 
ATOM   3491 C CB  . ALA B 1 215 ? 18.218  -23.054 7.822   1.00 31.86 ? 215 ALA B CB  1 
ATOM   3492 N N   . THR B 1 216 ? 15.784  -22.687 9.083   1.00 29.13 ? 216 THR B N   1 
ATOM   3493 C CA  . THR B 1 216 ? 15.101  -22.466 10.320  1.00 29.61 ? 216 THR B CA  1 
ATOM   3494 C C   . THR B 1 216 ? 13.675  -22.975 10.387  1.00 32.53 ? 216 THR B C   1 
ATOM   3495 O O   . THR B 1 216 ? 13.180  -23.338 11.481  1.00 33.66 ? 216 THR B O   1 
ATOM   3496 C CB  . THR B 1 216 ? 15.180  -20.985 10.581  1.00 27.75 ? 216 THR B CB  1 
ATOM   3497 O OG1 . THR B 1 216 ? 15.210  -20.279 9.354   1.00 22.94 ? 216 THR B OG1 1 
ATOM   3498 C CG2 . THR B 1 216 ? 16.411  -20.686 11.366  1.00 28.23 ? 216 THR B CG2 1 
ATOM   3499 N N   . CYS B 1 217 ? 13.042  -23.108 9.210   1.00 33.47 ? 217 CYS B N   1 
ATOM   3500 C CA  . CYS B 1 217 ? 11.639  -23.462 9.209   1.00 34.05 ? 217 CYS B CA  1 
ATOM   3501 C C   . CYS B 1 217 ? 11.231  -24.735 9.974   1.00 31.98 ? 217 CYS B C   1 
ATOM   3502 O O   . CYS B 1 217 ? 10.256  -24.662 10.717  1.00 31.21 ? 217 CYS B O   1 
ATOM   3503 C CB  . CYS B 1 217 ? 11.190  -23.461 7.721   1.00 33.97 ? 217 CYS B CB  1 
ATOM   3504 S SG  . CYS B 1 217 ? 11.193  -24.843 6.534   1.00 39.65 ? 217 CYS B SG  1 
ATOM   3505 N N   . LYS B 1 218 ? 11.929  -25.869 10.036  1.00 31.98 ? 218 LYS B N   1 
ATOM   3506 C CA  . LYS B 1 218 ? 11.354  -27.057 10.703  1.00 32.25 ? 218 LYS B CA  1 
ATOM   3507 C C   . LYS B 1 218 ? 11.556  -27.140 12.211  1.00 30.37 ? 218 LYS B C   1 
ATOM   3508 O O   . LYS B 1 218 ? 10.794  -27.745 12.955  1.00 30.01 ? 218 LYS B O   1 
ATOM   3509 C CB  . LYS B 1 218 ? 11.900  -28.370 10.070  1.00 31.12 ? 218 LYS B CB  1 
ATOM   3510 C CG  . LYS B 1 218 ? 11.445  -28.589 8.643   1.00 28.24 ? 218 LYS B CG  1 
ATOM   3511 C CD  . LYS B 1 218 ? 12.029  -29.872 8.062   1.00 34.09 ? 218 LYS B CD  1 
ATOM   3512 C CE  . LYS B 1 218 ? 13.600  -29.959 7.949   1.00 36.23 ? 218 LYS B CE  1 
ATOM   3513 N NZ  . LYS B 1 218 ? 14.114  -31.198 7.342   1.00 28.29 ? 218 LYS B NZ  1 
ATOM   3514 N N   . GLU B 1 219 ? 12.612  -26.542 12.703  1.00 29.91 ? 219 GLU B N   1 
ATOM   3515 C CA  . GLU B 1 219 ? 12.880  -26.563 14.109  1.00 29.45 ? 219 GLU B CA  1 
ATOM   3516 C C   . GLU B 1 219 ? 11.798  -25.687 14.714  1.00 28.12 ? 219 GLU B C   1 
ATOM   3517 O O   . GLU B 1 219 ? 11.156  -26.113 15.678  1.00 27.85 ? 219 GLU B O   1 
ATOM   3518 C CB  . GLU B 1 219 ? 14.290  -26.013 14.298  1.00 35.57 ? 219 GLU B CB  1 
ATOM   3519 C CG  . GLU B 1 219 ? 15.341  -26.969 14.904  1.00 41.13 ? 219 GLU B CG  1 
ATOM   3520 C CD  . GLU B 1 219 ? 15.802  -26.631 16.350  1.00 44.02 ? 219 GLU B CD  1 
ATOM   3521 O OE1 . GLU B 1 219 ? 15.140  -27.052 17.317  1.00 45.88 ? 219 GLU B OE1 1 
ATOM   3522 O OE2 . GLU B 1 219 ? 16.837  -25.957 16.510  1.00 44.53 ? 219 GLU B OE2 1 
ATOM   3523 N N   . LEU B 1 220 ? 11.550  -24.518 14.064  1.00 27.47 ? 220 LEU B N   1 
ATOM   3524 C CA  . LEU B 1 220 ? 10.546  -23.514 14.450  1.00 24.62 ? 220 LEU B CA  1 
ATOM   3525 C C   . LEU B 1 220 ? 9.106   -24.000 14.448  1.00 24.99 ? 220 LEU B C   1 
ATOM   3526 O O   . LEU B 1 220 ? 8.423   -23.890 15.466  1.00 24.45 ? 220 LEU B O   1 
ATOM   3527 C CB  . LEU B 1 220 ? 10.608  -22.310 13.537  1.00 22.69 ? 220 LEU B CB  1 
ATOM   3528 C CG  . LEU B 1 220 ? 11.527  -21.161 13.895  1.00 18.88 ? 220 LEU B CG  1 
ATOM   3529 C CD1 . LEU B 1 220 ? 11.378  -20.088 12.840  1.00 16.53 ? 220 LEU B CD1 1 
ATOM   3530 C CD2 . LEU B 1 220 ? 11.188  -20.632 15.288  1.00 19.50 ? 220 LEU B CD2 1 
ATOM   3531 N N   . ALA B 1 221 ? 8.621   -24.567 13.345  1.00 25.45 ? 221 ALA B N   1 
ATOM   3532 C CA  . ALA B 1 221 ? 7.307   -25.188 13.290  1.00 27.34 ? 221 ALA B CA  1 
ATOM   3533 C C   . ALA B 1 221 ? 7.209   -26.444 14.188  1.00 28.70 ? 221 ALA B C   1 
ATOM   3534 O O   . ALA B 1 221 ? 6.249   -27.213 14.048  1.00 29.66 ? 221 ALA B O   1 
ATOM   3535 C CB  . ALA B 1 221 ? 6.985   -25.591 11.840  1.00 25.47 ? 221 ALA B CB  1 
ATOM   3536 N N   . SER B 1 222 ? 8.166   -26.758 15.078  1.00 30.31 ? 222 SER B N   1 
ATOM   3537 C CA  . SER B 1 222 ? 8.006   -27.892 15.985  1.00 32.99 ? 222 SER B CA  1 
ATOM   3538 C C   . SER B 1 222 ? 7.632   -27.354 17.365  1.00 32.45 ? 222 SER B C   1 
ATOM   3539 O O   . SER B 1 222 ? 7.414   -28.115 18.323  1.00 34.41 ? 222 SER B O   1 
ATOM   3540 C CB  . SER B 1 222 ? 9.313   -28.747 16.082  1.00 33.95 ? 222 SER B CB  1 
ATOM   3541 O OG  . SER B 1 222 ? 9.115   -30.168 16.264  1.00 32.01 ? 222 SER B OG  1 
ATOM   3542 N N   . GLN B 1 223 ? 7.538   -26.034 17.544  1.00 30.94 ? 223 GLN B N   1 
ATOM   3543 C CA  . GLN B 1 223 ? 7.015   -25.561 18.804  1.00 27.08 ? 223 GLN B CA  1 
ATOM   3544 C C   . GLN B 1 223 ? 5.511   -25.689 18.798  1.00 26.20 ? 223 GLN B C   1 
ATOM   3545 O O   . GLN B 1 223 ? 4.838   -25.459 17.787  1.00 23.07 ? 223 GLN B O   1 
ATOM   3546 C CB  . GLN B 1 223 ? 7.372   -24.132 19.042  1.00 26.26 ? 223 GLN B CB  1 
ATOM   3547 C CG  . GLN B 1 223 ? 8.851   -23.969 19.218  1.00 27.08 ? 223 GLN B CG  1 
ATOM   3548 C CD  . GLN B 1 223 ? 9.439   -24.818 20.317  1.00 27.54 ? 223 GLN B CD  1 
ATOM   3549 O OE1 . GLN B 1 223 ? 8.793   -25.596 21.012  1.00 27.16 ? 223 GLN B OE1 1 
ATOM   3550 N NE2 . GLN B 1 223 ? 10.733  -24.727 20.509  1.00 31.42 ? 223 GLN B NE2 1 
ATOM   3551 N N   . PRO B 1 224 ? 4.935   -26.062 19.928  1.00 27.33 ? 224 PRO B N   1 
ATOM   3552 C CA  . PRO B 1 224 ? 3.515   -26.345 20.005  1.00 27.69 ? 224 PRO B CA  1 
ATOM   3553 C C   . PRO B 1 224 ? 2.653   -25.117 19.675  1.00 28.61 ? 224 PRO B C   1 
ATOM   3554 O O   . PRO B 1 224 ? 1.528   -25.270 19.219  1.00 31.86 ? 224 PRO B O   1 
ATOM   3555 C CB  . PRO B 1 224 ? 3.381   -26.851 21.420  1.00 26.78 ? 224 PRO B CB  1 
ATOM   3556 C CG  . PRO B 1 224 ? 4.437   -26.069 22.207  1.00 24.42 ? 224 PRO B CG  1 
ATOM   3557 C CD  . PRO B 1 224 ? 5.590   -26.169 21.245  1.00 26.48 ? 224 PRO B CD  1 
ATOM   3558 N N   . ASP B 1 225 ? 3.127   -23.883 19.889  1.00 26.56 ? 225 ASP B N   1 
ATOM   3559 C CA  . ASP B 1 225 ? 2.330   -22.691 19.739  1.00 21.09 ? 225 ASP B CA  1 
ATOM   3560 C C   . ASP B 1 225 ? 2.848   -21.792 18.665  1.00 19.02 ? 225 ASP B C   1 
ATOM   3561 O O   . ASP B 1 225 ? 2.680   -20.575 18.694  1.00 20.84 ? 225 ASP B O   1 
ATOM   3562 C CB  . ASP B 1 225 ? 2.319   -21.964 21.045  1.00 20.33 ? 225 ASP B CB  1 
ATOM   3563 C CG  . ASP B 1 225 ? 1.569   -22.671 22.155  1.00 20.30 ? 225 ASP B CG  1 
ATOM   3564 O OD1 . ASP B 1 225 ? 0.578   -23.375 21.901  1.00 18.84 ? 225 ASP B OD1 1 
ATOM   3565 O OD2 . ASP B 1 225 ? 1.984   -22.483 23.293  1.00 18.63 ? 225 ASP B OD2 1 
ATOM   3566 N N   . VAL B 1 226 ? 3.590   -22.321 17.724  1.00 16.67 ? 226 VAL B N   1 
ATOM   3567 C CA  . VAL B 1 226 ? 4.018   -21.557 16.577  1.00 12.03 ? 226 VAL B CA  1 
ATOM   3568 C C   . VAL B 1 226 ? 3.172   -22.251 15.498  1.00 11.30 ? 226 VAL B C   1 
ATOM   3569 O O   . VAL B 1 226 ? 3.288   -23.421 15.163  1.00 9.59  ? 226 VAL B O   1 
ATOM   3570 C CB  . VAL B 1 226 ? 5.559   -21.712 16.456  1.00 9.19  ? 226 VAL B CB  1 
ATOM   3571 C CG1 . VAL B 1 226 ? 5.924   -21.118 15.142  1.00 13.82 ? 226 VAL B CG1 1 
ATOM   3572 C CG2 . VAL B 1 226 ? 6.368   -20.958 17.519  1.00 2.00  ? 226 VAL B CG2 1 
ATOM   3573 N N   . ASP B 1 227 ? 2.198   -21.492 15.025  1.00 14.14 ? 227 ASP B N   1 
ATOM   3574 C CA  . ASP B 1 227 ? 1.186   -21.919 14.043  1.00 16.47 ? 227 ASP B CA  1 
ATOM   3575 C C   . ASP B 1 227 ? 1.482   -21.727 12.548  1.00 15.29 ? 227 ASP B C   1 
ATOM   3576 O O   . ASP B 1 227 ? 0.558   -21.723 11.733  1.00 17.02 ? 227 ASP B O   1 
ATOM   3577 C CB  . ASP B 1 227 ? -0.156  -21.190 14.398  1.00 18.38 ? 227 ASP B CB  1 
ATOM   3578 C CG  . ASP B 1 227 ? -0.915  -21.844 15.573  1.00 21.37 ? 227 ASP B CG  1 
ATOM   3579 O OD1 . ASP B 1 227 ? -1.229  -23.030 15.428  1.00 22.88 ? 227 ASP B OD1 1 
ATOM   3580 O OD2 . ASP B 1 227 ? -1.192  -21.205 16.600  1.00 14.02 ? 227 ASP B OD2 1 
ATOM   3581 N N   . GLY B 1 228 ? 2.732   -21.577 12.119  1.00 10.39 ? 228 GLY B N   1 
ATOM   3582 C CA  . GLY B 1 228 ? 3.021   -21.265 10.753  1.00 7.18  ? 228 GLY B CA  1 
ATOM   3583 C C   . GLY B 1 228 ? 3.832   -19.995 10.750  1.00 8.13  ? 228 GLY B C   1 
ATOM   3584 O O   . GLY B 1 228 ? 4.264   -19.599 11.844  1.00 9.90  ? 228 GLY B O   1 
ATOM   3585 N N   . PHE B 1 229 ? 4.013   -19.300 9.602   1.00 4.32  ? 229 PHE B N   1 
ATOM   3586 C CA  . PHE B 1 229 ? 4.987   -18.235 9.450   1.00 2.00  ? 229 PHE B CA  1 
ATOM   3587 C C   . PHE B 1 229 ? 4.600   -17.039 8.638   1.00 2.00  ? 229 PHE B C   1 
ATOM   3588 O O   . PHE B 1 229 ? 3.922   -17.194 7.615   1.00 2.00  ? 229 PHE B O   1 
ATOM   3589 C CB  . PHE B 1 229 ? 6.229   -18.718 8.748   1.00 5.63  ? 229 PHE B CB  1 
ATOM   3590 C CG  . PHE B 1 229 ? 6.781   -20.024 9.271   1.00 7.36  ? 229 PHE B CG  1 
ATOM   3591 C CD1 . PHE B 1 229 ? 7.497   -20.013 10.476  1.00 10.34 ? 229 PHE B CD1 1 
ATOM   3592 C CD2 . PHE B 1 229 ? 6.480   -21.217 8.611   1.00 4.96  ? 229 PHE B CD2 1 
ATOM   3593 C CE1 . PHE B 1 229 ? 7.886   -21.219 11.040  1.00 11.90 ? 229 PHE B CE1 1 
ATOM   3594 C CE2 . PHE B 1 229 ? 6.873   -22.409 9.174   1.00 4.72  ? 229 PHE B CE2 1 
ATOM   3595 C CZ  . PHE B 1 229 ? 7.570   -22.407 10.379  1.00 12.80 ? 229 PHE B CZ  1 
ATOM   3596 N N   . LEU B 1 230 ? 5.095   -15.863 9.016   1.00 2.75  ? 230 LEU B N   1 
ATOM   3597 C CA  . LEU B 1 230 ? 5.082   -14.715 8.108   1.00 6.16  ? 230 LEU B CA  1 
ATOM   3598 C C   . LEU B 1 230 ? 6.508   -14.511 7.480   1.00 7.93  ? 230 LEU B C   1 
ATOM   3599 O O   . LEU B 1 230 ? 7.553   -14.170 8.074   1.00 10.16 ? 230 LEU B O   1 
ATOM   3600 C CB  . LEU B 1 230 ? 4.597   -13.472 8.850   1.00 2.00  ? 230 LEU B CB  1 
ATOM   3601 C CG  . LEU B 1 230 ? 4.386   -12.366 7.840   1.00 2.00  ? 230 LEU B CG  1 
ATOM   3602 C CD1 . LEU B 1 230 ? 3.330   -12.790 6.830   1.00 2.00  ? 230 LEU B CD1 1 
ATOM   3603 C CD2 . LEU B 1 230 ? 3.988   -11.096 8.558   1.00 2.00  ? 230 LEU B CD2 1 
ATOM   3604 N N   . VAL B 1 231 ? 6.598   -14.817 6.199   1.00 8.29  ? 231 VAL B N   1 
ATOM   3605 C CA  . VAL B 1 231 ? 7.886   -14.893 5.562   1.00 7.71  ? 231 VAL B CA  1 
ATOM   3606 C C   . VAL B 1 231 ? 8.158   -13.635 4.811   1.00 9.29  ? 231 VAL B C   1 
ATOM   3607 O O   . VAL B 1 231 ? 7.451   -13.312 3.827   1.00 10.69 ? 231 VAL B O   1 
ATOM   3608 C CB  . VAL B 1 231 ? 7.960   -16.086 4.619   1.00 5.80  ? 231 VAL B CB  1 
ATOM   3609 C CG1 . VAL B 1 231 ? 9.403   -16.251 4.149   1.00 5.16  ? 231 VAL B CG1 1 
ATOM   3610 C CG2 . VAL B 1 231 ? 7.447   -17.333 5.312   1.00 2.00  ? 231 VAL B CG2 1 
ATOM   3611 N N   . GLY B 1 232 ? 9.232   -13.017 5.236   1.00 5.93  ? 232 GLY B N   1 
ATOM   3612 C CA  . GLY B 1 232 ? 9.602   -11.835 4.547   1.00 10.24 ? 232 GLY B CA  1 
ATOM   3613 C C   . GLY B 1 232 ? 10.368  -12.162 3.280   1.00 12.62 ? 232 GLY B C   1 
ATOM   3614 O O   . GLY B 1 232 ? 9.789   -12.760 2.387   1.00 12.82 ? 232 GLY B O   1 
ATOM   3615 N N   . GLY B 1 233 ? 11.704  -11.932 3.232   1.00 13.01 ? 233 GLY B N   1 
ATOM   3616 C CA  . GLY B 1 233 ? 12.471  -11.998 1.990   1.00 10.92 ? 233 GLY B CA  1 
ATOM   3617 C C   . GLY B 1 233 ? 12.706  -13.403 1.460   1.00 11.59 ? 233 GLY B C   1 
ATOM   3618 O O   . GLY B 1 233 ? 13.187  -13.578 0.338   1.00 15.13 ? 233 GLY B O   1 
ATOM   3619 N N   . ALA B 1 234 ? 12.409  -14.411 2.255   1.00 9.46  ? 234 ALA B N   1 
ATOM   3620 C CA  . ALA B 1 234 ? 12.641  -15.756 1.830   1.00 9.97  ? 234 ALA B CA  1 
ATOM   3621 C C   . ALA B 1 234 ? 11.510  -16.194 0.934   1.00 12.46 ? 234 ALA B C   1 
ATOM   3622 O O   . ALA B 1 234 ? 11.726  -17.121 0.158   1.00 14.57 ? 234 ALA B O   1 
ATOM   3623 C CB  . ALA B 1 234 ? 12.736  -16.616 3.061   1.00 10.76 ? 234 ALA B CB  1 
ATOM   3624 N N   . SER B 1 235 ? 10.342  -15.511 0.998   1.00 12.39 ? 235 SER B N   1 
ATOM   3625 C CA  . SER B 1 235 ? 9.145   -15.808 0.215   1.00 8.36  ? 235 SER B CA  1 
ATOM   3626 C C   . SER B 1 235 ? 9.259   -15.388 -1.252  1.00 10.84 ? 235 SER B C   1 
ATOM   3627 O O   . SER B 1 235 ? 8.411   -15.727 -2.109  1.00 11.21 ? 235 SER B O   1 
ATOM   3628 C CB  . SER B 1 235 ? 7.984   -15.094 0.818   1.00 5.34  ? 235 SER B CB  1 
ATOM   3629 O OG  . SER B 1 235 ? 8.273   -13.735 0.627   1.00 5.03  ? 235 SER B OG  1 
ATOM   3630 N N   . LEU B 1 236 ? 10.235  -14.482 -1.433  1.00 10.22 ? 236 LEU B N   1 
ATOM   3631 C CA  . LEU B 1 236 ? 10.649  -14.039 -2.735  1.00 12.50 ? 236 LEU B CA  1 
ATOM   3632 C C   . LEU B 1 236 ? 11.647  -15.006 -3.350  1.00 15.61 ? 236 LEU B C   1 
ATOM   3633 O O   . LEU B 1 236 ? 11.773  -15.011 -4.578  1.00 17.83 ? 236 LEU B O   1 
ATOM   3634 C CB  . LEU B 1 236 ? 11.262  -12.691 -2.632  1.00 11.03 ? 236 LEU B CB  1 
ATOM   3635 C CG  . LEU B 1 236 ? 10.254  -11.580 -2.782  1.00 14.07 ? 236 LEU B CG  1 
ATOM   3636 C CD1 . LEU B 1 236 ? 10.749  -10.364 -1.987  1.00 14.26 ? 236 LEU B CD1 1 
ATOM   3637 C CD2 . LEU B 1 236 ? 10.026  -11.306 -4.273  1.00 12.72 ? 236 LEU B CD2 1 
ATOM   3638 N N   . LYS B 1 237 ? 12.341  -15.859 -2.580  1.00 17.94 ? 237 LYS B N   1 
ATOM   3639 C CA  . LYS B 1 237 ? 13.247  -16.854 -3.134  1.00 19.85 ? 237 LYS B CA  1 
ATOM   3640 C C   . LYS B 1 237 ? 12.493  -18.177 -3.160  1.00 23.43 ? 237 LYS B C   1 
ATOM   3641 O O   . LYS B 1 237 ? 11.615  -18.422 -2.333  1.00 24.54 ? 237 LYS B O   1 
ATOM   3642 C CB  . LYS B 1 237 ? 14.443  -17.094 -2.281  1.00 19.38 ? 237 LYS B CB  1 
ATOM   3643 C CG  . LYS B 1 237 ? 15.049  -15.848 -1.750  1.00 21.69 ? 237 LYS B CG  1 
ATOM   3644 C CD  . LYS B 1 237 ? 15.922  -16.482 -0.711  1.00 27.47 ? 237 LYS B CD  1 
ATOM   3645 C CE  . LYS B 1 237 ? 16.642  -15.479 0.166   1.00 32.15 ? 237 LYS B CE  1 
ATOM   3646 N NZ  . LYS B 1 237 ? 18.085  -15.702 0.181   1.00 33.62 ? 237 LYS B NZ  1 
ATOM   3647 N N   . PRO B 1 238 ? 12.833  -19.141 -4.023  1.00 26.78 ? 238 PRO B N   1 
ATOM   3648 C CA  . PRO B 1 238 ? 12.214  -20.479 -4.123  1.00 26.36 ? 238 PRO B CA  1 
ATOM   3649 C C   . PRO B 1 238 ? 12.222  -21.419 -2.924  1.00 24.28 ? 238 PRO B C   1 
ATOM   3650 O O   . PRO B 1 238 ? 11.476  -22.405 -2.885  1.00 21.65 ? 238 PRO B O   1 
ATOM   3651 C CB  . PRO B 1 238 ? 12.906  -21.083 -5.306  1.00 29.52 ? 238 PRO B CB  1 
ATOM   3652 C CG  . PRO B 1 238 ? 14.274  -20.406 -5.281  1.00 29.28 ? 238 PRO B CG  1 
ATOM   3653 C CD  . PRO B 1 238 ? 13.832  -18.976 -5.080  1.00 29.30 ? 238 PRO B CD  1 
ATOM   3654 N N   . GLU B 1 239 ? 13.089  -21.140 -1.943  1.00 23.23 ? 239 GLU B N   1 
ATOM   3655 C CA  . GLU B 1 239 ? 13.077  -21.868 -0.677  1.00 22.49 ? 239 GLU B CA  1 
ATOM   3656 C C   . GLU B 1 239 ? 11.752  -21.664 0.076   1.00 21.34 ? 239 GLU B C   1 
ATOM   3657 O O   . GLU B 1 239 ? 11.415  -22.380 1.026   1.00 22.72 ? 239 GLU B O   1 
ATOM   3658 C CB  . GLU B 1 239 ? 14.221  -21.404 0.179   1.00 20.47 ? 239 GLU B CB  1 
ATOM   3659 C CG  . GLU B 1 239 ? 14.173  -19.945 0.564   1.00 22.54 ? 239 GLU B CG  1 
ATOM   3660 C CD  . GLU B 1 239 ? 15.513  -19.518 1.126   1.00 25.74 ? 239 GLU B CD  1 
ATOM   3661 O OE1 . GLU B 1 239 ? 16.480  -19.579 0.367   1.00 31.23 ? 239 GLU B OE1 1 
ATOM   3662 O OE2 . GLU B 1 239 ? 15.611  -19.138 2.291   1.00 24.24 ? 239 GLU B OE2 1 
ATOM   3663 N N   . PHE B 1 240 ? 10.929  -20.724 -0.374  1.00 19.26 ? 240 PHE B N   1 
ATOM   3664 C CA  . PHE B 1 240 ? 9.601   -20.508 0.154   1.00 18.93 ? 240 PHE B CA  1 
ATOM   3665 C C   . PHE B 1 240 ? 8.773   -21.775 0.151   1.00 17.73 ? 240 PHE B C   1 
ATOM   3666 O O   . PHE B 1 240 ? 7.989   -22.064 1.050   1.00 18.94 ? 240 PHE B O   1 
ATOM   3667 C CB  . PHE B 1 240 ? 8.911   -19.437 -0.685  1.00 17.26 ? 240 PHE B CB  1 
ATOM   3668 C CG  . PHE B 1 240 ? 7.589   -18.999 -0.083  1.00 15.34 ? 240 PHE B CG  1 
ATOM   3669 C CD1 . PHE B 1 240 ? 7.492   -18.681 1.282   1.00 13.18 ? 240 PHE B CD1 1 
ATOM   3670 C CD2 . PHE B 1 240 ? 6.470   -18.934 -0.915  1.00 12.58 ? 240 PHE B CD2 1 
ATOM   3671 C CE1 . PHE B 1 240 ? 6.252   -18.302 1.794   1.00 12.09 ? 240 PHE B CE1 1 
ATOM   3672 C CE2 . PHE B 1 240 ? 5.240   -18.555 -0.383  1.00 8.37  ? 240 PHE B CE2 1 
ATOM   3673 C CZ  . PHE B 1 240 ? 5.131   -18.242 0.963   1.00 10.35 ? 240 PHE B CZ  1 
ATOM   3674 N N   . VAL B 1 241 ? 9.031   -22.544 -0.890  1.00 19.56 ? 241 VAL B N   1 
ATOM   3675 C CA  . VAL B 1 241 ? 8.383   -23.803 -1.184  1.00 21.62 ? 241 VAL B CA  1 
ATOM   3676 C C   . VAL B 1 241 ? 8.561   -24.753 -0.030  1.00 22.40 ? 241 VAL B C   1 
ATOM   3677 O O   . VAL B 1 241 ? 7.588   -25.344 0.451   1.00 23.41 ? 241 VAL B O   1 
ATOM   3678 C CB  . VAL B 1 241 ? 9.015   -24.294 -2.500  1.00 22.58 ? 241 VAL B CB  1 
ATOM   3679 C CG1 . VAL B 1 241 ? 8.667   -25.742 -2.745  1.00 23.86 ? 241 VAL B CG1 1 
ATOM   3680 C CG2 . VAL B 1 241 ? 8.526   -23.380 -3.647  1.00 18.67 ? 241 VAL B CG2 1 
ATOM   3681 N N   . ASP B 1 242 ? 9.814   -24.792 0.434   1.00 23.85 ? 242 ASP B N   1 
ATOM   3682 C CA  . ASP B 1 242 ? 10.234  -25.591 1.566   1.00 25.35 ? 242 ASP B CA  1 
ATOM   3683 C C   . ASP B 1 242 ? 9.502   -25.084 2.763   1.00 26.46 ? 242 ASP B C   1 
ATOM   3684 O O   . ASP B 1 242 ? 8.868   -25.927 3.366   1.00 29.42 ? 242 ASP B O   1 
ATOM   3685 C CB  . ASP B 1 242 ? 11.723  -25.478 1.818   1.00 26.73 ? 242 ASP B CB  1 
ATOM   3686 C CG  . ASP B 1 242 ? 12.586  -26.123 0.730   1.00 30.76 ? 242 ASP B CG  1 
ATOM   3687 O OD1 . ASP B 1 242 ? 12.071  -26.953 -0.052  1.00 30.20 ? 242 ASP B OD1 1 
ATOM   3688 O OD2 . ASP B 1 242 ? 13.778  -25.774 0.676   1.00 30.50 ? 242 ASP B OD2 1 
ATOM   3689 N N   . ILE B 1 243 ? 9.438   -23.775 3.047   1.00 25.84 ? 243 ILE B N   1 
ATOM   3690 C CA  . ILE B 1 243 ? 8.666   -23.266 4.182   1.00 24.16 ? 243 ILE B CA  1 
ATOM   3691 C C   . ILE B 1 243 ? 7.165   -23.587 4.065   1.00 25.36 ? 243 ILE B C   1 
ATOM   3692 O O   . ILE B 1 243 ? 6.461   -23.522 5.071   1.00 25.33 ? 243 ILE B O   1 
ATOM   3693 C CB  . ILE B 1 243 ? 8.878   -21.742 4.318   1.00 20.95 ? 243 ILE B CB  1 
ATOM   3694 C CG1 . ILE B 1 243 ? 10.336  -21.438 4.598   1.00 18.41 ? 243 ILE B CG1 1 
ATOM   3695 C CG2 . ILE B 1 243 ? 8.060   -21.213 5.477   1.00 21.81 ? 243 ILE B CG2 1 
ATOM   3696 C CD1 . ILE B 1 243 ? 10.620  -20.004 5.026   1.00 15.31 ? 243 ILE B CD1 1 
ATOM   3697 N N   . ILE B 1 244 ? 6.581   -23.953 2.922   1.00 26.86 ? 244 ILE B N   1 
ATOM   3698 C CA  . ILE B 1 244 ? 5.180   -24.394 2.919   1.00 29.71 ? 244 ILE B CA  1 
ATOM   3699 C C   . ILE B 1 244 ? 5.128   -25.858 3.422   1.00 31.69 ? 244 ILE B C   1 
ATOM   3700 O O   . ILE B 1 244 ? 4.163   -26.302 4.093   1.00 32.03 ? 244 ILE B O   1 
ATOM   3701 C CB  . ILE B 1 244 ? 4.547   -24.261 1.476   1.00 27.60 ? 244 ILE B CB  1 
ATOM   3702 C CG1 . ILE B 1 244 ? 4.691   -22.827 0.960   1.00 27.23 ? 244 ILE B CG1 1 
ATOM   3703 C CG2 . ILE B 1 244 ? 3.060   -24.563 1.542   1.00 25.15 ? 244 ILE B CG2 1 
ATOM   3704 C CD1 . ILE B 1 244 ? 3.975   -22.441 -0.354  1.00 26.45 ? 244 ILE B CD1 1 
ATOM   3705 N N   . ASN B 1 245 ? 6.222   -26.596 3.136   1.00 31.82 ? 245 ASN B N   1 
ATOM   3706 C CA  . ASN B 1 245 ? 6.373   -27.996 3.508   1.00 30.19 ? 245 ASN B CA  1 
ATOM   3707 C C   . ASN B 1 245 ? 7.290   -28.019 4.727   1.00 31.02 ? 245 ASN B C   1 
ATOM   3708 O O   . ASN B 1 245 ? 8.448   -28.445 4.678   1.00 32.61 ? 245 ASN B O   1 
ATOM   3709 C CB  . ASN B 1 245 ? 6.972   -28.740 2.322   1.00 27.49 ? 245 ASN B CB  1 
ATOM   3710 C CG  . ASN B 1 245 ? 6.041   -28.822 1.118   1.00 29.56 ? 245 ASN B CG  1 
ATOM   3711 O OD1 . ASN B 1 245 ? 5.122   -29.639 0.945   1.00 29.30 ? 245 ASN B OD1 1 
ATOM   3712 N ND2 . ASN B 1 245 ? 6.267   -27.921 0.185   1.00 34.01 ? 245 ASN B ND2 1 
ATOM   3713 N N   . ALA B 1 246 ? 6.801   -27.441 5.824   1.00 31.66 ? 246 ALA B N   1 
ATOM   3714 C CA  . ALA B 1 246 ? 7.612   -27.342 7.008   1.00 34.49 ? 246 ALA B CA  1 
ATOM   3715 C C   . ALA B 1 246 ? 7.147   -28.340 8.061   1.00 38.75 ? 246 ALA B C   1 
ATOM   3716 O O   . ALA B 1 246 ? 7.792   -29.378 8.275   1.00 39.23 ? 246 ALA B O   1 
ATOM   3717 C CB  . ALA B 1 246 ? 7.551   -25.913 7.581   1.00 31.59 ? 246 ALA B CB  1 
ATOM   3718 N N   . LYS B 1 247 ? 6.063   -28.062 8.800   1.00 42.55 ? 247 LYS B N   1 
ATOM   3719 C CA  . LYS B 1 247 ? 5.574   -28.991 9.818   1.00 44.93 ? 247 LYS B CA  1 
ATOM   3720 C C   . LYS B 1 247 ? 4.765   -29.919 8.953   1.00 44.53 ? 247 LYS B C   1 
ATOM   3721 O O   . LYS B 1 247 ? 3.622   -29.571 8.640   1.00 42.30 ? 247 LYS B O   1 
ATOM   3722 C CB  . LYS B 1 247 ? 4.658   -28.281 10.843  1.00 48.48 ? 247 LYS B CB  1 
ATOM   3723 C CG  . LYS B 1 247 ? 4.084   -29.067 12.028  1.00 51.19 ? 247 LYS B CG  1 
ATOM   3724 C CD  . LYS B 1 247 ? 2.628   -29.522 11.902  1.00 52.83 ? 247 LYS B CD  1 
ATOM   3725 C CE  . LYS B 1 247 ? 2.533   -31.045 11.695  1.00 55.70 ? 247 LYS B CE  1 
ATOM   3726 N NZ  . LYS B 1 247 ? 3.099   -31.854 12.773  1.00 55.85 ? 247 LYS B NZ  1 
ATOM   3727 N N   . GLN B 1 248 ? 5.491   -30.978 8.572   1.00 45.68 ? 248 GLN B N   1 
ATOM   3728 C CA  . GLN B 1 248 ? 5.025   -32.058 7.716   1.00 49.72 ? 248 GLN B CA  1 
ATOM   3729 C C   . GLN B 1 248 ? 4.589   -31.427 6.382   1.00 50.00 ? 248 GLN B C   1 
ATOM   3730 O O   . GLN B 1 248 ? 5.409   -30.673 5.856   1.00 51.64 ? 248 GLN B O   1 
ATOM   3731 C CB  . GLN B 1 248 ? 3.883   -32.817 8.479   1.00 54.24 ? 248 GLN B CB  1 
ATOM   3732 C CG  . GLN B 1 248 ? 3.270   -34.101 7.878   1.00 58.70 ? 248 GLN B CG  1 
ATOM   3733 C CD  . GLN B 1 248 ? 2.805   -35.129 8.912   1.00 62.20 ? 248 GLN B CD  1 
ATOM   3734 O OE1 . GLN B 1 248 ? 2.624   -34.864 10.107  1.00 62.48 ? 248 GLN B OE1 1 
ATOM   3735 N NE2 . GLN B 1 248 ? 2.622   -36.378 8.482   1.00 66.36 ? 248 GLN B NE2 1 
ATOM   3736 O OXT . GLN B 1 248 ? 3.480   -31.647 5.876   1.00 48.32 ? 248 GLN B OXT 1 
HETATM 3737 P P   . PGA C 2 .   ? 11.614  -11.229 7.085   1.00 39.80 ? 549 PGA B P   1 
HETATM 3738 O O1P . PGA C 2 .   ? 10.218  -10.377 7.144   1.00 43.02 ? 549 PGA B O1P 1 
HETATM 3739 O O2P . PGA C 2 .   ? 12.337  -10.718 8.307   1.00 39.69 ? 549 PGA B O2P 1 
HETATM 3740 O O3P . PGA C 2 .   ? 12.198  -10.714 5.798   1.00 41.89 ? 549 PGA B O3P 1 
HETATM 3741 O O4P . PGA C 2 .   ? 11.174  -12.666 7.042   1.00 38.82 ? 549 PGA B O4P 1 
HETATM 3742 C C2  . PGA C 2 .   ? 9.123   -10.608 8.037   1.00 46.40 ? 549 PGA B C2  1 
HETATM 3743 C C1  . PGA C 2 .   ? 8.116   -9.801  7.367   1.00 47.47 ? 549 PGA B C1  1 
HETATM 3744 O O1  . PGA C 2 .   ? 8.319   -8.546  6.864   1.00 49.71 ? 549 PGA B O1  1 
HETATM 3745 O O2  . PGA C 2 .   ? 6.833   -10.129 7.080   1.00 46.45 ? 549 PGA B O2  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  TRP 12  12  12  TRP TRP A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  TRP 90  90  90  TRP TRP A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 HIS 100 100 100 HIS HIS A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 TRP 157 157 157 TRP TRP A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 TRP 168 168 168 TRP TRP A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 THR 172 172 172 THR THR A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 THR 177 177 177 THR THR A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 HIS 185 185 185 HIS HIS A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 TRP 191 191 191 TRP TRP A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLN 202 202 202 GLN GLN A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 THR 204 204 204 THR THR A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 TYR 208 208 208 TYR TYR A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 CYS 217 217 217 CYS CYS A . n 
A 1 218 LYS 218 218 218 LYS LYS A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 LYS 237 237 237 LYS LYS A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
B 1 1   ALA 1   1   1   ALA ALA B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   ARG 4   4   4   ARG ARG B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  ASN 11  11  11  ASN ASN B . n 
B 1 12  TRP 12  12  12  TRP TRP B . n 
B 1 13  LYS 13  13  13  LYS LYS B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  ARG 17  17  17  ARG ARG B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  GLN 19  19  19  GLN GLN B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  LEU 21  21  21  LEU LEU B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  THR 27  27  27  THR THR B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ASN 29  29  29  ASN ASN B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  VAL 39  39  39  VAL VAL B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  CYS 41  41  41  CYS CYS B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  PRO 43  43  43  PRO PRO B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  ALA 46  46  46  ALA ALA B . n 
B 1 47  TYR 47  47  47  TYR TYR B . n 
B 1 48  ILE 48  48  48  ILE ILE B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  PRO 57  57  57  PRO PRO B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  ILE 59  59  59  ILE ILE B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  GLN 64  64  64  GLN GLN B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  CYS 66  66  66  CYS CYS B . n 
B 1 67  TYR 67  67  67  TYR TYR B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  THR 70  70  70  THR THR B . n 
B 1 71  ASN 71  71  71  ASN ASN B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  PHE 74  74  74  PHE PHE B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  ILE 78  78  78  ILE ILE B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  MET 82  82  82  MET MET B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  CYS 86  86  86  CYS CYS B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  THR 89  89  89  THR THR B . n 
B 1 90  TRP 90  90  90  TRP TRP B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  GLY 94  94  94  GLY GLY B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 HIS 100 100 100 HIS HIS B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 ASP 106 106 106 ASP ASP B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 GLN 111 111 111 GLN GLN B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 HIS 115 115 115 HIS HIS B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 LEU 121 121 121 LEU LEU B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ILE 124 124 124 ILE ILE B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 CYS 126 126 126 CYS CYS B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 ASP 132 132 132 ASP ASP B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 GLU 145 145 145 GLU GLU B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 ASN 153 153 153 ASN ASN B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 TRP 157 157 157 TRP TRP B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 PRO 166 166 166 PRO PRO B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 TRP 168 168 168 TRP TRP B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ILE 170 170 170 ILE ILE B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 THR 172 172 172 THR THR B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 LYS 174 174 174 LYS LYS B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 THR 177 177 177 THR THR B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 GLN 179 179 179 GLN GLN B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 GLN 182 182 182 GLN GLN B . n 
B 1 183 GLU 183 183 183 GLU GLU B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 HIS 185 185 185 HIS HIS B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 LYS 187 187 187 LYS LYS B . n 
B 1 188 LEU 188 188 188 LEU LEU B . n 
B 1 189 ARG 189 189 189 ARG ARG B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 TRP 191 191 191 TRP TRP B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 LYS 193 193 193 LYS LYS B . n 
B 1 194 SER 194 194 194 SER SER B . n 
B 1 195 ASN 195 195 195 ASN ASN B . n 
B 1 196 VAL 196 196 196 VAL VAL B . n 
B 1 197 SER 197 197 197 SER SER B . n 
B 1 198 ASP 198 198 198 ASP ASP B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 ALA 201 201 201 ALA ALA B . n 
B 1 202 GLN 202 202 202 GLN GLN B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 THR 204 204 204 THR THR B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 TYR 208 208 208 TYR TYR B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 SER 211 211 211 SER SER B . n 
B 1 212 VAL 212 212 212 VAL VAL B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 ALA 215 215 215 ALA ALA B . n 
B 1 216 THR 216 216 216 THR THR B . n 
B 1 217 CYS 217 217 217 CYS CYS B . n 
B 1 218 LYS 218 218 218 LYS LYS B . n 
B 1 219 GLU 219 219 219 GLU GLU B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 SER 222 222 222 SER SER B . n 
B 1 223 GLN 223 223 223 GLN GLN B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 ASP 225 225 225 ASP ASP B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 GLY 228 228 228 GLY GLY B . n 
B 1 229 PHE 229 229 229 PHE PHE B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 ALA 234 234 234 ALA ALA B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 LYS 237 237 237 LYS LYS B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
B 1 246 ALA 246 246 246 ALA ALA B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 GLN 248 248 248 GLN GLN B . n 
# 
_pdbx_nonpoly_scheme.asym_id         C 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          PGA 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     549 
_pdbx_nonpoly_scheme.auth_seq_num    549 
_pdbx_nonpoly_scheme.pdb_mon_id      PGA 
_pdbx_nonpoly_scheme.auth_mon_id     PGA 
_pdbx_nonpoly_scheme.pdb_strand_id   B 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3760  ? 
1 MORE         -23   ? 
1 'SSA (A^2)'  18610 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-01-26 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 115 ? ? CD2 A HIS 115 ? ? 1.299 1.373 -0.074 0.011 N 
2 1 NE2 A HIS 185 ? ? CD2 A HIS 185 ? ? 1.304 1.373 -0.069 0.011 N 
3 1 NE2 B HIS 95  ? ? CD2 B HIS 95  ? ? 1.305 1.373 -0.068 0.011 N 
4 1 NE2 B HIS 115 ? ? CD2 B HIS 115 ? ? 1.299 1.373 -0.074 0.011 N 
5 1 NE2 B HIS 185 ? ? CD2 B HIS 185 ? ? 1.300 1.373 -0.073 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 4   ? ? CZ  A ARG 4   ? ? NH1 A ARG 4   ? ? 123.67 120.30 3.37   0.50 N 
2  1 CD1 A TRP 12  ? ? CG  A TRP 12  ? ? CD2 A TRP 12  ? ? 111.14 106.30 4.84   0.80 N 
3  1 CE2 A TRP 12  ? ? CD2 A TRP 12  ? ? CG  A TRP 12  ? ? 101.56 107.30 -5.74  0.80 N 
4  1 CG  A TRP 12  ? ? CD2 A TRP 12  ? ? CE3 A TRP 12  ? ? 141.18 133.90 7.28   0.90 N 
5  1 NE  A ARG 17  ? ? CZ  A ARG 17  ? ? NH1 A ARG 17  ? ? 125.08 120.30 4.78   0.50 N 
6  1 NE  A ARG 17  ? ? CZ  A ARG 17  ? ? NH2 A ARG 17  ? ? 116.56 120.30 -3.74  0.50 N 
7  1 CG1 A VAL 40  ? ? CB  A VAL 40  ? ? CG2 A VAL 40  ? ? 96.88  110.90 -14.02 1.60 N 
8  1 CA  A CYS 41  ? ? CB  A CYS 41  ? ? SG  A CYS 41  ? ? 99.00  114.00 -15.00 1.80 N 
9  1 CA  A VAL 61  ? ? CB  A VAL 61  ? ? CG1 A VAL 61  ? ? 120.09 110.90 9.19   1.50 N 
10 1 CA  A VAL 61  ? ? CB  A VAL 61  ? ? CG2 A VAL 61  ? ? 96.80  110.90 -14.10 1.50 N 
11 1 CA  A CYS 86  ? ? CB  A CYS 86  ? ? SG  A CYS 86  ? ? 99.47  114.00 -14.53 1.80 N 
12 1 CD1 A TRP 90  ? ? CG  A TRP 90  ? ? CD2 A TRP 90  ? ? 112.79 106.30 6.49   0.80 N 
13 1 CE2 A TRP 90  ? ? CD2 A TRP 90  ? ? CG  A TRP 90  ? ? 101.99 107.30 -5.31  0.80 N 
14 1 NE  A ARG 98  ? ? CZ  A ARG 98  ? ? NH1 A ARG 98  ? ? 124.03 120.30 3.73   0.50 N 
15 1 CG1 A VAL 123 ? ? CB  A VAL 123 ? ? CG2 A VAL 123 ? ? 100.50 110.90 -10.40 1.60 N 
16 1 CA  A THR 139 ? ? CB  A THR 139 ? ? CG2 A THR 139 ? ? 122.13 112.40 9.73   1.40 N 
17 1 CD1 A TRP 157 ? ? CG  A TRP 157 ? ? CD2 A TRP 157 ? ? 111.90 106.30 5.60   0.80 N 
18 1 CE2 A TRP 157 ? ? CD2 A TRP 157 ? ? CG  A TRP 157 ? ? 101.69 107.30 -5.61  0.80 N 
19 1 CD1 A TRP 168 ? ? CG  A TRP 168 ? ? CD2 A TRP 168 ? ? 112.48 106.30 6.18   0.80 N 
20 1 CE2 A TRP 168 ? ? CD2 A TRP 168 ? ? CG  A TRP 168 ? ? 101.72 107.30 -5.58  0.80 N 
21 1 CD1 A TRP 191 ? ? CG  A TRP 191 ? ? CD2 A TRP 191 ? ? 113.59 106.30 7.29   0.80 N 
22 1 CB  A TRP 191 ? ? CG  A TRP 191 ? ? CD1 A TRP 191 ? ? 119.18 127.00 -7.82  1.30 N 
23 1 CE2 A TRP 191 ? ? CD2 A TRP 191 ? ? CG  A TRP 191 ? ? 100.67 107.30 -6.63  0.80 N 
24 1 CA  A VAL 212 ? ? CB  A VAL 212 ? ? CG1 A VAL 212 ? ? 101.61 110.90 -9.29  1.50 N 
25 1 N   A LEU 230 ? ? CA  A LEU 230 ? ? C   A LEU 230 ? ? 94.07  111.00 -16.93 2.70 N 
26 1 CD1 B TRP 12  ? ? CG  B TRP 12  ? ? CD2 B TRP 12  ? ? 111.90 106.30 5.60   0.80 N 
27 1 CE2 B TRP 12  ? ? CD2 B TRP 12  ? ? CG  B TRP 12  ? ? 101.73 107.30 -5.57  0.80 N 
28 1 CA  B CYS 41  ? ? CB  B CYS 41  ? ? SG  B CYS 41  ? ? 121.35 114.20 7.15   1.10 N 
29 1 CB  B LEU 55  ? ? CG  B LEU 55  ? ? CD2 B LEU 55  ? ? 99.49  111.00 -11.51 1.70 N 
30 1 CA  B THR 89  ? ? CB  B THR 89  ? ? CG2 B THR 89  ? ? 102.09 112.40 -10.31 1.40 N 
31 1 CD1 B TRP 90  ? ? CG  B TRP 90  ? ? CD2 B TRP 90  ? ? 113.36 106.30 7.06   0.80 N 
32 1 CE2 B TRP 90  ? ? CD2 B TRP 90  ? ? CG  B TRP 90  ? ? 101.33 107.30 -5.97  0.80 N 
33 1 NE  B ARG 98  ? ? CZ  B ARG 98  ? ? NH1 B ARG 98  ? ? 124.41 120.30 4.11   0.50 N 
34 1 NE  B ARG 98  ? ? CZ  B ARG 98  ? ? NH2 B ARG 98  ? ? 116.65 120.30 -3.65  0.50 N 
35 1 NE  B ARG 134 ? ? CZ  B ARG 134 ? ? NH1 B ARG 134 ? ? 125.48 120.30 5.18   0.50 N 
36 1 NE  B ARG 134 ? ? CZ  B ARG 134 ? ? NH2 B ARG 134 ? ? 115.22 120.30 -5.08  0.50 N 
37 1 CD1 B TRP 157 ? ? CG  B TRP 157 ? ? CD2 B TRP 157 ? ? 111.49 106.30 5.19   0.80 N 
38 1 CE2 B TRP 157 ? ? CD2 B TRP 157 ? ? CG  B TRP 157 ? ? 101.68 107.30 -5.62  0.80 N 
39 1 CD1 B TRP 168 ? ? CG  B TRP 168 ? ? CD2 B TRP 168 ? ? 112.62 106.30 6.32   0.80 N 
40 1 CE2 B TRP 168 ? ? CD2 B TRP 168 ? ? CG  B TRP 168 ? ? 100.87 107.30 -6.43  0.80 N 
41 1 NE  B ARG 189 ? ? CZ  B ARG 189 ? ? NH1 B ARG 189 ? ? 124.99 120.30 4.69   0.50 N 
42 1 NE  B ARG 189 ? ? CZ  B ARG 189 ? ? NH2 B ARG 189 ? ? 115.63 120.30 -4.67  0.50 N 
43 1 CD1 B TRP 191 ? ? CG  B TRP 191 ? ? CD2 B TRP 191 ? ? 112.33 106.30 6.03   0.80 N 
44 1 CE2 B TRP 191 ? ? CD2 B TRP 191 ? ? CG  B TRP 191 ? ? 101.54 107.30 -5.76  0.80 N 
45 1 CA  B CYS 217 ? ? CB  B CYS 217 ? ? SG  B CYS 217 ? ? 128.52 114.20 14.32  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 3   ? ? -117.64 51.35   
2  1 LYS A 13  ? ? 68.48   -138.78 
3  1 MET A 14  ? ? -105.94 79.09   
4  1 THR A 45  ? ? -34.66  -31.37  
5  1 ASP A 152 ? ? -59.10  -0.97   
6  1 TRP A 157 ? ? -64.37  10.95   
7  1 VAL A 196 ? ? -122.71 -71.97  
8  1 SER B 3   ? ? -14.20  128.31  
9  1 ARG B 4   ? ? -44.14  96.84   
10 1 LYS B 13  ? ? 52.76   -151.33 
11 1 PRO B 57  ? ? -42.37  -19.47  
12 1 ALA B 73  ? ? -55.88  60.93   
13 1 SER B 96  ? ? -35.62  -34.16  
14 1 ILE B 138 ? ? -92.82  30.75   
15 1 LYS B 174 ? ? -65.43  92.07   
16 1 VAL B 196 ? ? -112.21 -71.73  
17 1 ALA B 221 ? ? -65.74  10.76   
18 1 ASN B 245 ? ? -102.30 65.03   
19 1 ALA B 246 ? ? -105.81 -78.62  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        '2-PHOSPHOGLYCOLIC ACID' 
_pdbx_entity_nonpoly.comp_id     PGA 
#