data_1HUM
# 
_entry.id   1HUM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HUM         
WWPDB D_1000174031 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1HUN 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HUM 
_pdbx_database_status.recvd_initial_deposition_date   1994-01-31 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Lodi, P.J.'       2 
'Garrett, D.S.'    3 
'Gronenborn, A.M.' 4 
# 
_citation.id                        primary 
_citation.title                     'High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            263 
_citation.page_first                1762 
_citation.page_last                 1767 
_citation.year                      1994 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8134838 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lodi, P.J.'       1 
primary 'Garrett, D.S.'    2 
primary 'Kuszewski, J.'    3 
primary 'Tsang, M.L.'      4 
primary 'Weatherbee, J.A.' 5 
primary 'Leonard, W.J.'    6 
primary 'Gronenborn, A.M.' 7 
primary 'Clore, G.M.'      8 
# 
_cell.entry_id           1HUM 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HUM 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA' 7824.742 2 ? ? ? ? 
2 water   nat water                                          18.015   4 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_seq_one_letter_code_can   APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  PRO n 
1 3  MET n 
1 4  GLY n 
1 5  SER n 
1 6  ASP n 
1 7  PRO n 
1 8  PRO n 
1 9  THR n 
1 10 ALA n 
1 11 CYS n 
1 12 CYS n 
1 13 PHE n 
1 14 SER n 
1 15 TYR n 
1 16 THR n 
1 17 ALA n 
1 18 ARG n 
1 19 LYS n 
1 20 LEU n 
1 21 PRO n 
1 22 ARG n 
1 23 ASN n 
1 24 PHE n 
1 25 VAL n 
1 26 VAL n 
1 27 ASP n 
1 28 TYR n 
1 29 TYR n 
1 30 GLU n 
1 31 THR n 
1 32 SER n 
1 33 SER n 
1 34 LEU n 
1 35 CYS n 
1 36 SER n 
1 37 GLN n 
1 38 PRO n 
1 39 ALA n 
1 40 VAL n 
1 41 VAL n 
1 42 PHE n 
1 43 GLN n 
1 44 THR n 
1 45 LYS n 
1 46 ARG n 
1 47 SER n 
1 48 LYS n 
1 49 GLN n 
1 50 VAL n 
1 51 CYS n 
1 52 ALA n 
1 53 ASP n 
1 54 PRO n 
1 55 SER n 
1 56 GLU n 
1 57 SER n 
1 58 TRP n 
1 59 VAL n 
1 60 GLN n 
1 61 GLU n 
1 62 TYR n 
1 63 VAL n 
1 64 TYR n 
1 65 ASP n 
1 66 LEU n 
1 67 GLU n 
1 68 LEU n 
1 69 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13236 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES
WVQEYVYDLELN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HUM A 1 ? 69 ? P13236 24 ? 92 ? 1 69 
2 1 1HUM B 1 ? 69 ? P13236 24 ? 92 ? 1 69 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_refine.entry_id           1HUM 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            
;RESTRAINED MINIMIZED AVERAGE STRUCTURE OVER 35 FILES
 AVE.RMS DIFF. TO MEAN FOR BACKBONE
    (4-69)= 0.304637 ANGSTROMS
 AVE.RMS DIFF. TO MEAN FOR ALL ORDERED NON-H-ATOMS
    (4-69)= 0.45 ANGSTROMS
 AVE.RMS DIFF. TO MEAN FOR ALL NON-H-ATOMS
    (4-69)= 0.706906 ANGSTROMS

THE 3D STRUCTURE OF THE HMIP-1BETA DIMER IN SOLUTION BY NMR
IS BASED ON 3586 EXPERIMENTAL RESTRAINTS COMPRISING:  3132
STRUCTURE USEFUL INTERPROTON DISTANCE RESTRAINTS OF WHICH
228 ARE INTERSUBUNIT; 24 RESTRAINTS FOR 12 H-BONDS
INVOLVING TIGHTLY BOUND WATER MOLECULES; 108 RESTRAINTS FOR
54 BACKBONE HYDROGEN BONDS INVOLVING SLOWLY EXCHANGING
AMIDE PROTONS; 220 TORSION ANGLE RESTRAINTS (122 PHI, 10
PSI, 80 CHI1 AND 8 CHI2); AND 102 HN-HALPHA THREE-BOND
COUPLING CONSTANTS.  A COMPLETE LIST OF EXPERIMENTAL
RESTRAINTS AND 1H, 13C AND 15N ASSIGNMENTS ARE AVAILABLE
FROM THE PROTEIN DATA BANK AS A SEPARATE ENTRY.

THE STRUCTURES ARE CALCULATED USING THE HYBRID METRIC
MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING
METHOD DESCRIBED BY: NILGES, M., CLORE, G.M. & GRONENBORN,
A.M. (1988) FEBS LETT 229, 317-324.  ALL STRUCTURAL
STATISTICS ARE GIVEN IN THE REFERENCE.

THIS ENTRY CORRESPONDS TO THE RESTRAINED MINIMIZED
AVERAGE STRUCTURE: (SA)R.  THIS IS OBTAINED BY FIRST
AVERAGING THE COORDINATES OF THE INDIVIDUAL 35 DYNAMICAL
SIMULATED ANNEALING SA STRUCTURES BEST FITTED TO RESIDUES
A 4 - A 69 (CHAIN A) AND B 4 - B 69 (CHAIN B), AND
SUBJECTING THE RESULTING COORDINATES TO RESTRAINED
MINIMIZATION.

THE FIELD THAT CONTAINS THE B VALUE IN X-RAY STRUCTURES
(COLUMNS 61 - 66) GIVES THE AVERAGE RMS DIFFERENCE BETWEEN
THE INDIVIDUAL SA STRUCTURES AND THE MEAN STRUCTURE.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1HUM 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_exptl.entry_id          1HUM 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1HUM 
_struct.title                     
'SOLUTION STRUCTURE OF THE CHEMOKINE HMIP-1BETA(SLASH)ACT-2 BY MULTI-DIMENSIONAL NMR: A NOVEL CHEMOKINE DIMER' 
_struct.pdbx_descriptor           'HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA (HMIP-1B) (NMR, MINIMIZED AVERAGE STRUCTURE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HUM 
_struct_keywords.pdbx_keywords   'CYTOKINE(CHEMOTACTIC)' 
_struct_keywords.text            'CYTOKINE(CHEMOTACTIC)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 21 ? VAL A 25 ? PRO A 21 VAL A 25 5 ? 5  
HELX_P HELX_P2 2 GLU A 56 ? ASN A 69 ? GLU A 56 ASN A 69 1 ? 14 
HELX_P HELX_P3 3 PRO B 21 ? VAL B 25 ? PRO B 21 VAL B 25 5 ? 5  
HELX_P HELX_P4 4 GLU B 56 ? ASN B 69 ? GLU B 56 ASN B 69 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 11 A CYS 35 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 12 A CYS 51 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf3 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 35 SG ? ? B CYS 11 B CYS 35 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf4 disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 51 SG ? ? B CYS 12 B CYS 51 1_555 ? ? ? ? ? ? ? 2.022 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 27 ? GLU A 30 ? ASP A 27 GLU A 30 
A 2 VAL A 40 ? GLN A 43 ? VAL A 40 GLN A 43 
A 3 GLN A 49 ? ALA A 52 ? GLN A 49 ALA A 52 
B 1 ASP B 27 ? GLU B 30 ? ASP B 27 GLU B 30 
B 2 VAL B 40 ? GLN B 43 ? VAL B 40 GLN B 43 
B 3 GLN B 49 ? ALA B 52 ? GLN B 49 ALA B 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 29 ? N TYR A 29 O VAL A 41 ? O VAL A 41 
A 2 3 N PHE A 42 ? N PHE A 42 O VAL A 50 ? O VAL A 50 
B 1 2 N TYR B 29 ? N TYR B 29 O VAL B 41 ? O VAL B 41 
B 2 3 N PHE B 42 ? N PHE B 42 O VAL B 50 ? O VAL B 50 
# 
_database_PDB_matrix.entry_id          1HUM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HUM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . ALA A 1 1  ? -9.458  18.076  -12.595 1.00 3.69 ? 1   ALA A N    1 
ATOM   2    C CA   . ALA A 1 1  ? -8.768  16.813  -12.201 1.00 3.21 ? 1   ALA A CA   1 
ATOM   3    C C    . ALA A 1 1  ? -9.023  16.533  -10.712 1.00 2.70 ? 1   ALA A C    1 
ATOM   4    O O    . ALA A 1 1  ? -8.122  16.662  -9.906  1.00 2.72 ? 1   ALA A O    1 
ATOM   5    C CB   . ALA A 1 1  ? -7.262  16.964  -12.438 1.00 3.46 ? 1   ALA A CB   1 
ATOM   6    H H1   . ALA A 1 1  ? -10.118 18.361  -11.844 1.00 3.97 ? 1   ALA A H1   1 
ATOM   7    H H2   . ALA A 1 1  ? -8.753  18.827  -12.736 1.00 4.00 ? 1   ALA A H2   1 
ATOM   8    H H3   . ALA A 1 1  ? -9.984  17.924  -13.481 1.00 3.97 ? 1   ALA A H3   1 
ATOM   9    H HA   . ALA A 1 1  ? -9.141  15.995  -12.796 1.00 3.58 ? 1   ALA A HA   1 
ATOM   10   H HB1  . ALA A 1 1  ? -7.094  17.418  -13.403 1.00 3.62 ? 1   ALA A HB1  1 
ATOM   11   H HB2  . ALA A 1 1  ? -6.837  17.591  -11.667 1.00 3.86 ? 1   ALA A HB2  1 
ATOM   12   H HB3  . ALA A 1 1  ? -6.793  15.992  -12.411 1.00 3.69 ? 1   ALA A HB3  1 
ATOM   13   N N    . PRO A 1 2  ? -10.241 16.165  -10.378 1.00 2.34 ? 2   PRO A N    1 
ATOM   14   C CA   . PRO A 1 2  ? -10.601 15.879  -8.977  1.00 1.97 ? 2   PRO A CA   1 
ATOM   15   C C    . PRO A 1 2  ? -9.754  14.711  -8.452  1.00 1.70 ? 2   PRO A C    1 
ATOM   16   O O    . PRO A 1 2  ? -9.527  13.736  -9.141  1.00 1.73 ? 2   PRO A O    1 
ATOM   17   C CB   . PRO A 1 2  ? -12.107 15.524  -9.015  1.00 1.82 ? 2   PRO A CB   1 
ATOM   18   C CG   . PRO A 1 2  ? -12.585 15.671  -10.490 1.00 2.08 ? 2   PRO A CG   1 
ATOM   19   C CD   . PRO A 1 2  ? -11.347 16.009  -11.349 1.00 2.44 ? 2   PRO A CD   1 
ATOM   20   H HA   . PRO A 1 2  ? -10.441 16.756  -8.368  1.00 2.21 ? 2   PRO A HA   1 
ATOM   21   H HB2  . PRO A 1 2  ? -12.263 14.507  -8.673  1.00 1.58 ? 2   PRO A HB2  1 
ATOM   22   H HB3  . PRO A 1 2  ? -12.665 16.205  -8.385  1.00 2.00 ? 2   PRO A HB3  1 
ATOM   23   H HG2  . PRO A 1 2  ? -13.031 14.742  -10.828 1.00 2.03 ? 2   PRO A HG2  1 
ATOM   24   H HG3  . PRO A 1 2  ? -13.312 16.468  -10.568 1.00 2.26 ? 2   PRO A HG3  1 
ATOM   25   H HD2  . PRO A 1 2  ? -11.136 15.199  -12.034 1.00 2.58 ? 2   PRO A HD2  1 
ATOM   26   H HD3  . PRO A 1 2  ? -11.495 16.931  -11.892 1.00 2.76 ? 2   PRO A HD3  1 
ATOM   27   N N    . MET A 1 3  ? -9.282  14.807  -7.239  1.00 1.58 ? 3   MET A N    1 
ATOM   28   C CA   . MET A 1 3  ? -8.449  13.709  -6.673  1.00 1.46 ? 3   MET A CA   1 
ATOM   29   C C    . MET A 1 3  ? -9.356  12.567  -6.206  1.00 1.12 ? 3   MET A C    1 
ATOM   30   O O    . MET A 1 3  ? -10.512 12.770  -5.891  1.00 0.94 ? 3   MET A O    1 
ATOM   31   C CB   . MET A 1 3  ? -7.642  14.245  -5.483  1.00 1.62 ? 3   MET A CB   1 
ATOM   32   C CG   . MET A 1 3  ? -7.201  15.682  -5.770  1.00 2.03 ? 3   MET A CG   1 
ATOM   33   S SD   . MET A 1 3  ? -6.066  16.233  -4.470  1.00 2.41 ? 3   MET A SD   1 
ATOM   34   C CE   . MET A 1 3  ? -6.554  17.975  -4.457  1.00 3.28 ? 3   MET A CE   1 
ATOM   35   H H    . MET A 1 3  ? -9.473  15.603  -6.701  1.00 1.68 ? 3   MET A H    1 
ATOM   36   H HA   . MET A 1 3  ? -7.773  13.343  -7.431  1.00 1.66 ? 3   MET A HA   1 
ATOM   37   H HB2  . MET A 1 3  ? -8.254  14.231  -4.590  1.00 1.96 ? 3   MET A HB2  1 
ATOM   38   H HB3  . MET A 1 3  ? -6.770  13.628  -5.331  1.00 1.90 ? 3   MET A HB3  1 
ATOM   39   H HG2  . MET A 1 3  ? -6.701  15.722  -6.726  1.00 2.40 ? 3   MET A HG2  1 
ATOM   40   H HG3  . MET A 1 3  ? -8.067  16.326  -5.789  1.00 2.55 ? 3   MET A HG3  1 
ATOM   41   H HE1  . MET A 1 3  ? -6.678  18.322  -5.474  1.00 3.69 ? 3   MET A HE1  1 
ATOM   42   H HE2  . MET A 1 3  ? -7.487  18.086  -3.927  1.00 3.73 ? 3   MET A HE2  1 
ATOM   43   H HE3  . MET A 1 3  ? -5.791  18.559  -3.962  1.00 3.55 ? 3   MET A HE3  1 
ATOM   44   N N    . GLY A 1 4  ? -8.840  11.370  -6.147  1.00 1.11 ? 4   GLY A N    1 
ATOM   45   C CA   . GLY A 1 4  ? -9.676  10.228  -5.687  1.00 0.88 ? 4   GLY A CA   1 
ATOM   46   C C    . GLY A 1 4  ? -10.284 10.580  -4.330  1.00 0.61 ? 4   GLY A C    1 
ATOM   47   O O    . GLY A 1 4  ? -10.082 11.661  -3.815  1.00 0.68 ? 4   GLY A O    1 
ATOM   48   H H    . GLY A 1 4  ? -7.904  11.226  -6.397  1.00 1.32 ? 4   GLY A H    1 
ATOM   49   H HA2  . GLY A 1 4  ? -10.465 10.046  -6.404  1.00 0.83 ? 4   GLY A HA2  1 
ATOM   50   H HA3  . GLY A 1 4  ? -9.064  9.345   -5.588  1.00 1.03 ? 4   GLY A HA3  1 
ATOM   51   N N    . SER A 1 5  ? -11.027 9.684   -3.740  1.00 0.45 ? 5   SER A N    1 
ATOM   52   C CA   . SER A 1 5  ? -11.641 9.989   -2.413  1.00 0.31 ? 5   SER A CA   1 
ATOM   53   C C    . SER A 1 5  ? -10.642 9.639   -1.298  1.00 0.29 ? 5   SER A C    1 
ATOM   54   O O    . SER A 1 5  ? -10.132 10.506  -0.617  1.00 0.32 ? 5   SER A O    1 
ATOM   55   C CB   . SER A 1 5  ? -12.944 9.184   -2.259  1.00 0.51 ? 5   SER A CB   1 
ATOM   56   O OG   . SER A 1 5  ? -14.022 10.084  -2.033  1.00 1.56 ? 5   SER A OG   1 
ATOM   57   H H    . SER A 1 5  ? -11.184 8.815   -4.166  1.00 0.57 ? 5   SER A H    1 
ATOM   58   H HA   . SER A 1 5  ? -11.871 11.042  -2.362  1.00 0.39 ? 5   SER A HA   1 
ATOM   59   H HB2  . SER A 1 5  ? -13.134 8.633   -3.164  1.00 0.87 ? 5   SER A HB2  1 
ATOM   60   H HB3  . SER A 1 5  ? -12.864 8.491   -1.431  1.00 0.94 ? 5   SER A HB3  1 
ATOM   61   H HG   . SER A 1 5  ? -14.416 10.296  -2.883  1.00 2.00 ? 5   SER A HG   1 
ATOM   62   N N    . ASP A 1 6  ? -10.359 8.379   -1.108  1.00 0.25 ? 6   ASP A N    1 
ATOM   63   C CA   . ASP A 1 6  ? -9.394  7.982   -0.038  1.00 0.24 ? 6   ASP A CA   1 
ATOM   64   C C    . ASP A 1 6  ? -8.857  6.565   -0.348  1.00 0.22 ? 6   ASP A C    1 
ATOM   65   O O    . ASP A 1 6  ? -9.209  5.611   0.318   1.00 0.20 ? 6   ASP A O    1 
ATOM   66   C CB   . ASP A 1 6  ? -10.121 8.022   1.337   1.00 0.25 ? 6   ASP A CB   1 
ATOM   67   C CG   . ASP A 1 6  ? -9.590  9.181   2.196   1.00 1.29 ? 6   ASP A CG   1 
ATOM   68   O OD1  . ASP A 1 6  ? -9.244  10.204  1.630   1.00 1.96 ? 6   ASP A OD1  1 
ATOM   69   O OD2  . ASP A 1 6  ? -9.540  9.021   3.405   1.00 2.10 ? 6   ASP A OD2  1 
ATOM   70   H H    . ASP A 1 6  ? -10.779 7.692   -1.671  1.00 0.24 ? 6   ASP A H    1 
ATOM   71   H HA   . ASP A 1 6  ? -8.569  8.679   -0.035  1.00 0.27 ? 6   ASP A HA   1 
ATOM   72   H HB2  . ASP A 1 6  ? -11.177 8.168   1.173   1.00 0.80 ? 6   ASP A HB2  1 
ATOM   73   H HB3  . ASP A 1 6  ? -9.972  7.095   1.872   1.00 0.92 ? 6   ASP A HB3  1 
ATOM   74   N N    . PRO A 1 7  ? -8.025  6.459   -1.362  1.00 0.24 ? 7   PRO A N    1 
ATOM   75   C CA   . PRO A 1 7  ? -7.457  5.156   -1.755  1.00 0.23 ? 7   PRO A CA   1 
ATOM   76   C C    . PRO A 1 7  ? -6.552  4.615   -0.625  1.00 0.22 ? 7   PRO A C    1 
ATOM   77   O O    . PRO A 1 7  ? -6.197  5.352   0.273   1.00 0.22 ? 7   PRO A O    1 
ATOM   78   C CB   . PRO A 1 7  ? -6.638  5.453   -3.037  1.00 0.28 ? 7   PRO A CB   1 
ATOM   79   C CG   . PRO A 1 7  ? -6.784  6.973   -3.345  1.00 0.30 ? 7   PRO A CG   1 
ATOM   80   C CD   . PRO A 1 7  ? -7.596  7.604   -2.193  1.00 0.29 ? 7   PRO A CD   1 
ATOM   81   H HA   . PRO A 1 7  ? -8.256  4.465   -1.972  1.00 0.22 ? 7   PRO A HA   1 
ATOM   82   H HB2  . PRO A 1 7  ? -5.593  5.205   -2.882  1.00 0.28 ? 7   PRO A HB2  1 
ATOM   83   H HB3  . PRO A 1 7  ? -7.024  4.878   -3.865  1.00 0.29 ? 7   PRO A HB3  1 
ATOM   84   H HG2  . PRO A 1 7  ? -5.804  7.432   -3.407  1.00 0.33 ? 7   PRO A HG2  1 
ATOM   85   H HG3  . PRO A 1 7  ? -7.309  7.113   -4.280  1.00 0.33 ? 7   PRO A HG3  1 
ATOM   86   H HD2  . PRO A 1 7  ? -6.968  8.274   -1.619  1.00 0.31 ? 7   PRO A HD2  1 
ATOM   87   H HD3  . PRO A 1 7  ? -8.459  8.131   -2.574  1.00 0.31 ? 7   PRO A HD3  1 
ATOM   88   N N    . PRO A 1 8  ? -6.191  3.348   -0.706  1.00 0.22 ? 8   PRO A N    1 
ATOM   89   C CA   . PRO A 1 8  ? -5.313  2.729   0.309   1.00 0.23 ? 8   PRO A CA   1 
ATOM   90   C C    . PRO A 1 8  ? -3.950  3.440   0.313   1.00 0.24 ? 8   PRO A C    1 
ATOM   91   O O    . PRO A 1 8  ? -3.826  4.562   -0.136  1.00 0.24 ? 8   PRO A O    1 
ATOM   92   C CB   . PRO A 1 8  ? -5.174  1.251   -0.135  1.00 0.25 ? 8   PRO A CB   1 
ATOM   93   C CG   . PRO A 1 8  ? -5.876  1.114   -1.517  1.00 0.26 ? 8   PRO A CG   1 
ATOM   94   C CD   . PRO A 1 8  ? -6.618  2.442   -1.795  1.00 0.25 ? 8   PRO A CD   1 
ATOM   95   H HA   . PRO A 1 8  ? -5.769  2.785   1.285   1.00 0.22 ? 8   PRO A HA   1 
ATOM   96   H HB2  . PRO A 1 8  ? -4.128  0.977   -0.219  1.00 0.26 ? 8   PRO A HB2  1 
ATOM   97   H HB3  . PRO A 1 8  ? -5.660  0.604   0.583   1.00 0.25 ? 8   PRO A HB3  1 
ATOM   98   H HG2  . PRO A 1 8  ? -5.136  0.935   -2.288  1.00 0.29 ? 8   PRO A HG2  1 
ATOM   99   H HG3  . PRO A 1 8  ? -6.584  0.297   -1.496  1.00 0.27 ? 8   PRO A HG3  1 
ATOM   100  H HD2  . PRO A 1 8  ? -6.334  2.845   -2.758  1.00 0.27 ? 8   PRO A HD2  1 
ATOM   101  H HD3  . PRO A 1 8  ? -7.686  2.286   -1.750  1.00 0.24 ? 8   PRO A HD3  1 
ATOM   102  N N    . THR A 1 9  ? -2.927  2.794   0.812   1.00 0.25 ? 9   THR A N    1 
ATOM   103  C CA   . THR A 1 9  ? -1.578  3.432   0.837   1.00 0.26 ? 9   THR A CA   1 
ATOM   104  C C    . THR A 1 9  ? -0.499  2.351   0.866   1.00 0.26 ? 9   THR A C    1 
ATOM   105  O O    . THR A 1 9  ? -0.505  1.473   1.706   1.00 0.27 ? 9   THR A O    1 
ATOM   106  C CB   . THR A 1 9  ? -1.449  4.310   2.081   1.00 0.27 ? 9   THR A CB   1 
ATOM   107  O OG1  . THR A 1 9  ? -2.610  5.118   2.210   1.00 0.26 ? 9   THR A OG1  1 
ATOM   108  C CG2  . THR A 1 9  ? -0.211  5.204   1.956   1.00 0.30 ? 9   THR A CG2  1 
ATOM   109  H H    . THR A 1 9  ? -3.047  1.887   1.167   1.00 0.26 ? 9   THR A H    1 
ATOM   110  H HA   . THR A 1 9  ? -1.447  4.038   -0.048  1.00 0.27 ? 9   THR A HA   1 
ATOM   111  H HB   . THR A 1 9  ? -1.347  3.682   2.953   1.00 0.27 ? 9   THR A HB   1 
ATOM   112  H HG1  . THR A 1 9  ? -2.971  5.262   1.332   1.00 0.96 ? 9   THR A HG1  1 
ATOM   113  H HG21 . THR A 1 9  ? -0.242  5.736   1.016   1.00 1.08 ? 9   THR A HG21 1 
ATOM   114  H HG22 . THR A 1 9  ? -0.195  5.914   2.769   1.00 1.00 ? 9   THR A HG22 1 
ATOM   115  H HG23 . THR A 1 9  ? 0.680   4.595   1.996   1.00 1.09 ? 9   THR A HG23 1 
ATOM   116  N N    . ALA A 1 10 ? 0.426   2.412   -0.049  1.00 0.25 ? 10  ALA A N    1 
ATOM   117  C CA   . ALA A 1 10 ? 1.511   1.396   -0.086  1.00 0.24 ? 10  ALA A CA   1 
ATOM   118  C C    . ALA A 1 10 ? 2.432   1.578   1.123   1.00 0.24 ? 10  ALA A C    1 
ATOM   119  O O    . ALA A 1 10 ? 3.481   2.184   1.028   1.00 0.23 ? 10  ALA A O    1 
ATOM   120  C CB   . ALA A 1 10 ? 2.320   1.574   -1.371  1.00 0.24 ? 10  ALA A CB   1 
ATOM   121  H H    . ALA A 1 10 ? 0.407   3.131   -0.714  1.00 0.24 ? 10  ALA A H    1 
ATOM   122  H HA   . ALA A 1 10 ? 1.082   0.405   -0.065  1.00 0.25 ? 10  ALA A HA   1 
ATOM   123  H HB1  . ALA A 1 10 ? 2.519   2.625   -1.527  1.00 1.04 ? 10  ALA A HB1  1 
ATOM   124  H HB2  . ALA A 1 10 ? 3.254   1.038   -1.288  1.00 1.00 ? 10  ALA A HB2  1 
ATOM   125  H HB3  . ALA A 1 10 ? 1.756   1.187   -2.207  1.00 1.04 ? 10  ALA A HB3  1 
ATOM   126  N N    . CYS A 1 11 ? 2.050   1.045   2.256   1.00 0.24 ? 11  CYS A N    1 
ATOM   127  C CA   . CYS A 1 11 ? 2.898   1.165   3.484   1.00 0.24 ? 11  CYS A CA   1 
ATOM   128  C C    . CYS A 1 11 ? 3.502   -0.206  3.792   1.00 0.23 ? 11  CYS A C    1 
ATOM   129  O O    . CYS A 1 11 ? 2.842   -1.221  3.690   1.00 0.25 ? 11  CYS A O    1 
ATOM   130  C CB   . CYS A 1 11 ? 2.031   1.619   4.663   1.00 0.24 ? 11  CYS A CB   1 
ATOM   131  S SG   . CYS A 1 11 ? 1.145   3.136   4.217   1.00 0.25 ? 11  CYS A SG   1 
ATOM   132  H H    . CYS A 1 11 ? 1.202   0.554   2.299   1.00 0.25 ? 11  CYS A H    1 
ATOM   133  H HA   . CYS A 1 11 ? 3.693   1.882   3.325   1.00 0.23 ? 11  CYS A HA   1 
ATOM   134  H HB2  . CYS A 1 11 ? 1.317   0.844   4.904   1.00 0.26 ? 11  CYS A HB2  1 
ATOM   135  H HB3  . CYS A 1 11 ? 2.660   1.808   5.520   1.00 0.24 ? 11  CYS A HB3  1 
ATOM   136  N N    . CYS A 1 12 ? 4.754   -0.249  4.155   1.00 0.21 ? 12  CYS A N    1 
ATOM   137  C CA   . CYS A 1 12 ? 5.392   -1.561  4.457   1.00 0.21 ? 12  CYS A CA   1 
ATOM   138  C C    . CYS A 1 12 ? 4.870   -2.089  5.793   1.00 0.22 ? 12  CYS A C    1 
ATOM   139  O O    . CYS A 1 12 ? 4.662   -1.344  6.729   1.00 0.25 ? 12  CYS A O    1 
ATOM   140  C CB   . CYS A 1 12 ? 6.912   -1.388  4.535   1.00 0.19 ? 12  CYS A CB   1 
ATOM   141  S SG   . CYS A 1 12 ? 7.548   -0.879  2.919   1.00 0.20 ? 12  CYS A SG   1 
ATOM   142  H H    . CYS A 1 12 ? 5.275   0.578   4.223   1.00 0.20 ? 12  CYS A H    1 
ATOM   143  H HA   . CYS A 1 12 ? 5.151   -2.265  3.674   1.00 0.21 ? 12  CYS A HA   1 
ATOM   144  H HB2  . CYS A 1 12 ? 7.152   -0.635  5.269   1.00 0.21 ? 12  CYS A HB2  1 
ATOM   145  H HB3  . CYS A 1 12 ? 7.366   -2.324  4.821   1.00 0.17 ? 12  CYS A HB3  1 
ATOM   146  N N    . PHE A 1 13 ? 4.667   -3.378  5.890   1.00 0.21 ? 13  PHE A N    1 
ATOM   147  C CA   . PHE A 1 13 ? 4.167   -3.979  7.164   1.00 0.22 ? 13  PHE A CA   1 
ATOM   148  C C    . PHE A 1 13 ? 5.348   -4.620  7.893   1.00 0.20 ? 13  PHE A C    1 
ATOM   149  O O    . PHE A 1 13 ? 5.305   -4.873  9.081   1.00 0.21 ? 13  PHE A O    1 
ATOM   150  C CB   . PHE A 1 13 ? 3.125   -5.054  6.842   1.00 0.24 ? 13  PHE A CB   1 
ATOM   151  C CG   . PHE A 1 13 ? 3.790   -6.197  6.112   1.00 0.24 ? 13  PHE A CG   1 
ATOM   152  C CD1  . PHE A 1 13 ? 4.097   -6.073  4.744   1.00 0.24 ? 13  PHE A CD1  1 
ATOM   153  C CD2  . PHE A 1 13 ? 4.111   -7.382  6.803   1.00 0.26 ? 13  PHE A CD2  1 
ATOM   154  C CE1  . PHE A 1 13 ? 4.724   -7.135  4.066   1.00 0.26 ? 13  PHE A CE1  1 
ATOM   155  C CE2  . PHE A 1 13 ? 4.738   -8.444  6.124   1.00 0.28 ? 13  PHE A CE2  1 
ATOM   156  C CZ   . PHE A 1 13 ? 5.045   -8.320  4.755   1.00 0.28 ? 13  PHE A CZ   1 
ATOM   157  H H    . PHE A 1 13 ? 4.851   -3.956  5.120   1.00 0.20 ? 13  PHE A H    1 
ATOM   158  H HA   . PHE A 1 13 ? 3.722   -3.217  7.788   1.00 0.25 ? 13  PHE A HA   1 
ATOM   159  H HB2  . PHE A 1 13 ? 2.686   -5.417  7.760   1.00 0.25 ? 13  PHE A HB2  1 
ATOM   160  H HB3  . PHE A 1 13 ? 2.351   -4.631  6.218   1.00 0.24 ? 13  PHE A HB3  1 
ATOM   161  H HD1  . PHE A 1 13 ? 3.851   -5.164  4.216   1.00 0.23 ? 13  PHE A HD1  1 
ATOM   162  H HD2  . PHE A 1 13 ? 3.875   -7.476  7.852   1.00 0.27 ? 13  PHE A HD2  1 
ATOM   163  H HE1  . PHE A 1 13 ? 4.958   -7.039  3.016   1.00 0.27 ? 13  PHE A HE1  1 
ATOM   164  H HE2  . PHE A 1 13 ? 4.984   -9.352  6.653   1.00 0.30 ? 13  PHE A HE2  1 
ATOM   165  H HZ   . PHE A 1 13 ? 5.527   -9.134  4.234   1.00 0.30 ? 13  PHE A HZ   1 
ATOM   166  N N    . SER A 1 14 ? 6.407   -4.878  7.176   1.00 0.17 ? 14  SER A N    1 
ATOM   167  C CA   . SER A 1 14 ? 7.610   -5.498  7.792   1.00 0.16 ? 14  SER A CA   1 
ATOM   168  C C    . SER A 1 14 ? 8.830   -5.147  6.942   1.00 0.15 ? 14  SER A C    1 
ATOM   169  O O    . SER A 1 14 ? 8.851   -4.141  6.261   1.00 0.14 ? 14  SER A O    1 
ATOM   170  C CB   . SER A 1 14 ? 7.437   -7.016  7.839   1.00 0.16 ? 14  SER A CB   1 
ATOM   171  O OG   . SER A 1 14 ? 7.257   -7.511  6.518   1.00 0.19 ? 14  SER A OG   1 
ATOM   172  H H    . SER A 1 14 ? 6.409   -4.659  6.220   1.00 0.17 ? 14  SER A H    1 
ATOM   173  H HA   . SER A 1 14 ? 7.743   -5.116  8.794   1.00 0.19 ? 14  SER A HA   1 
ATOM   174  H HB2  . SER A 1 14 ? 8.316   -7.468  8.270   1.00 0.19 ? 14  SER A HB2  1 
ATOM   175  H HB3  . SER A 1 14 ? 6.575   -7.261  8.447   1.00 0.20 ? 14  SER A HB3  1 
ATOM   176  H HG   . SER A 1 14 ? 7.894   -8.214  6.375   1.00 0.86 ? 14  SER A HG   1 
ATOM   177  N N    . TYR A 1 15 ? 9.852   -5.959  6.973   1.00 0.18 ? 15  TYR A N    1 
ATOM   178  C CA   . TYR A 1 15 ? 11.070  -5.656  6.163   1.00 0.19 ? 15  TYR A CA   1 
ATOM   179  C C    . TYR A 1 15 ? 11.804  -6.960  5.852   1.00 0.24 ? 15  TYR A C    1 
ATOM   180  O O    . TYR A 1 15 ? 11.587  -7.969  6.493   1.00 0.30 ? 15  TYR A O    1 
ATOM   181  C CB   . TYR A 1 15 ? 11.994  -4.726  6.958   1.00 0.21 ? 15  TYR A CB   1 
ATOM   182  C CG   . TYR A 1 15 ? 11.165  -3.702  7.695   1.00 0.20 ? 15  TYR A CG   1 
ATOM   183  C CD1  . TYR A 1 15 ? 10.690  -3.987  8.989   1.00 0.23 ? 15  TYR A CD1  1 
ATOM   184  C CD2  . TYR A 1 15 ? 10.862  -2.470  7.088   1.00 0.18 ? 15  TYR A CD2  1 
ATOM   185  C CE1  . TYR A 1 15 ? 9.913   -3.037  9.679   1.00 0.24 ? 15  TYR A CE1  1 
ATOM   186  C CE2  . TYR A 1 15 ? 10.083  -1.520  7.778   1.00 0.20 ? 15  TYR A CE2  1 
ATOM   187  C CZ   . TYR A 1 15 ? 9.609   -1.803  9.073   1.00 0.22 ? 15  TYR A CZ   1 
ATOM   188  O OH   . TYR A 1 15 ? 8.846   -0.870  9.748   1.00 0.26 ? 15  TYR A OH   1 
ATOM   189  H H    . TYR A 1 15 ? 9.821   -6.765  7.529   1.00 0.21 ? 15  TYR A H    1 
ATOM   190  H HA   . TYR A 1 15 ? 10.782  -5.177  5.238   1.00 0.16 ? 15  TYR A HA   1 
ATOM   191  H HB2  . TYR A 1 15 ? 12.567  -5.302  7.672   1.00 0.25 ? 15  TYR A HB2  1 
ATOM   192  H HB3  . TYR A 1 15 ? 12.666  -4.222  6.281   1.00 0.22 ? 15  TYR A HB3  1 
ATOM   193  H HD1  . TYR A 1 15 ? 10.925  -4.933  9.454   1.00 0.26 ? 15  TYR A HD1  1 
ATOM   194  H HD2  . TYR A 1 15 ? 11.225  -2.252  6.094   1.00 0.18 ? 15  TYR A HD2  1 
ATOM   195  H HE1  . TYR A 1 15 ? 9.549   -3.256  10.672  1.00 0.27 ? 15  TYR A HE1  1 
ATOM   196  H HE2  . TYR A 1 15 ? 9.850   -0.574  7.314   1.00 0.21 ? 15  TYR A HE2  1 
ATOM   197  H HH   . TYR A 1 15 ? 9.421   -0.140  9.994   1.00 0.91 ? 15  TYR A HH   1 
ATOM   198  N N    . THR A 1 16 ? 12.681  -6.951  4.883   1.00 0.22 ? 16  THR A N    1 
ATOM   199  C CA   . THR A 1 16 ? 13.428  -8.199  4.563   1.00 0.28 ? 16  THR A CA   1 
ATOM   200  C C    . THR A 1 16 ? 14.224  -8.615  5.805   1.00 0.33 ? 16  THR A C    1 
ATOM   201  O O    . THR A 1 16 ? 13.880  -8.253  6.912   1.00 0.37 ? 16  THR A O    1 
ATOM   202  C CB   . THR A 1 16 ? 14.360  -7.961  3.366   1.00 0.27 ? 16  THR A CB   1 
ATOM   203  O OG1  . THR A 1 16 ? 15.125  -9.131  3.116   1.00 0.36 ? 16  THR A OG1  1 
ATOM   204  C CG2  . THR A 1 16 ? 15.298  -6.788  3.650   1.00 0.26 ? 16  THR A CG2  1 
ATOM   205  H H    . THR A 1 16 ? 12.854  -6.124  4.381   1.00 0.18 ? 16  THR A H    1 
ATOM   206  H HA   . THR A 1 16 ? 12.723  -8.981  4.319   1.00 0.31 ? 16  THR A HA   1 
ATOM   207  H HB   . THR A 1 16 ? 13.766  -7.733  2.494   1.00 0.26 ? 16  THR A HB   1 
ATOM   208  H HG1  . THR A 1 16 ? 15.358  -9.139  2.185   1.00 0.85 ? 16  THR A HG1  1 
ATOM   209  H HG21 . THR A 1 16 ? 14.722  -5.943  3.996   1.00 1.06 ? 16  THR A HG21 1 
ATOM   210  H HG22 . THR A 1 16 ? 16.013  -7.073  4.406   1.00 1.01 ? 16  THR A HG22 1 
ATOM   211  H HG23 . THR A 1 16 ? 15.820  -6.519  2.743   1.00 1.08 ? 16  THR A HG23 1 
ATOM   212  N N    . ALA A 1 17 ? 15.275  -9.376  5.648   1.00 0.38 ? 17  ALA A N    1 
ATOM   213  C CA   . ALA A 1 17 ? 16.066  -9.807  6.843   1.00 0.45 ? 17  ALA A CA   1 
ATOM   214  C C    . ALA A 1 17 ? 17.551  -9.891  6.485   1.00 0.48 ? 17  ALA A C    1 
ATOM   215  O O    . ALA A 1 17 ? 18.371  -10.261 7.301   1.00 0.63 ? 17  ALA A O    1 
ATOM   216  C CB   . ALA A 1 17 ? 15.574  -11.184 7.298   1.00 0.53 ? 17  ALA A CB   1 
ATOM   217  H H    . ALA A 1 17 ? 15.539  -9.670  4.754   1.00 0.41 ? 17  ALA A H    1 
ATOM   218  H HA   . ALA A 1 17 ? 15.936  -9.097  7.649   1.00 0.45 ? 17  ALA A HA   1 
ATOM   219  H HB1  . ALA A 1 17 ? 15.441  -11.821 6.436   1.00 1.15 ? 17  ALA A HB1  1 
ATOM   220  H HB2  . ALA A 1 17 ? 16.299  -11.626 7.965   1.00 1.20 ? 17  ALA A HB2  1 
ATOM   221  H HB3  . ALA A 1 17 ? 14.631  -11.075 7.813   1.00 1.04 ? 17  ALA A HB3  1 
ATOM   222  N N    . ARG A 1 18 ? 17.904  -9.544  5.272   1.00 0.47 ? 18  ARG A N    1 
ATOM   223  C CA   . ARG A 1 18 ? 19.338  -9.601  4.849   1.00 0.48 ? 18  ARG A CA   1 
ATOM   224  C C    . ARG A 1 18 ? 19.671  -8.352  4.029   1.00 0.40 ? 18  ARG A C    1 
ATOM   225  O O    . ARG A 1 18 ? 18.903  -7.928  3.190   1.00 0.36 ? 18  ARG A O    1 
ATOM   226  C CB   . ARG A 1 18 ? 19.557  -10.851 3.989   1.00 0.53 ? 18  ARG A CB   1 
ATOM   227  C CG   . ARG A 1 18 ? 19.562  -12.121 4.886   1.00 0.71 ? 18  ARG A CG   1 
ATOM   228  C CD   . ARG A 1 18 ? 18.855  -13.292 4.189   1.00 1.17 ? 18  ARG A CD   1 
ATOM   229  N NE   . ARG A 1 18 ? 19.754  -13.872 3.151   1.00 1.90 ? 18  ARG A NE   1 
ATOM   230  C CZ   . ARG A 1 18 ? 19.470  -15.026 2.617   1.00 2.49 ? 18  ARG A CZ   1 
ATOM   231  N NH1  . ARG A 1 18 ? 18.372  -15.646 2.953   1.00 2.62 ? 18  ARG A NH1  1 
ATOM   232  N NH2  . ARG A 1 18 ? 20.277  -15.557 1.742   1.00 3.48 ? 18  ARG A NH2  1 
ATOM   233  H H    . ARG A 1 18 ? 17.224  -9.245  4.636   1.00 0.56 ? 18  ARG A H    1 
ATOM   234  H HA   . ARG A 1 18 ? 19.982  -9.646  5.716   1.00 0.53 ? 18  ARG A HA   1 
ATOM   235  H HB2  . ARG A 1 18 ? 18.767  -10.910 3.254   1.00 0.54 ? 18  ARG A HB2  1 
ATOM   236  H HB3  . ARG A 1 18 ? 20.505  -10.767 3.479   1.00 0.55 ? 18  ARG A HB3  1 
ATOM   237  H HG2  . ARG A 1 18 ? 20.583  -12.404 5.100   1.00 1.30 ? 18  ARG A HG2  1 
ATOM   238  H HG3  . ARG A 1 18 ? 19.054  -11.914 5.818   1.00 1.14 ? 18  ARG A HG3  1 
ATOM   239  H HD2  . ARG A 1 18 ? 18.625  -14.050 4.920   1.00 1.80 ? 18  ARG A HD2  1 
ATOM   240  H HD3  . ARG A 1 18 ? 17.938  -12.950 3.733   1.00 1.70 ? 18  ARG A HD3  1 
ATOM   241  H HE   . ARG A 1 18 ? 20.566  -13.394 2.883   1.00 2.45 ? 18  ARG A HE   1 
ATOM   242  H HH11 . ARG A 1 18 ? 17.751  -15.235 3.619   1.00 2.38 ? 18  ARG A HH11 1 
ATOM   243  H HH12 . ARG A 1 18 ? 18.153  -16.531 2.543   1.00 3.35 ? 18  ARG A HH12 1 
ATOM   244  H HH21 . ARG A 1 18 ? 21.115  -15.079 1.480   1.00 3.88 ? 18  ARG A HH21 1 
ATOM   245  H HH22 . ARG A 1 18 ? 20.059  -16.443 1.333   1.00 4.04 ? 18  ARG A HH22 1 
ATOM   246  N N    . LYS A 1 19 ? 20.810  -7.760  4.265   1.00 0.39 ? 19  LYS A N    1 
ATOM   247  C CA   . LYS A 1 19 ? 21.185  -6.540  3.497   1.00 0.34 ? 19  LYS A CA   1 
ATOM   248  C C    . LYS A 1 19 ? 21.355  -6.900  2.022   1.00 0.29 ? 19  LYS A C    1 
ATOM   249  O O    . LYS A 1 19 ? 22.048  -7.833  1.671   1.00 0.31 ? 19  LYS A O    1 
ATOM   250  C CB   . LYS A 1 19 ? 22.503  -5.968  4.052   1.00 0.39 ? 19  LYS A CB   1 
ATOM   251  C CG   . LYS A 1 19 ? 22.936  -4.712  3.256   1.00 0.43 ? 19  LYS A CG   1 
ATOM   252  C CD   . LYS A 1 19 ? 24.458  -4.491  3.338   1.00 0.66 ? 19  LYS A CD   1 
ATOM   253  C CE   . LYS A 1 19 ? 24.979  -4.698  4.770   1.00 0.85 ? 19  LYS A CE   1 
ATOM   254  N NZ   . LYS A 1 19 ? 25.381  -6.125  4.944   1.00 1.74 ? 19  LYS A NZ   1 
ATOM   255  H H    . LYS A 1 19 ? 21.417  -8.117  4.947   1.00 0.44 ? 19  LYS A H    1 
ATOM   256  H HA   . LYS A 1 19 ? 20.403  -5.801  3.597   1.00 0.34 ? 19  LYS A HA   1 
ATOM   257  H HB2  . LYS A 1 19 ? 22.353  -5.702  5.088   1.00 0.49 ? 19  LYS A HB2  1 
ATOM   258  H HB3  . LYS A 1 19 ? 23.269  -6.716  3.989   1.00 0.42 ? 19  LYS A HB3  1 
ATOM   259  H HG2  . LYS A 1 19 ? 22.663  -4.815  2.219   1.00 0.79 ? 19  LYS A HG2  1 
ATOM   260  H HG3  . LYS A 1 19 ? 22.441  -3.855  3.657   1.00 0.76 ? 19  LYS A HG3  1 
ATOM   261  H HD2  . LYS A 1 19 ? 24.952  -5.186  2.678   1.00 1.45 ? 19  LYS A HD2  1 
ATOM   262  H HD3  . LYS A 1 19 ? 24.681  -3.482  3.020   1.00 1.33 ? 19  LYS A HD3  1 
ATOM   263  H HE2  . LYS A 1 19 ? 25.840  -4.064  4.935   1.00 1.24 ? 19  LYS A HE2  1 
ATOM   264  H HE3  . LYS A 1 19 ? 24.213  -4.445  5.486   1.00 1.27 ? 19  LYS A HE3  1 
ATOM   265  H HZ1  . LYS A 1 19 ? 25.341  -6.610  4.024   1.00 2.29 ? 19  LYS A HZ1  1 
ATOM   266  H HZ2  . LYS A 1 19 ? 26.351  -6.170  5.319   1.00 2.09 ? 19  LYS A HZ2  1 
ATOM   267  H HZ3  . LYS A 1 19 ? 24.730  -6.593  5.606   1.00 2.21 ? 19  LYS A HZ3  1 
ATOM   268  N N    . LEU A 1 20 ? 20.742  -6.143  1.156   1.00 0.25 ? 20  LEU A N    1 
ATOM   269  C CA   . LEU A 1 20 ? 20.881  -6.410  -0.297  1.00 0.24 ? 20  LEU A CA   1 
ATOM   270  C C    . LEU A 1 20 ? 22.276  -5.921  -0.743  1.00 0.26 ? 20  LEU A C    1 
ATOM   271  O O    . LEU A 1 20 ? 22.569  -4.755  -0.564  1.00 0.26 ? 20  LEU A O    1 
ATOM   272  C CB   . LEU A 1 20 ? 19.819  -5.615  -1.068  1.00 0.23 ? 20  LEU A CB   1 
ATOM   273  C CG   . LEU A 1 20 ? 18.463  -5.687  -0.360  1.00 0.20 ? 20  LEU A CG   1 
ATOM   274  C CD1  . LEU A 1 20 ? 17.465  -4.827  -1.134  1.00 0.20 ? 20  LEU A CD1  1 
ATOM   275  C CD2  . LEU A 1 20 ? 17.956  -7.132  -0.326  1.00 0.24 ? 20  LEU A CD2  1 
ATOM   276  H H    . LEU A 1 20 ? 20.203  -5.384  1.464   1.00 0.25 ? 20  LEU A H    1 
ATOM   277  H HA   . LEU A 1 20 ? 20.753  -7.459  -0.481  1.00 0.26 ? 20  LEU A HA   1 
ATOM   278  H HB2  . LEU A 1 20 ? 20.123  -4.579  -1.136  1.00 0.23 ? 20  LEU A HB2  1 
ATOM   279  H HB3  . LEU A 1 20 ? 19.724  -6.021  -2.060  1.00 0.25 ? 20  LEU A HB3  1 
ATOM   280  H HG   . LEU A 1 20 ? 18.557  -5.308  0.648   1.00 0.19 ? 20  LEU A HG   1 
ATOM   281  H HD11 . LEU A 1 20 ? 17.862  -3.829  -1.243  1.00 1.02 ? 20  LEU A HD11 1 
ATOM   282  H HD12 . LEU A 1 20 ? 17.304  -5.259  -2.112  1.00 1.05 ? 20  LEU A HD12 1 
ATOM   283  H HD13 . LEU A 1 20 ? 16.530  -4.789  -0.599  1.00 1.02 ? 20  LEU A HD13 1 
ATOM   284  H HD21 . LEU A 1 20 ? 17.962  -7.540  -1.326  1.00 1.08 ? 20  LEU A HD21 1 
ATOM   285  H HD22 . LEU A 1 20 ? 18.594  -7.726  0.311   1.00 1.03 ? 20  LEU A HD22 1 
ATOM   286  H HD23 . LEU A 1 20 ? 16.947  -7.149  0.062   1.00 1.01 ? 20  LEU A HD23 1 
ATOM   287  N N    . PRO A 1 21 ? 23.109  -6.772  -1.313  1.00 0.30 ? 21  PRO A N    1 
ATOM   288  C CA   . PRO A 1 21 ? 24.439  -6.318  -1.754  1.00 0.34 ? 21  PRO A CA   1 
ATOM   289  C C    . PRO A 1 21 ? 24.279  -5.137  -2.711  1.00 0.30 ? 21  PRO A C    1 
ATOM   290  O O    . PRO A 1 21 ? 23.367  -5.100  -3.509  1.00 0.29 ? 21  PRO A O    1 
ATOM   291  C CB   . PRO A 1 21 ? 25.063  -7.535  -2.471  1.00 0.40 ? 21  PRO A CB   1 
ATOM   292  C CG   . PRO A 1 21 ? 24.102  -8.740  -2.259  1.00 0.41 ? 21  PRO A CG   1 
ATOM   293  C CD   . PRO A 1 21 ? 22.830  -8.205  -1.566  1.00 0.34 ? 21  PRO A CD   1 
ATOM   294  H HA   . PRO A 1 21 ? 25.039  -6.034  -0.904  1.00 0.37 ? 21  PRO A HA   1 
ATOM   295  H HB2  . PRO A 1 21 ? 25.172  -7.332  -3.531  1.00 0.40 ? 21  PRO A HB2  1 
ATOM   296  H HB3  . PRO A 1 21 ? 26.028  -7.757  -2.048  1.00 0.45 ? 21  PRO A HB3  1 
ATOM   297  H HG2  . PRO A 1 21 ? 23.848  -9.182  -3.215  1.00 0.44 ? 21  PRO A HG2  1 
ATOM   298  H HG3  . PRO A 1 21 ? 24.573  -9.484  -1.630  1.00 0.46 ? 21  PRO A HG3  1 
ATOM   299  H HD2  . PRO A 1 21 ? 21.972  -8.314  -2.220  1.00 0.33 ? 21  PRO A HD2  1 
ATOM   300  H HD3  . PRO A 1 21 ? 22.662  -8.722  -0.632  1.00 0.34 ? 21  PRO A HD3  1 
ATOM   301  N N    . ARG A 1 22 ? 25.164  -4.181  -2.654  1.00 0.31 ? 22  ARG A N    1 
ATOM   302  C CA   . ARG A 1 22 ? 25.060  -3.021  -3.584  1.00 0.30 ? 22  ARG A CA   1 
ATOM   303  C C    . ARG A 1 22 ? 24.883  -3.563  -5.004  1.00 0.32 ? 22  ARG A C    1 
ATOM   304  O O    . ARG A 1 22 ? 24.272  -2.947  -5.855  1.00 0.32 ? 22  ARG A O    1 
ATOM   305  C CB   . ARG A 1 22 ? 26.342  -2.189  -3.498  1.00 0.34 ? 22  ARG A CB   1 
ATOM   306  C CG   . ARG A 1 22 ? 26.134  -0.822  -4.162  1.00 0.59 ? 22  ARG A CG   1 
ATOM   307  C CD   . ARG A 1 22 ? 27.328  0.085   -3.844  1.00 1.27 ? 22  ARG A CD   1 
ATOM   308  N NE   . ARG A 1 22 ? 26.988  1.511   -4.161  1.00 1.33 ? 22  ARG A NE   1 
ATOM   309  C CZ   . ARG A 1 22 ? 26.601  1.874   -5.356  1.00 2.02 ? 22  ARG A CZ   1 
ATOM   310  N NH1  . ARG A 1 22 ? 26.667  1.038   -6.357  1.00 2.86 ? 22  ARG A NH1  1 
ATOM   311  N NH2  . ARG A 1 22 ? 26.200  3.100   -5.562  1.00 2.33 ? 22  ARG A NH2  1 
ATOM   312  H H    . ARG A 1 22 ? 25.903  -4.234  -2.012  1.00 0.34 ? 22  ARG A H    1 
ATOM   313  H HA   . ARG A 1 22 ? 24.208  -2.415  -3.316  1.00 0.28 ? 22  ARG A HA   1 
ATOM   314  H HB2  . ARG A 1 22 ? 26.604  -2.049  -2.459  1.00 0.47 ? 22  ARG A HB2  1 
ATOM   315  H HB3  . ARG A 1 22 ? 27.143  -2.710  -4.001  1.00 0.45 ? 22  ARG A HB3  1 
ATOM   316  H HG2  . ARG A 1 22 ? 26.047  -0.957  -5.228  1.00 1.25 ? 22  ARG A HG2  1 
ATOM   317  H HG3  . ARG A 1 22 ? 25.229  -0.369  -3.782  1.00 1.20 ? 22  ARG A HG3  1 
ATOM   318  H HD2  . ARG A 1 22 ? 27.546  0.035   -2.794  1.00 1.90 ? 22  ARG A HD2  1 
ATOM   319  H HD3  . ARG A 1 22 ? 28.198  -0.258  -4.401  1.00 1.96 ? 22  ARG A HD3  1 
ATOM   320  H HE   . ARG A 1 22 ? 27.011  2.178   -3.443  1.00 1.48 ? 22  ARG A HE   1 
ATOM   321  H HH11 . ARG A 1 22 ? 27.017  0.113   -6.216  1.00 2.91 ? 22  ARG A HH11 1 
ATOM   322  H HH12 . ARG A 1 22 ? 26.367  1.323   -7.268  1.00 3.63 ? 22  ARG A HH12 1 
ATOM   323  H HH21 . ARG A 1 22 ? 26.189  3.756   -4.807  1.00 2.20 ? 22  ARG A HH21 1 
ATOM   324  H HH22 . ARG A 1 22 ? 25.906  3.383   -6.475  1.00 2.99 ? 22  ARG A HH22 1 
ATOM   325  N N    . ASN A 1 23 ? 25.419  -4.729  -5.248  1.00 0.34 ? 23  ASN A N    1 
ATOM   326  C CA   . ASN A 1 23 ? 25.304  -5.358  -6.594  1.00 0.38 ? 23  ASN A CA   1 
ATOM   327  C C    . ASN A 1 23 ? 23.868  -5.870  -6.797  1.00 0.36 ? 23  ASN A C    1 
ATOM   328  O O    . ASN A 1 23 ? 23.595  -6.637  -7.699  1.00 0.39 ? 23  ASN A O    1 
ATOM   329  C CB   . ASN A 1 23 ? 26.307  -6.531  -6.673  1.00 0.43 ? 23  ASN A CB   1 
ATOM   330  C CG   . ASN A 1 23 ? 26.872  -6.686  -8.092  1.00 1.47 ? 23  ASN A CG   1 
ATOM   331  O OD1  . ASN A 1 23 ? 26.699  -5.824  -8.935  1.00 2.11 ? 23  ASN A OD1  1 
ATOM   332  N ND2  . ASN A 1 23 ? 27.550  -7.759  -8.390  1.00 2.42 ? 23  ASN A ND2  1 
ATOM   333  H H    . ASN A 1 23 ? 25.900  -5.200  -4.534  1.00 0.35 ? 23  ASN A H    1 
ATOM   334  H HA   . ASN A 1 23 ? 25.534  -4.621  -7.348  1.00 0.39 ? 23  ASN A HA   1 
ATOM   335  H HB2  . ASN A 1 23 ? 27.123  -6.340  -5.990  1.00 1.10 ? 23  ASN A HB2  1 
ATOM   336  H HB3  . ASN A 1 23 ? 25.818  -7.451  -6.384  1.00 0.99 ? 23  ASN A HB3  1 
ATOM   337  H HD21 . ASN A 1 23 ? 27.691  -8.452  -7.711  1.00 2.64 ? 23  ASN A HD21 1 
ATOM   338  H HD22 . ASN A 1 23 ? 27.921  -7.871  -9.290  1.00 3.21 ? 23  ASN A HD22 1 
ATOM   339  N N    . PHE A 1 24 ? 22.955  -5.460  -5.953  1.00 0.33 ? 24  PHE A N    1 
ATOM   340  C CA   . PHE A 1 24 ? 21.537  -5.931  -6.073  1.00 0.32 ? 24  PHE A CA   1 
ATOM   341  C C    . PHE A 1 24 ? 20.598  -4.757  -5.775  1.00 0.28 ? 24  PHE A C    1 
ATOM   342  O O    . PHE A 1 24 ? 19.493  -4.937  -5.303  1.00 0.27 ? 24  PHE A O    1 
ATOM   343  C CB   . PHE A 1 24 ? 21.304  -7.058  -5.049  1.00 0.31 ? 24  PHE A CB   1 
ATOM   344  C CG   . PHE A 1 24 ? 20.123  -7.924  -5.449  1.00 0.33 ? 24  PHE A CG   1 
ATOM   345  C CD1  . PHE A 1 24 ? 20.132  -8.615  -6.680  1.00 0.36 ? 24  PHE A CD1  1 
ATOM   346  C CD2  . PHE A 1 24 ? 19.017  -8.054  -4.582  1.00 0.32 ? 24  PHE A CD2  1 
ATOM   347  C CE1  . PHE A 1 24 ? 19.040  -9.429  -7.038  1.00 0.39 ? 24  PHE A CE1  1 
ATOM   348  C CE2  . PHE A 1 24 ? 17.926  -8.866  -4.944  1.00 0.34 ? 24  PHE A CE2  1 
ATOM   349  C CZ   . PHE A 1 24 ? 17.937  -9.552  -6.170  1.00 0.38 ? 24  PHE A CZ   1 
ATOM   350  H H    . PHE A 1 24 ? 23.206  -4.853  -5.228  1.00 0.31 ? 24  PHE A H    1 
ATOM   351  H HA   . PHE A 1 24 ? 21.349  -6.293  -7.074  1.00 0.34 ? 24  PHE A HA   1 
ATOM   352  H HB2  . PHE A 1 24 ? 22.187  -7.674  -4.992  1.00 0.33 ? 24  PHE A HB2  1 
ATOM   353  H HB3  . PHE A 1 24 ? 21.116  -6.624  -4.074  1.00 0.29 ? 24  PHE A HB3  1 
ATOM   354  H HD1  . PHE A 1 24 ? 20.975  -8.526  -7.348  1.00 0.38 ? 24  PHE A HD1  1 
ATOM   355  H HD2  . PHE A 1 24 ? 19.004  -7.530  -3.642  1.00 0.30 ? 24  PHE A HD2  1 
ATOM   356  H HE1  . PHE A 1 24 ? 19.048  -9.956  -7.979  1.00 0.42 ? 24  PHE A HE1  1 
ATOM   357  H HE2  . PHE A 1 24 ? 17.082  -8.963  -4.279  1.00 0.34 ? 24  PHE A HE2  1 
ATOM   358  H HZ   . PHE A 1 24 ? 17.100  -10.174 -6.443  1.00 0.41 ? 24  PHE A HZ   1 
ATOM   359  N N    . VAL A 1 25 ? 21.036  -3.553  -6.044  1.00 0.28 ? 25  VAL A N    1 
ATOM   360  C CA   . VAL A 1 25 ? 20.182  -2.357  -5.772  1.00 0.26 ? 25  VAL A CA   1 
ATOM   361  C C    . VAL A 1 25 ? 20.483  -1.271  -6.808  1.00 0.29 ? 25  VAL A C    1 
ATOM   362  O O    . VAL A 1 25 ? 21.402  -0.490  -6.654  1.00 0.30 ? 25  VAL A O    1 
ATOM   363  C CB   . VAL A 1 25 ? 20.496  -1.818  -4.368  1.00 0.23 ? 25  VAL A CB   1 
ATOM   364  C CG1  . VAL A 1 25 ? 19.530  -0.658  -4.004  1.00 0.21 ? 25  VAL A CG1  1 
ATOM   365  C CG2  . VAL A 1 25 ? 20.357  -2.960  -3.349  1.00 0.21 ? 25  VAL A CG2  1 
ATOM   366  H H    . VAL A 1 25 ? 21.931  -3.434  -6.421  1.00 0.30 ? 25  VAL A H    1 
ATOM   367  H HA   . VAL A 1 25 ? 19.138  -2.628  -5.828  1.00 0.26 ? 25  VAL A HA   1 
ATOM   368  H HB   . VAL A 1 25 ? 21.516  -1.454  -4.354  1.00 0.25 ? 25  VAL A HB   1 
ATOM   369  H HG11 . VAL A 1 25 ? 18.953  -0.364  -4.871  1.00 1.05 ? 25  VAL A HG11 1 
ATOM   370  H HG12 . VAL A 1 25 ? 18.855  -0.970  -3.224  1.00 1.01 ? 25  VAL A HG12 1 
ATOM   371  H HG13 . VAL A 1 25 ? 20.100  0.191   -3.655  1.00 1.04 ? 25  VAL A HG13 1 
ATOM   372  H HG21 . VAL A 1 25 ? 19.410  -3.458  -3.493  1.00 1.07 ? 25  VAL A HG21 1 
ATOM   373  H HG22 . VAL A 1 25 ? 21.161  -3.667  -3.486  1.00 1.02 ? 25  VAL A HG22 1 
ATOM   374  H HG23 . VAL A 1 25 ? 20.402  -2.556  -2.349  1.00 1.02 ? 25  VAL A HG23 1 
ATOM   375  N N    . VAL A 1 26 ? 19.717  -1.217  -7.867  1.00 0.31 ? 26  VAL A N    1 
ATOM   376  C CA   . VAL A 1 26 ? 19.955  -0.186  -8.920  1.00 0.35 ? 26  VAL A CA   1 
ATOM   377  C C    . VAL A 1 26 ? 19.166  1.080   -8.594  1.00 0.34 ? 26  VAL A C    1 
ATOM   378  O O    . VAL A 1 26 ? 19.372  2.118   -9.191  1.00 0.36 ? 26  VAL A O    1 
ATOM   379  C CB   . VAL A 1 26 ? 19.489  -0.729  -10.271 1.00 0.39 ? 26  VAL A CB   1 
ATOM   380  C CG1  . VAL A 1 26 ? 20.340  -1.941  -10.655 1.00 0.85 ? 26  VAL A CG1  1 
ATOM   381  C CG2  . VAL A 1 26 ? 18.016  -1.143  -10.180 1.00 0.66 ? 26  VAL A CG2  1 
ATOM   382  H H    . VAL A 1 26 ? 18.985  -1.857  -7.973  1.00 0.31 ? 26  VAL A H    1 
ATOM   383  H HA   . VAL A 1 26 ? 21.008  0.048   -8.971  1.00 0.36 ? 26  VAL A HA   1 
ATOM   384  H HB   . VAL A 1 26 ? 19.601  0.037   -11.020 1.00 0.62 ? 26  VAL A HB   1 
ATOM   385  H HG11 . VAL A 1 26 ? 20.476  -2.572  -9.791  1.00 1.39 ? 26  VAL A HG11 1 
ATOM   386  H HG12 . VAL A 1 26 ? 19.843  -2.500  -11.435 1.00 1.40 ? 26  VAL A HG12 1 
ATOM   387  H HG13 . VAL A 1 26 ? 21.302  -1.605  -11.010 1.00 1.45 ? 26  VAL A HG13 1 
ATOM   388  H HG21 . VAL A 1 26 ? 17.894  -1.871  -9.392  1.00 1.23 ? 26  VAL A HG21 1 
ATOM   389  H HG22 . VAL A 1 26 ? 17.411  -0.275  -9.965  1.00 1.26 ? 26  VAL A HG22 1 
ATOM   390  H HG23 . VAL A 1 26 ? 17.705  -1.575  -11.120 1.00 1.34 ? 26  VAL A HG23 1 
ATOM   391  N N    . ASP A 1 27 ? 18.260  1.010   -7.660  1.00 0.31 ? 27  ASP A N    1 
ATOM   392  C CA   . ASP A 1 27 ? 17.463  2.219   -7.320  1.00 0.30 ? 27  ASP A CA   1 
ATOM   393  C C    . ASP A 1 27 ? 16.663  1.960   -6.049  1.00 0.26 ? 27  ASP A C    1 
ATOM   394  O O    . ASP A 1 27 ? 16.821  0.945   -5.400  1.00 0.24 ? 27  ASP A O    1 
ATOM   395  C CB   . ASP A 1 27 ? 16.498  2.529   -8.467  1.00 0.34 ? 27  ASP A CB   1 
ATOM   396  C CG   . ASP A 1 27 ? 15.932  3.938   -8.291  1.00 0.34 ? 27  ASP A CG   1 
ATOM   397  O OD1  . ASP A 1 27 ? 16.703  4.831   -7.980  1.00 1.02 ? 27  ASP A OD1  1 
ATOM   398  O OD2  . ASP A 1 27 ? 14.736  4.102   -8.470  1.00 1.06 ? 27  ASP A OD2  1 
ATOM   399  H H    . ASP A 1 27 ? 18.097  0.162   -7.189  1.00 0.29 ? 27  ASP A H    1 
ATOM   400  H HA   . ASP A 1 27 ? 18.124  3.059   -7.167  1.00 0.30 ? 27  ASP A HA   1 
ATOM   401  H HB2  . ASP A 1 27 ? 17.026  2.467   -9.407  1.00 0.37 ? 27  ASP A HB2  1 
ATOM   402  H HB3  . ASP A 1 27 ? 15.687  1.813   -8.462  1.00 0.34 ? 27  ASP A HB3  1 
ATOM   403  N N    . TYR A 1 28 ? 15.801  2.869   -5.687  1.00 0.26 ? 28  TYR A N    1 
ATOM   404  C CA   . TYR A 1 28 ? 14.989  2.668   -4.460  1.00 0.22 ? 28  TYR A CA   1 
ATOM   405  C C    . TYR A 1 28 ? 13.715  3.503   -4.533  1.00 0.24 ? 28  TYR A C    1 
ATOM   406  O O    . TYR A 1 28 ? 13.435  4.162   -5.514  1.00 0.28 ? 28  TYR A O    1 
ATOM   407  C CB   . TYR A 1 28 ? 15.802  3.053   -3.219  1.00 0.19 ? 28  TYR A CB   1 
ATOM   408  C CG   . TYR A 1 28 ? 15.929  4.559   -3.099  1.00 0.20 ? 28  TYR A CG   1 
ATOM   409  C CD1  . TYR A 1 28 ? 16.606  5.294   -4.093  1.00 0.24 ? 28  TYR A CD1  1 
ATOM   410  C CD2  . TYR A 1 28 ? 15.386  5.224   -1.981  1.00 0.19 ? 28  TYR A CD2  1 
ATOM   411  C CE1  . TYR A 1 28 ? 16.735  6.690   -3.971  1.00 0.26 ? 28  TYR A CE1  1 
ATOM   412  C CE2  . TYR A 1 28 ? 15.517  6.618   -1.856  1.00 0.22 ? 28  TYR A CE2  1 
ATOM   413  C CZ   . TYR A 1 28 ? 16.192  7.354   -2.851  1.00 0.25 ? 28  TYR A CZ   1 
ATOM   414  O OH   . TYR A 1 28 ? 16.322  8.723   -2.731  1.00 0.28 ? 28  TYR A OH   1 
ATOM   415  H H    . TYR A 1 28 ? 15.686  3.680   -6.226  1.00 0.28 ? 28  TYR A H    1 
ATOM   416  H HA   . TYR A 1 28 ? 14.714  1.625   -4.386  1.00 0.21 ? 28  TYR A HA   1 
ATOM   417  H HB2  . TYR A 1 28 ? 15.311  2.662   -2.340  1.00 0.16 ? 28  TYR A HB2  1 
ATOM   418  H HB3  . TYR A 1 28 ? 16.784  2.619   -3.294  1.00 0.19 ? 28  TYR A HB3  1 
ATOM   419  H HD1  . TYR A 1 28 ? 17.019  4.791   -4.952  1.00 0.26 ? 28  TYR A HD1  1 
ATOM   420  H HD2  . TYR A 1 28 ? 14.867  4.662   -1.220  1.00 0.17 ? 28  TYR A HD2  1 
ATOM   421  H HE1  . TYR A 1 28 ? 17.256  7.250   -4.733  1.00 0.29 ? 28  TYR A HE1  1 
ATOM   422  H HE2  . TYR A 1 28 ? 15.098  7.124   -0.996  1.00 0.23 ? 28  TYR A HE2  1 
ATOM   423  H HH   . TYR A 1 28 ? 16.115  9.117   -3.582  1.00 1.00 ? 28  TYR A HH   1 
ATOM   424  N N    . TYR A 1 29 ? 12.940  3.457   -3.496  1.00 0.21 ? 29  TYR A N    1 
ATOM   425  C CA   . TYR A 1 29 ? 11.666  4.214   -3.465  1.00 0.24 ? 29  TYR A CA   1 
ATOM   426  C C    . TYR A 1 29 ? 11.236  4.358   -2.001  1.00 0.21 ? 29  TYR A C    1 
ATOM   427  O O    . TYR A 1 29 ? 11.416  3.458   -1.211  1.00 0.21 ? 29  TYR A O    1 
ATOM   428  C CB   . TYR A 1 29 ? 10.625  3.421   -4.275  1.00 0.27 ? 29  TYR A CB   1 
ATOM   429  C CG   . TYR A 1 29 ? 9.220   3.843   -3.906  1.00 0.29 ? 29  TYR A CG   1 
ATOM   430  C CD1  . TYR A 1 29 ? 8.772   5.135   -4.227  1.00 0.35 ? 29  TYR A CD1  1 
ATOM   431  C CD2  . TYR A 1 29 ? 8.364   2.941   -3.244  1.00 0.32 ? 29  TYR A CD2  1 
ATOM   432  C CE1  . TYR A 1 29 ? 7.464   5.531   -3.885  1.00 0.37 ? 29  TYR A CE1  1 
ATOM   433  C CE2  . TYR A 1 29 ? 7.056   3.335   -2.902  1.00 0.34 ? 29  TYR A CE2  1 
ATOM   434  C CZ   . TYR A 1 29 ? 6.606   4.631   -3.222  1.00 0.33 ? 29  TYR A CZ   1 
ATOM   435  O OH   . TYR A 1 29 ? 5.323   5.017   -2.886  1.00 0.36 ? 29  TYR A OH   1 
ATOM   436  H H    . TYR A 1 29 ? 13.197  2.912   -2.729  1.00 0.18 ? 29  TYR A H    1 
ATOM   437  H HA   . TYR A 1 29 ? 11.809  5.190   -3.905  1.00 0.26 ? 29  TYR A HA   1 
ATOM   438  H HB2  . TYR A 1 29 ? 10.782  3.604   -5.328  1.00 0.30 ? 29  TYR A HB2  1 
ATOM   439  H HB3  . TYR A 1 29 ? 10.748  2.367   -4.076  1.00 0.25 ? 29  TYR A HB3  1 
ATOM   440  H HD1  . TYR A 1 29 ? 9.432   5.822   -4.736  1.00 0.43 ? 29  TYR A HD1  1 
ATOM   441  H HD2  . TYR A 1 29 ? 8.711   1.945   -3.002  1.00 0.38 ? 29  TYR A HD2  1 
ATOM   442  H HE1  . TYR A 1 29 ? 7.120   6.525   -4.131  1.00 0.46 ? 29  TYR A HE1  1 
ATOM   443  H HE2  . TYR A 1 29 ? 6.400   2.643   -2.394  1.00 0.41 ? 29  TYR A HE2  1 
ATOM   444  H HH   . TYR A 1 29 ? 4.712   4.378   -3.262  1.00 0.98 ? 29  TYR A HH   1 
ATOM   445  N N    . GLU A 1 30 ? 10.680  5.479   -1.627  1.00 0.21 ? 30  GLU A N    1 
ATOM   446  C CA   . GLU A 1 30 ? 10.247  5.663   -0.205  1.00 0.19 ? 30  GLU A CA   1 
ATOM   447  C C    . GLU A 1 30 ? 8.743   5.393   -0.098  1.00 0.19 ? 30  GLU A C    1 
ATOM   448  O O    . GLU A 1 30 ? 8.009   5.526   -1.057  1.00 0.21 ? 30  GLU A O    1 
ATOM   449  C CB   . GLU A 1 30 ? 10.548  7.097   0.237   1.00 0.20 ? 30  GLU A CB   1 
ATOM   450  C CG   . GLU A 1 30 ? 12.045  7.244   0.520   1.00 0.22 ? 30  GLU A CG   1 
ATOM   451  C CD   . GLU A 1 30 ? 12.409  8.727   0.597   1.00 0.77 ? 30  GLU A CD   1 
ATOM   452  O OE1  . GLU A 1 30 ? 11.510  9.545   0.489   1.00 1.41 ? 30  GLU A OE1  1 
ATOM   453  O OE2  . GLU A 1 30 ? 13.582  9.022   0.762   1.00 1.53 ? 30  GLU A OE2  1 
ATOM   454  H H    . GLU A 1 30 ? 10.545  6.200   -2.276  1.00 0.23 ? 30  GLU A H    1 
ATOM   455  H HA   . GLU A 1 30 ? 10.782  4.972   0.438   1.00 0.16 ? 30  GLU A HA   1 
ATOM   456  H HB2  . GLU A 1 30 ? 10.262  7.778   -0.546  1.00 0.25 ? 30  GLU A HB2  1 
ATOM   457  H HB3  . GLU A 1 30 ? 9.990   7.323   1.134   1.00 0.23 ? 30  GLU A HB3  1 
ATOM   458  H HG2  . GLU A 1 30 ? 12.282  6.765   1.459   1.00 0.59 ? 30  GLU A HG2  1 
ATOM   459  H HG3  . GLU A 1 30 ? 12.609  6.778   -0.274  1.00 0.41 ? 30  GLU A HG3  1 
ATOM   460  N N    . THR A 1 31 ? 8.280   5.007   1.060   1.00 0.18 ? 31  THR A N    1 
ATOM   461  C CA   . THR A 1 31 ? 6.825   4.717   1.228   1.00 0.19 ? 31  THR A CA   1 
ATOM   462  C C    . THR A 1 31 ? 6.024   6.019   1.216   1.00 0.20 ? 31  THR A C    1 
ATOM   463  O O    . THR A 1 31 ? 6.524   7.069   0.866   1.00 0.22 ? 31  THR A O    1 
ATOM   464  C CB   . THR A 1 31 ? 6.603   4.010   2.568   1.00 0.19 ? 31  THR A CB   1 
ATOM   465  O OG1  . THR A 1 31 ? 7.272   4.736   3.583   1.00 0.20 ? 31  THR A OG1  1 
ATOM   466  C CG2  . THR A 1 31 ? 7.154   2.583   2.497   1.00 0.19 ? 31  THR A CG2  1 
ATOM   467  H H    . THR A 1 31 ? 8.893   4.898   1.818   1.00 0.17 ? 31  THR A H    1 
ATOM   468  H HA   . THR A 1 31 ? 6.488   4.082   0.424   1.00 0.20 ? 31  THR A HA   1 
ATOM   469  H HB   . THR A 1 31 ? 5.548   3.975   2.796   1.00 0.20 ? 31  THR A HB   1 
ATOM   470  H HG1  . THR A 1 31 ? 7.427   5.626   3.258   1.00 0.73 ? 31  THR A HG1  1 
ATOM   471  H HG21 . THR A 1 31 ? 6.823   2.110   1.584   1.00 1.03 ? 31  THR A HG21 1 
ATOM   472  H HG22 . THR A 1 31 ? 8.233   2.612   2.516   1.00 1.02 ? 31  THR A HG22 1 
ATOM   473  H HG23 . THR A 1 31 ? 6.796   2.018   3.343   1.00 1.03 ? 31  THR A HG23 1 
ATOM   474  N N    . SER A 1 32 ? 4.778   5.949   1.599   1.00 0.21 ? 32  SER A N    1 
ATOM   475  C CA   . SER A 1 32 ? 3.925   7.169   1.617   1.00 0.23 ? 32  SER A CA   1 
ATOM   476  C C    . SER A 1 32 ? 4.157   7.935   2.923   1.00 0.23 ? 32  SER A C    1 
ATOM   477  O O    . SER A 1 32 ? 5.244   7.946   3.466   1.00 0.25 ? 32  SER A O    1 
ATOM   478  C CB   . SER A 1 32 ? 2.451   6.755   1.500   1.00 0.24 ? 32  SER A CB   1 
ATOM   479  O OG   . SER A 1 32 ? 1.735   7.767   0.806   1.00 1.21 ? 32  SER A OG   1 
ATOM   480  H H    . SER A 1 32 ? 4.400   5.089   1.877   1.00 0.22 ? 32  SER A H    1 
ATOM   481  H HA   . SER A 1 32 ? 4.181   7.803   0.783   1.00 0.23 ? 32  SER A HA   1 
ATOM   482  H HB2  . SER A 1 32 ? 2.381   5.833   0.948   1.00 0.88 ? 32  SER A HB2  1 
ATOM   483  H HB3  . SER A 1 32 ? 2.026   6.610   2.487   1.00 0.83 ? 32  SER A HB3  1 
ATOM   484  H HG   . SER A 1 32 ? 1.887   7.646   -0.135  1.00 1.61 ? 32  SER A HG   1 
ATOM   485  N N    . SER A 1 33 ? 3.138   8.576   3.426   1.00 0.23 ? 33  SER A N    1 
ATOM   486  C CA   . SER A 1 33 ? 3.274   9.350   4.698   1.00 0.24 ? 33  SER A CA   1 
ATOM   487  C C    . SER A 1 33 ? 2.010   9.161   5.529   1.00 0.24 ? 33  SER A C    1 
ATOM   488  O O    . SER A 1 33 ? 2.049   9.116   6.743   1.00 0.24 ? 33  SER A O    1 
ATOM   489  C CB   . SER A 1 33 ? 3.434   10.830  4.367   1.00 0.25 ? 33  SER A CB   1 
ATOM   490  O OG   . SER A 1 33 ? 2.155   11.393  4.109   1.00 0.26 ? 33  SER A OG   1 
ATOM   491  H H    . SER A 1 33 ? 2.276   8.548   2.963   1.00 0.24 ? 33  SER A H    1 
ATOM   492  H HA   . SER A 1 33 ? 4.134   9.005   5.257   1.00 0.23 ? 33  SER A HA   1 
ATOM   493  H HB2  . SER A 1 33 ? 3.890   11.344  5.197   1.00 0.25 ? 33  SER A HB2  1 
ATOM   494  H HB3  . SER A 1 33 ? 4.061   10.928  3.495   1.00 0.25 ? 33  SER A HB3  1 
ATOM   495  H HG   . SER A 1 33 ? 2.284   12.217  3.633   1.00 0.96 ? 33  SER A HG   1 
ATOM   496  N N    . LEU A 1 34 ? 0.888   9.055   4.869   1.00 0.25 ? 34  LEU A N    1 
ATOM   497  C CA   . LEU A 1 34 ? -0.412  8.871   5.583   1.00 0.25 ? 34  LEU A CA   1 
ATOM   498  C C    . LEU A 1 34 ? -0.239  7.896   6.751   1.00 0.25 ? 34  LEU A C    1 
ATOM   499  O O    . LEU A 1 34 ? -0.536  8.211   7.886   1.00 0.26 ? 34  LEU A O    1 
ATOM   500  C CB   . LEU A 1 34 ? -1.450  8.299   4.613   1.00 0.26 ? 34  LEU A CB   1 
ATOM   501  C CG   . LEU A 1 34 ? -1.382  9.030   3.269   1.00 0.26 ? 34  LEU A CG   1 
ATOM   502  C CD1  . LEU A 1 34 ? -2.518  8.536   2.366   1.00 0.27 ? 34  LEU A CD1  1 
ATOM   503  C CD2  . LEU A 1 34 ? -1.518  10.544  3.494   1.00 0.26 ? 34  LEU A CD2  1 
ATOM   504  H H    . LEU A 1 34 ? 0.902   9.104   3.894   1.00 0.25 ? 34  LEU A H    1 
ATOM   505  H HA   . LEU A 1 34 ? -0.755  9.821   5.955   1.00 0.26 ? 34  LEU A HA   1 
ATOM   506  H HB2  . LEU A 1 34 ? -1.257  7.248   4.456   1.00 0.26 ? 34  LEU A HB2  1 
ATOM   507  H HB3  . LEU A 1 34 ? -2.433  8.424   5.033   1.00 0.26 ? 34  LEU A HB3  1 
ATOM   508  H HG   . LEU A 1 34 ? -0.437  8.819   2.793   1.00 0.26 ? 34  LEU A HG   1 
ATOM   509  H HD11 . LEU A 1 34 ? -2.620  7.463   2.465   1.00 1.03 ? 34  LEU A HD11 1 
ATOM   510  H HD12 . LEU A 1 34 ? -3.442  9.013   2.655   1.00 1.05 ? 34  LEU A HD12 1 
ATOM   511  H HD13 . LEU A 1 34 ? -2.292  8.782   1.340   1.00 1.02 ? 34  LEU A HD13 1 
ATOM   512  H HD21 . LEU A 1 34 ? -2.263  10.734  4.253   1.00 0.99 ? 34  LEU A HD21 1 
ATOM   513  H HD22 . LEU A 1 34 ? -0.568  10.946  3.816   1.00 1.06 ? 34  LEU A HD22 1 
ATOM   514  H HD23 . LEU A 1 34 ? -1.815  11.023  2.572   1.00 1.08 ? 34  LEU A HD23 1 
ATOM   515  N N    . CYS A 1 35 ? 0.238   6.715   6.476   1.00 0.25 ? 35  CYS A N    1 
ATOM   516  C CA   . CYS A 1 35 ? 0.427   5.719   7.568   1.00 0.25 ? 35  CYS A CA   1 
ATOM   517  C C    . CYS A 1 35 ? 1.583   6.170   8.469   1.00 0.24 ? 35  CYS A C    1 
ATOM   518  O O    . CYS A 1 35 ? 2.652   6.506   8.005   1.00 0.23 ? 35  CYS A O    1 
ATOM   519  C CB   . CYS A 1 35 ? 0.726   4.341   6.965   1.00 0.25 ? 35  CYS A CB   1 
ATOM   520  S SG   . CYS A 1 35 ? 1.816   4.519   5.530   1.00 0.23 ? 35  CYS A SG   1 
ATOM   521  H H    . CYS A 1 35 ? 0.468   6.483   5.552   1.00 0.25 ? 35  CYS A H    1 
ATOM   522  H HA   . CYS A 1 35 ? -0.479  5.663   8.155   1.00 0.26 ? 35  CYS A HA   1 
ATOM   523  H HB2  . CYS A 1 35 ? 1.206   3.720   7.704   1.00 0.25 ? 35  CYS A HB2  1 
ATOM   524  H HB3  . CYS A 1 35 ? -0.200  3.878   6.656   1.00 0.26 ? 35  CYS A HB3  1 
ATOM   525  N N    . SER A 1 36 ? 1.359   6.211   9.753   1.00 0.25 ? 36  SER A N    1 
ATOM   526  C CA   . SER A 1 36 ? 2.424   6.660   10.698  1.00 0.25 ? 36  SER A CA   1 
ATOM   527  C C    . SER A 1 36 ? 3.610   5.674   10.715  1.00 0.24 ? 36  SER A C    1 
ATOM   528  O O    . SER A 1 36 ? 4.268   5.523   11.725  1.00 0.25 ? 36  SER A O    1 
ATOM   529  C CB   . SER A 1 36 ? 1.812   6.788   12.113  1.00 0.27 ? 36  SER A CB   1 
ATOM   530  O OG   . SER A 1 36 ? 0.404   6.607   12.026  1.00 1.35 ? 36  SER A OG   1 
ATOM   531  H H    . SER A 1 36 ? 0.479   5.957   10.100  1.00 0.27 ? 36  SER A H    1 
ATOM   532  H HA   . SER A 1 36 ? 2.783   7.628   10.378  1.00 0.25 ? 36  SER A HA   1 
ATOM   533  H HB2  . SER A 1 36 ? 2.220   6.037   12.772  1.00 1.04 ? 36  SER A HB2  1 
ATOM   534  H HB3  . SER A 1 36 ? 2.031   7.770   12.519  1.00 1.04 ? 36  SER A HB3  1 
ATOM   535  H HG   . SER A 1 36 ? 0.109   6.179   12.833  1.00 1.84 ? 36  SER A HG   1 
ATOM   536  N N    . GLN A 1 37 ? 3.903   4.999   9.631   1.00 0.23 ? 37  GLN A N    1 
ATOM   537  C CA   . GLN A 1 37 ? 5.055   4.043   9.659   1.00 0.22 ? 37  GLN A CA   1 
ATOM   538  C C    . GLN A 1 37 ? 5.656   3.865   8.256   1.00 0.21 ? 37  GLN A C    1 
ATOM   539  O O    . GLN A 1 37 ? 5.586   2.789   7.700   1.00 0.20 ? 37  GLN A O    1 
ATOM   540  C CB   . GLN A 1 37 ? 4.573   2.684   10.180  1.00 0.24 ? 37  GLN A CB   1 
ATOM   541  C CG   . GLN A 1 37 ? 3.265   2.293   9.486   1.00 0.25 ? 37  GLN A CG   1 
ATOM   542  C CD   . GLN A 1 37 ? 2.793   0.936   10.017  1.00 0.29 ? 37  GLN A CD   1 
ATOM   543  O OE1  . GLN A 1 37 ? 2.568   0.780   11.201  1.00 1.09 ? 37  GLN A OE1  1 
ATOM   544  N NE2  . GLN A 1 37 ? 2.636   -0.057  9.187   1.00 1.07 ? 37  GLN A NE2  1 
ATOM   545  H H    . GLN A 1 37 ? 3.378   5.114   8.812   1.00 0.23 ? 37  GLN A H    1 
ATOM   546  H HA   . GLN A 1 37 ? 5.824   4.419   10.322  1.00 0.23 ? 37  GLN A HA   1 
ATOM   547  H HB2  . GLN A 1 37 ? 5.325   1.934   9.977   1.00 0.23 ? 37  GLN A HB2  1 
ATOM   548  H HB3  . GLN A 1 37 ? 4.408   2.746   11.245  1.00 0.26 ? 37  GLN A HB3  1 
ATOM   549  H HG2  . GLN A 1 37 ? 2.512   3.040   9.687   1.00 0.29 ? 37  GLN A HG2  1 
ATOM   550  H HG3  . GLN A 1 37 ? 3.428   2.221   8.422   1.00 0.25 ? 37  GLN A HG3  1 
ATOM   551  H HE21 . GLN A 1 37 ? 2.819   0.067   8.232   1.00 1.85 ? 37  GLN A HE21 1 
ATOM   552  H HE22 . GLN A 1 37 ? 2.334   -0.930  9.517   1.00 1.08 ? 37  GLN A HE22 1 
ATOM   553  N N    . PRO A 1 38 ? 6.253   4.912   7.727   1.00 0.20 ? 38  PRO A N    1 
ATOM   554  C CA   . PRO A 1 38 ? 6.890   4.849   6.397   1.00 0.19 ? 38  PRO A CA   1 
ATOM   555  C C    . PRO A 1 38 ? 8.153   3.983   6.487   1.00 0.18 ? 38  PRO A C    1 
ATOM   556  O O    . PRO A 1 38 ? 8.503   3.476   7.534   1.00 0.19 ? 38  PRO A O    1 
ATOM   557  C CB   . PRO A 1 38 ? 7.243   6.316   6.061   1.00 0.19 ? 38  PRO A CB   1 
ATOM   558  C CG   . PRO A 1 38 ? 6.999   7.158   7.347   1.00 0.20 ? 38  PRO A CG   1 
ATOM   559  C CD   . PRO A 1 38 ? 6.334   6.232   8.390   1.00 0.22 ? 38  PRO A CD   1 
ATOM   560  H HA   . PRO A 1 38 ? 6.208   4.445   5.657   1.00 0.19 ? 38  PRO A HA   1 
ATOM   561  H HB2  . PRO A 1 38 ? 8.281   6.395   5.753   1.00 0.18 ? 38  PRO A HB2  1 
ATOM   562  H HB3  . PRO A 1 38 ? 6.604   6.676   5.266   1.00 0.20 ? 38  PRO A HB3  1 
ATOM   563  H HG2  . PRO A 1 38 ? 7.943   7.531   7.728   1.00 0.20 ? 38  PRO A HG2  1 
ATOM   564  H HG3  . PRO A 1 38 ? 6.343   7.991   7.126   1.00 0.21 ? 38  PRO A HG3  1 
ATOM   565  H HD2  . PRO A 1 38 ? 6.943   6.169   9.283   1.00 0.22 ? 38  PRO A HD2  1 
ATOM   566  H HD3  . PRO A 1 38 ? 5.345   6.585   8.635   1.00 0.24 ? 38  PRO A HD3  1 
ATOM   567  N N    . ALA A 1 39 ? 8.837   3.821   5.394   1.00 0.17 ? 39  ALA A N    1 
ATOM   568  C CA   . ALA A 1 39 ? 10.075  3.006   5.387   1.00 0.16 ? 39  ALA A CA   1 
ATOM   569  C C    . ALA A 1 39 ? 10.775  3.225   4.051   1.00 0.15 ? 39  ALA A C    1 
ATOM   570  O O    . ALA A 1 39 ? 10.199  3.771   3.130   1.00 0.17 ? 39  ALA A O    1 
ATOM   571  C CB   . ALA A 1 39 ? 9.716   1.528   5.541   1.00 0.15 ? 39  ALA A CB   1 
ATOM   572  H H    . ALA A 1 39 ? 8.539   4.245   4.571   1.00 0.18 ? 39  ALA A H    1 
ATOM   573  H HA   . ALA A 1 39 ? 10.719  3.313   6.194   1.00 0.16 ? 39  ALA A HA   1 
ATOM   574  H HB1  . ALA A 1 39 ? 9.039   1.406   6.373   1.00 1.00 ? 39  ALA A HB1  1 
ATOM   575  H HB2  . ALA A 1 39 ? 9.242   1.176   4.637   1.00 1.03 ? 39  ALA A HB2  1 
ATOM   576  H HB3  . ALA A 1 39 ? 10.615  0.957   5.721   1.00 1.02 ? 39  ALA A HB3  1 
ATOM   577  N N    . VAL A 1 40 ? 11.997  2.786   3.914   1.00 0.13 ? 40  VAL A N    1 
ATOM   578  C CA   . VAL A 1 40 ? 12.700  2.955   2.608   1.00 0.12 ? 40  VAL A CA   1 
ATOM   579  C C    . VAL A 1 40 ? 12.508  1.664   1.824   1.00 0.11 ? 40  VAL A C    1 
ATOM   580  O O    . VAL A 1 40 ? 12.497  0.586   2.386   1.00 0.14 ? 40  VAL A O    1 
ATOM   581  C CB   . VAL A 1 40 ? 14.194  3.216   2.838   1.00 0.12 ? 40  VAL A CB   1 
ATOM   582  C CG1  . VAL A 1 40 ? 14.969  2.988   1.535   1.00 0.12 ? 40  VAL A CG1  1 
ATOM   583  C CG2  . VAL A 1 40 ? 14.386  4.666   3.282   1.00 0.16 ? 40  VAL A CG2  1 
ATOM   584  H H    . VAL A 1 40 ? 12.443  2.326   4.659   1.00 0.12 ? 40  VAL A H    1 
ATOM   585  H HA   . VAL A 1 40 ? 12.267  3.784   2.052   1.00 0.15 ? 40  VAL A HA   1 
ATOM   586  H HB   . VAL A 1 40 ? 14.566  2.549   3.602   1.00 0.12 ? 40  VAL A HB   1 
ATOM   587  H HG11 . VAL A 1 40 ? 14.432  3.444   0.716   1.00 1.02 ? 40  VAL A HG11 1 
ATOM   588  H HG12 . VAL A 1 40 ? 15.951  3.432   1.613   1.00 1.00 ? 40  VAL A HG12 1 
ATOM   589  H HG13 . VAL A 1 40 ? 15.064  1.928   1.354   1.00 1.01 ? 40  VAL A HG13 1 
ATOM   590  H HG21 . VAL A 1 40 ? 13.675  4.900   4.059   1.00 0.99 ? 40  VAL A HG21 1 
ATOM   591  H HG22 . VAL A 1 40 ? 15.390  4.797   3.657   1.00 1.06 ? 40  VAL A HG22 1 
ATOM   592  H HG23 . VAL A 1 40 ? 14.228  5.323   2.439   1.00 1.04 ? 40  VAL A HG23 1 
ATOM   593  N N    . VAL A 1 41 ? 12.330  1.770   0.536   1.00 0.13 ? 41  VAL A N    1 
ATOM   594  C CA   . VAL A 1 41 ? 12.104  0.553   -0.304  1.00 0.14 ? 41  VAL A CA   1 
ATOM   595  C C    . VAL A 1 41 ? 13.204  0.444   -1.363  1.00 0.14 ? 41  VAL A C    1 
ATOM   596  O O    . VAL A 1 41 ? 13.380  1.320   -2.179  1.00 0.17 ? 41  VAL A O    1 
ATOM   597  C CB   . VAL A 1 41 ? 10.731  0.674   -0.973  1.00 0.19 ? 41  VAL A CB   1 
ATOM   598  C CG1  . VAL A 1 41 ? 10.245  -0.702  -1.409  1.00 0.22 ? 41  VAL A CG1  1 
ATOM   599  C CG2  . VAL A 1 41 ? 9.731   1.264   0.027   1.00 0.20 ? 41  VAL A CG2  1 
ATOM   600  H H    . VAL A 1 41 ? 12.327  2.657   0.121   1.00 0.17 ? 41  VAL A H    1 
ATOM   601  H HA   . VAL A 1 41 ? 12.122  -0.327  0.312   1.00 0.13 ? 41  VAL A HA   1 
ATOM   602  H HB   . VAL A 1 41 ? 10.800  1.316   -1.837  1.00 0.20 ? 41  VAL A HB   1 
ATOM   603  H HG11 . VAL A 1 41 ? 10.214  -1.362  -0.554  1.00 1.00 ? 41  VAL A HG11 1 
ATOM   604  H HG12 . VAL A 1 41 ? 9.256   -0.608  -1.828  1.00 0.99 ? 41  VAL A HG12 1 
ATOM   605  H HG13 . VAL A 1 41 ? 10.922  -1.099  -2.149  1.00 0.95 ? 41  VAL A HG13 1 
ATOM   606  H HG21 . VAL A 1 41 ? 9.754   0.687   0.940   1.00 1.01 ? 41  VAL A HG21 1 
ATOM   607  H HG22 . VAL A 1 41 ? 9.996   2.287   0.243   1.00 1.02 ? 41  VAL A HG22 1 
ATOM   608  H HG23 . VAL A 1 41 ? 8.738   1.229   -0.395  1.00 1.03 ? 41  VAL A HG23 1 
ATOM   609  N N    . PHE A 1 42 ? 13.957  -0.624  -1.349  1.00 0.13 ? 42  PHE A N    1 
ATOM   610  C CA   . PHE A 1 42 ? 15.060  -0.778  -2.347  1.00 0.15 ? 42  PHE A CA   1 
ATOM   611  C C    . PHE A 1 42 ? 14.569  -1.537  -3.585  1.00 0.19 ? 42  PHE A C    1 
ATOM   612  O O    . PHE A 1 42 ? 13.868  -2.525  -3.490  1.00 0.21 ? 42  PHE A O    1 
ATOM   613  C CB   . PHE A 1 42 ? 16.211  -1.564  -1.710  1.00 0.14 ? 42  PHE A CB   1 
ATOM   614  C CG   . PHE A 1 42 ? 16.968  -0.686  -0.733  1.00 0.12 ? 42  PHE A CG   1 
ATOM   615  C CD1  . PHE A 1 42 ? 17.649  0.463   -1.190  1.00 0.12 ? 42  PHE A CD1  1 
ATOM   616  C CD2  . PHE A 1 42 ? 17.001  -1.021  0.636   1.00 0.12 ? 42  PHE A CD2  1 
ATOM   617  C CE1  . PHE A 1 42 ? 18.357  1.271   -0.281  1.00 0.13 ? 42  PHE A CE1  1 
ATOM   618  C CE2  . PHE A 1 42 ? 17.711  -0.212  1.543   1.00 0.14 ? 42  PHE A CE2  1 
ATOM   619  C CZ   . PHE A 1 42 ? 18.388  0.934   1.085   1.00 0.14 ? 42  PHE A CZ   1 
ATOM   620  H H    . PHE A 1 42 ? 13.808  -1.319  -0.675  1.00 0.12 ? 42  PHE A H    1 
ATOM   621  H HA   . PHE A 1 42 ? 15.416  0.195   -2.646  1.00 0.15 ? 42  PHE A HA   1 
ATOM   622  H HB2  . PHE A 1 42 ? 15.812  -2.421  -1.191  1.00 0.14 ? 42  PHE A HB2  1 
ATOM   623  H HB3  . PHE A 1 42 ? 16.885  -1.902  -2.482  1.00 0.16 ? 42  PHE A HB3  1 
ATOM   624  H HD1  . PHE A 1 42 ? 17.628  0.724   -2.235  1.00 0.14 ? 42  PHE A HD1  1 
ATOM   625  H HD2  . PHE A 1 42 ? 16.482  -1.899  0.989   1.00 0.13 ? 42  PHE A HD2  1 
ATOM   626  H HE1  . PHE A 1 42 ? 18.877  2.151   -0.631  1.00 0.15 ? 42  PHE A HE1  1 
ATOM   627  H HE2  . PHE A 1 42 ? 17.735  -0.472  2.589   1.00 0.16 ? 42  PHE A HE2  1 
ATOM   628  H HZ   . PHE A 1 42 ? 18.934  1.554   1.781   1.00 0.16 ? 42  PHE A HZ   1 
ATOM   629  N N    . GLN A 1 43 ? 14.970  -1.089  -4.747  1.00 0.22 ? 43  GLN A N    1 
ATOM   630  C CA   . GLN A 1 43 ? 14.581  -1.774  -6.018  1.00 0.26 ? 43  GLN A CA   1 
ATOM   631  C C    . GLN A 1 43 ? 15.787  -2.606  -6.477  1.00 0.28 ? 43  GLN A C    1 
ATOM   632  O O    . GLN A 1 43 ? 16.870  -2.076  -6.650  1.00 0.28 ? 43  GLN A O    1 
ATOM   633  C CB   . GLN A 1 43 ? 14.238  -0.712  -7.067  1.00 0.30 ? 43  GLN A CB   1 
ATOM   634  C CG   . GLN A 1 43 ? 12.990  0.057   -6.625  1.00 0.30 ? 43  GLN A CG   1 
ATOM   635  C CD   . GLN A 1 43 ? 12.853  1.333   -7.458  1.00 0.35 ? 43  GLN A CD   1 
ATOM   636  O OE1  . GLN A 1 43 ? 12.695  2.410   -6.920  1.00 1.15 ? 43  GLN A OE1  1 
ATOM   637  N NE2  . GLN A 1 43 ? 12.908  1.256   -8.760  1.00 1.11 ? 43  GLN A NE2  1 
ATOM   638  H H    . GLN A 1 43 ? 15.556  -0.303  -4.784  1.00 0.21 ? 43  GLN A H    1 
ATOM   639  H HA   . GLN A 1 43 ? 13.730  -2.420  -5.852  1.00 0.27 ? 43  GLN A HA   1 
ATOM   640  H HB2  . GLN A 1 43 ? 15.067  -0.026  -7.166  1.00 0.30 ? 43  GLN A HB2  1 
ATOM   641  H HB3  . GLN A 1 43 ? 14.047  -1.182  -8.014  1.00 0.33 ? 43  GLN A HB3  1 
ATOM   642  H HG2  . GLN A 1 43 ? 12.116  -0.563  -6.768  1.00 0.32 ? 43  GLN A HG2  1 
ATOM   643  H HG3  . GLN A 1 43 ? 13.078  0.319   -5.581  1.00 0.28 ? 43  GLN A HG3  1 
ATOM   644  H HE21 . GLN A 1 43 ? 13.035  0.388   -9.195  1.00 1.90 ? 43  GLN A HE21 1 
ATOM   645  H HE22 . GLN A 1 43 ? 12.821  2.069   -9.302  1.00 1.11 ? 43  GLN A HE22 1 
ATOM   646  N N    . THR A 1 44 ? 15.637  -3.908  -6.629  1.00 0.29 ? 44  THR A N    1 
ATOM   647  C CA   . THR A 1 44 ? 16.823  -4.753  -7.019  1.00 0.31 ? 44  THR A CA   1 
ATOM   648  C C    . THR A 1 44 ? 16.856  -5.050  -8.519  1.00 0.37 ? 44  THR A C    1 
ATOM   649  O O    . THR A 1 44 ? 16.276  -4.352  -9.327  1.00 0.40 ? 44  THR A O    1 
ATOM   650  C CB   . THR A 1 44 ? 16.769  -6.081  -6.268  1.00 0.31 ? 44  THR A CB   1 
ATOM   651  O OG1  . THR A 1 44 ? 15.887  -6.959  -6.944  1.00 0.35 ? 44  THR A OG1  1 
ATOM   652  C CG2  . THR A 1 44 ? 16.269  -5.845  -4.840  1.00 0.26 ? 44  THR A CG2  1 
ATOM   653  H H    . THR A 1 44 ? 14.761  -4.334  -6.453  1.00 0.29 ? 44  THR A H    1 
ATOM   654  H HA   . THR A 1 44 ? 17.735  -4.242  -6.746  1.00 0.30 ? 44  THR A HA   1 
ATOM   655  H HB   . THR A 1 44 ? 17.753  -6.517  -6.235  1.00 0.32 ? 44  THR A HB   1 
ATOM   656  H HG1  . THR A 1 44 ? 16.052  -6.878  -7.887  1.00 0.77 ? 44  THR A HG1  1 
ATOM   657  H HG21 . THR A 1 44 ? 16.744  -4.965  -4.430  1.00 1.05 ? 44  THR A HG21 1 
ATOM   658  H HG22 . THR A 1 44 ? 15.199  -5.704  -4.852  1.00 1.06 ? 44  THR A HG22 1 
ATOM   659  H HG23 . THR A 1 44 ? 16.512  -6.700  -4.228  1.00 1.01 ? 44  THR A HG23 1 
ATOM   660  N N    . LYS A 1 45 ? 17.564  -6.096  -8.884  1.00 0.42 ? 45  LYS A N    1 
ATOM   661  C CA   . LYS A 1 45 ? 17.695  -6.490  -10.321 1.00 0.47 ? 45  LYS A CA   1 
ATOM   662  C C    . LYS A 1 45 ? 16.932  -7.794  -10.581 1.00 0.50 ? 45  LYS A C    1 
ATOM   663  O O    . LYS A 1 45 ? 16.545  -8.076  -11.697 1.00 0.55 ? 45  LYS A O    1 
ATOM   664  C CB   . LYS A 1 45 ? 19.178  -6.722  -10.646 1.00 0.49 ? 45  LYS A CB   1 
ATOM   665  C CG   . LYS A 1 45 ? 20.028  -5.590  -10.069 1.00 0.45 ? 45  LYS A CG   1 
ATOM   666  C CD   . LYS A 1 45 ? 21.503  -5.851  -10.393 1.00 0.49 ? 45  LYS A CD   1 
ATOM   667  C CE   . LYS A 1 45 ? 22.317  -4.578  -10.156 1.00 0.53 ? 45  LYS A CE   1 
ATOM   668  N NZ   . LYS A 1 45 ? 23.772  -4.900  -10.209 1.00 1.41 ? 45  LYS A NZ   1 
ATOM   669  H H    . LYS A 1 45 ? 18.026  -6.625  -8.200  1.00 0.43 ? 45  LYS A H    1 
ATOM   670  H HA   . LYS A 1 45 ? 17.307  -5.708  -10.959 1.00 0.49 ? 45  LYS A HA   1 
ATOM   671  H HB2  . LYS A 1 45 ? 19.498  -7.661  -10.216 1.00 0.50 ? 45  LYS A HB2  1 
ATOM   672  H HB3  . LYS A 1 45 ? 19.311  -6.756  -11.715 1.00 0.56 ? 45  LYS A HB3  1 
ATOM   673  H HG2  . LYS A 1 45 ? 19.719  -4.654  -10.507 1.00 0.49 ? 45  LYS A HG2  1 
ATOM   674  H HG3  . LYS A 1 45 ? 19.899  -5.550  -8.998  1.00 0.41 ? 45  LYS A HG3  1 
ATOM   675  H HD2  . LYS A 1 45 ? 21.878  -6.639  -9.757  1.00 0.59 ? 45  LYS A HD2  1 
ATOM   676  H HD3  . LYS A 1 45 ? 21.599  -6.147  -11.427 1.00 0.68 ? 45  LYS A HD3  1 
ATOM   677  H HE2  . LYS A 1 45 ? 22.082  -3.855  -10.921 1.00 0.95 ? 45  LYS A HE2  1 
ATOM   678  H HE3  . LYS A 1 45 ? 22.073  -4.171  -9.186  1.00 1.18 ? 45  LYS A HE3  1 
ATOM   679  H HZ1  . LYS A 1 45 ? 23.919  -5.754  -10.784 1.00 1.95 ? 45  LYS A HZ1  1 
ATOM   680  H HZ2  . LYS A 1 45 ? 24.288  -4.102  -10.634 1.00 1.92 ? 45  LYS A HZ2  1 
ATOM   681  H HZ3  . LYS A 1 45 ? 24.127  -5.070  -9.246  1.00 1.99 ? 45  LYS A HZ3  1 
ATOM   682  N N    . ARG A 1 46 ? 16.727  -8.599  -9.562  1.00 0.49 ? 46  ARG A N    1 
ATOM   683  C CA   . ARG A 1 46 ? 16.002  -9.903  -9.746  1.00 0.53 ? 46  ARG A CA   1 
ATOM   684  C C    . ARG A 1 46 ? 14.876  -9.991  -8.717  1.00 0.48 ? 46  ARG A C    1 
ATOM   685  O O    . ARG A 1 46 ? 14.741  -10.956 -7.995  1.00 0.49 ? 46  ARG A O    1 
ATOM   686  C CB   . ARG A 1 46 ? 16.994  -11.069 -9.555  1.00 0.57 ? 46  ARG A CB   1 
ATOM   687  C CG   . ARG A 1 46 ? 16.467  -12.376 -10.203 1.00 0.68 ? 46  ARG A CG   1 
ATOM   688  C CD   . ARG A 1 46 ? 15.541  -13.148 -9.240  1.00 0.99 ? 46  ARG A CD   1 
ATOM   689  N NE   . ARG A 1 46 ? 15.667  -14.617 -9.500  1.00 1.58 ? 46  ARG A NE   1 
ATOM   690  C CZ   . ARG A 1 46 ? 15.549  -15.106 -10.707 1.00 2.19 ? 46  ARG A CZ   1 
ATOM   691  N NH1  . ARG A 1 46 ? 15.127  -14.354 -11.688 1.00 2.64 ? 46  ARG A NH1  1 
ATOM   692  N NH2  . ARG A 1 46 ? 15.799  -16.371 -10.921 1.00 2.86 ? 46  ARG A NH2  1 
ATOM   693  H H    . ARG A 1 46 ? 17.056  -8.350  -8.673  1.00 0.46 ? 46  ARG A H    1 
ATOM   694  H HA   . ARG A 1 46 ? 15.573  -9.945  -10.737 1.00 0.58 ? 46  ARG A HA   1 
ATOM   695  H HB2  . ARG A 1 46 ? 17.934  -10.803 -10.019 1.00 0.66 ? 46  ARG A HB2  1 
ATOM   696  H HB3  . ARG A 1 46 ? 17.160  -11.227 -8.504  1.00 0.54 ? 46  ARG A HB3  1 
ATOM   697  H HG2  . ARG A 1 46 ? 15.930  -12.139 -11.106 1.00 0.85 ? 46  ARG A HG2  1 
ATOM   698  H HG3  . ARG A 1 46 ? 17.309  -13.007 -10.454 1.00 1.16 ? 46  ARG A HG3  1 
ATOM   699  H HD2  . ARG A 1 46 ? 15.836  -12.978 -8.222  1.00 1.51 ? 46  ARG A HD2  1 
ATOM   700  H HD3  . ARG A 1 46 ? 14.516  -12.813 -9.377  1.00 1.06 ? 46  ARG A HD3  1 
ATOM   701  H HE   . ARG A 1 46 ? 15.894  -15.216 -8.758  1.00 2.02 ? 46  ARG A HE   1 
ATOM   702  H HH11 . ARG A 1 46 ? 14.885  -13.402 -11.521 1.00 2.46 ? 46  ARG A HH11 1 
ATOM   703  H HH12 . ARG A 1 46 ? 15.045  -14.735 -12.610 1.00 3.44 ? 46  ARG A HH12 1 
ATOM   704  H HH21 . ARG A 1 46 ? 16.079  -16.962 -10.162 1.00 3.02 ? 46  ARG A HH21 1 
ATOM   705  H HH22 . ARG A 1 46 ? 15.711  -16.750 -11.842 1.00 3.46 ? 46  ARG A HH22 1 
ATOM   706  N N    . SER A 1 47 ? 14.057  -8.984  -8.657  1.00 0.44 ? 47  SER A N    1 
ATOM   707  C CA   . SER A 1 47 ? 12.926  -8.992  -7.703  1.00 0.41 ? 47  SER A CA   1 
ATOM   708  C C    . SER A 1 47 ? 11.987  -7.851  -8.078  1.00 0.41 ? 47  SER A C    1 
ATOM   709  O O    . SER A 1 47 ? 11.486  -7.783  -9.182  1.00 0.45 ? 47  SER A O    1 
ATOM   710  C CB   . SER A 1 47 ? 13.436  -8.819  -6.265  1.00 0.38 ? 47  SER A CB   1 
ATOM   711  O OG   . SER A 1 47 ? 13.833  -7.472  -6.054  1.00 0.99 ? 47  SER A OG   1 
ATOM   712  H H    . SER A 1 47 ? 14.183  -8.218  -9.251  1.00 0.45 ? 47  SER A H    1 
ATOM   713  H HA   . SER A 1 47 ? 12.398  -9.924  -7.784  1.00 0.43 ? 47  SER A HA   1 
ATOM   714  H HB2  . SER A 1 47 ? 12.649  -9.067  -5.572  1.00 0.75 ? 47  SER A HB2  1 
ATOM   715  H HB3  . SER A 1 47 ? 14.275  -9.483  -6.100  1.00 0.80 ? 47  SER A HB3  1 
ATOM   716  H HG   . SER A 1 47 ? 14.116  -7.386  -5.141  1.00 1.38 ? 47  SER A HG   1 
ATOM   717  N N    . LYS A 1 48 ? 11.760  -6.952  -7.180  1.00 0.37 ? 48  LYS A N    1 
ATOM   718  C CA   . LYS A 1 48 ? 10.869  -5.802  -7.471  1.00 0.38 ? 48  LYS A CA   1 
ATOM   719  C C    . LYS A 1 48 ? 11.215  -4.690  -6.492  1.00 0.33 ? 48  LYS A C    1 
ATOM   720  O O    . LYS A 1 48 ? 12.113  -3.894  -6.704  1.00 0.31 ? 48  LYS A O    1 
ATOM   721  C CB   . LYS A 1 48 ? 9.395   -6.215  -7.261  1.00 0.44 ? 48  LYS A CB   1 
ATOM   722  C CG   . LYS A 1 48 ? 8.815   -6.866  -8.523  1.00 1.12 ? 48  LYS A CG   1 
ATOM   723  C CD   . LYS A 1 48 ? 7.289   -6.958  -8.374  1.00 1.24 ? 48  LYS A CD   1 
ATOM   724  C CE   . LYS A 1 48 ? 6.667   -7.773  -9.531  1.00 2.01 ? 48  LYS A CE   1 
ATOM   725  N NZ   . LYS A 1 48 ? 5.950   -6.847  -10.453 1.00 2.55 ? 48  LYS A NZ   1 
ATOM   726  H H    . LYS A 1 48 ? 12.194  -7.019  -6.308  1.00 0.34 ? 48  LYS A H    1 
ATOM   727  H HA   . LYS A 1 48 ? 11.020  -5.461  -8.484  1.00 0.42 ? 48  LYS A HA   1 
ATOM   728  H HB2  . LYS A 1 48 ? 9.338   -6.920  -6.444  1.00 1.03 ? 48  LYS A HB2  1 
ATOM   729  H HB3  . LYS A 1 48 ? 8.805   -5.342  -7.014  1.00 0.97 ? 48  LYS A HB3  1 
ATOM   730  H HG2  . LYS A 1 48 ? 9.057   -6.267  -9.389  1.00 1.69 ? 48  LYS A HG2  1 
ATOM   731  H HG3  . LYS A 1 48 ? 9.221   -7.859  -8.639  1.00 1.72 ? 48  LYS A HG3  1 
ATOM   732  H HD2  . LYS A 1 48 ? 7.055   -7.430  -7.428  1.00 1.51 ? 48  LYS A HD2  1 
ATOM   733  H HD3  . LYS A 1 48 ? 6.873   -5.962  -8.383  1.00 1.52 ? 48  LYS A HD3  1 
ATOM   734  H HE2  . LYS A 1 48 ? 7.439   -8.299  -10.079 1.00 2.55 ? 48  LYS A HE2  1 
ATOM   735  H HE3  . LYS A 1 48 ? 5.962   -8.492  -9.133  1.00 2.50 ? 48  LYS A HE3  1 
ATOM   736  H HZ1  . LYS A 1 48 ? 5.726   -5.965  -9.954  1.00 2.87 ? 48  LYS A HZ1  1 
ATOM   737  H HZ2  . LYS A 1 48 ? 6.555   -6.636  -11.272 1.00 3.06 ? 48  LYS A HZ2  1 
ATOM   738  H HZ3  . LYS A 1 48 ? 5.066   -7.294  -10.774 1.00 2.83 ? 48  LYS A HZ3  1 
ATOM   739  N N    . GLN A 1 49 ? 10.490  -4.655  -5.411  1.00 0.33 ? 49  GLN A N    1 
ATOM   740  C CA   . GLN A 1 49 ? 10.702  -3.632  -4.359  1.00 0.30 ? 49  GLN A CA   1 
ATOM   741  C C    . GLN A 1 49 ? 10.915  -4.349  -3.019  1.00 0.25 ? 49  GLN A C    1 
ATOM   742  O O    . GLN A 1 49 ? 10.334  -5.389  -2.767  1.00 0.26 ? 49  GLN A O    1 
ATOM   743  C CB   . GLN A 1 49 ? 9.442   -2.767  -4.302  1.00 0.34 ? 49  GLN A CB   1 
ATOM   744  C CG   . GLN A 1 49 ? 9.482   -1.720  -5.420  1.00 0.85 ? 49  GLN A CG   1 
ATOM   745  C CD   . GLN A 1 49 ? 8.204   -0.882  -5.380  1.00 1.00 ? 49  GLN A CD   1 
ATOM   746  O OE1  . GLN A 1 49 ? 7.370   -1.067  -4.516  1.00 1.60 ? 49  GLN A OE1  1 
ATOM   747  N NE2  . GLN A 1 49 ? 8.013   0.040   -6.284  1.00 1.68 ? 49  GLN A NE2  1 
ATOM   748  H H    . GLN A 1 49 ? 9.785   -5.324  -5.290  1.00 0.38 ? 49  GLN A H    1 
ATOM   749  H HA   . GLN A 1 49 ? 11.564  -3.019  -4.587  1.00 0.32 ? 49  GLN A HA   1 
ATOM   750  H HB2  . GLN A 1 49 ? 8.576   -3.396  -4.436  1.00 0.77 ? 49  GLN A HB2  1 
ATOM   751  H HB3  . GLN A 1 49 ? 9.382   -2.275  -3.353  1.00 0.83 ? 49  GLN A HB3  1 
ATOM   752  H HG2  . GLN A 1 49 ? 10.339  -1.076  -5.283  1.00 1.53 ? 49  GLN A HG2  1 
ATOM   753  H HG3  . GLN A 1 49 ? 9.553   -2.216  -6.377  1.00 1.39 ? 49  GLN A HG3  1 
ATOM   754  H HE21 . GLN A 1 49 ? 8.686   0.190   -6.980  1.00 2.24 ? 49  GLN A HE21 1 
ATOM   755  H HE22 . GLN A 1 49 ? 7.197   0.582   -6.266  1.00 2.04 ? 49  GLN A HE22 1 
ATOM   756  N N    . VAL A 1 50 ? 11.749  -3.813  -2.162  1.00 0.21 ? 50  VAL A N    1 
ATOM   757  C CA   . VAL A 1 50 ? 12.008  -4.472  -0.840  1.00 0.18 ? 50  VAL A CA   1 
ATOM   758  C C    . VAL A 1 50 ? 12.002  -3.426  0.267   1.00 0.14 ? 50  VAL A C    1 
ATOM   759  O O    . VAL A 1 50 ? 12.768  -2.490  0.244   1.00 0.13 ? 50  VAL A O    1 
ATOM   760  C CB   . VAL A 1 50 ? 13.379  -5.155  -0.871  1.00 0.20 ? 50  VAL A CB   1 
ATOM   761  C CG1  . VAL A 1 50 ? 13.526  -6.054  0.359   1.00 0.23 ? 50  VAL A CG1  1 
ATOM   762  C CG2  . VAL A 1 50 ? 13.509  -5.993  -2.153  1.00 0.30 ? 50  VAL A CG2  1 
ATOM   763  H H    . VAL A 1 50 ? 12.212  -2.980  -2.389  1.00 0.24 ? 50  VAL A H    1 
ATOM   764  H HA   . VAL A 1 50 ? 11.242  -5.208  -0.634  1.00 0.18 ? 50  VAL A HA   1 
ATOM   765  H HB   . VAL A 1 50 ? 14.153  -4.400  -0.853  1.00 0.23 ? 50  VAL A HB   1 
ATOM   766  H HG11 . VAL A 1 50 ? 12.733  -6.784  0.366   1.00 1.02 ? 50  VAL A HG11 1 
ATOM   767  H HG12 . VAL A 1 50 ? 14.479  -6.560  0.323   1.00 1.03 ? 50  VAL A HG12 1 
ATOM   768  H HG13 . VAL A 1 50 ? 13.470  -5.452  1.253   1.00 1.08 ? 50  VAL A HG13 1 
ATOM   769  H HG21 . VAL A 1 50 ? 12.553  -6.432  -2.400  1.00 1.10 ? 50  VAL A HG21 1 
ATOM   770  H HG22 . VAL A 1 50 ? 13.832  -5.358  -2.964  1.00 1.06 ? 50  VAL A HG22 1 
ATOM   771  H HG23 . VAL A 1 50 ? 14.238  -6.779  -2.003  1.00 1.02 ? 50  VAL A HG23 1 
ATOM   772  N N    . CYS A 1 51 ? 11.154  -3.588  1.244   1.00 0.14 ? 51  CYS A N    1 
ATOM   773  C CA   . CYS A 1 51 ? 11.101  -2.602  2.356   1.00 0.12 ? 51  CYS A CA   1 
ATOM   774  C C    . CYS A 1 51 ? 12.334  -2.773  3.241   1.00 0.11 ? 51  CYS A C    1 
ATOM   775  O O    . CYS A 1 51 ? 12.895  -3.847  3.341   1.00 0.13 ? 51  CYS A O    1 
ATOM   776  C CB   . CYS A 1 51 ? 9.839   -2.843  3.185   1.00 0.14 ? 51  CYS A CB   1 
ATOM   777  S SG   . CYS A 1 51 ? 8.376   -2.558  2.157   1.00 0.18 ? 51  CYS A SG   1 
ATOM   778  H H    . CYS A 1 51 ? 10.552  -4.361  1.246   1.00 0.15 ? 51  CYS A H    1 
ATOM   779  H HA   . CYS A 1 51 ? 11.080  -1.602  1.953   1.00 0.12 ? 51  CYS A HA   1 
ATOM   780  H HB2  . CYS A 1 51 ? 9.834   -3.861  3.545   1.00 0.15 ? 51  CYS A HB2  1 
ATOM   781  H HB3  . CYS A 1 51 ? 9.827   -2.167  4.023   1.00 0.14 ? 51  CYS A HB3  1 
ATOM   782  N N    . ALA A 1 52 ? 12.771  -1.718  3.879   1.00 0.10 ? 52  ALA A N    1 
ATOM   783  C CA   . ALA A 1 52 ? 13.982  -1.812  4.750   1.00 0.11 ? 52  ALA A CA   1 
ATOM   784  C C    . ALA A 1 52 ? 13.812  -0.901  5.969   1.00 0.13 ? 52  ALA A C    1 
ATOM   785  O O    . ALA A 1 52 ? 13.337  0.214   5.864   1.00 0.13 ? 52  ALA A O    1 
ATOM   786  C CB   . ALA A 1 52 ? 15.211  -1.366  3.953   1.00 0.10 ? 52  ALA A CB   1 
ATOM   787  H H    . ALA A 1 52 ? 12.309  -0.859  3.776   1.00 0.10 ? 52  ALA A H    1 
ATOM   788  H HA   . ALA A 1 52 ? 14.119  -2.834  5.081   1.00 0.13 ? 52  ALA A HA   1 
ATOM   789  H HB1  . ALA A 1 52 ? 15.185  -1.816  2.971   1.00 1.00 ? 52  ALA A HB1  1 
ATOM   790  H HB2  . ALA A 1 52 ? 15.207  -0.290  3.856   1.00 1.03 ? 52  ALA A HB2  1 
ATOM   791  H HB3  . ALA A 1 52 ? 16.106  -1.679  4.468   1.00 0.99 ? 52  ALA A HB3  1 
ATOM   792  N N    . ASP A 1 53 ? 14.202  -1.372  7.124   1.00 0.17 ? 53  ASP A N    1 
ATOM   793  C CA   . ASP A 1 53 ? 14.072  -0.548  8.363   1.00 0.20 ? 53  ASP A CA   1 
ATOM   794  C C    . ASP A 1 53 ? 15.062  0.647   8.286   1.00 0.20 ? 53  ASP A C    1 
ATOM   795  O O    . ASP A 1 53 ? 16.254  0.419   8.267   1.00 0.22 ? 53  ASP A O    1 
ATOM   796  C CB   . ASP A 1 53 ? 14.437  -1.436  9.582   1.00 0.25 ? 53  ASP A CB   1 
ATOM   797  C CG   . ASP A 1 53 ? 13.169  -1.920  10.297  1.00 1.39 ? 53  ASP A CG   1 
ATOM   798  O OD1  . ASP A 1 53 ? 12.549  -1.114  10.972  1.00 2.15 ? 53  ASP A OD1  1 
ATOM   799  O OD2  . ASP A 1 53 ? 12.846  -3.087  10.162  1.00 2.20 ? 53  ASP A OD2  1 
ATOM   800  H H    . ASP A 1 53 ? 14.581  -2.275  7.177   1.00 0.18 ? 53  ASP A H    1 
ATOM   801  H HA   . ASP A 1 53 ? 13.058  -0.209  8.451   1.00 0.20 ? 53  ASP A HA   1 
ATOM   802  H HB2  . ASP A 1 53 ? 14.996  -2.293  9.238   1.00 1.01 ? 53  ASP A HB2  1 
ATOM   803  H HB3  . ASP A 1 53 ? 15.043  -0.876  10.283  1.00 1.01 ? 53  ASP A HB3  1 
ATOM   804  N N    . PRO A 1 54 ? 14.582  1.885   8.259   1.00 0.21 ? 54  PRO A N    1 
ATOM   805  C CA   . PRO A 1 54 ? 15.502  3.040   8.201   1.00 0.22 ? 54  PRO A CA   1 
ATOM   806  C C    . PRO A 1 54 ? 16.366  3.065   9.470   1.00 0.27 ? 54  PRO A C    1 
ATOM   807  O O    . PRO A 1 54 ? 17.266  3.869   9.609   1.00 0.29 ? 54  PRO A O    1 
ATOM   808  C CB   . PRO A 1 54 ? 14.588  4.283   8.128   1.00 0.24 ? 54  PRO A CB   1 
ATOM   809  C CG   . PRO A 1 54 ? 13.114  3.788   8.203   1.00 0.23 ? 54  PRO A CG   1 
ATOM   810  C CD   . PRO A 1 54 ? 13.142  2.245   8.280   1.00 0.21 ? 54  PRO A CD   1 
ATOM   811  H HA   . PRO A 1 54 ? 16.127  2.979   7.322   1.00 0.20 ? 54  PRO A HA   1 
ATOM   812  H HB2  . PRO A 1 54 ? 14.796  4.950   8.958   1.00 0.28 ? 54  PRO A HB2  1 
ATOM   813  H HB3  . PRO A 1 54 ? 14.750  4.806   7.195   1.00 0.23 ? 54  PRO A HB3  1 
ATOM   814  H HG2  . PRO A 1 54 ? 12.632  4.197   9.085   1.00 0.27 ? 54  PRO A HG2  1 
ATOM   815  H HG3  . PRO A 1 54 ? 12.575  4.101   7.321   1.00 0.22 ? 54  PRO A HG3  1 
ATOM   816  H HD2  . PRO A 1 54 ? 12.681  1.911   9.201   1.00 0.23 ? 54  PRO A HD2  1 
ATOM   817  H HD3  . PRO A 1 54 ? 12.637  1.815   7.427   1.00 0.18 ? 54  PRO A HD3  1 
ATOM   818  N N    . SER A 1 55 ? 16.079  2.199   10.398  1.00 0.30 ? 55  SER A N    1 
ATOM   819  C CA   . SER A 1 55 ? 16.860  2.171   11.667  1.00 0.36 ? 55  SER A CA   1 
ATOM   820  C C    . SER A 1 55 ? 18.214  1.496   11.434  1.00 0.36 ? 55  SER A C    1 
ATOM   821  O O    . SER A 1 55 ? 19.163  1.733   12.156  1.00 0.39 ? 55  SER A O    1 
ATOM   822  C CB   . SER A 1 55 ? 16.078  1.392   12.724  1.00 0.40 ? 55  SER A CB   1 
ATOM   823  O OG   . SER A 1 55 ? 16.861  1.288   13.906  1.00 1.37 ? 55  SER A OG   1 
ATOM   824  H H    . SER A 1 55 ? 15.339  1.573   10.266  1.00 0.29 ? 55  SER A H    1 
ATOM   825  H HA   . SER A 1 55 ? 17.018  3.183   12.012  1.00 0.38 ? 55  SER A HA   1 
ATOM   826  H HB2  . SER A 1 55 ? 15.160  1.907   12.950  1.00 0.95 ? 55  SER A HB2  1 
ATOM   827  H HB3  . SER A 1 55 ? 15.850  0.404   12.344  1.00 1.14 ? 55  SER A HB3  1 
ATOM   828  H HG   . SER A 1 55 ? 16.392  0.723   14.524  1.00 1.83 ? 55  SER A HG   1 
ATOM   829  N N    . GLU A 1 56 ? 18.322  0.663   10.433  1.00 0.33 ? 56  GLU A N    1 
ATOM   830  C CA   . GLU A 1 56 ? 19.628  -0.009  10.172  1.00 0.33 ? 56  GLU A CA   1 
ATOM   831  C C    . GLU A 1 56 ? 20.544  0.956   9.417   1.00 0.32 ? 56  GLU A C    1 
ATOM   832  O O    . GLU A 1 56 ? 20.251  1.397   8.322   1.00 0.28 ? 56  GLU A O    1 
ATOM   833  C CB   . GLU A 1 56 ? 19.404  -1.281  9.346   1.00 0.31 ? 56  GLU A CB   1 
ATOM   834  C CG   . GLU A 1 56 ? 18.725  -2.364  10.206  1.00 0.35 ? 56  GLU A CG   1 
ATOM   835  C CD   . GLU A 1 56 ? 19.002  -3.749  9.612   1.00 1.30 ? 56  GLU A CD   1 
ATOM   836  O OE1  . GLU A 1 56 ? 18.768  -3.923  8.428   1.00 2.09 ? 56  GLU A OE1  1 
ATOM   837  O OE2  . GLU A 1 56 ? 19.445  -4.611  10.354  1.00 2.05 ? 56  GLU A OE2  1 
ATOM   838  H H    . GLU A 1 56 ? 17.551  0.484   9.856   1.00 0.30 ? 56  GLU A H    1 
ATOM   839  H HA   . GLU A 1 56 ? 20.092  -0.267  11.113  1.00 0.37 ? 56  GLU A HA   1 
ATOM   840  H HB2  . GLU A 1 56 ? 18.770  -1.047  8.505   1.00 0.28 ? 56  GLU A HB2  1 
ATOM   841  H HB3  . GLU A 1 56 ? 20.356  -1.644  8.990   1.00 0.31 ? 56  GLU A HB3  1 
ATOM   842  H HG2  . GLU A 1 56 ? 19.108  -2.328  11.215  1.00 0.90 ? 56  GLU A HG2  1 
ATOM   843  H HG3  . GLU A 1 56 ? 17.659  -2.193  10.221  1.00 1.05 ? 56  GLU A HG3  1 
ATOM   844  N N    . SER A 1 57 ? 21.644  1.304   10.022  1.00 0.37 ? 57  SER A N    1 
ATOM   845  C CA   . SER A 1 57 ? 22.602  2.262   9.399   1.00 0.38 ? 57  SER A CA   1 
ATOM   846  C C    . SER A 1 57 ? 22.909  1.899   7.942   1.00 0.34 ? 57  SER A C    1 
ATOM   847  O O    . SER A 1 57 ? 23.035  2.768   7.103   1.00 0.32 ? 57  SER A O    1 
ATOM   848  C CB   . SER A 1 57 ? 23.904  2.260   10.200  1.00 0.44 ? 57  SER A CB   1 
ATOM   849  O OG   . SER A 1 57 ? 24.333  0.918   10.393  1.00 1.42 ? 57  SER A OG   1 
ATOM   850  H H    . SER A 1 57 ? 21.835  0.942   10.911  1.00 0.41 ? 57  SER A H    1 
ATOM   851  H HA   . SER A 1 57 ? 22.175  3.252   9.430   1.00 0.38 ? 57  SER A HA   1 
ATOM   852  H HB2  . SER A 1 57 ? 24.662  2.802   9.659   1.00 1.16 ? 57  SER A HB2  1 
ATOM   853  H HB3  . SER A 1 57 ? 23.737  2.738   11.157  1.00 1.05 ? 57  SER A HB3  1 
ATOM   854  H HG   . SER A 1 57 ? 24.799  0.873   11.231  1.00 1.90 ? 57  SER A HG   1 
ATOM   855  N N    . TRP A 1 58 ? 23.060  0.643   7.624   1.00 0.34 ? 58  TRP A N    1 
ATOM   856  C CA   . TRP A 1 58 ? 23.390  0.296   6.213   1.00 0.31 ? 58  TRP A CA   1 
ATOM   857  C C    . TRP A 1 58 ? 22.297  0.819   5.287   1.00 0.26 ? 58  TRP A C    1 
ATOM   858  O O    . TRP A 1 58 ? 22.560  1.228   4.174   1.00 0.25 ? 58  TRP A O    1 
ATOM   859  C CB   . TRP A 1 58 ? 23.588  -1.220  6.053   1.00 0.33 ? 58  TRP A CB   1 
ATOM   860  C CG   . TRP A 1 58 ? 22.287  -1.962  6.006   1.00 0.30 ? 58  TRP A CG   1 
ATOM   861  C CD1  . TRP A 1 58 ? 21.812  -2.745  7.003   1.00 0.32 ? 58  TRP A CD1  1 
ATOM   862  C CD2  . TRP A 1 58 ? 21.308  -2.043  4.924   1.00 0.27 ? 58  TRP A CD2  1 
ATOM   863  N NE1  . TRP A 1 58 ? 20.614  -3.308  6.604   1.00 0.29 ? 58  TRP A NE1  1 
ATOM   864  C CE2  . TRP A 1 58 ? 20.254  -2.902  5.337   1.00 0.26 ? 58  TRP A CE2  1 
ATOM   865  C CE3  . TRP A 1 58 ? 21.228  -1.465  3.633   1.00 0.26 ? 58  TRP A CE3  1 
ATOM   866  C CZ2  . TRP A 1 58 ? 19.161  -3.179  4.505   1.00 0.25 ? 58  TRP A CZ2  1 
ATOM   867  C CZ3  . TRP A 1 58 ? 20.128  -1.741  2.793   1.00 0.26 ? 58  TRP A CZ3  1 
ATOM   868  C CH2  . TRP A 1 58 ? 19.097  -2.594  3.230   1.00 0.25 ? 58  TRP A CH2  1 
ATOM   869  H H    . TRP A 1 58 ? 22.971  -0.057  8.302   1.00 0.36 ? 58  TRP A H    1 
ATOM   870  H HA   . TRP A 1 58 ? 24.316  0.792   5.953   1.00 0.33 ? 58  TRP A HA   1 
ATOM   871  H HB2  . TRP A 1 58 ? 24.130  -1.409  5.139   1.00 0.35 ? 58  TRP A HB2  1 
ATOM   872  H HB3  . TRP A 1 58 ? 24.173  -1.586  6.886   1.00 0.38 ? 58  TRP A HB3  1 
ATOM   873  H HD1  . TRP A 1 58 ? 22.297  -2.912  7.954   1.00 0.36 ? 58  TRP A HD1  1 
ATOM   874  H HE1  . TRP A 1 58 ? 20.073  -3.921  7.139   1.00 0.31 ? 58  TRP A HE1  1 
ATOM   875  H HE3  . TRP A 1 58 ? 22.015  -0.818  3.285   1.00 0.27 ? 58  TRP A HE3  1 
ATOM   876  H HZ2  . TRP A 1 58 ? 18.371  -3.833  4.843   1.00 0.25 ? 58  TRP A HZ2  1 
ATOM   877  H HZ3  . TRP A 1 58 ? 20.076  -1.293  1.812   1.00 0.28 ? 58  TRP A HZ3  1 
ATOM   878  H HH2  . TRP A 1 58 ? 18.257  -2.802  2.584   1.00 0.27 ? 58  TRP A HH2  1 
ATOM   879  N N    . VAL A 1 59 ? 21.080  0.848   5.741   1.00 0.23 ? 59  VAL A N    1 
ATOM   880  C CA   . VAL A 1 59 ? 19.987  1.373   4.882   1.00 0.19 ? 59  VAL A CA   1 
ATOM   881  C C    . VAL A 1 59 ? 20.245  2.849   4.616   1.00 0.20 ? 59  VAL A C    1 
ATOM   882  O O    . VAL A 1 59 ? 20.145  3.322   3.503   1.00 0.20 ? 59  VAL A O    1 
ATOM   883  C CB   . VAL A 1 59 ? 18.658  1.206   5.617   1.00 0.19 ? 59  VAL A CB   1 
ATOM   884  C CG1  . VAL A 1 59 ? 17.514  1.788   4.778   1.00 0.18 ? 59  VAL A CG1  1 
ATOM   885  C CG2  . VAL A 1 59 ? 18.427  -0.282  5.864   1.00 0.19 ? 59  VAL A CG2  1 
ATOM   886  H H    . VAL A 1 59 ? 20.887  0.540   6.651   1.00 0.25 ? 59  VAL A H    1 
ATOM   887  H HA   . VAL A 1 59 ? 19.961  0.831   3.950   1.00 0.18 ? 59  VAL A HA   1 
ATOM   888  H HB   . VAL A 1 59 ? 18.704  1.726   6.564   1.00 0.21 ? 59  VAL A HB   1 
ATOM   889  H HG11 . VAL A 1 59 ? 17.662  1.539   3.740   1.00 1.02 ? 59  VAL A HG11 1 
ATOM   890  H HG12 . VAL A 1 59 ? 16.573  1.379   5.116   1.00 1.06 ? 59  VAL A HG12 1 
ATOM   891  H HG13 . VAL A 1 59 ? 17.499  2.862   4.890   1.00 1.00 ? 59  VAL A HG13 1 
ATOM   892  H HG21 . VAL A 1 59 ? 19.317  -0.708  6.302   1.00 1.05 ? 59  VAL A HG21 1 
ATOM   893  H HG22 . VAL A 1 59 ? 17.596  -0.416  6.538   1.00 1.01 ? 59  VAL A HG22 1 
ATOM   894  H HG23 . VAL A 1 59 ? 18.218  -0.775  4.927   1.00 1.03 ? 59  VAL A HG23 1 
ATOM   895  N N    . GLN A 1 60 ? 20.587  3.576   5.634   1.00 0.24 ? 60  GLN A N    1 
ATOM   896  C CA   . GLN A 1 60 ? 20.864  5.025   5.455   1.00 0.27 ? 60  GLN A CA   1 
ATOM   897  C C    . GLN A 1 60 ? 22.089  5.192   4.545   1.00 0.27 ? 60  GLN A C    1 
ATOM   898  O O    . GLN A 1 60 ? 22.130  6.051   3.687   1.00 0.29 ? 60  GLN A O    1 
ATOM   899  C CB   . GLN A 1 60 ? 21.128  5.645   6.844   1.00 0.32 ? 60  GLN A CB   1 
ATOM   900  C CG   . GLN A 1 60 ? 20.589  7.078   6.915   1.00 1.22 ? 60  GLN A CG   1 
ATOM   901  C CD   . GLN A 1 60 ? 20.621  7.555   8.369   1.00 1.62 ? 60  GLN A CD   1 
ATOM   902  O OE1  . GLN A 1 60 ? 20.329  6.798   9.275   1.00 2.20 ? 60  GLN A OE1  1 
ATOM   903  N NE2  . GLN A 1 60 ? 20.966  8.785   8.634   1.00 2.24 ? 60  GLN A NE2  1 
ATOM   904  H H    . GLN A 1 60 ? 20.668  3.164   6.523   1.00 0.25 ? 60  GLN A H    1 
ATOM   905  H HA   . GLN A 1 60 ? 20.011  5.492   4.990   1.00 0.27 ? 60  GLN A HA   1 
ATOM   906  H HB2  . GLN A 1 60 ? 20.635  5.047   7.595   1.00 0.90 ? 60  GLN A HB2  1 
ATOM   907  H HB3  . GLN A 1 60 ? 22.191  5.657   7.046   1.00 0.91 ? 60  GLN A HB3  1 
ATOM   908  H HG2  . GLN A 1 60 ? 21.205  7.725   6.308   1.00 1.94 ? 60  GLN A HG2  1 
ATOM   909  H HG3  . GLN A 1 60 ? 19.572  7.104   6.556   1.00 1.81 ? 60  GLN A HG3  1 
ATOM   910  H HE21 . GLN A 1 60 ? 21.202  9.394   7.905   1.00 2.58 ? 60  GLN A HE21 1 
ATOM   911  H HE22 . GLN A 1 60 ? 20.990  9.098   9.563   1.00 2.73 ? 60  GLN A HE22 1 
ATOM   912  N N    . GLU A 1 61 ? 23.086  4.373   4.738   1.00 0.28 ? 61  GLU A N    1 
ATOM   913  C CA   . GLU A 1 61 ? 24.319  4.470   3.900   1.00 0.30 ? 61  GLU A CA   1 
ATOM   914  C C    . GLU A 1 61 ? 23.989  4.171   2.434   1.00 0.28 ? 61  GLU A C    1 
ATOM   915  O O    . GLU A 1 61 ? 24.394  4.889   1.541   1.00 0.29 ? 61  GLU A O    1 
ATOM   916  C CB   . GLU A 1 61 ? 25.354  3.458   4.400   1.00 0.31 ? 61  GLU A CB   1 
ATOM   917  C CG   . GLU A 1 61 ? 26.683  3.682   3.673   1.00 0.34 ? 61  GLU A CG   1 
ATOM   918  C CD   . GLU A 1 61 ? 27.791  2.896   4.379   1.00 1.15 ? 61  GLU A CD   1 
ATOM   919  O OE1  . GLU A 1 61 ? 27.674  2.691   5.576   1.00 1.82 ? 61  GLU A OE1  1 
ATOM   920  O OE2  . GLU A 1 61 ? 28.737  2.515   3.710   1.00 1.94 ? 61  GLU A OE2  1 
ATOM   921  H H    . GLU A 1 61 ? 23.024  3.696   5.441   1.00 0.28 ? 61  GLU A H    1 
ATOM   922  H HA   . GLU A 1 61 ? 24.725  5.465   3.979   1.00 0.32 ? 61  GLU A HA   1 
ATOM   923  H HB2  . GLU A 1 61 ? 25.498  3.587   5.463   1.00 0.33 ? 61  GLU A HB2  1 
ATOM   924  H HB3  . GLU A 1 61 ? 25.003  2.457   4.203   1.00 0.31 ? 61  GLU A HB3  1 
ATOM   925  H HG2  . GLU A 1 61 ? 26.595  3.342   2.651   1.00 0.81 ? 61  GLU A HG2  1 
ATOM   926  H HG3  . GLU A 1 61 ? 26.929  4.733   3.684   1.00 0.86 ? 61  GLU A HG3  1 
ATOM   927  N N    . TYR A 1 62 ? 23.264  3.118   2.175   1.00 0.26 ? 62  TYR A N    1 
ATOM   928  C CA   . TYR A 1 62 ? 22.921  2.780   0.762   1.00 0.25 ? 62  TYR A CA   1 
ATOM   929  C C    . TYR A 1 62 ? 22.096  3.918   0.151   1.00 0.26 ? 62  TYR A C    1 
ATOM   930  O O    . TYR A 1 62 ? 22.239  4.242   -1.011  1.00 0.27 ? 62  TYR A O    1 
ATOM   931  C CB   . TYR A 1 62 ? 22.112  1.471   0.715   1.00 0.23 ? 62  TYR A CB   1 
ATOM   932  C CG   . TYR A 1 62 ? 23.038  0.266   0.769   1.00 0.23 ? 62  TYR A CG   1 
ATOM   933  C CD1  . TYR A 1 62 ? 24.040  0.172   1.759   1.00 0.26 ? 62  TYR A CD1  1 
ATOM   934  C CD2  . TYR A 1 62 ? 22.895  -0.768  -0.179  1.00 0.24 ? 62  TYR A CD2  1 
ATOM   935  C CE1  . TYR A 1 62 ? 24.890  -0.950  1.797   1.00 0.27 ? 62  TYR A CE1  1 
ATOM   936  C CE2  . TYR A 1 62 ? 23.745  -1.888  -0.140  1.00 0.25 ? 62  TYR A CE2  1 
ATOM   937  C CZ   . TYR A 1 62 ? 24.744  -1.980  0.848   1.00 0.27 ? 62  TYR A CZ   1 
ATOM   938  O OH   . TYR A 1 62 ? 25.578  -3.079  0.885   1.00 0.29 ? 62  TYR A OH   1 
ATOM   939  H H    . TYR A 1 62 ? 22.950  2.548   2.907   1.00 0.25 ? 62  TYR A H    1 
ATOM   940  H HA   . TYR A 1 62 ? 23.832  2.661   0.194   1.00 0.27 ? 62  TYR A HA   1 
ATOM   941  H HB2  . TYR A 1 62 ? 21.441  1.438   1.561   1.00 0.22 ? 62  TYR A HB2  1 
ATOM   942  H HB3  . TYR A 1 62 ? 21.533  1.434   -0.199  1.00 0.23 ? 62  TYR A HB3  1 
ATOM   943  H HD1  . TYR A 1 62 ? 24.159  0.956   2.487   1.00 0.27 ? 62  TYR A HD1  1 
ATOM   944  H HD2  . TYR A 1 62 ? 22.129  -0.701  -0.938  1.00 0.24 ? 62  TYR A HD2  1 
ATOM   945  H HE1  . TYR A 1 62 ? 25.656  -1.021  2.555   1.00 0.30 ? 62  TYR A HE1  1 
ATOM   946  H HE2  . TYR A 1 62 ? 23.632  -2.677  -0.867  1.00 0.26 ? 62  TYR A HE2  1 
ATOM   947  H HH   . TYR A 1 62 ? 25.912  -3.230  -0.003  1.00 0.87 ? 62  TYR A HH   1 
ATOM   948  N N    . VAL A 1 63 ? 21.245  4.535   0.922   1.00 0.26 ? 63  VAL A N    1 
ATOM   949  C CA   . VAL A 1 63 ? 20.434  5.653   0.377   1.00 0.27 ? 63  VAL A CA   1 
ATOM   950  C C    . VAL A 1 63 ? 21.375  6.800   0.029   1.00 0.31 ? 63  VAL A C    1 
ATOM   951  O O    . VAL A 1 63 ? 21.254  7.430   -1.000  1.00 0.33 ? 63  VAL A O    1 
ATOM   952  C CB   . VAL A 1 63 ? 19.412  6.102   1.426   1.00 0.28 ? 63  VAL A CB   1 
ATOM   953  C CG1  . VAL A 1 63 ? 18.806  7.454   1.031   1.00 0.31 ? 63  VAL A CG1  1 
ATOM   954  C CG2  . VAL A 1 63 ? 18.297  5.059   1.515   1.00 0.24 ? 63  VAL A CG2  1 
ATOM   955  H H    . VAL A 1 63 ? 21.151  4.275   1.860   1.00 0.25 ? 63  VAL A H    1 
ATOM   956  H HA   . VAL A 1 63 ? 19.921  5.327   -0.513  1.00 0.27 ? 63  VAL A HA   1 
ATOM   957  H HB   . VAL A 1 63 ? 19.900  6.193   2.386   1.00 0.29 ? 63  VAL A HB   1 
ATOM   958  H HG11 . VAL A 1 63 ? 18.556  7.442   -0.020  1.00 1.09 ? 63  VAL A HG11 1 
ATOM   959  H HG12 . VAL A 1 63 ? 17.913  7.633   1.612   1.00 1.05 ? 63  VAL A HG12 1 
ATOM   960  H HG13 . VAL A 1 63 ? 19.523  8.239   1.221   1.00 1.07 ? 63  VAL A HG13 1 
ATOM   961  H HG21 . VAL A 1 63 ? 17.836  4.943   0.545   1.00 1.03 ? 63  VAL A HG21 1 
ATOM   962  H HG22 . VAL A 1 63 ? 18.712  4.114   1.831   1.00 1.03 ? 63  VAL A HG22 1 
ATOM   963  H HG23 . VAL A 1 63 ? 17.555  5.384   2.229   1.00 1.05 ? 63  VAL A HG23 1 
ATOM   964  N N    . TYR A 1 64 ? 22.320  7.063   0.884   1.00 0.33 ? 64  TYR A N    1 
ATOM   965  C CA   . TYR A 1 64 ? 23.278  8.163   0.616   1.00 0.37 ? 64  TYR A CA   1 
ATOM   966  C C    . TYR A 1 64 ? 24.039  7.860   -0.673  1.00 0.37 ? 64  TYR A C    1 
ATOM   967  O O    . TYR A 1 64 ? 24.249  8.720   -1.502  1.00 0.40 ? 64  TYR A O    1 
ATOM   968  C CB   . TYR A 1 64 ? 24.265  8.261   1.786   1.00 0.39 ? 64  TYR A CB   1 
ATOM   969  C CG   . TYR A 1 64 ? 24.933  9.618   1.788   1.00 0.43 ? 64  TYR A CG   1 
ATOM   970  C CD1  . TYR A 1 64 ? 24.200  10.762  2.156   1.00 0.45 ? 64  TYR A CD1  1 
ATOM   971  C CD2  . TYR A 1 64 ? 26.289  9.740   1.425   1.00 0.47 ? 64  TYR A CD2  1 
ATOM   972  C CE1  . TYR A 1 64 ? 24.821  12.026  2.162   1.00 0.49 ? 64  TYR A CE1  1 
ATOM   973  C CE2  . TYR A 1 64 ? 26.910  11.004  1.430   1.00 0.51 ? 64  TYR A CE2  1 
ATOM   974  C CZ   . TYR A 1 64 ? 26.176  12.147  1.799   1.00 0.52 ? 64  TYR A CZ   1 
ATOM   975  O OH   . TYR A 1 64 ? 26.785  13.386  1.804   1.00 0.57 ? 64  TYR A OH   1 
ATOM   976  H H    . TYR A 1 64 ? 22.398  6.534   1.704   1.00 0.32 ? 64  TYR A H    1 
ATOM   977  H HA   . TYR A 1 64 ? 22.738  9.087   0.512   1.00 0.38 ? 64  TYR A HA   1 
ATOM   978  H HB2  . TYR A 1 64 ? 23.729  8.124   2.712   1.00 0.39 ? 64  TYR A HB2  1 
ATOM   979  H HB3  . TYR A 1 64 ? 25.015  7.489   1.693   1.00 0.39 ? 64  TYR A HB3  1 
ATOM   980  H HD1  . TYR A 1 64 ? 23.160  10.670  2.435   1.00 0.44 ? 64  TYR A HD1  1 
ATOM   981  H HD2  . TYR A 1 64 ? 26.853  8.863   1.142   1.00 0.47 ? 64  TYR A HD2  1 
ATOM   982  H HE1  . TYR A 1 64 ? 24.257  12.903  2.445   1.00 0.51 ? 64  TYR A HE1  1 
ATOM   983  H HE2  . TYR A 1 64 ? 27.949  11.096  1.152   1.00 0.55 ? 64  TYR A HE2  1 
ATOM   984  H HH   . TYR A 1 64 ? 27.736  13.249  1.789   1.00 0.96 ? 64  TYR A HH   1 
ATOM   985  N N    . ASP A 1 65 ? 24.450  6.638   -0.842  1.00 0.36 ? 65  ASP A N    1 
ATOM   986  C CA   . ASP A 1 65 ? 25.199  6.263   -2.073  1.00 0.37 ? 65  ASP A CA   1 
ATOM   987  C C    . ASP A 1 65 ? 24.307  6.468   -3.299  1.00 0.37 ? 65  ASP A C    1 
ATOM   988  O O    . ASP A 1 65 ? 24.768  6.836   -4.361  1.00 0.40 ? 65  ASP A O    1 
ATOM   989  C CB   . ASP A 1 65 ? 25.616  4.792   -1.981  1.00 0.36 ? 65  ASP A CB   1 
ATOM   990  C CG   . ASP A 1 65 ? 26.829  4.651   -1.058  1.00 0.38 ? 65  ASP A CG   1 
ATOM   991  O OD1  . ASP A 1 65 ? 27.645  5.557   -1.038  1.00 1.21 ? 65  ASP A OD1  1 
ATOM   992  O OD2  . ASP A 1 65 ? 26.921  3.637   -0.386  1.00 1.07 ? 65  ASP A OD2  1 
ATOM   993  H H    . ASP A 1 65 ? 24.263  5.963   -0.155  1.00 0.34 ? 65  ASP A H    1 
ATOM   994  H HA   . ASP A 1 65 ? 26.075  6.886   -2.163  1.00 0.41 ? 65  ASP A HA   1 
ATOM   995  H HB2  . ASP A 1 65 ? 24.795  4.212   -1.586  1.00 0.32 ? 65  ASP A HB2  1 
ATOM   996  H HB3  . ASP A 1 65 ? 25.869  4.427   -2.963  1.00 0.37 ? 65  ASP A HB3  1 
ATOM   997  N N    . LEU A 1 66 ? 23.036  6.232   -3.158  1.00 0.34 ? 66  LEU A N    1 
ATOM   998  C CA   . LEU A 1 66 ? 22.111  6.409   -4.309  1.00 0.34 ? 66  LEU A CA   1 
ATOM   999  C C    . LEU A 1 66 ? 21.936  7.903   -4.595  1.00 0.39 ? 66  LEU A C    1 
ATOM   1000 O O    . LEU A 1 66 ? 21.701  8.306   -5.717  1.00 0.42 ? 66  LEU A O    1 
ATOM   1001 C CB   . LEU A 1 66 ? 20.757  5.779   -3.959  1.00 0.31 ? 66  LEU A CB   1 
ATOM   1002 C CG   . LEU A 1 66 ? 20.812  4.249   -4.173  1.00 0.28 ? 66  LEU A CG   1 
ATOM   1003 C CD1  . LEU A 1 66 ? 19.712  3.563   -3.357  1.00 0.24 ? 66  LEU A CD1  1 
ATOM   1004 C CD2  . LEU A 1 66 ? 20.598  3.911   -5.658  1.00 0.30 ? 66  LEU A CD2  1 
ATOM   1005 H H    . LEU A 1 66 ? 22.689  5.935   -2.293  1.00 0.32 ? 66  LEU A H    1 
ATOM   1006 H HA   . LEU A 1 66 ? 22.526  5.928   -5.179  1.00 0.35 ? 66  LEU A HA   1 
ATOM   1007 H HB2  . LEU A 1 66 ? 20.531  5.991   -2.923  1.00 0.29 ? 66  LEU A HB2  1 
ATOM   1008 H HB3  . LEU A 1 66 ? 19.988  6.206   -4.581  1.00 0.32 ? 66  LEU A HB3  1 
ATOM   1009 H HG   . LEU A 1 66 ? 21.775  3.876   -3.854  1.00 0.28 ? 66  LEU A HG   1 
ATOM   1010 H HD11 . LEU A 1 66 ? 19.760  3.890   -2.331  1.00 0.96 ? 66  LEU A HD11 1 
ATOM   1011 H HD12 . LEU A 1 66 ? 18.748  3.815   -3.769  1.00 1.01 ? 66  LEU A HD12 1 
ATOM   1012 H HD13 . LEU A 1 66 ? 19.850  2.494   -3.398  1.00 1.01 ? 66  LEU A HD13 1 
ATOM   1013 H HD21 . LEU A 1 66 ? 19.744  4.452   -6.037  1.00 1.02 ? 66  LEU A HD21 1 
ATOM   1014 H HD22 . LEU A 1 66 ? 21.476  4.180   -6.224  1.00 1.09 ? 66  LEU A HD22 1 
ATOM   1015 H HD23 . LEU A 1 66 ? 20.421  2.851   -5.761  1.00 1.06 ? 66  LEU A HD23 1 
ATOM   1016 N N    . GLU A 1 67 ? 22.053  8.727   -3.593  1.00 0.39 ? 67  GLU A N    1 
ATOM   1017 C CA   . GLU A 1 67 ? 21.899  10.192  -3.815  1.00 0.44 ? 67  GLU A CA   1 
ATOM   1018 C C    . GLU A 1 67 ? 23.146  10.734  -4.519  1.00 0.49 ? 67  GLU A C    1 
ATOM   1019 O O    . GLU A 1 67 ? 23.079  11.685  -5.271  1.00 0.53 ? 67  GLU A O    1 
ATOM   1020 C CB   . GLU A 1 67 ? 21.722  10.907  -2.467  1.00 0.44 ? 67  GLU A CB   1 
ATOM   1021 C CG   . GLU A 1 67 ? 20.384  10.498  -1.814  1.00 0.41 ? 67  GLU A CG   1 
ATOM   1022 C CD   . GLU A 1 67 ? 19.846  11.645  -0.950  1.00 1.11 ? 67  GLU A CD   1 
ATOM   1023 O OE1  . GLU A 1 67 ? 19.854  12.770  -1.423  1.00 1.91 ? 67  GLU A OE1  1 
ATOM   1024 O OE2  . GLU A 1 67 ? 19.435  11.378  0.167   1.00 1.72 ? 67  GLU A OE2  1 
ATOM   1025 H H    . GLU A 1 67 ? 22.244  8.380   -2.697  1.00 0.37 ? 67  GLU A H    1 
ATOM   1026 H HA   . GLU A 1 67 ? 21.035  10.372  -4.436  1.00 0.45 ? 67  GLU A HA   1 
ATOM   1027 H HB2  . GLU A 1 67 ? 22.540  10.637  -1.813  1.00 0.43 ? 67  GLU A HB2  1 
ATOM   1028 H HB3  . GLU A 1 67 ? 21.736  11.974  -2.630  1.00 0.48 ? 67  GLU A HB3  1 
ATOM   1029 H HG2  . GLU A 1 67 ? 19.658  10.259  -2.578  1.00 0.88 ? 67  GLU A HG2  1 
ATOM   1030 H HG3  . GLU A 1 67 ? 20.541  9.633   -1.190  1.00 0.81 ? 67  GLU A HG3  1 
ATOM   1031 N N    . LEU A 1 68 ? 24.282  10.135  -4.286  1.00 0.49 ? 68  LEU A N    1 
ATOM   1032 C CA   . LEU A 1 68 ? 25.525  10.623  -4.952  1.00 0.54 ? 68  LEU A CA   1 
ATOM   1033 C C    . LEU A 1 68 ? 25.561  10.129  -6.398  1.00 0.55 ? 68  LEU A C    1 
ATOM   1034 O O    . LEU A 1 68 ? 25.227  10.847  -7.320  1.00 0.60 ? 68  LEU A O    1 
ATOM   1035 C CB   . LEU A 1 68 ? 26.760  10.102  -4.215  1.00 0.54 ? 68  LEU A CB   1 
ATOM   1036 C CG   . LEU A 1 68 ? 26.721  10.532  -2.745  1.00 0.54 ? 68  LEU A CG   1 
ATOM   1037 C CD1  . LEU A 1 68 ? 27.782  9.747   -1.981  1.00 0.55 ? 68  LEU A CD1  1 
ATOM   1038 C CD2  . LEU A 1 68 ? 27.019  12.035  -2.616  1.00 0.59 ? 68  LEU A CD2  1 
ATOM   1039 H H    . LEU A 1 68 ? 24.314  9.368   -3.677  1.00 0.45 ? 68  LEU A H    1 
ATOM   1040 H HA   . LEU A 1 68 ? 25.537  11.697  -4.944  1.00 0.57 ? 68  LEU A HA   1 
ATOM   1041 H HB2  . LEU A 1 68 ? 26.779  9.023   -4.271  1.00 0.51 ? 68  LEU A HB2  1 
ATOM   1042 H HB3  . LEU A 1 68 ? 27.648  10.498  -4.681  1.00 0.58 ? 68  LEU A HB3  1 
ATOM   1043 H HG   . LEU A 1 68 ? 25.748  10.313  -2.332  1.00 0.50 ? 68  LEU A HG   1 
ATOM   1044 H HD11 . LEU A 1 68 ? 28.725  9.826   -2.501  1.00 1.13 ? 68  LEU A HD11 1 
ATOM   1045 H HD12 . LEU A 1 68 ? 27.882  10.147  -0.986  1.00 1.23 ? 68  LEU A HD12 1 
ATOM   1046 H HD13 . LEU A 1 68 ? 27.487  8.713   -1.927  1.00 1.12 ? 68  LEU A HD13 1 
ATOM   1047 H HD21 . LEU A 1 68 ? 27.886  12.286  -3.208  1.00 1.13 ? 68  LEU A HD21 1 
ATOM   1048 H HD22 . LEU A 1 68 ? 26.171  12.607  -2.960  1.00 1.21 ? 68  LEU A HD22 1 
ATOM   1049 H HD23 . LEU A 1 68 ? 27.211  12.278  -1.581  1.00 1.20 ? 68  LEU A HD23 1 
ATOM   1050 N N    . ASN A 1 69 ? 25.971  8.906   -6.605  1.00 0.61 ? 69  ASN A N    1 
ATOM   1051 C CA   . ASN A 1 69 ? 26.041  8.357   -7.992  1.00 0.65 ? 69  ASN A CA   1 
ATOM   1052 C C    . ASN A 1 69 ? 24.698  7.710   -8.350  1.00 0.71 ? 69  ASN A C    1 
ATOM   1053 O O    . ASN A 1 69 ? 24.290  7.834   -9.493  1.00 1.17 ? 69  ASN A O    1 
ATOM   1054 C CB   . ASN A 1 69 ? 27.178  7.311   -8.057  1.00 0.81 ? 69  ASN A CB   1 
ATOM   1055 C CG   . ASN A 1 69 ? 27.910  7.397   -9.404  1.00 1.73 ? 69  ASN A CG   1 
ATOM   1056 O OD1  . ASN A 1 69 ? 27.498  6.793   -10.375 1.00 2.51 ? 69  ASN A OD1  1 
ATOM   1057 N ND2  . ASN A 1 69 ? 28.987  8.129   -9.497  1.00 2.50 ? 69  ASN A ND2  1 
ATOM   1058 O OXT  . ASN A 1 69 ? 24.103  7.103   -7.475  1.00 1.45 ? 69  ASN A OXT  1 
ATOM   1059 H H    . ASN A 1 69 ? 26.239  8.349   -5.848  1.00 0.69 ? 69  ASN A H    1 
ATOM   1060 H HA   . ASN A 1 69 ? 26.244  9.163   -8.684  1.00 0.62 ? 69  ASN A HA   1 
ATOM   1061 H HB2  . ASN A 1 69 ? 27.880  7.507   -7.261  1.00 1.43 ? 69  ASN A HB2  1 
ATOM   1062 H HB3  . ASN A 1 69 ? 26.772  6.315   -7.935  1.00 1.16 ? 69  ASN A HB3  1 
ATOM   1063 H HD21 . ASN A 1 69 ? 29.317  8.616   -8.713  1.00 2.62 ? 69  ASN A HD21 1 
ATOM   1064 H HD22 . ASN A 1 69 ? 29.464  8.194   -10.352 1.00 3.32 ? 69  ASN A HD22 1 
ATOM   1065 N N    . ALA B 1 1  ? 9.385   -18.196 -12.314 1.00 3.69 ? 1   ALA B N    1 
ATOM   1066 C CA   . ALA B 1 1  ? 8.694   -16.928 -11.940 1.00 3.21 ? 1   ALA B CA   1 
ATOM   1067 C C    . ALA B 1 1  ? 8.945   -16.627 -10.454 1.00 2.70 ? 1   ALA B C    1 
ATOM   1068 O O    . ALA B 1 1  ? 8.042   -16.744 -9.649  1.00 2.72 ? 1   ALA B O    1 
ATOM   1069 C CB   . ALA B 1 1  ? 7.189   -17.082 -12.178 1.00 3.46 ? 1   ALA B CB   1 
ATOM   1070 H H1   . ALA B 1 1  ? 10.043  -18.471 -11.557 1.00 3.97 ? 1   ALA B H1   1 
ATOM   1071 H H2   . ALA B 1 1  ? 8.681   -18.949 -12.447 1.00 4.00 ? 1   ALA B H2   1 
ATOM   1072 H H3   . ALA B 1 1  ? 9.913   -18.056 -13.200 1.00 3.97 ? 1   ALA B H3   1 
ATOM   1073 H HA   . ALA B 1 1  ? 9.069   -16.117 -12.545 1.00 3.58 ? 1   ALA B HA   1 
ATOM   1074 H HB1  . ALA B 1 1  ? 7.023   -17.549 -13.138 1.00 3.62 ? 1   ALA B HB1  1 
ATOM   1075 H HB2  . ALA B 1 1  ? 6.762   -17.697 -11.400 1.00 3.86 ? 1   ALA B HB2  1 
ATOM   1076 H HB3  . ALA B 1 1  ? 6.720   -16.109 -12.167 1.00 3.69 ? 1   ALA B HB3  1 
ATOM   1077 N N    . PRO B 1 2  ? 10.163  -16.254 -10.122 1.00 2.35 ? 2   PRO B N    1 
ATOM   1078 C CA   . PRO B 1 2  ? 10.518  -15.949 -8.724  1.00 1.97 ? 2   PRO B CA   1 
ATOM   1079 C C    . PRO B 1 2  ? 9.670   -14.772 -8.218  1.00 1.70 ? 2   PRO B C    1 
ATOM   1080 O O    . PRO B 1 2  ? 9.445   -13.807 -8.921  1.00 1.73 ? 2   PRO B O    1 
ATOM   1081 C CB   . PRO B 1 2  ? 12.025  -15.594 -8.763  1.00 1.82 ? 2   PRO B CB   1 
ATOM   1082 C CG   . PRO B 1 2  ? 12.506  -15.762 -10.235 1.00 2.08 ? 2   PRO B CG   1 
ATOM   1083 C CD   . PRO B 1 2  ? 11.271  -16.112 -11.092 1.00 2.44 ? 2   PRO B CD   1 
ATOM   1084 H HA   . PRO B 1 2  ? 10.357  -16.816 -8.103  1.00 2.21 ? 2   PRO B HA   1 
ATOM   1085 H HB2  . PRO B 1 2  ? 12.180  -14.571 -8.435  1.00 1.58 ? 2   PRO B HB2  1 
ATOM   1086 H HB3  . PRO B 1 2  ? 12.580  -16.266 -8.122  1.00 2.00 ? 2   PRO B HB3  1 
ATOM   1087 H HG2  . PRO B 1 2  ? 12.954  -14.838 -10.584 1.00 2.03 ? 2   PRO B HG2  1 
ATOM   1088 H HG3  . PRO B 1 2  ? 13.233  -16.561 -10.299 1.00 2.26 ? 2   PRO B HG3  1 
ATOM   1089 H HD2  . PRO B 1 2  ? 11.062  -15.311 -11.789 1.00 2.58 ? 2   PRO B HD2  1 
ATOM   1090 H HD3  . PRO B 1 2  ? 11.420  -17.042 -11.621 1.00 2.76 ? 2   PRO B HD3  1 
ATOM   1091 N N    . MET B 1 3  ? 9.195   -14.851 -7.005  1.00 1.58 ? 3   MET B N    1 
ATOM   1092 C CA   . MET B 1 3  ? 8.360   -13.745 -6.457  1.00 1.46 ? 3   MET B CA   1 
ATOM   1093 C C    . MET B 1 3  ? 9.266   -12.597 -6.003  1.00 1.12 ? 3   MET B C    1 
ATOM   1094 O O    . MET B 1 3  ? 10.421  -12.795 -5.682  1.00 0.94 ? 3   MET B O    1 
ATOM   1095 C CB   . MET B 1 3  ? 7.550   -14.266 -5.262  1.00 1.62 ? 3   MET B CB   1 
ATOM   1096 C CG   . MET B 1 3  ? 7.109   -15.706 -5.529  1.00 2.03 ? 3   MET B CG   1 
ATOM   1097 S SD   . MET B 1 3  ? 5.971   -16.238 -4.225  1.00 2.41 ? 3   MET B SD   1 
ATOM   1098 C CE   . MET B 1 3  ? 6.459   -17.981 -4.186  1.00 3.28 ? 3   MET B CE   1 
ATOM   1099 H H    . MET B 1 3  ? 9.384   -15.640 -6.455  1.00 1.68 ? 3   MET B H    1 
ATOM   1100 H HA   . MET B 1 3  ? 7.686   -13.390 -7.222  1.00 1.66 ? 3   MET B HA   1 
ATOM   1101 H HB2  . MET B 1 3  ? 8.159   -14.239 -4.368  1.00 1.96 ? 3   MET B HB2  1 
ATOM   1102 H HB3  . MET B 1 3  ? 6.678   -13.645 -5.121  1.00 1.90 ? 3   MET B HB3  1 
ATOM   1103 H HG2  . MET B 1 3  ? 6.612   -15.759 -6.486  1.00 2.40 ? 3   MET B HG2  1 
ATOM   1104 H HG3  . MET B 1 3  ? 7.976   -16.350 -5.537  1.00 2.55 ? 3   MET B HG3  1 
ATOM   1105 H HE1  . MET B 1 3  ? 6.585   -18.341 -5.198  1.00 3.69 ? 3   MET B HE1  1 
ATOM   1106 H HE2  . MET B 1 3  ? 7.390   -18.083 -3.652  1.00 3.73 ? 3   MET B HE2  1 
ATOM   1107 H HE3  . MET B 1 3  ? 5.694   -18.558 -3.685  1.00 3.55 ? 3   MET B HE3  1 
ATOM   1108 N N    . GLY B 1 4  ? 8.749   -11.400 -5.963  1.00 1.11 ? 4   GLY B N    1 
ATOM   1109 C CA   . GLY B 1 4  ? 9.585   -10.251 -5.516  1.00 0.88 ? 4   GLY B CA   1 
ATOM   1110 C C    . GLY B 1 4  ? 10.189  -10.583 -4.153  1.00 0.61 ? 4   GLY B C    1 
ATOM   1111 O O    . GLY B 1 4  ? 9.985   -11.658 -3.624  1.00 0.68 ? 4   GLY B O    1 
ATOM   1112 H H    . GLY B 1 4  ? 7.814   -11.258 -6.217  1.00 1.32 ? 4   GLY B H    1 
ATOM   1113 H HA2  . GLY B 1 4  ? 10.376  -10.079 -6.233  1.00 0.83 ? 4   GLY B HA2  1 
ATOM   1114 H HA3  . GLY B 1 4  ? 8.973   -9.367  -5.432  1.00 1.03 ? 4   GLY B HA3  1 
ATOM   1115 N N    . SER B 1 5  ? 10.931  -9.679  -3.573  1.00 0.45 ? 5   SER B N    1 
ATOM   1116 C CA   . SER B 1 5  ? 11.541  -9.965  -2.241  1.00 0.31 ? 5   SER B CA   1 
ATOM   1117 C C    . SER B 1 5  ? 10.538  -9.601  -1.133  1.00 0.29 ? 5   SER B C    1 
ATOM   1118 O O    . SER B 1 5  ? 10.027  -10.458 -0.441  1.00 0.32 ? 5   SER B O    1 
ATOM   1119 C CB   . SER B 1 5  ? 12.843  -9.158  -2.094  1.00 0.51 ? 5   SER B CB   1 
ATOM   1120 O OG   . SER B 1 5  ? 13.921  -10.054 -1.853  1.00 1.56 ? 5   SER B OG   1 
ATOM   1121 H H    . SER B 1 5  ? 11.089  -8.817  -4.011  1.00 0.57 ? 5   SER B H    1 
ATOM   1122 H HA   . SER B 1 5  ? 11.771  -11.019 -2.174  1.00 0.39 ? 5   SER B HA   1 
ATOM   1123 H HB2  . SER B 1 5  ? 13.036  -8.621  -3.007  1.00 0.87 ? 5   SER B HB2  1 
ATOM   1124 H HB3  . SER B 1 5  ? 12.761  -8.453  -1.276  1.00 0.94 ? 5   SER B HB3  1 
ATOM   1125 H HG   . SER B 1 5  ? 14.317  -10.280 -2.699  1.00 2.00 ? 5   SER B HG   1 
ATOM   1126 N N    . ASP B 1 6  ? 10.255  -8.337  -0.962  1.00 0.25 ? 6   ASP B N    1 
ATOM   1127 C CA   . ASP B 1 6  ? 9.288   -7.926  0.099   1.00 0.24 ? 6   ASP B CA   1 
ATOM   1128 C C    . ASP B 1 6  ? 8.752   -6.514  -0.231  1.00 0.22 ? 6   ASP B C    1 
ATOM   1129 O O    . ASP B 1 6  ? 9.102   -5.550  0.423   1.00 0.20 ? 6   ASP B O    1 
ATOM   1130 C CB   . ASP B 1 6  ? 10.010  -7.947  1.477   1.00 0.25 ? 6   ASP B CB   1 
ATOM   1131 C CG   . ASP B 1 6  ? 9.478   -9.094  2.351   1.00 1.29 ? 6   ASP B CG   1 
ATOM   1132 O OD1  . ASP B 1 6  ? 9.133   -10.124 1.797   1.00 1.96 ? 6   ASP B OD1  1 
ATOM   1133 O OD2  . ASP B 1 6  ? 9.425   -8.917  3.557   1.00 2.10 ? 6   ASP B OD2  1 
ATOM   1134 H H    . ASP B 1 6  ? 10.677  -7.659  -1.533  1.00 0.24 ? 6   ASP B H    1 
ATOM   1135 H HA   . ASP B 1 6  ? 8.462   -8.622  0.110   1.00 0.27 ? 6   ASP B HA   1 
ATOM   1136 H HB2  . ASP B 1 6  ? 11.066  -8.093  1.318   1.00 0.80 ? 6   ASP B HB2  1 
ATOM   1137 H HB3  . ASP B 1 6  ? 9.859   -7.012  1.999   1.00 0.92 ? 6   ASP B HB3  1 
ATOM   1138 N N    . PRO B 1 7  ? 7.922   -6.422  -1.249  1.00 0.24 ? 7   PRO B N    1 
ATOM   1139 C CA   . PRO B 1 7  ? 7.355   -5.124  -1.662  1.00 0.23 ? 7   PRO B CA   1 
ATOM   1140 C C    . PRO B 1 7  ? 6.447   -4.567  -0.543  1.00 0.22 ? 7   PRO B C    1 
ATOM   1141 O O    . PRO B 1 7  ? 6.090   -5.291  0.365   1.00 0.22 ? 7   PRO B O    1 
ATOM   1142 C CB   . PRO B 1 7  ? 6.540   -5.439  -2.942  1.00 0.28 ? 7   PRO B CB   1 
ATOM   1143 C CG   . PRO B 1 7  ? 6.687   -6.963  -3.228  1.00 0.30 ? 7   PRO B CG   1 
ATOM   1144 C CD   . PRO B 1 7  ? 7.495   -7.579  -2.066  1.00 0.29 ? 7   PRO B CD   1 
ATOM   1145 H HA   . PRO B 1 7  ? 8.154   -4.437  -1.886  1.00 0.22 ? 7   PRO B HA   1 
ATOM   1146 H HB2  . PRO B 1 7  ? 5.494   -5.188  -2.794  1.00 0.28 ? 7   PRO B HB2  1 
ATOM   1147 H HB3  . PRO B 1 7  ? 6.929   -4.876  -3.777  1.00 0.29 ? 7   PRO B HB3  1 
ATOM   1148 H HG2  . PRO B 1 7  ? 5.706   -7.424  -3.287  1.00 0.33 ? 7   PRO B HG2  1 
ATOM   1149 H HG3  . PRO B 1 7  ? 7.214   -7.116  -4.160  1.00 0.33 ? 7   PRO B HG3  1 
ATOM   1150 H HD2  . PRO B 1 7  ? 6.865   -8.240  -1.484  1.00 0.31 ? 7   PRO B HD2  1 
ATOM   1151 H HD3  . PRO B 1 7  ? 8.359   -8.110  -2.437  1.00 0.31 ? 7   PRO B HD3  1 
ATOM   1152 N N    . PRO B 1 8  ? 6.086   -3.302  -0.642  1.00 0.22 ? 8   PRO B N    1 
ATOM   1153 C CA   . PRO B 1 8  ? 5.206   -2.668  0.361   1.00 0.23 ? 8   PRO B CA   1 
ATOM   1154 C C    . PRO B 1 8  ? 3.842   -3.380  0.372   1.00 0.24 ? 8   PRO B C    1 
ATOM   1155 O O    . PRO B 1 8  ? 3.719   -4.507  -0.061  1.00 0.24 ? 8   PRO B O    1 
ATOM   1156 C CB   . PRO B 1 8  ? 5.068   -1.198  -0.104  1.00 0.25 ? 8   PRO B CB   1 
ATOM   1157 C CG   . PRO B 1 8  ? 5.774   -1.080  -1.486  1.00 0.26 ? 8   PRO B CG   1 
ATOM   1158 C CD   . PRO B 1 8  ? 6.517   -2.410  -1.742  1.00 0.25 ? 8   PRO B CD   1 
ATOM   1159 H HA   . PRO B 1 8  ? 5.660   -2.710  1.340   1.00 0.22 ? 8   PRO B HA   1 
ATOM   1160 H HB2  . PRO B 1 8  ? 4.022   -0.924  -0.195  1.00 0.26 ? 8   PRO B HB2  1 
ATOM   1161 H HB3  . PRO B 1 8  ? 5.552   -0.539  0.605   1.00 0.25 ? 8   PRO B HB3  1 
ATOM   1162 H HG2  . PRO B 1 8  ? 5.036   -0.911  -2.262  1.00 0.29 ? 8   PRO B HG2  1 
ATOM   1163 H HG3  . PRO B 1 8  ? 6.482   -0.261  -1.475  1.00 0.27 ? 8   PRO B HG3  1 
ATOM   1164 H HD2  . PRO B 1 8  ? 6.235   -2.827  -2.701  1.00 0.27 ? 8   PRO B HD2  1 
ATOM   1165 H HD3  . PRO B 1 8  ? 7.584   -2.255  -1.697  1.00 0.24 ? 8   PRO B HD3  1 
ATOM   1166 N N    . THR B 1 9  ? 2.819   -2.725  0.858   1.00 0.25 ? 9   THR B N    1 
ATOM   1167 C CA   . THR B 1 9  ? 1.469   -3.364  0.889   1.00 0.26 ? 9   THR B CA   1 
ATOM   1168 C C    . THR B 1 9  ? 0.391   -2.283  0.899   1.00 0.26 ? 9   THR B C    1 
ATOM   1169 O O    . THR B 1 9  ? 0.394   -1.393  1.727   1.00 0.27 ? 9   THR B O    1 
ATOM   1170 C CB   . THR B 1 9  ? 1.337   -4.224  2.145   1.00 0.27 ? 9   THR B CB   1 
ATOM   1171 O OG1  . THR B 1 9  ? 2.498   -5.030  2.290   1.00 0.26 ? 9   THR B OG1  1 
ATOM   1172 C CG2  . THR B 1 9  ? 0.099   -5.120  2.029   1.00 0.30 ? 9   THR B CG2  1 
ATOM   1173 H H    . THR B 1 9  ? 2.938   -1.814  1.201   1.00 0.26 ? 9   THR B H    1 
ATOM   1174 H HA   . THR B 1 9  ? 1.341   -3.982  0.012   1.00 0.27 ? 9   THR B HA   1 
ATOM   1175 H HB   . THR B 1 9  ? 1.232   -3.584  3.007   1.00 0.27 ? 9   THR B HB   1 
ATOM   1176 H HG1  . THR B 1 9  ? 2.861   -5.186  1.415   1.00 0.96 ? 9   THR B HG1  1 
ATOM   1177 H HG21 . THR B 1 9  ? 0.133   -5.665  1.097   1.00 1.08 ? 9   THR B HG21 1 
ATOM   1178 H HG22 . THR B 1 9  ? 0.081   -5.818  2.853   1.00 1.00 ? 9   THR B HG22 1 
ATOM   1179 H HG23 . THR B 1 9  ? -0.792  -4.510  2.057   1.00 1.09 ? 9   THR B HG23 1 
ATOM   1180 N N    . ALA B 1 10 ? -0.532  -2.356  -0.017  1.00 0.25 ? 10  ALA B N    1 
ATOM   1181 C CA   . ALA B 1 10 ? -1.617  -1.342  -0.072  1.00 0.24 ? 10  ALA B CA   1 
ATOM   1182 C C    . ALA B 1 10 ? -2.541  -1.506  1.137   1.00 0.24 ? 10  ALA B C    1 
ATOM   1183 O O    . ALA B 1 10 ? -3.590  -2.112  1.047   1.00 0.23 ? 10  ALA B O    1 
ATOM   1184 C CB   . ALA B 1 10 ? -2.423  -1.536  -1.357  1.00 0.24 ? 10  ALA B CB   1 
ATOM   1185 H H    . ALA B 1 10 ? -0.512  -3.084  -0.672  1.00 0.24 ? 10  ALA B H    1 
ATOM   1186 H HA   . ALA B 1 10 ? -1.188  -0.349  -0.063  1.00 0.25 ? 10  ALA B HA   1 
ATOM   1187 H HB1  . ALA B 1 10 ? -2.621  -2.589  -1.498  1.00 1.04 ? 10  ALA B HB1  1 
ATOM   1188 H HB2  . ALA B 1 10 ? -3.357  -1.001  -1.284  1.00 1.00 ? 10  ALA B HB2  1 
ATOM   1189 H HB3  . ALA B 1 10 ? -1.856  -1.161  -2.196  1.00 1.04 ? 10  ALA B HB3  1 
ATOM   1190 N N    . CYS B 1 11 ? -2.163  -0.957  2.264   1.00 0.24 ? 11  CYS B N    1 
ATOM   1191 C CA   . CYS B 1 11 ? -3.014  -1.059  3.491   1.00 0.24 ? 11  CYS B CA   1 
ATOM   1192 C C    . CYS B 1 11 ? -3.620  0.315   3.778   1.00 0.23 ? 11  CYS B C    1 
ATOM   1193 O O    . CYS B 1 11 ? -2.958  1.329   3.664   1.00 0.25 ? 11  CYS B O    1 
ATOM   1194 C CB   . CYS B 1 11 ? -2.150  -1.497  4.678   1.00 0.24 ? 11  CYS B CB   1 
ATOM   1195 S SG   . CYS B 1 11 ? -1.264  -3.020  4.257   1.00 0.25 ? 11  CYS B SG   1 
ATOM   1196 H H    . CYS B 1 11 ? -1.315  -0.466  2.302   1.00 0.25 ? 11  CYS B H    1 
ATOM   1197 H HA   . CYS B 1 11 ? -3.809  -1.778  3.339   1.00 0.23 ? 11  CYS B HA   1 
ATOM   1198 H HB2  . CYS B 1 11 ? -1.437  -0.719  4.911   1.00 0.26 ? 11  CYS B HB2  1 
ATOM   1199 H HB3  . CYS B 1 11 ? -2.782  -1.674  5.536   1.00 0.24 ? 11  CYS B HB3  1 
ATOM   1200 N N    . CYS B 1 12 ? -4.871  0.364   4.137   1.00 0.21 ? 12  CYS B N    1 
ATOM   1201 C CA   . CYS B 1 12 ? -5.510  1.680   4.418   1.00 0.21 ? 12  CYS B CA   1 
ATOM   1202 C C    . CYS B 1 12 ? -4.992  2.227   5.749   1.00 0.22 ? 12  CYS B C    1 
ATOM   1203 O O    . CYS B 1 12 ? -4.787  1.495   6.696   1.00 0.25 ? 12  CYS B O    1 
ATOM   1204 C CB   . CYS B 1 12 ? -7.031  1.509   4.495   1.00 0.19 ? 12  CYS B CB   1 
ATOM   1205 S SG   . CYS B 1 12 ? -7.662  0.976   2.884   1.00 0.20 ? 12  CYS B SG   1 
ATOM   1206 H H    . CYS B 1 12 ? -5.394  -0.462  4.215   1.00 0.20 ? 12  CYS B H    1 
ATOM   1207 H HA   . CYS B 1 12 ? -5.267  2.374   3.626   1.00 0.21 ? 12  CYS B HA   1 
ATOM   1208 H HB2  . CYS B 1 12 ? -7.273  0.768   5.240   1.00 0.21 ? 12  CYS B HB2  1 
ATOM   1209 H HB3  . CYS B 1 12 ? -7.486  2.450   4.764   1.00 0.17 ? 12  CYS B HB3  1 
ATOM   1210 N N    . PHE B 1 13 ? -4.789  3.517   5.827   1.00 0.21 ? 13  PHE B N    1 
ATOM   1211 C CA   . PHE B 1 13 ? -4.293  4.136   7.095   1.00 0.22 ? 13  PHE B CA   1 
ATOM   1212 C C    . PHE B 1 13 ? -5.476  4.786   7.811   1.00 0.20 ? 13  PHE B C    1 
ATOM   1213 O O    . PHE B 1 13 ? -5.436  5.057   8.995   1.00 0.21 ? 13  PHE B O    1 
ATOM   1214 C CB   . PHE B 1 13 ? -3.249  5.206   6.760   1.00 0.24 ? 13  PHE B CB   1 
ATOM   1215 C CG   . PHE B 1 13 ? -3.913  6.338   6.013   1.00 0.24 ? 13  PHE B CG   1 
ATOM   1216 C CD1  . PHE B 1 13 ? -4.216  6.196   4.646   1.00 0.24 ? 13  PHE B CD1  1 
ATOM   1217 C CD2  . PHE B 1 13 ? -4.236  7.533   6.685   1.00 0.26 ? 13  PHE B CD2  1 
ATOM   1218 C CE1  . PHE B 1 13 ? -4.841  7.248   3.950   1.00 0.26 ? 13  PHE B CE1  1 
ATOM   1219 C CE2  . PHE B 1 13 ? -4.861  8.585   5.990   1.00 0.28 ? 13  PHE B CE2  1 
ATOM   1220 C CZ   . PHE B 1 13 ? -5.164  8.442   4.622   1.00 0.28 ? 13  PHE B CZ   1 
ATOM   1221 H H    . PHE B 1 13 ? -4.971  4.085   5.049   1.00 0.20 ? 13  PHE B H    1 
ATOM   1222 H HA   . PHE B 1 13 ? -3.850  3.383   7.730   1.00 0.25 ? 13  PHE B HA   1 
ATOM   1223 H HB2  . PHE B 1 13 ? -2.814  5.583   7.675   1.00 0.25 ? 13  PHE B HB2  1 
ATOM   1224 H HB3  . PHE B 1 13 ? -2.475  4.774   6.144   1.00 0.24 ? 13  PHE B HB3  1 
ATOM   1225 H HD1  . PHE B 1 13 ? -3.968  5.279   4.131   1.00 0.23 ? 13  PHE B HD1  1 
ATOM   1226 H HD2  . PHE B 1 13 ? -4.003  7.643   7.734   1.00 0.27 ? 13  PHE B HD2  1 
ATOM   1227 H HE1  . PHE B 1 13 ? -5.072  7.138   2.902   1.00 0.27 ? 13  PHE B HE1  1 
ATOM   1228 H HE2  . PHE B 1 13 ? -5.109  9.501   6.506   1.00 0.30 ? 13  PHE B HE2  1 
ATOM   1229 H HZ   . PHE B 1 13 ? -5.644  9.249   4.088   1.00 0.30 ? 13  PHE B HZ   1 
ATOM   1230 N N    . SER B 1 14 ? -6.532  5.035   7.087   1.00 0.17 ? 14  SER B N    1 
ATOM   1231 C CA   . SER B 1 14 ? -7.737  5.664   7.691   1.00 0.16 ? 14  SER B CA   1 
ATOM   1232 C C    . SER B 1 14 ? -8.955  5.301   6.843   1.00 0.15 ? 14  SER B C    1 
ATOM   1233 O O    . SER B 1 14 ? -8.974  4.285   6.176   1.00 0.14 ? 14  SER B O    1 
ATOM   1234 C CB   . SER B 1 14 ? -7.564  7.182   7.718   1.00 0.16 ? 14  SER B CB   1 
ATOM   1235 O OG   . SER B 1 14 ? -7.381  7.658   6.390   1.00 0.19 ? 14  SER B OG   1 
ATOM   1236 H H    . SER B 1 14 ? -6.532  4.803   6.135   1.00 0.17 ? 14  SER B H    1 
ATOM   1237 H HA   . SER B 1 14 ? -7.874  5.296   8.698   1.00 0.19 ? 14  SER B HA   1 
ATOM   1238 H HB2  . SER B 1 14 ? -8.444  7.640   8.139   1.00 0.19 ? 14  SER B HB2  1 
ATOM   1239 H HB3  . SER B 1 14 ? -6.704  7.435   8.324   1.00 0.20 ? 14  SER B HB3  1 
ATOM   1240 H HG   . SER B 1 14 ? -8.017  8.360   6.236   1.00 0.86 ? 14  SER B HG   1 
ATOM   1241 N N    . TYR B 1 15 ? -9.977  6.113   6.860   1.00 0.18 ? 15  TYR B N    1 
ATOM   1242 C CA   . TYR B 1 15 ? -11.192 5.799   6.050   1.00 0.19 ? 15  TYR B CA   1 
ATOM   1243 C C    . TYR B 1 15 ? -11.926 7.099   5.720   1.00 0.24 ? 15  TYR B C    1 
ATOM   1244 O O    . TYR B 1 15 ? -11.711 8.116   6.347   1.00 0.30 ? 15  TYR B O    1 
ATOM   1245 C CB   . TYR B 1 15 ? -12.119 4.880   6.857   1.00 0.21 ? 15  TYR B CB   1 
ATOM   1246 C CG   . TYR B 1 15 ? -11.292 3.867   7.609   1.00 0.20 ? 15  TYR B CG   1 
ATOM   1247 C CD1  . TYR B 1 15 ? -10.821 4.169   8.901   1.00 0.23 ? 15  TYR B CD1  1 
ATOM   1248 C CD2  . TYR B 1 15 ? -10.987 2.626   7.021   1.00 0.18 ? 15  TYR B CD2  1 
ATOM   1249 C CE1  . TYR B 1 15 ? -10.045 3.230   9.606   1.00 0.24 ? 15  TYR B CE1  1 
ATOM   1250 C CE2  . TYR B 1 15 ? -10.210 1.686   7.726   1.00 0.20 ? 15  TYR B CE2  1 
ATOM   1251 C CZ   . TYR B 1 15 ? -9.740  1.987   9.018   1.00 0.22 ? 15  TYR B CZ   1 
ATOM   1252 O OH   . TYR B 1 15 ? -8.979  1.064   9.708   1.00 0.26 ? 15  TYR B OH   1 
ATOM   1253 H H    . TYR B 1 15 ? -9.947  6.927   7.405   1.00 0.21 ? 15  TYR B H    1 
ATOM   1254 H HA   . TYR B 1 15 ? -10.902 5.307   5.133   1.00 0.16 ? 15  TYR B HA   1 
ATOM   1255 H HB2  . TYR B 1 15 ? -12.694 5.466   7.560   1.00 0.25 ? 15  TYR B HB2  1 
ATOM   1256 H HB3  . TYR B 1 15 ? -12.789 4.366   6.184   1.00 0.22 ? 15  TYR B HB3  1 
ATOM   1257 H HD1  . TYR B 1 15 ? -11.057 5.122   9.352   1.00 0.26 ? 15  TYR B HD1  1 
ATOM   1258 H HD2  . TYR B 1 15 ? -11.347 2.395   6.029   1.00 0.18 ? 15  TYR B HD2  1 
ATOM   1259 H HE1  . TYR B 1 15 ? -9.683  3.462   10.597  1.00 0.27 ? 15  TYR B HE1  1 
ATOM   1260 H HE2  . TYR B 1 15 ? -9.976  0.734   7.276   1.00 0.21 ? 15  TYR B HE2  1 
ATOM   1261 H HH   . TYR B 1 15 ? -9.554  0.338   9.963   1.00 0.91 ? 15  TYR B HH   1 
ATOM   1262 N N    . THR B 1 16 ? -12.799 7.076   4.748   1.00 0.22 ? 16  THR B N    1 
ATOM   1263 C CA   . THR B 1 16 ? -13.546 8.319   4.409   1.00 0.28 ? 16  THR B CA   1 
ATOM   1264 C C    . THR B 1 16 ? -14.346 8.752   5.642   1.00 0.33 ? 16  THR B C    1 
ATOM   1265 O O    . THR B 1 16 ? -14.005 8.406   6.756   1.00 0.37 ? 16  THR B O    1 
ATOM   1266 C CB   . THR B 1 16 ? -14.475 8.064   3.212   1.00 0.27 ? 16  THR B CB   1 
ATOM   1267 O OG1  . THR B 1 16 ? -15.239 9.231   2.944   1.00 0.36 ? 16  THR B OG1  1 
ATOM   1268 C CG2  . THR B 1 16 ? -15.414 6.895   3.511   1.00 0.26 ? 16  THR B CG2  1 
ATOM   1269 H H    . THR B 1 16 ? -12.972 6.242   4.257   1.00 0.18 ? 16  THR B H    1 
ATOM   1270 H HA   . THR B 1 16 ? -12.840 9.098   4.155   1.00 0.31 ? 16  THR B HA   1 
ATOM   1271 H HB   . THR B 1 16 ? -13.878 7.824   2.346   1.00 0.26 ? 16  THR B HB   1 
ATOM   1272 H HG1  . THR B 1 16 ? -15.470 9.226   2.012   1.00 0.85 ? 16  THR B HG1  1 
ATOM   1273 H HG21 . THR B 1 16 ? -14.839 6.055   3.870   1.00 1.06 ? 16  THR B HG21 1 
ATOM   1274 H HG22 . THR B 1 16 ? -16.130 7.191   4.261   1.00 1.01 ? 16  THR B HG22 1 
ATOM   1275 H HG23 . THR B 1 16 ? -15.933 6.614   2.606   1.00 1.08 ? 16  THR B HG23 1 
ATOM   1276 N N    . ALA B 1 17 ? -15.396 9.511   5.472   1.00 0.38 ? 17  ALA B N    1 
ATOM   1277 C CA   . ALA B 1 17 ? -16.191 9.960   6.659   1.00 0.45 ? 17  ALA B CA   1 
ATOM   1278 C C    . ALA B 1 17 ? -17.674 10.038  6.295   1.00 0.48 ? 17  ALA B C    1 
ATOM   1279 O O    . ALA B 1 17 ? -18.496 10.420  7.104   1.00 0.63 ? 17  ALA B O    1 
ATOM   1280 C CB   . ALA B 1 17 ? -15.699 11.343  7.095   1.00 0.53 ? 17  ALA B CB   1 
ATOM   1281 H H    . ALA B 1 17 ? -15.657 9.793   4.573   1.00 0.41 ? 17  ALA B H    1 
ATOM   1282 H HA   . ALA B 1 17 ? -16.062 9.261   7.475   1.00 0.45 ? 17  ALA B HA   1 
ATOM   1283 H HB1  . ALA B 1 17 ? -15.563 11.968  6.225   1.00 1.15 ? 17  ALA B HB1  1 
ATOM   1284 H HB2  . ALA B 1 17 ? -16.426 11.794  7.754   1.00 1.20 ? 17  ALA B HB2  1 
ATOM   1285 H HB3  . ALA B 1 17 ? -14.758 11.241  7.615   1.00 1.04 ? 17  ALA B HB3  1 
ATOM   1286 N N    . ARG B 1 18 ? -18.024 9.675   5.087   1.00 0.47 ? 18  ARG B N    1 
ATOM   1287 C CA   . ARG B 1 18 ? -19.457 9.725   4.659   1.00 0.48 ? 18  ARG B CA   1 
ATOM   1288 C C    . ARG B 1 18 ? -19.788 8.465   3.855   1.00 0.40 ? 18  ARG B C    1 
ATOM   1289 O O    . ARG B 1 18 ? -19.017 8.029   3.024   1.00 0.36 ? 18  ARG B O    1 
ATOM   1290 C CB   . ARG B 1 18 ? -19.673 10.963  3.780   1.00 0.53 ? 18  ARG B CB   1 
ATOM   1291 C CG   . ARG B 1 18 ? -19.681 12.245  4.660   1.00 0.71 ? 18  ARG B CG   1 
ATOM   1292 C CD   . ARG B 1 18 ? -18.972 13.407  3.948   1.00 1.17 ? 18  ARG B CD   1 
ATOM   1293 N NE   . ARG B 1 18 ? -19.867 13.971  2.900   1.00 1.90 ? 18  ARG B NE   1 
ATOM   1294 C CZ   . ARG B 1 18 ? -19.582 15.119  2.351   1.00 2.49 ? 18  ARG B CZ   1 
ATOM   1295 N NH1  . ARG B 1 18 ? -18.486 15.743  2.681   1.00 2.62 ? 18  ARG B NH1  1 
ATOM   1296 N NH2  . ARG B 1 18 ? -20.387 15.637  1.466   1.00 3.48 ? 18  ARG B NH2  1 
ATOM   1297 H H    . ARG B 1 18 ? -17.342 9.366   4.456   1.00 0.56 ? 18  ARG B H    1 
ATOM   1298 H HA   . ARG B 1 18 ? -20.103 9.782   5.523   1.00 0.53 ? 18  ARG B HA   1 
ATOM   1299 H HB2  . ARG B 1 18 ? -18.881 11.012  3.047   1.00 0.54 ? 18  ARG B HB2  1 
ATOM   1300 H HB3  . ARG B 1 18 ? -20.620 10.872  3.269   1.00 0.55 ? 18  ARG B HB3  1 
ATOM   1301 H HG2  . ARG B 1 18 ? -20.702 12.532  4.867   1.00 1.30 ? 18  ARG B HG2  1 
ATOM   1302 H HG3  . ARG B 1 18 ? -19.175 12.052  5.596   1.00 1.14 ? 18  ARG B HG3  1 
ATOM   1303 H HD2  . ARG B 1 18 ? -18.744 14.175  4.669   1.00 1.80 ? 18  ARG B HD2  1 
ATOM   1304 H HD3  . ARG B 1 18 ? -18.053 13.058  3.499   1.00 1.70 ? 18  ARG B HD3  1 
ATOM   1305 H HE   . ARG B 1 18 ? -20.679 13.490  2.637   1.00 2.45 ? 18  ARG B HE   1 
ATOM   1306 H HH11 . ARG B 1 18 ? -17.866 15.341  3.354   1.00 2.38 ? 18  ARG B HH11 1 
ATOM   1307 H HH12 . ARG B 1 18 ? -18.265 16.622  2.259   1.00 3.35 ? 18  ARG B HH12 1 
ATOM   1308 H HH21 . ARG B 1 18 ? -21.224 15.155  1.208   1.00 3.88 ? 18  ARG B HH21 1 
ATOM   1309 H HH22 . ARG B 1 18 ? -20.168 16.518  1.045   1.00 4.04 ? 18  ARG B HH22 1 
ATOM   1310 N N    . LYS B 1 19 ? -20.927 7.877   4.097   1.00 0.39 ? 19  LYS B N    1 
ATOM   1311 C CA   . LYS B 1 19 ? -21.300 6.646   3.345   1.00 0.34 ? 19  LYS B CA   1 
ATOM   1312 C C    . LYS B 1 19 ? -21.466 6.985   1.865   1.00 0.29 ? 19  LYS B C    1 
ATOM   1313 O O    . LYS B 1 19 ? -22.159 7.913   1.498   1.00 0.31 ? 19  LYS B O    1 
ATOM   1314 C CB   . LYS B 1 19 ? -22.620 6.081   3.904   1.00 0.39 ? 19  LYS B CB   1 
ATOM   1315 C CG   . LYS B 1 19 ? -23.051 4.815   3.124   1.00 0.43 ? 19  LYS B CG   1 
ATOM   1316 C CD   . LYS B 1 19 ? -24.573 4.594   3.206   1.00 0.66 ? 19  LYS B CD   1 
ATOM   1317 C CE   . LYS B 1 19 ? -25.098 4.822   4.634   1.00 0.85 ? 19  LYS B CE   1 
ATOM   1318 N NZ   . LYS B 1 19 ? -25.500 6.252   4.786   1.00 1.74 ? 19  LYS B NZ   1 
ATOM   1319 H H    . LYS B 1 19 ? -21.536 8.243   4.772   1.00 0.44 ? 19  LYS B H    1 
ATOM   1320 H HA   . LYS B 1 19 ? -20.519 5.908   3.458   1.00 0.34 ? 19  LYS B HA   1 
ATOM   1321 H HB2  . LYS B 1 19 ? -22.473 5.830   4.944   1.00 0.49 ? 19  LYS B HB2  1 
ATOM   1322 H HB3  . LYS B 1 19 ? -23.386 6.829   3.828   1.00 0.42 ? 19  LYS B HB3  1 
ATOM   1323 H HG2  . LYS B 1 19 ? -22.775 4.903   2.087   1.00 0.79 ? 19  LYS B HG2  1 
ATOM   1324 H HG3  . LYS B 1 19 ? -22.557 3.963   3.539   1.00 0.76 ? 19  LYS B HG3  1 
ATOM   1325 H HD2  . LYS B 1 19 ? -25.065 5.281   2.535   1.00 1.45 ? 19  LYS B HD2  1 
ATOM   1326 H HD3  . LYS B 1 19 ? -24.795 3.581   2.902   1.00 1.33 ? 19  LYS B HD3  1 
ATOM   1327 H HE2  . LYS B 1 19 ? -25.959 4.190   4.804   1.00 1.24 ? 19  LYS B HE2  1 
ATOM   1328 H HE3  . LYS B 1 19 ? -24.333 4.579   5.354   1.00 1.27 ? 19  LYS B HE3  1 
ATOM   1329 H HZ1  . LYS B 1 19 ? -25.458 6.723   3.860   1.00 2.29 ? 19  LYS B HZ1  1 
ATOM   1330 H HZ2  . LYS B 1 19 ? -26.471 6.301   5.158   1.00 2.09 ? 19  LYS B HZ2  1 
ATOM   1331 H HZ3  . LYS B 1 19 ? -24.851 6.728   5.443   1.00 2.21 ? 19  LYS B HZ3  1 
ATOM   1332 N N    . LEU B 1 20 ? -20.850 6.216   1.011   1.00 0.25 ? 20  LEU B N    1 
ATOM   1333 C CA   . LEU B 1 20 ? -20.986 6.462   -0.446  1.00 0.24 ? 20  LEU B CA   1 
ATOM   1334 C C    . LEU B 1 20 ? -22.380 5.967   -0.889  1.00 0.26 ? 20  LEU B C    1 
ATOM   1335 O O    . LEU B 1 20 ? -22.673 4.804   -0.695  1.00 0.26 ? 20  LEU B O    1 
ATOM   1336 C CB   . LEU B 1 20 ? -19.922 5.656   -1.203  1.00 0.23 ? 20  LEU B CB   1 
ATOM   1337 C CG   . LEU B 1 20 ? -18.568 5.737   -0.493  1.00 0.20 ? 20  LEU B CG   1 
ATOM   1338 C CD1  . LEU B 1 20 ? -17.568 4.868   -1.252  1.00 0.20 ? 20  LEU B CD1  1 
ATOM   1339 C CD2  . LEU B 1 20 ? -18.060 7.183   -0.477  1.00 0.24 ? 20  LEU B CD2  1 
ATOM   1340 H H    . LEU B 1 20 ? -20.313 5.461   1.331   1.00 0.25 ? 20  LEU B H    1 
ATOM   1341 H HA   . LEU B 1 20 ? -20.857 7.509   -0.644  1.00 0.26 ? 20  LEU B HA   1 
ATOM   1342 H HB2  . LEU B 1 20 ? -20.225 4.620   -1.257  1.00 0.23 ? 20  LEU B HB2  1 
ATOM   1343 H HB3  . LEU B 1 20 ? -19.824 6.048   -2.200  1.00 0.25 ? 20  LEU B HB3  1 
ATOM   1344 H HG   . LEU B 1 20 ? -18.664 5.373   0.520   1.00 0.19 ? 20  LEU B HG   1 
ATOM   1345 H HD11 . LEU B 1 20 ? -17.964 3.867   -1.348  1.00 1.02 ? 20  LEU B HD11 1 
ATOM   1346 H HD12 . LEU B 1 20 ? -17.404 5.285   -2.235  1.00 1.05 ? 20  LEU B HD12 1 
ATOM   1347 H HD13 . LEU B 1 20 ? -16.634 4.837   -0.713  1.00 1.02 ? 20  LEU B HD13 1 
ATOM   1348 H HD21 . LEU B 1 20 ? -18.063 7.577   -1.483  1.00 1.08 ? 20  LEU B HD21 1 
ATOM   1349 H HD22 . LEU B 1 20 ? -18.700 7.787   0.149   1.00 1.03 ? 20  LEU B HD22 1 
ATOM   1350 H HD23 . LEU B 1 20 ? -17.053 7.206   -0.086  1.00 1.01 ? 20  LEU B HD23 1 
ATOM   1351 N N    . PRO B 1 21 ? -23.212 6.810   -1.473  1.00 0.30 ? 21  PRO B N    1 
ATOM   1352 C CA   . PRO B 1 21 ? -24.539 6.350   -1.911  1.00 0.34 ? 21  PRO B CA   1 
ATOM   1353 C C    . PRO B 1 21 ? -24.378 5.155   -2.851  1.00 0.30 ? 21  PRO B C    1 
ATOM   1354 O O    . PRO B 1 21 ? -23.463 5.106   -3.646  1.00 0.29 ? 21  PRO B O    1 
ATOM   1355 C CB   . PRO B 1 21 ? -25.162 7.557   -2.647  1.00 0.40 ? 21  PRO B CB   1 
ATOM   1356 C CG   . PRO B 1 21 ? -24.202 8.764   -2.449  1.00 0.41 ? 21  PRO B CG   1 
ATOM   1357 C CD   . PRO B 1 21 ? -22.931 8.238   -1.746  1.00 0.34 ? 21  PRO B CD   1 
ATOM   1358 H HA   . PRO B 1 21 ? -25.142 6.078   -1.059  1.00 0.37 ? 21  PRO B HA   1 
ATOM   1359 H HB2  . PRO B 1 21 ? -25.268 7.338   -3.705  1.00 0.40 ? 21  PRO B HB2  1 
ATOM   1360 H HB3  . PRO B 1 21 ? -26.128 7.785   -2.230  1.00 0.45 ? 21  PRO B HB3  1 
ATOM   1361 H HG2  . PRO B 1 21 ? -23.944 9.193   -3.411  1.00 0.44 ? 21  PRO B HG2  1 
ATOM   1362 H HG3  . PRO B 1 21 ? -24.674 9.516   -1.832  1.00 0.46 ? 21  PRO B HG3  1 
ATOM   1363 H HD2  . PRO B 1 21 ? -22.072 8.339   -2.399  1.00 0.33 ? 21  PRO B HD2  1 
ATOM   1364 H HD3  . PRO B 1 21 ? -22.765 8.769   -0.818  1.00 0.34 ? 21  PRO B HD3  1 
ATOM   1365 N N    . ARG B 1 22 ? -25.262 4.199   -2.783  1.00 0.31 ? 22  ARG B N    1 
ATOM   1366 C CA   . ARG B 1 22 ? -25.156 3.028   -3.697  1.00 0.30 ? 22  ARG B CA   1 
ATOM   1367 C C    . ARG B 1 22 ? -24.975 3.550   -5.124  1.00 0.32 ? 22  ARG B C    1 
ATOM   1368 O O    . ARG B 1 22 ? -24.362 2.923   -5.964  1.00 0.32 ? 22  ARG B O    1 
ATOM   1369 C CB   . ARG B 1 22 ? -26.439 2.196   -3.602  1.00 0.34 ? 22  ARG B CB   1 
ATOM   1370 C CG   . ARG B 1 22 ? -26.228 0.821   -4.247  1.00 0.59 ? 22  ARG B CG   1 
ATOM   1371 C CD   . ARG B 1 22 ? -27.423 -0.082  -3.919  1.00 1.27 ? 22  ARG B CD   1 
ATOM   1372 N NE   . ARG B 1 22 ? -27.082 -1.513  -4.216  1.00 1.33 ? 22  ARG B NE   1 
ATOM   1373 C CZ   . ARG B 1 22 ? -26.693 -1.893  -5.404  1.00 2.02 ? 22  ARG B CZ   1 
ATOM   1374 N NH1  . ARG B 1 22 ? -26.756 -1.070  -6.417  1.00 2.86 ? 22  ARG B NH1  1 
ATOM   1375 N NH2  . ARG B 1 22 ? -26.291 -3.121  -5.591  1.00 2.33 ? 22  ARG B NH2  1 
ATOM   1376 H H    . ARG B 1 22 ? -26.003 4.261   -2.144  1.00 0.34 ? 22  ARG B H    1 
ATOM   1377 H HA   . ARG B 1 22 ? -24.304 2.425   -3.418  1.00 0.28 ? 22  ARG B HA   1 
ATOM   1378 H HB2  . ARG B 1 22 ? -26.704 2.072   -2.562  1.00 0.47 ? 22  ARG B HB2  1 
ATOM   1379 H HB3  . ARG B 1 22 ? -27.238 2.710   -4.115  1.00 0.45 ? 22  ARG B HB3  1 
ATOM   1380 H HG2  . ARG B 1 22 ? -26.139 0.941   -5.313  1.00 1.25 ? 22  ARG B HG2  1 
ATOM   1381 H HG3  . ARG B 1 22 ? -25.324 0.373   -3.858  1.00 1.20 ? 22  ARG B HG3  1 
ATOM   1382 H HD2  . ARG B 1 22 ? -27.645 -0.018  -2.871  1.00 1.90 ? 22  ARG B HD2  1 
ATOM   1383 H HD3  . ARG B 1 22 ? -28.291 0.253   -4.484  1.00 1.96 ? 22  ARG B HD3  1 
ATOM   1384 H HE   . ARG B 1 22 ? -27.109 -2.171  -3.488  1.00 1.48 ? 22  ARG B HE   1 
ATOM   1385 H HH11 . ARG B 1 22 ? -27.106 -0.144  -6.289  1.00 2.91 ? 22  ARG B HH11 1 
ATOM   1386 H HH12 . ARG B 1 22 ? -26.453 -1.369  -7.323  1.00 3.63 ? 22  ARG B HH12 1 
ATOM   1387 H HH21 . ARG B 1 22 ? -26.282 -3.766  -4.828  1.00 2.20 ? 22  ARG B HH21 1 
ATOM   1388 H HH22 . ARG B 1 22 ? -25.995 -3.417  -6.500  1.00 2.99 ? 22  ARG B HH22 1 
ATOM   1389 N N    . ASN B 1 23 ? -25.511 4.712   -5.386  1.00 0.34 ? 23  ASN B N    1 
ATOM   1390 C CA   . ASN B 1 23 ? -25.391 5.321   -6.740  1.00 0.38 ? 23  ASN B CA   1 
ATOM   1391 C C    . ASN B 1 23 ? -23.955 5.830   -6.946  1.00 0.36 ? 23  ASN B C    1 
ATOM   1392 O O    . ASN B 1 23 ? -23.680 6.584   -7.858  1.00 0.39 ? 23  ASN B O    1 
ATOM   1393 C CB   . ASN B 1 23 ? -26.394 6.493   -6.838  1.00 0.43 ? 23  ASN B CB   1 
ATOM   1394 C CG   . ASN B 1 23 ? -26.955 6.628   -8.260  1.00 1.47 ? 23  ASN B CG   1 
ATOM   1395 O OD1  . ASN B 1 23 ? -26.781 5.755   -9.090  1.00 2.12 ? 23  ASN B OD1  1 
ATOM   1396 N ND2  . ASN B 1 23 ? -27.632 7.697   -8.576  1.00 2.42 ? 23  ASN B ND2  1 
ATOM   1397 H H    . ASN B 1 23 ? -25.992 5.192   -4.679  1.00 0.36 ? 23  ASN B H    1 
ATOM   1398 H HA   . ASN B 1 23 ? -25.619 4.574   -7.484  1.00 0.39 ? 23  ASN B HA   1 
ATOM   1399 H HB2  . ASN B 1 23 ? -27.212 6.311   -6.155  1.00 1.10 ? 23  ASN B HB2  1 
ATOM   1400 H HB3  . ASN B 1 23 ? -25.906 7.417   -6.561  1.00 0.99 ? 23  ASN B HB3  1 
ATOM   1401 H HD21 . ASN B 1 23 ? -27.775 8.399   -7.907  1.00 2.64 ? 23  ASN B HD21 1 
ATOM   1402 H HD22 . ASN B 1 23 ? -28.001 7.797   -9.478  1.00 3.21 ? 23  ASN B HD22 1 
ATOM   1403 N N    . PHE B 1 24 ? -23.045 5.432   -6.094  1.00 0.33 ? 24  PHE B N    1 
ATOM   1404 C CA   . PHE B 1 24 ? -21.626 5.902   -6.217  1.00 0.32 ? 24  PHE B CA   1 
ATOM   1405 C C    . PHE B 1 24 ? -20.688 4.732   -5.899  1.00 0.28 ? 24  PHE B C    1 
ATOM   1406 O O    . PHE B 1 24 ? -19.584 4.919   -5.427  1.00 0.27 ? 24  PHE B O    1 
ATOM   1407 C CB   . PHE B 1 24 ? -21.396 7.044   -5.207  1.00 0.31 ? 24  PHE B CB   1 
ATOM   1408 C CG   . PHE B 1 24 ? -20.214 7.903   -5.616  1.00 0.33 ? 24  PHE B CG   1 
ATOM   1409 C CD1  . PHE B 1 24 ? -20.219 8.577   -6.857  1.00 0.36 ? 24  PHE B CD1  1 
ATOM   1410 C CD2  . PHE B 1 24 ? -19.110 8.045   -4.749  1.00 0.32 ? 24  PHE B CD2  1 
ATOM   1411 C CE1  . PHE B 1 24 ? -19.126 9.385   -7.224  1.00 0.39 ? 24  PHE B CE1  1 
ATOM   1412 C CE2  . PHE B 1 24 ? -18.018 8.852   -5.119  1.00 0.34 ? 24  PHE B CE2  1 
ATOM   1413 C CZ   . PHE B 1 24 ? -18.025 9.520   -6.354  1.00 0.38 ? 24  PHE B CZ   1 
ATOM   1414 H H    . PHE B 1 24 ? -23.297 4.836   -5.361  1.00 0.31 ? 24  PHE B H    1 
ATOM   1415 H HA   . PHE B 1 24 ? -21.436 6.250   -7.222  1.00 0.34 ? 24  PHE B HA   1 
ATOM   1416 H HB2  . PHE B 1 24 ? -22.279 7.659   -5.162  1.00 0.33 ? 24  PHE B HB2  1 
ATOM   1417 H HB3  . PHE B 1 24 ? -21.210 6.623   -4.226  1.00 0.29 ? 24  PHE B HB3  1 
ATOM   1418 H HD1  . PHE B 1 24 ? -21.060 8.478   -7.526  1.00 0.38 ? 24  PHE B HD1  1 
ATOM   1419 H HD2  . PHE B 1 24 ? -19.100 7.535   -3.801  1.00 0.30 ? 24  PHE B HD2  1 
ATOM   1420 H HE1  . PHE B 1 24 ? -19.131 9.899   -8.172  1.00 0.42 ? 24  PHE B HE1  1 
ATOM   1421 H HE2  . PHE B 1 24 ? -17.175 8.959   -4.453  1.00 0.34 ? 24  PHE B HE2  1 
ATOM   1422 H HZ   . PHE B 1 24 ? -17.188 10.140  -6.634  1.00 0.41 ? 24  PHE B HZ   1 
ATOM   1423 N N    . VAL B 1 25 ? -21.125 3.524   -6.153  1.00 0.28 ? 25  VAL B N    1 
ATOM   1424 C CA   . VAL B 1 25 ? -20.272 2.332   -5.861  1.00 0.26 ? 25  VAL B CA   1 
ATOM   1425 C C    . VAL B 1 25 ? -20.571 1.231   -6.883  1.00 0.29 ? 25  VAL B C    1 
ATOM   1426 O O    . VAL B 1 25 ? -21.489 0.453   -6.721  1.00 0.30 ? 25  VAL B O    1 
ATOM   1427 C CB   . VAL B 1 25 ? -20.590 1.812   -4.451  1.00 0.23 ? 25  VAL B CB   1 
ATOM   1428 C CG1  . VAL B 1 25 ? -19.626 0.659   -4.068  1.00 0.21 ? 25  VAL B CG1  1 
ATOM   1429 C CG2  . VAL B 1 25 ? -20.454 2.969   -3.448  1.00 0.21 ? 25  VAL B CG2  1 
ATOM   1430 H H    . VAL B 1 25 ? -22.020 3.401   -6.530  1.00 0.30 ? 25  VAL B H    1 
ATOM   1431 H HA   . VAL B 1 25 ? -19.228 2.602   -5.919  1.00 0.26 ? 25  VAL B HA   1 
ATOM   1432 H HB   . VAL B 1 25 ? -21.610 1.448   -4.435  1.00 0.25 ? 25  VAL B HB   1 
ATOM   1433 H HG11 . VAL B 1 25 ? -19.045 0.352   -4.929  1.00 1.05 ? 25  VAL B HG11 1 
ATOM   1434 H HG12 . VAL B 1 25 ? -18.952 0.982   -3.291  1.00 1.01 ? 25  VAL B HG12 1 
ATOM   1435 H HG13 . VAL B 1 25 ? -20.196 -0.185  -3.709  1.00 1.04 ? 25  VAL B HG13 1 
ATOM   1436 H HG21 . VAL B 1 25 ? -19.506 3.466   -3.596  1.00 1.07 ? 25  VAL B HG21 1 
ATOM   1437 H HG22 . VAL B 1 25 ? -21.258 3.675   -3.597  1.00 1.02 ? 25  VAL B HG22 1 
ATOM   1438 H HG23 . VAL B 1 25 ? -20.501 2.579   -2.442  1.00 1.02 ? 25  VAL B HG23 1 
ATOM   1439 N N    . VAL B 1 26 ? -19.801 1.162   -7.939  1.00 0.31 ? 26  VAL B N    1 
ATOM   1440 C CA   . VAL B 1 26 ? -20.036 0.117   -8.978  1.00 0.35 ? 26  VAL B CA   1 
ATOM   1441 C C    . VAL B 1 26 ? -19.248 -1.145  -8.632  1.00 0.34 ? 26  VAL B C    1 
ATOM   1442 O O    . VAL B 1 26 ? -19.453 -2.190  -9.215  1.00 0.36 ? 26  VAL B O    1 
ATOM   1443 C CB   . VAL B 1 26 ? -19.567 0.641   -10.336 1.00 0.39 ? 26  VAL B CB   1 
ATOM   1444 C CG1  . VAL B 1 26 ? -20.416 1.847   -10.739 1.00 0.85 ? 26  VAL B CG1  1 
ATOM   1445 C CG2  . VAL B 1 26 ? -18.094 1.055   -10.246 1.00 0.66 ? 26  VAL B CG2  1 
ATOM   1446 H H    . VAL B 1 26 ? -19.069 1.801   -8.052  1.00 0.31 ? 26  VAL B H    1 
ATOM   1447 H HA   . VAL B 1 26 ? -21.089 -0.118  -9.029  1.00 0.36 ? 26  VAL B HA   1 
ATOM   1448 H HB   . VAL B 1 26 ? -19.677 -0.136  -11.074 1.00 0.62 ? 26  VAL B HB   1 
ATOM   1449 H HG11 . VAL B 1 26 ? -20.555 2.491   -9.884  1.00 1.39 ? 26  VAL B HG11 1 
ATOM   1450 H HG12 . VAL B 1 26 ? -19.918 2.395   -11.526 1.00 1.40 ? 26  VAL B HG12 1 
ATOM   1451 H HG13 . VAL B 1 26 ? -21.378 1.507   -11.092 1.00 1.45 ? 26  VAL B HG13 1 
ATOM   1452 H HG21 . VAL B 1 26 ? -17.974 1.795   -9.469  1.00 1.23 ? 26  VAL B HG21 1 
ATOM   1453 H HG22 . VAL B 1 26 ? -17.490 0.191   -10.018 1.00 1.26 ? 26  VAL B HG22 1 
ATOM   1454 H HG23 . VAL B 1 26 ? -17.781 1.474   -11.191 1.00 1.34 ? 26  VAL B HG23 1 
ATOM   1455 N N    . ASP B 1 27 ? -18.345 -1.060  -7.697  1.00 0.31 ? 27  ASP B N    1 
ATOM   1456 C CA   . ASP B 1 27 ? -17.549 -2.266  -7.337  1.00 0.30 ? 27  ASP B CA   1 
ATOM   1457 C C    . ASP B 1 27 ? -16.753 -1.989  -6.068  1.00 0.26 ? 27  ASP B C    1 
ATOM   1458 O O    . ASP B 1 27 ? -16.912 -0.965  -5.434  1.00 0.24 ? 27  ASP B O    1 
ATOM   1459 C CB   . ASP B 1 27 ? -16.581 -2.591  -8.478  1.00 0.34 ? 27  ASP B CB   1 
ATOM   1460 C CG   . ASP B 1 27 ? -16.016 -3.999  -8.280  1.00 0.34 ? 27  ASP B CG   1 
ATOM   1461 O OD1  . ASP B 1 27 ? -16.788 -4.887  -7.958  1.00 1.02 ? 27  ASP B OD1  1 
ATOM   1462 O OD2  . ASP B 1 27 ? -14.819 -4.165  -8.452  1.00 1.06 ? 27  ASP B OD2  1 
ATOM   1463 H H    . ASP B 1 27 ? -18.183 -0.207  -7.238  1.00 0.29 ? 27  ASP B H    1 
ATOM   1464 H HA   . ASP B 1 27 ? -18.211 -3.102  -7.174  1.00 0.30 ? 27  ASP B HA   1 
ATOM   1465 H HB2  . ASP B 1 27 ? -17.107 -2.542  -9.420  1.00 0.37 ? 27  ASP B HB2  1 
ATOM   1466 H HB3  . ASP B 1 27 ? -15.770 -1.876  -8.481  1.00 0.34 ? 27  ASP B HB3  1 
ATOM   1467 N N    . TYR B 1 28 ? -15.892 -2.892  -5.691  1.00 0.26 ? 28  TYR B N    1 
ATOM   1468 C CA   . TYR B 1 28 ? -15.083 -2.674  -4.464  1.00 0.22 ? 28  TYR B CA   1 
ATOM   1469 C C    . TYR B 1 28 ? -13.809 -3.510  -4.522  1.00 0.24 ? 28  TYR B C    1 
ATOM   1470 O O    . TYR B 1 28 ? -13.527 -4.182  -5.493  1.00 0.28 ? 28  TYR B O    1 
ATOM   1471 C CB   . TYR B 1 28 ? -15.900 -3.041  -3.220  1.00 0.19 ? 28  TYR B CB   1 
ATOM   1472 C CG   . TYR B 1 28 ? -16.027 -4.546  -3.079  1.00 0.20 ? 28  TYR B CG   1 
ATOM   1473 C CD1  . TYR B 1 28 ? -16.701 -5.295  -4.064  1.00 0.24 ? 28  TYR B CD1  1 
ATOM   1474 C CD2  . TYR B 1 28 ? -15.487 -5.195  -1.951  1.00 0.19 ? 28  TYR B CD2  1 
ATOM   1475 C CE1  . TYR B 1 28 ? -16.831 -6.689  -3.923  1.00 0.26 ? 28  TYR B CE1  1 
ATOM   1476 C CE2  . TYR B 1 28 ? -15.618 -6.588  -1.807  1.00 0.22 ? 28  TYR B CE2  1 
ATOM   1477 C CZ   . TYR B 1 28 ? -16.291 -7.337  -2.793  1.00 0.25 ? 28  TYR B CZ   1 
ATOM   1478 O OH   . TYR B 1 28 ? -16.421 -8.704  -2.653  1.00 0.28 ? 28  TYR B OH   1 
ATOM   1479 H H    . TYR B 1 28 ? -15.775 -3.710  -6.217  1.00 0.28 ? 28  TYR B H    1 
ATOM   1480 H HA   . TYR B 1 28 ? -14.808 -1.630  -4.405  1.00 0.21 ? 28  TYR B HA   1 
ATOM   1481 H HB2  . TYR B 1 28 ? -15.411 -2.638  -2.345  1.00 0.16 ? 28  TYR B HB2  1 
ATOM   1482 H HB3  . TYR B 1 28 ? -16.881 -2.609  -3.305  1.00 0.19 ? 28  TYR B HB3  1 
ATOM   1483 H HD1  . TYR B 1 28 ? -17.112 -4.803  -4.932  1.00 0.26 ? 28  TYR B HD1  1 
ATOM   1484 H HD2  . TYR B 1 28 ? -14.971 -4.623  -1.196  1.00 0.17 ? 28  TYR B HD2  1 
ATOM   1485 H HE1  . TYR B 1 28 ? -17.350 -7.260  -4.679  1.00 0.29 ? 28  TYR B HE1  1 
ATOM   1486 H HE2  . TYR B 1 28 ? -15.202 -7.080  -0.938  1.00 0.23 ? 28  TYR B HE2  1 
ATOM   1487 H HH   . TYR B 1 28 ? -16.212 -9.111  -3.498  1.00 1.00 ? 28  TYR B HH   1 
ATOM   1488 N N    . TYR B 1 29 ? -13.037 -3.450  -3.483  1.00 0.21 ? 29  TYR B N    1 
ATOM   1489 C CA   . TYR B 1 29 ? -11.763 -4.205  -3.439  1.00 0.24 ? 29  TYR B CA   1 
ATOM   1490 C C    . TYR B 1 29 ? -11.337 -4.330  -1.972  1.00 0.21 ? 29  TYR B C    1 
ATOM   1491 O O    . TYR B 1 29 ? -11.519 -3.418  -1.195  1.00 0.21 ? 29  TYR B O    1 
ATOM   1492 C CB   . TYR B 1 29 ? -10.719 -3.425  -4.257  1.00 0.27 ? 29  TYR B CB   1 
ATOM   1493 C CG   . TYR B 1 29 ? -9.316  -3.841  -3.878  1.00 0.29 ? 29  TYR B CG   1 
ATOM   1494 C CD1  . TYR B 1 29 ? -8.867  -5.138  -4.179  1.00 0.35 ? 29  TYR B CD1  1 
ATOM   1495 C CD2  . TYR B 1 29 ? -8.462  -2.930  -3.227  1.00 0.32 ? 29  TYR B CD2  1 
ATOM   1496 C CE1  . TYR B 1 29 ? -7.560  -5.529  -3.828  1.00 0.37 ? 29  TYR B CE1  1 
ATOM   1497 C CE2  . TYR B 1 29 ? -7.155  -3.319  -2.876  1.00 0.34 ? 29  TYR B CE2  1 
ATOM   1498 C CZ   . TYR B 1 29 ? -6.704  -4.619  -3.176  1.00 0.33 ? 29  TYR B CZ   1 
ATOM   1499 O OH   . TYR B 1 29 ? -5.422  -5.001  -2.832  1.00 0.36 ? 29  TYR B OH   1 
ATOM   1500 H H    . TYR B 1 29 ? -13.296 -2.893  -2.725  1.00 0.18 ? 29  TYR B H    1 
ATOM   1501 H HA   . TYR B 1 29 ? -11.905 -5.188  -3.865  1.00 0.26 ? 29  TYR B HA   1 
ATOM   1502 H HB2  . TYR B 1 29 ? -10.874 -3.621  -5.307  1.00 0.30 ? 29  TYR B HB2  1 
ATOM   1503 H HB3  . TYR B 1 29 ? -10.843 -2.368  -4.073  1.00 0.25 ? 29  TYR B HB3  1 
ATOM   1504 H HD1  . TYR B 1 29 ? -9.526  -5.833  -4.681  1.00 0.43 ? 29  TYR B HD1  1 
ATOM   1505 H HD2  . TYR B 1 29 ? -8.809  -1.932  -3.000  1.00 0.38 ? 29  TYR B HD2  1 
ATOM   1506 H HE1  . TYR B 1 29 ? -7.215  -6.525  -4.059  1.00 0.46 ? 29  TYR B HE1  1 
ATOM   1507 H HE2  . TYR B 1 29 ? -6.500  -2.621  -2.376  1.00 0.41 ? 29  TYR B HE2  1 
ATOM   1508 H HH   . TYR B 1 29 ? -4.810  -4.367  -3.214  1.00 0.98 ? 29  TYR B HH   1 
ATOM   1509 N N    . GLU B 1 30 ? -10.782 -5.446  -1.580  1.00 0.21 ? 30  GLU B N    1 
ATOM   1510 C CA   . GLU B 1 30 ? -10.353 -5.609  -0.154  1.00 0.19 ? 30  GLU B CA   1 
ATOM   1511 C C    . GLU B 1 30 ? -8.849  -5.338  -0.047  1.00 0.19 ? 30  GLU B C    1 
ATOM   1512 O O    . GLU B 1 30 ? -8.113  -5.484  -1.003  1.00 0.21 ? 30  GLU B O    1 
ATOM   1513 C CB   . GLU B 1 30 ? -10.655 -7.037  0.307   1.00 0.20 ? 30  GLU B CB   1 
ATOM   1514 C CG   . GLU B 1 30 ? -12.153 -7.179  0.588   1.00 0.22 ? 30  GLU B CG   1 
ATOM   1515 C CD   . GLU B 1 30 ? -12.517 -8.662  0.685   1.00 0.77 ? 30  GLU B CD   1 
ATOM   1516 O OE1  . GLU B 1 30 ? -11.618 -9.480  0.591   1.00 1.41 ? 30  GLU B OE1  1 
ATOM   1517 O OE2  . GLU B 1 30 ? -13.691 -8.954  0.850   1.00 1.53 ? 30  GLU B OE2  1 
ATOM   1518 H H    . GLU B 1 30 ? -10.646 -6.176  -2.219  1.00 0.23 ? 30  GLU B H    1 
ATOM   1519 H HA   . GLU B 1 30 ? -10.889 -4.909  0.478   1.00 0.16 ? 30  GLU B HA   1 
ATOM   1520 H HB2  . GLU B 1 30 ? -10.367 -7.728  -0.466  1.00 0.25 ? 30  GLU B HB2  1 
ATOM   1521 H HB3  . GLU B 1 30 ? -10.100 -7.251  1.208   1.00 0.23 ? 30  GLU B HB3  1 
ATOM   1522 H HG2  . GLU B 1 30 ? -12.392 -6.687  1.519   1.00 0.59 ? 30  GLU B HG2  1 
ATOM   1523 H HG3  . GLU B 1 30 ? -12.715 -6.724  -0.214  1.00 0.41 ? 30  GLU B HG3  1 
ATOM   1524 N N    . THR B 1 31 ? -8.390  -4.935  1.106   1.00 0.18 ? 31  THR B N    1 
ATOM   1525 C CA   . THR B 1 31 ? -6.935  -4.643  1.274   1.00 0.19 ? 31  THR B CA   1 
ATOM   1526 C C    . THR B 1 31 ? -6.134  -5.945  1.283   1.00 0.20 ? 31  THR B C    1 
ATOM   1527 O O    . THR B 1 31 ? -6.633  -7.000  0.946   1.00 0.22 ? 31  THR B O    1 
ATOM   1528 C CB   . THR B 1 31 ? -6.717  -3.916  2.604   1.00 0.19 ? 31  THR B CB   1 
ATOM   1529 O OG1  . THR B 1 31 ? -7.388  -4.628  3.628   1.00 0.20 ? 31  THR B OG1  1 
ATOM   1530 C CG2  . THR B 1 31 ? -7.269  -2.491  2.511   1.00 0.19 ? 31  THR B CG2  1 
ATOM   1531 H H    . THR B 1 31 ? -9.005  -4.816  1.861   1.00 0.17 ? 31  THR B H    1 
ATOM   1532 H HA   . THR B 1 31 ? -6.595  -4.019  0.461   1.00 0.20 ? 31  THR B HA   1 
ATOM   1533 H HB   . THR B 1 31 ? -5.663  -3.878  2.835   1.00 0.20 ? 31  THR B HB   1 
ATOM   1534 H HG1  . THR B 1 31 ? -7.542  -5.523  3.315   1.00 0.73 ? 31  THR B HG1  1 
ATOM   1535 H HG21 . THR B 1 31 ? -6.936  -2.031  1.592   1.00 1.03 ? 31  THR B HG21 1 
ATOM   1536 H HG22 . THR B 1 31 ? -8.347  -2.521  2.528   1.00 1.02 ? 31  THR B HG22 1 
ATOM   1537 H HG23 . THR B 1 31 ? -6.912  -1.913  3.349   1.00 1.03 ? 31  THR B HG23 1 
ATOM   1538 N N    . SER B 1 32 ? -4.888  -5.870  1.668   1.00 0.21 ? 32  SER B N    1 
ATOM   1539 C CA   . SER B 1 32 ? -4.036  -7.090  1.706   1.00 0.23 ? 32  SER B CA   1 
ATOM   1540 C C    . SER B 1 32 ? -4.272  -7.837  3.023   1.00 0.23 ? 32  SER B C    1 
ATOM   1541 O O    . SER B 1 32 ? -5.360  -7.840  3.563   1.00 0.25 ? 32  SER B O    1 
ATOM   1542 C CB   . SER B 1 32 ? -2.561  -6.677  1.588   1.00 0.24 ? 32  SER B CB   1 
ATOM   1543 O OG   . SER B 1 32 ? -1.843  -7.699  0.910   1.00 1.21 ? 32  SER B OG   1 
ATOM   1544 H H    . SER B 1 32 ? -4.512  -5.005  1.934   1.00 0.22 ? 32  SER B H    1 
ATOM   1545 H HA   . SER B 1 32 ? -4.290  -7.735  0.881   1.00 0.23 ? 32  SER B HA   1 
ATOM   1546 H HB2  . SER B 1 32 ? -2.490  -5.763  1.022   1.00 0.88 ? 32  SER B HB2  1 
ATOM   1547 H HB3  . SER B 1 32 ? -2.140  -6.518  2.574   1.00 0.83 ? 32  SER B HB3  1 
ATOM   1548 H HG   . SER B 1 32 ? -1.993  -7.591  -0.033  1.00 1.61 ? 32  SER B HG   1 
ATOM   1549 N N    . SER B 1 33 ? -3.254  -8.470  3.537   1.00 0.23 ? 33  SER B N    1 
ATOM   1550 C CA   . SER B 1 33 ? -3.394  -9.227  4.819   1.00 0.24 ? 33  SER B CA   1 
ATOM   1551 C C    . SER B 1 33 ? -2.132  -9.026  5.651   1.00 0.24 ? 33  SER B C    1 
ATOM   1552 O O    . SER B 1 33 ? -2.174  -8.963  6.864   1.00 0.24 ? 33  SER B O    1 
ATOM   1553 C CB   . SER B 1 33 ? -3.553  -10.711 4.509   1.00 0.25 ? 33  SER B CB   1 
ATOM   1554 O OG   . SER B 1 33 ? -2.273  -11.278 4.262   1.00 0.26 ? 33  SER B OG   1 
ATOM   1555 H H    . SER B 1 33 ? -2.391  -8.450  3.076   1.00 0.24 ? 33  SER B H    1 
ATOM   1556 H HA   . SER B 1 33 ? -4.255  -8.874  5.372   1.00 0.23 ? 33  SER B HA   1 
ATOM   1557 H HB2  . SER B 1 33 ? -4.012  -11.213 5.345   1.00 0.25 ? 33  SER B HB2  1 
ATOM   1558 H HB3  . SER B 1 33 ? -4.177  -10.822 3.637   1.00 0.25 ? 33  SER B HB3  1 
ATOM   1559 H HG   . SER B 1 33 ? -2.401  -12.108 3.798   1.00 0.96 ? 33  SER B HG   1 
ATOM   1560 N N    . LEU B 1 34 ? -1.008  -8.930  4.993   1.00 0.25 ? 34  LEU B N    1 
ATOM   1561 C CA   . LEU B 1 34 ? 0.290   -8.735  5.707   1.00 0.25 ? 34  LEU B CA   1 
ATOM   1562 C C    . LEU B 1 34 ? 0.113   -7.744  6.861   1.00 0.25 ? 34  LEU B C    1 
ATOM   1563 O O    . LEU B 1 34 ? 0.408   -8.043  8.002   1.00 0.26 ? 34  LEU B O    1 
ATOM   1564 C CB   . LEU B 1 34 ? 1.330   -8.177  4.733   1.00 0.26 ? 34  LEU B CB   1 
ATOM   1565 C CG   . LEU B 1 34 ? 1.266   -8.927  3.399   1.00 0.26 ? 34  LEU B CG   1 
ATOM   1566 C CD1  . LEU B 1 34 ? 2.405   -8.445  2.493   1.00 0.27 ? 34  LEU B CD1  1 
ATOM   1567 C CD2  . LEU B 1 34 ? 1.402   -10.437 3.646   1.00 0.26 ? 34  LEU B CD2  1 
ATOM   1568 H H    . LEU B 1 34 ? -1.019  -8.993  4.019   1.00 0.25 ? 34  LEU B H    1 
ATOM   1569 H HA   . LEU B 1 34 ? 0.632   -9.680  6.094   1.00 0.26 ? 34  LEU B HA   1 
ATOM   1570 H HB2  . LEU B 1 34 ? 1.138   -7.128  4.561   1.00 0.26 ? 34  LEU B HB2  1 
ATOM   1571 H HB3  . LEU B 1 34 ? 2.312   -8.295  5.158   1.00 0.26 ? 34  LEU B HB3  1 
ATOM   1572 H HG   . LEU B 1 34 ? 0.323   -8.723  2.917   1.00 0.26 ? 34  LEU B HG   1 
ATOM   1573 H HD11 . LEU B 1 34 ? 2.506   -7.371  2.577   1.00 1.03 ? 34  LEU B HD11 1 
ATOM   1574 H HD12 . LEU B 1 34 ? 3.328   -8.918  2.791   1.00 1.05 ? 34  LEU B HD12 1 
ATOM   1575 H HD13 . LEU B 1 34 ? 2.182   -8.706  1.470   1.00 1.02 ? 34  LEU B HD13 1 
ATOM   1576 H HD21 . LEU B 1 34 ? 2.145   -10.617 4.410   1.00 0.99 ? 34  LEU B HD21 1 
ATOM   1577 H HD22 . LEU B 1 34 ? 0.451   -10.835 3.970   1.00 1.06 ? 34  LEU B HD22 1 
ATOM   1578 H HD23 . LEU B 1 34 ? 1.701   -10.929 2.731   1.00 1.08 ? 34  LEU B HD23 1 
ATOM   1579 N N    . CYS B 1 35 ? -0.363  -6.567  6.569   1.00 0.25 ? 35  CYS B N    1 
ATOM   1580 C CA   . CYS B 1 35 ? -0.555  -5.557  7.646   1.00 0.25 ? 35  CYS B CA   1 
ATOM   1581 C C    . CYS B 1 35 ? -1.713  -5.997  8.552   1.00 0.24 ? 35  CYS B C    1 
ATOM   1582 O O    . CYS B 1 35 ? -2.780  -6.342  8.092   1.00 0.23 ? 35  CYS B O    1 
ATOM   1583 C CB   . CYS B 1 35 ? -0.854  -4.188  7.022   1.00 0.25 ? 35  CYS B CB   1 
ATOM   1584 S SG   . CYS B 1 35 ? -1.940  -4.385  5.586   1.00 0.23 ? 35  CYS B SG   1 
ATOM   1585 H H    . CYS B 1 35 ? -0.592  -6.349  5.642   1.00 0.25 ? 35  CYS B H    1 
ATOM   1586 H HA   . CYS B 1 35 ? 0.349   -5.492  8.234   1.00 0.26 ? 35  CYS B HA   1 
ATOM   1587 H HB2  . CYS B 1 35 ? -1.337  -3.557  7.751   1.00 0.25 ? 35  CYS B HB2  1 
ATOM   1588 H HB3  . CYS B 1 35 ? 0.073   -3.728  6.710   1.00 0.26 ? 35  CYS B HB3  1 
ATOM   1589 N N    . SER B 1 36 ? -1.492  -6.016  9.837   1.00 0.25 ? 36  SER B N    1 
ATOM   1590 C CA   . SER B 1 36 ? -2.559  -6.453  10.786  1.00 0.25 ? 36  SER B CA   1 
ATOM   1591 C C    . SER B 1 36 ? -3.745  -5.466  10.784  1.00 0.24 ? 36  SER B C    1 
ATOM   1592 O O    . SER B 1 36 ? -4.405  -5.299  11.790  1.00 0.25 ? 36  SER B O    1 
ATOM   1593 C CB   . SER B 1 36 ? -1.951  -6.560  12.203  1.00 0.27 ? 36  SER B CB   1 
ATOM   1594 O OG   . SER B 1 36 ? -0.543  -6.381  12.117  1.00 1.35 ? 36  SER B OG   1 
ATOM   1595 H H    . SER B 1 36 ? -0.614  -5.754  10.182  1.00 0.27 ? 36  SER B H    1 
ATOM   1596 H HA   . SER B 1 36 ? -2.918  -7.425  10.478  1.00 0.25 ? 36  SER B HA   1 
ATOM   1597 H HB2  . SER B 1 36 ? -2.360  -5.799  12.851  1.00 1.04 ? 36  SER B HB2  1 
ATOM   1598 H HB3  . SER B 1 36 ? -2.171  -7.535  12.623  1.00 1.04 ? 36  SER B HB3  1 
ATOM   1599 H HG   . SER B 1 36 ? -0.249  -5.941  12.919  1.00 1.84 ? 36  SER B HG   1 
ATOM   1600 N N    . GLN B 1 37 ? -4.037  -4.807  9.688   1.00 0.23 ? 37  GLN B N    1 
ATOM   1601 C CA   . GLN B 1 37 ? -5.189  -3.851  9.700   1.00 0.22 ? 37  GLN B CA   1 
ATOM   1602 C C    . GLN B 1 37 ? -5.785  -3.693  8.294   1.00 0.21 ? 37  GLN B C    1 
ATOM   1603 O O    . GLN B 1 37 ? -5.714  -2.625  7.724   1.00 0.20 ? 37  GLN B O    1 
ATOM   1604 C CB   . GLN B 1 37 ? -4.708  -2.485  10.203  1.00 0.24 ? 37  GLN B CB   1 
ATOM   1605 C CG   . GLN B 1 37 ? -3.398  -2.103  9.508   1.00 0.25 ? 37  GLN B CG   1 
ATOM   1606 C CD   . GLN B 1 37 ? -2.927  -0.740  10.021  1.00 0.29 ? 37  GLN B CD   1 
ATOM   1607 O OE1  . GLN B 1 37 ? -2.705  -0.568  11.203  1.00 1.09 ? 37  GLN B OE1  1 
ATOM   1608 N NE2  . GLN B 1 37 ? -2.768  0.243   9.177   1.00 1.07 ? 37  GLN B NE2  1 
ATOM   1609 H H    . GLN B 1 37 ? -3.509  -4.936  8.873   1.00 0.23 ? 37  GLN B H    1 
ATOM   1610 H HA   . GLN B 1 37 ? -5.959  -4.219  10.367  1.00 0.23 ? 37  GLN B HA   1 
ATOM   1611 H HB2  . GLN B 1 37 ? -5.459  -1.739  9.988   1.00 0.23 ? 37  GLN B HB2  1 
ATOM   1612 H HB3  . GLN B 1 37 ? -4.545  -2.531  11.270  1.00 0.26 ? 37  GLN B HB3  1 
ATOM   1613 H HG2  . GLN B 1 37 ? -2.645  -2.848  9.720   1.00 0.29 ? 37  GLN B HG2  1 
ATOM   1614 H HG3  . GLN B 1 37 ? -3.557  -2.046  8.442   1.00 0.25 ? 37  GLN B HG3  1 
ATOM   1615 H HE21 . GLN B 1 37 ? -2.948  0.104   8.224   1.00 1.85 ? 37  GLN B HE21 1 
ATOM   1616 H HE22 . GLN B 1 37 ? -2.466  1.119   9.496   1.00 1.08 ? 37  GLN B HE22 1 
ATOM   1617 N N    . PRO B 1 38 ? -6.380  -4.748  7.777   1.00 0.20 ? 38  PRO B N    1 
ATOM   1618 C CA   . PRO B 1 38 ? -7.013  -4.702  6.444   1.00 0.19 ? 38  PRO B CA   1 
ATOM   1619 C C    . PRO B 1 38 ? -8.277  -3.834  6.519   1.00 0.18 ? 38  PRO B C    1 
ATOM   1620 O O    . PRO B 1 38 ? -8.630  -3.313  7.558   1.00 0.19 ? 38  PRO B O    1 
ATOM   1621 C CB   . PRO B 1 38 ? -7.366  -6.174  6.127   1.00 0.19 ? 38  PRO B CB   1 
ATOM   1622 C CG   . PRO B 1 38 ? -7.126  -6.998  7.426   1.00 0.20 ? 38  PRO B CG   1 
ATOM   1623 C CD   . PRO B 1 38 ? -6.463  -6.057  8.458   1.00 0.22 ? 38  PRO B CD   1 
ATOM   1624 H HA   . PRO B 1 38 ? -6.329  -4.308  5.700   1.00 0.19 ? 38  PRO B HA   1 
ATOM   1625 H HB2  . PRO B 1 38 ? -8.403  -6.257  5.818   1.00 0.18 ? 38  PRO B HB2  1 
ATOM   1626 H HB3  . PRO B 1 38 ? -6.725  -6.545  5.339   1.00 0.20 ? 38  PRO B HB3  1 
ATOM   1627 H HG2  . PRO B 1 38 ? -8.070  -7.366  7.809   1.00 0.20 ? 38  PRO B HG2  1 
ATOM   1628 H HG3  . PRO B 1 38 ? -6.470  -7.834  7.219   1.00 0.21 ? 38  PRO B HG3  1 
ATOM   1629 H HD2  . PRO B 1 38 ? -7.075  -5.982  9.348   1.00 0.22 ? 38  PRO B HD2  1 
ATOM   1630 H HD3  . PRO B 1 38 ? -5.475  -6.408  8.709   1.00 0.24 ? 38  PRO B HD3  1 
ATOM   1631 N N    . ALA B 1 39 ? -8.958  -3.688  5.422   1.00 0.17 ? 39  ALA B N    1 
ATOM   1632 C CA   . ALA B 1 39 ? -10.196 -2.874  5.400   1.00 0.16 ? 39  ALA B CA   1 
ATOM   1633 C C    . ALA B 1 39 ? -10.893 -3.111  4.065   1.00 0.15 ? 39  ALA B C    1 
ATOM   1634 O O    . ALA B 1 39 ? -10.314 -3.670  3.154   1.00 0.17 ? 39  ALA B O    1 
ATOM   1635 C CB   . ALA B 1 39 ? -9.837  -1.393  5.534   1.00 0.15 ? 39  ALA B CB   1 
ATOM   1636 H H    . ALA B 1 39 ? -8.658  -4.124  4.605   1.00 0.18 ? 39  ALA B H    1 
ATOM   1637 H HA   . ALA B 1 39 ? -10.842 -3.169  6.210   1.00 0.16 ? 39  ALA B HA   1 
ATOM   1638 H HB1  . ALA B 1 39 ? -9.162  -1.260  6.366   1.00 1.00 ? 39  ALA B HB1  1 
ATOM   1639 H HB2  . ALA B 1 39 ? -9.360  -1.055  4.626   1.00 1.03 ? 39  ALA B HB2  1 
ATOM   1640 H HB3  . ALA B 1 39 ? -10.736 -0.819  5.703   1.00 1.02 ? 39  ALA B HB3  1 
ATOM   1641 N N    . VAL B 1 40 ? -12.113 -2.673  3.919   1.00 0.13 ? 40  VAL B N    1 
ATOM   1642 C CA   . VAL B 1 40 ? -12.813 -2.861  2.614   1.00 0.12 ? 40  VAL B CA   1 
ATOM   1643 C C    . VAL B 1 40 ? -12.619 -1.581  1.812   1.00 0.11 ? 40  VAL B C    1 
ATOM   1644 O O    . VAL B 1 40 ? -12.609 -0.496  2.358   1.00 0.14 ? 40  VAL B O    1 
ATOM   1645 C CB   . VAL B 1 40 ? -14.308 -3.119  2.843   1.00 0.12 ? 40  VAL B CB   1 
ATOM   1646 C CG1  . VAL B 1 40 ? -15.080 -2.909  1.535   1.00 0.12 ? 40  VAL B CG1  1 
ATOM   1647 C CG2  . VAL B 1 40 ? -14.502 -4.562  3.307   1.00 0.16 ? 40  VAL B CG2  1 
ATOM   1648 H H    . VAL B 1 40 ? -12.562 -2.203  4.656   1.00 0.12 ? 40  VAL B H    1 
ATOM   1649 H HA   . VAL B 1 40 ? -12.379 -3.698  2.070   1.00 0.15 ? 40  VAL B HA   1 
ATOM   1650 H HB   . VAL B 1 40 ? -14.682 -2.441  3.597   1.00 0.12 ? 40  VAL B HB   1 
ATOM   1651 H HG11 . VAL B 1 40 ? -14.540 -3.377  0.724   1.00 1.02 ? 40  VAL B HG11 1 
ATOM   1652 H HG12 . VAL B 1 40 ? -16.062 -3.352  1.616   1.00 1.00 ? 40  VAL B HG12 1 
ATOM   1653 H HG13 . VAL B 1 40 ? -15.174 -1.852  1.338   1.00 1.01 ? 40  VAL B HG13 1 
ATOM   1654 H HG21 . VAL B 1 40 ? -13.793 -4.786  4.089   1.00 0.99 ? 40  VAL B HG21 1 
ATOM   1655 H HG22 . VAL B 1 40 ? -15.506 -4.689  3.681   1.00 1.06 ? 40  VAL B HG22 1 
ATOM   1656 H HG23 . VAL B 1 40 ? -14.341 -5.231  2.473   1.00 1.04 ? 40  VAL B HG23 1 
ATOM   1657 N N    . VAL B 1 41 ? -12.437 -1.705  0.526   1.00 0.13 ? 41  VAL B N    1 
ATOM   1658 C CA   . VAL B 1 41 ? -12.209 -0.501  -0.332  1.00 0.14 ? 41  VAL B CA   1 
ATOM   1659 C C    . VAL B 1 41 ? -13.306 -0.406  -1.395  1.00 0.14 ? 41  VAL B C    1 
ATOM   1660 O O    . VAL B 1 41 ? -13.480 -1.293  -2.199  1.00 0.17 ? 41  VAL B O    1 
ATOM   1661 C CB   . VAL B 1 41 ? -10.834 -0.631  -0.993  1.00 0.19 ? 41  VAL B CB   1 
ATOM   1662 C CG1  . VAL B 1 41 ? -10.348 0.739   -1.449  1.00 0.22 ? 41  VAL B CG1  1 
ATOM   1663 C CG2  . VAL B 1 41 ? -9.838  -1.206  0.017   1.00 0.20 ? 41  VAL B CG2  1 
ATOM   1664 H H    . VAL B 1 41 ? -12.434 -2.599  0.124   1.00 0.17 ? 41  VAL B H    1 
ATOM   1665 H HA   . VAL B 1 41 ? -12.229 0.388   0.273   1.00 0.13 ? 41  VAL B HA   1 
ATOM   1666 H HB   . VAL B 1 41 ? -10.902 -1.285  -1.849  1.00 0.20 ? 41  VAL B HB   1 
ATOM   1667 H HG11 . VAL B 1 41 ? -10.318 1.411   -0.603  1.00 1.00 ? 41  VAL B HG11 1 
ATOM   1668 H HG12 . VAL B 1 41 ? -9.357  0.639   -1.864  1.00 0.99 ? 41  VAL B HG12 1 
ATOM   1669 H HG13 . VAL B 1 41 ? -11.022 1.125   -2.196  1.00 0.95 ? 41  VAL B HG13 1 
ATOM   1670 H HG21 . VAL B 1 41 ? -9.863  -0.617  0.922   1.00 1.01 ? 41  VAL B HG21 1 
ATOM   1671 H HG22 . VAL B 1 41 ? -10.103 -2.227  0.246   1.00 1.02 ? 41  VAL B HG22 1 
ATOM   1672 H HG23 . VAL B 1 41 ? -8.844  -1.178  -0.403  1.00 1.03 ? 41  VAL B HG23 1 
ATOM   1673 N N    . PHE B 1 42 ? -14.060 0.661   -1.398  1.00 0.13 ? 42  PHE B N    1 
ATOM   1674 C CA   . PHE B 1 42 ? -15.160 0.802   -2.401  1.00 0.15 ? 42  PHE B CA   1 
ATOM   1675 C C    . PHE B 1 42 ? -14.665 1.543   -3.648  1.00 0.19 ? 42  PHE B C    1 
ATOM   1676 O O    . PHE B 1 42 ? -13.964 2.532   -3.565  1.00 0.21 ? 42  PHE B O    1 
ATOM   1677 C CB   . PHE B 1 42 ? -16.313 1.597   -1.778  1.00 0.14 ? 42  PHE B CB   1 
ATOM   1678 C CG   . PHE B 1 42 ? -17.072 0.732   -0.791  1.00 0.12 ? 42  PHE B CG   1 
ATOM   1679 C CD1  . PHE B 1 42 ? -17.752 -0.423  -1.234  1.00 0.12 ? 42  PHE B CD1  1 
ATOM   1680 C CD2  . PHE B 1 42 ? -17.109 1.087   0.573   1.00 0.12 ? 42  PHE B CD2  1 
ATOM   1681 C CE1  . PHE B 1 42 ? -18.462 -1.218  -0.315  1.00 0.13 ? 42  PHE B CE1  1 
ATOM   1682 C CE2  . PHE B 1 42 ? -17.822 0.291   1.489   1.00 0.14 ? 42  PHE B CE2  1 
ATOM   1683 C CZ   . PHE B 1 42 ? -18.497 -0.862  1.046   1.00 0.14 ? 42  PHE B CZ   1 
ATOM   1684 H H    . PHE B 1 42 ? -13.912 1.366   -0.733  1.00 0.12 ? 42  PHE B H    1 
ATOM   1685 H HA   . PHE B 1 42 ? -15.515 -0.177  -2.688  1.00 0.15 ? 42  PHE B HA   1 
ATOM   1686 H HB2  . PHE B 1 42 ? -15.915 2.461   -1.270  1.00 0.14 ? 42  PHE B HB2  1 
ATOM   1687 H HB3  . PHE B 1 42 ? -16.985 1.924   -2.556  1.00 0.16 ? 42  PHE B HB3  1 
ATOM   1688 H HD1  . PHE B 1 42 ? -17.728 -0.699  -2.275  1.00 0.14 ? 42  PHE B HD1  1 
ATOM   1689 H HD2  . PHE B 1 42 ? -16.591 1.970   0.916   1.00 0.13 ? 42  PHE B HD2  1 
ATOM   1690 H HE1  . PHE B 1 42 ? -18.981 -2.102  -0.655  1.00 0.15 ? 42  PHE B HE1  1 
ATOM   1691 H HE2  . PHE B 1 42 ? -17.848 0.566   2.532   1.00 0.16 ? 42  PHE B HE2  1 
ATOM   1692 H HZ   . PHE B 1 42 ? -19.045 -1.472  1.748   1.00 0.16 ? 42  PHE B HZ   1 
ATOM   1693 N N    . GLN B 1 43 ? -15.063 1.078   -4.805  1.00 0.22 ? 43  GLN B N    1 
ATOM   1694 C CA   . GLN B 1 43 ? -14.671 1.746   -6.085  1.00 0.26 ? 43  GLN B CA   1 
ATOM   1695 C C    . GLN B 1 43 ? -15.875 2.571   -6.558  1.00 0.28 ? 43  GLN B C    1 
ATOM   1696 O O    . GLN B 1 43 ? -16.958 2.038   -6.726  1.00 0.28 ? 43  GLN B O    1 
ATOM   1697 C CB   . GLN B 1 43 ? -14.325 0.668   -7.117  1.00 0.30 ? 43  GLN B CB   1 
ATOM   1698 C CG   . GLN B 1 43 ? -13.078 -0.094  -6.661  1.00 0.30 ? 43  GLN B CG   1 
ATOM   1699 C CD   . GLN B 1 43 ? -12.939 -1.381  -7.475  1.00 0.35 ? 43  GLN B CD   1 
ATOM   1700 O OE1  . GLN B 1 43 ? -12.782 -2.450  -6.921  1.00 1.15 ? 43  GLN B OE1  1 
ATOM   1701 N NE2  . GLN B 1 43 ? -12.990 -1.324  -8.778  1.00 1.11 ? 43  GLN B NE2  1 
ATOM   1702 H H    . GLN B 1 43 ? -15.649 0.292   -4.833  1.00 0.21 ? 43  GLN B H    1 
ATOM   1703 H HA   . GLN B 1 43 ? -13.820 2.393   -5.925  1.00 0.27 ? 43  GLN B HA   1 
ATOM   1704 H HB2  . GLN B 1 43 ? -15.153 -0.018  -7.209  1.00 0.30 ? 43  GLN B HB2  1 
ATOM   1705 H HB3  . GLN B 1 43 ? -14.131 1.126   -8.070  1.00 0.33 ? 43  GLN B HB3  1 
ATOM   1706 H HG2  . GLN B 1 43 ? -12.204 0.525   -6.811  1.00 0.32 ? 43  GLN B HG2  1 
ATOM   1707 H HG3  . GLN B 1 43 ? -13.169 -0.341  -5.614  1.00 0.28 ? 43  GLN B HG3  1 
ATOM   1708 H HE21 . GLN B 1 43 ? -13.116 -0.461  -9.227  1.00 1.90 ? 43  GLN B HE21 1 
ATOM   1709 H HE22 . GLN B 1 43 ? -12.902 -2.142  -9.308  1.00 1.11 ? 43  GLN B HE22 1 
ATOM   1710 N N    . THR B 1 44 ? -15.725 3.871   -6.728  1.00 0.29 ? 44  THR B N    1 
ATOM   1711 C CA   . THR B 1 44 ? -16.910 4.709   -7.133  1.00 0.31 ? 44  THR B CA   1 
ATOM   1712 C C    . THR B 1 44 ? -16.939 4.985   -8.638  1.00 0.37 ? 44  THR B C    1 
ATOM   1713 O O    . THR B 1 44 ? -16.356 4.276   -9.434  1.00 0.40 ? 44  THR B O    1 
ATOM   1714 C CB   . THR B 1 44 ? -16.857 6.048   -6.401  1.00 0.31 ? 44  THR B CB   1 
ATOM   1715 O OG1  . THR B 1 44 ? -15.973 6.918   -7.087  1.00 0.35 ? 44  THR B OG1  1 
ATOM   1716 C CG2  . THR B 1 44 ? -16.361 5.834   -4.968  1.00 0.26 ? 44  THR B CG2  1 
ATOM   1717 H H    . THR B 1 44 ? -14.849 4.299   -6.556  1.00 0.29 ? 44  THR B H    1 
ATOM   1718 H HA   . THR B 1 44 ? -17.822 4.203   -6.856  1.00 0.30 ? 44  THR B HA   1 
ATOM   1719 H HB   . THR B 1 44 ? -17.842 6.484   -6.377  1.00 0.32 ? 44  THR B HB   1 
ATOM   1720 H HG1  . THR B 1 44 ? -16.136 6.822   -8.028  1.00 0.77 ? 44  THR B HG1  1 
ATOM   1721 H HG21 . THR B 1 44 ? -16.838 4.959   -4.547  1.00 1.05 ? 44  THR B HG21 1 
ATOM   1722 H HG22 . THR B 1 44 ? -15.291 5.692   -4.975  1.00 1.06 ? 44  THR B HG22 1 
ATOM   1723 H HG23 . THR B 1 44 ? -16.606 6.697   -4.369  1.00 1.01 ? 44  THR B HG23 1 
ATOM   1724 N N    . LYS B 1 45 ? -17.646 6.028   -9.019  1.00 0.42 ? 45  LYS B N    1 
ATOM   1725 C CA   . LYS B 1 45 ? -17.772 6.400   -10.462 1.00 0.47 ? 45  LYS B CA   1 
ATOM   1726 C C    . LYS B 1 45 ? -17.008 7.700   -10.738 1.00 0.50 ? 45  LYS B C    1 
ATOM   1727 O O    . LYS B 1 45 ? -16.619 7.967   -11.857 1.00 0.55 ? 45  LYS B O    1 
ATOM   1728 C CB   . LYS B 1 45 ? -19.254 6.628   -10.793 1.00 0.49 ? 45  LYS B CB   1 
ATOM   1729 C CG   . LYS B 1 45 ? -20.106 5.505   -10.203 1.00 0.45 ? 45  LYS B CG   1 
ATOM   1730 C CD   . LYS B 1 45 ? -21.580 5.760   -10.535 1.00 0.49 ? 45  LYS B CD   1 
ATOM   1731 C CE   . LYS B 1 45 ? -22.395 4.491   -10.282 1.00 0.53 ? 45  LYS B CE   1 
ATOM   1732 N NZ   . LYS B 1 45 ? -23.850 4.813   -10.344 1.00 1.41 ? 45  LYS B NZ   1 
ATOM   1733 H H    . LYS B 1 45 ? -18.109 6.565   -8.343  1.00 0.43 ? 45  LYS B H    1 
ATOM   1734 H HA   . LYS B 1 45 ? -17.383 5.609   -11.087 1.00 0.49 ? 45  LYS B HA   1 
ATOM   1735 H HB2  . LYS B 1 45 ? -19.576 7.573   -10.377 1.00 0.50 ? 45  LYS B HB2  1 
ATOM   1736 H HB3  . LYS B 1 45 ? -19.384 6.647   -11.863 1.00 0.56 ? 45  LYS B HB3  1 
ATOM   1737 H HG2  . LYS B 1 45 ? -19.796 4.562   -10.627 1.00 0.49 ? 45  LYS B HG2  1 
ATOM   1738 H HG3  . LYS B 1 45 ? -19.980 5.479   -9.131  1.00 0.41 ? 45  LYS B HG3  1 
ATOM   1739 H HD2  . LYS B 1 45 ? -21.957 6.558   -9.911  1.00 0.59 ? 45  LYS B HD2  1 
ATOM   1740 H HD3  . LYS B 1 45 ? -21.673 6.042   -11.573 1.00 0.68 ? 45  LYS B HD3  1 
ATOM   1741 H HE2  . LYS B 1 45 ? -22.158 3.757   -11.037 1.00 0.95 ? 45  LYS B HE2  1 
ATOM   1742 H HE3  . LYS B 1 45 ? -22.154 4.098   -9.306  1.00 1.18 ? 45  LYS B HE3  1 
ATOM   1743 H HZ1  . LYS B 1 45 ? -23.995 5.658   -10.931 1.00 1.95 ? 45  LYS B HZ1  1 
ATOM   1744 H HZ2  . LYS B 1 45 ? -24.364 4.010   -10.759 1.00 1.92 ? 45  LYS B HZ2  1 
ATOM   1745 H HZ3  . LYS B 1 45 ? -24.207 4.995   -9.385  1.00 1.99 ? 45  LYS B HZ3  1 
ATOM   1746 N N    . ARG B 1 46 ? -16.806 8.520   -9.729  1.00 0.49 ? 46  ARG B N    1 
ATOM   1747 C CA   . ARG B 1 46 ? -16.080 9.821   -9.930  1.00 0.53 ? 46  ARG B CA   1 
ATOM   1748 C C    . ARG B 1 46 ? -14.957 9.923   -8.899  1.00 0.48 ? 46  ARG B C    1 
ATOM   1749 O O    . ARG B 1 46 ? -14.824 10.898  -8.190  1.00 0.49 ? 46  ARG B O    1 
ATOM   1750 C CB   . ARG B 1 46 ? -17.074 10.991  -9.758  1.00 0.57 ? 46  ARG B CB   1 
ATOM   1751 C CG   . ARG B 1 46 ? -16.545 12.288  -10.423 1.00 0.68 ? 46  ARG B CG   1 
ATOM   1752 C CD   . ARG B 1 46 ? -15.621 13.072  -9.469  1.00 0.99 ? 46  ARG B CD   1 
ATOM   1753 N NE   . ARG B 1 46 ? -15.746 14.538  -9.749  1.00 1.58 ? 46  ARG B NE   1 
ATOM   1754 C CZ   . ARG B 1 46 ? -15.625 15.010  -10.963 1.00 2.19 ? 46  ARG B CZ   1 
ATOM   1755 N NH1  . ARG B 1 46 ? -15.200 14.245  -11.932 1.00 2.64 ? 46  ARG B NH1  1 
ATOM   1756 N NH2  . ARG B 1 46 ? -15.874 16.273  -11.195 1.00 2.86 ? 46  ARG B NH2  1 
ATOM   1757 H H    . ARG B 1 46 ? -17.138 8.284   -8.838  1.00 0.46 ? 46  ARG B H    1 
ATOM   1758 H HA   . ARG B 1 46 ? -15.649 9.850   -10.920 1.00 0.58 ? 46  ARG B HA   1 
ATOM   1759 H HB2  . ARG B 1 46 ? -18.012 10.717  -10.221 1.00 0.66 ? 46  ARG B HB2  1 
ATOM   1760 H HB3  . ARG B 1 46 ? -17.242 11.163  -8.710  1.00 0.54 ? 46  ARG B HB3  1 
ATOM   1761 H HG2  . ARG B 1 46 ? -16.005 12.038  -11.321 1.00 0.85 ? 46  ARG B HG2  1 
ATOM   1762 H HG3  . ARG B 1 46 ? -17.386 12.915  -10.685 1.00 1.16 ? 46  ARG B HG3  1 
ATOM   1763 H HD2  . ARG B 1 46 ? -15.919 12.918  -8.449  1.00 1.51 ? 46  ARG B HD2  1 
ATOM   1764 H HD3  . ARG B 1 46 ? -14.596 12.737  -9.598  1.00 1.06 ? 46  ARG B HD3  1 
ATOM   1765 H HE   . ARG B 1 46 ? -15.976 15.148  -9.016  1.00 2.02 ? 46  ARG B HE   1 
ATOM   1766 H HH11 . ARG B 1 46 ? -14.959 13.295  -11.751 1.00 2.46 ? 46  ARG B HH11 1 
ATOM   1767 H HH12 . ARG B 1 46 ? -15.116 14.612  -12.859 1.00 3.44 ? 46  ARG B HH12 1 
ATOM   1768 H HH21 . ARG B 1 46 ? -16.156 16.873  -10.446 1.00 3.02 ? 46  ARG B HH21 1 
ATOM   1769 H HH22 . ARG B 1 46 ? -15.784 16.638  -12.121 1.00 3.46 ? 46  ARG B HH22 1 
ATOM   1770 N N    . SER B 1 47 ? -14.139 8.918   -8.823  1.00 0.44 ? 47  SER B N    1 
ATOM   1771 C CA   . SER B 1 47 ? -13.010 8.939   -7.866  1.00 0.41 ? 47  SER B CA   1 
ATOM   1772 C C    . SER B 1 47 ? -12.070 7.792   -8.222  1.00 0.41 ? 47  SER B C    1 
ATOM   1773 O O    . SER B 1 47 ? -11.566 7.710   -9.324  1.00 0.45 ? 47  SER B O    1 
ATOM   1774 C CB   . SER B 1 47 ? -13.525 8.787   -6.427  1.00 0.38 ? 47  SER B CB   1 
ATOM   1775 O OG   . SER B 1 47 ? -13.922 7.443   -6.198  1.00 0.99 ? 47  SER B OG   1 
ATOM   1776 H H    . SER B 1 47 ? -14.263 8.143   -9.406  1.00 0.45 ? 47  SER B H    1 
ATOM   1777 H HA   . SER B 1 47 ? -12.483 9.869   -7.958  1.00 0.43 ? 47  SER B HA   1 
ATOM   1778 H HB2  . SER B 1 47 ? -12.739 9.045   -5.735  1.00 0.75 ? 47  SER B HB2  1 
ATOM   1779 H HB3  . SER B 1 47 ? -14.364 9.452   -6.274  1.00 0.80 ? 47  SER B HB3  1 
ATOM   1780 H HG   . SER B 1 47 ? -14.207 7.368   -5.285  1.00 1.38 ? 47  SER B HG   1 
ATOM   1781 N N    . LYS B 1 48 ? -11.846 6.906   -7.311  1.00 0.37 ? 48  LYS B N    1 
ATOM   1782 C CA   . LYS B 1 48 ? -10.954 5.754   -7.584  1.00 0.38 ? 48  LYS B CA   1 
ATOM   1783 C C    . LYS B 1 48 ? -11.303 4.654   -6.590  1.00 0.33 ? 48  LYS B C    1 
ATOM   1784 O O    . LYS B 1 48 ? -12.200 3.856   -6.793  1.00 0.31 ? 48  LYS B O    1 
ATOM   1785 C CB   . LYS B 1 48 ? -9.481  6.168   -7.376  1.00 0.44 ? 48  LYS B CB   1 
ATOM   1786 C CG   . LYS B 1 48 ? -8.897  6.801   -8.645  1.00 1.12 ? 48  LYS B CG   1 
ATOM   1787 C CD   . LYS B 1 48 ? -7.371  6.897   -8.493  1.00 1.24 ? 48  LYS B CD   1 
ATOM   1788 C CE   . LYS B 1 48 ? -6.747  7.695   -9.659  1.00 2.01 ? 48  LYS B CE   1 
ATOM   1789 N NZ   . LYS B 1 48 ? -6.027  6.755   -10.566 1.00 2.55 ? 48  LYS B NZ   1 
ATOM   1790 H H    . LYS B 1 48 ? -12.283 6.986   -6.442  1.00 0.34 ? 48  LYS B H    1 
ATOM   1791 H HA   . LYS B 1 48 ? -11.103 5.398   -8.592  1.00 0.42 ? 48  LYS B HA   1 
ATOM   1792 H HB2  . LYS B 1 48 ? -9.427  6.884   -6.568  1.00 1.03 ? 48  LYS B HB2  1 
ATOM   1793 H HB3  . LYS B 1 48 ? -8.892  5.298   -7.115  1.00 0.97 ? 48  LYS B HB3  1 
ATOM   1794 H HG2  . LYS B 1 48 ? -9.137  6.192   -9.503  1.00 1.69 ? 48  LYS B HG2  1 
ATOM   1795 H HG3  . LYS B 1 48 ? -9.303  7.792   -8.776  1.00 1.72 ? 48  LYS B HG3  1 
ATOM   1796 H HD2  . LYS B 1 48 ? -7.140  7.381   -7.553  1.00 1.51 ? 48  LYS B HD2  1 
ATOM   1797 H HD3  . LYS B 1 48 ? -6.956  5.899   -8.487  1.00 1.52 ? 48  LYS B HD3  1 
ATOM   1798 H HE2  . LYS B 1 48 ? -7.517  8.213   -10.217 1.00 2.55 ? 48  LYS B HE2  1 
ATOM   1799 H HE3  . LYS B 1 48 ? -6.043  8.419   -9.270  1.00 2.50 ? 48  LYS B HE3  1 
ATOM   1800 H HZ1  . LYS B 1 48 ? -5.805  5.880   -10.054 1.00 2.87 ? 48  LYS B HZ1  1 
ATOM   1801 H HZ2  . LYS B 1 48 ? -6.629  6.533   -11.384 1.00 3.06 ? 48  LYS B HZ2  1 
ATOM   1802 H HZ3  . LYS B 1 48 ? -5.142  7.198   -10.891 1.00 2.83 ? 48  LYS B HZ3  1 
ATOM   1803 N N    . GLN B 1 49 ? -10.581 4.635   -5.506  1.00 0.33 ? 49  GLN B N    1 
ATOM   1804 C CA   . GLN B 1 49 ? -10.796 3.626   -4.441  1.00 0.30 ? 49  GLN B CA   1 
ATOM   1805 C C    . GLN B 1 49 ? -11.012 4.363   -3.111  1.00 0.25 ? 49  GLN B C    1 
ATOM   1806 O O    . GLN B 1 49 ? -10.432 5.406   -2.872  1.00 0.26 ? 49  GLN B O    1 
ATOM   1807 C CB   . GLN B 1 49 ? -9.537  2.761   -4.369  1.00 0.34 ? 49  GLN B CB   1 
ATOM   1808 C CG   . GLN B 1 49 ? -9.573  1.699   -5.472  1.00 0.85 ? 49  GLN B CG   1 
ATOM   1809 C CD   . GLN B 1 49 ? -8.296  0.862   -5.415  1.00 1.00 ? 49  GLN B CD   1 
ATOM   1810 O OE1  . GLN B 1 49 ? -7.463  1.060   -4.552  1.00 1.60 ? 49  GLN B OE1  1 
ATOM   1811 N NE2  . GLN B 1 49 ? -8.102  -0.072  -6.306  1.00 1.68 ? 49  GLN B NE2  1 
ATOM   1812 H H    . GLN B 1 49 ? -9.876  5.306   -5.393  1.00 0.37 ? 49  GLN B H    1 
ATOM   1813 H HA   . GLN B 1 49 ? -11.657 3.011   -4.663  1.00 0.32 ? 49  GLN B HA   1 
ATOM   1814 H HB2  . GLN B 1 49 ? -8.670  3.390   -4.509  1.00 0.77 ? 49  GLN B HB2  1 
ATOM   1815 H HB3  . GLN B 1 49 ? -9.479  2.284   -3.412  1.00 0.83 ? 49  GLN B HB3  1 
ATOM   1816 H HG2  . GLN B 1 49 ? -10.431 1.059   -5.328  1.00 1.53 ? 49  GLN B HG2  1 
ATOM   1817 H HG3  . GLN B 1 49 ? -9.642  2.182   -6.435  1.00 1.39 ? 49  GLN B HG3  1 
ATOM   1818 H HE21 . GLN B 1 49 ? -8.773  -0.232  -7.002  1.00 2.24 ? 49  GLN B HE21 1 
ATOM   1819 H HE22 . GLN B 1 49 ? -7.286  -0.614  -6.278  1.00 2.04 ? 49  GLN B HE22 1 
ATOM   1820 N N    . VAL B 1 50 ? -11.849 3.838   -2.249  1.00 0.21 ? 50  VAL B N    1 
ATOM   1821 C CA   . VAL B 1 50 ? -12.112 4.517   -0.938  1.00 0.18 ? 50  VAL B CA   1 
ATOM   1822 C C    . VAL B 1 50 ? -12.109 3.487   0.184   1.00 0.14 ? 50  VAL B C    1 
ATOM   1823 O O    . VAL B 1 50 ? -12.875 2.550   0.172   1.00 0.13 ? 50  VAL B O    1 
ATOM   1824 C CB   . VAL B 1 50 ? -13.483 5.199   -0.982  1.00 0.20 ? 50  VAL B CB   1 
ATOM   1825 C CG1  . VAL B 1 50 ? -13.633 6.115   0.235   1.00 0.23 ? 50  VAL B CG1  1 
ATOM   1826 C CG2  . VAL B 1 50 ? -13.609 6.018   -2.276  1.00 0.30 ? 50  VAL B CG2  1 
ATOM   1827 H H    . VAL B 1 50 ? -12.312 3.003   -2.466  1.00 0.24 ? 50  VAL B H    1 
ATOM   1828 H HA   . VAL B 1 50 ? -11.346 5.255   -0.740  1.00 0.18 ? 50  VAL B HA   1 
ATOM   1829 H HB   . VAL B 1 50 ? -14.257 4.445   -0.956  1.00 0.23 ? 50  VAL B HB   1 
ATOM   1830 H HG11 . VAL B 1 50 ? -12.839 6.845   0.234   1.00 1.02 ? 50  VAL B HG11 1 
ATOM   1831 H HG12 . VAL B 1 50 ? -14.586 6.621   0.189   1.00 1.03 ? 50  VAL B HG12 1 
ATOM   1832 H HG13 . VAL B 1 50 ? -13.580 5.526   1.138   1.00 1.08 ? 50  VAL B HG13 1 
ATOM   1833 H HG21 . VAL B 1 50 ? -12.653 6.454   -2.527  1.00 1.10 ? 50  VAL B HG21 1 
ATOM   1834 H HG22 . VAL B 1 50 ? -13.929 5.372   -3.079  1.00 1.06 ? 50  VAL B HG22 1 
ATOM   1835 H HG23 . VAL B 1 50 ? -14.339 6.806   -2.140  1.00 1.02 ? 50  VAL B HG23 1 
ATOM   1836 N N    . CYS B 1 51 ? -11.263 3.662   1.160   1.00 0.14 ? 51  CYS B N    1 
ATOM   1837 C CA   . CYS B 1 51 ? -11.214 2.691   2.287   1.00 0.12 ? 51  CYS B CA   1 
ATOM   1838 C C    . CYS B 1 51 ? -12.449 2.875   3.166   1.00 0.11 ? 51  CYS B C    1 
ATOM   1839 O O    . CYS B 1 51 ? -13.010 3.950   3.249   1.00 0.13 ? 51  CYS B O    1 
ATOM   1840 C CB   . CYS B 1 51 ? -9.953  2.944   3.115   1.00 0.14 ? 51  CYS B CB   1 
ATOM   1841 S SG   . CYS B 1 51 ? -8.488  2.645   2.096   1.00 0.18 ? 51  CYS B SG   1 
ATOM   1842 H H    . CYS B 1 51 ? -10.662 4.434   1.154   1.00 0.15 ? 51  CYS B H    1 
ATOM   1843 H HA   . CYS B 1 51 ? -11.192 1.686   1.898   1.00 0.12 ? 51  CYS B HA   1 
ATOM   1844 H HB2  . CYS B 1 51 ? -9.950  3.967   3.461   1.00 0.15 ? 51  CYS B HB2  1 
ATOM   1845 H HB3  . CYS B 1 51 ? -9.944  2.280   3.963   1.00 0.14 ? 51  CYS B HB3  1 
ATOM   1846 N N    . ALA B 1 52 ? -12.888 1.829   3.817   1.00 0.10 ? 52  ALA B N    1 
ATOM   1847 C CA   . ALA B 1 52 ? -14.101 1.935   4.684   1.00 0.11 ? 52  ALA B CA   1 
ATOM   1848 C C    . ALA B 1 52 ? -13.935 1.041   5.916   1.00 0.13 ? 52  ALA B C    1 
ATOM   1849 O O    . ALA B 1 52 ? -13.460 -0.075  5.828   1.00 0.13 ? 52  ALA B O    1 
ATOM   1850 C CB   . ALA B 1 52 ? -15.328 1.479   3.890   1.00 0.10 ? 52  ALA B CB   1 
ATOM   1851 H H    . ALA B 1 52 ? -12.426 0.969   3.728   1.00 0.10 ? 52  ALA B H    1 
ATOM   1852 H HA   . ALA B 1 52 ? -14.239 2.961   5.001   1.00 0.13 ? 52  ALA B HA   1 
ATOM   1853 H HB1  . ALA B 1 52 ? -15.299 1.914   2.902   1.00 1.00 ? 52  ALA B HB1  1 
ATOM   1854 H HB2  . ALA B 1 52 ? -15.324 0.401   3.808   1.00 1.03 ? 52  ALA B HB2  1 
ATOM   1855 H HB3  . ALA B 1 52 ? -16.225 1.799   4.398   1.00 0.99 ? 52  ALA B HB3  1 
ATOM   1856 N N    . ASP B 1 53 ? -14.328 1.529   7.063   1.00 0.17 ? 53  ASP B N    1 
ATOM   1857 C CA   . ASP B 1 53 ? -14.202 0.722   8.314   1.00 0.20 ? 53  ASP B CA   1 
ATOM   1858 C C    . ASP B 1 53 ? -15.191 -0.474  8.251   1.00 0.20 ? 53  ASP B C    1 
ATOM   1859 O O    . ASP B 1 53 ? -16.383 -0.246  8.225   1.00 0.22 ? 53  ASP B O    1 
ATOM   1860 C CB   . ASP B 1 53 ? -14.569 1.627   9.519   1.00 0.25 ? 53  ASP B CB   1 
ATOM   1861 C CG   . ASP B 1 53 ? -13.304 2.122   10.231  1.00 1.39 ? 53  ASP B CG   1 
ATOM   1862 O OD1  . ASP B 1 53 ? -12.685 1.325   10.919  1.00 2.15 ? 53  ASP B OD1  1 
ATOM   1863 O OD2  . ASP B 1 53 ? -12.980 3.287   10.080  1.00 2.20 ? 53  ASP B OD2  1 
ATOM   1864 H H    . ASP B 1 53 ? -14.707 2.432   7.103   1.00 0.18 ? 53  ASP B H    1 
ATOM   1865 H HA   . ASP B 1 53 ? -13.188 0.385   8.410   1.00 0.20 ? 53  ASP B HA   1 
ATOM   1866 H HB2  . ASP B 1 53 ? -15.127 2.480   9.162   1.00 1.01 ? 53  ASP B HB2  1 
ATOM   1867 H HB3  . ASP B 1 53 ? -15.177 1.078   10.226  1.00 1.01 ? 53  ASP B HB3  1 
ATOM   1868 N N    . PRO B 1 54 ? -14.711 -1.712  8.242   1.00 0.21 ? 54  PRO B N    1 
ATOM   1869 C CA   . PRO B 1 54 ? -15.631 -2.866  8.200   1.00 0.22 ? 54  PRO B CA   1 
ATOM   1870 C C    . PRO B 1 54 ? -16.498 -2.875  9.465   1.00 0.27 ? 54  PRO B C    1 
ATOM   1871 O O    . PRO B 1 54 ? -17.399 -3.676  9.614   1.00 0.29 ? 54  PRO B O    1 
ATOM   1872 C CB   . PRO B 1 54 ? -14.717 -4.111  8.147   1.00 0.24 ? 54  PRO B CB   1 
ATOM   1873 C CG   . PRO B 1 54 ? -13.243 -3.616  8.218   1.00 0.23 ? 54  PRO B CG   1 
ATOM   1874 C CD   . PRO B 1 54 ? -13.272 -2.072  8.274   1.00 0.21 ? 54  PRO B CD   1 
ATOM   1875 H HA   . PRO B 1 54 ? -16.253 -2.819  7.318   1.00 0.20 ? 54  PRO B HA   1 
ATOM   1876 H HB2  . PRO B 1 54 ? -14.927 -4.765  8.985   1.00 0.28 ? 54  PRO B HB2  1 
ATOM   1877 H HB3  . PRO B 1 54 ? -14.876 -4.647  7.220   1.00 0.23 ? 54  PRO B HB3  1 
ATOM   1878 H HG2  . PRO B 1 54 ? -12.763 -4.012  9.107   1.00 0.27 ? 54  PRO B HG2  1 
ATOM   1879 H HG3  . PRO B 1 54 ? -12.702 -3.941  7.342   1.00 0.22 ? 54  PRO B HG3  1 
ATOM   1880 H HD2  . PRO B 1 54 ? -12.812 -1.724  9.191   1.00 0.23 ? 54  PRO B HD2  1 
ATOM   1881 H HD3  . PRO B 1 54 ? -12.764 -1.654  7.416   1.00 0.18 ? 54  PRO B HD3  1 
ATOM   1882 N N    . SER B 1 55 ? -16.214 -1.994  10.382  1.00 0.30 ? 55  SER B N    1 
ATOM   1883 C CA   . SER B 1 55 ? -16.998 -1.950  11.648  1.00 0.36 ? 55  SER B CA   1 
ATOM   1884 C C    . SER B 1 55 ? -18.351 -1.279  11.402  1.00 0.36 ? 55  SER B C    1 
ATOM   1885 O O    . SER B 1 55 ? -19.302 -1.504  12.124  1.00 0.39 ? 55  SER B O    1 
ATOM   1886 C CB   . SER B 1 55 ? -16.220 -1.155  12.696  1.00 0.40 ? 55  SER B CB   1 
ATOM   1887 O OG   . SER B 1 55 ? -17.005 -1.036  13.875  1.00 1.37 ? 55  SER B OG   1 
ATOM   1888 H H    . SER B 1 55 ? -15.473 -1.372  10.243  1.00 0.29 ? 55  SER B H    1 
ATOM   1889 H HA   . SER B 1 55 ? -17.157 -2.957  12.007  1.00 0.38 ? 55  SER B HA   1 
ATOM   1890 H HB2  . SER B 1 55 ? -15.302 -1.668  12.932  1.00 0.95 ? 55  SER B HB2  1 
ATOM   1891 H HB3  . SER B 1 55 ? -15.989 -0.173  12.303  1.00 1.14 ? 55  SER B HB3  1 
ATOM   1892 H HG   . SER B 1 55 ? -16.538 -0.462  14.486  1.00 1.83 ? 55  SER B HG   1 
ATOM   1893 N N    . GLU B 1 56 ? -18.457 -0.460  10.390  1.00 0.33 ? 56  GLU B N    1 
ATOM   1894 C CA   . GLU B 1 56 ? -19.762 0.209   10.115  1.00 0.33 ? 56  GLU B CA   1 
ATOM   1895 C C    . GLU B 1 56 ? -20.676 -0.767  9.371   1.00 0.32 ? 56  GLU B C    1 
ATOM   1896 O O    . GLU B 1 56 ? -20.380 -1.223  8.283   1.00 0.28 ? 56  GLU B O    1 
ATOM   1897 C CB   . GLU B 1 56 ? -19.535 1.469   9.272   1.00 0.31 ? 56  GLU B CB   1 
ATOM   1898 C CG   . GLU B 1 56 ? -18.859 2.565   10.118  1.00 0.35 ? 56  GLU B CG   1 
ATOM   1899 C CD   . GLU B 1 56 ? -19.135 3.940   9.505   1.00 1.30 ? 56  GLU B CD   1 
ATOM   1900 O OE1  . GLU B 1 56 ? -18.897 4.098   8.319   1.00 2.09 ? 56  GLU B OE1  1 
ATOM   1901 O OE2  . GLU B 1 56 ? -19.579 4.813   10.233  1.00 2.05 ? 56  GLU B OE2  1 
ATOM   1902 H H    . GLU B 1 56 ? -17.684 -0.288  9.811   1.00 0.30 ? 56  GLU B H    1 
ATOM   1903 H HA   . GLU B 1 56 ? -20.228 0.480   11.051  1.00 0.37 ? 56  GLU B HA   1 
ATOM   1904 H HB2  . GLU B 1 56 ? -18.899 1.223   8.436   1.00 0.28 ? 56  GLU B HB2  1 
ATOM   1905 H HB3  . GLU B 1 56 ? -20.487 1.828   8.908   1.00 0.31 ? 56  GLU B HB3  1 
ATOM   1906 H HG2  . GLU B 1 56 ? -19.245 2.544   11.127  1.00 0.90 ? 56  GLU B HG2  1 
ATOM   1907 H HG3  . GLU B 1 56 ? -17.793 2.393   10.139  1.00 1.05 ? 56  GLU B HG3  1 
ATOM   1908 N N    . SER B 1 57 ? -21.778 -1.105  9.978   1.00 0.37 ? 57  SER B N    1 
ATOM   1909 C CA   . SER B 1 57 ? -22.734 -2.073  9.366   1.00 0.38 ? 57  SER B CA   1 
ATOM   1910 C C    . SER B 1 57 ? -23.037 -1.730  7.904   1.00 0.34 ? 57  SER B C    1 
ATOM   1911 O O    . SER B 1 57 ? -23.161 -2.611  7.076   1.00 0.32 ? 57  SER B O    1 
ATOM   1912 C CB   . SER B 1 57 ? -24.038 -2.060  10.164  1.00 0.44 ? 57  SER B CB   1 
ATOM   1913 O OG   . SER B 1 57 ? -24.467 -0.715  10.337  1.00 1.42 ? 57  SER B OG   1 
ATOM   1914 H H    . SER B 1 57 ? -21.972 -0.732  10.861  1.00 0.41 ? 57  SER B H    1 
ATOM   1915 H HA   . SER B 1 57 ? -22.307 -3.061  9.412   1.00 0.38 ? 57  SER B HA   1 
ATOM   1916 H HB2  . SER B 1 57 ? -24.795 -2.607  9.628   1.00 1.16 ? 57  SER B HB2  1 
ATOM   1917 H HB3  . SER B 1 57 ? -23.874 -2.524  11.128  1.00 1.05 ? 57  SER B HB3  1 
ATOM   1918 H HG   . SER B 1 57 ? -24.936 -0.657  11.172  1.00 1.90 ? 57  SER B HG   1 
ATOM   1919 N N    . TRP B 1 58 ? -23.187 -0.478  7.567   1.00 0.34 ? 58  TRP B N    1 
ATOM   1920 C CA   . TRP B 1 58 ? -23.513 -0.151  6.151   1.00 0.31 ? 58  TRP B CA   1 
ATOM   1921 C C    . TRP B 1 58 ? -22.418 -0.688  5.235   1.00 0.26 ? 58  TRP B C    1 
ATOM   1922 O O    . TRP B 1 58 ? -22.677 -1.112  4.128   1.00 0.25 ? 58  TRP B O    1 
ATOM   1923 C CB   . TRP B 1 58 ? -23.711 1.362   5.969   1.00 0.33 ? 58  TRP B CB   1 
ATOM   1924 C CG   . TRP B 1 58 ? -22.409 2.103   5.915   1.00 0.30 ? 58  TRP B CG   1 
ATOM   1925 C CD1  . TRP B 1 58 ? -21.937 2.900   6.902   1.00 0.32 ? 58  TRP B CD1  1 
ATOM   1926 C CD2  . TRP B 1 58 ? -21.428 2.169   4.835   1.00 0.26 ? 58  TRP B CD2  1 
ATOM   1927 N NE1  . TRP B 1 58 ? -20.738 3.458   6.498   1.00 0.29 ? 58  TRP B NE1  1 
ATOM   1928 C CE2  . TRP B 1 58 ? -20.374 3.034   5.239   1.00 0.26 ? 58  TRP B CE2  1 
ATOM   1929 C CE3  . TRP B 1 58 ? -21.344 1.573   3.553   1.00 0.26 ? 58  TRP B CE3  1 
ATOM   1930 C CZ2  . TRP B 1 58 ? -19.279 3.299   4.405   1.00 0.25 ? 58  TRP B CZ2  1 
ATOM   1931 C CZ3  . TRP B 1 58 ? -20.241 1.837   2.711   1.00 0.26 ? 58  TRP B CZ3  1 
ATOM   1932 C CH2  . TRP B 1 58 ? -19.211 2.696   3.139   1.00 0.25 ? 58  TRP B CH2  1 
ATOM   1933 H H    . TRP B 1 58 ? -23.100 0.231   8.236   1.00 0.36 ? 58  TRP B H    1 
ATOM   1934 H HA   . TRP B 1 58 ? -24.438 -0.651  5.896   1.00 0.33 ? 58  TRP B HA   1 
ATOM   1935 H HB2  . TRP B 1 58 ? -24.250 1.539   5.051   1.00 0.35 ? 58  TRP B HB2  1 
ATOM   1936 H HB3  . TRP B 1 58 ? -24.298 1.740   6.795   1.00 0.38 ? 58  TRP B HB3  1 
ATOM   1937 H HD1  . TRP B 1 58 ? -22.425 3.081   7.849   1.00 0.36 ? 58  TRP B HD1  1 
ATOM   1938 H HE1  . TRP B 1 58 ? -20.198 4.078   7.026   1.00 0.31 ? 58  TRP B HE1  1 
ATOM   1939 H HE3  . TRP B 1 58 ? -22.130 0.921   3.211   1.00 0.27 ? 58  TRP B HE3  1 
ATOM   1940 H HZ2  . TRP B 1 58 ? -18.491 3.958   4.737   1.00 0.25 ? 58  TRP B HZ2  1 
ATOM   1941 H HZ3  . TRP B 1 58 ? -20.187 1.376   1.737   1.00 0.28 ? 58  TRP B HZ3  1 
ATOM   1942 H HH2  . TRP B 1 58 ? -18.370 2.895   2.492   1.00 0.27 ? 58  TRP B HH2  1 
ATOM   1943 N N    . VAL B 1 59 ? -21.202 -0.710  5.693   1.00 0.23 ? 59  VAL B N    1 
ATOM   1944 C CA   . VAL B 1 59 ? -20.107 -1.247  4.845   1.00 0.19 ? 59  VAL B CA   1 
ATOM   1945 C C    . VAL B 1 59 ? -20.364 -2.727  4.599   1.00 0.20 ? 59  VAL B C    1 
ATOM   1946 O O    . VAL B 1 59 ? -20.261 -3.216  3.492   1.00 0.20 ? 59  VAL B O    1 
ATOM   1947 C CB   . VAL B 1 59 ? -18.780 -1.070  5.581   1.00 0.19 ? 59  VAL B CB   1 
ATOM   1948 C CG1  . VAL B 1 59 ? -17.634 -1.663  4.753   1.00 0.18 ? 59  VAL B CG1  1 
ATOM   1949 C CG2  . VAL B 1 59 ? -18.549 0.421   5.807   1.00 0.19 ? 59  VAL B CG2  1 
ATOM   1950 H H    . VAL B 1 59 ? -21.011 -0.389  6.599   1.00 0.25 ? 59  VAL B H    1 
ATOM   1951 H HA   . VAL B 1 59 ? -20.077 -0.719  3.904   1.00 0.18 ? 59  VAL B HA   1 
ATOM   1952 H HB   . VAL B 1 59 ? -18.828 -1.576  6.535   1.00 0.21 ? 59  VAL B HB   1 
ATOM   1953 H HG11 . VAL B 1 59 ? -17.778 -1.429  3.711   1.00 1.02 ? 59  VAL B HG11 1 
ATOM   1954 H HG12 . VAL B 1 59 ? -16.693 -1.250  5.087   1.00 1.06 ? 59  VAL B HG12 1 
ATOM   1955 H HG13 . VAL B 1 59 ? -17.619 -2.736  4.879   1.00 1.00 ? 59  VAL B HG13 1 
ATOM   1956 H HG21 . VAL B 1 59 ? -19.440 0.854   6.236   1.00 1.05 ? 59  VAL B HG21 1 
ATOM   1957 H HG22 . VAL B 1 59 ? -17.721 0.564   6.482   1.00 1.01 ? 59  VAL B HG22 1 
ATOM   1958 H HG23 . VAL B 1 59 ? -18.337 0.901   4.864   1.00 1.03 ? 59  VAL B HG23 1 
ATOM   1959 N N    . GLN B 1 60 ? -20.709 -3.439  5.626   1.00 0.24 ? 60  GLN B N    1 
ATOM   1960 C CA   . GLN B 1 60 ? -20.986 -4.891  5.466   1.00 0.27 ? 60  GLN B CA   1 
ATOM   1961 C C    . GLN B 1 60 ? -22.208 -5.070  4.555   1.00 0.27 ? 60  GLN B C    1 
ATOM   1962 O O    . GLN B 1 60 ? -22.247 -5.942  3.711   1.00 0.29 ? 60  GLN B O    1 
ATOM   1963 C CB   . GLN B 1 60 ? -21.254 -5.492  6.864   1.00 0.32 ? 60  GLN B CB   1 
ATOM   1964 C CG   . GLN B 1 60 ? -20.715 -6.923  6.957   1.00 1.22 ? 60  GLN B CG   1 
ATOM   1965 C CD   . GLN B 1 60 ? -20.751 -7.379  8.417   1.00 1.62 ? 60  GLN B CD   1 
ATOM   1966 O OE1  . GLN B 1 60 ? -20.461 -6.609  9.313   1.00 2.20 ? 60  GLN B OE1  1 
ATOM   1967 N NE2  . GLN B 1 60 ? -21.097 -8.604  8.698   1.00 2.24 ? 60  GLN B NE2  1 
ATOM   1968 H H    . GLN B 1 60 ? -20.792 -3.015  6.508   1.00 0.25 ? 60  GLN B H    1 
ATOM   1969 H HA   . GLN B 1 60 ? -20.131 -5.365  5.011   1.00 0.27 ? 60  GLN B HA   1 
ATOM   1970 H HB2  . GLN B 1 60 ? -20.762 -4.882  7.607   1.00 0.90 ? 60  GLN B HB2  1 
ATOM   1971 H HB3  . GLN B 1 60 ? -22.317 -5.499  7.062   1.00 0.91 ? 60  GLN B HB3  1 
ATOM   1972 H HG2  . GLN B 1 60 ? -21.329 -7.578  6.357   1.00 1.94 ? 60  GLN B HG2  1 
ATOM   1973 H HG3  . GLN B 1 60 ? -19.697 -6.954  6.601   1.00 1.81 ? 60  GLN B HG3  1 
ATOM   1974 H HE21 . GLN B 1 60 ? -21.331 -9.225  7.977   1.00 2.58 ? 60  GLN B HE21 1 
ATOM   1975 H HE22 . GLN B 1 60 ? -21.123 -8.905  9.631   1.00 2.73 ? 60  GLN B HE22 1 
ATOM   1976 N N    . GLU B 1 61 ? -23.205 -4.249  4.733   1.00 0.28 ? 61  GLU B N    1 
ATOM   1977 C CA   . GLU B 1 61 ? -24.436 -4.357  3.894   1.00 0.30 ? 61  GLU B CA   1 
ATOM   1978 C C    . GLU B 1 61 ? -24.102 -4.080  2.425   1.00 0.28 ? 61  GLU B C    1 
ATOM   1979 O O    . GLU B 1 61 ? -24.505 -4.810  1.541   1.00 0.29 ? 61  GLU B O    1 
ATOM   1980 C CB   . GLU B 1 61 ? -25.473 -3.339  4.377   1.00 0.31 ? 61  GLU B CB   1 
ATOM   1981 C CG   . GLU B 1 61 ? -26.800 -3.572  3.650   1.00 0.34 ? 61  GLU B CG   1 
ATOM   1982 C CD   . GLU B 1 61 ? -27.910 -2.777  4.341   1.00 1.15 ? 61  GLU B CD   1 
ATOM   1983 O OE1  . GLU B 1 61 ? -27.796 -2.554  5.535   1.00 1.82 ? 61  GLU B OE1  1 
ATOM   1984 O OE2  . GLU B 1 61 ? -28.854 -2.405  3.664   1.00 1.94 ? 61  GLU B OE2  1 
ATOM   1985 H H    . GLU B 1 61 ? -23.146 -3.562  5.427   1.00 0.28 ? 61  GLU B H    1 
ATOM   1986 H HA   . GLU B 1 61 ? -24.843 -5.351  3.985   1.00 0.32 ? 61  GLU B HA   1 
ATOM   1987 H HB2  . GLU B 1 61 ? -25.619 -3.452  5.442   1.00 0.33 ? 61  GLU B HB2  1 
ATOM   1988 H HB3  . GLU B 1 61 ? -25.121 -2.340  4.167   1.00 0.31 ? 61  GLU B HB3  1 
ATOM   1989 H HG2  . GLU B 1 61 ? -26.708 -3.247  2.623   1.00 0.81 ? 61  GLU B HG2  1 
ATOM   1990 H HG3  . GLU B 1 61 ? -27.045 -4.624  3.674   1.00 0.86 ? 61  GLU B HG3  1 
ATOM   1991 N N    . TYR B 1 62 ? -23.376 -3.030  2.153   1.00 0.26 ? 62  TYR B N    1 
ATOM   1992 C CA   . TYR B 1 62 ? -23.029 -2.712  0.736   1.00 0.25 ? 62  TYR B CA   1 
ATOM   1993 C C    . TYR B 1 62 ? -22.203 -3.859  0.144   1.00 0.26 ? 62  TYR B C    1 
ATOM   1994 O O    . TYR B 1 62 ? -22.343 -4.199  -1.014  1.00 0.27 ? 62  TYR B O    1 
ATOM   1995 C CB   . TYR B 1 62 ? -22.220 -1.403  0.674   1.00 0.23 ? 62  TYR B CB   1 
ATOM   1996 C CG   . TYR B 1 62 ? -23.147 -0.198  0.708   1.00 0.23 ? 62  TYR B CG   1 
ATOM   1997 C CD1  . TYR B 1 62 ? -24.151 -0.091  1.694   1.00 0.26 ? 62  TYR B CD1  1 
ATOM   1998 C CD2  . TYR B 1 62 ? -23.000 0.823   -0.255  1.00 0.24 ? 62  TYR B CD2  1 
ATOM   1999 C CE1  . TYR B 1 62 ? -25.001 1.032   1.713   1.00 0.27 ? 62  TYR B CE1  1 
ATOM   2000 C CE2  . TYR B 1 62 ? -23.851 1.943   -0.233  1.00 0.25 ? 62  TYR B CE2  1 
ATOM   2001 C CZ   . TYR B 1 62 ? -24.852 2.049   0.750   1.00 0.27 ? 62  TYR B CZ   1 
ATOM   2002 O OH   . TYR B 1 62 ? -25.686 3.148   0.770   1.00 0.29 ? 62  TYR B OH   1 
ATOM   2003 H H    . TYR B 1 62 ? -23.064 -2.450  2.878   1.00 0.25 ? 62  TYR B H    1 
ATOM   2004 H HA   . TYR B 1 62 ? -23.939 -2.601  0.164   1.00 0.27 ? 62  TYR B HA   1 
ATOM   2005 H HB2  . TYR B 1 62 ? -21.551 -1.359  1.520   1.00 0.22 ? 62  TYR B HB2  1 
ATOM   2006 H HB3  . TYR B 1 62 ? -21.639 -1.381  -0.240  1.00 0.23 ? 62  TYR B HB3  1 
ATOM   2007 H HD1  . TYR B 1 62 ? -24.272 -0.864  2.432   1.00 0.27 ? 62  TYR B HD1  1 
ATOM   2008 H HD2  . TYR B 1 62 ? -22.233 0.744   -1.010  1.00 0.24 ? 62  TYR B HD2  1 
ATOM   2009 H HE1  . TYR B 1 62 ? -25.769 1.114   2.469   1.00 0.30 ? 62  TYR B HE1  1 
ATOM   2010 H HE2  . TYR B 1 62 ? -23.736 2.722   -0.972  1.00 0.26 ? 62  TYR B HE2  1 
ATOM   2011 H HH   . TYR B 1 62 ? -26.018 3.287   -0.121  1.00 0.87 ? 62  TYR B HH   1 
ATOM   2012 N N    . VAL B 1 63 ? -21.354 -4.465  0.926   1.00 0.26 ? 63  VAL B N    1 
ATOM   2013 C CA   . VAL B 1 63 ? -20.542 -5.590  0.399   1.00 0.27 ? 63  VAL B CA   1 
ATOM   2014 C C    . VAL B 1 63 ? -21.482 -6.742  0.065   1.00 0.31 ? 63  VAL B C    1 
ATOM   2015 O O    . VAL B 1 63 ? -21.358 -7.387  -0.954  1.00 0.33 ? 63  VAL B O    1 
ATOM   2016 C CB   . VAL B 1 63 ? -19.522 -6.025  1.458   1.00 0.28 ? 63  VAL B CB   1 
ATOM   2017 C CG1  . VAL B 1 63 ? -18.916 -7.382  1.083   1.00 0.31 ? 63  VAL B CG1  1 
ATOM   2018 C CG2  . VAL B 1 63 ? -18.407 -4.980  1.535   1.00 0.24 ? 63  VAL B CG2  1 
ATOM   2019 H H    . VAL B 1 63 ? -21.263 -4.191  1.860   1.00 0.25 ? 63  VAL B H    1 
ATOM   2020 H HA   . VAL B 1 63 ? -20.026 -5.277  -0.494  1.00 0.27 ? 63  VAL B HA   1 
ATOM   2021 H HB   . VAL B 1 63 ? -20.013 -6.102  2.417   1.00 0.29 ? 63  VAL B HB   1 
ATOM   2022 H HG11 . VAL B 1 63 ? -18.663 -7.385  0.033   1.00 1.09 ? 63  VAL B HG11 1 
ATOM   2023 H HG12 . VAL B 1 63 ? -18.024 -7.554  1.669   1.00 1.05 ? 63  VAL B HG12 1 
ATOM   2024 H HG13 . VAL B 1 63 ? -19.633 -8.163  1.282   1.00 1.07 ? 63  VAL B HG13 1 
ATOM   2025 H HG21 . VAL B 1 63 ? -17.944 -4.878  0.565   1.00 1.03 ? 63  VAL B HG21 1 
ATOM   2026 H HG22 . VAL B 1 63 ? -18.824 -4.031  1.836   1.00 1.03 ? 63  VAL B HG22 1 
ATOM   2027 H HG23 . VAL B 1 63 ? -17.668 -5.295  2.256   1.00 1.05 ? 63  VAL B HG23 1 
ATOM   2028 N N    . TYR B 1 64 ? -22.429 -6.993  0.921   1.00 0.33 ? 64  TYR B N    1 
ATOM   2029 C CA   . TYR B 1 64 ? -23.387 -8.096  0.666   1.00 0.37 ? 64  TYR B CA   1 
ATOM   2030 C C    . TYR B 1 64 ? -24.144 -7.812  -0.629  1.00 0.37 ? 64  TYR B C    1 
ATOM   2031 O O    . TYR B 1 64 ? -24.352 -8.683  -1.447  1.00 0.40 ? 64  TYR B O    1 
ATOM   2032 C CB   . TYR B 1 64 ? -24.376 -8.178  1.835   1.00 0.39 ? 64  TYR B CB   1 
ATOM   2033 C CG   . TYR B 1 64 ? -25.045 -9.535  1.854   1.00 0.44 ? 64  TYR B CG   1 
ATOM   2034 C CD1  . TYR B 1 64 ? -24.313 -10.673 2.240   1.00 0.45 ? 64  TYR B CD1  1 
ATOM   2035 C CD2  . TYR B 1 64 ? -26.400 -9.661  1.488   1.00 0.47 ? 64  TYR B CD2  1 
ATOM   2036 C CE1  . TYR B 1 64 ? -24.934 -11.937 2.262   1.00 0.50 ? 64  TYR B CE1  1 
ATOM   2037 C CE2  . TYR B 1 64 ? -27.021 -10.925 1.510   1.00 0.51 ? 64  TYR B CE2  1 
ATOM   2038 C CZ   . TYR B 1 64 ? -26.288 -12.063 1.897   1.00 0.52 ? 64  TYR B CZ   1 
ATOM   2039 O OH   . TYR B 1 64 ? -26.897 -13.302 1.918   1.00 0.57 ? 64  TYR B OH   1 
ATOM   2040 H H    . TYR B 1 64 ? -22.510 -6.452  1.733   1.00 0.32 ? 64  TYR B H    1 
ATOM   2041 H HA   . TYR B 1 64 ? -22.846 -9.023  0.576   1.00 0.38 ? 64  TYR B HA   1 
ATOM   2042 H HB2  . TYR B 1 64 ? -23.843 -8.028  2.760   1.00 0.39 ? 64  TYR B HB2  1 
ATOM   2043 H HB3  . TYR B 1 64 ? -25.126 -7.407  1.729   1.00 0.39 ? 64  TYR B HB3  1 
ATOM   2044 H HD1  . TYR B 1 64 ? -23.273 -10.578 2.520   1.00 0.44 ? 64  TYR B HD1  1 
ATOM   2045 H HD2  . TYR B 1 64 ? -26.963 -8.788  1.192   1.00 0.47 ? 64  TYR B HD2  1 
ATOM   2046 H HE1  . TYR B 1 64 ? -24.371 -12.810 2.558   1.00 0.51 ? 64  TYR B HE1  1 
ATOM   2047 H HE2  . TYR B 1 64 ? -28.059 -11.022 1.231   1.00 0.55 ? 64  TYR B HE2  1 
ATOM   2048 H HH   . TYR B 1 64 ? -27.848 -13.165 1.899   1.00 0.96 ? 64  TYR B HH   1 
ATOM   2049 N N    . ASP B 1 65 ? -24.554 -6.592  -0.817  1.00 0.36 ? 65  ASP B N    1 
ATOM   2050 C CA   . ASP B 1 65 ? -25.300 -6.235  -2.056  1.00 0.37 ? 65  ASP B CA   1 
ATOM   2051 C C    . ASP B 1 65 ? -24.405 -6.457  -3.276  1.00 0.37 ? 65  ASP B C    1 
ATOM   2052 O O    . ASP B 1 65 ? -24.862 -6.839  -4.334  1.00 0.40 ? 65  ASP B O    1 
ATOM   2053 C CB   . ASP B 1 65 ? -25.717 -4.762  -1.986  1.00 0.36 ? 65  ASP B CB   1 
ATOM   2054 C CG   . ASP B 1 65 ? -26.933 -4.608  -1.067  1.00 0.38 ? 65  ASP B CG   1 
ATOM   2055 O OD1  . ASP B 1 65 ? -27.749 -5.514  -1.037  1.00 1.20 ? 65  ASP B OD1  1 
ATOM   2056 O OD2  . ASP B 1 65 ? -27.027 -3.585  -0.411  1.00 1.07 ? 65  ASP B OD2  1 
ATOM   2057 H H    . ASP B 1 65 ? -24.369 -5.907  -0.140  1.00 0.34 ? 65  ASP B H    1 
ATOM   2058 H HA   . ASP B 1 65 ? -26.176 -6.858  -2.140  1.00 0.41 ? 65  ASP B HA   1 
ATOM   2059 H HB2  . ASP B 1 65 ? -24.897 -4.177  -1.596  1.00 0.32 ? 65  ASP B HB2  1 
ATOM   2060 H HB3  . ASP B 1 65 ? -25.968 -4.412  -2.973  1.00 0.37 ? 65  ASP B HB3  1 
ATOM   2061 N N    . LEU B 1 66 ? -23.134 -6.219  -3.134  1.00 0.34 ? 66  LEU B N    1 
ATOM   2062 C CA   . LEU B 1 66 ? -22.206 -6.413  -4.280  1.00 0.34 ? 66  LEU B CA   1 
ATOM   2063 C C    . LEU B 1 66 ? -22.030 -7.910  -4.544  1.00 0.39 ? 66  LEU B C    1 
ATOM   2064 O O    . LEU B 1 66 ? -21.792 -8.330  -5.660  1.00 0.42 ? 66  LEU B O    1 
ATOM   2065 C CB   . LEU B 1 66 ? -20.852 -5.777  -3.935  1.00 0.31 ? 66  LEU B CB   1 
ATOM   2066 C CG   . LEU B 1 66 ? -20.907 -4.251  -4.171  1.00 0.28 ? 66  LEU B CG   1 
ATOM   2067 C CD1  . LEU B 1 66 ? -19.809 -3.554  -3.362  1.00 0.24 ? 66  LEU B CD1  1 
ATOM   2068 C CD2  . LEU B 1 66 ? -20.689 -3.933  -5.660  1.00 0.30 ? 66  LEU B CD2  1 
ATOM   2069 H H    . LEU B 1 66 ? -22.789 -5.909  -2.272  1.00 0.32 ? 66  LEU B H    1 
ATOM   2070 H HA   . LEU B 1 66 ? -22.618 -5.943  -5.157  1.00 0.36 ? 66  LEU B HA   1 
ATOM   2071 H HB2  . LEU B 1 66 ? -20.629 -5.974  -2.896  1.00 0.29 ? 66  LEU B HB2  1 
ATOM   2072 H HB3  . LEU B 1 66 ? -20.082 -6.213  -4.549  1.00 0.32 ? 66  LEU B HB3  1 
ATOM   2073 H HG   . LEU B 1 66 ? -21.871 -3.873  -3.860  1.00 0.28 ? 66  LEU B HG   1 
ATOM   2074 H HD11 . LEU B 1 66 ? -19.860 -3.866  -2.332  1.00 0.96 ? 66  LEU B HD11 1 
ATOM   2075 H HD12 . LEU B 1 66 ? -18.844 -3.810  -3.768  1.00 1.01 ? 66  LEU B HD12 1 
ATOM   2076 H HD13 . LEU B 1 66 ? -19.947 -2.486  -3.418  1.00 1.01 ? 66  LEU B HD13 1 
ATOM   2077 H HD21 . LEU B 1 66 ? -19.834 -4.480  -6.030  1.00 1.02 ? 66  LEU B HD21 1 
ATOM   2078 H HD22 . LEU B 1 66 ? -21.565 -4.211  -6.226  1.00 1.09 ? 66  LEU B HD22 1 
ATOM   2079 H HD23 . LEU B 1 66 ? -20.512 -2.875  -5.778  1.00 1.06 ? 66  LEU B HD23 1 
ATOM   2080 N N    . GLU B 1 67 ? -22.150 -8.719  -3.531  1.00 0.39 ? 67  GLU B N    1 
ATOM   2081 C CA   . GLU B 1 67 ? -21.995 -10.188 -3.732  1.00 0.44 ? 67  GLU B CA   1 
ATOM   2082 C C    . GLU B 1 67 ? -23.240 -10.739 -4.432  1.00 0.49 ? 67  GLU B C    1 
ATOM   2083 O O    . GLU B 1 67 ? -23.171 -11.701 -5.170  1.00 0.53 ? 67  GLU B O    1 
ATOM   2084 C CB   . GLU B 1 67 ? -21.823 -10.883 -2.374  1.00 0.44 ? 67  GLU B CB   1 
ATOM   2085 C CG   . GLU B 1 67 ? -20.486 -10.466 -1.723  1.00 0.41 ? 67  GLU B CG   1 
ATOM   2086 C CD   . GLU B 1 67 ? -19.951 -11.600 -0.842  1.00 1.11 ? 67  GLU B CD   1 
ATOM   2087 O OE1  . GLU B 1 67 ? -19.957 -12.731 -1.299  1.00 1.91 ? 67  GLU B OE1  1 
ATOM   2088 O OE2  . GLU B 1 67 ? -19.542 -11.317 0.272   1.00 1.72 ? 67  GLU B OE2  1 
ATOM   2089 H H    . GLU B 1 67 ? -22.343 -8.361  -2.641  1.00 0.37 ? 67  GLU B H    1 
ATOM   2090 H HA   . GLU B 1 67 ? -21.129 -10.377 -4.348  1.00 0.45 ? 67  GLU B HA   1 
ATOM   2091 H HB2  . GLU B 1 67 ? -22.642 -10.605 -1.726  1.00 0.43 ? 67  GLU B HB2  1 
ATOM   2092 H HB3  . GLU B 1 67 ? -21.836 -11.953 -2.522  1.00 0.48 ? 67  GLU B HB3  1 
ATOM   2093 H HG2  . GLU B 1 67 ? -19.758 -10.239 -2.488  1.00 0.88 ? 67  GLU B HG2  1 
ATOM   2094 H HG3  . GLU B 1 67 ? -20.645 -9.591  -1.112  1.00 0.81 ? 67  GLU B HG3  1 
ATOM   2095 N N    . LEU B 1 68 ? -24.377 -10.137 -4.210  1.00 0.49 ? 68  LEU B N    1 
ATOM   2096 C CA   . LEU B 1 68 ? -25.618 -10.635 -4.873  1.00 0.54 ? 68  LEU B CA   1 
ATOM   2097 C C    . LEU B 1 68 ? -25.650 -10.160 -6.326  1.00 0.55 ? 68  LEU B C    1 
ATOM   2098 O O    . LEU B 1 68 ? -25.314 -10.892 -7.236  1.00 0.60 ? 68  LEU B O    1 
ATOM   2099 C CB   . LEU B 1 68 ? -26.855 -10.103 -4.146  1.00 0.54 ? 68  LEU B CB   1 
ATOM   2100 C CG   . LEU B 1 68 ? -26.820 -10.512 -2.670  1.00 0.54 ? 68  LEU B CG   1 
ATOM   2101 C CD1  . LEU B 1 68 ? -27.883 -9.716  -1.921  1.00 0.55 ? 68  LEU B CD1  1 
ATOM   2102 C CD2  . LEU B 1 68 ? -27.119 -12.014 -2.521  1.00 0.59 ? 68  LEU B CD2  1 
ATOM   2103 H H    . LEU B 1 68 ? -24.411 -9.361  -3.613  1.00 0.45 ? 68  LEU B H    1 
ATOM   2104 H HA   . LEU B 1 68 ? -25.631 -11.708 -4.850  1.00 0.57 ? 68  LEU B HA   1 
ATOM   2105 H HB2  . LEU B 1 68 ? -26.874 -9.025  -4.218  1.00 0.51 ? 68  LEU B HB2  1 
ATOM   2106 H HB3  . LEU B 1 68 ? -27.742 -10.507 -4.609  1.00 0.58 ? 68  LEU B HB3  1 
ATOM   2107 H HG   . LEU B 1 68 ? -25.848 -10.288 -2.258  1.00 0.50 ? 68  LEU B HG   1 
ATOM   2108 H HD11 . LEU B 1 68 ? -28.825 -9.803  -2.442  1.00 1.13 ? 68  LEU B HD11 1 
ATOM   2109 H HD12 . LEU B 1 68 ? -27.986 -10.102 -0.920  1.00 1.23 ? 68  LEU B HD12 1 
ATOM   2110 H HD13 . LEU B 1 68 ? -27.589 -8.681  -1.880  1.00 1.12 ? 68  LEU B HD13 1 
ATOM   2111 H HD21 . LEU B 1 68 ? -27.984 -12.272 -3.112  1.00 1.13 ? 68  LEU B HD21 1 
ATOM   2112 H HD22 . LEU B 1 68 ? -26.270 -12.590 -2.855  1.00 1.21 ? 68  LEU B HD22 1 
ATOM   2113 H HD23 . LEU B 1 68 ? -27.314 -12.241 -1.484  1.00 1.20 ? 68  LEU B HD23 1 
ATOM   2114 N N    . ASN B 1 69 ? -26.060 -8.941  -6.551  1.00 0.61 ? 69  ASN B N    1 
ATOM   2115 C CA   . ASN B 1 69 ? -26.126 -8.412  -7.945  1.00 0.65 ? 69  ASN B CA   1 
ATOM   2116 C C    . ASN B 1 69 ? -24.782 -7.770  -8.309  1.00 0.71 ? 69  ASN B C    1 
ATOM   2117 O O    . ASN B 1 69 ? -24.371 -7.909  -9.449  1.00 1.17 ? 69  ASN B O    1 
ATOM   2118 C CB   . ASN B 1 69 ? -27.262 -7.367  -8.030  1.00 0.81 ? 69  ASN B CB   1 
ATOM   2119 C CG   . ASN B 1 69 ? -27.991 -7.471  -9.377  1.00 1.73 ? 69  ASN B CG   1 
ATOM   2120 O OD1  . ASN B 1 69 ? -27.576 -6.882  -10.355 1.00 2.51 ? 69  ASN B OD1  1 
ATOM   2121 N ND2  . ASN B 1 69 ? -29.067 -8.205  -9.463  1.00 2.50 ? 69  ASN B ND2  1 
ATOM   2122 O OXT  . ASN B 1 69 ? -24.189 -7.151  -7.441  1.00 1.45 ? 69  ASN B OXT  1 
ATOM   2123 H H    . ASN B 1 69 ? -26.330 -8.373  -5.802  1.00 0.69 ? 69  ASN B H    1 
ATOM   2124 H HA   . ASN B 1 69 ? -26.327 -9.227  -8.627  1.00 0.62 ? 69  ASN B HA   1 
ATOM   2125 H HB2  . ASN B 1 69 ? -27.967 -7.551  -7.232  1.00 1.43 ? 69  ASN B HB2  1 
ATOM   2126 H HB3  . ASN B 1 69 ? -26.857 -6.369  -7.921  1.00 1.16 ? 69  ASN B HB3  1 
ATOM   2127 H HD21 . ASN B 1 69 ? -29.400 -8.681  -8.673  1.00 2.62 ? 69  ASN B HD21 1 
ATOM   2128 H HD22 . ASN B 1 69 ? -29.542 -8.282  -10.318 1.00 3.32 ? 69  ASN B HD22 1 
HETATM 2129 O O    . HOH C 2 .  ? 6.548   1.681   5.744   1.00 0.30 ? 201 HOH A O    1 
HETATM 2130 H H1   . HOH C 2 .  ? 5.619   1.732   5.969   1.00 0.74 ? 201 HOH A H1   1 
HETATM 2131 H H2   . HOH C 2 .  ? 6.984   2.218   6.404   1.00 0.33 ? 201 HOH A H2   1 
HETATM 2132 O O    . HOH C 2 .  ? 4.227   5.603   6.415   1.00 0.22 ? 202 HOH A O    1 
HETATM 2133 H H1   . HOH C 2 .  ? 3.545   5.790   5.770   1.00 0.79 ? 202 HOH A H1   1 
HETATM 2134 H H2   . HOH C 2 .  ? 4.240   6.374   6.981   1.00 0.99 ? 202 HOH A H2   1 
HETATM 2135 O O    . HOH D 2 .  ? -6.589  -1.519  5.730   1.00 0.29 ? 301 HOH B O    1 
HETATM 2136 H H1   . HOH D 2 .  ? -5.678  -1.580  6.017   1.00 0.65 ? 301 HOH B H1   1 
HETATM 2137 H H2   . HOH D 2 .  ? -7.077  -2.030  6.374   1.00 0.28 ? 301 HOH B H2   1 
HETATM 2138 O O    . HOH D 2 .  ? -4.359  -5.472  6.474   1.00 0.22 ? 302 HOH B O    1 
HETATM 2139 H H1   . HOH D 2 .  ? -3.453  -5.352  6.752   1.00 0.80 ? 302 HOH B H1   1 
HETATM 2140 H H2   . HOH D 2 .  ? -4.487  -6.419  6.469   1.00 1.00 ? 302 HOH B H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  MET 3  3  3  MET MET A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  ASP 6  6  6  ASP ASP A . n 
A 1 7  PRO 7  7  7  PRO PRO A . n 
A 1 8  PRO 8  8  8  PRO PRO A . n 
A 1 9  THR 9  9  9  THR THR A . n 
A 1 10 ALA 10 10 10 ALA ALA A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 THR 16 16 16 THR THR A . n 
A 1 17 ALA 17 17 17 ALA ALA A . n 
A 1 18 ARG 18 18 18 ARG ARG A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 PRO 21 21 21 PRO PRO A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ASN 23 23 23 ASN ASN A . n 
A 1 24 PHE 24 24 24 PHE PHE A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 TYR 28 28 28 TYR TYR A . n 
A 1 29 TYR 29 29 29 TYR TYR A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 SER 32 32 32 SER SER A . n 
A 1 33 SER 33 33 33 SER SER A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 CYS 35 35 35 CYS CYS A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 PRO 38 38 38 PRO PRO A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 PHE 42 42 42 PHE PHE A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 THR 44 44 44 THR THR A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 GLN 49 49 49 GLN GLN A . n 
A 1 50 VAL 50 50 50 VAL VAL A . n 
A 1 51 CYS 51 51 51 CYS CYS A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 ASP 53 53 53 ASP ASP A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 SER 55 55 55 SER SER A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 SER 57 57 57 SER SER A . n 
A 1 58 TRP 58 58 58 TRP TRP A . n 
A 1 59 VAL 59 59 59 VAL VAL A . n 
A 1 60 GLN 60 60 60 GLN GLN A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 TYR 62 62 62 TYR TYR A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 TYR 64 64 64 TYR TYR A . n 
A 1 65 ASP 65 65 65 ASP ASP A . n 
A 1 66 LEU 66 66 66 LEU LEU A . n 
A 1 67 GLU 67 67 67 GLU GLU A . n 
A 1 68 LEU 68 68 68 LEU LEU A . n 
A 1 69 ASN 69 69 69 ASN ASN A . n 
B 1 1  ALA 1  1  1  ALA ALA B . n 
B 1 2  PRO 2  2  2  PRO PRO B . n 
B 1 3  MET 3  3  3  MET MET B . n 
B 1 4  GLY 4  4  4  GLY GLY B . n 
B 1 5  SER 5  5  5  SER SER B . n 
B 1 6  ASP 6  6  6  ASP ASP B . n 
B 1 7  PRO 7  7  7  PRO PRO B . n 
B 1 8  PRO 8  8  8  PRO PRO B . n 
B 1 9  THR 9  9  9  THR THR B . n 
B 1 10 ALA 10 10 10 ALA ALA B . n 
B 1 11 CYS 11 11 11 CYS CYS B . n 
B 1 12 CYS 12 12 12 CYS CYS B . n 
B 1 13 PHE 13 13 13 PHE PHE B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 TYR 15 15 15 TYR TYR B . n 
B 1 16 THR 16 16 16 THR THR B . n 
B 1 17 ALA 17 17 17 ALA ALA B . n 
B 1 18 ARG 18 18 18 ARG ARG B . n 
B 1 19 LYS 19 19 19 LYS LYS B . n 
B 1 20 LEU 20 20 20 LEU LEU B . n 
B 1 21 PRO 21 21 21 PRO PRO B . n 
B 1 22 ARG 22 22 22 ARG ARG B . n 
B 1 23 ASN 23 23 23 ASN ASN B . n 
B 1 24 PHE 24 24 24 PHE PHE B . n 
B 1 25 VAL 25 25 25 VAL VAL B . n 
B 1 26 VAL 26 26 26 VAL VAL B . n 
B 1 27 ASP 27 27 27 ASP ASP B . n 
B 1 28 TYR 28 28 28 TYR TYR B . n 
B 1 29 TYR 29 29 29 TYR TYR B . n 
B 1 30 GLU 30 30 30 GLU GLU B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 SER 32 32 32 SER SER B . n 
B 1 33 SER 33 33 33 SER SER B . n 
B 1 34 LEU 34 34 34 LEU LEU B . n 
B 1 35 CYS 35 35 35 CYS CYS B . n 
B 1 36 SER 36 36 36 SER SER B . n 
B 1 37 GLN 37 37 37 GLN GLN B . n 
B 1 38 PRO 38 38 38 PRO PRO B . n 
B 1 39 ALA 39 39 39 ALA ALA B . n 
B 1 40 VAL 40 40 40 VAL VAL B . n 
B 1 41 VAL 41 41 41 VAL VAL B . n 
B 1 42 PHE 42 42 42 PHE PHE B . n 
B 1 43 GLN 43 43 43 GLN GLN B . n 
B 1 44 THR 44 44 44 THR THR B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 ARG 46 46 46 ARG ARG B . n 
B 1 47 SER 47 47 47 SER SER B . n 
B 1 48 LYS 48 48 48 LYS LYS B . n 
B 1 49 GLN 49 49 49 GLN GLN B . n 
B 1 50 VAL 50 50 50 VAL VAL B . n 
B 1 51 CYS 51 51 51 CYS CYS B . n 
B 1 52 ALA 52 52 52 ALA ALA B . n 
B 1 53 ASP 53 53 53 ASP ASP B . n 
B 1 54 PRO 54 54 54 PRO PRO B . n 
B 1 55 SER 55 55 55 SER SER B . n 
B 1 56 GLU 56 56 56 GLU GLU B . n 
B 1 57 SER 57 57 57 SER SER B . n 
B 1 58 TRP 58 58 58 TRP TRP B . n 
B 1 59 VAL 59 59 59 VAL VAL B . n 
B 1 60 GLN 60 60 60 GLN GLN B . n 
B 1 61 GLU 61 61 61 GLU GLU B . n 
B 1 62 TYR 62 62 62 TYR TYR B . n 
B 1 63 VAL 63 63 63 VAL VAL B . n 
B 1 64 TYR 64 64 64 TYR TYR B . n 
B 1 65 ASP 65 65 65 ASP ASP B . n 
B 1 66 LEU 66 66 66 LEU LEU B . n 
B 1 67 GLU 67 67 67 GLU GLU B . n 
B 1 68 LEU 68 68 68 LEU LEU B . n 
B 1 69 ASN 69 69 69 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1 201 201 HOH HOH A . 
C 2 HOH 2 202 202 HOH HOH A . 
D 2 HOH 1 301 301 HOH HOH B . 
D 2 HOH 2 302 302 HOH HOH B . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-04-30 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 6  ? ? -159.73 71.59   
2  1 PRO A 8  ? ? -62.06  -158.72 
3  1 ALA A 10 ? ? -68.93  82.32   
4  1 SER A 14 ? ? -156.20 -154.04 
5  1 THR A 16 ? ? -60.47  -156.89 
6  1 PHE A 24 ? ? -140.45 28.64   
7  1 THR A 31 ? ? -72.35  -167.60 
8  1 SER A 32 ? ? -83.64  -146.88 
9  1 SER A 33 ? ? -140.92 -34.80  
10 1 SER A 36 ? ? -65.94  30.63   
11 1 GLN A 37 ? ? -153.23 66.79   
12 1 THR A 44 ? ? -98.21  -158.75 
13 1 SER A 47 ? ? -167.55 -121.20 
14 1 LYS A 48 ? ? -158.33 -94.17  
15 1 LEU A 68 ? ? -78.26  -81.16  
16 1 ASP B 6  ? ? -159.75 71.60   
17 1 PRO B 8  ? ? -62.02  -158.68 
18 1 ALA B 10 ? ? -68.87  82.26   
19 1 SER B 14 ? ? -156.12 -154.07 
20 1 THR B 16 ? ? -60.40  -156.96 
21 1 PHE B 24 ? ? -140.48 28.71   
22 1 THR B 31 ? ? -72.30  -167.64 
23 1 SER B 32 ? ? -83.62  -146.85 
24 1 SER B 33 ? ? -140.94 -34.87  
25 1 SER B 36 ? ? -66.12  30.72   
26 1 GLN B 37 ? ? -153.36 66.76   
27 1 THR B 44 ? ? -98.22  -158.64 
28 1 SER B 47 ? ? -167.59 -121.18 
29 1 LYS B 48 ? ? -158.34 -94.14  
30 1 LEU B 68 ? ? -78.28  -81.16  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#