data_1HUN
# 
_entry.id   1HUN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HUN         
WWPDB D_1000174032 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1HUM 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HUN 
_pdbx_database_status.recvd_initial_deposition_date   1994-01-31 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Lodi, P.J.'       2 
'Garrett, D.S.'    3 
'Gronenborn, A.M.' 4 
# 
_citation.id                        primary 
_citation.title                     'High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            263 
_citation.page_first                1762 
_citation.page_last                 1767 
_citation.year                      1994 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8134838 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lodi, P.J.'       1 
primary 'Garrett, D.S.'    2 
primary 'Kuszewski, J.'    3 
primary 'Tsang, M.L.'      4 
primary 'Weatherbee, J.A.' 5 
primary 'Leonard, W.J.'    6 
primary 'Gronenborn, A.M.' 7 
primary 'Clore, G.M.'      8 
# 
_cell.entry_id           1HUN 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HUN 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA' 7824.742 2 ? ? ? ? 
2 water   nat water                                          18.015   4 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_seq_one_letter_code_can   APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  PRO n 
1 3  MET n 
1 4  GLY n 
1 5  SER n 
1 6  ASP n 
1 7  PRO n 
1 8  PRO n 
1 9  THR n 
1 10 ALA n 
1 11 CYS n 
1 12 CYS n 
1 13 PHE n 
1 14 SER n 
1 15 TYR n 
1 16 THR n 
1 17 ALA n 
1 18 ARG n 
1 19 LYS n 
1 20 LEU n 
1 21 PRO n 
1 22 ARG n 
1 23 ASN n 
1 24 PHE n 
1 25 VAL n 
1 26 VAL n 
1 27 ASP n 
1 28 TYR n 
1 29 TYR n 
1 30 GLU n 
1 31 THR n 
1 32 SER n 
1 33 SER n 
1 34 LEU n 
1 35 CYS n 
1 36 SER n 
1 37 GLN n 
1 38 PRO n 
1 39 ALA n 
1 40 VAL n 
1 41 VAL n 
1 42 PHE n 
1 43 GLN n 
1 44 THR n 
1 45 LYS n 
1 46 ARG n 
1 47 SER n 
1 48 LYS n 
1 49 GLN n 
1 50 VAL n 
1 51 CYS n 
1 52 ALA n 
1 53 ASP n 
1 54 PRO n 
1 55 SER n 
1 56 GLU n 
1 57 SER n 
1 58 TRP n 
1 59 VAL n 
1 60 GLN n 
1 61 GLU n 
1 62 TYR n 
1 63 VAL n 
1 64 TYR n 
1 65 ASP n 
1 66 LEU n 
1 67 GLU n 
1 68 LEU n 
1 69 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL4_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13236 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES
WVQEYVYDLELN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HUN A 1 ? 69 ? P13236 24 ? 92 ? 1 69 
2 1 1HUN B 1 ? 69 ? P13236 24 ? 92 ? 1 69 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_refine.entry_id           1HUN 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            
;RESTRAINED MINIMIZED AVERAGE STRUCTURE OVER 35 FILES
 AVE.RMS DIFF. TO MEAN FOR BACKBONE
    (4-69)= 0.304637 ANGSTROMS
 AVE.RMS DIFF. TO MEAN FOR ALL ORDERED NON-H-ATOMS
    (4-69)= 0.45 ANGSTROMS
 AVE.RMS DIFF. TO MEAN FOR ALL NON-H-ATOMS
    (4-69)= 0.706906 ANGSTROMS

THE 3D STRUCTURE OF THE HMIP-1BETA DIMER IN SOLUTION BY NMR
IS BASED ON 3586 EXPERIMENTAL RESTRAINTS COMPRISING:  3132
STRUCTURE USEFUL INTERPROTON DISTANCE RESTRAINTS OF WHICH
228 ARE INTERSUBUNIT; 24 RESTRAINTS FOR 12 H-BONDS
INVOLVING TIGHTLY BOUND WATER MOLECULES; 108 RESTRAINTS FOR
54 BACKBONE HYDROGEN BONDS INVOLVING SLOWLY EXCHANGING
AMIDE PROTONS; 220 TORSION ANGLE RESTRAINTS (122 PHI, 10
PSI, 80 CHI1 AND 8 CHI2); AND 102 HN-HALPHA THREE-BOND
COUPLING CONSTANTS.  A COMPLETE LIST OF EXPERIMENTAL
RESTRAINTS AND 1H, 13C AND 15N ASSIGNMENTS ARE AVAILABLE
FROM THE PROTEIN DATA BANK AS A SEPARATE ENTRY.

THE STRUCTURES ARE CALCULATED USING THE HYBRID METRIC
MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING
METHOD DESCRIBED BY: NILGES, M., CLORE, G.M. & GRONENBORN,
A.M. (1988) FEBS LETT 229, 317-324.  ALL STRUCTURAL
STATISTICS ARE GIVEN IN THE REFERENCE.

THE FIELD THAT CONTAINS THE B VALUE IN X-RAY STRUCTURES
(COLUMNS 61 - 66) HAS NO MEANING IN THIS ENTRY.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1HUN 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    35 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_exptl.entry_id          1HUN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1HUN 
_struct.title                     
'SOLUTION STRUCTURE OF THE CHEMOKINE HMIP-1BETA(SLASH)ACT-2 BY MULTI-DIMENSIONAL NMR: A NOVEL CHEMOKINE DIMER' 
_struct.pdbx_descriptor           'HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA (HMIP-1B) (NMR, 35 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HUN 
_struct_keywords.pdbx_keywords   'CYTOKINE(CHEMOTACTIC)' 
_struct_keywords.text            'CYTOKINE(CHEMOTACTIC)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 21 ? VAL A 25 ? PRO A 21 VAL A 25 5 ? 5  
HELX_P HELX_P2 2 GLU A 56 ? LEU A 68 ? GLU A 56 LEU A 68 1 ? 13 
HELX_P HELX_P3 3 PRO B 21 ? VAL B 25 ? PRO B 21 VAL B 25 5 ? 5  
HELX_P HELX_P4 4 GLU B 56 ? LEU B 68 ? GLU B 56 LEU B 68 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 11 A CYS 35 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 12 A CYS 51 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf3 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 35 SG ? ? B CYS 11 B CYS 35 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf4 disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 51 SG ? ? B CYS 12 B CYS 51 1_555 ? ? ? ? ? ? ? 2.021 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 27 ? GLU A 30 ? ASP A 27 GLU A 30 
A 2 VAL A 40 ? GLN A 43 ? VAL A 40 GLN A 43 
A 3 GLN A 49 ? ALA A 52 ? GLN A 49 ALA A 52 
B 1 ASP B 27 ? GLU B 30 ? ASP B 27 GLU B 30 
B 2 VAL B 40 ? GLN B 43 ? VAL B 40 GLN B 43 
B 3 GLN B 49 ? ALA B 52 ? GLN B 49 ALA B 52 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 29 ? N TYR A 29 O VAL A 41 ? O VAL A 41 
A 2 3 N PHE A 42 ? N PHE A 42 O VAL A 50 ? O VAL A 50 
B 1 2 N TYR B 29 ? N TYR B 29 O VAL B 41 ? O VAL B 41 
B 2 3 N PHE B 42 ? N PHE B 42 O VAL B 50 ? O VAL B 50 
# 
_database_PDB_matrix.entry_id          1HUN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HUN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ALA A 1 1  ? -10.431 21.377  -7.538  1.00 0.00 ? 1   ALA A N    1  
ATOM   2     C CA   . ALA A 1 1  ? -11.518 20.529  -8.106  1.00 0.00 ? 1   ALA A CA   1  
ATOM   3     C C    . ALA A 1 1  ? -11.640 19.246  -7.258  1.00 0.00 ? 1   ALA A C    1  
ATOM   4     O O    . ALA A 1 1  ? -10.738 18.928  -6.509  1.00 0.00 ? 1   ALA A O    1  
ATOM   5     C CB   . ALA A 1 1  ? -11.167 20.188  -9.573  1.00 0.00 ? 1   ALA A CB   1  
ATOM   6     H H1   . ALA A 1 1  ? -10.317 21.163  -6.527  1.00 0.00 ? 1   ALA A H1   1  
ATOM   7     H H2   . ALA A 1 1  ? -9.540  21.179  -8.039  1.00 0.00 ? 1   ALA A H2   1  
ATOM   8     H H3   . ALA A 1 1  ? -10.678 22.380  -7.653  1.00 0.00 ? 1   ALA A H3   1  
ATOM   9     H HA   . ALA A 1 1  ? -12.445 21.080  -8.067  1.00 0.00 ? 1   ALA A HA   1  
ATOM   10    H HB1  . ALA A 1 1  ? -10.179 20.561  -9.796  1.00 0.00 ? 1   ALA A HB1  1  
ATOM   11    H HB2  . ALA A 1 1  ? -11.186 19.117  -9.727  1.00 0.00 ? 1   ALA A HB2  1  
ATOM   12    H HB3  . ALA A 1 1  ? -11.881 20.654  -10.238 1.00 0.00 ? 1   ALA A HB3  1  
ATOM   13    N N    . PRO A 1 2  ? -12.743 18.537  -7.399  1.00 0.00 ? 2   PRO A N    1  
ATOM   14    C CA   . PRO A 1 2  ? -12.954 17.289  -6.640  1.00 0.00 ? 2   PRO A CA   1  
ATOM   15    C C    . PRO A 1 2  ? -11.785 16.324  -6.887  1.00 0.00 ? 2   PRO A C    1  
ATOM   16    O O    . PRO A 1 2  ? -11.701 15.687  -7.918  1.00 0.00 ? 2   PRO A O    1  
ATOM   17    C CB   . PRO A 1 2  ? -14.289 16.717  -7.178  1.00 0.00 ? 2   PRO A CB   1  
ATOM   18    C CG   . PRO A 1 2  ? -14.831 17.715  -8.244  1.00 0.00 ? 2   PRO A CG   1  
ATOM   19    C CD   . PRO A 1 2  ? -13.851 18.908  -8.308  1.00 0.00 ? 2   PRO A CD   1  
ATOM   20    H HA   . PRO A 1 2  ? -13.041 17.505  -5.586  1.00 0.00 ? 2   PRO A HA   1  
ATOM   21    H HB2  . PRO A 1 2  ? -14.128 15.744  -7.629  1.00 0.00 ? 2   PRO A HB2  1  
ATOM   22    H HB3  . PRO A 1 2  ? -15.005 16.626  -6.372  1.00 0.00 ? 2   PRO A HB3  1  
ATOM   23    H HG2  . PRO A 1 2  ? -14.885 17.227  -9.211  1.00 0.00 ? 2   PRO A HG2  1  
ATOM   24    H HG3  . PRO A 1 2  ? -15.815 18.065  -7.960  1.00 0.00 ? 2   PRO A HG3  1  
ATOM   25    H HD2  . PRO A 1 2  ? -13.486 19.046  -9.317  1.00 0.00 ? 2   PRO A HD2  1  
ATOM   26    H HD3  . PRO A 1 2  ? -14.333 19.808  -7.955  1.00 0.00 ? 2   PRO A HD3  1  
ATOM   27    N N    . MET A 1 3  ? -10.884 16.214  -5.948  1.00 0.00 ? 3   MET A N    1  
ATOM   28    C CA   . MET A 1 3  ? -9.726  15.293  -6.131  1.00 0.00 ? 3   MET A CA   1  
ATOM   29    C C    . MET A 1 3  ? -10.176 13.854  -5.840  1.00 0.00 ? 3   MET A C    1  
ATOM   30    O O    . MET A 1 3  ? -11.350 13.581  -5.689  1.00 0.00 ? 3   MET A O    1  
ATOM   31    C CB   . MET A 1 3  ? -8.591  15.708  -5.169  1.00 0.00 ? 3   MET A CB   1  
ATOM   32    C CG   . MET A 1 3  ? -7.218  15.429  -5.802  1.00 0.00 ? 3   MET A CG   1  
ATOM   33    S SD   . MET A 1 3  ? -5.978  15.245  -4.497  1.00 0.00 ? 3   MET A SD   1  
ATOM   34    C CE   . MET A 1 3  ? -4.857  14.151  -5.403  1.00 0.00 ? 3   MET A CE   1  
ATOM   35    H H    . MET A 1 3  ? -10.970 16.736  -5.124  1.00 0.00 ? 3   MET A H    1  
ATOM   36    H HA   . MET A 1 3  ? -9.380  15.358  -7.154  1.00 0.00 ? 3   MET A HA   1  
ATOM   37    H HB2  . MET A 1 3  ? -8.676  16.764  -4.958  1.00 0.00 ? 3   MET A HB2  1  
ATOM   38    H HB3  . MET A 1 3  ? -8.674  15.157  -4.242  1.00 0.00 ? 3   MET A HB3  1  
ATOM   39    H HG2  . MET A 1 3  ? -7.262  14.521  -6.385  1.00 0.00 ? 3   MET A HG2  1  
ATOM   40    H HG3  . MET A 1 3  ? -6.943  16.254  -6.444  1.00 0.00 ? 3   MET A HG3  1  
ATOM   41    H HE1  . MET A 1 3  ? -4.563  14.626  -6.329  1.00 0.00 ? 3   MET A HE1  1  
ATOM   42    H HE2  . MET A 1 3  ? -3.982  13.952  -4.799  1.00 0.00 ? 3   MET A HE2  1  
ATOM   43    H HE3  . MET A 1 3  ? -5.359  13.222  -5.622  1.00 0.00 ? 3   MET A HE3  1  
ATOM   44    N N    . GLY A 1 4  ? -9.254  12.934  -5.764  1.00 0.00 ? 4   GLY A N    1  
ATOM   45    C CA   . GLY A 1 4  ? -9.633  11.519  -5.488  1.00 0.00 ? 4   GLY A CA   1  
ATOM   46    C C    . GLY A 1 4  ? -10.338 11.418  -4.141  1.00 0.00 ? 4   GLY A C    1  
ATOM   47    O O    . GLY A 1 4  ? -10.531 12.395  -3.444  1.00 0.00 ? 4   GLY A O    1  
ATOM   48    H H    . GLY A 1 4  ? -8.314  13.172  -5.891  1.00 0.00 ? 4   GLY A H    1  
ATOM   49    H HA2  . GLY A 1 4  ? -10.300 11.168  -6.264  1.00 0.00 ? 4   GLY A HA2  1  
ATOM   50    H HA3  . GLY A 1 4  ? -8.748  10.904  -5.471  1.00 0.00 ? 4   GLY A HA3  1  
ATOM   51    N N    . SER A 1 5  ? -10.734 10.232  -3.781  1.00 0.00 ? 5   SER A N    1  
ATOM   52    C CA   . SER A 1 5  ? -11.446 10.019  -2.492  1.00 0.00 ? 5   SER A CA   1  
ATOM   53    C C    . SER A 1 5  ? -10.437 9.692   -1.379  1.00 0.00 ? 5   SER A C    1  
ATOM   54    O O    . SER A 1 5  ? -9.836  10.572  -0.796  1.00 0.00 ? 5   SER A O    1  
ATOM   55    C CB   . SER A 1 5  ? -12.406 8.852   -2.679  1.00 0.00 ? 5   SER A CB   1  
ATOM   56    O OG   . SER A 1 5  ? -11.773 7.883   -3.505  1.00 0.00 ? 5   SER A OG   1  
ATOM   57    H H    . SER A 1 5  ? -10.569 9.468   -4.373  1.00 0.00 ? 5   SER A H    1  
ATOM   58    H HA   . SER A 1 5  ? -12.004 10.905  -2.229  1.00 0.00 ? 5   SER A HA   1  
ATOM   59    H HB2  . SER A 1 5  ? -12.647 8.416   -1.727  1.00 0.00 ? 5   SER A HB2  1  
ATOM   60    H HB3  . SER A 1 5  ? -13.314 9.204   -3.151  1.00 0.00 ? 5   SER A HB3  1  
ATOM   61    H HG   . SER A 1 5  ? -10.850 7.834   -3.249  1.00 0.00 ? 5   SER A HG   1  
ATOM   62    N N    . ASP A 1 6  ? -10.253 8.428   -1.077  1.00 0.00 ? 6   ASP A N    1  
ATOM   63    C CA   . ASP A 1 6  ? -9.289  8.045   0.001   1.00 0.00 ? 6   ASP A CA   1  
ATOM   64    C C    . ASP A 1 6  ? -8.817  6.600   -0.226  1.00 0.00 ? 6   ASP A C    1  
ATOM   65    O O    . ASP A 1 6  ? -9.156  5.723   0.543   1.00 0.00 ? 6   ASP A O    1  
ATOM   66    C CB   . ASP A 1 6  ? -9.982  8.136   1.368   1.00 0.00 ? 6   ASP A CB   1  
ATOM   67    C CG   . ASP A 1 6  ? -10.763 9.448   1.462   1.00 0.00 ? 6   ASP A CG   1  
ATOM   68    O OD1  . ASP A 1 6  ? -10.145 10.464  1.735   1.00 0.00 ? 6   ASP A OD1  1  
ATOM   69    O OD2  . ASP A 1 6  ? -11.966 9.415   1.260   1.00 0.00 ? 6   ASP A OD2  1  
ATOM   70    H H    . ASP A 1 6  ? -10.750 7.729   -1.559  1.00 0.00 ? 6   ASP A H    1  
ATOM   71    H HA   . ASP A 1 6  ? -8.441  8.712   -0.016  1.00 0.00 ? 6   ASP A HA   1  
ATOM   72    H HB2  . ASP A 1 6  ? -10.661 7.303   1.487   1.00 0.00 ? 6   ASP A HB2  1  
ATOM   73    H HB3  . ASP A 1 6  ? -9.240  8.106   2.153   1.00 0.00 ? 6   ASP A HB3  1  
ATOM   74    N N    . PRO A 1 7  ? -8.056  6.382   -1.279  1.00 0.00 ? 7   PRO A N    1  
ATOM   75    C CA   . PRO A 1 7  ? -7.553  5.032   -1.600  1.00 0.00 ? 7   PRO A CA   1  
ATOM   76    C C    . PRO A 1 7  ? -6.610  4.542   -0.479  1.00 0.00 ? 7   PRO A C    1  
ATOM   77    O O    . PRO A 1 7  ? -6.224  5.319   0.372   1.00 0.00 ? 7   PRO A O    1  
ATOM   78    C CB   . PRO A 1 7  ? -6.802  5.199   -2.945  1.00 0.00 ? 7   PRO A CB   1  
ATOM   79    C CG   . PRO A 1 7  ? -6.863  6.706   -3.334  1.00 0.00 ? 7   PRO A CG   1  
ATOM   80    C CD   . PRO A 1 7  ? -7.642  7.444   -2.223  1.00 0.00 ? 7   PRO A CD   1  
ATOM   81    H HA   . PRO A 1 7  ? -8.386  4.356   -1.718  1.00 0.00 ? 7   PRO A HA   1  
ATOM   82    H HB2  . PRO A 1 7  ? -5.769  4.884   -2.841  1.00 0.00 ? 7   PRO A HB2  1  
ATOM   83    H HB3  . PRO A 1 7  ? -7.283  4.607   -3.712  1.00 0.00 ? 7   PRO A HB3  1  
ATOM   84    H HG2  . PRO A 1 7  ? -5.858  7.106   -3.414  1.00 0.00 ? 7   PRO A HG2  1  
ATOM   85    H HG3  . PRO A 1 7  ? -7.376  6.824   -4.280  1.00 0.00 ? 7   PRO A HG3  1  
ATOM   86    H HD2  . PRO A 1 7  ? -6.999  8.160   -1.727  1.00 0.00 ? 7   PRO A HD2  1  
ATOM   87    H HD3  . PRO A 1 7  ? -8.511  7.938   -2.630  1.00 0.00 ? 7   PRO A HD3  1  
ATOM   88    N N    . PRO A 1 8  ? -6.257  3.270   -0.511  1.00 0.00 ? 8   PRO A N    1  
ATOM   89    C CA   . PRO A 1 8  ? -5.354  2.692   0.506   1.00 0.00 ? 8   PRO A CA   1  
ATOM   90    C C    . PRO A 1 8  ? -3.995  3.409   0.470   1.00 0.00 ? 8   PRO A C    1  
ATOM   91    O O    . PRO A 1 8  ? -3.885  4.528   0.010   1.00 0.00 ? 8   PRO A O    1  
ATOM   92    C CB   . PRO A 1 8  ? -5.216  1.199   0.115   1.00 0.00 ? 8   PRO A CB   1  
ATOM   93    C CG   . PRO A 1 8  ? -5.992  0.993   -1.218  1.00 0.00 ? 8   PRO A CG   1  
ATOM   94    C CD   . PRO A 1 8  ? -6.722  2.315   -1.541  1.00 0.00 ? 8   PRO A CD   1  
ATOM   95    H HA   . PRO A 1 8  ? -5.795  2.780   1.486   1.00 0.00 ? 8   PRO A HA   1  
ATOM   96    H HB2  . PRO A 1 8  ? -4.172  0.936   -0.018  1.00 0.00 ? 8   PRO A HB2  1  
ATOM   97    H HB3  . PRO A 1 8  ? -5.648  0.575   0.886   1.00 0.00 ? 8   PRO A HB3  1  
ATOM   98    H HG2  . PRO A 1 8  ? -5.298  0.747   -2.013  1.00 0.00 ? 8   PRO A HG2  1  
ATOM   99    H HG3  . PRO A 1 8  ? -6.714  0.193   -1.108  1.00 0.00 ? 8   PRO A HG3  1  
ATOM   100   H HD2  . PRO A 1 8  ? -6.456  2.663   -2.530  1.00 0.00 ? 8   PRO A HD2  1  
ATOM   101   H HD3  . PRO A 1 8  ? -7.789  2.181   -1.465  1.00 0.00 ? 8   PRO A HD3  1  
ATOM   102   N N    . THR A 1 9  ? -2.962  2.770   0.955   1.00 0.00 ? 9   THR A N    1  
ATOM   103   C CA   . THR A 1 9  ? -1.615  3.412   0.951   1.00 0.00 ? 9   THR A CA   1  
ATOM   104   C C    . THR A 1 9  ? -0.530  2.336   0.978   1.00 0.00 ? 9   THR A C    1  
ATOM   105   O O    . THR A 1 9  ? -0.526  1.459   1.819   1.00 0.00 ? 9   THR A O    1  
ATOM   106   C CB   . THR A 1 9  ? -1.475  4.304   2.184   1.00 0.00 ? 9   THR A CB   1  
ATOM   107   O OG1  . THR A 1 9  ? -2.649  5.088   2.334   1.00 0.00 ? 9   THR A OG1  1  
ATOM   108   C CG2  . THR A 1 9  ? -0.261  5.220   2.018   1.00 0.00 ? 9   THR A CG2  1  
ATOM   109   H H    . THR A 1 9  ? -3.073  1.868   1.324   1.00 0.00 ? 9   THR A H    1  
ATOM   110   H HA   . THR A 1 9  ? -1.498  4.009   0.058   1.00 0.00 ? 9   THR A HA   1  
ATOM   111   H HB   . THR A 1 9  ? -1.339  3.687   3.059   1.00 0.00 ? 9   THR A HB   1  
ATOM   112   H HG1  . THR A 1 9  ? -2.988  5.285   1.458   1.00 0.00 ? 9   THR A HG1  1  
ATOM   113   H HG21 . THR A 1 9  ? 0.597   4.630   1.736   1.00 0.00 ? 9   THR A HG21 1  
ATOM   114   H HG22 . THR A 1 9  ? -0.464  5.951   1.250   1.00 0.00 ? 9   THR A HG22 1  
ATOM   115   H HG23 . THR A 1 9  ? -0.062  5.725   2.952   1.00 0.00 ? 9   THR A HG23 1  
ATOM   116   N N    . ALA A 1 10 ? 0.391   2.401   0.059   1.00 0.00 ? 10  ALA A N    1  
ATOM   117   C CA   . ALA A 1 10 ? 1.484   1.392   0.017   1.00 0.00 ? 10  ALA A CA   1  
ATOM   118   C C    . ALA A 1 10 ? 2.419   1.590   1.211   1.00 0.00 ? 10  ALA A C    1  
ATOM   119   O O    . ALA A 1 10 ? 3.463   2.202   1.094   1.00 0.00 ? 10  ALA A O    1  
ATOM   120   C CB   . ALA A 1 10 ? 2.273   1.565   -1.278  1.00 0.00 ? 10  ALA A CB   1  
ATOM   121   H H    . ALA A 1 10 ? 0.365   3.119   -0.607  1.00 0.00 ? 10  ALA A H    1  
ATOM   122   H HA   . ALA A 1 10 ? 1.061   0.398   0.052   1.00 0.00 ? 10  ALA A HA   1  
ATOM   123   H HB1  . ALA A 1 10 ? 2.589   2.594   -1.370  1.00 0.00 ? 10  ALA A HB1  1  
ATOM   124   H HB2  . ALA A 1 10 ? 3.140   0.922   -1.260  1.00 0.00 ? 10  ALA A HB2  1  
ATOM   125   H HB3  . ALA A 1 10 ? 1.647   1.305   -2.118  1.00 0.00 ? 10  ALA A HB3  1  
ATOM   126   N N    . CYS A 1 11 ? 2.058   1.067   2.356   1.00 0.00 ? 11  CYS A N    1  
ATOM   127   C CA   . CYS A 1 11 ? 2.924   1.206   3.570   1.00 0.00 ? 11  CYS A CA   1  
ATOM   128   C C    . CYS A 1 11 ? 3.541   -0.156  3.891   1.00 0.00 ? 11  CYS A C    1  
ATOM   129   O O    . CYS A 1 11 ? 2.885   -1.176  3.814   1.00 0.00 ? 11  CYS A O    1  
ATOM   130   C CB   . CYS A 1 11 ? 2.070   1.673   4.752   1.00 0.00 ? 11  CYS A CB   1  
ATOM   131   S SG   . CYS A 1 11 ? 1.171   3.177   4.292   1.00 0.00 ? 11  CYS A SG   1  
ATOM   132   H H    . CYS A 1 11 ? 1.214   0.572   2.417   1.00 0.00 ? 11  CYS A H    1  
ATOM   133   H HA   . CYS A 1 11 ? 3.713   1.925   3.390   1.00 0.00 ? 11  CYS A HA   1  
ATOM   134   H HB2  . CYS A 1 11 ? 1.365   0.899   5.016   1.00 0.00 ? 11  CYS A HB2  1  
ATOM   135   H HB3  . CYS A 1 11 ? 2.710   1.881   5.598   1.00 0.00 ? 11  CYS A HB3  1  
ATOM   136   N N    . CYS A 1 12 ? 4.798   -0.186  4.240   1.00 0.00 ? 12  CYS A N    1  
ATOM   137   C CA   . CYS A 1 12 ? 5.449   -1.489  4.554   1.00 0.00 ? 12  CYS A CA   1  
ATOM   138   C C    . CYS A 1 12 ? 4.922   -2.019  5.888   1.00 0.00 ? 12  CYS A C    1  
ATOM   139   O O    . CYS A 1 12 ? 4.690   -1.271  6.817   1.00 0.00 ? 12  CYS A O    1  
ATOM   140   C CB   . CYS A 1 12 ? 6.966   -1.301  4.647   1.00 0.00 ? 12  CYS A CB   1  
ATOM   141   S SG   . CYS A 1 12 ? 7.622   -0.851  3.021   1.00 0.00 ? 12  CYS A SG   1  
ATOM   142   H H    . CYS A 1 12 ? 5.314   0.645   4.289   1.00 0.00 ? 12  CYS A H    1  
ATOM   143   H HA   . CYS A 1 12 ? 5.223   -2.200  3.774   1.00 0.00 ? 12  CYS A HA   1  
ATOM   144   H HB2  . CYS A 1 12 ? 7.190   -0.518  5.354   1.00 0.00 ? 12  CYS A HB2  1  
ATOM   145   H HB3  . CYS A 1 12 ? 7.424   -2.222  4.976   1.00 0.00 ? 12  CYS A HB3  1  
ATOM   146   N N    . PHE A 1 13 ? 4.741   -3.311  5.989   1.00 0.00 ? 13  PHE A N    1  
ATOM   147   C CA   . PHE A 1 13 ? 4.238   -3.915  7.260   1.00 0.00 ? 13  PHE A CA   1  
ATOM   148   C C    . PHE A 1 13 ? 5.417   -4.556  7.993   1.00 0.00 ? 13  PHE A C    1  
ATOM   149   O O    . PHE A 1 13 ? 5.360   -4.830  9.175   1.00 0.00 ? 13  PHE A O    1  
ATOM   150   C CB   . PHE A 1 13 ? 3.194   -4.990  6.934   1.00 0.00 ? 13  PHE A CB   1  
ATOM   151   C CG   . PHE A 1 13 ? 3.858   -6.126  6.192   1.00 0.00 ? 13  PHE A CG   1  
ATOM   152   C CD1  . PHE A 1 13 ? 4.172   -5.986  4.828   1.00 0.00 ? 13  PHE A CD1  1  
ATOM   153   C CD2  . PHE A 1 13 ? 4.169   -7.322  6.868   1.00 0.00 ? 13  PHE A CD2  1  
ATOM   154   C CE1  . PHE A 1 13 ? 4.796   -7.043  4.138   1.00 0.00 ? 13  PHE A CE1  1  
ATOM   155   C CE2  . PHE A 1 13 ? 4.794   -8.379  6.178   1.00 0.00 ? 13  PHE A CE2  1  
ATOM   156   C CZ   . PHE A 1 13 ? 5.108   -8.239  4.813   1.00 0.00 ? 13  PHE A CZ   1  
ATOM   157   H H    . PHE A 1 13 ? 4.944   -3.889  5.224   1.00 0.00 ? 13  PHE A H    1  
ATOM   158   H HA   . PHE A 1 13 ? 3.789   -3.155  7.884   1.00 0.00 ? 13  PHE A HA   1  
ATOM   159   H HB2  . PHE A 1 13 ? 2.761   -5.360  7.851   1.00 0.00 ? 13  PHE A HB2  1  
ATOM   160   H HB3  . PHE A 1 13 ? 2.419   -4.563  6.316   1.00 0.00 ? 13  PHE A HB3  1  
ATOM   161   H HD1  . PHE A 1 13 ? 3.933   -5.069  4.310   1.00 0.00 ? 13  PHE A HD1  1  
ATOM   162   H HD2  . PHE A 1 13 ? 3.928   -7.429  7.915   1.00 0.00 ? 13  PHE A HD2  1  
ATOM   163   H HE1  . PHE A 1 13 ? 5.036   -6.935  3.091   1.00 0.00 ? 13  PHE A HE1  1  
ATOM   164   H HE2  . PHE A 1 13 ? 5.032   -9.296  6.697   1.00 0.00 ? 13  PHE A HE2  1  
ATOM   165   H HZ   . PHE A 1 13 ? 5.587   -9.049  4.283   1.00 0.00 ? 13  PHE A HZ   1  
ATOM   166   N N    . SER A 1 14 ? 6.490   -4.789  7.287   1.00 0.00 ? 14  SER A N    1  
ATOM   167   C CA   . SER A 1 14 ? 7.691   -5.406  7.914   1.00 0.00 ? 14  SER A CA   1  
ATOM   168   C C    . SER A 1 14 ? 8.921   -5.047  7.079   1.00 0.00 ? 14  SER A C    1  
ATOM   169   O O    . SER A 1 14 ? 8.927   -4.070  6.358   1.00 0.00 ? 14  SER A O    1  
ATOM   170   C CB   . SER A 1 14 ? 7.525   -6.926  7.954   1.00 0.00 ? 14  SER A CB   1  
ATOM   171   O OG   . SER A 1 14 ? 7.699   -7.452  6.645   1.00 0.00 ? 14  SER A OG   1  
ATOM   172   H H    . SER A 1 14 ? 6.505   -4.555  6.336   1.00 0.00 ? 14  SER A H    1  
ATOM   173   H HA   . SER A 1 14 ? 7.812   -5.027  8.919   1.00 0.00 ? 14  SER A HA   1  
ATOM   174   H HB2  . SER A 1 14 ? 8.265   -7.354  8.610   1.00 0.00 ? 14  SER A HB2  1  
ATOM   175   H HB3  . SER A 1 14 ? 6.537   -7.169  8.323   1.00 0.00 ? 14  SER A HB3  1  
ATOM   176   H HG   . SER A 1 14 ? 7.775   -8.406  6.717   1.00 0.00 ? 14  SER A HG   1  
ATOM   177   N N    . TYR A 1 15 ? 9.967   -5.825  7.166   1.00 0.00 ? 15  TYR A N    1  
ATOM   178   C CA   . TYR A 1 15 ? 11.194  -5.517  6.370   1.00 0.00 ? 15  TYR A CA   1  
ATOM   179   C C    . TYR A 1 15 ? 11.982  -6.806  6.134   1.00 0.00 ? 15  TYR A C    1  
ATOM   180   O O    . TYR A 1 15 ? 11.804  -7.789  6.827   1.00 0.00 ? 15  TYR A O    1  
ATOM   181   C CB   . TYR A 1 15 ? 12.070  -4.518  7.139   1.00 0.00 ? 15  TYR A CB   1  
ATOM   182   C CG   . TYR A 1 15 ? 11.199  -3.483  7.808   1.00 0.00 ? 15  TYR A CG   1  
ATOM   183   C CD1  . TYR A 1 15 ? 10.843  -2.308  7.119   1.00 0.00 ? 15  TYR A CD1  1  
ATOM   184   C CD2  . TYR A 1 15 ? 10.741  -3.695  9.123   1.00 0.00 ? 15  TYR A CD2  1  
ATOM   185   C CE1  . TYR A 1 15 ? 10.029  -1.345  7.746   1.00 0.00 ? 15  TYR A CE1  1  
ATOM   186   C CE2  . TYR A 1 15 ? 9.928   -2.732  9.749   1.00 0.00 ? 15  TYR A CE2  1  
ATOM   187   C CZ   . TYR A 1 15 ? 9.571   -1.557  9.061   1.00 0.00 ? 15  TYR A CZ   1  
ATOM   188   O OH   . TYR A 1 15 ? 8.774   -0.612  9.674   1.00 0.00 ? 15  TYR A OH   1  
ATOM   189   H H    . TYR A 1 15 ? 9.947   -6.610  7.752   1.00 0.00 ? 15  TYR A H    1  
ATOM   190   H HA   . TYR A 1 15 ? 10.911  -5.094  5.415   1.00 0.00 ? 15  TYR A HA   1  
ATOM   191   H HB2  . TYR A 1 15 ? 12.644  -5.040  7.892   1.00 0.00 ? 15  TYR A HB2  1  
ATOM   192   H HB3  . TYR A 1 15 ? 12.743  -4.028  6.451   1.00 0.00 ? 15  TYR A HB3  1  
ATOM   193   H HD1  . TYR A 1 15 ? 11.194  -2.146  6.111   1.00 0.00 ? 15  TYR A HD1  1  
ATOM   194   H HD2  . TYR A 1 15 ? 11.014  -4.597  9.651   1.00 0.00 ? 15  TYR A HD2  1  
ATOM   195   H HE1  . TYR A 1 15 ? 9.756   -0.445  7.218   1.00 0.00 ? 15  TYR A HE1  1  
ATOM   196   H HE2  . TYR A 1 15 ? 9.577   -2.894  10.758  1.00 0.00 ? 15  TYR A HE2  1  
ATOM   197   H HH   . TYR A 1 15 ? 9.348   0.027   10.103  1.00 0.00 ? 15  TYR A HH   1  
ATOM   198   N N    . THR A 1 16 ? 12.861  -6.810  5.169   1.00 0.00 ? 16  THR A N    1  
ATOM   199   C CA   . THR A 1 16 ? 13.660  -8.041  4.912   1.00 0.00 ? 16  THR A CA   1  
ATOM   200   C C    . THR A 1 16 ? 14.460  -8.377  6.175   1.00 0.00 ? 16  THR A C    1  
ATOM   201   O O    . THR A 1 16 ? 14.145  -7.914  7.253   1.00 0.00 ? 16  THR A O    1  
ATOM   202   C CB   . THR A 1 16 ? 14.599  -7.813  3.718   1.00 0.00 ? 16  THR A CB   1  
ATOM   203   O OG1  . THR A 1 16 ? 15.487  -8.912  3.588   1.00 0.00 ? 16  THR A OG1  1  
ATOM   204   C CG2  . THR A 1 16 ? 15.402  -6.527  3.918   1.00 0.00 ? 16  THR A CG2  1  
ATOM   205   H H    . THR A 1 16 ? 13.002  -6.002  4.627   1.00 0.00 ? 16  THR A H    1  
ATOM   206   H HA   . THR A 1 16 ? 12.989  -8.858  4.689   1.00 0.00 ? 16  THR A HA   1  
ATOM   207   H HB   . THR A 1 16 ? 14.012  -7.725  2.819   1.00 0.00 ? 16  THR A HB   1  
ATOM   208   H HG1  . THR A 1 16 ? 15.268  -9.376  2.776   1.00 0.00 ? 16  THR A HG1  1  
ATOM   209   H HG21 . THR A 1 16 ? 14.726  -5.691  4.008   1.00 0.00 ? 16  THR A HG21 1  
ATOM   210   H HG22 . THR A 1 16 ? 15.996  -6.610  4.815   1.00 0.00 ? 16  THR A HG22 1  
ATOM   211   H HG23 . THR A 1 16 ? 16.052  -6.375  3.068   1.00 0.00 ? 16  THR A HG23 1  
ATOM   212   N N    . ALA A 1 17 ? 15.487  -9.177  6.060   1.00 0.00 ? 17  ALA A N    1  
ATOM   213   C CA   . ALA A 1 17 ? 16.298  -9.539  7.262   1.00 0.00 ? 17  ALA A CA   1  
ATOM   214   C C    . ALA A 1 17 ? 17.768  -9.639  6.860   1.00 0.00 ? 17  ALA A C    1  
ATOM   215   O O    . ALA A 1 17 ? 18.606  -10.070 7.628   1.00 0.00 ? 17  ALA A O    1  
ATOM   216   C CB   . ALA A 1 17 ? 15.824  -10.889 7.803   1.00 0.00 ? 17  ALA A CB   1  
ATOM   217   H H    . ALA A 1 17 ? 15.724  -9.545  5.187   1.00 0.00 ? 17  ALA A H    1  
ATOM   218   H HA   . ALA A 1 17 ? 16.186  -8.783  8.028   1.00 0.00 ? 17  ALA A HA   1  
ATOM   219   H HB1  . ALA A 1 17 ? 15.925  -11.639 7.033   1.00 0.00 ? 17  ALA A HB1  1  
ATOM   220   H HB2  . ALA A 1 17 ? 16.424  -11.165 8.656   1.00 0.00 ? 17  ALA A HB2  1  
ATOM   221   H HB3  . ALA A 1 17 ? 14.788  -10.814 8.099   1.00 0.00 ? 17  ALA A HB3  1  
ATOM   222   N N    . ARG A 1 18 ? 18.087  -9.239  5.658   1.00 0.00 ? 18  ARG A N    1  
ATOM   223   C CA   . ARG A 1 18 ? 19.502  -9.302  5.185   1.00 0.00 ? 18  ARG A CA   1  
ATOM   224   C C    . ARG A 1 18 ? 19.797  -8.073  4.321   1.00 0.00 ? 18  ARG A C    1  
ATOM   225   O O    . ARG A 1 18 ? 19.025  -7.713  3.454   1.00 0.00 ? 18  ARG A O    1  
ATOM   226   C CB   . ARG A 1 18 ? 19.698  -10.573 4.353   1.00 0.00 ? 18  ARG A CB   1  
ATOM   227   C CG   . ARG A 1 18 ? 19.877  -11.775 5.285   1.00 0.00 ? 18  ARG A CG   1  
ATOM   228   C CD   . ARG A 1 18 ? 19.713  -13.066 4.487   1.00 0.00 ? 18  ARG A CD   1  
ATOM   229   N NE   . ARG A 1 18 ? 20.215  -14.215 5.291   1.00 0.00 ? 18  ARG A NE   1  
ATOM   230   C CZ   . ARG A 1 18 ? 19.907  -15.436 4.948   1.00 0.00 ? 18  ARG A CZ   1  
ATOM   231   N NH1  . ARG A 1 18 ? 19.156  -15.650 3.902   1.00 0.00 ? 18  ARG A NH1  1  
ATOM   232   N NH2  . ARG A 1 18 ? 20.349  -16.443 5.651   1.00 0.00 ? 18  ARG A NH2  1  
ATOM   233   H H    . ARG A 1 18 ? 17.391  -8.893  5.061   1.00 0.00 ? 18  ARG A H    1  
ATOM   234   H HA   . ARG A 1 18 ? 20.175  -9.315  6.031   1.00 0.00 ? 18  ARG A HA   1  
ATOM   235   H HB2  . ARG A 1 18 ? 18.832  -10.729 3.727   1.00 0.00 ? 18  ARG A HB2  1  
ATOM   236   H HB3  . ARG A 1 18 ? 20.576  -10.469 3.733   1.00 0.00 ? 18  ARG A HB3  1  
ATOM   237   H HG2  . ARG A 1 18 ? 20.863  -11.746 5.726   1.00 0.00 ? 18  ARG A HG2  1  
ATOM   238   H HG3  . ARG A 1 18 ? 19.132  -11.740 6.065   1.00 0.00 ? 18  ARG A HG3  1  
ATOM   239   H HD2  . ARG A 1 18 ? 18.668  -13.215 4.260   1.00 0.00 ? 18  ARG A HD2  1  
ATOM   240   H HD3  . ARG A 1 18 ? 20.276  -12.994 3.569   1.00 0.00 ? 18  ARG A HD3  1  
ATOM   241   H HE   . ARG A 1 18 ? 20.779  -14.054 6.076   1.00 0.00 ? 18  ARG A HE   1  
ATOM   242   H HH11 . ARG A 1 18 ? 18.817  -14.879 3.364   1.00 0.00 ? 18  ARG A HH11 1  
ATOM   243   H HH12 . ARG A 1 18 ? 18.919  -16.586 3.640   1.00 0.00 ? 18  ARG A HH12 1  
ATOM   244   H HH21 . ARG A 1 18 ? 20.924  -16.279 6.453   1.00 0.00 ? 18  ARG A HH21 1  
ATOM   245   H HH22 . ARG A 1 18 ? 20.112  -17.378 5.389   1.00 0.00 ? 18  ARG A HH22 1  
ATOM   246   N N    . LYS A 1 19 ? 20.909  -7.430  4.545   1.00 0.00 ? 19  LYS A N    1  
ATOM   247   C CA   . LYS A 1 19 ? 21.248  -6.231  3.730   1.00 0.00 ? 19  LYS A CA   1  
ATOM   248   C C    . LYS A 1 19 ? 21.437  -6.660  2.271   1.00 0.00 ? 19  LYS A C    1  
ATOM   249   O O    . LYS A 1 19 ? 22.147  -7.601  1.975   1.00 0.00 ? 19  LYS A O    1  
ATOM   250   C CB   . LYS A 1 19 ? 22.538  -5.594  4.276   1.00 0.00 ? 19  LYS A CB   1  
ATOM   251   C CG   . LYS A 1 19 ? 23.187  -4.700  3.210   1.00 0.00 ? 19  LYS A CG   1  
ATOM   252   C CD   . LYS A 1 19 ? 24.224  -3.784  3.864   1.00 0.00 ? 19  LYS A CD   1  
ATOM   253   C CE   . LYS A 1 19 ? 25.354  -4.615  4.473   1.00 0.00 ? 19  LYS A CE   1  
ATOM   254   N NZ   . LYS A 1 19 ? 25.793  -5.659  3.505   1.00 0.00 ? 19  LYS A NZ   1  
ATOM   255   H H    . LYS A 1 19 ? 21.521  -7.736  5.247   1.00 0.00 ? 19  LYS A H    1  
ATOM   256   H HA   . LYS A 1 19 ? 20.440  -5.516  3.791   1.00 0.00 ? 19  LYS A HA   1  
ATOM   257   H HB2  . LYS A 1 19 ? 22.298  -4.996  5.144   1.00 0.00 ? 19  LYS A HB2  1  
ATOM   258   H HB3  . LYS A 1 19 ? 23.228  -6.372  4.560   1.00 0.00 ? 19  LYS A HB3  1  
ATOM   259   H HG2  . LYS A 1 19 ? 23.668  -5.317  2.465   1.00 0.00 ? 19  LYS A HG2  1  
ATOM   260   H HG3  . LYS A 1 19 ? 22.427  -4.097  2.738   1.00 0.00 ? 19  LYS A HG3  1  
ATOM   261   H HD2  . LYS A 1 19 ? 24.631  -3.114  3.123   1.00 0.00 ? 19  LYS A HD2  1  
ATOM   262   H HD3  . LYS A 1 19 ? 23.749  -3.212  4.641   1.00 0.00 ? 19  LYS A HD3  1  
ATOM   263   H HE2  . LYS A 1 19 ? 26.188  -3.968  4.704   1.00 0.00 ? 19  LYS A HE2  1  
ATOM   264   H HE3  . LYS A 1 19 ? 25.004  -5.086  5.379   1.00 0.00 ? 19  LYS A HE3  1  
ATOM   265   H HZ1  . LYS A 1 19 ? 25.569  -5.349  2.537   1.00 0.00 ? 19  LYS A HZ1  1  
ATOM   266   H HZ2  . LYS A 1 19 ? 26.817  -5.808  3.595   1.00 0.00 ? 19  LYS A HZ2  1  
ATOM   267   H HZ3  . LYS A 1 19 ? 25.297  -6.550  3.707   1.00 0.00 ? 19  LYS A HZ3  1  
ATOM   268   N N    . LEU A 1 20 ? 20.806  -5.973  1.360   1.00 0.00 ? 20  LEU A N    1  
ATOM   269   C CA   . LEU A 1 20 ? 20.946  -6.335  -0.077  1.00 0.00 ? 20  LEU A CA   1  
ATOM   270   C C    . LEU A 1 20 ? 22.335  -5.883  -0.586  1.00 0.00 ? 20  LEU A C    1  
ATOM   271   O O    . LEU A 1 20 ? 22.655  -4.719  -0.459  1.00 0.00 ? 20  LEU A O    1  
ATOM   272   C CB   . LEU A 1 20 ? 19.874  -5.598  -0.882  1.00 0.00 ? 20  LEU A CB   1  
ATOM   273   C CG   . LEU A 1 20 ? 18.515  -5.728  -0.193  1.00 0.00 ? 20  LEU A CG   1  
ATOM   274   C CD1  . LEU A 1 20 ? 17.439  -5.137  -1.104  1.00 0.00 ? 20  LEU A CD1  1  
ATOM   275   C CD2  . LEU A 1 20 ? 18.203  -7.205  0.074   1.00 0.00 ? 20  LEU A CD2  1  
ATOM   276   H H    . LEU A 1 20 ? 20.240  -5.218  1.621   1.00 0.00 ? 20  LEU A H    1  
ATOM   277   H HA   . LEU A 1 20 ? 20.809  -7.393  -0.187  1.00 0.00 ? 20  LEU A HA   1  
ATOM   278   H HB2  . LEU A 1 20 ? 20.137  -4.553  -0.956  1.00 0.00 ? 20  LEU A HB2  1  
ATOM   279   H HB3  . LEU A 1 20 ? 19.815  -6.022  -1.872  1.00 0.00 ? 20  LEU A HB3  1  
ATOM   280   H HG   . LEU A 1 20 ? 18.533  -5.186  0.741   1.00 0.00 ? 20  LEU A HG   1  
ATOM   281   H HD11 . LEU A 1 20 ? 17.766  -4.174  -1.469  1.00 0.00 ? 20  LEU A HD11 1  
ATOM   282   H HD12 . LEU A 1 20 ? 17.270  -5.801  -1.939  1.00 0.00 ? 20  LEU A HD12 1  
ATOM   283   H HD13 . LEU A 1 20 ? 16.523  -5.019  -0.547  1.00 0.00 ? 20  LEU A HD13 1  
ATOM   284   H HD21 . LEU A 1 20 ? 18.474  -7.794  -0.790  1.00 0.00 ? 20  LEU A HD21 1  
ATOM   285   H HD22 . LEU A 1 20 ? 18.765  -7.542  0.932   1.00 0.00 ? 20  LEU A HD22 1  
ATOM   286   H HD23 . LEU A 1 20 ? 17.146  -7.321  0.270   1.00 0.00 ? 20  LEU A HD23 1  
ATOM   287   N N    . PRO A 1 21 ? 23.128  -6.773  -1.166  1.00 0.00 ? 21  PRO A N    1  
ATOM   288   C CA   . PRO A 1 21 ? 24.448  -6.368  -1.684  1.00 0.00 ? 21  PRO A CA   1  
ATOM   289   C C    . PRO A 1 21 ? 24.278  -5.214  -2.675  1.00 0.00 ? 21  PRO A C    1  
ATOM   290   O O    . PRO A 1 21 ? 23.324  -5.169  -3.424  1.00 0.00 ? 21  PRO A O    1  
ATOM   291   C CB   . PRO A 1 21 ? 25.004  -7.624  -2.393  1.00 0.00 ? 21  PRO A CB   1  
ATOM   292   C CG   . PRO A 1 21 ? 24.039  -8.801  -2.075  1.00 0.00 ? 21  PRO A CG   1  
ATOM   293   C CD   . PRO A 1 21 ? 22.809  -8.209  -1.353  1.00 0.00 ? 21  PRO A CD   1  
ATOM   294   H HA   . PRO A 1 21 ? 25.098  -6.077  -0.873  1.00 0.00 ? 21  PRO A HA   1  
ATOM   295   H HB2  . PRO A 1 21 ? 25.048  -7.463  -3.466  1.00 0.00 ? 21  PRO A HB2  1  
ATOM   296   H HB3  . PRO A 1 21 ? 25.992  -7.849  -2.027  1.00 0.00 ? 21  PRO A HB3  1  
ATOM   297   H HG2  . PRO A 1 21 ? 23.733  -9.287  -2.994  1.00 0.00 ? 21  PRO A HG2  1  
ATOM   298   H HG3  . PRO A 1 21 ? 24.529  -9.519  -1.431  1.00 0.00 ? 21  PRO A HG3  1  
ATOM   299   H HD2  . PRO A 1 21 ? 21.923  -8.322  -1.966  1.00 0.00 ? 21  PRO A HD2  1  
ATOM   300   H HD3  . PRO A 1 21 ? 22.670  -8.687  -0.393  1.00 0.00 ? 21  PRO A HD3  1  
ATOM   301   N N    . ARG A 1 22 ? 25.200  -4.293  -2.701  1.00 0.00 ? 22  ARG A N    1  
ATOM   302   C CA   . ARG A 1 22 ? 25.084  -3.168  -3.669  1.00 0.00 ? 22  ARG A CA   1  
ATOM   303   C C    . ARG A 1 22 ? 24.832  -3.747  -5.062  1.00 0.00 ? 22  ARG A C    1  
ATOM   304   O O    . ARG A 1 22 ? 24.147  -3.164  -5.878  1.00 0.00 ? 22  ARG A O    1  
ATOM   305   C CB   . ARG A 1 22 ? 26.379  -2.358  -3.676  1.00 0.00 ? 22  ARG A CB   1  
ATOM   306   C CG   . ARG A 1 22 ? 26.196  -1.121  -4.562  1.00 0.00 ? 22  ARG A CG   1  
ATOM   307   C CD   . ARG A 1 22 ? 27.449  -0.241  -4.496  1.00 0.00 ? 22  ARG A CD   1  
ATOM   308   N NE   . ARG A 1 22 ? 27.085  1.181   -4.802  1.00 0.00 ? 22  ARG A NE   1  
ATOM   309   C CZ   . ARG A 1 22 ? 26.416  1.496   -5.879  1.00 0.00 ? 22  ARG A CZ   1  
ATOM   310   N NH1  . ARG A 1 22 ? 26.215  0.612   -6.817  1.00 0.00 ? 22  ARG A NH1  1  
ATOM   311   N NH2  . ARG A 1 22 ? 25.997  2.721   -6.046  1.00 0.00 ? 22  ARG A NH2  1  
ATOM   312   H H    . ARG A 1 22 ? 25.972  -4.350  -2.101  1.00 0.00 ? 22  ARG A H    1  
ATOM   313   H HA   . ARG A 1 22 ? 24.262  -2.529  -3.387  1.00 0.00 ? 22  ARG A HA   1  
ATOM   314   H HB2  . ARG A 1 22 ? 26.616  -2.052  -2.667  1.00 0.00 ? 22  ARG A HB2  1  
ATOM   315   H HB3  . ARG A 1 22 ? 27.182  -2.964  -4.068  1.00 0.00 ? 22  ARG A HB3  1  
ATOM   316   H HG2  . ARG A 1 22 ? 26.026  -1.440  -5.578  1.00 0.00 ? 22  ARG A HG2  1  
ATOM   317   H HG3  . ARG A 1 22 ? 25.343  -0.556  -4.216  1.00 0.00 ? 22  ARG A HG3  1  
ATOM   318   H HD2  . ARG A 1 22 ? 27.858  -0.266  -3.502  1.00 0.00 ? 22  ARG A HD2  1  
ATOM   319   H HD3  . ARG A 1 22 ? 28.189  -0.620  -5.195  1.00 0.00 ? 22  ARG A HD3  1  
ATOM   320   H HE   . ARG A 1 22 ? 27.308  1.882   -4.154  1.00 0.00 ? 22  ARG A HE   1  
ATOM   321   H HH11 . ARG A 1 22 ? 26.577  -0.312  -6.720  1.00 0.00 ? 22  ARG A HH11 1  
ATOM   322   H HH12 . ARG A 1 22 ? 25.696  0.861   -7.635  1.00 0.00 ? 22  ARG A HH12 1  
ATOM   323   H HH21 . ARG A 1 22 ? 26.189  3.414   -5.351  1.00 0.00 ? 22  ARG A HH21 1  
ATOM   324   H HH22 . ARG A 1 22 ? 25.485  2.967   -6.869  1.00 0.00 ? 22  ARG A HH22 1  
ATOM   325   N N    . ASN A 1 23 ? 25.383  -4.901  -5.331  1.00 0.00 ? 23  ASN A N    1  
ATOM   326   C CA   . ASN A 1 23 ? 25.182  -5.538  -6.663  1.00 0.00 ? 23  ASN A CA   1  
ATOM   327   C C    . ASN A 1 23 ? 23.750  -6.070  -6.768  1.00 0.00 ? 23  ASN A C    1  
ATOM   328   O O    . ASN A 1 23 ? 23.435  -6.860  -7.636  1.00 0.00 ? 23  ASN A O    1  
ATOM   329   C CB   . ASN A 1 23 ? 26.168  -6.697  -6.827  1.00 0.00 ? 23  ASN A CB   1  
ATOM   330   C CG   . ASN A 1 23 ? 26.081  -7.246  -8.251  1.00 0.00 ? 23  ASN A CG   1  
ATOM   331   O OD1  . ASN A 1 23 ? 25.588  -6.582  -9.142  1.00 0.00 ? 23  ASN A OD1  1  
ATOM   332   N ND2  . ASN A 1 23 ? 26.542  -8.440  -8.507  1.00 0.00 ? 23  ASN A ND2  1  
ATOM   333   H H    . ASN A 1 23 ? 25.927  -5.355  -4.649  1.00 0.00 ? 23  ASN A H    1  
ATOM   334   H HA   . ASN A 1 23 ? 25.353  -4.809  -7.441  1.00 0.00 ? 23  ASN A HA   1  
ATOM   335   H HB2  . ASN A 1 23 ? 27.172  -6.344  -6.637  1.00 0.00 ? 23  ASN A HB2  1  
ATOM   336   H HB3  . ASN A 1 23 ? 25.923  -7.480  -6.125  1.00 0.00 ? 23  ASN A HB3  1  
ATOM   337   H HD21 . ASN A 1 23 ? 26.940  -8.975  -7.789  1.00 0.00 ? 23  ASN A HD21 1  
ATOM   338   H HD22 . ASN A 1 23 ? 26.491  -8.801  -9.416  1.00 0.00 ? 23  ASN A HD22 1  
ATOM   339   N N    . PHE A 1 24 ? 22.882  -5.650  -5.884  1.00 0.00 ? 24  PHE A N    1  
ATOM   340   C CA   . PHE A 1 24 ? 21.465  -6.135  -5.918  1.00 0.00 ? 24  PHE A CA   1  
ATOM   341   C C    . PHE A 1 24 ? 20.530  -4.960  -5.615  1.00 0.00 ? 24  PHE A C    1  
ATOM   342   O O    . PHE A 1 24 ? 19.445  -5.132  -5.097  1.00 0.00 ? 24  PHE A O    1  
ATOM   343   C CB   . PHE A 1 24 ? 21.292  -7.231  -4.851  1.00 0.00 ? 24  PHE A CB   1  
ATOM   344   C CG   . PHE A 1 24 ? 20.103  -8.112  -5.176  1.00 0.00 ? 24  PHE A CG   1  
ATOM   345   C CD1  . PHE A 1 24 ? 20.093  -8.865  -6.367  1.00 0.00 ? 24  PHE A CD1  1  
ATOM   346   C CD2  . PHE A 1 24 ? 19.013  -8.192  -4.285  1.00 0.00 ? 24  PHE A CD2  1  
ATOM   347   C CE1  . PHE A 1 24 ? 18.997  -9.693  -6.667  1.00 0.00 ? 24  PHE A CE1  1  
ATOM   348   C CE2  . PHE A 1 24 ? 17.915  -9.020  -4.588  1.00 0.00 ? 24  PHE A CE2  1  
ATOM   349   C CZ   . PHE A 1 24 ? 17.907  -9.770  -5.778  1.00 0.00 ? 24  PHE A CZ   1  
ATOM   350   H H    . PHE A 1 24 ? 23.164  -5.020  -5.189  1.00 0.00 ? 24  PHE A H    1  
ATOM   351   H HA   . PHE A 1 24 ? 21.232  -6.532  -6.899  1.00 0.00 ? 24  PHE A HA   1  
ATOM   352   H HB2  . PHE A 1 24 ? 22.182  -7.838  -4.819  1.00 0.00 ? 24  PHE A HB2  1  
ATOM   353   H HB3  . PHE A 1 24 ? 21.142  -6.771  -3.883  1.00 0.00 ? 24  PHE A HB3  1  
ATOM   354   H HD1  . PHE A 1 24 ? 20.927  -8.811  -7.051  1.00 0.00 ? 24  PHE A HD1  1  
ATOM   355   H HD2  . PHE A 1 24 ? 19.018  -7.617  -3.373  1.00 0.00 ? 24  PHE A HD2  1  
ATOM   356   H HE1  . PHE A 1 24 ? 18.993  -10.268 -7.580  1.00 0.00 ? 24  PHE A HE1  1  
ATOM   357   H HE2  . PHE A 1 24 ? 17.080  -9.079  -3.906  1.00 0.00 ? 24  PHE A HE2  1  
ATOM   358   H HZ   . PHE A 1 24 ? 17.066  -10.406 -6.009  1.00 0.00 ? 24  PHE A HZ   1  
ATOM   359   N N    . VAL A 1 25 ? 20.950  -3.765  -5.941  1.00 0.00 ? 25  VAL A N    1  
ATOM   360   C CA   . VAL A 1 25 ? 20.099  -2.565  -5.681  1.00 0.00 ? 25  VAL A CA   1  
ATOM   361   C C    . VAL A 1 25 ? 20.391  -1.510  -6.750  1.00 0.00 ? 25  VAL A C    1  
ATOM   362   O O    . VAL A 1 25 ? 21.266  -0.682  -6.595  1.00 0.00 ? 25  VAL A O    1  
ATOM   363   C CB   . VAL A 1 25 ? 20.427  -1.990  -4.301  1.00 0.00 ? 25  VAL A CB   1  
ATOM   364   C CG1  . VAL A 1 25 ? 19.496  -0.815  -4.001  1.00 0.00 ? 25  VAL A CG1  1  
ATOM   365   C CG2  . VAL A 1 25 ? 20.235  -3.070  -3.235  1.00 0.00 ? 25  VAL A CG2  1  
ATOM   366   H H    . VAL A 1 25 ? 21.829  -3.655  -6.360  1.00 0.00 ? 25  VAL A H    1  
ATOM   367   H HA   . VAL A 1 25 ? 19.055  -2.840  -5.721  1.00 0.00 ? 25  VAL A HA   1  
ATOM   368   H HB   . VAL A 1 25 ? 21.452  -1.648  -4.288  1.00 0.00 ? 25  VAL A HB   1  
ATOM   369   H HG11 . VAL A 1 25 ? 18.469  -1.148  -4.048  1.00 0.00 ? 25  VAL A HG11 1  
ATOM   370   H HG12 . VAL A 1 25 ? 19.706  -0.434  -3.013  1.00 0.00 ? 25  VAL A HG12 1  
ATOM   371   H HG13 . VAL A 1 25 ? 19.654  -0.033  -4.729  1.00 0.00 ? 25  VAL A HG13 1  
ATOM   372   H HG21 . VAL A 1 25 ? 19.274  -3.543  -3.371  1.00 0.00 ? 25  VAL A HG21 1  
ATOM   373   H HG22 . VAL A 1 25 ? 21.017  -3.809  -3.324  1.00 0.00 ? 25  VAL A HG22 1  
ATOM   374   H HG23 . VAL A 1 25 ? 20.277  -2.617  -2.256  1.00 0.00 ? 25  VAL A HG23 1  
ATOM   375   N N    . VAL A 1 26 ? 19.670  -1.539  -7.838  1.00 0.00 ? 26  VAL A N    1  
ATOM   376   C CA   . VAL A 1 26 ? 19.909  -0.548  -8.923  1.00 0.00 ? 26  VAL A CA   1  
ATOM   377   C C    . VAL A 1 26 ? 19.133  0.736   -8.632  1.00 0.00 ? 26  VAL A C    1  
ATOM   378   O O    . VAL A 1 26 ? 19.347  1.754   -9.259  1.00 0.00 ? 26  VAL A O    1  
ATOM   379   C CB   . VAL A 1 26 ? 19.440  -1.137  -10.253 1.00 0.00 ? 26  VAL A CB   1  
ATOM   380   C CG1  . VAL A 1 26 ? 20.323  -2.330  -10.619 1.00 0.00 ? 26  VAL A CG1  1  
ATOM   381   C CG2  . VAL A 1 26 ? 17.986  -1.602  -10.126 1.00 0.00 ? 26  VAL A CG2  1  
ATOM   382   H H    . VAL A 1 26 ? 18.974  -2.219  -7.947  1.00 0.00 ? 26  VAL A H    1  
ATOM   383   H HA   . VAL A 1 26 ? 20.964  -0.322  -8.983  1.00 0.00 ? 26  VAL A HA   1  
ATOM   384   H HB   . VAL A 1 26 ? 19.513  -0.387  -11.021 1.00 0.00 ? 26  VAL A HB   1  
ATOM   385   H HG11 . VAL A 1 26 ? 20.324  -3.039  -9.805  1.00 0.00 ? 26  VAL A HG11 1  
ATOM   386   H HG12 . VAL A 1 26 ? 19.937  -2.804  -11.509 1.00 0.00 ? 26  VAL A HG12 1  
ATOM   387   H HG13 . VAL A 1 26 ? 21.331  -1.989  -10.801 1.00 0.00 ? 26  VAL A HG13 1  
ATOM   388   H HG21 . VAL A 1 26 ? 17.368  -0.775  -9.812  1.00 0.00 ? 26  VAL A HG21 1  
ATOM   389   H HG22 . VAL A 1 26 ? 17.641  -1.965  -11.083 1.00 0.00 ? 26  VAL A HG22 1  
ATOM   390   H HG23 . VAL A 1 26 ? 17.924  -2.396  -9.397  1.00 0.00 ? 26  VAL A HG23 1  
ATOM   391   N N    . ASP A 1 27 ? 18.235  0.701   -7.689  1.00 0.00 ? 27  ASP A N    1  
ATOM   392   C CA   . ASP A 1 27 ? 17.455  1.930   -7.374  1.00 0.00 ? 27  ASP A CA   1  
ATOM   393   C C    . ASP A 1 27 ? 16.656  1.707   -6.094  1.00 0.00 ? 27  ASP A C    1  
ATOM   394   O O    . ASP A 1 27 ? 16.826  0.718   -5.410  1.00 0.00 ? 27  ASP A O    1  
ATOM   395   C CB   . ASP A 1 27 ? 16.497  2.233   -8.529  1.00 0.00 ? 27  ASP A CB   1  
ATOM   396   C CG   . ASP A 1 27 ? 15.929  3.644   -8.367  1.00 0.00 ? 27  ASP A CG   1  
ATOM   397   O OD1  . ASP A 1 27 ? 16.694  4.587   -8.491  1.00 0.00 ? 27  ASP A OD1  1  
ATOM   398   O OD2  . ASP A 1 27 ? 14.739  3.758   -8.121  1.00 0.00 ? 27  ASP A OD2  1  
ATOM   399   H H    . ASP A 1 27 ? 18.071  -0.130  -7.191  1.00 0.00 ? 27  ASP A H    1  
ATOM   400   H HA   . ASP A 1 27 ? 18.130  2.761   -7.237  1.00 0.00 ? 27  ASP A HA   1  
ATOM   401   H HB2  . ASP A 1 27 ? 17.031  2.165   -9.466  1.00 0.00 ? 27  ASP A HB2  1  
ATOM   402   H HB3  . ASP A 1 27 ? 15.687  1.518   -8.524  1.00 0.00 ? 27  ASP A HB3  1  
ATOM   403   N N    . TYR A 1 28 ? 15.781  2.617   -5.760  1.00 0.00 ? 28  TYR A N    1  
ATOM   404   C CA   . TYR A 1 28 ? 14.974  2.446   -4.522  1.00 0.00 ? 28  TYR A CA   1  
ATOM   405   C C    . TYR A 1 28 ? 13.677  3.245   -4.629  1.00 0.00 ? 28  TYR A C    1  
ATOM   406   O O    . TYR A 1 28 ? 13.371  3.836   -5.645  1.00 0.00 ? 28  TYR A O    1  
ATOM   407   C CB   . TYR A 1 28 ? 15.777  2.905   -3.298  1.00 0.00 ? 28  TYR A CB   1  
ATOM   408   C CG   . TYR A 1 28 ? 15.875  4.418   -3.255  1.00 0.00 ? 28  TYR A CG   1  
ATOM   409   C CD1  . TYR A 1 28 ? 16.553  5.113   -4.276  1.00 0.00 ? 28  TYR A CD1  1  
ATOM   410   C CD2  . TYR A 1 28 ? 15.299  5.131   -2.184  1.00 0.00 ? 28  TYR A CD2  1  
ATOM   411   C CE1  . TYR A 1 28 ? 16.652  6.516   -4.227  1.00 0.00 ? 28  TYR A CE1  1  
ATOM   412   C CE2  . TYR A 1 28 ? 15.398  6.532   -2.133  1.00 0.00 ? 28  TYR A CE2  1  
ATOM   413   C CZ   . TYR A 1 28 ? 16.075  7.227   -3.156  1.00 0.00 ? 28  TYR A CZ   1  
ATOM   414   O OH   . TYR A 1 28 ? 16.174  8.602   -3.107  1.00 0.00 ? 28  TYR A OH   1  
ATOM   415   H H    . TYR A 1 28 ? 15.656  3.409   -6.323  1.00 0.00 ? 28  TYR A H    1  
ATOM   416   H HA   . TYR A 1 28 ? 14.726  1.400   -4.404  1.00 0.00 ? 28  TYR A HA   1  
ATOM   417   H HB2  . TYR A 1 28 ? 15.290  2.551   -2.402  1.00 0.00 ? 28  TYR A HB2  1  
ATOM   418   H HB3  . TYR A 1 28 ? 16.767  2.486   -3.349  1.00 0.00 ? 28  TYR A HB3  1  
ATOM   419   H HD1  . TYR A 1 28 ? 16.997  4.571   -5.098  1.00 0.00 ? 28  TYR A HD1  1  
ATOM   420   H HD2  . TYR A 1 28 ? 14.780  4.600   -1.401  1.00 0.00 ? 28  TYR A HD2  1  
ATOM   421   H HE1  . TYR A 1 28 ? 17.174  7.046   -5.011  1.00 0.00 ? 28  TYR A HE1  1  
ATOM   422   H HE2  . TYR A 1 28 ? 14.956  7.074   -1.308  1.00 0.00 ? 28  TYR A HE2  1  
ATOM   423   H HH   . TYR A 1 28 ? 15.302  8.956   -2.916  1.00 0.00 ? 28  TYR A HH   1  
ATOM   424   N N    . TYR A 1 29 ? 12.912  3.245   -3.581  1.00 0.00 ? 29  TYR A N    1  
ATOM   425   C CA   . TYR A 1 29 ? 11.619  3.974   -3.584  1.00 0.00 ? 29  TYR A CA   1  
ATOM   426   C C    . TYR A 1 29 ? 11.185  4.183   -2.127  1.00 0.00 ? 29  TYR A C    1  
ATOM   427   O O    . TYR A 1 29 ? 11.365  3.318   -1.299  1.00 0.00 ? 29  TYR A O    1  
ATOM   428   C CB   . TYR A 1 29 ? 10.591  3.123   -4.351  1.00 0.00 ? 29  TYR A CB   1  
ATOM   429   C CG   . TYR A 1 29 ? 9.182   3.545   -4.005  1.00 0.00 ? 29  TYR A CG   1  
ATOM   430   C CD1  . TYR A 1 29 ? 8.670   4.752   -4.511  1.00 0.00 ? 29  TYR A CD1  1  
ATOM   431   C CD2  . TYR A 1 29 ? 8.387   2.731   -3.177  1.00 0.00 ? 29  TYR A CD2  1  
ATOM   432   C CE1  . TYR A 1 29 ? 7.358   5.148   -4.186  1.00 0.00 ? 29  TYR A CE1  1  
ATOM   433   C CE2  . TYR A 1 29 ? 7.076   3.124   -2.853  1.00 0.00 ? 29  TYR A CE2  1  
ATOM   434   C CZ   . TYR A 1 29 ? 6.560   4.334   -3.357  1.00 0.00 ? 29  TYR A CZ   1  
ATOM   435   O OH   . TYR A 1 29 ? 5.275   4.722   -3.039  1.00 0.00 ? 29  TYR A OH   1  
ATOM   436   H H    . TYR A 1 29 ? 13.190  2.754   -2.784  1.00 0.00 ? 29  TYR A H    1  
ATOM   437   H HA   . TYR A 1 29 ? 11.740  4.931   -4.070  1.00 0.00 ? 29  TYR A HA   1  
ATOM   438   H HB2  . TYR A 1 29 ? 10.749  3.249   -5.412  1.00 0.00 ? 29  TYR A HB2  1  
ATOM   439   H HB3  . TYR A 1 29 ? 10.728  2.083   -4.093  1.00 0.00 ? 29  TYR A HB3  1  
ATOM   440   H HD1  . TYR A 1 29 ? 9.283   5.373   -5.148  1.00 0.00 ? 29  TYR A HD1  1  
ATOM   441   H HD2  . TYR A 1 29 ? 8.785   1.801   -2.793  1.00 0.00 ? 29  TYR A HD2  1  
ATOM   442   H HE1  . TYR A 1 29 ? 6.962   6.075   -4.574  1.00 0.00 ? 29  TYR A HE1  1  
ATOM   443   H HE2  . TYR A 1 29 ? 6.466   2.500   -2.216  1.00 0.00 ? 29  TYR A HE2  1  
ATOM   444   H HH   . TYR A 1 29 ? 5.254   5.681   -3.007  1.00 0.00 ? 29  TYR A HH   1  
ATOM   445   N N    . GLU A 1 30 ? 10.624  5.319   -1.802  1.00 0.00 ? 30  GLU A N    1  
ATOM   446   C CA   . GLU A 1 30 ? 10.189  5.567   -0.388  1.00 0.00 ? 30  GLU A CA   1  
ATOM   447   C C    . GLU A 1 30 ? 8.685   5.298   -0.256  1.00 0.00 ? 30  GLU A C    1  
ATOM   448   O O    . GLU A 1 30 ? 7.947   5.343   -1.220  1.00 0.00 ? 30  GLU A O    1  
ATOM   449   C CB   . GLU A 1 30 ? 10.485  7.020   -0.013  1.00 0.00 ? 30  GLU A CB   1  
ATOM   450   C CG   . GLU A 1 30 ? 11.984  7.191   0.240   1.00 0.00 ? 30  GLU A CG   1  
ATOM   451   C CD   . GLU A 1 30 ? 12.308  8.677   0.405   1.00 0.00 ? 30  GLU A CD   1  
ATOM   452   O OE1  . GLU A 1 30 ? 11.471  9.488   0.046   1.00 0.00 ? 30  GLU A OE1  1  
ATOM   453   O OE2  . GLU A 1 30 ? 13.387  8.978   0.887   1.00 0.00 ? 30  GLU A OE2  1  
ATOM   454   H H    . GLU A 1 30 ? 10.489  6.011   -2.483  1.00 0.00 ? 30  GLU A H    1  
ATOM   455   H HA   . GLU A 1 30 ? 10.729  4.910   0.284   1.00 0.00 ? 30  GLU A HA   1  
ATOM   456   H HB2  . GLU A 1 30 ? 10.182  7.664   -0.820  1.00 0.00 ? 30  GLU A HB2  1  
ATOM   457   H HB3  . GLU A 1 30 ? 9.939   7.281   0.881   1.00 0.00 ? 30  GLU A HB3  1  
ATOM   458   H HG2  . GLU A 1 30 ? 12.260  6.659   1.139   1.00 0.00 ? 30  GLU A HG2  1  
ATOM   459   H HG3  . GLU A 1 30 ? 12.539  6.795   -0.597  1.00 0.00 ? 30  GLU A HG3  1  
ATOM   460   N N    . THR A 1 31 ? 8.233   5.008   0.935   1.00 0.00 ? 31  THR A N    1  
ATOM   461   C CA   . THR A 1 31 ? 6.781   4.720   1.148   1.00 0.00 ? 31  THR A CA   1  
ATOM   462   C C    . THR A 1 31 ? 5.963   6.012   1.092   1.00 0.00 ? 31  THR A C    1  
ATOM   463   O O    . THR A 1 31 ? 6.425   7.040   0.637   1.00 0.00 ? 31  THR A O    1  
ATOM   464   C CB   . THR A 1 31 ? 6.598   4.075   2.522   1.00 0.00 ? 31  THR A CB   1  
ATOM   465   O OG1  . THR A 1 31 ? 7.291   4.846   3.485   1.00 0.00 ? 31  THR A OG1  1  
ATOM   466   C CG2  . THR A 1 31 ? 7.155   2.651   2.488   1.00 0.00 ? 31  THR A CG2  1  
ATOM   467   H H    . THR A 1 31 ? 8.855   4.969   1.694   1.00 0.00 ? 31  THR A H    1  
ATOM   468   H HA   . THR A 1 31 ? 6.432   4.042   0.384   1.00 0.00 ? 31  THR A HA   1  
ATOM   469   H HB   . THR A 1 31 ? 5.552   4.043   2.783   1.00 0.00 ? 31  THR A HB   1  
ATOM   470   H HG1  . THR A 1 31 ? 8.201   4.939   3.193   1.00 0.00 ? 31  THR A HG1  1  
ATOM   471   H HG21 . THR A 1 31 ? 6.699   2.106   1.674   1.00 0.00 ? 31  THR A HG21 1  
ATOM   472   H HG22 . THR A 1 31 ? 8.225   2.686   2.342   1.00 0.00 ? 31  THR A HG22 1  
ATOM   473   H HG23 . THR A 1 31 ? 6.935   2.155   3.419   1.00 0.00 ? 31  THR A HG23 1  
ATOM   474   N N    . SER A 1 32 ? 4.744   5.956   1.558   1.00 0.00 ? 32  SER A N    1  
ATOM   475   C CA   . SER A 1 32 ? 3.867   7.160   1.548   1.00 0.00 ? 32  SER A CA   1  
ATOM   476   C C    . SER A 1 32 ? 4.109   7.985   2.811   1.00 0.00 ? 32  SER A C    1  
ATOM   477   O O    . SER A 1 32 ? 5.222   8.119   3.280   1.00 0.00 ? 32  SER A O    1  
ATOM   478   C CB   . SER A 1 32 ? 2.408   6.712   1.518   1.00 0.00 ? 32  SER A CB   1  
ATOM   479   O OG   . SER A 1 32 ? 2.214   5.812   0.434   1.00 0.00 ? 32  SER A OG   1  
ATOM   480   H H    . SER A 1 32 ? 4.401   5.112   1.917   1.00 0.00 ? 32  SER A H    1  
ATOM   481   H HA   . SER A 1 32 ? 4.074   7.761   0.680   1.00 0.00 ? 32  SER A HA   1  
ATOM   482   H HB2  . SER A 1 32 ? 2.167   6.213   2.441   1.00 0.00 ? 32  SER A HB2  1  
ATOM   483   H HB3  . SER A 1 32 ? 1.769   7.577   1.401   1.00 0.00 ? 32  SER A HB3  1  
ATOM   484   H HG   . SER A 1 32 ? 1.729   6.275   -0.252  1.00 0.00 ? 32  SER A HG   1  
ATOM   485   N N    . SER A 1 33 ? 3.064   8.540   3.360   1.00 0.00 ? 33  SER A N    1  
ATOM   486   C CA   . SER A 1 33 ? 3.201   9.368   4.596   1.00 0.00 ? 33  SER A CA   1  
ATOM   487   C C    . SER A 1 33 ? 1.957   9.182   5.460   1.00 0.00 ? 33  SER A C    1  
ATOM   488   O O    . SER A 1 33 ? 2.026   9.158   6.673   1.00 0.00 ? 33  SER A O    1  
ATOM   489   C CB   . SER A 1 33 ? 3.312   10.836  4.201   1.00 0.00 ? 33  SER A CB   1  
ATOM   490   O OG   . SER A 1 33 ? 2.012   11.353  3.946   1.00 0.00 ? 33  SER A OG   1  
ATOM   491   H H    . SER A 1 33 ? 2.183   8.413   2.953   1.00 0.00 ? 33  SER A H    1  
ATOM   492   H HA   . SER A 1 33 ? 4.079   9.070   5.150   1.00 0.00 ? 33  SER A HA   1  
ATOM   493   H HB2  . SER A 1 33 ? 3.770   11.397  4.998   1.00 0.00 ? 33  SER A HB2  1  
ATOM   494   H HB3  . SER A 1 33 ? 3.917   10.915  3.312   1.00 0.00 ? 33  SER A HB3  1  
ATOM   495   H HG   . SER A 1 33 ? 1.474   10.641  3.593   1.00 0.00 ? 33  SER A HG   1  
ATOM   496   N N    . LEU A 1 34 ? 0.820   9.061   4.831   1.00 0.00 ? 34  LEU A N    1  
ATOM   497   C CA   . LEU A 1 34 ? -0.461  8.882   5.579   1.00 0.00 ? 34  LEU A CA   1  
ATOM   498   C C    . LEU A 1 34 ? -0.258  7.936   6.763   1.00 0.00 ? 34  LEU A C    1  
ATOM   499   O O    . LEU A 1 34 ? -0.531  8.273   7.898   1.00 0.00 ? 34  LEU A O    1  
ATOM   500   C CB   . LEU A 1 34 ? -1.517  8.284   4.648   1.00 0.00 ? 34  LEU A CB   1  
ATOM   501   C CG   . LEU A 1 34 ? -1.482  8.984   3.289   1.00 0.00 ? 34  LEU A CG   1  
ATOM   502   C CD1  . LEU A 1 34 ? -2.658  8.497   2.440   1.00 0.00 ? 34  LEU A CD1  1  
ATOM   503   C CD2  . LEU A 1 34 ? -1.583  10.501  3.488   1.00 0.00 ? 34  LEU A CD2  1  
ATOM   504   H H    . LEU A 1 34 ? 0.809   9.097   3.854   1.00 0.00 ? 34  LEU A H    1  
ATOM   505   H HA   . LEU A 1 34 ? -0.803  9.838   5.938   1.00 0.00 ? 34  LEU A HA   1  
ATOM   506   H HB2  . LEU A 1 34 ? -1.322  7.230   4.510   1.00 0.00 ? 34  LEU A HB2  1  
ATOM   507   H HB3  . LEU A 1 34 ? -2.491  8.412   5.088   1.00 0.00 ? 34  LEU A HB3  1  
ATOM   508   H HG   . LEU A 1 34 ? -0.558  8.745   2.786   1.00 0.00 ? 34  LEU A HG   1  
ATOM   509   H HD11 . LEU A 1 34 ? -2.767  7.427   2.553   1.00 0.00 ? 34  LEU A HD11 1  
ATOM   510   H HD12 . LEU A 1 34 ? -3.564  8.985   2.765   1.00 0.00 ? 34  LEU A HD12 1  
ATOM   511   H HD13 . LEU A 1 34 ? -2.474  8.731   1.404   1.00 0.00 ? 34  LEU A HD13 1  
ATOM   512   H HD21 . LEU A 1 34 ? -2.355  10.719  4.211   1.00 0.00 ? 34  LEU A HD21 1  
ATOM   513   H HD22 . LEU A 1 34 ? -0.638  10.881  3.844   1.00 0.00 ? 34  LEU A HD22 1  
ATOM   514   H HD23 . LEU A 1 34 ? -1.828  10.971  2.547   1.00 0.00 ? 34  LEU A HD23 1  
ATOM   515   N N    . CYS A 1 35 ? 0.216   6.753   6.502   1.00 0.00 ? 35  CYS A N    1  
ATOM   516   C CA   . CYS A 1 35 ? 0.432   5.783   7.609   1.00 0.00 ? 35  CYS A CA   1  
ATOM   517   C C    . CYS A 1 35 ? 1.587   6.274   8.487   1.00 0.00 ? 35  CYS A C    1  
ATOM   518   O O    . CYS A 1 35 ? 2.639   6.633   8.006   1.00 0.00 ? 35  CYS A O    1  
ATOM   519   C CB   . CYS A 1 35 ? 0.754   4.402   7.027   1.00 0.00 ? 35  CYS A CB   1  
ATOM   520   S SG   . CYS A 1 35 ? 1.837   4.579   5.587   1.00 0.00 ? 35  CYS A SG   1  
ATOM   521   H H    . CYS A 1 35 ? 0.425   6.503   5.578   1.00 0.00 ? 35  CYS A H    1  
ATOM   522   H HA   . CYS A 1 35 ? -0.467  5.719   8.204   1.00 0.00 ? 35  CYS A HA   1  
ATOM   523   H HB2  . CYS A 1 35 ? 1.249   3.802   7.774   1.00 0.00 ? 35  CYS A HB2  1  
ATOM   524   H HB3  . CYS A 1 35 ? -0.163  3.916   6.728   1.00 0.00 ? 35  CYS A HB3  1  
ATOM   525   N N    . SER A 1 36 ? 1.380   6.318   9.773   1.00 0.00 ? 36  SER A N    1  
ATOM   526   C CA   . SER A 1 36 ? 2.447   6.801   10.697  1.00 0.00 ? 36  SER A CA   1  
ATOM   527   C C    . SER A 1 36 ? 3.654   5.849   10.707  1.00 0.00 ? 36  SER A C    1  
ATOM   528   O O    . SER A 1 36 ? 4.318   5.713   11.715  1.00 0.00 ? 36  SER A O    1  
ATOM   529   C CB   . SER A 1 36 ? 1.877   6.901   12.112  1.00 0.00 ? 36  SER A CB   1  
ATOM   530   O OG   . SER A 1 36 ? 0.788   7.814   12.116  1.00 0.00 ? 36  SER A OG   1  
ATOM   531   H H    . SER A 1 36 ? 0.512   6.042   10.135  1.00 0.00 ? 36  SER A H    1  
ATOM   532   H HA   . SER A 1 36 ? 2.772   7.781   10.380  1.00 0.00 ? 36  SER A HA   1  
ATOM   533   H HB2  . SER A 1 36 ? 1.530   5.933   12.432  1.00 0.00 ? 36  SER A HB2  1  
ATOM   534   H HB3  . SER A 1 36 ? 2.650   7.245   12.787  1.00 0.00 ? 36  SER A HB3  1  
ATOM   535   H HG   . SER A 1 36 ? 0.964   8.489   11.456  1.00 0.00 ? 36  SER A HG   1  
ATOM   536   N N    . GLN A 1 37 ? 3.958   5.184   9.619   1.00 0.00 ? 37  GLN A N    1  
ATOM   537   C CA   . GLN A 1 37 ? 5.132   4.256   9.640   1.00 0.00 ? 37  GLN A CA   1  
ATOM   538   C C    . GLN A 1 37 ? 5.715   4.066   8.230   1.00 0.00 ? 37  GLN A C    1  
ATOM   539   O O    . GLN A 1 37 ? 5.675   2.975   7.704   1.00 0.00 ? 37  GLN A O    1  
ATOM   540   C CB   . GLN A 1 37 ? 4.698   2.894   10.196  1.00 0.00 ? 37  GLN A CB   1  
ATOM   541   C CG   . GLN A 1 37 ? 3.399   2.438   9.520   1.00 0.00 ? 37  GLN A CG   1  
ATOM   542   C CD   . GLN A 1 37 ? 2.941   1.118   10.142  1.00 0.00 ? 37  GLN A CD   1  
ATOM   543   O OE1  . GLN A 1 37 ? 2.288   1.111   11.167  1.00 0.00 ? 37  GLN A OE1  1  
ATOM   544   N NE2  . GLN A 1 37 ? 3.256   -0.007  9.562   1.00 0.00 ? 37  GLN A NE2  1  
ATOM   545   H H    . GLN A 1 37 ? 3.425   5.288   8.804   1.00 0.00 ? 37  GLN A H    1  
ATOM   546   H HA   . GLN A 1 37 ? 5.901   4.664   10.282  1.00 0.00 ? 37  GLN A HA   1  
ATOM   547   H HB2  . GLN A 1 37 ? 5.474   2.167   10.008  1.00 0.00 ? 37  GLN A HB2  1  
ATOM   548   H HB3  . GLN A 1 37 ? 4.535   2.978   11.260  1.00 0.00 ? 37  GLN A HB3  1  
ATOM   549   H HG2  . GLN A 1 37 ? 2.634   3.186   9.662   1.00 0.00 ? 37  GLN A HG2  1  
ATOM   550   H HG3  . GLN A 1 37 ? 3.571   2.293   8.465   1.00 0.00 ? 37  GLN A HG3  1  
ATOM   551   H HE21 . GLN A 1 37 ? 3.783   -0.002  8.735   1.00 0.00 ? 37  GLN A HE21 1  
ATOM   552   H HE22 . GLN A 1 37 ? 2.967   -0.858  9.952   1.00 0.00 ? 37  GLN A HE22 1  
ATOM   553   N N    . PRO A 1 38 ? 6.267   5.119   7.664   1.00 0.00 ? 38  PRO A N    1  
ATOM   554   C CA   . PRO A 1 38 ? 6.885   5.041   6.324   1.00 0.00 ? 38  PRO A CA   1  
ATOM   555   C C    . PRO A 1 38 ? 8.149   4.172   6.408   1.00 0.00 ? 38  PRO A C    1  
ATOM   556   O O    . PRO A 1 38 ? 8.512   3.683   7.459   1.00 0.00 ? 38  PRO A O    1  
ATOM   557   C CB   . PRO A 1 38 ? 7.234   6.505   5.965   1.00 0.00 ? 38  PRO A CB   1  
ATOM   558   C CG   . PRO A 1 38 ? 6.956   7.374   7.227   1.00 0.00 ? 38  PRO A CG   1  
ATOM   559   C CD   . PRO A 1 38 ? 6.316   6.457   8.294   1.00 0.00 ? 38  PRO A CD   1  
ATOM   560   H HA   . PRO A 1 38 ? 6.190   4.628   5.596   1.00 0.00 ? 38  PRO A HA   1  
ATOM   561   H HB2  . PRO A 1 38 ? 8.278   6.586   5.678   1.00 0.00 ? 38  PRO A HB2  1  
ATOM   562   H HB3  . PRO A 1 38 ? 6.610   6.842   5.149   1.00 0.00 ? 38  PRO A HB3  1  
ATOM   563   H HG2  . PRO A 1 38 ? 7.886   7.788   7.600   1.00 0.00 ? 38  PRO A HG2  1  
ATOM   564   H HG3  . PRO A 1 38 ? 6.275   8.179   6.981   1.00 0.00 ? 38  PRO A HG3  1  
ATOM   565   H HD2  . PRO A 1 38 ? 6.929   6.432   9.187   1.00 0.00 ? 38  PRO A HD2  1  
ATOM   566   H HD3  . PRO A 1 38 ? 5.319   6.792   8.532   1.00 0.00 ? 38  PRO A HD3  1  
ATOM   567   N N    . ALA A 1 39 ? 8.817   3.986   5.308   1.00 0.00 ? 39  ALA A N    1  
ATOM   568   C CA   . ALA A 1 39 ? 10.053  3.166   5.302   1.00 0.00 ? 39  ALA A CA   1  
ATOM   569   C C    . ALA A 1 39 ? 10.734  3.338   3.948   1.00 0.00 ? 39  ALA A C    1  
ATOM   570   O O    . ALA A 1 39 ? 10.151  3.867   3.022   1.00 0.00 ? 39  ALA A O    1  
ATOM   571   C CB   . ALA A 1 39 ? 9.695   1.694   5.509   1.00 0.00 ? 39  ALA A CB   1  
ATOM   572   H H    . ALA A 1 39 ? 8.510   4.395   4.481   1.00 0.00 ? 39  ALA A H    1  
ATOM   573   H HA   . ALA A 1 39 ? 10.713  3.496   6.088   1.00 0.00 ? 39  ALA A HA   1  
ATOM   574   H HB1  . ALA A 1 39 ? 9.030   1.601   6.354   1.00 0.00 ? 39  ALA A HB1  1  
ATOM   575   H HB2  . ALA A 1 39 ? 9.206   1.314   4.623   1.00 0.00 ? 39  ALA A HB2  1  
ATOM   576   H HB3  . ALA A 1 39 ? 10.595  1.126   5.694   1.00 0.00 ? 39  ALA A HB3  1  
ATOM   577   N N    . VAL A 1 40 ? 11.947  2.877   3.806   1.00 0.00 ? 40  VAL A N    1  
ATOM   578   C CA   . VAL A 1 40 ? 12.640  2.996   2.488   1.00 0.00 ? 40  VAL A CA   1  
ATOM   579   C C    . VAL A 1 40 ? 12.477  1.664   1.766   1.00 0.00 ? 40  VAL A C    1  
ATOM   580   O O    . VAL A 1 40 ? 12.478  0.614   2.378   1.00 0.00 ? 40  VAL A O    1  
ATOM   581   C CB   . VAL A 1 40 ? 14.129  3.303   2.699   1.00 0.00 ? 40  VAL A CB   1  
ATOM   582   C CG1  . VAL A 1 40 ? 14.907  3.025   1.408   1.00 0.00 ? 40  VAL A CG1  1  
ATOM   583   C CG2  . VAL A 1 40 ? 14.289  4.777   3.066   1.00 0.00 ? 40  VAL A CG2  1  
ATOM   584   H H    . VAL A 1 40 ? 12.396  2.434   4.559   1.00 0.00 ? 40  VAL A H    1  
ATOM   585   H HA   . VAL A 1 40 ? 12.186  3.787   1.894   1.00 0.00 ? 40  VAL A HA   1  
ATOM   586   H HB   . VAL A 1 40 ? 14.517  2.685   3.496   1.00 0.00 ? 40  VAL A HB   1  
ATOM   587   H HG11 . VAL A 1 40 ? 14.358  3.426   0.568   1.00 0.00 ? 40  VAL A HG11 1  
ATOM   588   H HG12 . VAL A 1 40 ? 15.878  3.494   1.460   1.00 0.00 ? 40  VAL A HG12 1  
ATOM   589   H HG13 . VAL A 1 40 ? 15.027  1.960   1.282   1.00 0.00 ? 40  VAL A HG13 1  
ATOM   590   H HG21 . VAL A 1 40 ? 13.646  5.011   3.900   1.00 0.00 ? 40  VAL A HG21 1  
ATOM   591   H HG22 . VAL A 1 40 ? 15.316  4.972   3.334   1.00 0.00 ? 40  VAL A HG22 1  
ATOM   592   H HG23 . VAL A 1 40 ? 14.016  5.388   2.217   1.00 0.00 ? 40  VAL A HG23 1  
ATOM   593   N N    . VAL A 1 41 ? 12.321  1.704   0.471   1.00 0.00 ? 41  VAL A N    1  
ATOM   594   C CA   . VAL A 1 41 ? 12.134  0.446   -0.318  1.00 0.00 ? 41  VAL A CA   1  
ATOM   595   C C    . VAL A 1 41 ? 13.252  0.320   -1.359  1.00 0.00 ? 41  VAL A C    1  
ATOM   596   O O    . VAL A 1 41 ? 13.402  1.157   -2.220  1.00 0.00 ? 41  VAL A O    1  
ATOM   597   C CB   . VAL A 1 41 ? 10.770  0.501   -1.013  1.00 0.00 ? 41  VAL A CB   1  
ATOM   598   C CG1  . VAL A 1 41 ? 10.334  -0.907  -1.411  1.00 0.00 ? 41  VAL A CG1  1  
ATOM   599   C CG2  . VAL A 1 41 ? 9.734   1.090   -0.051  1.00 0.00 ? 41  VAL A CG2  1  
ATOM   600   H H    . VAL A 1 41 ? 12.316  2.571   0.015   1.00 0.00 ? 41  VAL A H    1  
ATOM   601   H HA   . VAL A 1 41 ? 12.163  -0.406  0.339   1.00 0.00 ? 41  VAL A HA   1  
ATOM   602   H HB   . VAL A 1 41 ? 10.837  1.119   -1.897  1.00 0.00 ? 41  VAL A HB   1  
ATOM   603   H HG11 . VAL A 1 41 ? 11.152  -1.413  -1.902  1.00 0.00 ? 41  VAL A HG11 1  
ATOM   604   H HG12 . VAL A 1 41 ? 10.047  -1.458  -0.528  1.00 0.00 ? 41  VAL A HG12 1  
ATOM   605   H HG13 . VAL A 1 41 ? 9.493   -0.840  -2.082  1.00 0.00 ? 41  VAL A HG13 1  
ATOM   606   H HG21 . VAL A 1 41 ? 9.744   0.532   0.873   1.00 0.00 ? 41  VAL A HG21 1  
ATOM   607   H HG22 . VAL A 1 41 ? 9.972   2.123   0.151   1.00 0.00 ? 41  VAL A HG22 1  
ATOM   608   H HG23 . VAL A 1 41 ? 8.753   1.028   -0.498  1.00 0.00 ? 41  VAL A HG23 1  
ATOM   609   N N    . PHE A 1 42 ? 14.045  -0.718  -1.286  1.00 0.00 ? 42  PHE A N    1  
ATOM   610   C CA   . PHE A 1 42 ? 15.158  -0.878  -2.274  1.00 0.00 ? 42  PHE A CA   1  
ATOM   611   C C    . PHE A 1 42 ? 14.674  -1.670  -3.493  1.00 0.00 ? 42  PHE A C    1  
ATOM   612   O O    . PHE A 1 42 ? 14.017  -2.683  -3.367  1.00 0.00 ? 42  PHE A O    1  
ATOM   613   C CB   . PHE A 1 42 ? 16.320  -1.640  -1.621  1.00 0.00 ? 42  PHE A CB   1  
ATOM   614   C CG   . PHE A 1 42 ? 17.086  -0.726  -0.689  1.00 0.00 ? 42  PHE A CG   1  
ATOM   615   C CD1  . PHE A 1 42 ? 17.773  0.392   -1.203  1.00 0.00 ? 42  PHE A CD1  1  
ATOM   616   C CD2  . PHE A 1 42 ? 17.125  -0.999  0.693   1.00 0.00 ? 42  PHE A CD2  1  
ATOM   617   C CE1  . PHE A 1 42 ? 18.494  1.236   -0.337  1.00 0.00 ? 42  PHE A CE1  1  
ATOM   618   C CE2  . PHE A 1 42 ? 17.848  -0.157  1.558   1.00 0.00 ? 42  PHE A CE2  1  
ATOM   619   C CZ   . PHE A 1 42 ? 18.532  0.961   1.043   1.00 0.00 ? 42  PHE A CZ   1  
ATOM   620   H H    . PHE A 1 42 ? 13.916  -1.386  -0.581  1.00 0.00 ? 42  PHE A H    1  
ATOM   621   H HA   . PHE A 1 42 ? 15.503  0.094   -2.594  1.00 0.00 ? 42  PHE A HA   1  
ATOM   622   H HB2  . PHE A 1 42 ? 15.928  -2.478  -1.065  1.00 0.00 ? 42  PHE A HB2  1  
ATOM   623   H HB3  . PHE A 1 42 ? 16.989  -2.003  -2.389  1.00 0.00 ? 42  PHE A HB3  1  
ATOM   624   H HD1  . PHE A 1 42 ? 17.746  0.604   -2.262  1.00 0.00 ? 42  PHE A HD1  1  
ATOM   625   H HD2  . PHE A 1 42 ? 16.600  -1.855  1.090   1.00 0.00 ? 42  PHE A HD2  1  
ATOM   626   H HE1  . PHE A 1 42 ? 19.019  2.093   -0.731  1.00 0.00 ? 42  PHE A HE1  1  
ATOM   627   H HE2  . PHE A 1 42 ? 17.878  -0.369  2.616   1.00 0.00 ? 42  PHE A HE2  1  
ATOM   628   H HZ   . PHE A 1 42 ? 19.088  1.607   1.707   1.00 0.00 ? 42  PHE A HZ   1  
ATOM   629   N N    . GLN A 1 43 ? 15.025  -1.224  -4.673  1.00 0.00 ? 43  GLN A N    1  
ATOM   630   C CA   . GLN A 1 43 ? 14.623  -1.950  -5.916  1.00 0.00 ? 43  GLN A CA   1  
ATOM   631   C C    . GLN A 1 43 ? 15.797  -2.837  -6.338  1.00 0.00 ? 43  GLN A C    1  
ATOM   632   O O    . GLN A 1 43 ? 16.902  -2.356  -6.518  1.00 0.00 ? 43  GLN A O    1  
ATOM   633   C CB   . GLN A 1 43 ? 14.304  -0.927  -7.008  1.00 0.00 ? 43  GLN A CB   1  
ATOM   634   C CG   . GLN A 1 43 ? 13.052  -0.138  -6.616  1.00 0.00 ? 43  GLN A CG   1  
ATOM   635   C CD   . GLN A 1 43 ? 12.933  1.104   -7.501  1.00 0.00 ? 43  GLN A CD   1  
ATOM   636   O OE1  . GLN A 1 43 ? 12.493  2.144   -7.052  1.00 0.00 ? 43  GLN A OE1  1  
ATOM   637   N NE2  . GLN A 1 43 ? 13.308  1.040   -8.749  1.00 0.00 ? 43  GLN A NE2  1  
ATOM   638   H H    . GLN A 1 43 ? 15.574  -0.416  -4.741  1.00 0.00 ? 43  GLN A H    1  
ATOM   639   H HA   . GLN A 1 43 ? 13.758  -2.561  -5.723  1.00 0.00 ? 43  GLN A HA   1  
ATOM   640   H HB2  . GLN A 1 43 ? 15.137  -0.250  -7.119  1.00 0.00 ? 43  GLN A HB2  1  
ATOM   641   H HB3  . GLN A 1 43 ? 14.125  -1.433  -7.940  1.00 0.00 ? 43  GLN A HB3  1  
ATOM   642   H HG2  . GLN A 1 43 ? 12.179  -0.761  -6.749  1.00 0.00 ? 43  GLN A HG2  1  
ATOM   643   H HG3  . GLN A 1 43 ? 13.125  0.164   -5.583  1.00 0.00 ? 43  GLN A HG3  1  
ATOM   644   H HE21 . GLN A 1 43 ? 13.663  0.200   -9.111  1.00 0.00 ? 43  GLN A HE21 1  
ATOM   645   H HE22 . GLN A 1 43 ? 13.236  1.830   -9.324  1.00 0.00 ? 43  GLN A HE22 1  
ATOM   646   N N    . THR A 1 44 ? 15.590  -4.136  -6.453  1.00 0.00 ? 44  THR A N    1  
ATOM   647   C CA   . THR A 1 44 ? 16.736  -5.047  -6.807  1.00 0.00 ? 44  THR A CA   1  
ATOM   648   C C    . THR A 1 44 ? 16.752  -5.413  -8.292  1.00 0.00 ? 44  THR A C    1  
ATOM   649   O O    . THR A 1 44 ? 16.294  -4.675  -9.142  1.00 0.00 ? 44  THR A O    1  
ATOM   650   C CB   . THR A 1 44 ? 16.627  -6.336  -5.995  1.00 0.00 ? 44  THR A CB   1  
ATOM   651   O OG1  . THR A 1 44 ? 15.694  -7.204  -6.619  1.00 0.00 ? 44  THR A OG1  1  
ATOM   652   C CG2  . THR A 1 44 ? 16.153  -6.009  -4.580  1.00 0.00 ? 44  THR A CG2  1  
ATOM   653   H H    . THR A 1 44 ? 14.691  -4.514  -6.275  1.00 0.00 ? 44  THR A H    1  
ATOM   654   H HA   . THR A 1 44 ? 17.671  -4.563  -6.558  1.00 0.00 ? 44  THR A HA   1  
ATOM   655   H HB   . THR A 1 44 ? 17.593  -6.815  -5.947  1.00 0.00 ? 44  THR A HB   1  
ATOM   656   H HG1  . THR A 1 44 ? 15.996  -7.370  -7.515  1.00 0.00 ? 44  THR A HG1  1  
ATOM   657   H HG21 . THR A 1 44 ? 16.748  -5.203  -4.178  1.00 0.00 ? 44  THR A HG21 1  
ATOM   658   H HG22 . THR A 1 44 ? 15.116  -5.711  -4.612  1.00 0.00 ? 44  THR A HG22 1  
ATOM   659   H HG23 . THR A 1 44 ? 16.259  -6.882  -3.954  1.00 0.00 ? 44  THR A HG23 1  
ATOM   660   N N    . LYS A 1 45 ? 17.312  -6.565  -8.594  1.00 0.00 ? 45  LYS A N    1  
ATOM   661   C CA   . LYS A 1 45 ? 17.420  -7.037  -10.010 1.00 0.00 ? 45  LYS A CA   1  
ATOM   662   C C    . LYS A 1 45 ? 16.590  -8.311  -10.213 1.00 0.00 ? 45  LYS A C    1  
ATOM   663   O O    . LYS A 1 45 ? 16.062  -8.547  -11.282 1.00 0.00 ? 45  LYS A O    1  
ATOM   664   C CB   . LYS A 1 45 ? 18.885  -7.361  -10.305 1.00 0.00 ? 45  LYS A CB   1  
ATOM   665   C CG   . LYS A 1 45 ? 19.764  -6.178  -9.902  1.00 0.00 ? 45  LYS A CG   1  
ATOM   666   C CD   . LYS A 1 45 ? 21.232  -6.505  -10.202 1.00 0.00 ? 45  LYS A CD   1  
ATOM   667   C CE   . LYS A 1 45 ? 22.043  -5.212  -10.273 1.00 0.00 ? 45  LYS A CE   1  
ATOM   668   N NZ   . LYS A 1 45 ? 22.013  -4.532  -8.947  1.00 0.00 ? 45  LYS A NZ   1  
ATOM   669   H H    . LYS A 1 45 ? 17.683  -7.119  -7.876  1.00 0.00 ? 45  LYS A H    1  
ATOM   670   H HA   . LYS A 1 45 ? 17.083  -6.267  -10.688 1.00 0.00 ? 45  LYS A HA   1  
ATOM   671   H HB2  . LYS A 1 45 ? 19.179  -8.236  -9.744  1.00 0.00 ? 45  LYS A HB2  1  
ATOM   672   H HB3  . LYS A 1 45 ? 19.007  -7.552  -11.358 1.00 0.00 ? 45  LYS A HB3  1  
ATOM   673   H HG2  . LYS A 1 45 ? 19.463  -5.302  -10.460 1.00 0.00 ? 45  LYS A HG2  1  
ATOM   674   H HG3  . LYS A 1 45 ? 19.649  -5.989  -8.845  1.00 0.00 ? 45  LYS A HG3  1  
ATOM   675   H HD2  . LYS A 1 45 ? 21.627  -7.135  -9.418  1.00 0.00 ? 45  LYS A HD2  1  
ATOM   676   H HD3  . LYS A 1 45 ? 21.304  -7.022  -11.149 1.00 0.00 ? 45  LYS A HD3  1  
ATOM   677   H HE2  . LYS A 1 45 ? 23.063  -5.444  -10.536 1.00 0.00 ? 45  LYS A HE2  1  
ATOM   678   H HE3  . LYS A 1 45 ? 21.616  -4.562  -11.022 1.00 0.00 ? 45  LYS A HE3  1  
ATOM   679   H HZ1  . LYS A 1 45 ? 21.186  -4.858  -8.408  1.00 0.00 ? 45  LYS A HZ1  1  
ATOM   680   H HZ2  . LYS A 1 45 ? 22.879  -4.761  -8.420  1.00 0.00 ? 45  LYS A HZ2  1  
ATOM   681   H HZ3  . LYS A 1 45 ? 21.954  -3.502  -9.088  1.00 0.00 ? 45  LYS A HZ3  1  
ATOM   682   N N    . ARG A 1 46 ? 16.477  -9.135  -9.195  1.00 0.00 ? 46  ARG A N    1  
ATOM   683   C CA   . ARG A 1 46 ? 15.688  -10.410 -9.312  1.00 0.00 ? 46  ARG A CA   1  
ATOM   684   C C    . ARG A 1 46 ? 14.560  -10.365 -8.288  1.00 0.00 ? 46  ARG A C    1  
ATOM   685   O O    . ARG A 1 46 ? 14.335  -11.285 -7.531  1.00 0.00 ? 46  ARG A O    1  
ATOM   686   C CB   . ARG A 1 46 ? 16.621  -11.612 -9.050  1.00 0.00 ? 46  ARG A CB   1  
ATOM   687   C CG   . ARG A 1 46 ? 15.872  -12.971 -9.070  1.00 0.00 ? 46  ARG A CG   1  
ATOM   688   C CD   . ARG A 1 46 ? 14.743  -12.992 -10.111 1.00 0.00 ? 46  ARG A CD   1  
ATOM   689   N NE   . ARG A 1 46 ? 14.234  -14.386 -10.254 1.00 0.00 ? 46  ARG A NE   1  
ATOM   690   C CZ   . ARG A 1 46 ? 13.093  -14.606 -10.847 1.00 0.00 ? 46  ARG A CZ   1  
ATOM   691   N NH1  . ARG A 1 46 ? 12.398  -13.608 -11.319 1.00 0.00 ? 46  ARG A NH1  1  
ATOM   692   N NH2  . ARG A 1 46 ? 12.647  -15.827 -10.970 1.00 0.00 ? 46  ARG A NH2  1  
ATOM   693   H H    . ARG A 1 46 ? 16.913  -8.915  -8.347  1.00 0.00 ? 46  ARG A H    1  
ATOM   694   H HA   . ARG A 1 46 ? 15.264  -10.486 -10.303 1.00 0.00 ? 46  ARG A HA   1  
ATOM   695   H HB2  . ARG A 1 46 ? 17.391  -11.626 -9.807  1.00 0.00 ? 46  ARG A HB2  1  
ATOM   696   H HB3  . ARG A 1 46 ? 17.085  -11.486 -8.084  1.00 0.00 ? 46  ARG A HB3  1  
ATOM   697   H HG2  . ARG A 1 46 ? 16.577  -13.752 -9.313  1.00 0.00 ? 46  ARG A HG2  1  
ATOM   698   H HG3  . ARG A 1 46 ? 15.462  -13.172 -8.093  1.00 0.00 ? 46  ARG A HG3  1  
ATOM   699   H HD2  . ARG A 1 46 ? 13.936  -12.352 -9.790  1.00 0.00 ? 46  ARG A HD2  1  
ATOM   700   H HD3  . ARG A 1 46 ? 15.120  -12.652 -11.062 1.00 0.00 ? 46  ARG A HD3  1  
ATOM   701   H HE   . ARG A 1 46 ? 14.757  -15.136 -9.902  1.00 0.00 ? 46  ARG A HE   1  
ATOM   702   H HH11 . ARG A 1 46 ? 12.740  -12.673 -11.226 1.00 0.00 ? 46  ARG A HH11 1  
ATOM   703   H HH12 . ARG A 1 46 ? 11.523  -13.778 -11.773 1.00 0.00 ? 46  ARG A HH12 1  
ATOM   704   H HH21 . ARG A 1 46 ? 13.180  -16.592 -10.609 1.00 0.00 ? 46  ARG A HH21 1  
ATOM   705   H HH22 . ARG A 1 46 ? 11.773  -15.997 -11.424 1.00 0.00 ? 46  ARG A HH22 1  
ATOM   706   N N    . SER A 1 47 ? 13.842  -9.289  -8.271  1.00 0.00 ? 47  SER A N    1  
ATOM   707   C CA   . SER A 1 47 ? 12.721  -9.151  -7.325  1.00 0.00 ? 47  SER A CA   1  
ATOM   708   C C    . SER A 1 47 ? 11.875  -7.972  -7.781  1.00 0.00 ? 47  SER A C    1  
ATOM   709   O O    . SER A 1 47 ? 11.383  -7.940  -8.891  1.00 0.00 ? 47  SER A O    1  
ATOM   710   C CB   . SER A 1 47 ? 13.261  -8.919  -5.911  1.00 0.00 ? 47  SER A CB   1  
ATOM   711   O OG   . SER A 1 47 ? 14.326  -9.828  -5.663  1.00 0.00 ? 47  SER A OG   1  
ATOM   712   H H    . SER A 1 47 ? 14.041  -8.558  -8.890  1.00 0.00 ? 47  SER A H    1  
ATOM   713   H HA   . SER A 1 47 ? 12.125  -10.042 -7.336  1.00 0.00 ? 47  SER A HA   1  
ATOM   714   H HB2  . SER A 1 47 ? 13.626  -7.914  -5.816  1.00 0.00 ? 47  SER A HB2  1  
ATOM   715   H HB3  . SER A 1 47 ? 12.466  -9.081  -5.197  1.00 0.00 ? 47  SER A HB3  1  
ATOM   716   H HG   . SER A 1 47 ? 14.790  -9.533  -4.876  1.00 0.00 ? 47  SER A HG   1  
ATOM   717   N N    . LYS A 1 48 ? 11.721  -7.000  -6.953  1.00 0.00 ? 48  LYS A N    1  
ATOM   718   C CA   . LYS A 1 48 ? 10.933  -5.812  -7.338  1.00 0.00 ? 48  LYS A CA   1  
ATOM   719   C C    . LYS A 1 48 ? 11.290  -4.688  -6.376  1.00 0.00 ? 48  LYS A C    1  
ATOM   720   O O    . LYS A 1 48 ? 12.089  -3.824  -6.681  1.00 0.00 ? 48  LYS A O    1  
ATOM   721   C CB   . LYS A 1 48 ? 9.436   -6.141  -7.268  1.00 0.00 ? 48  LYS A CB   1  
ATOM   722   C CG   . LYS A 1 48 ? 8.652   -5.109  -8.078  1.00 0.00 ? 48  LYS A CG   1  
ATOM   723   C CD   . LYS A 1 48 ? 7.163   -5.212  -7.739  1.00 0.00 ? 48  LYS A CD   1  
ATOM   724   C CE   . LYS A 1 48 ? 6.350   -4.442  -8.779  1.00 0.00 ? 48  LYS A CE   1  
ATOM   725   N NZ   . LYS A 1 48 ? 6.933   -3.082  -8.959  1.00 0.00 ? 48  LYS A NZ   1  
ATOM   726   H H    . LYS A 1 48 ? 12.145  -7.037  -6.080  1.00 0.00 ? 48  LYS A H    1  
ATOM   727   H HA   . LYS A 1 48 ? 11.196  -5.519  -8.345  1.00 0.00 ? 48  LYS A HA   1  
ATOM   728   H HB2  . LYS A 1 48 ? 9.266   -7.124  -7.682  1.00 0.00 ? 48  LYS A HB2  1  
ATOM   729   H HB3  . LYS A 1 48 ? 9.101   -6.122  -6.244  1.00 0.00 ? 48  LYS A HB3  1  
ATOM   730   H HG2  . LYS A 1 48 ? 9.013   -4.120  -7.840  1.00 0.00 ? 48  LYS A HG2  1  
ATOM   731   H HG3  . LYS A 1 48 ? 8.794   -5.301  -9.130  1.00 0.00 ? 48  LYS A HG3  1  
ATOM   732   H HD2  . LYS A 1 48 ? 6.864   -6.250  -7.742  1.00 0.00 ? 48  LYS A HD2  1  
ATOM   733   H HD3  . LYS A 1 48 ? 6.987   -4.789  -6.761  1.00 0.00 ? 48  LYS A HD3  1  
ATOM   734   H HE2  . LYS A 1 48 ? 6.374   -4.971  -9.720  1.00 0.00 ? 48  LYS A HE2  1  
ATOM   735   H HE3  . LYS A 1 48 ? 5.327   -4.354  -8.442  1.00 0.00 ? 48  LYS A HE3  1  
ATOM   736   H HZ1  . LYS A 1 48 ? 7.594   -2.883  -8.180  1.00 0.00 ? 48  LYS A HZ1  1  
ATOM   737   H HZ2  . LYS A 1 48 ? 7.440   -3.038  -9.865  1.00 0.00 ? 48  LYS A HZ2  1  
ATOM   738   H HZ3  . LYS A 1 48 ? 6.171   -2.375  -8.957  1.00 0.00 ? 48  LYS A HZ3  1  
ATOM   739   N N    . GLN A 1 49 ? 10.725  -4.719  -5.200  1.00 0.00 ? 49  GLN A N    1  
ATOM   740   C CA   . GLN A 1 49 ? 11.024  -3.680  -4.176  1.00 0.00 ? 49  GLN A CA   1  
ATOM   741   C C    . GLN A 1 49 ? 11.094  -4.376  -2.809  1.00 0.00 ? 49  GLN A C    1  
ATOM   742   O O    . GLN A 1 49 ? 10.357  -5.310  -2.545  1.00 0.00 ? 49  GLN A O    1  
ATOM   743   C CB   . GLN A 1 49 ? 9.915   -2.599  -4.185  1.00 0.00 ? 49  GLN A CB   1  
ATOM   744   C CG   . GLN A 1 49 ? 9.143   -2.645  -5.507  1.00 0.00 ? 49  GLN A CG   1  
ATOM   745   C CD   . GLN A 1 49 ? 8.117   -1.511  -5.537  1.00 0.00 ? 49  GLN A CD   1  
ATOM   746   O OE1  . GLN A 1 49 ? 8.146   -0.628  -4.703  1.00 0.00 ? 49  GLN A OE1  1  
ATOM   747   N NE2  . GLN A 1 49 ? 7.205   -1.497  -6.470  1.00 0.00 ? 49  GLN A NE2  1  
ATOM   748   H H    . GLN A 1 49 ? 10.108  -5.445  -4.981  1.00 0.00 ? 49  GLN A H    1  
ATOM   749   H HA   . GLN A 1 49 ? 11.980  -3.224  -4.389  1.00 0.00 ? 49  GLN A HA   1  
ATOM   750   H HB2  . GLN A 1 49 ? 9.224   -2.768  -3.369  1.00 0.00 ? 49  GLN A HB2  1  
ATOM   751   H HB3  . GLN A 1 49 ? 10.363  -1.623  -4.077  1.00 0.00 ? 49  GLN A HB3  1  
ATOM   752   H HG2  . GLN A 1 49 ? 9.833   -2.528  -6.330  1.00 0.00 ? 49  GLN A HG2  1  
ATOM   753   H HG3  . GLN A 1 49 ? 8.633   -3.591  -5.593  1.00 0.00 ? 49  GLN A HG3  1  
ATOM   754   H HE21 . GLN A 1 49 ? 7.182   -2.209  -7.143  1.00 0.00 ? 49  GLN A HE21 1  
ATOM   755   H HE22 . GLN A 1 49 ? 6.544   -0.774  -6.498  1.00 0.00 ? 49  GLN A HE22 1  
ATOM   756   N N    . VAL A 1 50 ? 11.982  -3.944  -1.944  1.00 0.00 ? 50  VAL A N    1  
ATOM   757   C CA   . VAL A 1 50 ? 12.103  -4.592  -0.597  1.00 0.00 ? 50  VAL A CA   1  
ATOM   758   C C    . VAL A 1 50 ? 12.074  -3.506  0.471   1.00 0.00 ? 50  VAL A C    1  
ATOM   759   O O    . VAL A 1 50 ? 12.823  -2.557  0.415   1.00 0.00 ? 50  VAL A O    1  
ATOM   760   C CB   . VAL A 1 50 ? 13.436  -5.362  -0.509  1.00 0.00 ? 50  VAL A CB   1  
ATOM   761   C CG1  . VAL A 1 50 ? 13.327  -6.449  0.567   1.00 0.00 ? 50  VAL A CG1  1  
ATOM   762   C CG2  . VAL A 1 50 ? 13.768  -5.992  -1.873  1.00 0.00 ? 50  VAL A CG2  1  
ATOM   763   H H    . VAL A 1 50 ? 12.573  -3.199  -2.182  1.00 0.00 ? 50  VAL A H    1  
ATOM   764   H HA   . VAL A 1 50 ? 11.275  -5.270  -0.433  1.00 0.00 ? 50  VAL A HA   1  
ATOM   765   H HB   . VAL A 1 50 ? 14.230  -4.679  -0.231  1.00 0.00 ? 50  VAL A HB   1  
ATOM   766   H HG11 . VAL A 1 50 ? 12.498  -7.101  0.338   1.00 0.00 ? 50  VAL A HG11 1  
ATOM   767   H HG12 . VAL A 1 50 ? 14.240  -7.026  0.593   1.00 0.00 ? 50  VAL A HG12 1  
ATOM   768   H HG13 . VAL A 1 50 ? 13.163  -5.986  1.527   1.00 0.00 ? 50  VAL A HG13 1  
ATOM   769   H HG21 . VAL A 1 50 ? 12.859  -6.229  -2.393  1.00 0.00 ? 50  VAL A HG21 1  
ATOM   770   H HG22 . VAL A 1 50 ? 14.336  -5.289  -2.461  1.00 0.00 ? 50  VAL A HG22 1  
ATOM   771   H HG23 . VAL A 1 50 ? 14.349  -6.893  -1.735  1.00 0.00 ? 50  VAL A HG23 1  
ATOM   772   N N    . CYS A 1 51 ? 11.222  -3.643  1.442   1.00 0.00 ? 51  CYS A N    1  
ATOM   773   C CA   . CYS A 1 51 ? 11.142  -2.611  2.509   1.00 0.00 ? 51  CYS A CA   1  
ATOM   774   C C    . CYS A 1 51 ? 12.375  -2.714  3.405   1.00 0.00 ? 51  CYS A C    1  
ATOM   775   O O    . CYS A 1 51 ? 12.950  -3.772  3.568   1.00 0.00 ? 51  CYS A O    1  
ATOM   776   C CB   . CYS A 1 51 ? 9.881   -2.845  3.341   1.00 0.00 ? 51  CYS A CB   1  
ATOM   777   S SG   . CYS A 1 51 ? 8.417   -2.568  2.311   1.00 0.00 ? 51  CYS A SG   1  
ATOM   778   H H    . CYS A 1 51 ? 10.632  -4.423  1.468   1.00 0.00 ? 51  CYS A H    1  
ATOM   779   H HA   . CYS A 1 51 ? 11.102  -1.628  2.062   1.00 0.00 ? 51  CYS A HA   1  
ATOM   780   H HB2  . CYS A 1 51 ? 9.875   -3.860  3.708   1.00 0.00 ? 51  CYS A HB2  1  
ATOM   781   H HB3  . CYS A 1 51 ? 9.869   -2.162  4.173   1.00 0.00 ? 51  CYS A HB3  1  
ATOM   782   N N    . ALA A 1 52 ? 12.796  -1.616  3.976   1.00 0.00 ? 52  ALA A N    1  
ATOM   783   C CA   . ALA A 1 52 ? 14.006  -1.637  4.852   1.00 0.00 ? 52  ALA A CA   1  
ATOM   784   C C    . ALA A 1 52 ? 13.811  -0.671  6.023   1.00 0.00 ? 52  ALA A C    1  
ATOM   785   O O    . ALA A 1 52 ? 13.354  0.445   5.854   1.00 0.00 ? 52  ALA A O    1  
ATOM   786   C CB   . ALA A 1 52 ? 15.223  -1.194  4.037   1.00 0.00 ? 52  ALA A CB   1  
ATOM   787   H H    . ALA A 1 52 ? 12.321  -0.772  3.819   1.00 0.00 ? 52  ALA A H    1  
ATOM   788   H HA   . ALA A 1 52 ? 14.171  -2.638  5.232   1.00 0.00 ? 52  ALA A HA   1  
ATOM   789   H HB1  . ALA A 1 52 ? 15.307  -1.808  3.153   1.00 0.00 ? 52  ALA A HB1  1  
ATOM   790   H HB2  . ALA A 1 52 ? 15.103  -0.160  3.746   1.00 0.00 ? 52  ALA A HB2  1  
ATOM   791   H HB3  . ALA A 1 52 ? 16.115  -1.298  4.636   1.00 0.00 ? 52  ALA A HB3  1  
ATOM   792   N N    . ASP A 1 53 ? 14.157  -1.093  7.209   1.00 0.00 ? 53  ASP A N    1  
ATOM   793   C CA   . ASP A 1 53 ? 13.999  -0.206  8.398   1.00 0.00 ? 53  ASP A CA   1  
ATOM   794   C C    . ASP A 1 53 ? 15.005  0.969   8.300   1.00 0.00 ? 53  ASP A C    1  
ATOM   795   O O    . ASP A 1 53 ? 16.195  0.724   8.311   1.00 0.00 ? 53  ASP A O    1  
ATOM   796   C CB   . ASP A 1 53 ? 14.308  -1.016  9.660   1.00 0.00 ? 53  ASP A CB   1  
ATOM   797   C CG   . ASP A 1 53 ? 13.882  -0.219  10.894  1.00 0.00 ? 53  ASP A CG   1  
ATOM   798   O OD1  . ASP A 1 53 ? 13.887  0.999   10.820  1.00 0.00 ? 53  ASP A OD1  1  
ATOM   799   O OD2  . ASP A 1 53 ? 13.559  -0.839  11.893  1.00 0.00 ? 53  ASP A OD2  1  
ATOM   800   H H    . ASP A 1 53 ? 14.523  -1.997  7.317   1.00 0.00 ? 53  ASP A H    1  
ATOM   801   H HA   . ASP A 1 53 ? 12.985  0.141   8.444   1.00 0.00 ? 53  ASP A HA   1  
ATOM   802   H HB2  . ASP A 1 53 ? 13.767  -1.951  9.629   1.00 0.00 ? 53  ASP A HB2  1  
ATOM   803   H HB3  . ASP A 1 53 ? 15.368  -1.214  9.710   1.00 0.00 ? 53  ASP A HB3  1  
ATOM   804   N N    . PRO A 1 54 ? 14.540  2.212   8.206   1.00 0.00 ? 54  PRO A N    1  
ATOM   805   C CA   . PRO A 1 54 ? 15.470  3.359   8.111   1.00 0.00 ? 54  PRO A CA   1  
ATOM   806   C C    . PRO A 1 54 ? 16.336  3.447   9.376   1.00 0.00 ? 54  PRO A C    1  
ATOM   807   O O    . PRO A 1 54 ? 17.251  4.243   9.459   1.00 0.00 ? 54  PRO A O    1  
ATOM   808   C CB   . PRO A 1 54 ? 14.564  4.605   7.978   1.00 0.00 ? 54  PRO A CB   1  
ATOM   809   C CG   . PRO A 1 54 ? 13.087  4.122   8.035   1.00 0.00 ? 54  PRO A CG   1  
ATOM   810   C CD   . PRO A 1 54 ? 13.104  2.583   8.183   1.00 0.00 ? 54  PRO A CD   1  
ATOM   811   H HA   . PRO A 1 54 ? 16.095  3.260   7.236   1.00 0.00 ? 54  PRO A HA   1  
ATOM   812   H HB2  . PRO A 1 54 ? 14.758  5.296   8.792   1.00 0.00 ? 54  PRO A HB2  1  
ATOM   813   H HB3  . PRO A 1 54 ? 14.751  5.097   7.033   1.00 0.00 ? 54  PRO A HB3  1  
ATOM   814   H HG2  . PRO A 1 54 ? 12.583  4.572   8.884   1.00 0.00 ? 54  PRO A HG2  1  
ATOM   815   H HG3  . PRO A 1 54 ? 12.574  4.396   7.124   1.00 0.00 ? 54  PRO A HG3  1  
ATOM   816   H HD2  . PRO A 1 54 ? 12.624  2.293   9.110   1.00 0.00 ? 54  PRO A HD2  1  
ATOM   817   H HD3  . PRO A 1 54 ? 12.614  2.118   7.340   1.00 0.00 ? 54  PRO A HD3  1  
ATOM   818   N N    . SER A 1 55 ? 16.044  2.650   10.362  1.00 0.00 ? 55  SER A N    1  
ATOM   819   C CA   . SER A 1 55 ? 16.839  2.704   11.621  1.00 0.00 ? 55  SER A CA   1  
ATOM   820   C C    . SER A 1 55 ? 18.196  2.032   11.406  1.00 0.00 ? 55  SER A C    1  
ATOM   821   O O    . SER A 1 55 ? 19.128  2.245   12.156  1.00 0.00 ? 55  SER A O    1  
ATOM   822   C CB   . SER A 1 55 ? 16.082  1.977   12.732  1.00 0.00 ? 55  SER A CB   1  
ATOM   823   O OG   . SER A 1 55 ? 14.848  2.642   12.973  1.00 0.00 ? 55  SER A OG   1  
ATOM   824   H H    . SER A 1 55 ? 15.294  2.028   10.280  1.00 0.00 ? 55  SER A H    1  
ATOM   825   H HA   . SER A 1 55 ? 16.990  3.735   11.906  1.00 0.00 ? 55  SER A HA   1  
ATOM   826   H HB2  . SER A 1 55 ? 15.884  0.962   12.432  1.00 0.00 ? 55  SER A HB2  1  
ATOM   827   H HB3  . SER A 1 55 ? 16.682  1.973   13.633  1.00 0.00 ? 55  SER A HB3  1  
ATOM   828   H HG   . SER A 1 55 ? 14.758  3.344   12.324  1.00 0.00 ? 55  SER A HG   1  
ATOM   829   N N    . GLU A 1 56 ? 18.322  1.227   10.386  1.00 0.00 ? 56  GLU A N    1  
ATOM   830   C CA   . GLU A 1 56 ? 19.627  0.553   10.129  1.00 0.00 ? 56  GLU A CA   1  
ATOM   831   C C    . GLU A 1 56 ? 20.554  1.516   9.377   1.00 0.00 ? 56  GLU A C    1  
ATOM   832   O O    . GLU A 1 56 ? 20.267  1.953   8.279   1.00 0.00 ? 56  GLU A O    1  
ATOM   833   C CB   . GLU A 1 56 ? 19.397  -0.707  9.298   1.00 0.00 ? 56  GLU A CB   1  
ATOM   834   C CG   . GLU A 1 56 ? 18.858  -1.826  10.193  1.00 0.00 ? 56  GLU A CG   1  
ATOM   835   C CD   . GLU A 1 56 ? 18.642  -3.089  9.357   1.00 0.00 ? 56  GLU A CD   1  
ATOM   836   O OE1  . GLU A 1 56 ? 17.788  -3.061  8.485   1.00 0.00 ? 56  GLU A OE1  1  
ATOM   837   O OE2  . GLU A 1 56 ? 19.333  -4.064  9.603   1.00 0.00 ? 56  GLU A OE2  1  
ATOM   838   H H    . GLU A 1 56 ? 17.562  1.070   9.788   1.00 0.00 ? 56  GLU A H    1  
ATOM   839   H HA   . GLU A 1 56 ? 20.085  0.284   11.072  1.00 0.00 ? 56  GLU A HA   1  
ATOM   840   H HB2  . GLU A 1 56 ? 18.683  -0.494  8.522   1.00 0.00 ? 56  GLU A HB2  1  
ATOM   841   H HB3  . GLU A 1 56 ? 20.330  -1.020  8.856   1.00 0.00 ? 56  GLU A HB3  1  
ATOM   842   H HG2  . GLU A 1 56 ? 19.569  -2.032  10.980  1.00 0.00 ? 56  GLU A HG2  1  
ATOM   843   H HG3  . GLU A 1 56 ? 17.918  -1.519  10.627  1.00 0.00 ? 56  GLU A HG3  1  
ATOM   844   N N    . SER A 1 57 ? 21.654  1.856   9.980   1.00 0.00 ? 57  SER A N    1  
ATOM   845   C CA   . SER A 1 57 ? 22.617  2.800   9.346   1.00 0.00 ? 57  SER A CA   1  
ATOM   846   C C    . SER A 1 57 ? 22.966  2.375   7.916   1.00 0.00 ? 57  SER A C    1  
ATOM   847   O O    . SER A 1 57 ? 23.130  3.206   7.045   1.00 0.00 ? 57  SER A O    1  
ATOM   848   C CB   . SER A 1 57 ? 23.896  2.847   10.182  1.00 0.00 ? 57  SER A CB   1  
ATOM   849   O OG   . SER A 1 57 ? 24.389  1.526   10.359  1.00 0.00 ? 57  SER A OG   1  
ATOM   850   H H    . SER A 1 57 ? 21.847  1.495   10.866  1.00 0.00 ? 57  SER A H    1  
ATOM   851   H HA   . SER A 1 57 ? 22.179  3.785   9.322   1.00 0.00 ? 57  SER A HA   1  
ATOM   852   H HB2  . SER A 1 57 ? 24.639  3.438   9.673   1.00 0.00 ? 57  SER A HB2  1  
ATOM   853   H HB3  . SER A 1 57 ? 23.681  3.295   11.143  1.00 0.00 ? 57  SER A HB3  1  
ATOM   854   H HG   . SER A 1 57 ? 25.304  1.587   10.646  1.00 0.00 ? 57  SER A HG   1  
ATOM   855   N N    . TRP A 1 58 ? 23.109  1.103   7.658   1.00 0.00 ? 58  TRP A N    1  
ATOM   856   C CA   . TRP A 1 58 ? 23.477  0.681   6.278   1.00 0.00 ? 58  TRP A CA   1  
ATOM   857   C C    . TRP A 1 58 ? 22.390  1.122   5.301   1.00 0.00 ? 58  TRP A C    1  
ATOM   858   O O    . TRP A 1 58 ? 22.655  1.400   4.150   1.00 0.00 ? 58  TRP A O    1  
ATOM   859   C CB   . TRP A 1 58 ? 23.710  -0.837  6.220   1.00 0.00 ? 58  TRP A CB   1  
ATOM   860   C CG   . TRP A 1 58 ? 22.419  -1.598  6.157   1.00 0.00 ? 58  TRP A CG   1  
ATOM   861   C CD1  . TRP A 1 58 ? 21.873  -2.277  7.191   1.00 0.00 ? 58  TRP A CD1  1  
ATOM   862   C CD2  . TRP A 1 58 ? 21.529  -1.803  5.018   1.00 0.00 ? 58  TRP A CD2  1  
ATOM   863   N NE1  . TRP A 1 58 ? 20.702  -2.880  6.766   1.00 0.00 ? 58  TRP A NE1  1  
ATOM   864   C CE2  . TRP A 1 58 ? 20.442  -2.616  5.439   1.00 0.00 ? 58  TRP A CE2  1  
ATOM   865   C CE3  . TRP A 1 58 ? 21.551  -1.364  3.674   1.00 0.00 ? 58  TRP A CE3  1  
ATOM   866   C CZ2  . TRP A 1 58 ? 19.414  -2.982  4.558   1.00 0.00 ? 58  TRP A CZ2  1  
ATOM   867   C CZ3  . TRP A 1 58 ? 20.518  -1.730  2.784   1.00 0.00 ? 58  TRP A CZ3  1  
ATOM   868   C CH2  . TRP A 1 58 ? 19.452  -2.537  3.227   1.00 0.00 ? 58  TRP A CH2  1  
ATOM   869   H H    . TRP A 1 58 ? 22.986  0.437   8.363   1.00 0.00 ? 58  TRP A H    1  
ATOM   870   H HA   . TRP A 1 58 ? 24.397  1.181   6.007   1.00 0.00 ? 58  TRP A HA   1  
ATOM   871   H HB2  . TRP A 1 58 ? 24.296  -1.067  5.345   1.00 0.00 ? 58  TRP A HB2  1  
ATOM   872   H HB3  . TRP A 1 58 ? 24.258  -1.142  7.100   1.00 0.00 ? 58  TRP A HB3  1  
ATOM   873   H HD1  . TRP A 1 58 ? 22.284  -2.339  8.188   1.00 0.00 ? 58  TRP A HD1  1  
ATOM   874   H HE1  . TRP A 1 58 ? 20.116  -3.430  7.323   1.00 0.00 ? 58  TRP A HE1  1  
ATOM   875   H HE3  . TRP A 1 58 ? 22.364  -0.751  3.325   1.00 0.00 ? 58  TRP A HE3  1  
ATOM   876   H HZ2  . TRP A 1 58 ? 18.598  -3.600  4.901   1.00 0.00 ? 58  TRP A HZ2  1  
ATOM   877   H HZ3  . TRP A 1 58 ? 20.545  -1.389  1.759   1.00 0.00 ? 58  TRP A HZ3  1  
ATOM   878   H HH2  . TRP A 1 58 ? 18.664  -2.815  2.544   1.00 0.00 ? 58  TRP A HH2  1  
ATOM   879   N N    . VAL A 1 59 ? 21.174  1.214   5.752   1.00 0.00 ? 59  VAL A N    1  
ATOM   880   C CA   . VAL A 1 59 ? 20.089  1.660   4.841   1.00 0.00 ? 59  VAL A CA   1  
ATOM   881   C C    . VAL A 1 59 ? 20.334  3.119   4.478   1.00 0.00 ? 59  VAL A C    1  
ATOM   882   O O    . VAL A 1 59 ? 20.248  3.508   3.331   1.00 0.00 ? 59  VAL A O    1  
ATOM   883   C CB   . VAL A 1 59 ? 18.744  1.514   5.549   1.00 0.00 ? 59  VAL A CB   1  
ATOM   884   C CG1  . VAL A 1 59 ? 17.623  2.053   4.655   1.00 0.00 ? 59  VAL A CG1  1  
ATOM   885   C CG2  . VAL A 1 59 ? 18.509  0.034   5.842   1.00 0.00 ? 59  VAL A CG2  1  
ATOM   886   H H    . VAL A 1 59 ? 20.978  1.005   6.689   1.00 0.00 ? 59  VAL A H    1  
ATOM   887   H HA   . VAL A 1 59 ? 20.097  1.058   3.946   1.00 0.00 ? 59  VAL A HA   1  
ATOM   888   H HB   . VAL A 1 59 ? 18.761  2.069   6.476   1.00 0.00 ? 59  VAL A HB   1  
ATOM   889   H HG11 . VAL A 1 59 ? 17.777  1.721   3.641   1.00 0.00 ? 59  VAL A HG11 1  
ATOM   890   H HG12 . VAL A 1 59 ? 16.671  1.690   5.013   1.00 0.00 ? 59  VAL A HG12 1  
ATOM   891   H HG13 . VAL A 1 59 ? 17.629  3.133   4.684   1.00 0.00 ? 59  VAL A HG13 1  
ATOM   892   H HG21 . VAL A 1 59 ? 19.386  -0.379  6.321   1.00 0.00 ? 59  VAL A HG21 1  
ATOM   893   H HG22 . VAL A 1 59 ? 17.655  -0.074  6.492   1.00 0.00 ? 59  VAL A HG22 1  
ATOM   894   H HG23 . VAL A 1 59 ? 18.327  -0.491  4.917   1.00 0.00 ? 59  VAL A HG23 1  
ATOM   895   N N    . GLN A 1 60 ? 20.657  3.926   5.445   1.00 0.00 ? 60  GLN A N    1  
ATOM   896   C CA   . GLN A 1 60 ? 20.929  5.360   5.147   1.00 0.00 ? 60  GLN A CA   1  
ATOM   897   C C    . GLN A 1 60 ? 22.176  5.465   4.263   1.00 0.00 ? 60  GLN A C    1  
ATOM   898   O O    . GLN A 1 60 ? 22.274  6.322   3.408   1.00 0.00 ? 60  GLN A O    1  
ATOM   899   C CB   . GLN A 1 60 ? 21.162  6.119   6.455   1.00 0.00 ? 60  GLN A CB   1  
ATOM   900   C CG   . GLN A 1 60 ? 21.170  7.623   6.179   1.00 0.00 ? 60  GLN A CG   1  
ATOM   901   C CD   . GLN A 1 60 ? 19.745  8.097   5.889   1.00 0.00 ? 60  GLN A CD   1  
ATOM   902   O OE1  . GLN A 1 60 ? 18.946  8.246   6.793   1.00 0.00 ? 60  GLN A OE1  1  
ATOM   903   N NE2  . GLN A 1 60 ? 19.389  8.342   4.658   1.00 0.00 ? 60  GLN A NE2  1  
ATOM   904   H H    . GLN A 1 60 ? 20.734  3.586   6.365   1.00 0.00 ? 60  GLN A H    1  
ATOM   905   H HA   . GLN A 1 60 ? 20.084  5.785   4.627   1.00 0.00 ? 60  GLN A HA   1  
ATOM   906   H HB2  . GLN A 1 60 ? 20.370  5.885   7.153   1.00 0.00 ? 60  GLN A HB2  1  
ATOM   907   H HB3  . GLN A 1 60 ? 22.112  5.827   6.877   1.00 0.00 ? 60  GLN A HB3  1  
ATOM   908   H HG2  . GLN A 1 60 ? 21.556  8.146   7.042   1.00 0.00 ? 60  GLN A HG2  1  
ATOM   909   H HG3  . GLN A 1 60 ? 21.796  7.829   5.324   1.00 0.00 ? 60  GLN A HG3  1  
ATOM   910   H HE21 . GLN A 1 60 ? 20.033  8.222   3.929   1.00 0.00 ? 60  GLN A HE21 1  
ATOM   911   H HE22 . GLN A 1 60 ? 18.478  8.646   4.462   1.00 0.00 ? 60  GLN A HE22 1  
ATOM   912   N N    . GLU A 1 61 ? 23.130  4.598   4.470   1.00 0.00 ? 61  GLU A N    1  
ATOM   913   C CA   . GLU A 1 61 ? 24.379  4.640   3.653   1.00 0.00 ? 61  GLU A CA   1  
ATOM   914   C C    . GLU A 1 61 ? 24.065  4.313   2.191   1.00 0.00 ? 61  GLU A C    1  
ATOM   915   O O    . GLU A 1 61 ? 24.471  5.016   1.287   1.00 0.00 ? 61  GLU A O    1  
ATOM   916   C CB   . GLU A 1 61 ? 25.377  3.618   4.198   1.00 0.00 ? 61  GLU A CB   1  
ATOM   917   C CG   . GLU A 1 61 ? 26.723  3.790   3.491   1.00 0.00 ? 61  GLU A CG   1  
ATOM   918   C CD   . GLU A 1 61 ? 27.741  2.816   4.085   1.00 0.00 ? 61  GLU A CD   1  
ATOM   919   O OE1  . GLU A 1 61 ? 27.567  2.432   5.229   1.00 0.00 ? 61  GLU A OE1  1  
ATOM   920   O OE2  . GLU A 1 61 ? 28.679  2.470   3.384   1.00 0.00 ? 61  GLU A OE2  1  
ATOM   921   H H    . GLU A 1 61 ? 23.028  3.919   5.169   1.00 0.00 ? 61  GLU A H    1  
ATOM   922   H HA   . GLU A 1 61 ? 24.811  5.626   3.712   1.00 0.00 ? 61  GLU A HA   1  
ATOM   923   H HB2  . GLU A 1 61 ? 25.506  3.772   5.260   1.00 0.00 ? 61  GLU A HB2  1  
ATOM   924   H HB3  . GLU A 1 61 ? 25.005  2.620   4.021   1.00 0.00 ? 61  GLU A HB3  1  
ATOM   925   H HG2  . GLU A 1 61 ? 26.603  3.589   2.436   1.00 0.00 ? 61  GLU A HG2  1  
ATOM   926   H HG3  . GLU A 1 61 ? 27.075  4.802   3.626   1.00 0.00 ? 61  GLU A HG3  1  
ATOM   927   N N    . TYR A 1 62 ? 23.354  3.247   1.951   1.00 0.00 ? 62  TYR A N    1  
ATOM   928   C CA   . TYR A 1 62 ? 23.022  2.869   0.546   1.00 0.00 ? 62  TYR A CA   1  
ATOM   929   C C    . TYR A 1 62 ? 22.198  3.986   -0.104  1.00 0.00 ? 62  TYR A C    1  
ATOM   930   O O    . TYR A 1 62 ? 22.327  4.257   -1.281  1.00 0.00 ? 62  TYR A O    1  
ATOM   931   C CB   . TYR A 1 62 ? 22.213  1.562   0.537   1.00 0.00 ? 62  TYR A CB   1  
ATOM   932   C CG   . TYR A 1 62 ? 23.136  0.357   0.645   1.00 0.00 ? 62  TYR A CG   1  
ATOM   933   C CD1  . TYR A 1 62 ? 24.090  0.273   1.681   1.00 0.00 ? 62  TYR A CD1  1  
ATOM   934   C CD2  . TYR A 1 62 ? 23.029  -0.690  -0.295  1.00 0.00 ? 62  TYR A CD2  1  
ATOM   935   C CE1  . TYR A 1 62 ? 24.933  -0.854  1.773   1.00 0.00 ? 62  TYR A CE1  1  
ATOM   936   C CE2  . TYR A 1 62 ? 23.872  -1.812  -0.201  1.00 0.00 ? 62  TYR A CE2  1  
ATOM   937   C CZ   . TYR A 1 62 ? 24.823  -1.894  0.832   1.00 0.00 ? 62  TYR A CZ   1  
ATOM   938   O OH   . TYR A 1 62 ? 25.648  -2.997  0.923   1.00 0.00 ? 62  TYR A OH   1  
ATOM   939   H H    . TYR A 1 62 ? 23.042  2.692   2.695   1.00 0.00 ? 62  TYR A H    1  
ATOM   940   H HA   . TYR A 1 62 ? 23.937  2.732   -0.013  1.00 0.00 ? 62  TYR A HA   1  
ATOM   941   H HB2  . TYR A 1 62 ? 21.533  1.562   1.377   1.00 0.00 ? 62  TYR A HB2  1  
ATOM   942   H HB3  . TYR A 1 62 ? 21.643  1.496   -0.380  1.00 0.00 ? 62  TYR A HB3  1  
ATOM   943   H HD1  . TYR A 1 62 ? 24.179  1.068   2.402   1.00 0.00 ? 62  TYR A HD1  1  
ATOM   944   H HD2  . TYR A 1 62 ? 22.300  -0.629  -1.090  1.00 0.00 ? 62  TYR A HD2  1  
ATOM   945   H HE1  . TYR A 1 62 ? 25.661  -0.921  2.569   1.00 0.00 ? 62  TYR A HE1  1  
ATOM   946   H HE2  . TYR A 1 62 ? 23.788  -2.612  -0.922  1.00 0.00 ? 62  TYR A HE2  1  
ATOM   947   H HH   . TYR A 1 62 ? 26.393  -2.859  0.334   1.00 0.00 ? 62  TYR A HH   1  
ATOM   948   N N    . VAL A 1 63 ? 21.361  4.639   0.650   1.00 0.00 ? 63  VAL A N    1  
ATOM   949   C CA   . VAL A 1 63 ? 20.545  5.735   0.069   1.00 0.00 ? 63  VAL A CA   1  
ATOM   950   C C    . VAL A 1 63 ? 21.481  6.858   -0.351  1.00 0.00 ? 63  VAL A C    1  
ATOM   951   O O    . VAL A 1 63 ? 21.320  7.466   -1.388  1.00 0.00 ? 63  VAL A O    1  
ATOM   952   C CB   . VAL A 1 63 ? 19.558  6.248   1.121   1.00 0.00 ? 63  VAL A CB   1  
ATOM   953   C CG1  . VAL A 1 63 ? 18.871  7.518   0.613   1.00 0.00 ? 63  VAL A CG1  1  
ATOM   954   C CG2  . VAL A 1 63 ? 18.503  5.172   1.392   1.00 0.00 ? 63  VAL A CG2  1  
ATOM   955   H H    . VAL A 1 63 ? 21.277  4.419   1.597   1.00 0.00 ? 63  VAL A H    1  
ATOM   956   H HA   . VAL A 1 63 ? 20.005  5.371   -0.791  1.00 0.00 ? 63  VAL A HA   1  
ATOM   957   H HB   . VAL A 1 63 ? 20.093  6.468   2.033   1.00 0.00 ? 63  VAL A HB   1  
ATOM   958   H HG11 . VAL A 1 63 ? 18.539  7.366   -0.403  1.00 0.00 ? 63  VAL A HG11 1  
ATOM   959   H HG12 . VAL A 1 63 ? 18.021  7.743   1.240   1.00 0.00 ? 63  VAL A HG12 1  
ATOM   960   H HG13 . VAL A 1 63 ? 19.569  8.342   0.645   1.00 0.00 ? 63  VAL A HG13 1  
ATOM   961   H HG21 . VAL A 1 63 ? 18.982  4.210   1.485   1.00 0.00 ? 63  VAL A HG21 1  
ATOM   962   H HG22 . VAL A 1 63 ? 17.981  5.404   2.309   1.00 0.00 ? 63  VAL A HG22 1  
ATOM   963   H HG23 . VAL A 1 63 ? 17.798  5.144   0.574   1.00 0.00 ? 63  VAL A HG23 1  
ATOM   964   N N    . TYR A 1 64 ? 22.464  7.130   0.454   1.00 0.00 ? 64  TYR A N    1  
ATOM   965   C CA   . TYR A 1 64 ? 23.421  8.209   0.115   1.00 0.00 ? 64  TYR A CA   1  
ATOM   966   C C    . TYR A 1 64 ? 24.141  7.848   -1.181  1.00 0.00 ? 64  TYR A C    1  
ATOM   967   O O    . TYR A 1 64 ? 24.317  8.666   -2.061  1.00 0.00 ? 64  TYR A O    1  
ATOM   968   C CB   . TYR A 1 64 ? 24.443  8.352   1.246   1.00 0.00 ? 64  TYR A CB   1  
ATOM   969   C CG   . TYR A 1 64 ? 25.145  9.687   1.135   1.00 0.00 ? 64  TYR A CG   1  
ATOM   970   C CD1  . TYR A 1 64 ? 24.472  10.869  1.501   1.00 0.00 ? 64  TYR A CD1  1  
ATOM   971   C CD2  . TYR A 1 64 ? 26.472  9.750   0.666   1.00 0.00 ? 64  TYR A CD2  1  
ATOM   972   C CE1  . TYR A 1 64 ? 25.124  12.112  1.397   1.00 0.00 ? 64  TYR A CE1  1  
ATOM   973   C CE2  . TYR A 1 64 ? 27.124  10.994  0.562   1.00 0.00 ? 64  TYR A CE2  1  
ATOM   974   C CZ   . TYR A 1 64 ? 26.450  12.175  0.928   1.00 0.00 ? 64  TYR A CZ   1  
ATOM   975   O OH   . TYR A 1 64 ? 27.089  13.394  0.826   1.00 0.00 ? 64  TYR A OH   1  
ATOM   976   H H    . TYR A 1 64 ? 22.573  6.621   1.284   1.00 0.00 ? 64  TYR A H    1  
ATOM   977   H HA   . TYR A 1 64 ? 22.882  9.130   -0.011  1.00 0.00 ? 64  TYR A HA   1  
ATOM   978   H HB2  . TYR A 1 64 ? 23.934  8.290   2.194   1.00 0.00 ? 64  TYR A HB2  1  
ATOM   979   H HB3  . TYR A 1 64 ? 25.170  7.556   1.180   1.00 0.00 ? 64  TYR A HB3  1  
ATOM   980   H HD1  . TYR A 1 64 ? 23.454  10.821  1.861   1.00 0.00 ? 64  TYR A HD1  1  
ATOM   981   H HD2  . TYR A 1 64 ? 26.989  8.845   0.385   1.00 0.00 ? 64  TYR A HD2  1  
ATOM   982   H HE1  . TYR A 1 64 ? 24.607  13.018  1.677   1.00 0.00 ? 64  TYR A HE1  1  
ATOM   983   H HE2  . TYR A 1 64 ? 28.141  11.042  0.202   1.00 0.00 ? 64  TYR A HE2  1  
ATOM   984   H HH   . TYR A 1 64 ? 27.933  13.251  0.391   1.00 0.00 ? 64  TYR A HH   1  
ATOM   985   N N    . ASP A 1 65 ? 24.554  6.621   -1.298  1.00 0.00 ? 65  ASP A N    1  
ATOM   986   C CA   . ASP A 1 65 ? 25.266  6.182   -2.530  1.00 0.00 ? 65  ASP A CA   1  
ATOM   987   C C    . ASP A 1 65 ? 24.336  6.338   -3.736  1.00 0.00 ? 65  ASP A C    1  
ATOM   988   O O    . ASP A 1 65 ? 24.765  6.647   -4.830  1.00 0.00 ? 65  ASP A O    1  
ATOM   989   C CB   . ASP A 1 65 ? 25.669  4.711   -2.376  1.00 0.00 ? 65  ASP A CB   1  
ATOM   990   C CG   . ASP A 1 65 ? 26.930  4.607   -1.514  1.00 0.00 ? 65  ASP A CG   1  
ATOM   991   O OD1  . ASP A 1 65 ? 26.794  4.588   -0.302  1.00 0.00 ? 65  ASP A OD1  1  
ATOM   992   O OD2  . ASP A 1 65 ? 28.008  4.549   -2.082  1.00 0.00 ? 65  ASP A OD2  1  
ATOM   993   H H    . ASP A 1 65 ? 24.393  5.984   -0.569  1.00 0.00 ? 65  ASP A H    1  
ATOM   994   H HA   . ASP A 1 65 ? 26.147  6.789   -2.674  1.00 0.00 ? 65  ASP A HA   1  
ATOM   995   H HB2  . ASP A 1 65 ? 24.864  4.168   -1.902  1.00 0.00 ? 65  ASP A HB2  1  
ATOM   996   H HB3  . ASP A 1 65 ? 25.862  4.287   -3.347  1.00 0.00 ? 65  ASP A HB3  1  
ATOM   997   N N    . LEU A 1 66 ? 23.067  6.125   -3.540  1.00 0.00 ? 66  LEU A N    1  
ATOM   998   C CA   . LEU A 1 66 ? 22.099  6.257   -4.664  1.00 0.00 ? 66  LEU A CA   1  
ATOM   999   C C    . LEU A 1 66 ? 21.915  7.737   -5.014  1.00 0.00 ? 66  LEU A C    1  
ATOM   1000  O O    . LEU A 1 66 ? 21.655  8.089   -6.147  1.00 0.00 ? 66  LEU A O    1  
ATOM   1001  C CB   . LEU A 1 66 ? 20.758  5.649   -4.230  1.00 0.00 ? 66  LEU A CB   1  
ATOM   1002  C CG   . LEU A 1 66 ? 20.797  4.112   -4.377  1.00 0.00 ? 66  LEU A CG   1  
ATOM   1003  C CD1  . LEU A 1 66 ? 19.733  3.479   -3.478  1.00 0.00 ? 66  LEU A CD1  1  
ATOM   1004  C CD2  . LEU A 1 66 ? 20.508  3.707   -5.833  1.00 0.00 ? 66  LEU A CD2  1  
ATOM   1005  H H    . LEU A 1 66 ? 22.749  5.875   -2.650  1.00 0.00 ? 66  LEU A H    1  
ATOM   1006  H HA   . LEU A 1 66 ? 22.477  5.730   -5.526  1.00 0.00 ? 66  LEU A HA   1  
ATOM   1007  H HB2  . LEU A 1 66 ? 20.577  5.906   -3.195  1.00 0.00 ? 66  LEU A HB2  1  
ATOM   1008  H HB3  . LEU A 1 66 ? 19.966  6.053   -4.837  1.00 0.00 ? 66  LEU A HB3  1  
ATOM   1009  H HG   . LEU A 1 66 ? 21.772  3.747   -4.087  1.00 0.00 ? 66  LEU A HG   1  
ATOM   1010  H HD11 . LEU A 1 66 ? 18.764  3.874   -3.734  1.00 0.00 ? 66  LEU A HD11 1  
ATOM   1011  H HD12 . LEU A 1 66 ? 19.733  2.408   -3.620  1.00 0.00 ? 66  LEU A HD12 1  
ATOM   1012  H HD13 . LEU A 1 66 ? 19.953  3.705   -2.445  1.00 0.00 ? 66  LEU A HD13 1  
ATOM   1013  H HD21 . LEU A 1 66 ? 19.631  4.225   -6.190  1.00 0.00 ? 66  LEU A HD21 1  
ATOM   1014  H HD22 . LEU A 1 66 ? 21.352  3.957   -6.456  1.00 0.00 ? 66  LEU A HD22 1  
ATOM   1015  H HD23 . LEU A 1 66 ? 20.335  2.642   -5.878  1.00 0.00 ? 66  LEU A HD23 1  
ATOM   1016  N N    . GLU A 1 67 ? 22.054  8.603   -4.052  1.00 0.00 ? 67  GLU A N    1  
ATOM   1017  C CA   . GLU A 1 67 ? 21.894  10.059  -4.332  1.00 0.00 ? 67  GLU A CA   1  
ATOM   1018  C C    . GLU A 1 67 ? 23.103  10.550  -5.123  1.00 0.00 ? 67  GLU A C    1  
ATOM   1019  O O    . GLU A 1 67 ? 23.020  11.487  -5.892  1.00 0.00 ? 67  GLU A O    1  
ATOM   1020  C CB   . GLU A 1 67 ? 21.810  10.825  -3.011  1.00 0.00 ? 67  GLU A CB   1  
ATOM   1021  C CG   . GLU A 1 67 ? 20.463  10.548  -2.352  1.00 0.00 ? 67  GLU A CG   1  
ATOM   1022  C CD   . GLU A 1 67 ? 20.306  11.430  -1.112  1.00 0.00 ? 67  GLU A CD   1  
ATOM   1023  O OE1  . GLU A 1 67 ? 20.960  12.459  -1.055  1.00 0.00 ? 67  GLU A OE1  1  
ATOM   1024  O OE2  . GLU A 1 67 ? 19.535  11.063  -0.241  1.00 0.00 ? 67  GLU A OE2  1  
ATOM   1025  H H    . GLU A 1 67 ? 22.265  8.296   -3.147  1.00 0.00 ? 67  GLU A H    1  
ATOM   1026  H HA   . GLU A 1 67 ? 20.994  10.222  -4.906  1.00 0.00 ? 67  GLU A HA   1  
ATOM   1027  H HB2  . GLU A 1 67 ? 22.606  10.501  -2.356  1.00 0.00 ? 67  GLU A HB2  1  
ATOM   1028  H HB3  . GLU A 1 67 ? 21.906  11.883  -3.200  1.00 0.00 ? 67  GLU A HB3  1  
ATOM   1029  H HG2  . GLU A 1 67 ? 19.671  10.764  -3.054  1.00 0.00 ? 67  GLU A HG2  1  
ATOM   1030  H HG3  . GLU A 1 67 ? 20.414  9.511   -2.063  1.00 0.00 ? 67  GLU A HG3  1  
ATOM   1031  N N    . LEU A 1 68 ? 24.226  9.919   -4.939  1.00 0.00 ? 68  LEU A N    1  
ATOM   1032  C CA   . LEU A 1 68 ? 25.449  10.340  -5.681  1.00 0.00 ? 68  LEU A CA   1  
ATOM   1033  C C    . LEU A 1 68 ? 25.373  9.824   -7.120  1.00 0.00 ? 68  LEU A C    1  
ATOM   1034  O O    . LEU A 1 68 ? 24.634  10.339  -7.935  1.00 0.00 ? 68  LEU A O    1  
ATOM   1035  C CB   . LEU A 1 68 ? 26.688  9.765   -5.002  1.00 0.00 ? 68  LEU A CB   1  
ATOM   1036  C CG   . LEU A 1 68 ? 26.809  10.321  -3.579  1.00 0.00 ? 68  LEU A CG   1  
ATOM   1037  C CD1  . LEU A 1 68 ? 28.003  9.661   -2.900  1.00 0.00 ? 68  LEU A CD1  1  
ATOM   1038  C CD2  . LEU A 1 68 ? 27.013  11.850  -3.613  1.00 0.00 ? 68  LEU A CD2  1  
ATOM   1039  H H    . LEU A 1 68 ? 24.263  9.166   -4.313  1.00 0.00 ? 68  LEU A H    1  
ATOM   1040  H HA   . LEU A 1 68 ? 25.515  11.414  -5.688  1.00 0.00 ? 68  LEU A HA   1  
ATOM   1041  H HB2  . LEU A 1 68 ? 26.607  8.688   -4.961  1.00 0.00 ? 68  LEU A HB2  1  
ATOM   1042  H HB3  . LEU A 1 68 ? 27.567  10.038  -5.567  1.00 0.00 ? 68  LEU A HB3  1  
ATOM   1043  H HG   . LEU A 1 68 ? 25.910  10.087  -3.027  1.00 0.00 ? 68  LEU A HG   1  
ATOM   1044  H HD11 . LEU A 1 68 ? 27.933  8.590   -3.017  1.00 0.00 ? 68  LEU A HD11 1  
ATOM   1045  H HD12 . LEU A 1 68 ? 28.914  10.016  -3.357  1.00 0.00 ? 68  LEU A HD12 1  
ATOM   1046  H HD13 . LEU A 1 68 ? 28.002  9.912   -1.852  1.00 0.00 ? 68  LEU A HD13 1  
ATOM   1047  H HD21 . LEU A 1 68 ? 27.588  12.124  -4.487  1.00 0.00 ? 68  LEU A HD21 1  
ATOM   1048  H HD22 . LEU A 1 68 ? 26.052  12.341  -3.646  1.00 0.00 ? 68  LEU A HD22 1  
ATOM   1049  H HD23 . LEU A 1 68 ? 27.541  12.169  -2.724  1.00 0.00 ? 68  LEU A HD23 1  
ATOM   1050  N N    . ASN A 1 69 ? 26.133  8.810   -7.440  1.00 0.00 ? 69  ASN A N    1  
ATOM   1051  C CA   . ASN A 1 69 ? 26.107  8.258   -8.826  1.00 0.00 ? 69  ASN A CA   1  
ATOM   1052  C C    . ASN A 1 69 ? 25.033  7.173   -8.923  1.00 0.00 ? 69  ASN A C    1  
ATOM   1053  O O    . ASN A 1 69 ? 25.051  6.273   -8.100  1.00 0.00 ? 69  ASN A O    1  
ATOM   1054  C CB   . ASN A 1 69 ? 27.472  7.650   -9.156  1.00 0.00 ? 69  ASN A CB   1  
ATOM   1055  C CG   . ASN A 1 69 ? 27.533  7.311   -10.646 1.00 0.00 ? 69  ASN A CG   1  
ATOM   1056  O OD1  . ASN A 1 69 ? 27.264  8.149   -11.484 1.00 0.00 ? 69  ASN A OD1  1  
ATOM   1057  N ND2  . ASN A 1 69 ? 27.877  6.108   -11.016 1.00 0.00 ? 69  ASN A ND2  1  
ATOM   1058  O OXT  . ASN A 1 69 ? 24.210  7.261   -9.819  1.00 0.00 ? 69  ASN A OXT  1  
ATOM   1059  H H    . ASN A 1 69 ? 26.721  8.410   -6.768  1.00 0.00 ? 69  ASN A H    1  
ATOM   1060  H HA   . ASN A 1 69 ? 25.887  9.048   -9.528  1.00 0.00 ? 69  ASN A HA   1  
ATOM   1061  H HB2  . ASN A 1 69 ? 28.250  8.361   -8.916  1.00 0.00 ? 69  ASN A HB2  1  
ATOM   1062  H HB3  . ASN A 1 69 ? 27.616  6.750   -8.578  1.00 0.00 ? 69  ASN A HB3  1  
ATOM   1063  H HD21 . ASN A 1 69 ? 28.093  5.431   -10.341 1.00 0.00 ? 69  ASN A HD21 1  
ATOM   1064  H HD22 . ASN A 1 69 ? 27.918  5.880   -11.968 1.00 0.00 ? 69  ASN A HD22 1  
ATOM   1065  N N    . ALA B 1 1  ? 10.346  -21.424 -7.208  1.00 0.00 ? 1   ALA B N    1  
ATOM   1066  C CA   . ALA B 1 1  ? 11.434  -20.584 -7.785  1.00 0.00 ? 1   ALA B CA   1  
ATOM   1067  C C    . ALA B 1 1  ? 11.553  -19.289 -6.955  1.00 0.00 ? 1   ALA B C    1  
ATOM   1068  O O    . ALA B 1 1  ? 10.649  -18.960 -6.213  1.00 0.00 ? 1   ALA B O    1  
ATOM   1069  C CB   . ALA B 1 1  ? 11.087  -20.263 -9.257  1.00 0.00 ? 1   ALA B CB   1  
ATOM   1070  H H1   . ALA B 1 1  ? 10.228  -21.196 -6.201  1.00 0.00 ? 1   ALA B H1   1  
ATOM   1071  H H2   . ALA B 1 1  ? 9.456   -21.233 -7.714  1.00 0.00 ? 1   ALA B H2   1  
ATOM   1072  H H3   . ALA B 1 1  ? 10.592  -22.428 -7.308  1.00 0.00 ? 1   ALA B H3   1  
ATOM   1073  H HA   . ALA B 1 1  ? 12.361  -21.135 -7.736  1.00 0.00 ? 1   ALA B HA   1  
ATOM   1074  H HB1  . ALA B 1 1  ? 10.099  -20.640 -9.479  1.00 0.00 ? 1   ALA B HB1  1  
ATOM   1075  H HB2  . ALA B 1 1  ? 11.107  -19.194 -9.426  1.00 0.00 ? 1   ALA B HB2  1  
ATOM   1076  H HB3  . ALA B 1 1  ? 11.803  -20.739 -9.914  1.00 0.00 ? 1   ALA B HB3  1  
ATOM   1077  N N    . PRO B 1 2  ? 12.657  -18.582 -7.103  1.00 0.00 ? 2   PRO B N    1  
ATOM   1078  C CA   . PRO B 1 2  ? 12.866  -17.324 -6.361  1.00 0.00 ? 2   PRO B CA   1  
ATOM   1079  C C    . PRO B 1 2  ? 11.697  -16.362 -6.625  1.00 0.00 ? 2   PRO B C    1  
ATOM   1080  O O    . PRO B 1 2  ? 11.616  -15.740 -7.665  1.00 0.00 ? 2   PRO B O    1  
ATOM   1081  C CB   . PRO B 1 2  ? 14.203  -16.759 -6.903  1.00 0.00 ? 2   PRO B CB   1  
ATOM   1082  C CG   . PRO B 1 2  ? 14.747  -17.772 -7.953  1.00 0.00 ? 2   PRO B CG   1  
ATOM   1083  C CD   . PRO B 1 2  ? 13.767  -18.966 -8.003  1.00 0.00 ? 2   PRO B CD   1  
ATOM   1084  H HA   . PRO B 1 2  ? 12.950  -17.525 -5.303  1.00 0.00 ? 2   PRO B HA   1  
ATOM   1085  H HB2  . PRO B 1 2  ? 14.042  -15.792 -7.367  1.00 0.00 ? 2   PRO B HB2  1  
ATOM   1086  H HB3  . PRO B 1 2  ? 14.915  -16.657 -6.096  1.00 0.00 ? 2   PRO B HB3  1  
ATOM   1087  H HG2  . PRO B 1 2  ? 14.804  -17.297 -8.927  1.00 0.00 ? 2   PRO B HG2  1  
ATOM   1088  H HG3  . PRO B 1 2  ? 15.730  -18.118 -7.662  1.00 0.00 ? 2   PRO B HG3  1  
ATOM   1089  H HD2  . PRO B 1 2  ? 13.405  -19.118 -9.011  1.00 0.00 ? 2   PRO B HD2  1  
ATOM   1090  H HD3  . PRO B 1 2  ? 14.249  -19.861 -7.636  1.00 0.00 ? 2   PRO B HD3  1  
ATOM   1091  N N    . MET B 1 3  ? 10.794  -16.239 -5.690  1.00 0.00 ? 3   MET B N    1  
ATOM   1092  C CA   . MET B 1 3  ? 9.636   -15.321 -5.888  1.00 0.00 ? 3   MET B CA   1  
ATOM   1093  C C    . MET B 1 3  ? 10.086  -13.878 -5.616  1.00 0.00 ? 3   MET B C    1  
ATOM   1094  O O    . MET B 1 3  ? 11.259  -13.603 -5.466  1.00 0.00 ? 3   MET B O    1  
ATOM   1095  C CB   . MET B 1 3  ? 8.499   -15.723 -4.924  1.00 0.00 ? 3   MET B CB   1  
ATOM   1096  C CG   . MET B 1 3  ? 7.127   -15.452 -5.565  1.00 0.00 ? 3   MET B CG   1  
ATOM   1097  S SD   . MET B 1 3  ? 5.884   -15.250 -4.265  1.00 0.00 ? 3   MET B SD   1  
ATOM   1098  C CE   . MET B 1 3  ? 4.766   -14.169 -5.190  1.00 0.00 ? 3   MET B CE   1  
ATOM   1099  H H    . MET B 1 3  ? 10.878  -16.749 -4.857  1.00 0.00 ? 3   MET B H    1  
ATOM   1100  H HA   . MET B 1 3  ? 9.294   -15.400 -6.911  1.00 0.00 ? 3   MET B HA   1  
ATOM   1101  H HB2  . MET B 1 3  ? 8.583   -16.776 -4.699  1.00 0.00 ? 3   MET B HB2  1  
ATOM   1102  H HB3  . MET B 1 3  ? 8.579   -15.159 -4.004  1.00 0.00 ? 3   MET B HB3  1  
ATOM   1103  H HG2  . MET B 1 3  ? 7.173   -14.553 -6.160  1.00 0.00 ? 3   MET B HG2  1  
ATOM   1104  H HG3  . MET B 1 3  ? 6.854   -16.286 -6.196  1.00 0.00 ? 3   MET B HG3  1  
ATOM   1105  H HE1  . MET B 1 3  ? 4.474   -14.657 -6.110  1.00 0.00 ? 3   MET B HE1  1  
ATOM   1106  H HE2  . MET B 1 3  ? 3.889   -13.962 -4.592  1.00 0.00 ? 3   MET B HE2  1  
ATOM   1107  H HE3  . MET B 1 3  ? 5.268   -13.243 -5.421  1.00 0.00 ? 3   MET B HE3  1  
ATOM   1108  N N    . GLY B 1 4  ? 9.164   -12.957 -5.556  1.00 0.00 ? 4   GLY B N    1  
ATOM   1109  C CA   . GLY B 1 4  ? 9.542   -11.539 -5.300  1.00 0.00 ? 4   GLY B CA   1  
ATOM   1110  C C    . GLY B 1 4  ? 10.244  -11.419 -3.952  1.00 0.00 ? 4   GLY B C    1  
ATOM   1111  O O    . GLY B 1 4  ? 10.435  -12.386 -3.241  1.00 0.00 ? 4   GLY B O    1  
ATOM   1112  H H    . GLY B 1 4  ? 8.224   -13.197 -5.682  1.00 0.00 ? 4   GLY B H    1  
ATOM   1113  H HA2  . GLY B 1 4  ? 10.211  -11.198 -6.078  1.00 0.00 ? 4   GLY B HA2  1  
ATOM   1114  H HA3  . GLY B 1 4  ? 8.657   -10.922 -5.293  1.00 0.00 ? 4   GLY B HA3  1  
ATOM   1115  N N    . SER B 1 5  ? 10.638  -10.227 -3.608  1.00 0.00 ? 5   SER B N    1  
ATOM   1116  C CA   . SER B 1 5  ? 11.346  -9.996  -2.319  1.00 0.00 ? 5   SER B CA   1  
ATOM   1117  C C    . SER B 1 5  ? 10.335  -9.654  -1.214  1.00 0.00 ? 5   SER B C    1  
ATOM   1118  O O    . SER B 1 5  ? 9.732   -10.526 -0.621  1.00 0.00 ? 5   SER B O    1  
ATOM   1119  C CB   . SER B 1 5  ? 12.307  -8.832  -2.521  1.00 0.00 ? 5   SER B CB   1  
ATOM   1120  O OG   . SER B 1 5  ? 11.677  -7.875  -3.361  1.00 0.00 ? 5   SER B OG   1  
ATOM   1121  H H    . SER B 1 5  ? 10.474  -9.472  -4.210  1.00 0.00 ? 5   SER B H    1  
ATOM   1122  H HA   . SER B 1 5  ? 11.904  -10.879 -2.043  1.00 0.00 ? 5   SER B HA   1  
ATOM   1123  H HB2  . SER B 1 5  ? 12.545  -8.383  -1.574  1.00 0.00 ? 5   SER B HB2  1  
ATOM   1124  H HB3  . SER B 1 5  ? 13.217  -9.191  -2.985  1.00 0.00 ? 5   SER B HB3  1  
ATOM   1125  H HG   . SER B 1 5  ? 10.752  -7.822  -3.109  1.00 0.00 ? 5   SER B HG   1  
ATOM   1126  N N    . ASP B 1 6  ? 10.150  -8.386  -0.930  1.00 0.00 ? 6   ASP B N    1  
ATOM   1127  C CA   . ASP B 1 6  ? 9.183   -7.987  0.139   1.00 0.00 ? 6   ASP B CA   1  
ATOM   1128  C C    . ASP B 1 6  ? 8.712   -6.545  -0.109  1.00 0.00 ? 6   ASP B C    1  
ATOM   1129  O O    . ASP B 1 6  ? 9.048   -5.657  0.648   1.00 0.00 ? 6   ASP B O    1  
ATOM   1130  C CB   . ASP B 1 6  ? 9.872   -8.059  1.510   1.00 0.00 ? 6   ASP B CB   1  
ATOM   1131  C CG   . ASP B 1 6  ? 10.652  -9.370  1.625   1.00 0.00 ? 6   ASP B CG   1  
ATOM   1132  O OD1  . ASP B 1 6  ? 10.033  -10.381 1.910   1.00 0.00 ? 6   ASP B OD1  1  
ATOM   1133  O OD2  . ASP B 1 6  ? 11.856  -9.339  1.425   1.00 0.00 ? 6   ASP B OD2  1  
ATOM   1134  H H    . ASP B 1 6  ? 10.648  -7.694  -1.421  1.00 0.00 ? 6   ASP B H    1  
ATOM   1135  H HA   . ASP B 1 6  ? 8.335   -8.654  0.129   1.00 0.00 ? 6   ASP B HA   1  
ATOM   1136  H HB2  . ASP B 1 6  ? 10.551  -7.224  1.619   1.00 0.00 ? 6   ASP B HB2  1  
ATOM   1137  H HB3  . ASP B 1 6  ? 9.127   -8.017  2.291   1.00 0.00 ? 6   ASP B HB3  1  
ATOM   1138  N N    . PRO B 1 7  ? 7.953   -6.343  -1.167  1.00 0.00 ? 7   PRO B N    1  
ATOM   1139  C CA   . PRO B 1 7  ? 7.451   -4.997  -1.509  1.00 0.00 ? 7   PRO B CA   1  
ATOM   1140  C C    . PRO B 1 7  ? 6.504   -4.491  -0.398  1.00 0.00 ? 7   PRO B C    1  
ATOM   1141  O O    . PRO B 1 7  ? 6.117   -5.256  0.463   1.00 0.00 ? 7   PRO B O    1  
ATOM   1142  C CB   . PRO B 1 7  ? 6.704   -5.183  -2.853  1.00 0.00 ? 7   PRO B CB   1  
ATOM   1143  C CG   . PRO B 1 7  ? 6.766   -6.695  -3.221  1.00 0.00 ? 7   PRO B CG   1  
ATOM   1144  C CD   . PRO B 1 7  ? 7.542   -7.418  -2.097  1.00 0.00 ? 7   PRO B CD   1  
ATOM   1145  H HA   . PRO B 1 7  ? 8.284   -4.323  -1.634  1.00 0.00 ? 7   PRO B HA   1  
ATOM   1146  H HB2  . PRO B 1 7  ? 5.671   -4.866  -2.756  1.00 0.00 ? 7   PRO B HB2  1  
ATOM   1147  H HB3  . PRO B 1 7  ? 7.187   -4.602  -3.628  1.00 0.00 ? 7   PRO B HB3  1  
ATOM   1148  H HG2  . PRO B 1 7  ? 5.762   -7.097  -3.298  1.00 0.00 ? 7   PRO B HG2  1  
ATOM   1149  H HG3  . PRO B 1 7  ? 7.281   -6.827  -4.163  1.00 0.00 ? 7   PRO B HG3  1  
ATOM   1150  H HD2  . PRO B 1 7  ? 6.898   -8.127  -1.593  1.00 0.00 ? 7   PRO B HD2  1  
ATOM   1151  H HD3  . PRO B 1 7  ? 8.412   -7.917  -2.495  1.00 0.00 ? 7   PRO B HD3  1  
ATOM   1152  N N    . PRO B 1 8  ? 6.152   -3.220  -0.448  1.00 0.00 ? 8   PRO B N    1  
ATOM   1153  C CA   . PRO B 1 8  ? 5.246   -2.628  0.558   1.00 0.00 ? 8   PRO B CA   1  
ATOM   1154  C C    . PRO B 1 8  ? 3.888   -3.345  0.529   1.00 0.00 ? 8   PRO B C    1  
ATOM   1155  O O    . PRO B 1 8  ? 3.778   -4.470  0.084   1.00 0.00 ? 8   PRO B O    1  
ATOM   1156  C CB   . PRO B 1 8  ? 5.109   -1.141  0.146   1.00 0.00 ? 8   PRO B CB   1  
ATOM   1157  C CG   . PRO B 1 8  ? 5.890   -0.953  -1.187  1.00 0.00 ? 8   PRO B CG   1  
ATOM   1158  C CD   . PRO B 1 8  ? 6.620   -2.280  -1.491  1.00 0.00 ? 8   PRO B CD   1  
ATOM   1159  H HA   . PRO B 1 8  ? 5.685   -2.702  1.541   1.00 0.00 ? 8   PRO B HA   1  
ATOM   1160  H HB2  . PRO B 1 8  ? 4.066   -0.879  0.006   1.00 0.00 ? 8   PRO B HB2  1  
ATOM   1161  H HB3  . PRO B 1 8  ? 5.540   -0.506  0.909   1.00 0.00 ? 8   PRO B HB3  1  
ATOM   1162  H HG2  . PRO B 1 8  ? 5.197   -0.718  -1.988  1.00 0.00 ? 8   PRO B HG2  1  
ATOM   1163  H HG3  . PRO B 1 8  ? 6.611   -0.152  -1.087  1.00 0.00 ? 8   PRO B HG3  1  
ATOM   1164  H HD2  . PRO B 1 8  ? 6.356   -2.642  -2.475  1.00 0.00 ? 8   PRO B HD2  1  
ATOM   1165  H HD3  . PRO B 1 8  ? 7.687   -2.144  -1.413  1.00 0.00 ? 8   PRO B HD3  1  
ATOM   1166  N N    . THR B 1 9  ? 2.853   -2.699  1.002   1.00 0.00 ? 9   THR B N    1  
ATOM   1167  C CA   . THR B 1 9  ? 1.506   -3.341  1.003   1.00 0.00 ? 9   THR B CA   1  
ATOM   1168  C C    . THR B 1 9  ? 0.421   -2.265  1.012   1.00 0.00 ? 9   THR B C    1  
ATOM   1169  O O    . THR B 1 9  ? 0.415   -1.376  1.841   1.00 0.00 ? 9   THR B O    1  
ATOM   1170  C CB   . THR B 1 9  ? 1.363   -4.216  2.248   1.00 0.00 ? 9   THR B CB   1  
ATOM   1171  O OG1  . THR B 1 9  ? 2.536   -4.998  2.412   1.00 0.00 ? 9   THR B OG1  1  
ATOM   1172  C CG2  . THR B 1 9  ? 0.150   -5.134  2.092   1.00 0.00 ? 9   THR B CG2  1  
ATOM   1173  H H    . THR B 1 9  ? 2.963   -1.792  1.358   1.00 0.00 ? 9   THR B H    1  
ATOM   1174  H HA   . THR B 1 9  ? 1.392   -3.951  0.118   1.00 0.00 ? 9   THR B HA   1  
ATOM   1175  H HB   . THR B 1 9  ? 1.224   -3.587  3.114   1.00 0.00 ? 9   THR B HB   1  
ATOM   1176  H HG1  . THR B 1 9  ? 2.878   -5.207  1.540   1.00 0.00 ? 9   THR B HG1  1  
ATOM   1177  H HG21 . THR B 1 9  ? -0.709  -4.549  1.799   1.00 0.00 ? 9   THR B HG21 1  
ATOM   1178  H HG22 . THR B 1 9  ? 0.355   -5.876  1.334   1.00 0.00 ? 9   THR B HG22 1  
ATOM   1179  H HG23 . THR B 1 9  ? -0.052  -5.626  3.032   1.00 0.00 ? 9   THR B HG23 1  
ATOM   1180  N N    . ALA B 1 10 ? -0.498  -2.343  0.092   1.00 0.00 ? 10  ALA B N    1  
ATOM   1181  C CA   . ALA B 1 10 ? -1.590  -1.335  0.033   1.00 0.00 ? 10  ALA B CA   1  
ATOM   1182  C C    . ALA B 1 10 ? -2.529  -1.517  1.226   1.00 0.00 ? 10  ALA B C    1  
ATOM   1183  O O    . ALA B 1 10 ? -3.572  -2.130  1.116   1.00 0.00 ? 10  ALA B O    1  
ATOM   1184  C CB   . ALA B 1 10 ? -2.377  -1.527  -1.262  1.00 0.00 ? 10  ALA B CB   1  
ATOM   1185  H H    . ALA B 1 10 ? -0.470  -3.071  -0.564  1.00 0.00 ? 10  ALA B H    1  
ATOM   1186  H HA   . ALA B 1 10 ? -1.168  -0.340  0.055   1.00 0.00 ? 10  ALA B HA   1  
ATOM   1187  H HB1  . ALA B 1 10 ? -2.692  -2.557  -1.340  1.00 0.00 ? 10  ALA B HB1  1  
ATOM   1188  H HB2  . ALA B 1 10 ? -3.243  -0.884  -1.255  1.00 0.00 ? 10  ALA B HB2  1  
ATOM   1189  H HB3  . ALA B 1 10 ? -1.749  -1.278  -2.104  1.00 0.00 ? 10  ALA B HB3  1  
ATOM   1190  N N    . CYS B 1 11 ? -2.171  -0.977  2.364   1.00 0.00 ? 11  CYS B N    1  
ATOM   1191  C CA   . CYS B 1 11 ? -3.040  -1.099  3.578   1.00 0.00 ? 11  CYS B CA   1  
ATOM   1192  C C    . CYS B 1 11 ? -3.658  0.267   3.879   1.00 0.00 ? 11  CYS B C    1  
ATOM   1193  O O    . CYS B 1 11 ? -3.003  1.287   3.789   1.00 0.00 ? 11  CYS B O    1  
ATOM   1194  C CB   . CYS B 1 11 ? -2.190  -1.550  4.769   1.00 0.00 ? 11  CYS B CB   1  
ATOM   1195  S SG   . CYS B 1 11 ? -1.290  -3.060  4.332   1.00 0.00 ? 11  CYS B SG   1  
ATOM   1196  H H    . CYS B 1 11 ? -1.328  -0.481  2.421   1.00 0.00 ? 11  CYS B H    1  
ATOM   1197  H HA   . CYS B 1 11 ? -3.829  -1.820  3.406   1.00 0.00 ? 11  CYS B HA   1  
ATOM   1198  H HB2  . CYS B 1 11 ? -1.486  -0.772  5.024   1.00 0.00 ? 11  CYS B HB2  1  
ATOM   1199  H HB3  . CYS B 1 11 ? -2.832  -1.746  5.616   1.00 0.00 ? 11  CYS B HB3  1  
ATOM   1200  N N    . CYS B 1 12 ? -4.916  0.302   4.223   1.00 0.00 ? 12  CYS B N    1  
ATOM   1201  C CA   . CYS B 1 12 ? -5.568  1.609   4.518   1.00 0.00 ? 12  CYS B CA   1  
ATOM   1202  C C    . CYS B 1 12 ? -5.045  2.158   5.845   1.00 0.00 ? 12  CYS B C    1  
ATOM   1203  O O    . CYS B 1 12 ? -4.816  1.424   6.786   1.00 0.00 ? 12  CYS B O    1  
ATOM   1204  C CB   . CYS B 1 12 ? -7.086  1.422   4.608   1.00 0.00 ? 12  CYS B CB   1  
ATOM   1205  S SG   . CYS B 1 12 ? -7.737  0.949   2.986   1.00 0.00 ? 12  CYS B SG   1  
ATOM   1206  H H    . CYS B 1 12 ? -5.432  -0.529  4.283   1.00 0.00 ? 12  CYS B H    1  
ATOM   1207  H HA   . CYS B 1 12 ? -5.341  2.309   3.728   1.00 0.00 ? 12  CYS B HA   1  
ATOM   1208  H HB2  . CYS B 1 12 ? -7.312  0.648   5.325   1.00 0.00 ? 12  CYS B HB2  1  
ATOM   1209  H HB3  . CYS B 1 12 ? -7.545  2.347   4.923   1.00 0.00 ? 12  CYS B HB3  1  
ATOM   1210  N N    . PHE B 1 13 ? -4.864  3.451   5.928   1.00 0.00 ? 13  PHE B N    1  
ATOM   1211  C CA   . PHE B 1 13 ? -4.364  4.073   7.192   1.00 0.00 ? 13  PHE B CA   1  
ATOM   1212  C C    . PHE B 1 13 ? -5.546  4.724   7.912   1.00 0.00 ? 13  PHE B C    1  
ATOM   1213  O O    . PHE B 1 13 ? -5.492  5.015   9.091   1.00 0.00 ? 13  PHE B O    1  
ATOM   1214  C CB   . PHE B 1 13 ? -3.320  5.143   6.853   1.00 0.00 ? 13  PHE B CB   1  
ATOM   1215  C CG   . PHE B 1 13 ? -3.981  6.269   6.094   1.00 0.00 ? 13  PHE B CG   1  
ATOM   1216  C CD1  . PHE B 1 13 ? -4.292  6.110   4.731   1.00 0.00 ? 13  PHE B CD1  1  
ATOM   1217  C CD2  . PHE B 1 13 ? -4.294  7.475   6.752   1.00 0.00 ? 13  PHE B CD2  1  
ATOM   1218  C CE1  . PHE B 1 13 ? -4.914  7.157   4.024   1.00 0.00 ? 13  PHE B CE1  1  
ATOM   1219  C CE2  . PHE B 1 13 ? -4.917  8.522   6.046   1.00 0.00 ? 13  PHE B CE2  1  
ATOM   1220  C CZ   . PHE B 1 13 ? -5.227  8.363   4.682   1.00 0.00 ? 13  PHE B CZ   1  
ATOM   1221  H H    . PHE B 1 13 ? -5.064  4.019   5.155   1.00 0.00 ? 13  PHE B H    1  
ATOM   1222  H HA   . PHE B 1 13 ? -3.917  3.322   7.828   1.00 0.00 ? 13  PHE B HA   1  
ATOM   1223  H HB2  . PHE B 1 13 ? -2.888  5.527   7.767   1.00 0.00 ? 13  PHE B HB2  1  
ATOM   1224  H HB3  . PHE B 1 13 ? -2.542  4.707   6.244   1.00 0.00 ? 13  PHE B HB3  1  
ATOM   1225  H HD1  . PHE B 1 13 ? -4.051  5.186   4.226   1.00 0.00 ? 13  PHE B HD1  1  
ATOM   1226  H HD2  . PHE B 1 13 ? -4.056  7.596   7.798   1.00 0.00 ? 13  PHE B HD2  1  
ATOM   1227  H HE1  . PHE B 1 13 ? -5.151  7.035   2.978   1.00 0.00 ? 13  PHE B HE1  1  
ATOM   1228  H HE2  . PHE B 1 13 ? -5.156  9.446   6.551   1.00 0.00 ? 13  PHE B HE2  1  
ATOM   1229  H HZ   . PHE B 1 13 ? -5.705  9.165   4.139   1.00 0.00 ? 13  PHE B HZ   1  
ATOM   1230  N N    . SER B 1 14 ? -6.616  4.948   7.201   1.00 0.00 ? 14  SER B N    1  
ATOM   1231  C CA   . SER B 1 14 ? -7.819  5.574   7.815   1.00 0.00 ? 14  SER B CA   1  
ATOM   1232  C C    . SER B 1 14 ? -9.047  5.203   6.982   1.00 0.00 ? 14  SER B C    1  
ATOM   1233  O O    . SER B 1 14 ? -9.050  4.215   6.275   1.00 0.00 ? 14  SER B O    1  
ATOM   1234  C CB   . SER B 1 14 ? -7.653  7.094   7.835   1.00 0.00 ? 14  SER B CB   1  
ATOM   1235  O OG   . SER B 1 14 ? -7.824  7.601   6.518   1.00 0.00 ? 14  SER B OG   1  
ATOM   1236  H H    . SER B 1 14 ? -6.629  4.699   6.253   1.00 0.00 ? 14  SER B H    1  
ATOM   1237  H HA   . SER B 1 14 ? -7.942  5.209   8.825   1.00 0.00 ? 14  SER B HA   1  
ATOM   1238  H HB2  . SER B 1 14 ? -8.395  7.531   8.482   1.00 0.00 ? 14  SER B HB2  1  
ATOM   1239  H HB3  . SER B 1 14 ? -6.666  7.342   8.202   1.00 0.00 ? 14  SER B HB3  1  
ATOM   1240  H HG   . SER B 1 14 ? -7.899  8.556   6.576   1.00 0.00 ? 14  SER B HG   1  
ATOM   1241  N N    . TYR B 1 15 ? -10.093 5.982   7.055   1.00 0.00 ? 15  TYR B N    1  
ATOM   1242  C CA   . TYR B 1 15 ? -11.317 5.663   6.260   1.00 0.00 ? 15  TYR B CA   1  
ATOM   1243  C C    . TYR B 1 15 ? -12.105 6.948   6.004   1.00 0.00 ? 15  TYR B C    1  
ATOM   1244  O O    . TYR B 1 15 ? -11.929 7.940   6.684   1.00 0.00 ? 15  TYR B O    1  
ATOM   1245  C CB   . TYR B 1 15 ? -12.196 4.673   7.041   1.00 0.00 ? 15  TYR B CB   1  
ATOM   1246  C CG   . TYR B 1 15 ? -11.326 3.649   7.727   1.00 0.00 ? 15  TYR B CG   1  
ATOM   1247  C CD1  . TYR B 1 15 ? -10.967 2.464   7.056   1.00 0.00 ? 15  TYR B CD1  1  
ATOM   1248  C CD2  . TYR B 1 15 ? -10.873 3.879   9.040   1.00 0.00 ? 15  TYR B CD2  1  
ATOM   1249  C CE1  . TYR B 1 15 ? -10.155 1.511   7.699   1.00 0.00 ? 15  TYR B CE1  1  
ATOM   1250  C CE2  . TYR B 1 15 ? -10.060 2.926   9.682   1.00 0.00 ? 15  TYR B CE2  1  
ATOM   1251  C CZ   . TYR B 1 15 ? -9.701  1.741   9.012   1.00 0.00 ? 15  TYR B CZ   1  
ATOM   1252  O OH   . TYR B 1 15 ? -8.905  0.806   9.641   1.00 0.00 ? 15  TYR B OH   1  
ATOM   1253  H H    . TYR B 1 15 ? -10.075 6.775   7.630   1.00 0.00 ? 15  TYR B H    1  
ATOM   1254  H HA   . TYR B 1 15 ? -11.032 5.226   5.312   1.00 0.00 ? 15  TYR B HA   1  
ATOM   1255  H HB2  . TYR B 1 15 ? -12.772 5.206   7.784   1.00 0.00 ? 15  TYR B HB2  1  
ATOM   1256  H HB3  . TYR B 1 15 ? -12.866 4.174   6.358   1.00 0.00 ? 15  TYR B HB3  1  
ATOM   1257  H HD1  . TYR B 1 15 ? -11.315 2.287   6.049   1.00 0.00 ? 15  TYR B HD1  1  
ATOM   1258  H HD2  . TYR B 1 15 ? -11.147 4.788   9.555   1.00 0.00 ? 15  TYR B HD2  1  
ATOM   1259  H HE1  . TYR B 1 15 ? -9.879  0.603   7.185   1.00 0.00 ? 15  TYR B HE1  1  
ATOM   1260  H HE2  . TYR B 1 15 ? -9.713  3.103   10.690  1.00 0.00 ? 15  TYR B HE2  1  
ATOM   1261  H HH   . TYR B 1 15 ? -9.480  0.172   10.076  1.00 0.00 ? 15  TYR B HH   1  
ATOM   1262  N N    . THR B 1 16 ? -12.981 6.938   5.037   1.00 0.00 ? 16  THR B N    1  
ATOM   1263  C CA   . THR B 1 16 ? -13.779 8.166   4.760   1.00 0.00 ? 16  THR B CA   1  
ATOM   1264  C C    . THR B 1 16 ? -14.583 8.519   6.016   1.00 0.00 ? 16  THR B C    1  
ATOM   1265  O O    . THR B 1 16 ? -14.271 8.071   7.101   1.00 0.00 ? 16  THR B O    1  
ATOM   1266  C CB   . THR B 1 16 ? -14.715 7.921   3.567   1.00 0.00 ? 16  THR B CB   1  
ATOM   1267  O OG1  . THR B 1 16 ? -15.603 9.018   3.419   1.00 0.00 ? 16  THR B OG1  1  
ATOM   1268  C CG2  . THR B 1 16 ? -15.519 6.638   3.783   1.00 0.00 ? 16  THR B CG2  1  
ATOM   1269  H H    . THR B 1 16 ? -13.121 6.123   4.505   1.00 0.00 ? 16  THR B H    1  
ATOM   1270  H HA   . THR B 1 16 ? -13.108 8.980   4.527   1.00 0.00 ? 16  THR B HA   1  
ATOM   1271  H HB   . THR B 1 16 ? -14.126 7.820   2.670   1.00 0.00 ? 16  THR B HB   1  
ATOM   1272  H HG1  . THR B 1 16 ? -15.382 9.470   2.601   1.00 0.00 ? 16  THR B HG1  1  
ATOM   1273  H HG21 . THR B 1 16 ? -14.843 5.803   3.886   1.00 0.00 ? 16  THR B HG21 1  
ATOM   1274  H HG22 . THR B 1 16 ? -16.115 6.733   4.677   1.00 0.00 ? 16  THR B HG22 1  
ATOM   1275  H HG23 . THR B 1 16 ? -16.166 6.474   2.933   1.00 0.00 ? 16  THR B HG23 1  
ATOM   1276  N N    . ALA B 1 17 ? -15.609 9.317   5.887   1.00 0.00 ? 17  ALA B N    1  
ATOM   1277  C CA   . ALA B 1 17 ? -16.424 9.696   7.082   1.00 0.00 ? 17  ALA B CA   1  
ATOM   1278  C C    . ALA B 1 17 ? -17.893 9.791   6.674   1.00 0.00 ? 17  ALA B C    1  
ATOM   1279  O O    . ALA B 1 17 ? -18.733 10.233  7.433   1.00 0.00 ? 17  ALA B O    1  
ATOM   1280  C CB   . ALA B 1 17 ? -15.952 11.054  7.604   1.00 0.00 ? 17  ALA B CB   1  
ATOM   1281  H H    . ALA B 1 17 ? -15.845 9.673   5.008   1.00 0.00 ? 17  ALA B H    1  
ATOM   1282  H HA   . ALA B 1 17 ? -16.315 8.951   7.858   1.00 0.00 ? 17  ALA B HA   1  
ATOM   1283  H HB1  . ALA B 1 17 ? -16.051 11.793  6.824   1.00 0.00 ? 17  ALA B HB1  1  
ATOM   1284  H HB2  . ALA B 1 17 ? -16.554 11.342  8.452   1.00 0.00 ? 17  ALA B HB2  1  
ATOM   1285  H HB3  . ALA B 1 17 ? -14.917 10.983  7.905   1.00 0.00 ? 17  ALA B HB3  1  
ATOM   1286  N N    . ARG B 1 18 ? -18.209 9.374   5.477   1.00 0.00 ? 18  ARG B N    1  
ATOM   1287  C CA   . ARG B 1 18 ? -19.622 9.430   4.999   1.00 0.00 ? 18  ARG B CA   1  
ATOM   1288  C C    . ARG B 1 18 ? -19.915 8.189   4.152   1.00 0.00 ? 18  ARG B C    1  
ATOM   1289  O O    . ARG B 1 18 ? -19.141 7.817   3.292   1.00 0.00 ? 18  ARG B O    1  
ATOM   1290  C CB   . ARG B 1 18 ? -19.816 10.690  4.149   1.00 0.00 ? 18  ARG B CB   1  
ATOM   1291  C CG   . ARG B 1 18 ? -19.997 11.904  5.063   1.00 0.00 ? 18  ARG B CG   1  
ATOM   1292  C CD   . ARG B 1 18 ? -19.831 13.184  4.248   1.00 0.00 ? 18  ARG B CD   1  
ATOM   1293  N NE   . ARG B 1 18 ? -20.336 14.345  5.034   1.00 0.00 ? 18  ARG B NE   1  
ATOM   1294  C CZ   . ARG B 1 18 ? -20.026 15.560  4.675   1.00 0.00 ? 18  ARG B CZ   1  
ATOM   1295  N NH1  . ARG B 1 18 ? -19.273 15.760  3.628   1.00 0.00 ? 18  ARG B NH1  1  
ATOM   1296  N NH2  . ARG B 1 18 ? -20.470 16.577  5.363   1.00 0.00 ? 18  ARG B NH2  1  
ATOM   1297  H H    . ARG B 1 18 ? -17.511 9.020   4.887   1.00 0.00 ? 18  ARG B H    1  
ATOM   1298  H HA   . ARG B 1 18 ? -20.298 9.455   5.843   1.00 0.00 ? 18  ARG B HA   1  
ATOM   1299  H HB2  . ARG B 1 18 ? -18.948 10.836  3.523   1.00 0.00 ? 18  ARG B HB2  1  
ATOM   1300  H HB3  . ARG B 1 18 ? -20.692 10.576  3.528   1.00 0.00 ? 18  ARG B HB3  1  
ATOM   1301  H HG2  . ARG B 1 18 ? -20.985 11.881  5.502   1.00 0.00 ? 18  ARG B HG2  1  
ATOM   1302  H HG3  . ARG B 1 18 ? -19.255 11.881  5.846   1.00 0.00 ? 18  ARG B HG3  1  
ATOM   1303  H HD2  . ARG B 1 18 ? -18.785 13.330  4.021   1.00 0.00 ? 18  ARG B HD2  1  
ATOM   1304  H HD3  . ARG B 1 18 ? -20.391 13.099  3.329   1.00 0.00 ? 18  ARG B HD3  1  
ATOM   1305  H HE   . ARG B 1 18 ? -20.901 14.195  5.820   1.00 0.00 ? 18  ARG B HE   1  
ATOM   1306  H HH11 . ARG B 1 18 ? -18.932 14.981  3.101   1.00 0.00 ? 18  ARG B HH11 1  
ATOM   1307  H HH12 . ARG B 1 18 ? -19.035 16.692  3.353   1.00 0.00 ? 18  ARG B HH12 1  
ATOM   1308  H HH21 . ARG B 1 18 ? -21.047 16.424  6.165   1.00 0.00 ? 18  ARG B HH21 1  
ATOM   1309  H HH22 . ARG B 1 18 ? -20.233 17.508  5.087   1.00 0.00 ? 18  ARG B HH22 1  
ATOM   1310  N N    . LYS B 1 19 ? -21.027 7.549   4.382   1.00 0.00 ? 19  LYS B N    1  
ATOM   1311  C CA   . LYS B 1 19 ? -21.365 6.339   3.583   1.00 0.00 ? 19  LYS B CA   1  
ATOM   1312  C C    . LYS B 1 19 ? -21.550 6.748   2.117   1.00 0.00 ? 19  LYS B C    1  
ATOM   1313  O O    . LYS B 1 19 ? -22.259 7.684   1.806   1.00 0.00 ? 19  LYS B O    1  
ATOM   1314  C CB   . LYS B 1 19 ? -22.656 5.710   4.134   1.00 0.00 ? 19  LYS B CB   1  
ATOM   1315  C CG   . LYS B 1 19 ? -23.302 4.801   3.079   1.00 0.00 ? 19  LYS B CG   1  
ATOM   1316  C CD   . LYS B 1 19 ? -24.341 3.894   3.743   1.00 0.00 ? 19  LYS B CD   1  
ATOM   1317  C CE   . LYS B 1 19 ? -25.472 4.734   4.337   1.00 0.00 ? 19  LYS B CE   1  
ATOM   1318  N NZ   . LYS B 1 19 ? -25.908 5.764   3.353   1.00 0.00 ? 19  LYS B NZ   1  
ATOM   1319  H H    . LYS B 1 19 ? -21.642 7.866   5.077   1.00 0.00 ? 19  LYS B H    1  
ATOM   1320  H HA   . LYS B 1 19 ? -20.557 5.625   3.656   1.00 0.00 ? 19  LYS B HA   1  
ATOM   1321  H HB2  . LYS B 1 19 ? -22.419 5.125   5.011   1.00 0.00 ? 19  LYS B HB2  1  
ATOM   1322  H HB3  . LYS B 1 19 ? -23.346 6.492   4.405   1.00 0.00 ? 19  LYS B HB3  1  
ATOM   1323  H HG2  . LYS B 1 19 ? -23.781 5.408   2.324   1.00 0.00 ? 19  LYS B HG2  1  
ATOM   1324  H HG3  . LYS B 1 19 ? -22.541 4.191   2.617   1.00 0.00 ? 19  LYS B HG3  1  
ATOM   1325  H HD2  . LYS B 1 19 ? -24.746 3.214   3.010   1.00 0.00 ? 19  LYS B HD2  1  
ATOM   1326  H HD3  . LYS B 1 19 ? -23.867 3.333   4.528   1.00 0.00 ? 19  LYS B HD3  1  
ATOM   1327  H HE2  . LYS B 1 19 ? -26.307 4.090   4.575   1.00 0.00 ? 19  LYS B HE2  1  
ATOM   1328  H HE3  . LYS B 1 19 ? -25.125 5.217   5.237   1.00 0.00 ? 19  LYS B HE3  1  
ATOM   1329  H HZ1  . LYS B 1 19 ? -25.682 5.441   2.390   1.00 0.00 ? 19  LYS B HZ1  1  
ATOM   1330  H HZ2  . LYS B 1 19 ? -26.933 5.914   3.438   1.00 0.00 ? 19  LYS B HZ2  1  
ATOM   1331  H HZ3  . LYS B 1 19 ? -25.413 6.658   3.544   1.00 0.00 ? 19  LYS B HZ3  1  
ATOM   1332  N N    . LEU B 1 20 ? -20.916 6.048   1.217   1.00 0.00 ? 20  LEU B N    1  
ATOM   1333  C CA   . LEU B 1 20 ? -21.052 6.390   -0.224  1.00 0.00 ? 20  LEU B CA   1  
ATOM   1334  C C    . LEU B 1 20 ? -22.439 5.931   -0.732  1.00 0.00 ? 20  LEU B C    1  
ATOM   1335  O O    . LEU B 1 20 ? -22.760 4.768   -0.589  1.00 0.00 ? 20  LEU B O    1  
ATOM   1336  C CB   . LEU B 1 20 ? -19.978 5.642   -1.016  1.00 0.00 ? 20  LEU B CB   1  
ATOM   1337  C CG   . LEU B 1 20 ? -18.620 5.781   -0.326  1.00 0.00 ? 20  LEU B CG   1  
ATOM   1338  C CD1  . LEU B 1 20 ? -17.542 5.177   -1.225  1.00 0.00 ? 20  LEU B CD1  1  
ATOM   1339  C CD2  . LEU B 1 20 ? -18.309 7.261   -0.079  1.00 0.00 ? 20  LEU B CD2  1  
ATOM   1340  H H    . LEU B 1 20 ? -20.350 5.296   1.491   1.00 0.00 ? 20  LEU B H    1  
ATOM   1341  H HA   . LEU B 1 20 ? -20.915 7.445   -0.349  1.00 0.00 ? 20  LEU B HA   1  
ATOM   1342  H HB2  . LEU B 1 20 ? -20.241 4.595   -1.076  1.00 0.00 ? 20  LEU B HB2  1  
ATOM   1343  H HB3  . LEU B 1 20 ? -19.916 6.051   -2.012  1.00 0.00 ? 20  LEU B HB3  1  
ATOM   1344  H HG   . LEU B 1 20 ? -18.641 5.252   0.616   1.00 0.00 ? 20  LEU B HG   1  
ATOM   1345  H HD11 . LEU B 1 20 ? -17.868 4.210   -1.578  1.00 0.00 ? 20  LEU B HD11 1  
ATOM   1346  H HD12 . LEU B 1 20 ? -17.371 5.829   -2.069  1.00 0.00 ? 20  LEU B HD12 1  
ATOM   1347  H HD13 . LEU B 1 20 ? -16.627 5.067   -0.664  1.00 0.00 ? 20  LEU B HD13 1  
ATOM   1348  H HD21 . LEU B 1 20 ? -18.578 7.838   -0.951  1.00 0.00 ? 20  LEU B HD21 1  
ATOM   1349  H HD22 . LEU B 1 20 ? -18.873 7.611   0.773   1.00 0.00 ? 20  LEU B HD22 1  
ATOM   1350  H HD23 . LEU B 1 20 ? -17.253 7.380   0.119   1.00 0.00 ? 20  LEU B HD23 1  
ATOM   1351  N N    . PRO B 1 21 ? -23.231 6.813   -1.326  1.00 0.00 ? 21  PRO B N    1  
ATOM   1352  C CA   . PRO B 1 21 ? -24.549 6.400   -1.842  1.00 0.00 ? 21  PRO B CA   1  
ATOM   1353  C C    . PRO B 1 21 ? -24.376 5.232   -2.816  1.00 0.00 ? 21  PRO B C    1  
ATOM   1354  O O    . PRO B 1 21 ? -23.421 5.177   -3.562  1.00 0.00 ? 21  PRO B O    1  
ATOM   1355  C CB   . PRO B 1 21 ? -25.104 7.646   -2.570  1.00 0.00 ? 21  PRO B CB   1  
ATOM   1356  C CG   . PRO B 1 21 ? -24.139 8.827   -2.266  1.00 0.00 ? 21  PRO B CG   1  
ATOM   1357  C CD   . PRO B 1 21 ? -22.911 8.245   -1.532  1.00 0.00 ? 21  PRO B CD   1  
ATOM   1358  H HA   . PRO B 1 21 ? -25.201 6.120   -1.029  1.00 0.00 ? 21  PRO B HA   1  
ATOM   1359  H HB2  . PRO B 1 21 ? -25.144 7.470   -3.640  1.00 0.00 ? 21  PRO B HB2  1  
ATOM   1360  H HB3  . PRO B 1 21 ? -26.092 7.876   -2.209  1.00 0.00 ? 21  PRO B HB3  1  
ATOM   1361  H HG2  . PRO B 1 21 ? -23.830 9.301   -3.191  1.00 0.00 ? 21  PRO B HG2  1  
ATOM   1362  H HG3  . PRO B 1 21 ? -24.631 9.554   -1.633  1.00 0.00 ? 21  PRO B HG3  1  
ATOM   1363  H HD2  . PRO B 1 21 ? -22.023 8.350   -2.144  1.00 0.00 ? 21  PRO B HD2  1  
ATOM   1364  H HD3  . PRO B 1 21 ? -22.775 8.737   -0.579  1.00 0.00 ? 21  PRO B HD3  1  
ATOM   1365  N N    . ARG B 1 22 ? -25.299 4.311   -2.832  1.00 0.00 ? 22  ARG B N    1  
ATOM   1366  C CA   . ARG B 1 22 ? -25.180 3.172   -3.783  1.00 0.00 ? 22  ARG B CA   1  
ATOM   1367  C C    . ARG B 1 22 ? -24.924 3.732   -5.183  1.00 0.00 ? 22  ARG B C    1  
ATOM   1368  O O    . ARG B 1 22 ? -24.237 3.137   -5.990  1.00 0.00 ? 22  ARG B O    1  
ATOM   1369  C CB   . ARG B 1 22 ? -26.475 2.363   -3.783  1.00 0.00 ? 22  ARG B CB   1  
ATOM   1370  C CG   . ARG B 1 22 ? -26.289 1.113   -4.651  1.00 0.00 ? 22  ARG B CG   1  
ATOM   1371  C CD   . ARG B 1 22 ? -27.543 0.234   -4.576  1.00 0.00 ? 22  ARG B CD   1  
ATOM   1372  N NE   . ARG B 1 22 ? -27.178 -1.192  -4.860  1.00 0.00 ? 22  ARG B NE   1  
ATOM   1373  C CZ   . ARG B 1 22 ? -26.505 -1.522  -5.932  1.00 0.00 ? 22  ARG B CZ   1  
ATOM   1374  N NH1  . ARG B 1 22 ? -26.302 -0.651  -6.881  1.00 0.00 ? 22  ARG B NH1  1  
ATOM   1375  N NH2  . ARG B 1 22 ? -26.087 -2.750  -6.080  1.00 0.00 ? 22  ARG B NH2  1  
ATOM   1376  H H    . ARG B 1 22 ? -26.072 4.376   -2.234  1.00 0.00 ? 22  ARG B H    1  
ATOM   1377  H HA   . ARG B 1 22 ? -24.358 2.537   -3.491  1.00 0.00 ? 22  ARG B HA   1  
ATOM   1378  H HB2  . ARG B 1 22 ? -26.715 2.071   -2.770  1.00 0.00 ? 22  ARG B HB2  1  
ATOM   1379  H HB3  . ARG B 1 22 ? -27.277 2.963   -4.186  1.00 0.00 ? 22  ARG B HB3  1  
ATOM   1380  H HG2  . ARG B 1 22 ? -26.116 1.418   -5.670  1.00 0.00 ? 22  ARG B HG2  1  
ATOM   1381  H HG3  . ARG B 1 22 ? -25.437 0.553   -4.294  1.00 0.00 ? 22  ARG B HG3  1  
ATOM   1382  H HD2  . ARG B 1 22 ? -27.954 0.273   -3.583  1.00 0.00 ? 22  ARG B HD2  1  
ATOM   1383  H HD3  . ARG B 1 22 ? -28.281 0.603   -5.282  1.00 0.00 ? 22  ARG B HD3  1  
ATOM   1384  H HE   . ARG B 1 22 ? -27.402 -1.884  -4.203  1.00 0.00 ? 22  ARG B HE   1  
ATOM   1385  H HH11 . ARG B 1 22 ? -26.664 0.273   -6.798  1.00 0.00 ? 22  ARG B HH11 1  
ATOM   1386  H HH12 . ARG B 1 22 ? -25.781 -0.912  -7.694  1.00 0.00 ? 22  ARG B HH12 1  
ATOM   1387  H HH21 . ARG B 1 22 ? -26.280 -3.433  -5.375  1.00 0.00 ? 22  ARG B HH21 1  
ATOM   1388  H HH22 . ARG B 1 22 ? -25.572 -3.007  -6.898  1.00 0.00 ? 22  ARG B HH22 1  
ATOM   1389  N N    . ASN B 1 23 ? -25.474 4.882   -5.470  1.00 0.00 ? 23  ASN B N    1  
ATOM   1390  C CA   . ASN B 1 23 ? -25.269 5.500   -6.811  1.00 0.00 ? 23  ASN B CA   1  
ATOM   1391  C C    . ASN B 1 23 ? -23.837 6.030   -6.919  1.00 0.00 ? 23  ASN B C    1  
ATOM   1392  O O    . ASN B 1 23 ? -23.520 6.808   -7.797  1.00 0.00 ? 23  ASN B O    1  
ATOM   1393  C CB   . ASN B 1 23 ? -26.255 6.656   -6.993  1.00 0.00 ? 23  ASN B CB   1  
ATOM   1394  C CG   . ASN B 1 23 ? -26.164 7.185   -8.425  1.00 0.00 ? 23  ASN B CG   1  
ATOM   1395  O OD1  . ASN B 1 23 ? -25.668 6.509   -9.305  1.00 0.00 ? 23  ASN B OD1  1  
ATOM   1396  N ND2  . ASN B 1 23 ? -26.625 8.375   -8.699  1.00 0.00 ? 23  ASN B ND2  1  
ATOM   1397  H H    . ASN B 1 23 ? -26.020 5.345   -4.796  1.00 0.00 ? 23  ASN B H    1  
ATOM   1398  H HA   . ASN B 1 23 ? -25.438 4.760   -7.578  1.00 0.00 ? 23  ASN B HA   1  
ATOM   1399  H HB2  . ASN B 1 23 ? -27.259 6.306   -6.801  1.00 0.00 ? 23  ASN B HB2  1  
ATOM   1400  H HB3  . ASN B 1 23 ? -26.012 7.449   -6.302  1.00 0.00 ? 23  ASN B HB3  1  
ATOM   1401  H HD21 . ASN B 1 23 ? -27.024 8.921   -7.989  1.00 0.00 ? 23  ASN B HD21 1  
ATOM   1402  H HD22 . ASN B 1 23 ? -26.571 8.723   -9.613  1.00 0.00 ? 23  ASN B HD22 1  
ATOM   1403  N N    . PHE B 1 24 ? -22.971 5.623   -6.026  1.00 0.00 ? 24  PHE B N    1  
ATOM   1404  C CA   . PHE B 1 24 ? -21.555 6.108   -6.064  1.00 0.00 ? 24  PHE B CA   1  
ATOM   1405  C C    . PHE B 1 24 ? -20.621 4.937   -5.742  1.00 0.00 ? 24  PHE B C    1  
ATOM   1406  O O    . PHE B 1 24 ? -19.537 5.116   -5.223  1.00 0.00 ? 24  PHE B O    1  
ATOM   1407  C CB   . PHE B 1 24 ? -21.384 7.219   -5.012  1.00 0.00 ? 24  PHE B CB   1  
ATOM   1408  C CG   . PHE B 1 24 ? -20.195 8.095   -5.346  1.00 0.00 ? 24  PHE B CG   1  
ATOM   1409  C CD1  . PHE B 1 24 ? -20.181 8.831   -6.547  1.00 0.00 ? 24  PHE B CD1  1  
ATOM   1410  C CD2  . PHE B 1 24 ? -19.107 8.187   -4.453  1.00 0.00 ? 24  PHE B CD2  1  
ATOM   1411  C CE1  . PHE B 1 24 ? -19.084 9.655   -6.856  1.00 0.00 ? 24  PHE B CE1  1  
ATOM   1412  C CE2  . PHE B 1 24 ? -18.009 9.011   -4.764  1.00 0.00 ? 24  PHE B CE2  1  
ATOM   1413  C CZ   . PHE B 1 24 ? -17.997 9.745   -5.965  1.00 0.00 ? 24  PHE B CZ   1  
ATOM   1414  H H    . PHE B 1 24 ? -23.255 5.003   -5.324  1.00 0.00 ? 24  PHE B H    1  
ATOM   1415  H HA   . PHE B 1 24 ? -21.319 6.491   -7.049  1.00 0.00 ? 24  PHE B HA   1  
ATOM   1416  H HB2  . PHE B 1 24 ? -22.274 7.826   -4.991  1.00 0.00 ? 24  PHE B HB2  1  
ATOM   1417  H HB3  . PHE B 1 24 ? -21.237 6.772   -4.037  1.00 0.00 ? 24  PHE B HB3  1  
ATOM   1418  H HD1  . PHE B 1 24 ? -21.013 8.767   -7.233  1.00 0.00 ? 24  PHE B HD1  1  
ATOM   1419  H HD2  . PHE B 1 24 ? -19.115 7.625   -3.533  1.00 0.00 ? 24  PHE B HD2  1  
ATOM   1420  H HE1  . PHE B 1 24 ? -19.078 10.217  -7.776  1.00 0.00 ? 24  PHE B HE1  1  
ATOM   1421  H HE2  . PHE B 1 24 ? -17.175 9.080   -4.081  1.00 0.00 ? 24  PHE B HE2  1  
ATOM   1422  H HZ   . PHE B 1 24 ? -17.155 10.377  -6.203  1.00 0.00 ? 24  PHE B HZ   1  
ATOM   1423  N N    . VAL B 1 25 ? -21.039 3.737   -6.052  1.00 0.00 ? 25  VAL B N    1  
ATOM   1424  C CA   . VAL B 1 25 ? -20.189 2.541   -5.773  1.00 0.00 ? 25  VAL B CA   1  
ATOM   1425  C C    . VAL B 1 25 ? -20.479 1.471   -6.828  1.00 0.00 ? 25  VAL B C    1  
ATOM   1426  O O    . VAL B 1 25 ? -21.354 0.645   -6.664  1.00 0.00 ? 25  VAL B O    1  
ATOM   1427  C CB   . VAL B 1 25 ? -20.521 1.985   -4.386  1.00 0.00 ? 25  VAL B CB   1  
ATOM   1428  C CG1  . VAL B 1 25 ? -19.591 0.815   -4.067  1.00 0.00 ? 25  VAL B CG1  1  
ATOM   1429  C CG2  . VAL B 1 25 ? -20.332 3.080   -3.335  1.00 0.00 ? 25  VAL B CG2  1  
ATOM   1430  H H    . VAL B 1 25 ? -21.917 3.622   -6.471  1.00 0.00 ? 25  VAL B H    1  
ATOM   1431  H HA   . VAL B 1 25 ? -19.145 2.815   -5.814  1.00 0.00 ? 25  VAL B HA   1  
ATOM   1432  H HB   . VAL B 1 25 ? -21.546 1.643   -4.371  1.00 0.00 ? 25  VAL B HB   1  
ATOM   1433  H HG11 . VAL B 1 25 ? -18.564 1.147   -4.115  1.00 0.00 ? 25  VAL B HG11 1  
ATOM   1434  H HG12 . VAL B 1 25 ? -19.803 0.448   -3.074  1.00 0.00 ? 25  VAL B HG12 1  
ATOM   1435  H HG13 . VAL B 1 25 ? -19.747 0.023   -4.784  1.00 0.00 ? 25  VAL B HG13 1  
ATOM   1436  H HG21 . VAL B 1 25 ? -19.370 3.551   -3.474  1.00 0.00 ? 25  VAL B HG21 1  
ATOM   1437  H HG22 . VAL B 1 25 ? -21.114 3.818   -3.437  1.00 0.00 ? 25  VAL B HG22 1  
ATOM   1438  H HG23 . VAL B 1 25 ? -20.377 2.641   -2.349  1.00 0.00 ? 25  VAL B HG23 1  
ATOM   1439  N N    . VAL B 1 26 ? -19.755 1.485   -7.914  1.00 0.00 ? 26  VAL B N    1  
ATOM   1440  C CA   . VAL B 1 26 ? -19.990 0.479   -8.985  1.00 0.00 ? 26  VAL B CA   1  
ATOM   1441  C C    . VAL B 1 26 ? -19.216 -0.801  -8.674  1.00 0.00 ? 26  VAL B C    1  
ATOM   1442  O O    . VAL B 1 26 ? -19.427 -1.828  -9.288  1.00 0.00 ? 26  VAL B O    1  
ATOM   1443  C CB   . VAL B 1 26 ? -19.518 1.049   -10.322 1.00 0.00 ? 26  VAL B CB   1  
ATOM   1444  C CG1  . VAL B 1 26 ? -20.399 2.237   -10.708 1.00 0.00 ? 26  VAL B CG1  1  
ATOM   1445  C CG2  . VAL B 1 26 ? -18.064 1.516   -10.198 1.00 0.00 ? 26  VAL B CG2  1  
ATOM   1446  H H    . VAL B 1 26 ? -19.058 2.163   -8.030  1.00 0.00 ? 26  VAL B H    1  
ATOM   1447  H HA   . VAL B 1 26 ? -21.045 0.251   -9.045  1.00 0.00 ? 26  VAL B HA   1  
ATOM   1448  H HB   . VAL B 1 26 ? -19.589 0.288   -11.080 1.00 0.00 ? 26  VAL B HB   1  
ATOM   1449  H HG11 . VAL B 1 26 ? -20.402 2.957   -9.903  1.00 0.00 ? 26  VAL B HG11 1  
ATOM   1450  H HG12 . VAL B 1 26 ? -20.011 2.698   -11.604 1.00 0.00 ? 26  VAL B HG12 1  
ATOM   1451  H HG13 . VAL B 1 26 ? -21.408 1.893   -10.888 1.00 0.00 ? 26  VAL B HG13 1  
ATOM   1452  H HG21 . VAL B 1 26 ? -17.447 0.693   -9.870  1.00 0.00 ? 26  VAL B HG21 1  
ATOM   1453  H HG22 . VAL B 1 26 ? -17.716 1.866   -11.159 1.00 0.00 ? 26  VAL B HG22 1  
ATOM   1454  H HG23 . VAL B 1 26 ? -18.004 2.320   -9.480  1.00 0.00 ? 26  VAL B HG23 1  
ATOM   1455  N N    . ASP B 1 27 ? -18.319 -0.753  -7.729  1.00 0.00 ? 27  ASP B N    1  
ATOM   1456  C CA   . ASP B 1 27 ? -17.540 -1.977  -7.395  1.00 0.00 ? 27  ASP B CA   1  
ATOM   1457  C C    . ASP B 1 27 ? -16.745 -1.737  -6.116  1.00 0.00 ? 27  ASP B C    1  
ATOM   1458  O O    . ASP B 1 27 ? -16.917 -0.737  -5.447  1.00 0.00 ? 27  ASP B O    1  
ATOM   1459  C CB   . ASP B 1 27 ? -16.579 -2.296  -8.543  1.00 0.00 ? 27  ASP B CB   1  
ATOM   1460  C CG   . ASP B 1 27 ? -16.012 -3.705  -8.359  1.00 0.00 ? 27  ASP B CG   1  
ATOM   1461  O OD1  . ASP B 1 27 ? -16.777 -4.649  -8.472  1.00 0.00 ? 27  ASP B OD1  1  
ATOM   1462  O OD2  . ASP B 1 27 ? -14.823 -3.815  -8.109  1.00 0.00 ? 27  ASP B OD2  1  
ATOM   1463  H H    . ASP B 1 27 ? -18.157 0.086   -7.243  1.00 0.00 ? 27  ASP B H    1  
ATOM   1464  H HA   . ASP B 1 27 ? -18.216 -2.806  -7.248  1.00 0.00 ? 27  ASP B HA   1  
ATOM   1465  H HB2  . ASP B 1 27 ? -17.111 -2.241  -9.482  1.00 0.00 ? 27  ASP B HB2  1  
ATOM   1466  H HB3  . ASP B 1 27 ? -15.769 -1.581  -8.546  1.00 0.00 ? 27  ASP B HB3  1  
ATOM   1467  N N    . TYR B 1 28 ? -15.872 -2.642  -5.767  1.00 0.00 ? 28  TYR B N    1  
ATOM   1468  C CA   . TYR B 1 28 ? -15.067 -2.453  -4.529  1.00 0.00 ? 28  TYR B CA   1  
ATOM   1469  C C    . TYR B 1 28 ? -13.770 -3.253  -4.621  1.00 0.00 ? 28  TYR B C    1  
ATOM   1470  O O    . TYR B 1 28 ? -13.461 -3.858  -5.628  1.00 0.00 ? 28  TYR B O    1  
ATOM   1471  C CB   . TYR B 1 28 ? -15.874 -2.895  -3.301  1.00 0.00 ? 28  TYR B CB   1  
ATOM   1472  C CG   . TYR B 1 28 ? -15.973 -4.407  -3.237  1.00 0.00 ? 28  TYR B CG   1  
ATOM   1473  C CD1  . TYR B 1 28 ? -16.648 -5.116  -4.250  1.00 0.00 ? 28  TYR B CD1  1  
ATOM   1474  C CD2  . TYR B 1 28 ? -15.400 -5.104  -2.154  1.00 0.00 ? 28  TYR B CD2  1  
ATOM   1475  C CE1  . TYR B 1 28 ? -16.747 -6.518  -4.182  1.00 0.00 ? 28  TYR B CE1  1  
ATOM   1476  C CE2  . TYR B 1 28 ? -15.499 -6.505  -2.084  1.00 0.00 ? 28  TYR B CE2  1  
ATOM   1477  C CZ   . TYR B 1 28 ? -16.173 -7.214  -3.098  1.00 0.00 ? 28  TYR B CZ   1  
ATOM   1478  O OH   . TYR B 1 28 ? -16.271 -8.589  -3.031  1.00 0.00 ? 28  TYR B OH   1  
ATOM   1479  H H    . TYR B 1 28 ? -15.744 -3.441  -6.318  1.00 0.00 ? 28  TYR B H    1  
ATOM   1480  H HA   . TYR B 1 28 ? -14.820 -1.405  -4.425  1.00 0.00 ? 28  TYR B HA   1  
ATOM   1481  H HB2  . TYR B 1 28 ? -15.390 -2.528  -2.409  1.00 0.00 ? 28  TYR B HB2  1  
ATOM   1482  H HB3  . TYR B 1 28 ? -16.864 -2.476  -3.361  1.00 0.00 ? 28  TYR B HB3  1  
ATOM   1483  H HD1  . TYR B 1 28 ? -17.089 -4.586  -5.080  1.00 0.00 ? 28  TYR B HD1  1  
ATOM   1484  H HD2  . TYR B 1 28 ? -14.882 -4.563  -1.378  1.00 0.00 ? 28  TYR B HD2  1  
ATOM   1485  H HE1  . TYR B 1 28 ? -17.267 -7.059  -4.960  1.00 0.00 ? 28  TYR B HE1  1  
ATOM   1486  H HE2  . TYR B 1 28 ? -15.059 -7.035  -1.250  1.00 0.00 ? 28  TYR B HE2  1  
ATOM   1487  H HH   . TYR B 1 28 ? -15.400 -8.939  -2.833  1.00 0.00 ? 28  TYR B HH   1  
ATOM   1488  N N    . TYR B 1 29 ? -13.008 -3.239  -3.571  1.00 0.00 ? 29  TYR B N    1  
ATOM   1489  C CA   . TYR B 1 29 ? -11.715 -3.967  -3.560  1.00 0.00 ? 29  TYR B CA   1  
ATOM   1490  C C    . TYR B 1 29 ? -11.285 -4.156  -2.099  1.00 0.00 ? 29  TYR B C    1  
ATOM   1491  O O    . TYR B 1 29 ? -11.468 -3.279  -1.284  1.00 0.00 ? 29  TYR B O    1  
ATOM   1492  C CB   . TYR B 1 29 ? -10.685 -3.128  -4.336  1.00 0.00 ? 29  TYR B CB   1  
ATOM   1493  C CG   . TYR B 1 29 ? -9.278  -3.545  -3.981  1.00 0.00 ? 29  TYR B CG   1  
ATOM   1494  C CD1  . TYR B 1 29 ? -8.764  -4.758  -4.467  1.00 0.00 ? 29  TYR B CD1  1  
ATOM   1495  C CD2  . TYR B 1 29 ? -8.485  -2.718  -3.162  1.00 0.00 ? 29  TYR B CD2  1  
ATOM   1496  C CE1  . TYR B 1 29 ? -7.453  -5.150  -4.134  1.00 0.00 ? 29  TYR B CE1  1  
ATOM   1497  C CE2  . TYR B 1 29 ? -7.174  -3.108  -2.828  1.00 0.00 ? 29  TYR B CE2  1  
ATOM   1498  C CZ   . TYR B 1 29 ? -6.657  -4.324  -3.314  1.00 0.00 ? 29  TYR B CZ   1  
ATOM   1499  O OH   . TYR B 1 29 ? -5.373  -4.708  -2.987  1.00 0.00 ? 29  TYR B OH   1  
ATOM   1500  H H    . TYR B 1 29 ? -13.288 -2.736  -2.782  1.00 0.00 ? 29  TYR B H    1  
ATOM   1501  H HA   . TYR B 1 29 ? -11.835 -4.931  -4.034  1.00 0.00 ? 29  TYR B HA   1  
ATOM   1502  H HB2  . TYR B 1 29 ? -10.840 -3.268  -5.395  1.00 0.00 ? 29  TYR B HB2  1  
ATOM   1503  H HB3  . TYR B 1 29 ? -10.823 -2.084  -4.093  1.00 0.00 ? 29  TYR B HB3  1  
ATOM   1504  H HD1  . TYR B 1 29 ? -9.375  -5.388  -5.098  1.00 0.00 ? 29  TYR B HD1  1  
ATOM   1505  H HD2  . TYR B 1 29 ? -8.883  -1.783  -2.792  1.00 0.00 ? 29  TYR B HD2  1  
ATOM   1506  H HE1  . TYR B 1 29 ? -7.056  -6.082  -4.507  1.00 0.00 ? 29  TYR B HE1  1  
ATOM   1507  H HE2  . TYR B 1 29 ? -6.566  -2.474  -2.199  1.00 0.00 ? 29  TYR B HE2  1  
ATOM   1508  H HH   . TYR B 1 29 ? -5.352  -5.666  -2.942  1.00 0.00 ? 29  TYR B HH   1  
ATOM   1509  N N    . GLU B 1 30 ? -10.725 -5.287  -1.757  1.00 0.00 ? 30  GLU B N    1  
ATOM   1510  C CA   . GLU B 1 30 ? -10.294 -5.515  -0.339  1.00 0.00 ? 30  GLU B CA   1  
ATOM   1511  C C    . GLU B 1 30 ? -8.791  -5.244  -0.205  1.00 0.00 ? 30  GLU B C    1  
ATOM   1512  O O    . GLU B 1 30 ? -8.050  -5.303  -1.166  1.00 0.00 ? 30  GLU B O    1  
ATOM   1513  C CB   . GLU B 1 30 ? -10.591 -6.963  0.056   1.00 0.00 ? 30  GLU B CB   1  
ATOM   1514  C CG   . GLU B 1 30 ? -12.091 -7.130  0.308   1.00 0.00 ? 30  GLU B CG   1  
ATOM   1515  C CD   . GLU B 1 30 ? -12.415 -8.614  0.492   1.00 0.00 ? 30  GLU B CD   1  
ATOM   1516  O OE1  . GLU B 1 30 ? -11.577 -9.431  0.147   1.00 0.00 ? 30  GLU B OE1  1  
ATOM   1517  O OE2  . GLU B 1 30 ? -13.496 -8.907  0.976   1.00 0.00 ? 30  GLU B OE2  1  
ATOM   1518  H H    . GLU B 1 30 ? -10.588 -5.988  -2.428  1.00 0.00 ? 30  GLU B H    1  
ATOM   1519  H HA   . GLU B 1 30 ? -10.836 -4.849  0.323   1.00 0.00 ? 30  GLU B HA   1  
ATOM   1520  H HB2  . GLU B 1 30 ? -10.286 -7.618  -0.741  1.00 0.00 ? 30  GLU B HB2  1  
ATOM   1521  H HB3  . GLU B 1 30 ? -10.047 -7.211  0.956   1.00 0.00 ? 30  GLU B HB3  1  
ATOM   1522  H HG2  . GLU B 1 30 ? -12.369 -6.586  1.199   1.00 0.00 ? 30  GLU B HG2  1  
ATOM   1523  H HG3  . GLU B 1 30 ? -12.643 -6.746  -0.537  1.00 0.00 ? 30  GLU B HG3  1  
ATOM   1524  N N    . THR B 1 31 ? -8.342  -4.937  0.982   1.00 0.00 ? 31  THR B N    1  
ATOM   1525  C CA   . THR B 1 31 ? -6.890  -4.646  1.196   1.00 0.00 ? 31  THR B CA   1  
ATOM   1526  C C    . THR B 1 31 ? -6.073  -5.939  1.159   1.00 0.00 ? 31  THR B C    1  
ATOM   1527  O O    . THR B 1 31 ? -6.533  -6.973  0.717   1.00 0.00 ? 31  THR B O    1  
ATOM   1528  C CB   . THR B 1 31 ? -6.711  -3.983  2.562   1.00 0.00 ? 31  THR B CB   1  
ATOM   1529  O OG1  . THR B 1 31 ? -7.406  -4.743  3.534   1.00 0.00 ? 31  THR B OG1  1  
ATOM   1530  C CG2  . THR B 1 31 ? -7.271  -2.561  2.508   1.00 0.00 ? 31  THR B CG2  1  
ATOM   1531  H H    . THR B 1 31 ? -8.966  -4.888  1.739   1.00 0.00 ? 31  THR B H    1  
ATOM   1532  H HA   . THR B 1 31 ? -6.539  -3.977  0.424   1.00 0.00 ? 31  THR B HA   1  
ATOM   1533  H HB   . THR B 1 31 ? -5.666  -3.946  2.825   1.00 0.00 ? 31  THR B HB   1  
ATOM   1534  H HG1  . THR B 1 31 ? -8.315  -4.838  3.242   1.00 0.00 ? 31  THR B HG1  1  
ATOM   1535  H HG21 . THR B 1 31 ? -6.807  -2.023  1.693   1.00 0.00 ? 31  THR B HG21 1  
ATOM   1536  H HG22 . THR B 1 31 ? -8.338  -2.599  2.352   1.00 0.00 ? 31  THR B HG22 1  
ATOM   1537  H HG23 . THR B 1 31 ? -7.060  -2.055  3.436   1.00 0.00 ? 31  THR B HG23 1  
ATOM   1538  N N    . SER B 1 32 ? -4.855  -5.876  1.628   1.00 0.00 ? 32  SER B N    1  
ATOM   1539  C CA   . SER B 1 32 ? -3.978  -7.080  1.638   1.00 0.00 ? 32  SER B CA   1  
ATOM   1540  C C    . SER B 1 32 ? -4.223  -7.887  2.911   1.00 0.00 ? 32  SER B C    1  
ATOM   1541  O O    . SER B 1 32 ? -5.337  -8.015  3.379   1.00 0.00 ? 32  SER B O    1  
ATOM   1542  C CB   . SER B 1 32 ? -2.518  -6.633  1.605   1.00 0.00 ? 32  SER B CB   1  
ATOM   1543  O OG   . SER B 1 32 ? -2.322  -5.748  0.510   1.00 0.00 ? 32  SER B OG   1  
ATOM   1544  H H    . SER B 1 32 ? -4.513  -5.027  1.977   1.00 0.00 ? 32  SER B H    1  
ATOM   1545  H HA   . SER B 1 32 ? -4.182  -7.694  0.777   1.00 0.00 ? 32  SER B HA   1  
ATOM   1546  H HB2  . SER B 1 32 ? -2.280  -6.121  2.522   1.00 0.00 ? 32  SER B HB2  1  
ATOM   1547  H HB3  . SER B 1 32 ? -1.879  -7.499  1.502   1.00 0.00 ? 32  SER B HB3  1  
ATOM   1548  H HG   . SER B 1 32 ? -1.835  -6.220  -0.169  1.00 0.00 ? 32  SER B HG   1  
ATOM   1549  N N    . SER B 1 33 ? -3.180  -8.435  3.471   1.00 0.00 ? 33  SER B N    1  
ATOM   1550  C CA   . SER B 1 33 ? -3.320  -9.246  4.718   1.00 0.00 ? 33  SER B CA   1  
ATOM   1551  C C    . SER B 1 33 ? -2.079  -9.047  5.583   1.00 0.00 ? 33  SER B C    1  
ATOM   1552  O O    . SER B 1 33 ? -2.151  -9.006  6.795   1.00 0.00 ? 33  SER B O    1  
ATOM   1553  C CB   . SER B 1 33 ? -3.431  -10.719 4.343   1.00 0.00 ? 33  SER B CB   1  
ATOM   1554  O OG   . SER B 1 33 ? -2.130  -11.239 4.099   1.00 0.00 ? 33  SER B OG   1  
ATOM   1555  H H    . SER B 1 33 ? -2.298  -8.314  3.064   1.00 0.00 ? 33  SER B H    1  
ATOM   1556  H HA   . SER B 1 33 ? -4.200  -8.940  5.265   1.00 0.00 ? 33  SER B HA   1  
ATOM   1557  H HB2  . SER B 1 33 ? -3.891  -11.268 5.147   1.00 0.00 ? 33  SER B HB2  1  
ATOM   1558  H HB3  . SER B 1 33 ? -4.033  -10.810 3.454   1.00 0.00 ? 33  SER B HB3  1  
ATOM   1559  H HG   . SER B 1 33 ? -1.591  -10.532 3.738   1.00 0.00 ? 33  SER B HG   1  
ATOM   1560  N N    . LEU B 1 34 ? -0.940  -8.936  4.955   1.00 0.00 ? 34  LEU B N    1  
ATOM   1561  C CA   . LEU B 1 34 ? 0.339   -8.746  5.704   1.00 0.00 ? 34  LEU B CA   1  
ATOM   1562  C C    . LEU B 1 34 ? 0.132   -7.783  6.874   1.00 0.00 ? 34  LEU B C    1  
ATOM   1563  O O    . LEU B 1 34 ? 0.402   -8.104  8.014   1.00 0.00 ? 34  LEU B O    1  
ATOM   1564  C CB   . LEU B 1 34 ? 1.398   -8.161  4.768   1.00 0.00 ? 34  LEU B CB   1  
ATOM   1565  C CG   . LEU B 1 34 ? 1.366   -8.880  3.419   1.00 0.00 ? 34  LEU B CG   1  
ATOM   1566  C CD1  . LEU B 1 34 ? 2.545   -8.405  2.566   1.00 0.00 ? 34  LEU B CD1  1  
ATOM   1567  C CD2  . LEU B 1 34 ? 1.467   -10.394 3.639   1.00 0.00 ? 34  LEU B CD2  1  
ATOM   1568  H H    . LEU B 1 34 ? -0.926  -8.985  3.979   1.00 0.00 ? 34  LEU B H    1  
ATOM   1569  H HA   . LEU B 1 34 ? 0.680   -9.696  6.078   1.00 0.00 ? 34  LEU B HA   1  
ATOM   1570  H HB2  . LEU B 1 34 ? 1.203   -7.109  4.614   1.00 0.00 ? 34  LEU B HB2  1  
ATOM   1571  H HB3  . LEU B 1 34 ? 2.370   -8.283  5.212   1.00 0.00 ? 34  LEU B HB3  1  
ATOM   1572  H HG   . LEU B 1 34 ? 0.443   -8.649  2.909   1.00 0.00 ? 34  LEU B HG   1  
ATOM   1573  H HD11 . LEU B 1 34 ? 2.653   -7.333  2.664   1.00 0.00 ? 34  LEU B HD11 1  
ATOM   1574  H HD12 . LEU B 1 34 ? 3.450   -8.889  2.900   1.00 0.00 ? 34  LEU B HD12 1  
ATOM   1575  H HD13 . LEU B 1 34 ? 2.363   -8.654  1.533   1.00 0.00 ? 34  LEU B HD13 1  
ATOM   1576  H HD21 . LEU B 1 34 ? 2.237   -10.602 4.367   1.00 0.00 ? 34  LEU B HD21 1  
ATOM   1577  H HD22 . LEU B 1 34 ? 0.520   -10.770 3.998   1.00 0.00 ? 34  LEU B HD22 1  
ATOM   1578  H HD23 . LEU B 1 34 ? 1.715   -10.878 2.705   1.00 0.00 ? 34  LEU B HD23 1  
ATOM   1579  N N    . CYS B 1 35 ? -0.340  -6.604  6.595   1.00 0.00 ? 35  CYS B N    1  
ATOM   1580  C CA   . CYS B 1 35 ? -0.560  -5.618  7.687   1.00 0.00 ? 35  CYS B CA   1  
ATOM   1581  C C    . CYS B 1 35 ? -1.717  -6.096  8.570   1.00 0.00 ? 35  CYS B C    1  
ATOM   1582  O O    . CYS B 1 35 ? -2.767  -6.463  8.091   1.00 0.00 ? 35  CYS B O    1  
ATOM   1583  C CB   . CYS B 1 35 ? -0.881  -4.245  7.085   1.00 0.00 ? 35  CYS B CB   1  
ATOM   1584  S SG   . CYS B 1 35 ? -1.960  -4.443  5.645   1.00 0.00 ? 35  CYS B SG   1  
ATOM   1585  H H    . CYS B 1 35 ? -0.547  -6.367  5.667   1.00 0.00 ? 35  CYS B H    1  
ATOM   1586  H HA   . CYS B 1 35 ? 0.338   -5.546  8.285   1.00 0.00 ? 35  CYS B HA   1  
ATOM   1587  H HB2  . CYS B 1 35 ? -1.376  -3.635  7.823   1.00 0.00 ? 35  CYS B HB2  1  
ATOM   1588  H HB3  . CYS B 1 35 ? 0.038   -3.764  6.782   1.00 0.00 ? 35  CYS B HB3  1  
ATOM   1589  N N    . SER B 1 36 ? -1.514  -6.122  9.857   1.00 0.00 ? 36  SER B N    1  
ATOM   1590  C CA   . SER B 1 36 ? -2.584  -6.593  10.784  1.00 0.00 ? 36  SER B CA   1  
ATOM   1591  C C    . SER B 1 36 ? -3.791  -5.641  10.777  1.00 0.00 ? 36  SER B C    1  
ATOM   1592  O O    . SER B 1 36 ? -4.458  -5.490  11.782  1.00 0.00 ? 36  SER B O    1  
ATOM   1593  C CB   . SER B 1 36 ? -2.018  -6.674  12.202  1.00 0.00 ? 36  SER B CB   1  
ATOM   1594  O OG   . SER B 1 36 ? -0.928  -7.586  12.221  1.00 0.00 ? 36  SER B OG   1  
ATOM   1595  H H    . SER B 1 36 ? -0.647  -5.841  10.218  1.00 0.00 ? 36  SER B H    1  
ATOM   1596  H HA   . SER B 1 36 ? -2.908  -7.576  10.479  1.00 0.00 ? 36  SER B HA   1  
ATOM   1597  H HB2  . SER B 1 36 ? -1.671  -5.701  12.509  1.00 0.00 ? 36  SER B HB2  1  
ATOM   1598  H HB3  . SER B 1 36 ? -2.793  -7.008  12.880  1.00 0.00 ? 36  SER B HB3  1  
ATOM   1599  H HG   . SER B 1 36 ? -1.103  -8.270  11.570  1.00 0.00 ? 36  SER B HG   1  
ATOM   1600  N N    . GLN B 1 37 ? -4.093  -4.991  9.679   1.00 0.00 ? 37  GLN B N    1  
ATOM   1601  C CA   . GLN B 1 37 ? -5.268  -4.063  9.684   1.00 0.00 ? 37  GLN B CA   1  
ATOM   1602  C C    . GLN B 1 37 ? -5.847  -3.893  8.271   1.00 0.00 ? 37  GLN B C    1  
ATOM   1603  O O    . GLN B 1 37 ? -5.808  -2.808  7.730   1.00 0.00 ? 37  GLN B O    1  
ATOM   1604  C CB   . GLN B 1 37 ? -4.834  -2.693  10.221  1.00 0.00 ? 37  GLN B CB   1  
ATOM   1605  C CG   . GLN B 1 37 ? -3.534  -2.247  9.542   1.00 0.00 ? 37  GLN B CG   1  
ATOM   1606  C CD   . GLN B 1 37 ? -3.076  -0.919  10.147  1.00 0.00 ? 37  GLN B CD   1  
ATOM   1607  O OE1  . GLN B 1 37 ? -2.425  -0.897  11.173  1.00 0.00 ? 37  GLN B OE1  1  
ATOM   1608  N NE2  . GLN B 1 37 ? -3.389  0.199   9.550   1.00 0.00 ? 37  GLN B NE2  1  
ATOM   1609  H H    . GLN B 1 37 ? -3.558  -5.106  8.867   1.00 0.00 ? 37  GLN B H    1  
ATOM   1610  H HA   . GLN B 1 37 ? -6.039  -4.461  10.331  1.00 0.00 ? 37  GLN B HA   1  
ATOM   1611  H HB2  . GLN B 1 37 ? -5.610  -1.968  10.022  1.00 0.00 ? 37  GLN B HB2  1  
ATOM   1612  H HB3  . GLN B 1 37 ? -4.674  -2.761  11.287  1.00 0.00 ? 37  GLN B HB3  1  
ATOM   1613  H HG2  . GLN B 1 37 ? -2.770  -2.993  9.696   1.00 0.00 ? 37  GLN B HG2  1  
ATOM   1614  H HG3  . GLN B 1 37 ? -3.704  -2.117  8.484   1.00 0.00 ? 37  GLN B HG3  1  
ATOM   1615  H HE21 . GLN B 1 37 ? -3.914  0.182   8.723   1.00 0.00 ? 37  GLN B HE21 1  
ATOM   1616  H HE22 . GLN B 1 37 ? -3.100  1.055   9.930   1.00 0.00 ? 37  GLN B HE22 1  
ATOM   1617  N N    . PRO B 1 38 ? -6.395  -4.954  7.716   1.00 0.00 ? 38  PRO B N    1  
ATOM   1618  C CA   . PRO B 1 38 ? -7.007  -4.894  6.373   1.00 0.00 ? 38  PRO B CA   1  
ATOM   1619  C C    . PRO B 1 38 ? -8.270  -4.022  6.440   1.00 0.00 ? 38  PRO B C    1  
ATOM   1620  O O    . PRO B 1 38 ? -8.631  -3.511  7.481   1.00 0.00 ? 38  PRO B O    1  
ATOM   1621  C CB   . PRO B 1 38 ? -7.358  -6.363  6.034   1.00 0.00 ? 38  PRO B CB   1  
ATOM   1622  C CG   . PRO B 1 38 ? -7.082  -7.215  7.308   1.00 0.00 ? 38  PRO B CG   1  
ATOM   1623  C CD   . PRO B 1 38 ? -6.444  -6.284  8.364   1.00 0.00 ? 38  PRO B CD   1  
ATOM   1624  H HA   . PRO B 1 38 ? -6.311  -4.494  5.642   1.00 0.00 ? 38  PRO B HA   1  
ATOM   1625  H HB2  . PRO B 1 38 ? -8.401  -6.447  5.747   1.00 0.00 ? 38  PRO B HB2  1  
ATOM   1626  H HB3  . PRO B 1 38 ? -6.733  -6.713  5.224   1.00 0.00 ? 38  PRO B HB3  1  
ATOM   1627  H HG2  . PRO B 1 38 ? -8.012  -7.624  7.686   1.00 0.00 ? 38  PRO B HG2  1  
ATOM   1628  H HG3  . PRO B 1 38 ? -6.401  -8.023  7.074   1.00 0.00 ? 38  PRO B HG3  1  
ATOM   1629  H HD2  . PRO B 1 38 ? -7.057  -6.247  9.256   1.00 0.00 ? 38  PRO B HD2  1  
ATOM   1630  H HD3  . PRO B 1 38 ? -5.446  -6.615  8.608   1.00 0.00 ? 38  PRO B HD3  1  
ATOM   1631  N N    . ALA B 1 39 ? -8.938  -3.857  5.338   1.00 0.00 ? 39  ALA B N    1  
ATOM   1632  C CA   . ALA B 1 39 ? -10.173 -3.035  5.316   1.00 0.00 ? 39  ALA B CA   1  
ATOM   1633  C C    . ALA B 1 39 ? -10.851 -3.226  3.964   1.00 0.00 ? 39  ALA B C    1  
ATOM   1634  O O    . ALA B 1 39 ? -10.266 -3.769  3.047   1.00 0.00 ? 39  ALA B O    1  
ATOM   1635  C CB   . ALA B 1 39 ? -9.813  -1.559  5.502   1.00 0.00 ? 39  ALA B CB   1  
ATOM   1636  H H    . ALA B 1 39 ? -8.633  -4.282  4.519   1.00 0.00 ? 39  ALA B H    1  
ATOM   1637  H HA   . ALA B 1 39 ? -10.835 -3.351  6.106   1.00 0.00 ? 39  ALA B HA   1  
ATOM   1638  H HB1  . ALA B 1 39 ? -9.143  -1.455  6.342   1.00 0.00 ? 39  ALA B HB1  1  
ATOM   1639  H HB2  . ALA B 1 39 ? -9.329  -1.192  4.608   1.00 0.00 ? 39  ALA B HB2  1  
ATOM   1640  H HB3  . ALA B 1 39 ? -10.712 -0.990  5.683   1.00 0.00 ? 39  ALA B HB3  1  
ATOM   1641  N N    . VAL B 1 40 ? -12.064 -2.767  3.813   1.00 0.00 ? 40  VAL B N    1  
ATOM   1642  C CA   . VAL B 1 40 ? -12.753 -2.904  2.495   1.00 0.00 ? 40  VAL B CA   1  
ATOM   1643  C C    . VAL B 1 40 ? -12.589 -1.582  1.754   1.00 0.00 ? 40  VAL B C    1  
ATOM   1644  O O    . VAL B 1 40 ? -12.591 -0.524  2.352   1.00 0.00 ? 40  VAL B O    1  
ATOM   1645  C CB   . VAL B 1 40 ? -14.242 -3.208  2.706   1.00 0.00 ? 40  VAL B CB   1  
ATOM   1646  C CG1  . VAL B 1 40 ? -15.017 -2.949  1.409   1.00 0.00 ? 40  VAL B CG1  1  
ATOM   1647  C CG2  . VAL B 1 40 ? -14.404 -4.677  3.093   1.00 0.00 ? 40  VAL B CG2  1  
ATOM   1648  H H    . VAL B 1 40 ? -12.513 -2.311  4.557   1.00 0.00 ? 40  VAL B H    1  
ATOM   1649  H HA   . VAL B 1 40 ? -12.298 -3.703  1.913   1.00 0.00 ? 40  VAL B HA   1  
ATOM   1650  H HB   . VAL B 1 40 ? -14.633 -2.579  3.493   1.00 0.00 ? 40  VAL B HB   1  
ATOM   1651  H HG11 . VAL B 1 40 ? -14.466 -3.361  0.576   1.00 0.00 ? 40  VAL B HG11 1  
ATOM   1652  H HG12 . VAL B 1 40 ? -15.988 -3.418  1.465   1.00 0.00 ? 40  VAL B HG12 1  
ATOM   1653  H HG13 . VAL B 1 40 ? -15.137 -1.886  1.268   1.00 0.00 ? 40  VAL B HG13 1  
ATOM   1654  H HG21 . VAL B 1 40 ? -13.763 -4.900  3.933   1.00 0.00 ? 40  VAL B HG21 1  
ATOM   1655  H HG22 . VAL B 1 40 ? -15.432 -4.868  3.361   1.00 0.00 ? 40  VAL B HG22 1  
ATOM   1656  H HG23 . VAL B 1 40 ? -14.128 -5.300  2.254   1.00 0.00 ? 40  VAL B HG23 1  
ATOM   1657  N N    . VAL B 1 41 ? -12.428 -1.641  0.461   1.00 0.00 ? 41  VAL B N    1  
ATOM   1658  C CA   . VAL B 1 41 ? -12.239 -0.394  -0.345  1.00 0.00 ? 41  VAL B CA   1  
ATOM   1659  C C    . VAL B 1 41 ? -13.354 -0.283  -1.391  1.00 0.00 ? 41  VAL B C    1  
ATOM   1660  O O    . VAL B 1 41 ? -13.502 -1.130  -2.241  1.00 0.00 ? 41  VAL B O    1  
ATOM   1661  C CB   . VAL B 1 41 ? -10.873 -0.459  -1.037  1.00 0.00 ? 41  VAL B CB   1  
ATOM   1662  C CG1  . VAL B 1 41 ? -10.436 0.944   -1.453  1.00 0.00 ? 41  VAL B CG1  1  
ATOM   1663  C CG2  . VAL B 1 41 ? -9.840  -1.034  -0.063  1.00 0.00 ? 41  VAL B CG2  1  
ATOM   1664  H H    . VAL B 1 41 ? -12.422 -2.514  0.017   1.00 0.00 ? 41  VAL B H    1  
ATOM   1665  H HA   . VAL B 1 41 ? -12.270 0.467   0.299   1.00 0.00 ? 41  VAL B HA   1  
ATOM   1666  H HB   . VAL B 1 41 ? -10.938 -1.089  -1.911  1.00 0.00 ? 41  VAL B HB   1  
ATOM   1667  H HG11 . VAL B 1 41 ? -11.253 1.442   -1.953  1.00 0.00 ? 41  VAL B HG11 1  
ATOM   1668  H HG12 . VAL B 1 41 ? -10.152 1.508   -0.577  1.00 0.00 ? 41  VAL B HG12 1  
ATOM   1669  H HG13 . VAL B 1 41 ? -9.593  0.868   -2.121  1.00 0.00 ? 41  VAL B HG13 1  
ATOM   1670  H HG21 . VAL B 1 41 ? -9.853  -0.463  0.853   1.00 0.00 ? 41  VAL B HG21 1  
ATOM   1671  H HG22 . VAL B 1 41 ? -10.079 -2.064  0.152   1.00 0.00 ? 41  VAL B HG22 1  
ATOM   1672  H HG23 . VAL B 1 41 ? -8.857  -0.978  -0.508  1.00 0.00 ? 41  VAL B HG23 1  
ATOM   1673  N N    . PHE B 1 42 ? -14.148 0.756   -1.335  1.00 0.00 ? 42  PHE B N    1  
ATOM   1674  C CA   . PHE B 1 42 ? -15.258 0.902   -2.329  1.00 0.00 ? 42  PHE B CA   1  
ATOM   1675  C C    . PHE B 1 42 ? -14.771 1.677   -3.557  1.00 0.00 ? 42  PHE B C    1  
ATOM   1676  O O    . PHE B 1 42 ? -14.113 2.691   -3.444  1.00 0.00 ? 42  PHE B O    1  
ATOM   1677  C CB   . PHE B 1 42 ? -16.421 1.673   -1.690  1.00 0.00 ? 42  PHE B CB   1  
ATOM   1678  C CG   . PHE B 1 42 ? -17.190 0.772   -0.747  1.00 0.00 ? 42  PHE B CG   1  
ATOM   1679  C CD1  . PHE B 1 42 ? -17.876 -0.353  -1.247  1.00 0.00 ? 42  PHE B CD1  1  
ATOM   1680  C CD2  . PHE B 1 42 ? -17.233 1.065   0.631   1.00 0.00 ? 42  PHE B CD2  1  
ATOM   1681  C CE1  . PHE B 1 42 ? -18.600 -1.184  -0.371  1.00 0.00 ? 42  PHE B CE1  1  
ATOM   1682  C CE2  . PHE B 1 42 ? -17.959 0.235   1.506   1.00 0.00 ? 42  PHE B CE2  1  
ATOM   1683  C CZ   . PHE B 1 42 ? -18.641 -0.890  1.005   1.00 0.00 ? 42  PHE B CZ   1  
ATOM   1684  H H    . PHE B 1 42 ? -14.021 1.434   -0.639  1.00 0.00 ? 42  PHE B H    1  
ATOM   1685  H HA   . PHE B 1 42 ? -15.602 -0.074  -2.636  1.00 0.00 ? 42  PHE B HA   1  
ATOM   1686  H HB2  . PHE B 1 42 ? -16.031 2.519   -1.144  1.00 0.00 ? 42  PHE B HB2  1  
ATOM   1687  H HB3  . PHE B 1 42 ? -17.088 2.026   -2.465  1.00 0.00 ? 42  PHE B HB3  1  
ATOM   1688  H HD1  . PHE B 1 42 ? -17.846 -0.580  -2.303  1.00 0.00 ? 42  PHE B HD1  1  
ATOM   1689  H HD2  . PHE B 1 42 ? -16.709 1.927   1.017   1.00 0.00 ? 42  PHE B HD2  1  
ATOM   1690  H HE1  . PHE B 1 42 ? -19.124 -2.047  -0.755  1.00 0.00 ? 42  PHE B HE1  1  
ATOM   1691  H HE2  . PHE B 1 42 ? -17.991 0.463   2.560   1.00 0.00 ? 42  PHE B HE2  1  
ATOM   1692  H HZ   . PHE B 1 42 ? -19.199 -1.527  1.675   1.00 0.00 ? 42  PHE B HZ   1  
ATOM   1693  N N    . GLN B 1 43 ? -15.118 1.215   -4.731  1.00 0.00 ? 43  GLN B N    1  
ATOM   1694  C CA   . GLN B 1 43 ? -14.712 1.923   -5.984  1.00 0.00 ? 43  GLN B CA   1  
ATOM   1695  C C    . GLN B 1 43 ? -15.886 2.804   -6.422  1.00 0.00 ? 43  GLN B C    1  
ATOM   1696  O O    . GLN B 1 43 ? -16.990 2.321   -6.598  1.00 0.00 ? 43  GLN B O    1  
ATOM   1697  C CB   . GLN B 1 43 ? -14.390 0.885   -7.061  1.00 0.00 ? 43  GLN B CB   1  
ATOM   1698  C CG   . GLN B 1 43 ? -13.140 0.101   -6.654  1.00 0.00 ? 43  GLN B CG   1  
ATOM   1699  C CD   . GLN B 1 43 ? -13.018 -1.153  -7.521  1.00 0.00 ? 43  GLN B CD   1  
ATOM   1700  O OE1  . GLN B 1 43 ? -12.580 -2.186  -7.056  1.00 0.00 ? 43  GLN B OE1  1  
ATOM   1701  N NE2  . GLN B 1 43 ? -13.390 -1.106  -8.771  1.00 0.00 ? 43  GLN B NE2  1  
ATOM   1702  H H    . GLN B 1 43 ? -15.667 0.405   -4.790  1.00 0.00 ? 43  GLN B H    1  
ATOM   1703  H HA   . GLN B 1 43 ? -13.849 2.537   -5.797  1.00 0.00 ? 43  GLN B HA   1  
ATOM   1704  H HB2  . GLN B 1 43 ? -15.223 0.207   -7.164  1.00 0.00 ? 43  GLN B HB2  1  
ATOM   1705  H HB3  . GLN B 1 43 ? -14.209 1.378   -7.999  1.00 0.00 ? 43  GLN B HB3  1  
ATOM   1706  H HG2  . GLN B 1 43 ? -12.267 0.722   -6.793  1.00 0.00 ? 43  GLN B HG2  1  
ATOM   1707  H HG3  . GLN B 1 43 ? -13.215 -0.186  -5.617  1.00 0.00 ? 43  GLN B HG3  1  
ATOM   1708  H HE21 . GLN B 1 43 ? -13.744 -0.272  -9.146  1.00 0.00 ? 43  GLN B HE21 1  
ATOM   1709  H HE22 . GLN B 1 43 ? -13.316 -1.904  -9.334  1.00 0.00 ? 43  GLN B HE22 1  
ATOM   1710  N N    . THR B 1 44 ? -15.678 4.101   -6.555  1.00 0.00 ? 44  THR B N    1  
ATOM   1711  C CA   . THR B 1 44 ? -16.823 5.007   -6.924  1.00 0.00 ? 44  THR B CA   1  
ATOM   1712  C C    . THR B 1 44 ? -16.835 5.353   -8.414  1.00 0.00 ? 44  THR B C    1  
ATOM   1713  O O    . THR B 1 44 ? -16.375 4.603   -9.252  1.00 0.00 ? 44  THR B O    1  
ATOM   1714  C CB   . THR B 1 44 ? -16.716 6.307   -6.130  1.00 0.00 ? 44  THR B CB   1  
ATOM   1715  O OG1  . THR B 1 44 ? -15.781 7.167   -6.764  1.00 0.00 ? 44  THR B OG1  1  
ATOM   1716  C CG2  . THR B 1 44 ? -16.247 6.001   -4.710  1.00 0.00 ? 44  THR B CG2  1  
ATOM   1717  H H    . THR B 1 44 ? -14.780 4.482   -6.379  1.00 0.00 ? 44  THR B H    1  
ATOM   1718  H HA   . THR B 1 44 ? -17.759 4.527   -6.671  1.00 0.00 ? 44  THR B HA   1  
ATOM   1719  H HB   . THR B 1 44 ? -17.683 6.787   -6.092  1.00 0.00 ? 44  THR B HB   1  
ATOM   1720  H HG1  . THR B 1 44 ? -16.081 7.320   -7.663  1.00 0.00 ? 44  THR B HG1  1  
ATOM   1721  H HG21 . THR B 1 44 ? -16.843 5.200   -4.298  1.00 0.00 ? 44  THR B HG21 1  
ATOM   1722  H HG22 . THR B 1 44 ? -15.210 5.703   -4.734  1.00 0.00 ? 44  THR B HG22 1  
ATOM   1723  H HG23 . THR B 1 44 ? -16.354 6.883   -4.096  1.00 0.00 ? 44  THR B HG23 1  
ATOM   1724  N N    . LYS B 1 45 ? -17.394 6.500   -8.734  1.00 0.00 ? 45  LYS B N    1  
ATOM   1725  C CA   . LYS B 1 45 ? -17.499 6.952   -10.157 1.00 0.00 ? 45  LYS B CA   1  
ATOM   1726  C C    . LYS B 1 45 ? -16.667 8.223   -10.376 1.00 0.00 ? 45  LYS B C    1  
ATOM   1727  O O    . LYS B 1 45 ? -16.137 8.444   -11.446 1.00 0.00 ? 45  LYS B O    1  
ATOM   1728  C CB   . LYS B 1 45 ? -18.962 7.271   -10.461 1.00 0.00 ? 45  LYS B CB   1  
ATOM   1729  C CG   . LYS B 1 45 ? -19.843 6.094   -10.043 1.00 0.00 ? 45  LYS B CG   1  
ATOM   1730  C CD   . LYS B 1 45 ? -21.310 6.418   -10.352 1.00 0.00 ? 45  LYS B CD   1  
ATOM   1731  C CE   . LYS B 1 45 ? -22.121 5.123   -10.406 1.00 0.00 ? 45  LYS B CE   1  
ATOM   1732  N NZ   . LYS B 1 45 ? -22.095 4.462   -9.071  1.00 0.00 ? 45  LYS B NZ   1  
ATOM   1733  H H    . LYS B 1 45 ? -17.767 7.064   -8.025  1.00 0.00 ? 45  LYS B H    1  
ATOM   1734  H HA   . LYS B 1 45 ? -17.159 6.173   -10.823 1.00 0.00 ? 45  LYS B HA   1  
ATOM   1735  H HB2  . LYS B 1 45 ? -19.258 8.154   -9.913  1.00 0.00 ? 45  LYS B HB2  1  
ATOM   1736  H HB3  . LYS B 1 45 ? -19.081 7.448   -11.517 1.00 0.00 ? 45  LYS B HB3  1  
ATOM   1737  H HG2  . LYS B 1 45 ? -19.540 5.211   -10.588 1.00 0.00 ? 45  LYS B HG2  1  
ATOM   1738  H HG3  . LYS B 1 45 ? -19.731 5.920   -8.983  1.00 0.00 ? 45  LYS B HG3  1  
ATOM   1739  H HD2  . LYS B 1 45 ? -21.707 7.058   -9.578  1.00 0.00 ? 45  LYS B HD2  1  
ATOM   1740  H HD3  . LYS B 1 45 ? -21.379 6.921   -11.306 1.00 0.00 ? 45  LYS B HD3  1  
ATOM   1741  H HE2  . LYS B 1 45 ? -23.140 5.351   -10.676 1.00 0.00 ? 45  LYS B HE2  1  
ATOM   1742  H HE3  . LYS B 1 45 ? -21.692 4.463   -11.145 1.00 0.00 ? 45  LYS B HE3  1  
ATOM   1743  H HZ1  . LYS B 1 45 ? -21.269 4.795   -8.535  1.00 0.00 ? 45  LYS B HZ1  1  
ATOM   1744  H HZ2  . LYS B 1 45 ? -22.962 4.699   -8.550  1.00 0.00 ? 45  LYS B HZ2  1  
ATOM   1745  H HZ3  . LYS B 1 45 ? -22.035 3.430   -9.197  1.00 0.00 ? 45  LYS B HZ3  1  
ATOM   1746  N N    . ARG B 1 46 ? -16.558 9.061   -9.369  1.00 0.00 ? 46  ARG B N    1  
ATOM   1747  C CA   . ARG B 1 46 ? -15.768 10.334  -9.502  1.00 0.00 ? 46  ARG B CA   1  
ATOM   1748  C C    . ARG B 1 46 ? -14.643 10.304  -8.473  1.00 0.00 ? 46  ARG B C    1  
ATOM   1749  O O    . ARG B 1 46 ? -14.420 11.235  -7.729  1.00 0.00 ? 46  ARG B O    1  
ATOM   1750  C CB   . ARG B 1 46 ? -16.702 11.540  -9.259  1.00 0.00 ? 46  ARG B CB   1  
ATOM   1751  C CG   . ARG B 1 46 ? -15.953 12.899  -9.296  1.00 0.00 ? 46  ARG B CG   1  
ATOM   1752  C CD   . ARG B 1 46 ? -14.821 12.905  -10.334 1.00 0.00 ? 46  ARG B CD   1  
ATOM   1753  N NE   . ARG B 1 46 ? -14.311 14.297  -10.495 1.00 0.00 ? 46  ARG B NE   1  
ATOM   1754  C CZ   . ARG B 1 46 ? -13.169 14.509  -11.089 1.00 0.00 ? 46  ARG B CZ   1  
ATOM   1755  N NH1  . ARG B 1 46 ? -12.472 13.504  -11.544 1.00 0.00 ? 46  ARG B NH1  1  
ATOM   1756  N NH2  . ARG B 1 46 ? -12.723 15.727  -11.227 1.00 0.00 ? 46  ARG B NH2  1  
ATOM   1757  H H    . ARG B 1 46 ? -16.996 8.853   -8.519  1.00 0.00 ? 46  ARG B H    1  
ATOM   1758  H HA   . ARG B 1 46 ? -15.342 10.396  -10.492 1.00 0.00 ? 46  ARG B HA   1  
ATOM   1759  H HB2  . ARG B 1 46 ? -17.470 11.543  -10.018 1.00 0.00 ? 46  ARG B HB2  1  
ATOM   1760  H HB3  . ARG B 1 46 ? -17.169 11.427  -8.293  1.00 0.00 ? 46  ARG B HB3  1  
ATOM   1761  H HG2  . ARG B 1 46 ? -16.657 13.676  -9.552  1.00 0.00 ? 46  ARG B HG2  1  
ATOM   1762  H HG3  . ARG B 1 46 ? -15.545 13.113  -8.321  1.00 0.00 ? 46  ARG B HG3  1  
ATOM   1763  H HD2  . ARG B 1 46 ? -14.015 12.269  -10.001 1.00 0.00 ? 46  ARG B HD2  1  
ATOM   1764  H HD3  . ARG B 1 46 ? -15.195 12.552  -11.282 1.00 0.00 ? 46  ARG B HD3  1  
ATOM   1765  H HE   . ARG B 1 46 ? -14.835 15.052  -10.155 1.00 0.00 ? 46  ARG B HE   1  
ATOM   1766  H HH11 . ARG B 1 46 ? -12.815 12.570  -11.439 1.00 0.00 ? 46  ARG B HH11 1  
ATOM   1767  H HH12 . ARG B 1 46 ? -11.596 13.668  -11.999 1.00 0.00 ? 46  ARG B HH12 1  
ATOM   1768  H HH21 . ARG B 1 46 ? -13.257 16.498  -10.878 1.00 0.00 ? 46  ARG B HH21 1  
ATOM   1769  H HH22 . ARG B 1 46 ? -11.847 15.891  -11.681 1.00 0.00 ? 46  ARG B HH22 1  
ATOM   1770  N N    . SER B 1 47 ? -13.925 9.228   -8.439  1.00 0.00 ? 47  SER B N    1  
ATOM   1771  C CA   . SER B 1 47 ? -12.806 9.103   -7.489  1.00 0.00 ? 47  SER B CA   1  
ATOM   1772  C C    . SER B 1 47 ? -11.960 7.918   -7.926  1.00 0.00 ? 47  SER B C    1  
ATOM   1773  O O    . SER B 1 47 ? -11.464 7.870   -9.034  1.00 0.00 ? 47  SER B O    1  
ATOM   1774  C CB   . SER B 1 47 ? -13.350 8.891   -6.073  1.00 0.00 ? 47  SER B CB   1  
ATOM   1775  O OG   . SER B 1 47 ? -14.416 9.803   -5.841  1.00 0.00 ? 47  SER B OG   1  
ATOM   1776  H H    . SER B 1 47 ? -14.122 8.489   -9.049  1.00 0.00 ? 47  SER B H    1  
ATOM   1777  H HA   . SER B 1 47 ? -12.211 9.994   -7.511  1.00 0.00 ? 47  SER B HA   1  
ATOM   1778  H HB2  . SER B 1 47 ? -13.716 7.888   -5.965  1.00 0.00 ? 47  SER B HB2  1  
ATOM   1779  H HB3  . SER B 1 47 ? -12.557 9.064   -5.359  1.00 0.00 ? 47  SER B HB3  1  
ATOM   1780  H HG   . SER B 1 47 ? -14.882 9.519   -5.051  1.00 0.00 ? 47  SER B HG   1  
ATOM   1781  N N    . LYS B 1 48 ? -11.807 6.958   -7.084  1.00 0.00 ? 48  LYS B N    1  
ATOM   1782  C CA   . LYS B 1 48 ? -11.019 5.765   -7.450  1.00 0.00 ? 48  LYS B CA   1  
ATOM   1783  C C    . LYS B 1 48 ? -11.379 4.654   -6.474  1.00 0.00 ? 48  LYS B C    1  
ATOM   1784  O O    . LYS B 1 48 ? -12.177 3.786   -6.768  1.00 0.00 ? 48  LYS B O    1  
ATOM   1785  C CB   . LYS B 1 48 ? -9.521  6.094   -7.381  1.00 0.00 ? 48  LYS B CB   1  
ATOM   1786  C CG   . LYS B 1 48 ? -8.736  5.052   -8.173  1.00 0.00 ? 48  LYS B CG   1  
ATOM   1787  C CD   . LYS B 1 48 ? -7.248  5.159   -7.831  1.00 0.00 ? 48  LYS B CD   1  
ATOM   1788  C CE   . LYS B 1 48 ? -6.431  4.374   -8.859  1.00 0.00 ? 48  LYS B CE   1  
ATOM   1789  N NZ   . LYS B 1 48 ? -7.014  3.012   -9.021  1.00 0.00 ? 48  LYS B NZ   1  
ATOM   1790  H H    . LYS B 1 48 ? -12.234 7.007   -6.212  1.00 0.00 ? 48  LYS B H    1  
ATOM   1791  H HA   . LYS B 1 48 ? -11.279 5.458   -8.453  1.00 0.00 ? 48  LYS B HA   1  
ATOM   1792  H HB2  . LYS B 1 48 ? -9.351  7.072   -7.807  1.00 0.00 ? 48  LYS B HB2  1  
ATOM   1793  H HB3  . LYS B 1 48 ? -9.190  6.090   -6.355  1.00 0.00 ? 48  LYS B HB3  1  
ATOM   1794  H HG2  . LYS B 1 48 ? -9.097  4.066   -7.922  1.00 0.00 ? 48  LYS B HG2  1  
ATOM   1795  H HG3  . LYS B 1 48 ? -8.875  5.228   -9.228  1.00 0.00 ? 48  LYS B HG3  1  
ATOM   1796  H HD2  . LYS B 1 48 ? -6.949  6.197   -7.848  1.00 0.00 ? 48  LYS B HD2  1  
ATOM   1797  H HD3  . LYS B 1 48 ? -7.074  4.750   -6.848  1.00 0.00 ? 48  LYS B HD3  1  
ATOM   1798  H HE2  . LYS B 1 48 ? -6.453  4.891   -9.807  1.00 0.00 ? 48  LYS B HE2  1  
ATOM   1799  H HE3  . LYS B 1 48 ? -5.410  4.291   -8.518  1.00 0.00 ? 48  LYS B HE3  1  
ATOM   1800  H HZ1  . LYS B 1 48 ? -7.677  2.824   -8.241  1.00 0.00 ? 48  LYS B HZ1  1  
ATOM   1801  H HZ2  . LYS B 1 48 ? -7.519  2.956   -9.927  1.00 0.00 ? 48  LYS B HZ2  1  
ATOM   1802  H HZ3  . LYS B 1 48 ? -6.252  2.305   -9.007  1.00 0.00 ? 48  LYS B HZ3  1  
ATOM   1803  N N    . GLN B 1 49 ? -10.816 4.702   -5.296  1.00 0.00 ? 49  GLN B N    1  
ATOM   1804  C CA   . GLN B 1 49 ? -11.119 3.678   -4.258  1.00 0.00 ? 49  GLN B CA   1  
ATOM   1805  C C    . GLN B 1 49 ? -11.193 4.393   -2.902  1.00 0.00 ? 49  GLN B C    1  
ATOM   1806  O O    . GLN B 1 49 ? -10.456 5.330   -2.648  1.00 0.00 ? 49  GLN B O    1  
ATOM   1807  C CB   . GLN B 1 49 ? -10.009 2.597   -4.249  1.00 0.00 ? 49  GLN B CB   1  
ATOM   1808  C CG   . GLN B 1 49 ? -9.234  2.624   -5.570  1.00 0.00 ? 49  GLN B CG   1  
ATOM   1809  C CD   . GLN B 1 49 ? -8.208  1.489   -5.581  1.00 0.00 ? 49  GLN B CD   1  
ATOM   1810  O OE1  . GLN B 1 49 ? -8.239  0.618   -4.734  1.00 0.00 ? 49  GLN B OE1  1  
ATOM   1811  N NE2  . GLN B 1 49 ? -7.293  1.462   -6.511  1.00 0.00 ? 49  GLN B NE2  1  
ATOM   1812  H H    . GLN B 1 49 ? -10.200 5.431   -5.086  1.00 0.00 ? 49  GLN B H    1  
ATOM   1813  H HA   . GLN B 1 49 ? -12.074 3.219   -4.467  1.00 0.00 ? 49  GLN B HA   1  
ATOM   1814  H HB2  . GLN B 1 49 ? -9.321  2.777   -3.434  1.00 0.00 ? 49  GLN B HB2  1  
ATOM   1815  H HB3  . GLN B 1 49 ? -10.458 1.622   -4.129  1.00 0.00 ? 49  GLN B HB3  1  
ATOM   1816  H HG2  . GLN B 1 49 ? -9.922  2.496   -6.393  1.00 0.00 ? 49  GLN B HG2  1  
ATOM   1817  H HG3  . GLN B 1 49 ? -8.723  3.569   -5.668  1.00 0.00 ? 49  GLN B HG3  1  
ATOM   1818  H HE21 . GLN B 1 49 ? -7.268  2.165   -7.194  1.00 0.00 ? 49  GLN B HE21 1  
ATOM   1819  H HE22 . GLN B 1 49 ? -6.632  0.739   -6.527  1.00 0.00 ? 49  GLN B HE22 1  
ATOM   1820  N N    . VAL B 1 50 ? -12.083 3.973   -2.033  1.00 0.00 ? 50  VAL B N    1  
ATOM   1821  C CA   . VAL B 1 50 ? -12.207 4.640   -0.696  1.00 0.00 ? 50  VAL B CA   1  
ATOM   1822  C C    . VAL B 1 50 ? -12.181 3.569   0.387   1.00 0.00 ? 50  VAL B C    1  
ATOM   1823  O O    . VAL B 1 50 ? -12.930 2.619   0.343   1.00 0.00 ? 50  VAL B O    1  
ATOM   1824  C CB   . VAL B 1 50 ? -13.541 5.412   -0.622  1.00 0.00 ? 50  VAL B CB   1  
ATOM   1825  C CG1  . VAL B 1 50 ? -13.435 6.514   0.439   1.00 0.00 ? 50  VAL B CG1  1  
ATOM   1826  C CG2  . VAL B 1 50 ? -13.869 6.022   -1.996  1.00 0.00 ? 50  VAL B CG2  1  
ATOM   1827  H H    . VAL B 1 50 ? -12.673 3.225   -2.262  1.00 0.00 ? 50  VAL B H    1  
ATOM   1828  H HA   . VAL B 1 50 ? -11.380 5.320   -0.539  1.00 0.00 ? 50  VAL B HA   1  
ATOM   1829  H HB   . VAL B 1 50 ? -14.336 4.732   -0.336  1.00 0.00 ? 50  VAL B HB   1  
ATOM   1830  H HG11 . VAL B 1 50 ? -12.605 7.162   0.203   1.00 0.00 ? 50  VAL B HG11 1  
ATOM   1831  H HG12 . VAL B 1 50 ? -14.348 7.090   0.455   1.00 0.00 ? 50  VAL B HG12 1  
ATOM   1832  H HG13 . VAL B 1 50 ? -13.273 6.064   1.405   1.00 0.00 ? 50  VAL B HG13 1  
ATOM   1833  H HG21 . VAL B 1 50 ? -12.959 6.251   -2.517  1.00 0.00 ? 50  VAL B HG21 1  
ATOM   1834  H HG22 . VAL B 1 50 ? -14.436 5.310   -2.575  1.00 0.00 ? 50  VAL B HG22 1  
ATOM   1835  H HG23 . VAL B 1 50 ? -14.450 6.925   -1.872  1.00 0.00 ? 50  VAL B HG23 1  
ATOM   1836  N N    . CYS B 1 51 ? -11.332 3.719   1.359   1.00 0.00 ? 51  CYS B N    1  
ATOM   1837  C CA   . CYS B 1 51 ? -11.255 2.702   2.441   1.00 0.00 ? 51  CYS B CA   1  
ATOM   1838  C C    . CYS B 1 51 ? -12.490 2.818   3.331   1.00 0.00 ? 51  CYS B C    1  
ATOM   1839  O O    . CYS B 1 51 ? -13.066 3.879   3.478   1.00 0.00 ? 51  CYS B O    1  
ATOM   1840  C CB   . CYS B 1 51 ? -9.996  2.948   3.272   1.00 0.00 ? 51  CYS B CB   1  
ATOM   1841  S SG   . CYS B 1 51 ? -8.530  2.657   2.251   1.00 0.00 ? 51  CYS B SG   1  
ATOM   1842  H H    . CYS B 1 51 ? -10.743 4.500   1.375   1.00 0.00 ? 51  CYS B H    1  
ATOM   1843  H HA   . CYS B 1 51 ? -11.214 1.714   2.007   1.00 0.00 ? 51  CYS B HA   1  
ATOM   1844  H HB2  . CYS B 1 51 ? -9.992  3.968   3.626   1.00 0.00 ? 51  CYS B HB2  1  
ATOM   1845  H HB3  . CYS B 1 51 ? -9.987  2.277   4.114   1.00 0.00 ? 51  CYS B HB3  1  
ATOM   1846  N N    . ALA B 1 52 ? -12.913 1.728   3.917   1.00 0.00 ? 52  ALA B N    1  
ATOM   1847  C CA   . ALA B 1 52 ? -14.125 1.762   4.789   1.00 0.00 ? 52  ALA B CA   1  
ATOM   1848  C C    . ALA B 1 52 ? -13.933 0.812   5.974   1.00 0.00 ? 52  ALA B C    1  
ATOM   1849  O O    . ALA B 1 52 ? -13.476 -0.305  5.822   1.00 0.00 ? 52  ALA B O    1  
ATOM   1850  C CB   . ALA B 1 52 ? -15.340 1.307   3.977   1.00 0.00 ? 52  ALA B CB   1  
ATOM   1851  H H    . ALA B 1 52 ? -12.438 0.882   3.773   1.00 0.00 ? 52  ALA B H    1  
ATOM   1852  H HA   . ALA B 1 52 ? -14.292 2.768   5.154   1.00 0.00 ? 52  ALA B HA   1  
ATOM   1853  H HB1  . ALA B 1 52 ? -15.422 1.909   3.084   1.00 0.00 ? 52  ALA B HB1  1  
ATOM   1854  H HB2  . ALA B 1 52 ? -15.220 0.269   3.701   1.00 0.00 ? 52  ALA B HB2  1  
ATOM   1855  H HB3  . ALA B 1 52 ? -16.234 1.420   4.572   1.00 0.00 ? 52  ALA B HB3  1  
ATOM   1856  N N    . ASP B 1 53 ? -14.283 1.251   7.153   1.00 0.00 ? 53  ASP B N    1  
ATOM   1857  C CA   . ASP B 1 53 ? -14.128 0.381   8.355   1.00 0.00 ? 53  ASP B CA   1  
ATOM   1858  C C    . ASP B 1 53 ? -15.134 -0.795  8.270   1.00 0.00 ? 53  ASP B C    1  
ATOM   1859  O O    . ASP B 1 53 ? -16.324 -0.550  8.275   1.00 0.00 ? 53  ASP B O    1  
ATOM   1860  C CB   . ASP B 1 53 ? -14.441 1.208   9.604   1.00 0.00 ? 53  ASP B CB   1  
ATOM   1861  C CG   . ASP B 1 53 ? -14.019 0.429   10.851  1.00 0.00 ? 53  ASP B CG   1  
ATOM   1862  O OD1  . ASP B 1 53 ? -14.023 -0.790  10.794  1.00 0.00 ? 53  ASP B OD1  1  
ATOM   1863  O OD2  . ASP B 1 53 ? -13.698 1.064   11.842  1.00 0.00 ? 53  ASP B OD2  1  
ATOM   1864  H H    . ASP B 1 53 ? -14.649 2.156   7.247   1.00 0.00 ? 53  ASP B H    1  
ATOM   1865  H HA   . ASP B 1 53 ? -13.115 0.035   8.408   1.00 0.00 ? 53  ASP B HA   1  
ATOM   1866  H HB2  . ASP B 1 53 ? -13.900 2.143   9.562   1.00 0.00 ? 53  ASP B HB2  1  
ATOM   1867  H HB3  . ASP B 1 53 ? -15.501 1.407   9.648   1.00 0.00 ? 53  ASP B HB3  1  
ATOM   1868  N N    . PRO B 1 54 ? -14.669 -2.039  8.195   1.00 0.00 ? 54  PRO B N    1  
ATOM   1869  C CA   . PRO B 1 54 ? -15.598 -3.188  8.114   1.00 0.00 ? 54  PRO B CA   1  
ATOM   1870  C C    . PRO B 1 54 ? -16.468 -3.258  9.377   1.00 0.00 ? 54  PRO B C    1  
ATOM   1871  O O    . PRO B 1 54 ? -17.382 -4.053  9.469   1.00 0.00 ? 54  PRO B O    1  
ATOM   1872  C CB   . PRO B 1 54 ? -14.693 -4.435  8.001   1.00 0.00 ? 54  PRO B CB   1  
ATOM   1873  C CG   . PRO B 1 54 ? -13.215 -3.951  8.054   1.00 0.00 ? 54  PRO B CG   1  
ATOM   1874  C CD   . PRO B 1 54 ? -13.233 -2.411  8.182   1.00 0.00 ? 54  PRO B CD   1  
ATOM   1875  H HA   . PRO B 1 54 ? -16.221 -3.101  7.236   1.00 0.00 ? 54  PRO B HA   1  
ATOM   1876  H HB2  . PRO B 1 54 ? -14.888 -5.115  8.823   1.00 0.00 ? 54  PRO B HB2  1  
ATOM   1877  H HB3  . PRO B 1 54 ? -14.876 -4.941  7.062   1.00 0.00 ? 54  PRO B HB3  1  
ATOM   1878  H HG2  . PRO B 1 54 ? -12.714 -4.390  8.911   1.00 0.00 ? 54  PRO B HG2  1  
ATOM   1879  H HG3  . PRO B 1 54 ? -12.700 -4.238  7.149   1.00 0.00 ? 54  PRO B HG3  1  
ATOM   1880  H HD2  . PRO B 1 54 ? -12.755 -2.108  9.106   1.00 0.00 ? 54  PRO B HD2  1  
ATOM   1881  H HD3  . PRO B 1 54 ? -12.740 -1.957  7.334   1.00 0.00 ? 54  PRO B HD3  1  
ATOM   1882  N N    . SER B 1 55 ? -16.179 -2.447  10.353  1.00 0.00 ? 55  SER B N    1  
ATOM   1883  C CA   . SER B 1 55 ? -16.977 -2.484  11.611  1.00 0.00 ? 55  SER B CA   1  
ATOM   1884  C C    . SER B 1 55 ? -18.334 -1.815  11.382  1.00 0.00 ? 55  SER B C    1  
ATOM   1885  O O    . SER B 1 55 ? -19.267 -2.018  12.133  1.00 0.00 ? 55  SER B O    1  
ATOM   1886  C CB   . SER B 1 55 ? -16.223 -1.741  12.714  1.00 0.00 ? 55  SER B CB   1  
ATOM   1887  O OG   . SER B 1 55 ? -14.990 -2.403  12.967  1.00 0.00 ? 55  SER B OG   1  
ATOM   1888  H H    . SER B 1 55 ? -15.429 -1.826  10.264  1.00 0.00 ? 55  SER B H    1  
ATOM   1889  H HA   . SER B 1 55 ? -17.129 -3.511  11.909  1.00 0.00 ? 55  SER B HA   1  
ATOM   1890  H HB2  . SER B 1 55 ? -16.024 -0.730  12.399  1.00 0.00 ? 55  SER B HB2  1  
ATOM   1891  H HB3  . SER B 1 55 ? -16.826 -1.725  13.612  1.00 0.00 ? 55  SER B HB3  1  
ATOM   1892  H HG   . SER B 1 55 ? -14.899 -3.114  12.329  1.00 0.00 ? 55  SER B HG   1  
ATOM   1893  N N    . GLU B 1 56 ? -18.457 -1.025  10.351  1.00 0.00 ? 56  GLU B N    1  
ATOM   1894  C CA   . GLU B 1 56 ? -19.762 -0.355  10.081  1.00 0.00 ? 56  GLU B CA   1  
ATOM   1895  C C    . GLU B 1 56 ? -20.686 -1.327  9.340   1.00 0.00 ? 56  GLU B C    1  
ATOM   1896  O O    . GLU B 1 56 ? -20.396 -1.780  8.249   1.00 0.00 ? 56  GLU B O    1  
ATOM   1897  C CB   . GLU B 1 56 ? -19.529 0.894   9.232   1.00 0.00 ? 56  GLU B CB   1  
ATOM   1898  C CG   . GLU B 1 56 ? -18.992 2.026   10.113  1.00 0.00 ? 56  GLU B CG   1  
ATOM   1899  C CD   . GLU B 1 56 ? -18.774 3.277   9.260   1.00 0.00 ? 56  GLU B CD   1  
ATOM   1900  O OE1  . GLU B 1 56 ? -17.918 3.236   8.392   1.00 0.00 ? 56  GLU B OE1  1  
ATOM   1901  O OE2  . GLU B 1 56 ? -19.466 4.255   9.491   1.00 0.00 ? 56  GLU B OE2  1  
ATOM   1902  H H    . GLU B 1 56 ? -17.695 -0.876  9.753   1.00 0.00 ? 56  GLU B H    1  
ATOM   1903  H HA   . GLU B 1 56 ? -20.222 -0.072  11.018  1.00 0.00 ? 56  GLU B HA   1  
ATOM   1904  H HB2  . GLU B 1 56 ? -18.812 0.670   8.461   1.00 0.00 ? 56  GLU B HB2  1  
ATOM   1905  H HB3  . GLU B 1 56 ? -20.460 1.201   8.784   1.00 0.00 ? 56  GLU B HB3  1  
ATOM   1906  H HG2  . GLU B 1 56 ? -19.706 2.242   10.895  1.00 0.00 ? 56  GLU B HG2  1  
ATOM   1907  H HG3  . GLU B 1 56 ? -18.054 1.725   10.554  1.00 0.00 ? 56  GLU B HG3  1  
ATOM   1908  N N    . SER B 1 57 ? -21.788 -1.659  9.944   1.00 0.00 ? 57  SER B N    1  
ATOM   1909  C CA   . SER B 1 57 ? -22.749 -2.612  9.322   1.00 0.00 ? 57  SER B CA   1  
ATOM   1910  C C    . SER B 1 57 ? -23.094 -2.207  7.884   1.00 0.00 ? 57  SER B C    1  
ATOM   1911  O O    . SER B 1 57 ? -23.255 -3.050  7.025   1.00 0.00 ? 57  SER B O    1  
ATOM   1912  C CB   . SER B 1 57 ? -24.030 -2.648  10.154  1.00 0.00 ? 57  SER B CB   1  
ATOM   1913  O OG   . SER B 1 57 ? -24.524 -1.324  10.312  1.00 0.00 ? 57  SER B OG   1  
ATOM   1914  H H    . SER B 1 57 ? -21.983 -1.286  10.825  1.00 0.00 ? 57  SER B H    1  
ATOM   1915  H HA   . SER B 1 57 ? -22.311 -3.596  9.313   1.00 0.00 ? 57  SER B HA   1  
ATOM   1916  H HB2  . SER B 1 57 ? -24.772 -3.245  9.651   1.00 0.00 ? 57  SER B HB2  1  
ATOM   1917  H HB3  . SER B 1 57 ? -23.818 -3.082  11.122  1.00 0.00 ? 57  SER B HB3  1  
ATOM   1918  H HG   . SER B 1 57 ? -25.439 -1.381  10.596  1.00 0.00 ? 57  SER B HG   1  
ATOM   1919  N N    . TRP B 1 58 ? -23.236 -0.939  7.609   1.00 0.00 ? 58  TRP B N    1  
ATOM   1920  C CA   . TRP B 1 58 ? -23.600 -0.537  6.222   1.00 0.00 ? 58  TRP B CA   1  
ATOM   1921  C C    . TRP B 1 58 ? -22.511 -0.990  5.254   1.00 0.00 ? 58  TRP B C    1  
ATOM   1922  O O    . TRP B 1 58 ? -22.773 -1.286  4.106   1.00 0.00 ? 58  TRP B O    1  
ATOM   1923  C CB   . TRP B 1 58 ? -23.833 0.981   6.141   1.00 0.00 ? 58  TRP B CB   1  
ATOM   1924  C CG   . TRP B 1 58 ? -22.542 1.741   6.071   1.00 0.00 ? 58  TRP B CG   1  
ATOM   1925  C CD1  . TRP B 1 58 ? -21.999 2.435   7.097   1.00 0.00 ? 58  TRP B CD1  1  
ATOM   1926  C CD2  . TRP B 1 58 ? -21.649 1.930   4.932   1.00 0.00 ? 58  TRP B CD2  1  
ATOM   1927  N NE1  . TRP B 1 58 ? -20.827 3.031   6.667   1.00 0.00 ? 58  TRP B NE1  1  
ATOM   1928  C CE2  . TRP B 1 58 ? -20.563 2.748   5.345   1.00 0.00 ? 58  TRP B CE2  1  
ATOM   1929  C CE3  . TRP B 1 58 ? -21.667 1.472   3.594   1.00 0.00 ? 58  TRP B CE3  1  
ATOM   1930  C CZ2  . TRP B 1 58 ? -19.532 3.102   4.462   1.00 0.00 ? 58  TRP B CZ2  1  
ATOM   1931  C CZ3  . TRP B 1 58 ? -20.632 1.826   2.702   1.00 0.00 ? 58  TRP B CZ3  1  
ATOM   1932  C CH2  . TRP B 1 58 ? -19.567 2.638   3.137   1.00 0.00 ? 58  TRP B CH2  1  
ATOM   1933  H H    . TRP B 1 58 ? -23.115 -0.263  8.304   1.00 0.00 ? 58  TRP B H    1  
ATOM   1934  H HA   . TRP B 1 58 ? -24.520 -1.040  5.955   1.00 0.00 ? 58  TRP B HA   1  
ATOM   1935  H HB2  . TRP B 1 58 ? -24.417 1.199   5.262   1.00 0.00 ? 58  TRP B HB2  1  
ATOM   1936  H HB3  . TRP B 1 58 ? -24.384 1.298   7.016   1.00 0.00 ? 58  TRP B HB3  1  
ATOM   1937  H HD1  . TRP B 1 58 ? -22.413 2.512   8.092   1.00 0.00 ? 58  TRP B HD1  1  
ATOM   1938  H HE1  . TRP B 1 58 ? -20.243 3.589   7.218   1.00 0.00 ? 58  TRP B HE1  1  
ATOM   1939  H HE3  . TRP B 1 58 ? -22.479 0.855   3.251   1.00 0.00 ? 58  TRP B HE3  1  
ATOM   1940  H HZ2  . TRP B 1 58 ? -18.717 3.725   4.798   1.00 0.00 ? 58  TRP B HZ2  1  
ATOM   1941  H HZ3  . TRP B 1 58 ? -20.656 1.470   1.682   1.00 0.00 ? 58  TRP B HZ3  1  
ATOM   1942  H HH2  . TRP B 1 58 ? -18.777 2.907   2.452   1.00 0.00 ? 58  TRP B HH2  1  
ATOM   1943  N N    . VAL B 1 59 ? -21.296 -1.076  5.709   1.00 0.00 ? 59  VAL B N    1  
ATOM   1944  C CA   . VAL B 1 59 ? -20.209 -1.535  4.808   1.00 0.00 ? 59  VAL B CA   1  
ATOM   1945  C C    . VAL B 1 59 ? -20.452 -2.999  4.464   1.00 0.00 ? 59  VAL B C    1  
ATOM   1946  O O    . VAL B 1 59 ? -20.364 -3.404  3.323   1.00 0.00 ? 59  VAL B O    1  
ATOM   1947  C CB   . VAL B 1 59 ? -18.866 -1.380  5.517   1.00 0.00 ? 59  VAL B CB   1  
ATOM   1948  C CG1  . VAL B 1 59 ? -17.742 -1.931  4.634   1.00 0.00 ? 59  VAL B CG1  1  
ATOM   1949  C CG2  . VAL B 1 59 ? -18.631 0.105   5.790   1.00 0.00 ? 59  VAL B CG2  1  
ATOM   1950  H H    . VAL B 1 59 ? -21.102 -0.854  6.643   1.00 0.00 ? 59  VAL B H    1  
ATOM   1951  H HA   . VAL B 1 59 ? -20.214 -0.946  3.904   1.00 0.00 ? 59  VAL B HA   1  
ATOM   1952  H HB   . VAL B 1 59 ? -18.885 -1.922  6.451   1.00 0.00 ? 59  VAL B HB   1  
ATOM   1953  H HG11 . VAL B 1 59 ? -17.894 -1.614  3.615   1.00 0.00 ? 59  VAL B HG11 1  
ATOM   1954  H HG12 . VAL B 1 59 ? -16.791 -1.562  4.989   1.00 0.00 ? 59  VAL B HG12 1  
ATOM   1955  H HG13 . VAL B 1 59 ? -17.748 -3.010  4.678   1.00 0.00 ? 59  VAL B HG13 1  
ATOM   1956  H HG21 . VAL B 1 59 ? -19.509 0.524   6.261   1.00 0.00 ? 59  VAL B HG21 1  
ATOM   1957  H HG22 . VAL B 1 59 ? -17.779 0.221   6.440   1.00 0.00 ? 59  VAL B HG22 1  
ATOM   1958  H HG23 . VAL B 1 59 ? -18.446 0.616   4.858   1.00 0.00 ? 59  VAL B HG23 1  
ATOM   1959  N N    . GLN B 1 60 ? -20.778 -3.793  5.441   1.00 0.00 ? 60  GLN B N    1  
ATOM   1960  C CA   . GLN B 1 60 ? -21.049 -5.231  5.164   1.00 0.00 ? 60  GLN B CA   1  
ATOM   1961  C C    . GLN B 1 60 ? -22.294 -5.347  4.278   1.00 0.00 ? 60  GLN B C    1  
ATOM   1962  O O    . GLN B 1 60 ? -22.390 -6.216  3.434   1.00 0.00 ? 60  GLN B O    1  
ATOM   1963  C CB   . GLN B 1 60 ? -21.286 -5.971  6.482   1.00 0.00 ? 60  GLN B CB   1  
ATOM   1964  C CG   . GLN B 1 60 ? -21.294 -7.480  6.226   1.00 0.00 ? 60  GLN B CG   1  
ATOM   1965  C CD   . GLN B 1 60 ? -19.868 -7.957  5.947   1.00 0.00 ? 60  GLN B CD   1  
ATOM   1966  O OE1  . GLN B 1 60 ? -19.072 -8.093  6.855   1.00 0.00 ? 60  GLN B OE1  1  
ATOM   1967  N NE2  . GLN B 1 60 ? -19.509 -8.220  4.720   1.00 0.00 ? 60  GLN B NE2  1  
ATOM   1968  H H    . GLN B 1 60 ? -20.858 -3.440  6.357   1.00 0.00 ? 60  GLN B H    1  
ATOM   1969  H HA   . GLN B 1 60 ? -20.203 -5.663  4.652   1.00 0.00 ? 60  GLN B HA   1  
ATOM   1970  H HB2  . GLN B 1 60 ? -20.497 -5.727  7.178   1.00 0.00 ? 60  GLN B HB2  1  
ATOM   1971  H HB3  . GLN B 1 60 ? -22.237 -5.674  6.896   1.00 0.00 ? 60  GLN B HB3  1  
ATOM   1972  H HG2  . GLN B 1 60 ? -21.682 -7.990  7.096   1.00 0.00 ? 60  GLN B HG2  1  
ATOM   1973  H HG3  . GLN B 1 60 ? -21.917 -7.697  5.372   1.00 0.00 ? 60  GLN B HG3  1  
ATOM   1974  H HE21 . GLN B 1 60 ? -20.150 -8.110  3.988   1.00 0.00 ? 60  GLN B HE21 1  
ATOM   1975  H HE22 . GLN B 1 60 ? -18.597 -8.526  4.531   1.00 0.00 ? 60  GLN B HE22 1  
ATOM   1976  N N    . GLU B 1 61 ? -23.250 -4.478  4.470   1.00 0.00 ? 61  GLU B N    1  
ATOM   1977  C CA   . GLU B 1 61 ? -24.496 -4.532  3.650   1.00 0.00 ? 61  GLU B CA   1  
ATOM   1978  C C    . GLU B 1 61 ? -24.177 -4.225  2.184   1.00 0.00 ? 61  GLU B C    1  
ATOM   1979  O O    . GLU B 1 61 ? -24.581 -4.941  1.289   1.00 0.00 ? 61  GLU B O    1  
ATOM   1980  C CB   . GLU B 1 61 ? -25.495 -3.502  4.178   1.00 0.00 ? 61  GLU B CB   1  
ATOM   1981  C CG   . GLU B 1 61 ? -26.839 -3.685  3.469   1.00 0.00 ? 61  GLU B CG   1  
ATOM   1982  C CD   . GLU B 1 61 ? -27.859 -2.702  4.046   1.00 0.00 ? 61  GLU B CD   1  
ATOM   1983  O OE1  . GLU B 1 61 ? -27.687 -2.302  5.186   1.00 0.00 ? 61  GLU B OE1  1  
ATOM   1984  O OE2  . GLU B 1 61 ? -28.794 -2.366  3.339   1.00 0.00 ? 61  GLU B OE2  1  
ATOM   1985  H H    . GLU B 1 61 ? -23.148 -3.790  5.160   1.00 0.00 ? 61  GLU B H    1  
ATOM   1986  H HA   . GLU B 1 61 ? -24.927 -5.517  3.721   1.00 0.00 ? 61  GLU B HA   1  
ATOM   1987  H HB2  . GLU B 1 61 ? -25.627 -3.641  5.242   1.00 0.00 ? 61  GLU B HB2  1  
ATOM   1988  H HB3  . GLU B 1 61 ? -25.122 -2.507  3.988   1.00 0.00 ? 61  GLU B HB3  1  
ATOM   1989  H HG2  . GLU B 1 61 ? -26.715 -3.498  2.412   1.00 0.00 ? 61  GLU B HG2  1  
ATOM   1990  H HG3  . GLU B 1 61 ? -27.192 -4.694  3.618   1.00 0.00 ? 61  GLU B HG3  1  
ATOM   1991  N N    . TYR B 1 62 ? -23.465 -3.163  1.931   1.00 0.00 ? 62  TYR B N    1  
ATOM   1992  C CA   . TYR B 1 62 ? -23.130 -2.805  0.522   1.00 0.00 ? 62  TYR B CA   1  
ATOM   1993  C C    . TYR B 1 62 ? -22.304 -3.931  -0.110  1.00 0.00 ? 62  TYR B C    1  
ATOM   1994  O O    . TYR B 1 62 ? -22.429 -4.218  -1.284  1.00 0.00 ? 62  TYR B O    1  
ATOM   1995  C CB   . TYR B 1 62 ? -22.321 -1.498  0.497   1.00 0.00 ? 62  TYR B CB   1  
ATOM   1996  C CG   . TYR B 1 62 ? -23.243 -0.292  0.585   1.00 0.00 ? 62  TYR B CG   1  
ATOM   1997  C CD1  . TYR B 1 62 ? -24.201 -0.193  1.617   1.00 0.00 ? 62  TYR B CD1  1  
ATOM   1998  C CD2  . TYR B 1 62 ? -23.134 0.742   -0.369  1.00 0.00 ? 62  TYR B CD2  1  
ATOM   1999  C CE1  . TYR B 1 62 ? -25.044 0.935   1.691   1.00 0.00 ? 62  TYR B CE1  1  
ATOM   2000  C CE2  . TYR B 1 62 ? -23.978 1.865   -0.294  1.00 0.00 ? 62  TYR B CE2  1  
ATOM   2001  C CZ   . TYR B 1 62 ? -24.931 1.962   0.736   1.00 0.00 ? 62  TYR B CZ   1  
ATOM   2002  O OH   . TYR B 1 62 ? -25.757 3.066   0.809   1.00 0.00 ? 62  TYR B OH   1  
ATOM   2003  H H    . TYR B 1 62 ? -23.156 -2.597  2.668   1.00 0.00 ? 62  TYR B H    1  
ATOM   2004  H HA   . TYR B 1 62 ? -24.043 -2.675  -0.041  1.00 0.00 ? 62  TYR B HA   1  
ATOM   2005  H HB2  . TYR B 1 62 ? -21.643 -1.486  1.338   1.00 0.00 ? 62  TYR B HB2  1  
ATOM   2006  H HB3  . TYR B 1 62 ? -21.748 -1.445  -0.419  1.00 0.00 ? 62  TYR B HB3  1  
ATOM   2007  H HD1  . TYR B 1 62 ? -24.291 -0.978  2.349   1.00 0.00 ? 62  TYR B HD1  1  
ATOM   2008  H HD2  . TYR B 1 62 ? -22.403 0.671   -1.161  1.00 0.00 ? 62  TYR B HD2  1  
ATOM   2009  H HE1  . TYR B 1 62 ? -25.775 1.013   2.484   1.00 0.00 ? 62  TYR B HE1  1  
ATOM   2010  H HE2  . TYR B 1 62 ? -23.892 2.655   -1.025  1.00 0.00 ? 62  TYR B HE2  1  
ATOM   2011  H HH   . TYR B 1 62 ? -26.500 2.920   0.220   1.00 0.00 ? 62  TYR B HH   1  
ATOM   2012  N N    . VAL B 1 63 ? -21.469 -4.574  0.655   1.00 0.00 ? 63  VAL B N    1  
ATOM   2013  C CA   . VAL B 1 63 ? -20.651 -5.678  0.092   1.00 0.00 ? 63  VAL B CA   1  
ATOM   2014  C C    . VAL B 1 63 ? -21.586 -6.806  -0.314  1.00 0.00 ? 63  VAL B C    1  
ATOM   2015  O O    . VAL B 1 63 ? -21.422 -7.429  -1.343  1.00 0.00 ? 63  VAL B O    1  
ATOM   2016  C CB   . VAL B 1 63 ? -19.668 -6.175  1.154   1.00 0.00 ? 63  VAL B CB   1  
ATOM   2017  C CG1  . VAL B 1 63 ? -18.979 -7.453  0.666   1.00 0.00 ? 63  VAL B CG1  1  
ATOM   2018  C CG2  . VAL B 1 63 ? -18.613 -5.096  1.413   1.00 0.00 ? 63  VAL B CG2  1  
ATOM   2019  H H    . VAL B 1 63 ? -21.388 -4.340  1.600   1.00 0.00 ? 63  VAL B H    1  
ATOM   2020  H HA   . VAL B 1 63 ? -20.109 -5.325  -0.771  1.00 0.00 ? 63  VAL B HA   1  
ATOM   2021  H HB   . VAL B 1 63 ? -20.205 -6.383  2.068   1.00 0.00 ? 63  VAL B HB   1  
ATOM   2022  H HG11 . VAL B 1 63 ? -18.644 -7.315  -0.351  1.00 0.00 ? 63  VAL B HG11 1  
ATOM   2023  H HG12 . VAL B 1 63 ? -18.131 -7.668  1.299   1.00 0.00 ? 63  VAL B HG12 1  
ATOM   2024  H HG13 . VAL B 1 63 ? -19.677 -8.276  0.707   1.00 0.00 ? 63  VAL B HG13 1  
ATOM   2025  H HG21 . VAL B 1 63 ? -19.093 -4.132  1.491   1.00 0.00 ? 63  VAL B HG21 1  
ATOM   2026  H HG22 . VAL B 1 63 ? -18.094 -5.314  2.334   1.00 0.00 ? 63  VAL B HG22 1  
ATOM   2027  H HG23 . VAL B 1 63 ? -17.906 -5.079  0.596   1.00 0.00 ? 63  VAL B HG23 1  
ATOM   2028  N N    . TYR B 1 64 ? -22.572 -7.066  0.492   1.00 0.00 ? 64  TYR B N    1  
ATOM   2029  C CA   . TYR B 1 64 ? -23.528 -8.150  0.165   1.00 0.00 ? 64  TYR B CA   1  
ATOM   2030  C C    . TYR B 1 64 ? -24.244 -7.807  -1.138  1.00 0.00 ? 64  TYR B C    1  
ATOM   2031  O O    . TYR B 1 64 ? -24.417 -8.637  -2.006  1.00 0.00 ? 64  TYR B O    1  
ATOM   2032  C CB   . TYR B 1 64 ? -24.553 -8.278  1.295   1.00 0.00 ? 64  TYR B CB   1  
ATOM   2033  C CG   . TYR B 1 64 ? -25.255 -9.614  1.201   1.00 0.00 ? 64  TYR B CG   1  
ATOM   2034  C CD1  . TYR B 1 64 ? -24.582 -10.790 1.585   1.00 0.00 ? 64  TYR B CD1  1  
ATOM   2035  C CD2  . TYR B 1 64 ? -26.580 -9.684  0.729   1.00 0.00 ? 64  TYR B CD2  1  
ATOM   2036  C CE1  . TYR B 1 64 ? -25.234 -12.035 1.497   1.00 0.00 ? 64  TYR B CE1  1  
ATOM   2037  C CE2  . TYR B 1 64 ? -27.232 -10.929 0.641   1.00 0.00 ? 64  TYR B CE2  1  
ATOM   2038  C CZ   . TYR B 1 64 ? -26.559 -12.105 1.025   1.00 0.00 ? 64  TYR B CZ   1  
ATOM   2039  O OH   . TYR B 1 64 ? -27.199 -13.325 0.938   1.00 0.00 ? 64  TYR B OH   1  
ATOM   2040  H H    . TYR B 1 64 ? -22.683 -6.546  1.314   1.00 0.00 ? 64  TYR B H    1  
ATOM   2041  H HA   . TYR B 1 64 ? -22.988 -9.073  0.054   1.00 0.00 ? 64  TYR B HA   1  
ATOM   2042  H HB2  . TYR B 1 64 ? -24.046 -8.202  2.243   1.00 0.00 ? 64  TYR B HB2  1  
ATOM   2043  H HB3  . TYR B 1 64 ? -25.280 -7.482  1.216   1.00 0.00 ? 64  TYR B HB3  1  
ATOM   2044  H HD1  . TYR B 1 64 ? -23.566 -10.738 1.947   1.00 0.00 ? 64  TYR B HD1  1  
ATOM   2045  H HD2  . TYR B 1 64 ? -27.096 -8.782  0.434   1.00 0.00 ? 64  TYR B HD2  1  
ATOM   2046  H HE1  . TYR B 1 64 ? -24.718 -12.937 1.791   1.00 0.00 ? 64  TYR B HE1  1  
ATOM   2047  H HE2  . TYR B 1 64 ? -28.248 -10.982 0.279   1.00 0.00 ? 64  TYR B HE2  1  
ATOM   2048  H HH   . TYR B 1 64 ? -28.041 -13.188 0.500   1.00 0.00 ? 64  TYR B HH   1  
ATOM   2049  N N    . ASP B 1 65 ? -24.656 -6.582  -1.273  1.00 0.00 ? 65  ASP B N    1  
ATOM   2050  C CA   . ASP B 1 65 ? -25.365 -6.161  -2.513  1.00 0.00 ? 65  ASP B CA   1  
ATOM   2051  C C    . ASP B 1 65 ? -24.432 -6.334  -3.715  1.00 0.00 ? 65  ASP B C    1  
ATOM   2052  O O    . ASP B 1 65 ? -24.858 -6.658  -4.806  1.00 0.00 ? 65  ASP B O    1  
ATOM   2053  C CB   . ASP B 1 65 ? -25.769 -4.688  -2.382  1.00 0.00 ? 65  ASP B CB   1  
ATOM   2054  C CG   . ASP B 1 65 ? -27.033 -4.572  -1.525  1.00 0.00 ? 65  ASP B CG   1  
ATOM   2055  O OD1  . ASP B 1 65 ? -26.902 -4.535  -0.313  1.00 0.00 ? 65  ASP B OD1  1  
ATOM   2056  O OD2  . ASP B 1 65 ? -28.109 -4.522  -2.097  1.00 0.00 ? 65  ASP B OD2  1  
ATOM   2057  H H    . ASP B 1 65 ? -24.498 -5.935  -0.553  1.00 0.00 ? 65  ASP B H    1  
ATOM   2058  H HA   . ASP B 1 65 ? -26.246 -6.770  -2.652  1.00 0.00 ? 65  ASP B HA   1  
ATOM   2059  H HB2  . ASP B 1 65 ? -24.965 -4.138  -1.912  1.00 0.00 ? 65  ASP B HB2  1  
ATOM   2060  H HB3  . ASP B 1 65 ? -25.959 -4.277  -3.359  1.00 0.00 ? 65  ASP B HB3  1  
ATOM   2061  N N    . LEU B 1 66 ? -23.164 -6.118  -3.518  1.00 0.00 ? 66  LEU B N    1  
ATOM   2062  C CA   . LEU B 1 66 ? -22.192 -6.265  -4.637  1.00 0.00 ? 66  LEU B CA   1  
ATOM   2063  C C    . LEU B 1 66 ? -22.008 -7.750  -4.966  1.00 0.00 ? 66  LEU B C    1  
ATOM   2064  O O    . LEU B 1 66 ? -21.744 -8.118  -6.093  1.00 0.00 ? 66  LEU B O    1  
ATOM   2065  C CB   . LEU B 1 66 ? -20.852 -5.651  -4.209  1.00 0.00 ? 66  LEU B CB   1  
ATOM   2066  C CG   . LEU B 1 66 ? -20.891 -4.117  -4.377  1.00 0.00 ? 66  LEU B CG   1  
ATOM   2067  C CD1  . LEU B 1 66 ? -19.829 -3.471  -3.484  1.00 0.00 ? 66  LEU B CD1  1  
ATOM   2068  C CD2  . LEU B 1 66 ? -20.598 -3.732  -5.838  1.00 0.00 ? 66  LEU B CD2  1  
ATOM   2069  H H    . LEU B 1 66 ? -22.848 -5.855  -2.630  1.00 0.00 ? 66  LEU B H    1  
ATOM   2070  H HA   . LEU B 1 66 ? -22.568 -5.751  -5.507  1.00 0.00 ? 66  LEU B HA   1  
ATOM   2071  H HB2  . LEU B 1 66 ? -20.674 -5.894  -3.170  1.00 0.00 ? 66  LEU B HB2  1  
ATOM   2072  H HB3  . LEU B 1 66 ? -20.059 -6.065  -4.807  1.00 0.00 ? 66  LEU B HB3  1  
ATOM   2073  H HG   . LEU B 1 66 ? -21.867 -3.747  -4.095  1.00 0.00 ? 66  LEU B HG   1  
ATOM   2074  H HD11 . LEU B 1 66 ? -18.860 -3.870  -3.731  1.00 0.00 ? 66  LEU B HD11 1  
ATOM   2075  H HD12 . LEU B 1 66 ? -19.829 -2.402  -3.641  1.00 0.00 ? 66  LEU B HD12 1  
ATOM   2076  H HD13 . LEU B 1 66 ? -20.053 -3.682  -2.449  1.00 0.00 ? 66  LEU B HD13 1  
ATOM   2077  H HD21 . LEU B 1 66 ? -19.720 -4.256  -6.184  1.00 0.00 ? 66  LEU B HD21 1  
ATOM   2078  H HD22 . LEU B 1 66 ? -21.440 -3.991  -6.460  1.00 0.00 ? 66  LEU B HD22 1  
ATOM   2079  H HD23 . LEU B 1 66 ? -20.424 -2.668  -5.898  1.00 0.00 ? 66  LEU B HD23 1  
ATOM   2080  N N    . GLU B 1 67 ? -22.149 -8.603  -3.992  1.00 0.00 ? 67  GLU B N    1  
ATOM   2081  C CA   . GLU B 1 67 ? -21.988 -10.063 -4.251  1.00 0.00 ? 67  GLU B CA   1  
ATOM   2082  C C    . GLU B 1 67 ? -23.196 -10.565 -5.038  1.00 0.00 ? 67  GLU B C    1  
ATOM   2083  O O    . GLU B 1 67 ? -23.110 -11.512 -5.794  1.00 0.00 ? 67  GLU B O    1  
ATOM   2084  C CB   . GLU B 1 67 ? -21.908 -10.810 -2.920  1.00 0.00 ? 67  GLU B CB   1  
ATOM   2085  C CG   . GLU B 1 67 ? -20.562 -10.523 -2.261  1.00 0.00 ? 67  GLU B CG   1  
ATOM   2086  C CD   . GLU B 1 67 ? -20.409 -11.388 -1.008  1.00 0.00 ? 67  GLU B CD   1  
ATOM   2087  O OE1  . GLU B 1 67 ? -21.063 -12.416 -0.939  1.00 0.00 ? 67  GLU B OE1  1  
ATOM   2088  O OE2  . GLU B 1 67 ? -19.641 -11.009 -0.140  1.00 0.00 ? 67  GLU B OE2  1  
ATOM   2089  H H    . GLU B 1 67 ? -22.363 -8.282  -3.092  1.00 0.00 ? 67  GLU B H    1  
ATOM   2090  H HA   . GLU B 1 67 ? -21.087 -10.234 -4.820  1.00 0.00 ? 67  GLU B HA   1  
ATOM   2091  H HB2  . GLU B 1 67 ? -22.706 -10.477 -2.272  1.00 0.00 ? 67  GLU B HB2  1  
ATOM   2092  H HB3  . GLU B 1 67 ? -22.003 -11.871 -3.094  1.00 0.00 ? 67  GLU B HB3  1  
ATOM   2093  H HG2  . GLU B 1 67 ? -19.769 -10.749 -2.957  1.00 0.00 ? 67  GLU B HG2  1  
ATOM   2094  H HG3  . GLU B 1 67 ? -20.515 -9.482  -1.986  1.00 0.00 ? 67  GLU B HG3  1  
ATOM   2095  N N    . LEU B 1 68 ? -24.319 -9.931  -4.867  1.00 0.00 ? 68  LEU B N    1  
ATOM   2096  C CA   . LEU B 1 68 ? -25.539 -10.363 -5.606  1.00 0.00 ? 68  LEU B CA   1  
ATOM   2097  C C    . LEU B 1 68 ? -25.460 -9.867  -7.052  1.00 0.00 ? 68  LEU B C    1  
ATOM   2098  O O    . LEU B 1 68 ? -24.718 -10.393 -7.858  1.00 0.00 ? 68  LEU B O    1  
ATOM   2099  C CB   . LEU B 1 68 ? -26.781 -9.778  -4.938  1.00 0.00 ? 68  LEU B CB   1  
ATOM   2100  C CG   . LEU B 1 68 ? -26.905 -10.314 -3.509  1.00 0.00 ? 68  LEU B CG   1  
ATOM   2101  C CD1  . LEU B 1 68 ? -28.101 -9.644  -2.842  1.00 0.00 ? 68  LEU B CD1  1  
ATOM   2102  C CD2  . LEU B 1 68 ? -27.109 -11.843 -3.521  1.00 0.00 ? 68  LEU B CD2  1  
ATOM   2103  H H    . LEU B 1 68 ? -24.358 -9.169  -4.252  1.00 0.00 ? 68  LEU B H    1  
ATOM   2104  H HA   . LEU B 1 68 ? -25.605 -11.436 -5.598  1.00 0.00 ? 68  LEU B HA   1  
ATOM   2105  H HB2  . LEU B 1 68 ? -26.700 -8.701  -4.913  1.00 0.00 ? 68  LEU B HB2  1  
ATOM   2106  H HB3  . LEU B 1 68 ? -27.657 -10.059 -5.502  1.00 0.00 ? 68  LEU B HB3  1  
ATOM   2107  H HG   . LEU B 1 68 ? -26.008 -10.072 -2.957  1.00 0.00 ? 68  LEU B HG   1  
ATOM   2108  H HD11 . LEU B 1 68 ? -28.031 -8.576  -2.974  1.00 0.00 ? 68  LEU B HD11 1  
ATOM   2109  H HD12 . LEU B 1 68 ? -29.011 -10.006 -3.297  1.00 0.00 ? 68  LEU B HD12 1  
ATOM   2110  H HD13 . LEU B 1 68 ? -28.103 -9.881  -1.790  1.00 0.00 ? 68  LEU B HD13 1  
ATOM   2111  H HD21 . LEU B 1 68 ? -27.682 -12.129 -4.393  1.00 0.00 ? 68  LEU B HD21 1  
ATOM   2112  H HD22 . LEU B 1 68 ? -26.148 -12.335 -3.545  1.00 0.00 ? 68  LEU B HD22 1  
ATOM   2113  H HD23 . LEU B 1 68 ? -27.639 -12.150 -2.630  1.00 0.00 ? 68  LEU B HD23 1  
ATOM   2114  N N    . ASN B 1 69 ? -26.219 -8.857  -7.388  1.00 0.00 ? 69  ASN B N    1  
ATOM   2115  C CA   . ASN B 1 69 ? -26.189 -8.325  -8.782  1.00 0.00 ? 69  ASN B CA   1  
ATOM   2116  C C    . ASN B 1 69 ? -25.114 -7.242  -8.891  1.00 0.00 ? 69  ASN B C    1  
ATOM   2117  O O    . ASN B 1 69 ? -25.135 -6.330  -8.081  1.00 0.00 ? 69  ASN B O    1  
ATOM   2118  C CB   . ASN B 1 69 ? -27.553 -7.722  -9.124  1.00 0.00 ? 69  ASN B CB   1  
ATOM   2119  C CG   . ASN B 1 69 ? -27.609 -7.404  -10.619 1.00 0.00 ? 69  ASN B CG   1  
ATOM   2120  O OD1  . ASN B 1 69 ? -27.338 -8.254  -11.444 1.00 0.00 ? 69  ASN B OD1  1  
ATOM   2121  N ND2  . ASN B 1 69 ? -27.952 -6.206  -11.007 1.00 0.00 ? 69  ASN B ND2  1  
ATOM   2122  O OXT  . ASN B 1 69 ? -24.288 -7.342  -9.784  1.00 0.00 ? 69  ASN B OXT  1  
ATOM   2123  H H    . ASN B 1 69 ? -26.809 -8.448  -6.723  1.00 0.00 ? 69  ASN B H    1  
ATOM   2124  H HA   . ASN B 1 69 ? -25.967 -9.125  -9.472  1.00 0.00 ? 69  ASN B HA   1  
ATOM   2125  H HB2  . ASN B 1 69 ? -28.332 -8.430  -8.876  1.00 0.00 ? 69  ASN B HB2  1  
ATOM   2126  H HB3  . ASN B 1 69 ? -27.698 -6.814  -8.559  1.00 0.00 ? 69  ASN B HB3  1  
ATOM   2127  H HD21 . ASN B 1 69 ? -28.171 -5.520  -10.342 1.00 0.00 ? 69  ASN B HD21 1  
ATOM   2128  H HD22 . ASN B 1 69 ? -27.991 -5.992  -11.962 1.00 0.00 ? 69  ASN B HD22 1  
HETATM 2129  O O    . HOH C 2 .  ? 6.655   1.813   5.807   1.00 0.00 ? 201 HOH A O    1  
HETATM 2130  H H1   . HOH C 2 .  ? 6.164   2.603   5.581   1.00 0.00 ? 201 HOH A H1   1  
HETATM 2131  H H2   . HOH C 2 .  ? 7.092   2.030   6.630   1.00 0.00 ? 201 HOH A H2   1  
HETATM 2132  O O    . HOH C 2 .  ? 4.218   5.794   6.387   1.00 0.00 ? 202 HOH A O    1  
HETATM 2133  H H1   . HOH C 2 .  ? 3.848   5.110   6.945   1.00 0.00 ? 202 HOH A H1   1  
HETATM 2134  H H2   . HOH C 2 .  ? 4.305   6.554   6.963   1.00 0.00 ? 202 HOH A H2   1  
HETATM 2135  O O    . HOH D 2 .  ? -6.349  -1.559  5.711   1.00 0.00 ? 301 HOH B O    1  
HETATM 2136  H H1   . HOH D 2 .  ? -5.671  -2.176  5.437   1.00 0.00 ? 301 HOH B H1   1  
HETATM 2137  H H2   . HOH D 2 .  ? -6.979  -2.093  6.198   1.00 0.00 ? 301 HOH B H2   1  
HETATM 2138  O O    . HOH D 2 .  ? -4.341  -5.649  6.456   1.00 0.00 ? 302 HOH B O    1  
HETATM 2139  H H1   . HOH D 2 .  ? -3.754  -5.005  6.851   1.00 0.00 ? 302 HOH B H1   1  
HETATM 2140  H H2   . HOH D 2 .  ? -3.867  -6.478  6.523   1.00 0.00 ? 302 HOH B H2   1  
ATOM   2141  N N    . ALA A 1 1  ? -9.207  15.832  -14.244 1.00 0.00 ? 1   ALA A N    2  
ATOM   2142  C CA   . ALA A 1 1  ? -8.554  14.678  -13.565 1.00 0.00 ? 1   ALA A CA   2  
ATOM   2143  C C    . ALA A 1 1  ? -8.700  14.822  -12.043 1.00 0.00 ? 1   ALA A C    2  
ATOM   2144  O O    . ALA A 1 1  ? -7.720  15.031  -11.355 1.00 0.00 ? 1   ALA A O    2  
ATOM   2145  C CB   . ALA A 1 1  ? -7.068  14.656  -13.929 1.00 0.00 ? 1   ALA A CB   2  
ATOM   2146  H H1   . ALA A 1 1  ? -9.603  16.475  -13.530 1.00 0.00 ? 1   ALA A H1   2  
ATOM   2147  H H2   . ALA A 1 1  ? -8.504  16.339  -14.819 1.00 0.00 ? 1   ALA A H2   2  
ATOM   2148  H H3   . ALA A 1 1  ? -9.972  15.485  -14.858 1.00 0.00 ? 1   ALA A H3   2  
ATOM   2149  H HA   . ALA A 1 1  ? -9.013  13.757  -13.891 1.00 0.00 ? 1   ALA A HA   2  
ATOM   2150  H HB1  . ALA A 1 1  ? -6.651  15.644  -13.800 1.00 0.00 ? 1   ALA A HB1  2  
ATOM   2151  H HB2  . ALA A 1 1  ? -6.549  13.960  -13.285 1.00 0.00 ? 1   ALA A HB2  2  
ATOM   2152  H HB3  . ALA A 1 1  ? -6.953  14.348  -14.958 1.00 0.00 ? 1   ALA A HB3  2  
ATOM   2153  N N    . PRO A 1 2  ? -9.917  14.711  -11.549 1.00 0.00 ? 2   PRO A N    2  
ATOM   2154  C CA   . PRO A 1 2  ? -10.174 14.836  -10.102 1.00 0.00 ? 2   PRO A CA   2  
ATOM   2155  C C    . PRO A 1 2  ? -9.432  13.724  -9.344  1.00 0.00 ? 2   PRO A C    2  
ATOM   2156  O O    . PRO A 1 2  ? -9.277  12.622  -9.833  1.00 0.00 ? 2   PRO A O    2  
ATOM   2157  C CB   . PRO A 1 2  ? -11.710 14.699  -9.955  1.00 0.00 ? 2   PRO A CB   2  
ATOM   2158  C CG   . PRO A 1 2  ? -12.298 14.480  -11.380 1.00 0.00 ? 2   PRO A CG   2  
ATOM   2159  C CD   . PRO A 1 2  ? -11.117 14.457  -12.377 1.00 0.00 ? 2   PRO A CD   2  
ATOM   2160  H HA   . PRO A 1 2  ? -9.852  15.804  -9.750  1.00 0.00 ? 2   PRO A HA   2  
ATOM   2161  H HB2  . PRO A 1 2  ? -11.954 13.855  -9.319  1.00 0.00 ? 2   PRO A HB2  2  
ATOM   2162  H HB3  . PRO A 1 2  ? -12.122 15.604  -9.528  1.00 0.00 ? 2   PRO A HB3  2  
ATOM   2163  H HG2  . PRO A 1 2  ? -12.835 13.537  -11.416 1.00 0.00 ? 2   PRO A HG2  2  
ATOM   2164  H HG3  . PRO A 1 2  ? -12.973 15.289  -11.632 1.00 0.00 ? 2   PRO A HG3  2  
ATOM   2165  H HD2  . PRO A 1 2  ? -11.049 13.488  -12.855 1.00 0.00 ? 2   PRO A HD2  2  
ATOM   2166  H HD3  . PRO A 1 2  ? -11.228 15.235  -13.118 1.00 0.00 ? 2   PRO A HD3  2  
ATOM   2167  N N    . MET A 1 3  ? -8.973  14.009  -8.156  1.00 0.00 ? 3   MET A N    2  
ATOM   2168  C CA   . MET A 1 3  ? -8.244  12.973  -7.370  1.00 0.00 ? 3   MET A CA   2  
ATOM   2169  C C    . MET A 1 3  ? -9.252  12.018  -6.727  1.00 0.00 ? 3   MET A C    2  
ATOM   2170  O O    . MET A 1 3  ? -10.344 12.407  -6.361  1.00 0.00 ? 3   MET A O    2  
ATOM   2171  C CB   . MET A 1 3  ? -7.417  13.651  -6.276  1.00 0.00 ? 3   MET A CB   2  
ATOM   2172  C CG   . MET A 1 3  ? -6.436  14.639  -6.912  1.00 0.00 ? 3   MET A CG   2  
ATOM   2173  S SD   . MET A 1 3  ? -5.771  15.734  -5.634  1.00 0.00 ? 3   MET A SD   2  
ATOM   2174  C CE   . MET A 1 3  ? -4.356  16.351  -6.577  1.00 0.00 ? 3   MET A CE   2  
ATOM   2175  H H    . MET A 1 3  ? -9.108  14.904  -7.780  1.00 0.00 ? 3   MET A H    2  
ATOM   2176  H HA   . MET A 1 3  ? -7.589  12.418  -8.026  1.00 0.00 ? 3   MET A HA   2  
ATOM   2177  H HB2  . MET A 1 3  ? -8.075  14.180  -5.603  1.00 0.00 ? 3   MET A HB2  2  
ATOM   2178  H HB3  . MET A 1 3  ? -6.864  12.903  -5.727  1.00 0.00 ? 3   MET A HB3  2  
ATOM   2179  H HG2  . MET A 1 3  ? -5.628  14.095  -7.377  1.00 0.00 ? 3   MET A HG2  2  
ATOM   2180  H HG3  . MET A 1 3  ? -6.951  15.227  -7.658  1.00 0.00 ? 3   MET A HG3  2  
ATOM   2181  H HE1  . MET A 1 3  ? -4.645  16.492  -7.609  1.00 0.00 ? 3   MET A HE1  2  
ATOM   2182  H HE2  . MET A 1 3  ? -4.027  17.292  -6.157  1.00 0.00 ? 3   MET A HE2  2  
ATOM   2183  H HE3  . MET A 1 3  ? -3.549  15.637  -6.527  1.00 0.00 ? 3   MET A HE3  2  
ATOM   2184  N N    . GLY A 1 4  ? -8.896  10.770  -6.586  1.00 0.00 ? 4   GLY A N    2  
ATOM   2185  C CA   . GLY A 1 4  ? -9.835  9.793   -5.965  1.00 0.00 ? 4   GLY A CA   2  
ATOM   2186  C C    . GLY A 1 4  ? -10.308 10.327  -4.613  1.00 0.00 ? 4   GLY A C    2  
ATOM   2187  O O    . GLY A 1 4  ? -9.980  11.432  -4.223  1.00 0.00 ? 4   GLY A O    2  
ATOM   2188  H H    . GLY A 1 4  ? -8.011  10.476  -6.887  1.00 0.00 ? 4   GLY A H    2  
ATOM   2189  H HA2  . GLY A 1 4  ? -10.686 9.650   -6.616  1.00 0.00 ? 4   GLY A HA2  2  
ATOM   2190  H HA3  . GLY A 1 4  ? -9.330  8.851   -5.818  1.00 0.00 ? 4   GLY A HA3  2  
ATOM   2191  N N    . SER A 1 5  ? -11.081 9.557   -3.891  1.00 0.00 ? 5   SER A N    2  
ATOM   2192  C CA   . SER A 1 5  ? -11.578 10.028  -2.565  1.00 0.00 ? 5   SER A CA   2  
ATOM   2193  C C    . SER A 1 5  ? -10.552 9.677   -1.474  1.00 0.00 ? 5   SER A C    2  
ATOM   2194  O O    . SER A 1 5  ? -9.955  10.546  -0.870  1.00 0.00 ? 5   SER A O    2  
ATOM   2195  C CB   . SER A 1 5  ? -12.939 9.373   -2.269  1.00 0.00 ? 5   SER A CB   2  
ATOM   2196  O OG   . SER A 1 5  ? -13.897 10.393  -2.011  1.00 0.00 ? 5   SER A OG   2  
ATOM   2197  H H    . SER A 1 5  ? -11.337 8.672   -4.223  1.00 0.00 ? 5   SER A H    2  
ATOM   2198  H HA   . SER A 1 5  ? -11.705 11.099  -2.594  1.00 0.00 ? 5   SER A HA   2  
ATOM   2199  H HB2  . SER A 1 5  ? -13.257 8.806   -3.127  1.00 0.00 ? 5   SER A HB2  2  
ATOM   2200  H HB3  . SER A 1 5  ? -12.865 8.714   -1.413  1.00 0.00 ? 5   SER A HB3  2  
ATOM   2201  H HG   . SER A 1 5  ? -14.761 10.056  -2.256  1.00 0.00 ? 5   SER A HG   2  
ATOM   2202  N N    . ASP A 1 6  ? -10.345 8.411   -1.216  1.00 0.00 ? 6   ASP A N    2  
ATOM   2203  C CA   . ASP A 1 6  ? -9.360  8.010   -0.164  1.00 0.00 ? 6   ASP A CA   2  
ATOM   2204  C C    . ASP A 1 6  ? -8.875  6.575   -0.426  1.00 0.00 ? 6   ASP A C    2  
ATOM   2205  O O    . ASP A 1 6  ? -9.208  5.675   0.319   1.00 0.00 ? 6   ASP A O    2  
ATOM   2206  C CB   . ASP A 1 6  ? -10.029 8.062   1.216   1.00 0.00 ? 6   ASP A CB   2  
ATOM   2207  C CG   . ASP A 1 6  ? -10.802 9.375   1.366   1.00 0.00 ? 6   ASP A CG   2  
ATOM   2208  O OD1  . ASP A 1 6  ? -10.182 10.368  1.708   1.00 0.00 ? 6   ASP A OD1  2  
ATOM   2209  O OD2  . ASP A 1 6  ? -11.999 9.363   1.135   1.00 0.00 ? 6   ASP A OD2  2  
ATOM   2210  H H    . ASP A 1 6  ? -10.837 7.726   -1.715  1.00 0.00 ? 6   ASP A H    2  
ATOM   2211  H HA   . ASP A 1 6  ? -8.519  8.686   -0.177  1.00 0.00 ? 6   ASP A HA   2  
ATOM   2212  H HB2  . ASP A 1 6  ? -10.709 7.229   1.319   1.00 0.00 ? 6   ASP A HB2  2  
ATOM   2213  H HB3  . ASP A 1 6  ? -9.272  8.004   1.985   1.00 0.00 ? 6   ASP A HB3  2  
ATOM   2214  N N    . PRO A 1 7  ? -8.103  6.392   -1.477  1.00 0.00 ? 7   PRO A N    2  
ATOM   2215  C CA   . PRO A 1 7  ? -7.582  5.056   -1.827  1.00 0.00 ? 7   PRO A CA   2  
ATOM   2216  C C    . PRO A 1 7  ? -6.619  4.562   -0.724  1.00 0.00 ? 7   PRO A C    2  
ATOM   2217  O O    . PRO A 1 7  ? -6.216  5.334   0.122   1.00 0.00 ? 7   PRO A O    2  
ATOM   2218  C CB   . PRO A 1 7  ? -6.846  5.259   -3.174  1.00 0.00 ? 7   PRO A CB   2  
ATOM   2219  C CG   . PRO A 1 7  ? -6.926  6.775   -3.529  1.00 0.00 ? 7   PRO A CG   2  
ATOM   2220  C CD   . PRO A 1 7  ? -7.697  7.481   -2.391  1.00 0.00 ? 7   PRO A CD   2  
ATOM   2221  H HA   . PRO A 1 7  ? -8.402  4.368   -1.950  1.00 0.00 ? 7   PRO A HA   2  
ATOM   2222  H HB2  . PRO A 1 7  ? -5.808  4.953   -3.087  1.00 0.00 ? 7   PRO A HB2  2  
ATOM   2223  H HB3  . PRO A 1 7  ? -7.328  4.681   -3.950  1.00 0.00 ? 7   PRO A HB3  2  
ATOM   2224  H HG2  . PRO A 1 7  ? -5.926  7.187   -3.614  1.00 0.00 ? 7   PRO A HG2  2  
ATOM   2225  H HG3  . PRO A 1 7  ? -7.452  6.909   -4.465  1.00 0.00 ? 7   PRO A HG3  2  
ATOM   2226  H HD2  . PRO A 1 7  ? -7.050  8.182   -1.880  1.00 0.00 ? 7   PRO A HD2  2  
ATOM   2227  H HD3  . PRO A 1 7  ? -8.569  7.986   -2.777  1.00 0.00 ? 7   PRO A HD3  2  
ATOM   2228  N N    . PRO A 1 8  ? -6.269  3.289   -0.767  1.00 0.00 ? 8   PRO A N    2  
ATOM   2229  C CA   . PRO A 1 8  ? -5.348  2.703   0.229   1.00 0.00 ? 8   PRO A CA   2  
ATOM   2230  C C    . PRO A 1 8  ? -3.987  3.418   0.176   1.00 0.00 ? 8   PRO A C    2  
ATOM   2231  O O    . PRO A 1 8  ? -3.877  4.528   -0.304  1.00 0.00 ? 8   PRO A O    2  
ATOM   2232  C CB   . PRO A 1 8  ? -5.216  1.214   -0.178  1.00 0.00 ? 8   PRO A CB   2  
ATOM   2233  C CG   . PRO A 1 8  ? -5.997  1.027   -1.511  1.00 0.00 ? 8   PRO A CG   2  
ATOM   2234  C CD   . PRO A 1 8  ? -6.757  2.341   -1.792  1.00 0.00 ? 8   PRO A CD   2  
ATOM   2235  H HA   . PRO A 1 8  ? -5.770  2.780   1.219   1.00 0.00 ? 8   PRO A HA   2  
ATOM   2236  H HB2  . PRO A 1 8  ? -4.173  0.949   -0.316  1.00 0.00 ? 8   PRO A HB2  2  
ATOM   2237  H HB3  . PRO A 1 8  ? -5.649  0.582   0.586   1.00 0.00 ? 8   PRO A HB3  2  
ATOM   2238  H HG2  . PRO A 1 8  ? -5.302  0.819   -2.318  1.00 0.00 ? 8   PRO A HG2  2  
ATOM   2239  H HG3  . PRO A 1 8  ? -6.699  0.208   -1.419  1.00 0.00 ? 8   PRO A HG3  2  
ATOM   2240  H HD2  . PRO A 1 8  ? -6.532  2.706   -2.786  1.00 0.00 ? 8   PRO A HD2  2  
ATOM   2241  H HD3  . PRO A 1 8  ? -7.820  2.187   -1.678  1.00 0.00 ? 8   PRO A HD3  2  
ATOM   2242  N N    . THR A 1 9  ? -2.954  2.783   0.667   1.00 0.00 ? 9   THR A N    2  
ATOM   2243  C CA   . THR A 1 9  ? -1.603  3.417   0.646   1.00 0.00 ? 9   THR A CA   2  
ATOM   2244  C C    . THR A 1 9  ? -0.525  2.333   0.679   1.00 0.00 ? 9   THR A C    2  
ATOM   2245  O O    . THR A 1 9  ? -0.537  1.451   1.515   1.00 0.00 ? 9   THR A O    2  
ATOM   2246  C CB   . THR A 1 9  ? -1.446  4.323   1.869   1.00 0.00 ? 9   THR A CB   2  
ATOM   2247  O OG1  . THR A 1 9  ? -2.614  5.115   2.023   1.00 0.00 ? 9   THR A OG1  2  
ATOM   2248  C CG2  . THR A 1 9  ? -0.230  5.232   1.682   1.00 0.00 ? 9   THR A CG2  2  
ATOM   2249  H H    . THR A 1 9  ? -3.067  1.887   1.050   1.00 0.00 ? 9   THR A H    2  
ATOM   2250  H HA   . THR A 1 9  ? -1.487  4.003   -0.254  1.00 0.00 ? 9   THR A HA   2  
ATOM   2251  H HB   . THR A 1 9  ? -1.303  3.714   2.749   1.00 0.00 ? 9   THR A HB   2  
ATOM   2252  H HG1  . THR A 1 9  ? -2.934  5.345   1.148   1.00 0.00 ? 9   THR A HG1  2  
ATOM   2253  H HG21 . THR A 1 9  ? 0.652   4.627   1.522   1.00 0.00 ? 9   THR A HG21 2  
ATOM   2254  H HG22 . THR A 1 9  ? -0.386  5.872   0.826   1.00 0.00 ? 9   THR A HG22 2  
ATOM   2255  H HG23 . THR A 1 9  ? -0.094  5.839   2.565   1.00 0.00 ? 9   THR A HG23 2  
ATOM   2256  N N    . ALA A 1 10 ? 0.407   2.397   -0.229  1.00 0.00 ? 10  ALA A N    2  
ATOM   2257  C CA   . ALA A 1 10 ? 1.492   1.380   -0.264  1.00 0.00 ? 10  ALA A CA   2  
ATOM   2258  C C    . ALA A 1 10 ? 2.415   1.562   0.943   1.00 0.00 ? 10  ALA A C    2  
ATOM   2259  O O    . ALA A 1 10 ? 3.466   2.162   0.843   1.00 0.00 ? 10  ALA A O    2  
ATOM   2260  C CB   . ALA A 1 10 ? 2.300   1.557   -1.548  1.00 0.00 ? 10  ALA A CB   2  
ATOM   2261  H H    . ALA A 1 10 ? 0.395   3.119   -0.891  1.00 0.00 ? 10  ALA A H    2  
ATOM   2262  H HA   . ALA A 1 10 ? 1.062   0.388   -0.242  1.00 0.00 ? 10  ALA A HA   2  
ATOM   2263  H HB1  . ALA A 1 10 ? 2.541   2.602   -1.678  1.00 0.00 ? 10  ALA A HB1  2  
ATOM   2264  H HB2  . ALA A 1 10 ? 3.212   0.982   -1.481  1.00 0.00 ? 10  ALA A HB2  2  
ATOM   2265  H HB3  . ALA A 1 10 ? 1.717   1.213   -2.389  1.00 0.00 ? 10  ALA A HB3  2  
ATOM   2266  N N    . CYS A 1 11 ? 2.031   1.037   2.080   1.00 0.00 ? 11  CYS A N    2  
ATOM   2267  C CA   . CYS A 1 11 ? 2.882   1.161   3.305   1.00 0.00 ? 11  CYS A CA   2  
ATOM   2268  C C    . CYS A 1 11 ? 3.478   -0.212  3.627   1.00 0.00 ? 11  CYS A C    2  
ATOM   2269  O O    . CYS A 1 11 ? 2.807   -1.222  3.548   1.00 0.00 ? 11  CYS A O    2  
ATOM   2270  C CB   . CYS A 1 11 ? 2.019   1.632   4.481   1.00 0.00 ? 11  CYS A CB   2  
ATOM   2271  S SG   . CYS A 1 11 ? 1.179   3.173   4.033   1.00 0.00 ? 11  CYS A SG   2  
ATOM   2272  H H    . CYS A 1 11 ? 1.181   0.552   2.127   1.00 0.00 ? 11  CYS A H    2  
ATOM   2273  H HA   . CYS A 1 11 ? 3.682   1.870   3.140   1.00 0.00 ? 11  CYS A HA   2  
ATOM   2274  H HB2  . CYS A 1 11 ? 1.284   0.876   4.714   1.00 0.00 ? 11  CYS A HB2  2  
ATOM   2275  H HB3  . CYS A 1 11 ? 2.647   1.802   5.343   1.00 0.00 ? 11  CYS A HB3  2  
ATOM   2276  N N    . CYS A 1 12 ? 4.734   -0.261  3.979   1.00 0.00 ? 12  CYS A N    2  
ATOM   2277  C CA   . CYS A 1 12 ? 5.365   -1.574  4.294   1.00 0.00 ? 12  CYS A CA   2  
ATOM   2278  C C    . CYS A 1 12 ? 4.830   -2.093  5.629   1.00 0.00 ? 12  CYS A C    2  
ATOM   2279  O O    . CYS A 1 12 ? 4.581   -1.336  6.546   1.00 0.00 ? 12  CYS A O    2  
ATOM   2280  C CB   . CYS A 1 12 ? 6.885   -1.408  4.383   1.00 0.00 ? 12  CYS A CB   2  
ATOM   2281  S SG   . CYS A 1 12 ? 7.544   -0.964  2.755   1.00 0.00 ? 12  CYS A SG   2  
ATOM   2282  H H    . CYS A 1 12 ? 5.263   0.563   4.030   1.00 0.00 ? 12  CYS A H    2  
ATOM   2283  H HA   . CYS A 1 12 ? 5.127   -2.282  3.513   1.00 0.00 ? 12  CYS A HA   2  
ATOM   2284  H HB2  . CYS A 1 12 ? 7.121   -0.628  5.091   1.00 0.00 ? 12  CYS A HB2  2  
ATOM   2285  H HB3  . CYS A 1 12 ? 7.329   -2.336  4.710   1.00 0.00 ? 12  CYS A HB3  2  
ATOM   2286  N N    . PHE A 1 13 ? 4.658   -3.386  5.744   1.00 0.00 ? 13  PHE A N    2  
ATOM   2287  C CA   . PHE A 1 13 ? 4.145   -3.978  7.018   1.00 0.00 ? 13  PHE A CA   2  
ATOM   2288  C C    . PHE A 1 13 ? 5.316   -4.604  7.778   1.00 0.00 ? 13  PHE A C    2  
ATOM   2289  O O    . PHE A 1 13 ? 5.242   -4.861  8.962   1.00 0.00 ? 13  PHE A O    2  
ATOM   2290  C CB   . PHE A 1 13 ? 3.117   -5.064  6.694   1.00 0.00 ? 13  PHE A CB   2  
ATOM   2291  C CG   . PHE A 1 13 ? 3.796   -6.189  5.949   1.00 0.00 ? 13  PHE A CG   2  
ATOM   2292  C CD1  . PHE A 1 13 ? 4.085   -6.049  4.579   1.00 0.00 ? 13  PHE A CD1  2  
ATOM   2293  C CD2  . PHE A 1 13 ? 4.144   -7.374  6.626   1.00 0.00 ? 13  PHE A CD2  2  
ATOM   2294  C CE1  . PHE A 1 13 ? 4.721   -7.095  3.885   1.00 0.00 ? 13  PHE A CE1  2  
ATOM   2295  C CE2  . PHE A 1 13 ? 4.780   -8.419  5.933   1.00 0.00 ? 13  PHE A CE2  2  
ATOM   2296  C CZ   . PHE A 1 13 ? 5.069   -8.281  4.561   1.00 0.00 ? 13  PHE A CZ   2  
ATOM   2297  H H    . PHE A 1 13 ? 4.873   -3.973  4.989   1.00 0.00 ? 13  PHE A H    2  
ATOM   2298  H HA   . PHE A 1 13 ? 3.682   -3.214  7.628   1.00 0.00 ? 13  PHE A HA   2  
ATOM   2299  H HB2  . PHE A 1 13 ? 2.692   -5.443  7.612   1.00 0.00 ? 13  PHE A HB2  2  
ATOM   2300  H HB3  . PHE A 1 13 ? 2.333   -4.647  6.079   1.00 0.00 ? 13  PHE A HB3  2  
ATOM   2301  H HD1  . PHE A 1 13 ? 3.818   -5.141  4.060   1.00 0.00 ? 13  PHE A HD1  2  
ATOM   2302  H HD2  . PHE A 1 13 ? 3.921   -7.479  7.678   1.00 0.00 ? 13  PHE A HD2  2  
ATOM   2303  H HE1  . PHE A 1 13 ? 4.942   -6.988  2.833   1.00 0.00 ? 13  PHE A HE1  2  
ATOM   2304  H HE2  . PHE A 1 13 ? 5.047   -9.328  6.453   1.00 0.00 ? 13  PHE A HE2  2  
ATOM   2305  H HZ   . PHE A 1 13 ? 5.558   -9.083  4.028   1.00 0.00 ? 13  PHE A HZ   2  
ATOM   2306  N N    . SER A 1 14 ? 6.400   -4.847  7.092   1.00 0.00 ? 14  SER A N    2  
ATOM   2307  C CA   . SER A 1 14 ? 7.590   -5.453  7.749   1.00 0.00 ? 14  SER A CA   2  
ATOM   2308  C C    . SER A 1 14 ? 8.835   -5.093  6.939   1.00 0.00 ? 14  SER A C    2  
ATOM   2309  O O    . SER A 1 14 ? 8.870   -4.088  6.256   1.00 0.00 ? 14  SER A O    2  
ATOM   2310  C CB   . SER A 1 14 ? 7.431   -6.974  7.793   1.00 0.00 ? 14  SER A CB   2  
ATOM   2311  O OG   . SER A 1 14 ? 7.536   -7.495  6.475   1.00 0.00 ? 14  SER A OG   2  
ATOM   2312  H H    . SER A 1 14 ? 6.430   -4.627  6.137   1.00 0.00 ? 14  SER A H    2  
ATOM   2313  H HA   . SER A 1 14 ? 7.687   -5.069  8.754   1.00 0.00 ? 14  SER A HA   2  
ATOM   2314  H HB2  . SER A 1 14 ? 8.207   -7.401  8.406   1.00 0.00 ? 14  SER A HB2  2  
ATOM   2315  H HB3  . SER A 1 14 ? 6.466   -7.221  8.214   1.00 0.00 ? 14  SER A HB3  2  
ATOM   2316  H HG   . SER A 1 14 ? 7.648   -6.757  5.872   1.00 0.00 ? 14  SER A HG   2  
ATOM   2317  N N    . TYR A 1 15 ? 9.862   -5.895  7.008   1.00 0.00 ? 15  TYR A N    2  
ATOM   2318  C CA   . TYR A 1 15 ? 11.105  -5.585  6.239   1.00 0.00 ? 15  TYR A CA   2  
ATOM   2319  C C    . TYR A 1 15 ? 11.864  -6.882  5.957   1.00 0.00 ? 15  TYR A C    2  
ATOM   2320  O O    . TYR A 1 15 ? 11.711  -7.865  6.657   1.00 0.00 ? 15  TYR A O    2  
ATOM   2321  C CB   . TYR A 1 15 ? 11.992  -4.639  7.060   1.00 0.00 ? 15  TYR A CB   2  
ATOM   2322  C CG   . TYR A 1 15 ? 11.131  -3.614  7.759   1.00 0.00 ? 15  TYR A CG   2  
ATOM   2323  C CD1  . TYR A 1 15 ? 10.804  -2.407  7.113   1.00 0.00 ? 15  TYR A CD1  2  
ATOM   2324  C CD2  . TYR A 1 15 ? 10.651  -3.870  9.058   1.00 0.00 ? 15  TYR A CD2  2  
ATOM   2325  C CE1  . TYR A 1 15 ? 9.998   -1.455  7.766   1.00 0.00 ? 15  TYR A CE1  2  
ATOM   2326  C CE2  . TYR A 1 15 ? 9.845   -2.918  9.711   1.00 0.00 ? 15  TYR A CE2  2  
ATOM   2327  C CZ   . TYR A 1 15 ? 9.519   -1.710  9.065   1.00 0.00 ? 15  TYR A CZ   2  
ATOM   2328  O OH   . TYR A 1 15 ? 8.728   -0.778  9.706   1.00 0.00 ? 15  TYR A OH   2  
ATOM   2329  H H    . TYR A 1 15 ? 9.819   -6.700  7.566   1.00 0.00 ? 15  TYR A H    2  
ATOM   2330  H HA   . TYR A 1 15 ? 10.843  -5.114  5.301   1.00 0.00 ? 15  TYR A HA   2  
ATOM   2331  H HB2  . TYR A 1 15 ? 12.543  -5.205  7.798   1.00 0.00 ? 15  TYR A HB2  2  
ATOM   2332  H HB3  . TYR A 1 15 ? 12.685  -4.137  6.404   1.00 0.00 ? 15  TYR A HB3  2  
ATOM   2333  H HD1  . TYR A 1 15 ? 11.172  -2.211  6.116   1.00 0.00 ? 15  TYR A HD1  2  
ATOM   2334  H HD2  . TYR A 1 15 ? 10.902  -4.796  9.554   1.00 0.00 ? 15  TYR A HD2  2  
ATOM   2335  H HE1  . TYR A 1 15 ? 9.748   -0.530  7.272   1.00 0.00 ? 15  TYR A HE1  2  
ATOM   2336  H HE2  . TYR A 1 15 ? 9.477   -3.114  10.708  1.00 0.00 ? 15  TYR A HE2  2  
ATOM   2337  H HH   . TYR A 1 15 ? 7.887   -0.736  9.245   1.00 0.00 ? 15  TYR A HH   2  
ATOM   2338  N N    . THR A 1 16 ? 12.686  -6.895  4.945   1.00 0.00 ? 16  THR A N    2  
ATOM   2339  C CA   . THR A 1 16 ? 13.454  -8.133  4.636   1.00 0.00 ? 16  THR A CA   2  
ATOM   2340  C C    . THR A 1 16 ? 14.293  -8.509  5.862   1.00 0.00 ? 16  THR A C    2  
ATOM   2341  O O    . THR A 1 16 ? 14.052  -8.034  6.954   1.00 0.00 ? 16  THR A O    2  
ATOM   2342  C CB   . THR A 1 16 ? 14.357  -7.895  3.419   1.00 0.00 ? 16  THR A CB   2  
ATOM   2343  O OG1  . THR A 1 16 ? 15.178  -9.034  3.203   1.00 0.00 ? 16  THR A OG1  2  
ATOM   2344  C CG2  . THR A 1 16 ? 15.239  -6.668  3.651   1.00 0.00 ? 16  THR A CG2  2  
ATOM   2345  H H    . THR A 1 16 ? 12.803  -6.090  4.394   1.00 0.00 ? 16  THR A H    2  
ATOM   2346  H HA   . THR A 1 16 ? 12.764  -8.936  4.420   1.00 0.00 ? 16  THR A HA   2  
ATOM   2347  H HB   . THR A 1 16 ? 13.743  -7.728  2.547   1.00 0.00 ? 16  THR A HB   2  
ATOM   2348  H HG1  . THR A 1 16 ? 14.626  -9.733  2.846   1.00 0.00 ? 16  THR A HG1  2  
ATOM   2349  H HG21 . THR A 1 16 ? 15.834  -6.814  4.539   1.00 0.00 ? 16  THR A HG21 2  
ATOM   2350  H HG22 . THR A 1 16 ? 15.890  -6.526  2.799   1.00 0.00 ? 16  THR A HG22 2  
ATOM   2351  H HG23 . THR A 1 16 ? 14.615  -5.795  3.774   1.00 0.00 ? 16  THR A HG23 2  
ATOM   2352  N N    . ALA A 1 17 ? 15.272  -9.360  5.699   1.00 0.00 ? 17  ALA A N    2  
ATOM   2353  C CA   . ALA A 1 17 ? 16.119  -9.766  6.863   1.00 0.00 ? 17  ALA A CA   2  
ATOM   2354  C C    . ALA A 1 17 ? 17.563  -9.940  6.393   1.00 0.00 ? 17  ALA A C    2  
ATOM   2355  O O    . ALA A 1 17 ? 18.402  -10.458 7.103   1.00 0.00 ? 17  ALA A O    2  
ATOM   2356  C CB   . ALA A 1 17 ? 15.595  -11.088 7.431   1.00 0.00 ? 17  ALA A CB   2  
ATOM   2357  H H    . ALA A 1 17 ? 15.450  -9.737  4.813   1.00 0.00 ? 17  ALA A H    2  
ATOM   2358  H HA   . ALA A 1 17 ? 16.083  -9.004  7.630   1.00 0.00 ? 17  ALA A HA   2  
ATOM   2359  H HB1  . ALA A 1 17 ? 15.327  -11.747 6.618   1.00 0.00 ? 17  ALA A HB1  2  
ATOM   2360  H HB2  . ALA A 1 17 ? 16.361  -11.553 8.035   1.00 0.00 ? 17  ALA A HB2  2  
ATOM   2361  H HB3  . ALA A 1 17 ? 14.724  -10.897 8.039   1.00 0.00 ? 17  ALA A HB3  2  
ATOM   2362  N N    . ARG A 1 18 ? 17.859  -9.500  5.197   1.00 0.00 ? 18  ARG A N    2  
ATOM   2363  C CA   . ARG A 1 18 ? 19.246  -9.622  4.661   1.00 0.00 ? 18  ARG A CA   2  
ATOM   2364  C C    . ARG A 1 18 ? 19.598  -8.339  3.906   1.00 0.00 ? 18  ARG A C    2  
ATOM   2365  O O    . ARG A 1 18 ? 18.876  -7.909  3.028   1.00 0.00 ? 18  ARG A O    2  
ATOM   2366  C CB   . ARG A 1 18 ? 19.329  -10.808 3.688   1.00 0.00 ? 18  ARG A CB   2  
ATOM   2367  C CG   . ARG A 1 18 ? 19.241  -12.149 4.451   1.00 0.00 ? 18  ARG A CG   2  
ATOM   2368  C CD   . ARG A 1 18 ? 17.767  -12.557 4.684   1.00 0.00 ? 18  ARG A CD   2  
ATOM   2369  N NE   . ARG A 1 18 ? 17.591  -13.049 6.089   1.00 0.00 ? 18  ARG A NE   2  
ATOM   2370  C CZ   . ARG A 1 18 ? 18.418  -13.914 6.617   1.00 0.00 ? 18  ARG A CZ   2  
ATOM   2371  N NH1  . ARG A 1 18 ? 19.356  -14.460 5.893   1.00 0.00 ? 18  ARG A NH1  2  
ATOM   2372  N NH2  . ARG A 1 18 ? 18.283  -14.259 7.868   1.00 0.00 ? 18  ARG A NH2  2  
ATOM   2373  H H    . ARG A 1 18 ? 17.162  -9.082  4.650   1.00 0.00 ? 18  ARG A H    2  
ATOM   2374  H HA   . ARG A 1 18 ? 19.949  -9.762  5.470   1.00 0.00 ? 18  ARG A HA   2  
ATOM   2375  H HB2  . ARG A 1 18 ? 18.519  -10.743 2.976   1.00 0.00 ? 18  ARG A HB2  2  
ATOM   2376  H HB3  . ARG A 1 18 ? 20.269  -10.761 3.158   1.00 0.00 ? 18  ARG A HB3  2  
ATOM   2377  H HG2  . ARG A 1 18 ? 19.738  -12.912 3.866   1.00 0.00 ? 18  ARG A HG2  2  
ATOM   2378  H HG3  . ARG A 1 18 ? 19.743  -12.056 5.403   1.00 0.00 ? 18  ARG A HG3  2  
ATOM   2379  H HD2  . ARG A 1 18 ? 17.120  -11.707 4.550   1.00 0.00 ? 18  ARG A HD2  2  
ATOM   2380  H HD3  . ARG A 1 18 ? 17.486  -13.328 3.972   1.00 0.00 ? 18  ARG A HD3  2  
ATOM   2381  H HE   . ARG A 1 18 ? 16.860  -12.691 6.635   1.00 0.00 ? 18  ARG A HE   2  
ATOM   2382  H HH11 . ARG A 1 18 ? 19.445  -14.223 4.929   1.00 0.00 ? 18  ARG A HH11 2  
ATOM   2383  H HH12 . ARG A 1 18 ? 19.986  -15.118 6.305   1.00 0.00 ? 18  ARG A HH12 2  
ATOM   2384  H HH21 . ARG A 1 18 ? 17.549  -13.864 8.420   1.00 0.00 ? 18  ARG A HH21 2  
ATOM   2385  H HH22 . ARG A 1 18 ? 18.913  -14.921 8.275   1.00 0.00 ? 18  ARG A HH22 2  
ATOM   2386  N N    . LYS A 1 19 ? 20.701  -7.725  4.234   1.00 0.00 ? 19  LYS A N    2  
ATOM   2387  C CA   . LYS A 1 19 ? 21.088  -6.476  3.524   1.00 0.00 ? 19  LYS A CA   2  
ATOM   2388  C C    . LYS A 1 19 ? 21.328  -6.802  2.047   1.00 0.00 ? 19  LYS A C    2  
ATOM   2389  O O    . LYS A 1 19 ? 22.049  -7.721  1.711   1.00 0.00 ? 19  LYS A O    2  
ATOM   2390  C CB   . LYS A 1 19 ? 22.364  -5.898  4.162   1.00 0.00 ? 19  LYS A CB   2  
ATOM   2391  C CG   . LYS A 1 19 ? 23.066  -4.942  3.185   1.00 0.00 ? 19  LYS A CG   2  
ATOM   2392  C CD   . LYS A 1 19 ? 24.086  -4.084  3.935   1.00 0.00 ? 19  LYS A CD   2  
ATOM   2393  C CE   . LYS A 1 19 ? 25.207  -4.963  4.495   1.00 0.00 ? 19  LYS A CE   2  
ATOM   2394  N NZ   . LYS A 1 19 ? 25.693  -5.897  3.440   1.00 0.00 ? 19  LYS A NZ   2  
ATOM   2395  H H    . LYS A 1 19 ? 21.274  -8.087  4.943   1.00 0.00 ? 19  LYS A H    2  
ATOM   2396  H HA   . LYS A 1 19 ? 20.287  -5.756  3.605   1.00 0.00 ? 19  LYS A HA   2  
ATOM   2397  H HB2  . LYS A 1 19 ? 22.098  -5.357  5.059   1.00 0.00 ? 19  LYS A HB2  2  
ATOM   2398  H HB3  . LYS A 1 19 ? 23.032  -6.702  4.419   1.00 0.00 ? 19  LYS A HB3  2  
ATOM   2399  H HG2  . LYS A 1 19 ? 23.568  -5.514  2.419   1.00 0.00 ? 19  LYS A HG2  2  
ATOM   2400  H HG3  . LYS A 1 19 ? 22.331  -4.298  2.725   1.00 0.00 ? 19  LYS A HG3  2  
ATOM   2401  H HD2  . LYS A 1 19 ? 24.507  -3.354  3.262   1.00 0.00 ? 19  LYS A HD2  2  
ATOM   2402  H HD3  . LYS A 1 19 ? 23.595  -3.581  4.747   1.00 0.00 ? 19  LYS A HD3  2  
ATOM   2403  H HE2  . LYS A 1 19 ? 26.022  -4.334  4.820   1.00 0.00 ? 19  LYS A HE2  2  
ATOM   2404  H HE3  . LYS A 1 19 ? 24.833  -5.528  5.335   1.00 0.00 ? 19  LYS A HE3  2  
ATOM   2405  H HZ1  . LYS A 1 19 ? 25.827  -5.377  2.550   1.00 0.00 ? 19  LYS A HZ1  2  
ATOM   2406  H HZ2  . LYS A 1 19 ? 26.598  -6.313  3.735   1.00 0.00 ? 19  LYS A HZ2  2  
ATOM   2407  H HZ3  . LYS A 1 19 ? 24.992  -6.653  3.298   1.00 0.00 ? 19  LYS A HZ3  2  
ATOM   2408  N N    . LEU A 1 20 ? 20.727  -6.054  1.167   1.00 0.00 ? 20  LEU A N    2  
ATOM   2409  C CA   . LEU A 1 20 ? 20.914  -6.312  -0.285  1.00 0.00 ? 20  LEU A CA   2  
ATOM   2410  C C    . LEU A 1 20 ? 22.321  -5.834  -0.713  1.00 0.00 ? 20  LEU A C    2  
ATOM   2411  O O    . LEU A 1 20 ? 22.623  -4.671  -0.535  1.00 0.00 ? 20  LEU A O    2  
ATOM   2412  C CB   . LEU A 1 20 ? 19.873  -5.509  -1.066  1.00 0.00 ? 20  LEU A CB   2  
ATOM   2413  C CG   . LEU A 1 20 ? 18.490  -5.681  -0.435  1.00 0.00 ? 20  LEU A CG   2  
ATOM   2414  C CD1  . LEU A 1 20 ? 17.448  -5.018  -1.334  1.00 0.00 ? 20  LEU A CD1  2  
ATOM   2415  C CD2  . LEU A 1 20 ? 18.163  -7.172  -0.290  1.00 0.00 ? 20  LEU A CD2  2  
ATOM   2416  H H    . LEU A 1 20 ? 20.151  -5.319  1.463   1.00 0.00 ? 20  LEU A H    2  
ATOM   2417  H HA   . LEU A 1 20 ? 20.774  -7.357  -0.478  1.00 0.00 ? 20  LEU A HA   2  
ATOM   2418  H HB2  . LEU A 1 20 ? 20.143  -4.464  -1.049  1.00 0.00 ? 20  LEU A HB2  2  
ATOM   2419  H HB3  . LEU A 1 20 ? 19.846  -5.855  -2.087  1.00 0.00 ? 20  LEU A HB3  2  
ATOM   2420  H HG   . LEU A 1 20 ? 18.479  -5.210  0.538   1.00 0.00 ? 20  LEU A HG   2  
ATOM   2421  H HD11 . LEU A 1 20 ? 17.798  -4.040  -1.631  1.00 0.00 ? 20  LEU A HD11 2  
ATOM   2422  H HD12 . LEU A 1 20 ? 17.292  -5.628  -2.211  1.00 0.00 ? 20  LEU A HD12 2  
ATOM   2423  H HD13 . LEU A 1 20 ? 16.519  -4.919  -0.794  1.00 0.00 ? 20  LEU A HD13 2  
ATOM   2424  H HD21 . LEU A 1 20 ? 18.461  -7.696  -1.185  1.00 0.00 ? 20  LEU A HD21 2  
ATOM   2425  H HD22 . LEU A 1 20 ? 18.692  -7.576  0.559   1.00 0.00 ? 20  LEU A HD22 2  
ATOM   2426  H HD23 . LEU A 1 20 ? 17.099  -7.294  -0.139  1.00 0.00 ? 20  LEU A HD23 2  
ATOM   2427  N N    . PRO A 1 21 ? 23.151  -6.699  -1.278  1.00 0.00 ? 21  PRO A N    2  
ATOM   2428  C CA   . PRO A 1 21 ? 24.492  -6.269  -1.716  1.00 0.00 ? 21  PRO A CA   2  
ATOM   2429  C C    . PRO A 1 21 ? 24.364  -5.080  -2.672  1.00 0.00 ? 21  PRO A C    2  
ATOM   2430  O O    . PRO A 1 21 ? 23.434  -4.999  -3.446  1.00 0.00 ? 21  PRO A O    2  
ATOM   2431  C CB   . PRO A 1 21 ? 25.089  -7.496  -2.442  1.00 0.00 ? 21  PRO A CB   2  
ATOM   2432  C CG   . PRO A 1 21 ? 24.129  -8.693  -2.190  1.00 0.00 ? 21  PRO A CG   2  
ATOM   2433  C CD   . PRO A 1 21 ? 22.854  -8.131  -1.524  1.00 0.00 ? 21  PRO A CD   2  
ATOM   2434  H HA   . PRO A 1 21 ? 25.099  -6.005  -0.864  1.00 0.00 ? 21  PRO A HA   2  
ATOM   2435  H HB2  . PRO A 1 21 ? 25.166  -7.304  -3.507  1.00 0.00 ? 21  PRO A HB2  2  
ATOM   2436  H HB3  . PRO A 1 21 ? 26.066  -7.719  -2.049  1.00 0.00 ? 21  PRO A HB3  2  
ATOM   2437  H HG2  . PRO A 1 21 ? 23.880  -9.171  -3.130  1.00 0.00 ? 21  PRO A HG2  2  
ATOM   2438  H HG3  . PRO A 1 21 ? 24.598  -9.412  -1.530  1.00 0.00 ? 21  PRO A HG3  2  
ATOM   2439  H HD2  . PRO A 1 21 ? 22.007  -8.232  -2.194  1.00 0.00 ? 21  PRO A HD2  2  
ATOM   2440  H HD3  . PRO A 1 21 ? 22.662  -8.638  -0.589  1.00 0.00 ? 21  PRO A HD3  2  
ATOM   2441  N N    . ARG A 1 22 ? 25.295  -4.168  -2.639  1.00 0.00 ? 22  ARG A N    2  
ATOM   2442  C CA   . ARG A 1 22 ? 25.220  -3.009  -3.569  1.00 0.00 ? 22  ARG A CA   2  
ATOM   2443  C C    . ARG A 1 22 ? 24.995  -3.537  -4.987  1.00 0.00 ? 22  ARG A C    2  
ATOM   2444  O O    . ARG A 1 22 ? 24.330  -2.922  -5.797  1.00 0.00 ? 22  ARG A O    2  
ATOM   2445  C CB   . ARG A 1 22 ? 26.525  -2.219  -3.518  1.00 0.00 ? 22  ARG A CB   2  
ATOM   2446  C CG   . ARG A 1 22 ? 26.420  -1.013  -4.461  1.00 0.00 ? 22  ARG A CG   2  
ATOM   2447  C CD   . ARG A 1 22 ? 27.645  -0.092  -4.302  1.00 0.00 ? 22  ARG A CD   2  
ATOM   2448  N NE   . ARG A 1 22 ? 27.211  1.340   -4.373  1.00 0.00 ? 22  ARG A NE   2  
ATOM   2449  C CZ   . ARG A 1 22 ? 26.411  1.759   -5.319  1.00 0.00 ? 22  ARG A CZ   2  
ATOM   2450  N NH1  . ARG A 1 22 ? 26.099  0.981   -6.319  1.00 0.00 ? 22  ARG A NH1  2  
ATOM   2451  N NH2  . ARG A 1 22 ? 25.960  2.983   -5.288  1.00 0.00 ? 22  ARG A NH2  2  
ATOM   2452  H H    . ARG A 1 22 ? 26.048  -4.253  -2.018  1.00 0.00 ? 22  ARG A H    2  
ATOM   2453  H HA   . ARG A 1 22 ? 24.401  -2.367  -3.287  1.00 0.00 ? 22  ARG A HA   2  
ATOM   2454  H HB2  . ARG A 1 22 ? 26.695  -1.879  -2.506  1.00 0.00 ? 22  ARG A HB2  2  
ATOM   2455  H HB3  . ARG A 1 22 ? 27.343  -2.850  -3.831  1.00 0.00 ? 22  ARG A HB3  2  
ATOM   2456  H HG2  . ARG A 1 22 ? 26.362  -1.371  -5.479  1.00 0.00 ? 22  ARG A HG2  2  
ATOM   2457  H HG3  . ARG A 1 22 ? 25.524  -0.457  -4.229  1.00 0.00 ? 22  ARG A HG3  2  
ATOM   2458  H HD2  . ARG A 1 22 ? 28.105  -0.250  -3.341  1.00 0.00 ? 22  ARG A HD2  2  
ATOM   2459  H HD3  . ARG A 1 22 ? 28.368  -0.314  -5.080  1.00 0.00 ? 22  ARG A HD3  2  
ATOM   2460  H HE   . ARG A 1 22 ? 27.496  1.963   -3.673  1.00 0.00 ? 22  ARG A HE   2  
ATOM   2461  H HH11 . ARG A 1 22 ? 26.473  0.060   -6.370  1.00 0.00 ? 22  ARG A HH11 2  
ATOM   2462  H HH12 . ARG A 1 22 ? 25.482  1.310   -7.034  1.00 0.00 ? 22  ARG A HH12 2  
ATOM   2463  H HH21 . ARG A 1 22 ? 26.226  3.596   -4.545  1.00 0.00 ? 22  ARG A HH21 2  
ATOM   2464  H HH22 . ARG A 1 22 ? 25.348  3.309   -6.009  1.00 0.00 ? 22  ARG A HH22 2  
ATOM   2465  N N    . ASN A 1 23 ? 25.546  -4.684  -5.286  1.00 0.00 ? 23  ASN A N    2  
ATOM   2466  C CA   . ASN A 1 23 ? 25.371  -5.272  -6.643  1.00 0.00 ? 23  ASN A CA   2  
ATOM   2467  C C    . ASN A 1 23 ? 23.938  -5.790  -6.797  1.00 0.00 ? 23  ASN A C    2  
ATOM   2468  O O    . ASN A 1 23 ? 23.640  -6.550  -7.698  1.00 0.00 ? 23  ASN A O    2  
ATOM   2469  C CB   . ASN A 1 23 ? 26.354  -6.430  -6.827  1.00 0.00 ? 23  ASN A CB   2  
ATOM   2470  C CG   . ASN A 1 23 ? 26.395  -6.837  -8.301  1.00 0.00 ? 23  ASN A CG   2  
ATOM   2471  O OD1  . ASN A 1 23 ? 26.437  -5.994  -9.175  1.00 0.00 ? 23  ASN A OD1  2  
ATOM   2472  N ND2  . ASN A 1 23 ? 26.382  -8.103  -8.617  1.00 0.00 ? 23  ASN A ND2  2  
ATOM   2473  H H    . ASN A 1 23 ? 26.074  -5.163  -4.609  1.00 0.00 ? 23  ASN A H    2  
ATOM   2474  H HA   . ASN A 1 23 ? 25.562  -4.516  -7.390  1.00 0.00 ? 23  ASN A HA   2  
ATOM   2475  H HB2  . ASN A 1 23 ? 27.339  -6.119  -6.512  1.00 0.00 ? 23  ASN A HB2  2  
ATOM   2476  H HB3  . ASN A 1 23 ? 26.034  -7.272  -6.233  1.00 0.00 ? 23  ASN A HB3  2  
ATOM   2477  H HD21 . ASN A 1 23 ? 26.349  -8.783  -7.911  1.00 0.00 ? 23  ASN A HD21 2  
ATOM   2478  H HD22 . ASN A 1 23 ? 26.408  -8.374  -9.558  1.00 0.00 ? 23  ASN A HD22 2  
ATOM   2479  N N    . PHE A 1 24 ? 23.051  -5.395  -5.920  1.00 0.00 ? 24  PHE A N    2  
ATOM   2480  C CA   . PHE A 1 24 ? 21.633  -5.873  -6.006  1.00 0.00 ? 24  PHE A CA   2  
ATOM   2481  C C    . PHE A 1 24 ? 20.692  -4.712  -5.671  1.00 0.00 ? 24  PHE A C    2  
ATOM   2482  O O    . PHE A 1 24 ? 19.602  -4.906  -5.170  1.00 0.00 ? 24  PHE A O    2  
ATOM   2483  C CB   . PHE A 1 24 ? 21.437  -7.025  -5.002  1.00 0.00 ? 24  PHE A CB   2  
ATOM   2484  C CG   . PHE A 1 24 ? 20.248  -7.888  -5.390  1.00 0.00 ? 24  PHE A CG   2  
ATOM   2485  C CD1  . PHE A 1 24 ? 20.226  -8.547  -6.639  1.00 0.00 ? 24  PHE A CD1  2  
ATOM   2486  C CD2  . PHE A 1 24 ? 19.168  -8.048  -4.496  1.00 0.00 ? 24  PHE A CD2  2  
ATOM   2487  C CE1  . PHE A 1 24 ? 19.128  -9.357  -6.989  1.00 0.00 ? 24  PHE A CE1  2  
ATOM   2488  C CE2  . PHE A 1 24 ? 18.072  -8.857  -4.851  1.00 0.00 ? 24  PHE A CE2  2  
ATOM   2489  C CZ   . PHE A 1 24 ? 18.052  -9.511  -6.096  1.00 0.00 ? 24  PHE A CZ   2  
ATOM   2490  H H    . PHE A 1 24 ? 23.318  -4.790  -5.199  1.00 0.00 ? 24  PHE A H    2  
ATOM   2491  H HA   . PHE A 1 24 ? 21.423  -6.218  -7.007  1.00 0.00 ? 24  PHE A HA   2  
ATOM   2492  H HB2  . PHE A 1 24 ? 22.326  -7.636  -4.985  1.00 0.00 ? 24  PHE A HB2  2  
ATOM   2493  H HB3  . PHE A 1 24 ? 21.273  -6.613  -4.014  1.00 0.00 ? 24  PHE A HB3  2  
ATOM   2494  H HD1  . PHE A 1 24 ? 21.049  -8.435  -7.329  1.00 0.00 ? 24  PHE A HD1  2  
ATOM   2495  H HD2  . PHE A 1 24 ? 19.180  -7.548  -3.541  1.00 0.00 ? 24  PHE A HD2  2  
ATOM   2496  H HE1  . PHE A 1 24 ? 19.113  -9.860  -7.944  1.00 0.00 ? 24  PHE A HE1  2  
ATOM   2497  H HE2  . PHE A 1 24 ? 17.246  -8.978  -4.166  1.00 0.00 ? 24  PHE A HE2  2  
ATOM   2498  H HZ   . PHE A 1 24 ? 17.212  -10.133 -6.366  1.00 0.00 ? 24  PHE A HZ   2  
ATOM   2499  N N    . VAL A 1 25 ? 21.108  -3.504  -5.954  1.00 0.00 ? 25  VAL A N    2  
ATOM   2500  C CA   . VAL A 1 25 ? 20.251  -2.314  -5.666  1.00 0.00 ? 25  VAL A CA   2  
ATOM   2501  C C    . VAL A 1 25 ? 20.560  -1.218  -6.688  1.00 0.00 ? 25  VAL A C    2  
ATOM   2502  O O    . VAL A 1 25 ? 21.415  -0.381  -6.474  1.00 0.00 ? 25  VAL A O    2  
ATOM   2503  C CB   . VAL A 1 25 ? 20.554  -1.787  -4.262  1.00 0.00 ? 25  VAL A CB   2  
ATOM   2504  C CG1  . VAL A 1 25 ? 19.595  -0.644  -3.925  1.00 0.00 ? 25  VAL A CG1  2  
ATOM   2505  C CG2  . VAL A 1 25 ? 20.374  -2.907  -3.236  1.00 0.00 ? 25  VAL A CG2  2  
ATOM   2506  H H    . VAL A 1 25 ? 21.989  -3.377  -6.363  1.00 0.00 ? 25  VAL A H    2  
ATOM   2507  H HA   . VAL A 1 25 ? 19.207  -2.588  -5.733  1.00 0.00 ? 25  VAL A HA   2  
ATOM   2508  H HB   . VAL A 1 25 ? 21.571  -1.425  -4.228  1.00 0.00 ? 25  VAL A HB   2  
ATOM   2509  H HG11 . VAL A 1 25 ? 19.716  0.154   -4.642  1.00 0.00 ? 25  VAL A HG11 2  
ATOM   2510  H HG12 . VAL A 1 25 ? 18.578  -1.006  -3.957  1.00 0.00 ? 25  VAL A HG12 2  
ATOM   2511  H HG13 . VAL A 1 25 ? 19.814  -0.273  -2.935  1.00 0.00 ? 25  VAL A HG13 2  
ATOM   2512  H HG21 . VAL A 1 25 ? 19.419  -3.386  -3.390  1.00 0.00 ? 25  VAL A HG21 2  
ATOM   2513  H HG22 . VAL A 1 25 ? 21.165  -3.633  -3.350  1.00 0.00 ? 25  VAL A HG22 2  
ATOM   2514  H HG23 . VAL A 1 25 ? 20.411  -2.487  -2.242  1.00 0.00 ? 25  VAL A HG23 2  
ATOM   2515  N N    . VAL A 1 26 ? 19.876  -1.216  -7.802  1.00 0.00 ? 26  VAL A N    2  
ATOM   2516  C CA   . VAL A 1 26 ? 20.135  -0.180  -8.839  1.00 0.00 ? 26  VAL A CA   2  
ATOM   2517  C C    . VAL A 1 26 ? 19.336  1.079   -8.518  1.00 0.00 ? 26  VAL A C    2  
ATOM   2518  O O    . VAL A 1 26 ? 19.538  2.120   -9.110  1.00 0.00 ? 26  VAL A O    2  
ATOM   2519  C CB   . VAL A 1 26 ? 19.704  -0.718  -10.202 1.00 0.00 ? 26  VAL A CB   2  
ATOM   2520  C CG1  . VAL A 1 26 ? 20.423  -2.037  -10.475 1.00 0.00 ? 26  VAL A CG1  2  
ATOM   2521  C CG2  . VAL A 1 26 ? 18.191  -0.952  -10.203 1.00 0.00 ? 26  VAL A CG2  2  
ATOM   2522  H H    . VAL A 1 26 ? 19.195  -1.901  -7.960  1.00 0.00 ? 26  VAL A H    2  
ATOM   2523  H HA   . VAL A 1 26 ? 21.188  0.059   -8.861  1.00 0.00 ? 26  VAL A HA   2  
ATOM   2524  H HB   . VAL A 1 26 ? 19.960  -0.004  -10.965 1.00 0.00 ? 26  VAL A HB   2  
ATOM   2525  H HG11 . VAL A 1 26 ? 20.265  -2.706  -9.644  1.00 0.00 ? 26  VAL A HG11 2  
ATOM   2526  H HG12 . VAL A 1 26 ? 20.032  -2.481  -11.378 1.00 0.00 ? 26  VAL A HG12 2  
ATOM   2527  H HG13 . VAL A 1 26 ? 21.481  -1.851  -10.593 1.00 0.00 ? 26  VAL A HG13 2  
ATOM   2528  H HG21 . VAL A 1 26 ? 17.911  -1.495  -9.311  1.00 0.00 ? 26  VAL A HG21 2  
ATOM   2529  H HG22 . VAL A 1 26 ? 17.679  -0.002  -10.223 1.00 0.00 ? 26  VAL A HG22 2  
ATOM   2530  H HG23 . VAL A 1 26 ? 17.915  -1.527  -11.074 1.00 0.00 ? 26  VAL A HG23 2  
ATOM   2531  N N    . ASP A 1 27 ? 18.425  0.997   -7.591  1.00 0.00 ? 27  ASP A N    2  
ATOM   2532  C CA   . ASP A 1 27 ? 17.619  2.199   -7.250  1.00 0.00 ? 27  ASP A CA   2  
ATOM   2533  C C    . ASP A 1 27 ? 16.809  1.926   -5.990  1.00 0.00 ? 27  ASP A C    2  
ATOM   2534  O O    . ASP A 1 27 ? 16.969  0.909   -5.344  1.00 0.00 ? 27  ASP A O    2  
ATOM   2535  C CB   . ASP A 1 27 ? 16.668  2.516   -8.408  1.00 0.00 ? 27  ASP A CB   2  
ATOM   2536  C CG   . ASP A 1 27 ? 16.094  3.923   -8.226  1.00 0.00 ? 27  ASP A CG   2  
ATOM   2537  O OD1  . ASP A 1 27 ? 16.868  4.828   -7.964  1.00 0.00 ? 27  ASP A OD1  2  
ATOM   2538  O OD2  . ASP A 1 27 ? 14.889  4.070   -8.354  1.00 0.00 ? 27  ASP A OD2  2  
ATOM   2539  H H    . ASP A 1 27 ? 18.268  0.147   -7.123  1.00 0.00 ? 27  ASP A H    2  
ATOM   2540  H HA   . ASP A 1 27 ? 18.277  3.040   -7.081  1.00 0.00 ? 27  ASP A HA   2  
ATOM   2541  H HB2  . ASP A 1 27 ? 17.208  2.466   -9.341  1.00 0.00 ? 27  ASP A HB2  2  
ATOM   2542  H HB3  . ASP A 1 27 ? 15.859  1.798   -8.419  1.00 0.00 ? 27  ASP A HB3  2  
ATOM   2543  N N    . TYR A 1 28 ? 15.936  2.824   -5.632  1.00 0.00 ? 28  TYR A N    2  
ATOM   2544  C CA   . TYR A 1 28 ? 15.113  2.611   -4.412  1.00 0.00 ? 28  TYR A CA   2  
ATOM   2545  C C    . TYR A 1 28 ? 13.827  3.423   -4.507  1.00 0.00 ? 28  TYR A C    2  
ATOM   2546  O O    . TYR A 1 28 ? 13.538  4.051   -5.507  1.00 0.00 ? 28  TYR A O    2  
ATOM   2547  C CB   . TYR A 1 28 ? 15.904  3.022   -3.164  1.00 0.00 ? 28  TYR A CB   2  
ATOM   2548  C CG   . TYR A 1 28 ? 16.012  4.532   -3.068  1.00 0.00 ? 28  TYR A CG   2  
ATOM   2549  C CD1  . TYR A 1 28 ? 16.701  5.259   -4.059  1.00 0.00 ? 28  TYR A CD1  2  
ATOM   2550  C CD2  . TYR A 1 28 ? 15.429  5.211   -1.978  1.00 0.00 ? 28  TYR A CD2  2  
ATOM   2551  C CE1  . TYR A 1 28 ? 16.807  6.658   -3.960  1.00 0.00 ? 28  TYR A CE1  2  
ATOM   2552  C CE2  . TYR A 1 28 ? 15.535  6.609   -1.878  1.00 0.00 ? 28  TYR A CE2  2  
ATOM   2553  C CZ   . TYR A 1 28 ? 16.224  7.335   -2.870  1.00 0.00 ? 28  TYR A CZ   2  
ATOM   2554  O OH   . TYR A 1 28 ? 16.329  8.708   -2.773  1.00 0.00 ? 28  TYR A OH   2  
ATOM   2555  H H    . TYR A 1 28 ? 15.819  3.638   -6.167  1.00 0.00 ? 28  TYR A H    2  
ATOM   2556  H HA   . TYR A 1 28 ? 14.858  1.564   -4.337  1.00 0.00 ? 28  TYR A HA   2  
ATOM   2557  H HB2  . TYR A 1 28 ? 15.402  2.640   -2.286  1.00 0.00 ? 28  TYR A HB2  2  
ATOM   2558  H HB3  . TYR A 1 28 ? 16.891  2.597   -3.217  1.00 0.00 ? 28  TYR A HB3  2  
ATOM   2559  H HD1  . TYR A 1 28 ? 17.149  4.744   -4.896  1.00 0.00 ? 28  TYR A HD1  2  
ATOM   2560  H HD2  . TYR A 1 28 ? 14.900  4.658   -1.219  1.00 0.00 ? 28  TYR A HD2  2  
ATOM   2561  H HE1  . TYR A 1 28 ? 17.338  7.213   -4.721  1.00 0.00 ? 28  TYR A HE1  2  
ATOM   2562  H HE2  . TYR A 1 28 ? 15.087  7.124   -1.039  1.00 0.00 ? 28  TYR A HE2  2  
ATOM   2563  H HH   . TYR A 1 28 ? 17.207  8.960   -3.070  1.00 0.00 ? 28  TYR A HH   2  
ATOM   2564  N N    . TYR A 1 29 ? 13.047  3.392   -3.473  1.00 0.00 ? 29  TYR A N    2  
ATOM   2565  C CA   . TYR A 1 29 ? 11.763  4.133   -3.475  1.00 0.00 ? 29  TYR A CA   2  
ATOM   2566  C C    . TYR A 1 29 ? 11.298  4.292   -2.023  1.00 0.00 ? 29  TYR A C    2  
ATOM   2567  O O    . TYR A 1 29 ? 11.432  3.390   -1.226  1.00 0.00 ? 29  TYR A O    2  
ATOM   2568  C CB   . TYR A 1 29 ? 10.749  3.324   -4.299  1.00 0.00 ? 29  TYR A CB   2  
ATOM   2569  C CG   . TYR A 1 29 ? 9.336   3.750   -3.981  1.00 0.00 ? 29  TYR A CG   2  
ATOM   2570  C CD1  . TYR A 1 29 ? 8.854   4.984   -4.452  1.00 0.00 ? 29  TYR A CD1  2  
ATOM   2571  C CD2  . TYR A 1 29 ? 8.504   2.911   -3.216  1.00 0.00 ? 29  TYR A CD2  2  
ATOM   2572  C CE1  . TYR A 1 29 ? 7.536   5.383   -4.156  1.00 0.00 ? 29  TYR A CE1  2  
ATOM   2573  C CE2  . TYR A 1 29 ? 7.186   3.309   -2.919  1.00 0.00 ? 29  TYR A CE2  2  
ATOM   2574  C CZ   . TYR A 1 29 ? 6.702   4.545   -3.388  1.00 0.00 ? 29  TYR A CZ   2  
ATOM   2575  O OH   . TYR A 1 29 ? 5.411   4.936   -3.098  1.00 0.00 ? 29  TYR A OH   2  
ATOM   2576  H H    . TYR A 1 29 ? 13.308  2.871   -2.689  1.00 0.00 ? 29  TYR A H    2  
ATOM   2577  H HA   . TYR A 1 29 ? 11.904  5.106   -3.921  1.00 0.00 ? 29  TYR A HA   2  
ATOM   2578  H HB2  . TYR A 1 29 ? 10.938  3.484   -5.350  1.00 0.00 ? 29  TYR A HB2  2  
ATOM   2579  H HB3  . TYR A 1 29 ? 10.866  2.273   -4.075  1.00 0.00 ? 29  TYR A HB3  2  
ATOM   2580  H HD1  . TYR A 1 29 ? 9.496   5.622   -5.042  1.00 0.00 ? 29  TYR A HD1  2  
ATOM   2581  H HD2  . TYR A 1 29 ? 8.878   1.961   -2.860  1.00 0.00 ? 29  TYR A HD2  2  
ATOM   2582  H HE1  . TYR A 1 29 ? 7.165   6.330   -4.517  1.00 0.00 ? 29  TYR A HE1  2  
ATOM   2583  H HE2  . TYR A 1 29 ? 6.549   2.665   -2.330  1.00 0.00 ? 29  TYR A HE2  2  
ATOM   2584  H HH   . TYR A 1 29 ? 4.994   5.212   -3.917  1.00 0.00 ? 29  TYR A HH   2  
ATOM   2585  N N    . GLU A 1 30 ? 10.761  5.428   -1.663  1.00 0.00 ? 30  GLU A N    2  
ATOM   2586  C CA   . GLU A 1 30 ? 10.297  5.623   -0.253  1.00 0.00 ? 30  GLU A CA   2  
ATOM   2587  C C    . GLU A 1 30 ? 8.791   5.355   -0.172  1.00 0.00 ? 30  GLU A C    2  
ATOM   2588  O O    . GLU A 1 30 ? 8.076   5.471   -1.147  1.00 0.00 ? 30  GLU A O    2  
ATOM   2589  C CB   . GLU A 1 30 ? 10.588  7.062   0.184   1.00 0.00 ? 30  GLU A CB   2  
ATOM   2590  C CG   . GLU A 1 30 ? 12.076  7.210   0.510   1.00 0.00 ? 30  GLU A CG   2  
ATOM   2591  C CD   . GLU A 1 30 ? 12.374  8.662   0.888   1.00 0.00 ? 30  GLU A CD   2  
ATOM   2592  O OE1  . GLU A 1 30 ? 11.433  9.385   1.169   1.00 0.00 ? 30  GLU A OE1  2  
ATOM   2593  O OE2  . GLU A 1 30 ? 13.539  9.026   0.890   1.00 0.00 ? 30  GLU A OE2  2  
ATOM   2594  H H    . GLU A 1 30 ? 10.664  6.152   -2.316  1.00 0.00 ? 30  GLU A H    2  
ATOM   2595  H HA   . GLU A 1 30 ? 10.817  4.938   0.407   1.00 0.00 ? 30  GLU A HA   2  
ATOM   2596  H HB2  . GLU A 1 30 ? 10.326  7.735   -0.614  1.00 0.00 ? 30  GLU A HB2  2  
ATOM   2597  H HB3  . GLU A 1 30 ? 10.005  7.299   1.062   1.00 0.00 ? 30  GLU A HB3  2  
ATOM   2598  H HG2  . GLU A 1 30 ? 12.331  6.562   1.336   1.00 0.00 ? 30  GLU A HG2  2  
ATOM   2599  H HG3  . GLU A 1 30 ? 12.662  6.939   -0.356  1.00 0.00 ? 30  GLU A HG3  2  
ATOM   2600  N N    . THR A 1 31 ? 8.309   4.989   0.984   1.00 0.00 ? 31  THR A N    2  
ATOM   2601  C CA   . THR A 1 31 ? 6.850   4.700   1.136   1.00 0.00 ? 31  THR A CA   2  
ATOM   2602  C C    . THR A 1 31 ? 6.049   6.002   1.109   1.00 0.00 ? 31  THR A C    2  
ATOM   2603  O O    . THR A 1 31 ? 6.544   7.048   0.739   1.00 0.00 ? 31  THR A O    2  
ATOM   2604  C CB   . THR A 1 31 ? 6.617   3.998   2.474   1.00 0.00 ? 31  THR A CB   2  
ATOM   2605  O OG1  . THR A 1 31 ? 7.334   4.684   3.481   1.00 0.00 ? 31  THR A OG1  2  
ATOM   2606  C CG2  . THR A 1 31 ? 7.102   2.549   2.381   1.00 0.00 ? 31  THR A CG2  2  
ATOM   2607  H H    . THR A 1 31 ? 8.909   4.895   1.753   1.00 0.00 ? 31  THR A H    2  
ATOM   2608  H HA   . THR A 1 31 ? 6.523   4.059   0.331   1.00 0.00 ? 31  THR A HA   2  
ATOM   2609  H HB   . THR A 1 31 ? 5.566   4.007   2.722   1.00 0.00 ? 31  THR A HB   2  
ATOM   2610  H HG1  . THR A 1 31 ? 7.017   5.590   3.506   1.00 0.00 ? 31  THR A HG1  2  
ATOM   2611  H HG21 . THR A 1 31 ? 8.066   2.522   1.893   1.00 0.00 ? 31  THR A HG21 2  
ATOM   2612  H HG22 . THR A 1 31 ? 7.188   2.134   3.373   1.00 0.00 ? 31  THR A HG22 2  
ATOM   2613  H HG23 . THR A 1 31 ? 6.392   1.969   1.808   1.00 0.00 ? 31  THR A HG23 2  
ATOM   2614  N N    . SER A 1 32 ? 4.807   5.935   1.505   1.00 0.00 ? 32  SER A N    2  
ATOM   2615  C CA   . SER A 1 32 ? 3.948   7.151   1.515   1.00 0.00 ? 32  SER A CA   2  
ATOM   2616  C C    . SER A 1 32 ? 4.169   7.925   2.814   1.00 0.00 ? 32  SER A C    2  
ATOM   2617  O O    . SER A 1 32 ? 5.255   7.959   3.356   1.00 0.00 ? 32  SER A O    2  
ATOM   2618  C CB   . SER A 1 32 ? 2.483   6.729   1.426   1.00 0.00 ? 32  SER A CB   2  
ATOM   2619  O OG   . SER A 1 32 ? 2.306   5.885   0.295   1.00 0.00 ? 32  SER A OG   2  
ATOM   2620  H H    . SER A 1 32 ? 4.436   5.077   1.799   1.00 0.00 ? 32  SER A H    2  
ATOM   2621  H HA   . SER A 1 32 ? 4.191   7.780   0.674   1.00 0.00 ? 32  SER A HA   2  
ATOM   2622  H HB2  . SER A 1 32 ? 2.210   6.188   2.317   1.00 0.00 ? 32  SER A HB2  2  
ATOM   2623  H HB3  . SER A 1 32 ? 1.861   7.608   1.334   1.00 0.00 ? 32  SER A HB3  2  
ATOM   2624  H HG   . SER A 1 32 ? 1.822   6.380   -0.371  1.00 0.00 ? 32  SER A HG   2  
ATOM   2625  N N    . SER A 1 33 ? 3.137   8.548   3.312   1.00 0.00 ? 33  SER A N    2  
ATOM   2626  C CA   . SER A 1 33 ? 3.255   9.332   4.580   1.00 0.00 ? 33  SER A CA   2  
ATOM   2627  C C    . SER A 1 33 ? 1.987   9.129   5.403   1.00 0.00 ? 33  SER A C    2  
ATOM   2628  O O    . SER A 1 33 ? 2.021   9.066   6.615   1.00 0.00 ? 33  SER A O    2  
ATOM   2629  C CB   . SER A 1 33 ? 3.392   10.812  4.237   1.00 0.00 ? 33  SER A CB   2  
ATOM   2630  O OG   . SER A 1 33 ? 2.103   11.351  3.972   1.00 0.00 ? 33  SER A OG   2  
ATOM   2631  H H    . SER A 1 33 ? 2.277   8.500   2.849   1.00 0.00 ? 33  SER A H    2  
ATOM   2632  H HA   . SER A 1 33 ? 4.115   9.005   5.147   1.00 0.00 ? 33  SER A HA   2  
ATOM   2633  H HB2  . SER A 1 33 ? 3.837   11.338  5.064   1.00 0.00 ? 33  SER A HB2  2  
ATOM   2634  H HB3  . SER A 1 33 ? 4.017   10.913  3.365   1.00 0.00 ? 33  SER A HB3  2  
ATOM   2635  H HG   . SER A 1 33 ? 1.883   11.158  3.058   1.00 0.00 ? 33  SER A HG   2  
ATOM   2636  N N    . LEU A 1 34 ? 0.868   9.035   4.736   1.00 0.00 ? 34  LEU A N    2  
ATOM   2637  C CA   . LEU A 1 34 ? -0.436  8.840   5.438   1.00 0.00 ? 34  LEU A CA   2  
ATOM   2638  C C    . LEU A 1 34 ? -0.272  7.862   6.601   1.00 0.00 ? 34  LEU A C    2  
ATOM   2639  O O    . LEU A 1 34 ? -0.578  8.169   7.736   1.00 0.00 ? 34  LEU A O    2  
ATOM   2640  C CB   . LEU A 1 34 ? -1.463  8.269   4.456   1.00 0.00 ? 34  LEU A CB   2  
ATOM   2641  C CG   . LEU A 1 34 ? -1.371  8.995   3.113   1.00 0.00 ? 34  LEU A CG   2  
ATOM   2642  C CD1  . LEU A 1 34 ? -2.517  8.532   2.212   1.00 0.00 ? 34  LEU A CD1  2  
ATOM   2643  C CD2  . LEU A 1 34 ? -1.472  10.507  3.338   1.00 0.00 ? 34  LEU A CD2  2  
ATOM   2644  H H    . LEU A 1 34 ? 0.888   9.099   3.762   1.00 0.00 ? 34  LEU A H    2  
ATOM   2645  H HA   . LEU A 1 34 ? -0.788  9.787   5.810   1.00 0.00 ? 34  LEU A HA   2  
ATOM   2646  H HB2  . LEU A 1 34 ? -1.272  7.216   4.304   1.00 0.00 ? 34  LEU A HB2  2  
ATOM   2647  H HB3  . LEU A 1 34 ? -2.451  8.398   4.861   1.00 0.00 ? 34  LEU A HB3  2  
ATOM   2648  H HG   . LEU A 1 34 ? -0.430  8.760   2.641   1.00 0.00 ? 34  LEU A HG   2  
ATOM   2649  H HD11 . LEU A 1 34 ? -2.624  7.458   2.285   1.00 0.00 ? 34  LEU A HD11 2  
ATOM   2650  H HD12 . LEU A 1 34 ? -3.436  9.006   2.524   1.00 0.00 ? 34  LEU A HD12 2  
ATOM   2651  H HD13 . LEU A 1 34 ? -2.302  8.803   1.190   1.00 0.00 ? 34  LEU A HD13 2  
ATOM   2652  H HD21 . LEU A 1 34 ? -2.275  10.716  4.030   1.00 0.00 ? 34  LEU A HD21 2  
ATOM   2653  H HD22 . LEU A 1 34 ? -0.542  10.874  3.744   1.00 0.00 ? 34  LEU A HD22 2  
ATOM   2654  H HD23 . LEU A 1 34 ? -1.672  10.998  2.397   1.00 0.00 ? 34  LEU A HD23 2  
ATOM   2655  N N    . CYS A 1 35 ? 0.208   6.684   6.323   1.00 0.00 ? 35  CYS A N    2  
ATOM   2656  C CA   . CYS A 1 35 ? 0.390   5.684   7.409   1.00 0.00 ? 35  CYS A CA   2  
ATOM   2657  C C    . CYS A 1 35 ? 1.529   6.139   8.328   1.00 0.00 ? 35  CYS A C    2  
ATOM   2658  O O    . CYS A 1 35 ? 2.596   6.496   7.882   1.00 0.00 ? 35  CYS A O    2  
ATOM   2659  C CB   . CYS A 1 35 ? 0.716   4.315   6.798   1.00 0.00 ? 35  CYS A CB   2  
ATOM   2660  S SG   . CYS A 1 35 ? 1.835   4.520   5.390   1.00 0.00 ? 35  CYS A SG   2  
ATOM   2661  H H    . CYS A 1 35 ? 0.445   6.460   5.400   1.00 0.00 ? 35  CYS A H    2  
ATOM   2662  H HA   . CYS A 1 35 ? -0.524  5.612   7.982   1.00 0.00 ? 35  CYS A HA   2  
ATOM   2663  H HB2  . CYS A 1 35 ? 1.186   3.691   7.541   1.00 0.00 ? 35  CYS A HB2  2  
ATOM   2664  H HB3  . CYS A 1 35 ? -0.199  3.846   6.464   1.00 0.00 ? 35  CYS A HB3  2  
ATOM   2665  N N    . SER A 1 36 ? 1.292   6.154   9.610   1.00 0.00 ? 36  SER A N    2  
ATOM   2666  C CA   . SER A 1 36 ? 2.344   6.600   10.569  1.00 0.00 ? 36  SER A CA   2  
ATOM   2667  C C    . SER A 1 36 ? 3.530   5.622   10.588  1.00 0.00 ? 36  SER A C    2  
ATOM   2668  O O    . SER A 1 36 ? 4.160   5.443   11.612  1.00 0.00 ? 36  SER A O    2  
ATOM   2669  C CB   . SER A 1 36 ? 1.741   6.686   11.971  1.00 0.00 ? 36  SER A CB   2  
ATOM   2670  O OG   . SER A 1 36 ? 0.810   7.758   12.016  1.00 0.00 ? 36  SER A OG   2  
ATOM   2671  H H    . SER A 1 36 ? 0.413   5.881   9.945   1.00 0.00 ? 36  SER A H    2  
ATOM   2672  H HA   . SER A 1 36 ? 2.697   7.578   10.277  1.00 0.00 ? 36  SER A HA   2  
ATOM   2673  H HB2  . SER A 1 36 ? 1.232   5.765   12.202  1.00 0.00 ? 36  SER A HB2  2  
ATOM   2674  H HB3  . SER A 1 36 ? 2.531   6.849   12.692  1.00 0.00 ? 36  SER A HB3  2  
ATOM   2675  H HG   . SER A 1 36 ? -0.073  7.389   11.945  1.00 0.00 ? 36  SER A HG   2  
ATOM   2676  N N    . GLN A 1 37 ? 3.852   4.980   9.492   1.00 0.00 ? 37  GLN A N    2  
ATOM   2677  C CA   . GLN A 1 37 ? 5.004   4.024   9.518   1.00 0.00 ? 37  GLN A CA   2  
ATOM   2678  C C    . GLN A 1 37 ? 5.626   3.869   8.120   1.00 0.00 ? 37  GLN A C    2  
ATOM   2679  O O    . GLN A 1 37 ? 5.575   2.799   7.551   1.00 0.00 ? 37  GLN A O    2  
ATOM   2680  C CB   . GLN A 1 37 ? 4.514   2.656   10.005  1.00 0.00 ? 37  GLN A CB   2  
ATOM   2681  C CG   . GLN A 1 37 ? 3.215   2.283   9.285   1.00 0.00 ? 37  GLN A CG   2  
ATOM   2682  C CD   . GLN A 1 37 ? 2.747   0.906   9.759   1.00 0.00 ? 37  GLN A CD   2  
ATOM   2683  O OE1  . GLN A 1 37 ? 3.429   -0.080  9.567   1.00 0.00 ? 37  GLN A OE1  2  
ATOM   2684  N NE2  . GLN A 1 37 ? 1.602   0.798   10.377  1.00 0.00 ? 37  GLN A NE2  2  
ATOM   2685  H H    . GLN A 1 37 ? 3.345   5.118   8.666   1.00 0.00 ? 37  GLN A H    2  
ATOM   2686  H HA   . GLN A 1 37 ? 5.762   4.388   10.199  1.00 0.00 ? 37  GLN A HA   2  
ATOM   2687  H HB2  . GLN A 1 37 ? 5.268   1.910   9.800   1.00 0.00 ? 37  GLN A HB2  2  
ATOM   2688  H HB3  . GLN A 1 37 ? 4.333   2.699   11.069  1.00 0.00 ? 37  GLN A HB3  2  
ATOM   2689  H HG2  . GLN A 1 37 ? 2.456   3.018   9.507   1.00 0.00 ? 37  GLN A HG2  2  
ATOM   2690  H HG3  . GLN A 1 37 ? 3.389   2.253   8.220   1.00 0.00 ? 37  GLN A HG3  2  
ATOM   2691  H HE21 . GLN A 1 37 ? 1.052   1.593   10.533  1.00 0.00 ? 37  GLN A HE21 2  
ATOM   2692  H HE22 . GLN A 1 37 ? 1.293   -0.080  10.685  1.00 0.00 ? 37  GLN A HE22 2  
ATOM   2693  N N    . PRO A 1 38 ? 6.219   4.928   7.610   1.00 0.00 ? 38  PRO A N    2  
ATOM   2694  C CA   . PRO A 1 38 ? 6.873   4.884   6.288   1.00 0.00 ? 38  PRO A CA   2  
ATOM   2695  C C    . PRO A 1 38 ? 8.108   3.972   6.369   1.00 0.00 ? 38  PRO A C    2  
ATOM   2696  O O    . PRO A 1 38 ? 8.407   3.402   7.399   1.00 0.00 ? 38  PRO A O    2  
ATOM   2697  C CB   . PRO A 1 38 ? 7.276   6.349   5.996   1.00 0.00 ? 38  PRO A CB   2  
ATOM   2698  C CG   . PRO A 1 38 ? 6.978   7.179   7.279   1.00 0.00 ? 38  PRO A CG   2  
ATOM   2699  C CD   . PRO A 1 38 ? 6.282   6.241   8.292   1.00 0.00 ? 38  PRO A CD   2  
ATOM   2700  H HA   . PRO A 1 38 ? 6.189   4.522   5.527   1.00 0.00 ? 38  PRO A HA   2  
ATOM   2701  H HB2  . PRO A 1 38 ? 8.331   6.410   5.749   1.00 0.00 ? 38  PRO A HB2  2  
ATOM   2702  H HB3  . PRO A 1 38 ? 6.691   6.734   5.171   1.00 0.00 ? 38  PRO A HB3  2  
ATOM   2703  H HG2  . PRO A 1 38 ? 7.904   7.557   7.697   1.00 0.00 ? 38  PRO A HG2  2  
ATOM   2704  H HG3  . PRO A 1 38 ? 6.325   8.010   7.041   1.00 0.00 ? 38  PRO A HG3  2  
ATOM   2705  H HD2  . PRO A 1 38 ? 6.865   6.167   9.201   1.00 0.00 ? 38  PRO A HD2  2  
ATOM   2706  H HD3  . PRO A 1 38 ? 5.286   6.593   8.511   1.00 0.00 ? 38  PRO A HD3  2  
ATOM   2707  N N    . ALA A 1 39 ? 8.821   3.842   5.290   1.00 0.00 ? 39  ALA A N    2  
ATOM   2708  C CA   . ALA A 1 39 ? 10.033  2.987   5.278   1.00 0.00 ? 39  ALA A CA   2  
ATOM   2709  C C    . ALA A 1 39 ? 10.745  3.196   3.946   1.00 0.00 ? 39  ALA A C    2  
ATOM   2710  O O    . ALA A 1 39 ? 10.193  3.778   3.033   1.00 0.00 ? 39  ALA A O    2  
ATOM   2711  C CB   . ALA A 1 39 ? 9.630   1.517   5.415   1.00 0.00 ? 39  ALA A CB   2  
ATOM   2712  H H    . ALA A 1 39 ? 8.564   4.316   4.481   1.00 0.00 ? 39  ALA A H    2  
ATOM   2713  H HA   . ALA A 1 39 ? 10.685  3.266   6.089   1.00 0.00 ? 39  ALA A HA   2  
ATOM   2714  H HB1  . ALA A 1 39 ? 8.939   1.409   6.238   1.00 0.00 ? 39  ALA A HB1  2  
ATOM   2715  H HB2  . ALA A 1 39 ? 9.157   1.187   4.502   1.00 0.00 ? 39  ALA A HB2  2  
ATOM   2716  H HB3  . ALA A 1 39 ? 10.510  0.920   5.602   1.00 0.00 ? 39  ALA A HB3  2  
ATOM   2717  N N    . VAL A 1 40 ? 11.948  2.708   3.806   1.00 0.00 ? 40  VAL A N    2  
ATOM   2718  C CA   . VAL A 1 40 ? 12.666  2.863   2.505   1.00 0.00 ? 40  VAL A CA   2  
ATOM   2719  C C    . VAL A 1 40 ? 12.494  1.562   1.726   1.00 0.00 ? 40  VAL A C    2  
ATOM   2720  O O    . VAL A 1 40 ? 12.455  0.489   2.294   1.00 0.00 ? 40  VAL A O    2  
ATOM   2721  C CB   . VAL A 1 40 ? 14.155  3.138   2.753   1.00 0.00 ? 40  VAL A CB   2  
ATOM   2722  C CG1  . VAL A 1 40 ? 14.949  2.905   1.463   1.00 0.00 ? 40  VAL A CG1  2  
ATOM   2723  C CG2  . VAL A 1 40 ? 14.330  4.594   3.187   1.00 0.00 ? 40  VAL A CG2  2  
ATOM   2724  H H    . VAL A 1 40 ? 12.370  2.221   4.546   1.00 0.00 ? 40  VAL A H    2  
ATOM   2725  H HA   . VAL A 1 40 ? 12.237  3.684   1.934   1.00 0.00 ? 40  VAL A HA   2  
ATOM   2726  H HB   . VAL A 1 40 ? 14.522  2.480   3.529   1.00 0.00 ? 40  VAL A HB   2  
ATOM   2727  H HG11 . VAL A 1 40 ? 14.415  3.341   0.632   1.00 0.00 ? 40  VAL A HG11 2  
ATOM   2728  H HG12 . VAL A 1 40 ? 15.922  3.363   1.547   1.00 0.00 ? 40  VAL A HG12 2  
ATOM   2729  H HG13 . VAL A 1 40 ? 15.062  1.844   1.298   1.00 0.00 ? 40  VAL A HG13 2  
ATOM   2730  H HG21 . VAL A 1 40 ? 13.656  4.811   4.002   1.00 0.00 ? 40  VAL A HG21 2  
ATOM   2731  H HG22 . VAL A 1 40 ? 15.349  4.754   3.507   1.00 0.00 ? 40  VAL A HG22 2  
ATOM   2732  H HG23 . VAL A 1 40 ? 14.108  5.245   2.353   1.00 0.00 ? 40  VAL A HG23 2  
ATOM   2733  N N    . VAL A 1 41 ? 12.371  1.659   0.432   1.00 0.00 ? 41  VAL A N    2  
ATOM   2734  C CA   . VAL A 1 41 ? 12.175  0.443   -0.418  1.00 0.00 ? 41  VAL A CA   2  
ATOM   2735  C C    . VAL A 1 41 ? 13.314  0.338   -1.436  1.00 0.00 ? 41  VAL A C    2  
ATOM   2736  O O    . VAL A 1 41 ? 13.508  1.212   -2.252  1.00 0.00 ? 41  VAL A O    2  
ATOM   2737  C CB   . VAL A 1 41 ? 10.833  0.568   -1.138  1.00 0.00 ? 41  VAL A CB   2  
ATOM   2738  C CG1  . VAL A 1 41 ? 10.392  -0.792  -1.665  1.00 0.00 ? 41  VAL A CG1  2  
ATOM   2739  C CG2  . VAL A 1 41 ? 9.781   1.087   -0.154  1.00 0.00 ? 41  VAL A CG2  2  
ATOM   2740  H H    . VAL A 1 41 ? 12.397  2.545   0.013   1.00 0.00 ? 41  VAL A H    2  
ATOM   2741  H HA   . VAL A 1 41 ? 12.166  -0.440  0.197   1.00 0.00 ? 41  VAL A HA   2  
ATOM   2742  H HB   . VAL A 1 41 ? 10.927  1.255   -1.964  1.00 0.00 ? 41  VAL A HB   2  
ATOM   2743  H HG11 . VAL A 1 41 ? 11.214  -1.263  -2.185  1.00 0.00 ? 41  VAL A HG11 2  
ATOM   2744  H HG12 . VAL A 1 41 ? 10.081  -1.416  -0.841  1.00 0.00 ? 41  VAL A HG12 2  
ATOM   2745  H HG13 . VAL A 1 41 ? 9.566   -0.652  -2.343  1.00 0.00 ? 41  VAL A HG13 2  
ATOM   2746  H HG21 . VAL A 1 41 ? 9.769   0.458   0.724   1.00 0.00 ? 41  VAL A HG21 2  
ATOM   2747  H HG22 . VAL A 1 41 ? 10.022  2.100   0.133   1.00 0.00 ? 41  VAL A HG22 2  
ATOM   2748  H HG23 . VAL A 1 41 ? 8.809   1.068   -0.623  1.00 0.00 ? 41  VAL A HG23 2  
ATOM   2749  N N    . PHE A 1 42 ? 14.078  -0.722  -1.393  1.00 0.00 ? 42  PHE A N    2  
ATOM   2750  C CA   . PHE A 1 42 ? 15.212  -0.865  -2.357  1.00 0.00 ? 42  PHE A CA   2  
ATOM   2751  C C    . PHE A 1 42 ? 14.756  -1.619  -3.610  1.00 0.00 ? 42  PHE A C    2  
ATOM   2752  O O    . PHE A 1 42 ? 14.096  -2.636  -3.535  1.00 0.00 ? 42  PHE A O    2  
ATOM   2753  C CB   . PHE A 1 42 ? 16.354  -1.645  -1.696  1.00 0.00 ? 42  PHE A CB   2  
ATOM   2754  C CG   . PHE A 1 42 ? 17.080  -0.762  -0.704  1.00 0.00 ? 42  PHE A CG   2  
ATOM   2755  C CD1  . PHE A 1 42 ? 17.776  0.379   -1.153  1.00 0.00 ? 42  PHE A CD1  2  
ATOM   2756  C CD2  . PHE A 1 42 ? 17.071  -1.083  0.669   1.00 0.00 ? 42  PHE A CD2  2  
ATOM   2757  C CE1  . PHE A 1 42 ? 18.457  1.197   -0.231  1.00 0.00 ? 42  PHE A CE1  2  
ATOM   2758  C CE2  . PHE A 1 42 ? 17.754  -0.266  1.589   1.00 0.00 ? 42  PHE A CE2  2  
ATOM   2759  C CZ   . PHE A 1 42 ? 18.448  0.875   1.139   1.00 0.00 ? 42  PHE A CZ   2  
ATOM   2760  H H    . PHE A 1 42 ? 13.913  -1.418  -0.723  1.00 0.00 ? 42  PHE A H    2  
ATOM   2761  H HA   . PHE A 1 42 ? 15.569  0.113   -2.643  1.00 0.00 ? 42  PHE A HA   2  
ATOM   2762  H HB2  . PHE A 1 42 ? 15.951  -2.507  -1.186  1.00 0.00 ? 42  PHE A HB2  2  
ATOM   2763  H HB3  . PHE A 1 42 ? 17.051  -1.973  -2.454  1.00 0.00 ? 42  PHE A HB3  2  
ATOM   2764  H HD1  . PHE A 1 42 ? 17.787  0.629   -2.202  1.00 0.00 ? 42  PHE A HD1  2  
ATOM   2765  H HD2  . PHE A 1 42 ? 16.538  -1.957  1.016   1.00 0.00 ? 42  PHE A HD2  2  
ATOM   2766  H HE1  . PHE A 1 42 ? 18.990  2.072   -0.575  1.00 0.00 ? 42  PHE A HE1  2  
ATOM   2767  H HE2  . PHE A 1 42 ? 17.747  -0.515  2.640   1.00 0.00 ? 42  PHE A HE2  2  
ATOM   2768  H HZ   . PHE A 1 42 ? 18.973  1.501   1.844   1.00 0.00 ? 42  PHE A HZ   2  
ATOM   2769  N N    . GLN A 1 43 ? 15.137  -1.132  -4.763  1.00 0.00 ? 43  GLN A N    2  
ATOM   2770  C CA   . GLN A 1 43 ? 14.772  -1.812  -6.043  1.00 0.00 ? 43  GLN A CA   2  
ATOM   2771  C C    . GLN A 1 43 ? 15.985  -2.642  -6.482  1.00 0.00 ? 43  GLN A C    2  
ATOM   2772  O O    . GLN A 1 43 ? 17.075  -2.114  -6.621  1.00 0.00 ? 43  GLN A O    2  
ATOM   2773  C CB   . GLN A 1 43 ? 14.447  -0.744  -7.090  1.00 0.00 ? 43  GLN A CB   2  
ATOM   2774  C CG   . GLN A 1 43 ? 13.223  0.056   -6.641  1.00 0.00 ? 43  GLN A CG   2  
ATOM   2775  C CD   . GLN A 1 43 ? 13.111  1.331   -7.480  1.00 0.00 ? 43  GLN A CD   2  
ATOM   2776  O OE1  . GLN A 1 43 ? 13.686  2.347   -7.144  1.00 0.00 ? 43  GLN A OE1  2  
ATOM   2777  N NE2  . GLN A 1 43 ? 12.388  1.320   -8.568  1.00 0.00 ? 43  GLN A NE2  2  
ATOM   2778  H H    . GLN A 1 43 ? 15.687  -0.322  -4.787  1.00 0.00 ? 43  GLN A H    2  
ATOM   2779  H HA   . GLN A 1 43 ? 13.920  -2.456  -5.893  1.00 0.00 ? 43  GLN A HA   2  
ATOM   2780  H HB2  . GLN A 1 43 ? 15.291  -0.082  -7.196  1.00 0.00 ? 43  GLN A HB2  2  
ATOM   2781  H HB3  . GLN A 1 43 ? 14.237  -1.211  -8.034  1.00 0.00 ? 43  GLN A HB3  2  
ATOM   2782  H HG2  . GLN A 1 43 ? 12.333  -0.542  -6.774  1.00 0.00 ? 43  GLN A HG2  2  
ATOM   2783  H HG3  . GLN A 1 43 ? 13.326  0.321   -5.600  1.00 0.00 ? 43  GLN A HG3  2  
ATOM   2784  H HE21 . GLN A 1 43 ? 11.924  0.501   -8.839  1.00 0.00 ? 43  GLN A HE21 2  
ATOM   2785  H HE22 . GLN A 1 43 ? 12.310  2.131   -9.112  1.00 0.00 ? 43  GLN A HE22 2  
ATOM   2786  N N    . THR A 1 44 ? 15.833  -3.944  -6.653  1.00 0.00 ? 44  THR A N    2  
ATOM   2787  C CA   . THR A 1 44 ? 17.027  -4.789  -7.021  1.00 0.00 ? 44  THR A CA   2  
ATOM   2788  C C    . THR A 1 44 ? 17.086  -5.104  -8.517  1.00 0.00 ? 44  THR A C    2  
ATOM   2789  O O    . THR A 1 44 ? 16.485  -4.443  -9.340  1.00 0.00 ? 44  THR A O    2  
ATOM   2790  C CB   . THR A 1 44 ? 16.964  -6.111  -6.259  1.00 0.00 ? 44  THR A CB   2  
ATOM   2791  O OG1  . THR A 1 44 ? 16.091  -6.997  -6.937  1.00 0.00 ? 44  THR A OG1  2  
ATOM   2792  C CG2  . THR A 1 44 ? 16.446  -5.861  -4.841  1.00 0.00 ? 44  THR A CG2  2  
ATOM   2793  H H    . THR A 1 44 ? 14.948  -4.368  -6.504  1.00 0.00 ? 44  THR A H    2  
ATOM   2794  H HA   . THR A 1 44 ? 17.937  -4.276  -6.741  1.00 0.00 ? 44  THR A HA   2  
ATOM   2795  H HB   . THR A 1 44 ? 17.948  -6.544  -6.209  1.00 0.00 ? 44  THR A HB   2  
ATOM   2796  H HG1  . THR A 1 44 ? 16.462  -7.173  -7.805  1.00 0.00 ? 44  THR A HG1  2  
ATOM   2797  H HG21 . THR A 1 44 ? 16.923  -4.983  -4.431  1.00 0.00 ? 44  THR A HG21 2  
ATOM   2798  H HG22 . THR A 1 44 ? 15.377  -5.707  -4.870  1.00 0.00 ? 44  THR A HG22 2  
ATOM   2799  H HG23 . THR A 1 44 ? 16.669  -6.714  -4.220  1.00 0.00 ? 44  THR A HG23 2  
ATOM   2800  N N    . LYS A 1 45 ? 17.843  -6.124  -8.856  1.00 0.00 ? 45  LYS A N    2  
ATOM   2801  C CA   . LYS A 1 45 ? 18.010  -6.538  -10.283 1.00 0.00 ? 45  LYS A CA   2  
ATOM   2802  C C    . LYS A 1 45 ? 17.237  -7.830  -10.554 1.00 0.00 ? 45  LYS A C    2  
ATOM   2803  O O    . LYS A 1 45 ? 16.899  -8.128  -11.683 1.00 0.00 ? 45  LYS A O    2  
ATOM   2804  C CB   . LYS A 1 45 ? 19.487  -6.811  -10.552 1.00 0.00 ? 45  LYS A CB   2  
ATOM   2805  C CG   . LYS A 1 45 ? 20.310  -5.589  -10.178 1.00 0.00 ? 45  LYS A CG   2  
ATOM   2806  C CD   . LYS A 1 45 ? 21.778  -5.838  -10.536 1.00 0.00 ? 45  LYS A CD   2  
ATOM   2807  C CE   . LYS A 1 45 ? 22.509  -4.506  -10.628 1.00 0.00 ? 45  LYS A CE   2  
ATOM   2808  N NZ   . LYS A 1 45 ? 22.103  -3.799  -11.875 1.00 0.00 ? 45  LYS A NZ   2  
ATOM   2809  H H    . LYS A 1 45 ? 18.318  -6.620  -8.156  1.00 0.00 ? 45  LYS A H    2  
ATOM   2810  H HA   . LYS A 1 45 ? 17.669  -5.752  -10.941 1.00 0.00 ? 45  LYS A HA   2  
ATOM   2811  H HB2  . LYS A 1 45 ? 19.810  -7.657  -9.964  1.00 0.00 ? 45  LYS A HB2  2  
ATOM   2812  H HB3  . LYS A 1 45 ? 19.629  -7.025  -11.599 1.00 0.00 ? 45  LYS A HB3  2  
ATOM   2813  H HG2  . LYS A 1 45 ? 19.940  -4.734  -10.723 1.00 0.00 ? 45  LYS A HG2  2  
ATOM   2814  H HG3  . LYS A 1 45 ? 20.225  -5.408  -9.117  1.00 0.00 ? 45  LYS A HG3  2  
ATOM   2815  H HD2  . LYS A 1 45 ? 22.235  -6.447  -9.770  1.00 0.00 ? 45  LYS A HD2  2  
ATOM   2816  H HD3  . LYS A 1 45 ? 21.846  -6.345  -11.488 1.00 0.00 ? 45  LYS A HD3  2  
ATOM   2817  H HE2  . LYS A 1 45 ? 22.255  -3.903  -9.772  1.00 0.00 ? 45  LYS A HE2  2  
ATOM   2818  H HE3  . LYS A 1 45 ? 23.570  -4.684  -10.644 1.00 0.00 ? 45  LYS A HE3  2  
ATOM   2819  H HZ1  . LYS A 1 45 ? 21.069  -3.841  -11.975 1.00 0.00 ? 45  LYS A HZ1  2  
ATOM   2820  H HZ2  . LYS A 1 45 ? 22.408  -2.805  -11.825 1.00 0.00 ? 45  LYS A HZ2  2  
ATOM   2821  H HZ3  . LYS A 1 45 ? 22.547  -4.258  -12.694 1.00 0.00 ? 45  LYS A HZ3  2  
ATOM   2822  N N    . ARG A 1 46 ? 16.976  -8.615  -9.532  1.00 0.00 ? 46  ARG A N    2  
ATOM   2823  C CA   . ARG A 1 46 ? 16.248  -9.910  -9.736  1.00 0.00 ? 46  ARG A CA   2  
ATOM   2824  C C    . ARG A 1 46 ? 15.110  -9.995  -8.716  1.00 0.00 ? 46  ARG A C    2  
ATOM   2825  O O    . ARG A 1 46 ? 14.983  -10.944 -7.972  1.00 0.00 ? 46  ARG A O    2  
ATOM   2826  C CB   . ARG A 1 46 ? 17.236  -11.078 -9.538  1.00 0.00 ? 46  ARG A CB   2  
ATOM   2827  C CG   . ARG A 1 46 ? 16.757  -12.346 -10.274 1.00 0.00 ? 46  ARG A CG   2  
ATOM   2828  C CD   . ARG A 1 46 ? 15.579  -12.997 -9.542  1.00 0.00 ? 46  ARG A CD   2  
ATOM   2829  N NE   . ARG A 1 46 ? 15.380  -14.376 -10.066 1.00 0.00 ? 46  ARG A NE   2  
ATOM   2830  C CZ   . ARG A 1 46 ? 14.643  -15.226 -9.402  1.00 0.00 ? 46  ARG A CZ   2  
ATOM   2831  N NH1  . ARG A 1 46 ? 14.087  -14.867 -8.278  1.00 0.00 ? 46  ARG A NH1  2  
ATOM   2832  N NH2  . ARG A 1 46 ? 14.465  -16.434 -9.862  1.00 0.00 ? 46  ARG A NH2  2  
ATOM   2833  H H    . ARG A 1 46 ? 17.273  -8.360  -8.635  1.00 0.00 ? 46  ARG A H    2  
ATOM   2834  H HA   . ARG A 1 46 ? 15.831  -9.950  -10.732 1.00 0.00 ? 46  ARG A HA   2  
ATOM   2835  H HB2  . ARG A 1 46 ? 18.202  -10.790 -9.926  1.00 0.00 ? 46  ARG A HB2  2  
ATOM   2836  H HB3  . ARG A 1 46 ? 17.332  -11.294 -8.483  1.00 0.00 ? 46  ARG A HB3  2  
ATOM   2837  H HG2  . ARG A 1 46 ? 16.454  -12.089 -11.278 1.00 0.00 ? 46  ARG A HG2  2  
ATOM   2838  H HG3  . ARG A 1 46 ? 17.573  -13.051 -10.325 1.00 0.00 ? 46  ARG A HG3  2  
ATOM   2839  H HD2  . ARG A 1 46 ? 15.790  -13.044 -8.483  1.00 0.00 ? 46  ARG A HD2  2  
ATOM   2840  H HD3  . ARG A 1 46 ? 14.684  -12.419 -9.712  1.00 0.00 ? 46  ARG A HD3  2  
ATOM   2841  H HE   . ARG A 1 46 ? 15.800  -14.646 -10.909 1.00 0.00 ? 46  ARG A HE   2  
ATOM   2842  H HH11 . ARG A 1 46 ? 14.223  -13.942 -7.924  1.00 0.00 ? 46  ARG A HH11 2  
ATOM   2843  H HH12 . ARG A 1 46 ? 13.523  -15.518 -7.769  1.00 0.00 ? 46  ARG A HH12 2  
ATOM   2844  H HH21 . ARG A 1 46 ? 14.892  -16.708 -10.723 1.00 0.00 ? 46  ARG A HH21 2  
ATOM   2845  H HH22 . ARG A 1 46 ? 13.901  -17.084 -9.354  1.00 0.00 ? 46  ARG A HH22 2  
ATOM   2846  N N    . SER A 1 47 ? 14.278  -8.999  -8.684  1.00 0.00 ? 47  SER A N    2  
ATOM   2847  C CA   . SER A 1 47 ? 13.138  -9.000  -7.745  1.00 0.00 ? 47  SER A CA   2  
ATOM   2848  C C    . SER A 1 47 ? 12.220  -7.849  -8.132  1.00 0.00 ? 47  SER A C    2  
ATOM   2849  O O    . SER A 1 47 ? 11.760  -7.761  -9.252  1.00 0.00 ? 47  SER A O    2  
ATOM   2850  C CB   . SER A 1 47 ? 13.627  -8.841  -6.298  1.00 0.00 ? 47  SER A CB   2  
ATOM   2851  O OG   . SER A 1 47 ? 14.025  -7.497  -6.070  1.00 0.00 ? 47  SER A OG   2  
ATOM   2852  H H    . SER A 1 47 ? 14.400  -8.241  -9.289  1.00 0.00 ? 47  SER A H    2  
ATOM   2853  H HA   . SER A 1 47 ? 12.600  -9.926  -7.839  1.00 0.00 ? 47  SER A HA   2  
ATOM   2854  H HB2  . SER A 1 47 ? 12.830  -9.093  -5.618  1.00 0.00 ? 47  SER A HB2  2  
ATOM   2855  H HB3  . SER A 1 47 ? 14.462  -9.509  -6.127  1.00 0.00 ? 47  SER A HB3  2  
ATOM   2856  H HG   . SER A 1 47 ? 14.201  -7.396  -5.132  1.00 0.00 ? 47  SER A HG   2  
ATOM   2857  N N    . LYS A 1 48 ? 11.978  -6.959  -7.231  1.00 0.00 ? 48  LYS A N    2  
ATOM   2858  C CA   . LYS A 1 48 ? 11.111  -5.796  -7.536  1.00 0.00 ? 48  LYS A CA   2  
ATOM   2859  C C    . LYS A 1 48 ? 11.409  -4.711  -6.515  1.00 0.00 ? 48  LYS A C    2  
ATOM   2860  O O    . LYS A 1 48 ? 12.306  -3.907  -6.681  1.00 0.00 ? 48  LYS A O    2  
ATOM   2861  C CB   . LYS A 1 48 ? 9.633   -6.192  -7.429  1.00 0.00 ? 48  LYS A CB   2  
ATOM   2862  C CG   . LYS A 1 48 ? 9.244   -7.118  -8.587  1.00 0.00 ? 48  LYS A CG   2  
ATOM   2863  C CD   . LYS A 1 48 ? 7.719   -7.171  -8.710  1.00 0.00 ? 48  LYS A CD   2  
ATOM   2864  C CE   . LYS A 1 48 ? 7.331   -8.033  -9.913  1.00 0.00 ? 48  LYS A CE   2  
ATOM   2865  N NZ   . LYS A 1 48 ? 5.905   -7.782  -10.264 1.00 0.00 ? 48  LYS A NZ   2  
ATOM   2866  H H    . LYS A 1 48 ? 12.388  -7.041  -6.351  1.00 0.00 ? 48  LYS A H    2  
ATOM   2867  H HA   . LYS A 1 48 ? 11.324  -5.429  -8.531  1.00 0.00 ? 48  LYS A HA   2  
ATOM   2868  H HB2  . LYS A 1 48 ? 9.468   -6.701  -6.492  1.00 0.00 ? 48  LYS A HB2  2  
ATOM   2869  H HB3  . LYS A 1 48 ? 9.023   -5.300  -7.463  1.00 0.00 ? 48  LYS A HB3  2  
ATOM   2870  H HG2  . LYS A 1 48 ? 9.665   -6.744  -9.508  1.00 0.00 ? 48  LYS A HG2  2  
ATOM   2871  H HG3  . LYS A 1 48 ? 9.618   -8.112  -8.393  1.00 0.00 ? 48  LYS A HG3  2  
ATOM   2872  H HD2  . LYS A 1 48 ? 7.299   -7.596  -7.810  1.00 0.00 ? 48  LYS A HD2  2  
ATOM   2873  H HD3  . LYS A 1 48 ? 7.335   -6.171  -8.848  1.00 0.00 ? 48  LYS A HD3  2  
ATOM   2874  H HE2  . LYS A 1 48 ? 7.958   -7.781  -10.756 1.00 0.00 ? 48  LYS A HE2  2  
ATOM   2875  H HE3  . LYS A 1 48 ? 7.463   -9.076  -9.665  1.00 0.00 ? 48  LYS A HE3  2  
ATOM   2876  H HZ1  . LYS A 1 48 ? 5.509   -7.070  -9.617  1.00 0.00 ? 48  LYS A HZ1  2  
ATOM   2877  H HZ2  . LYS A 1 48 ? 5.843   -7.435  -11.241 1.00 0.00 ? 48  LYS A HZ2  2  
ATOM   2878  H HZ3  . LYS A 1 48 ? 5.365   -8.666  -10.178 1.00 0.00 ? 48  LYS A HZ3  2  
ATOM   2879  N N    . GLN A 1 49 ? 10.657  -4.709  -5.449  1.00 0.00 ? 49  GLN A N    2  
ATOM   2880  C CA   . GLN A 1 49 ? 10.843  -3.704  -4.365  1.00 0.00 ? 49  GLN A CA   2  
ATOM   2881  C C    . GLN A 1 49 ? 11.005  -4.449  -3.030  1.00 0.00 ? 49  GLN A C    2  
ATOM   2882  O O    . GLN A 1 49 ? 10.381  -5.468  -2.796  1.00 0.00 ? 49  GLN A O    2  
ATOM   2883  C CB   . GLN A 1 49 ? 9.586   -2.802  -4.331  1.00 0.00 ? 49  GLN A CB   2  
ATOM   2884  C CG   . GLN A 1 49 ? 9.888   -1.429  -4.950  1.00 0.00 ? 49  GLN A CG   2  
ATOM   2885  C CD   . GLN A 1 49 ? 8.668   -0.519  -4.794  1.00 0.00 ? 49  GLN A CD   2  
ATOM   2886  O OE1  . GLN A 1 49 ? 8.756   0.675   -5.006  1.00 0.00 ? 49  GLN A OE1  2  
ATOM   2887  N NE2  . GLN A 1 49 ? 7.525   -1.034  -4.432  1.00 0.00 ? 49  GLN A NE2  2  
ATOM   2888  H H    . GLN A 1 49 ? 9.953   -5.385  -5.357  1.00 0.00 ? 49  GLN A H    2  
ATOM   2889  H HA   . GLN A 1 49 ? 11.727  -3.108  -4.551  1.00 0.00 ? 49  GLN A HA   2  
ATOM   2890  H HB2  . GLN A 1 49 ? 8.800   -3.276  -4.901  1.00 0.00 ? 49  GLN A HB2  2  
ATOM   2891  H HB3  . GLN A 1 49 ? 9.250   -2.672  -3.315  1.00 0.00 ? 49  GLN A HB3  2  
ATOM   2892  H HG2  . GLN A 1 49 ? 10.735  -0.986  -4.449  1.00 0.00 ? 49  GLN A HG2  2  
ATOM   2893  H HG3  . GLN A 1 49 ? 10.113  -1.549  -5.998  1.00 0.00 ? 49  GLN A HG3  2  
ATOM   2894  H HE21 . GLN A 1 49 ? 7.455   -1.997  -4.262  1.00 0.00 ? 49  GLN A HE21 2  
ATOM   2895  H HE22 . GLN A 1 49 ? 6.739   -0.459  -4.330  1.00 0.00 ? 49  GLN A HE22 2  
ATOM   2896  N N    . VAL A 1 50 ? 11.837  -3.946  -2.152  1.00 0.00 ? 50  VAL A N    2  
ATOM   2897  C CA   . VAL A 1 50 ? 12.046  -4.610  -0.826  1.00 0.00 ? 50  VAL A CA   2  
ATOM   2898  C C    . VAL A 1 50 ? 12.052  -3.547  0.265   1.00 0.00 ? 50  VAL A C    2  
ATOM   2899  O O    . VAL A 1 50 ? 12.831  -2.619  0.229   1.00 0.00 ? 50  VAL A O    2  
ATOM   2900  C CB   . VAL A 1 50 ? 13.386  -5.350  -0.823  1.00 0.00 ? 50  VAL A CB   2  
ATOM   2901  C CG1  . VAL A 1 50 ? 13.459  -6.264  0.403   1.00 0.00 ? 50  VAL A CG1  2  
ATOM   2902  C CG2  . VAL A 1 50 ? 13.510  -6.187  -2.102  1.00 0.00 ? 50  VAL A CG2  2  
ATOM   2903  H H    . VAL A 1 50 ? 12.326  -3.123  -2.364  1.00 0.00 ? 50  VAL A H    2  
ATOM   2904  H HA   . VAL A 1 50 ? 11.245  -5.311  -0.631  1.00 0.00 ? 50  VAL A HA   2  
ATOM   2905  H HB   . VAL A 1 50 ? 14.194  -4.633  -0.781  1.00 0.00 ? 50  VAL A HB   2  
ATOM   2906  H HG11 . VAL A 1 50 ? 13.361  -5.671  1.300   1.00 0.00 ? 50  VAL A HG11 2  
ATOM   2907  H HG12 . VAL A 1 50 ? 12.660  -6.988  0.360   1.00 0.00 ? 50  VAL A HG12 2  
ATOM   2908  H HG13 . VAL A 1 50 ? 14.409  -6.777  0.414   1.00 0.00 ? 50  VAL A HG13 2  
ATOM   2909  H HG21 . VAL A 1 50 ? 12.552  -6.629  -2.340  1.00 0.00 ? 50  VAL A HG21 2  
ATOM   2910  H HG22 . VAL A 1 50 ? 13.823  -5.551  -2.915  1.00 0.00 ? 50  VAL A HG22 2  
ATOM   2911  H HG23 . VAL A 1 50 ? 14.241  -6.969  -1.956  1.00 0.00 ? 50  VAL A HG23 2  
ATOM   2912  N N    . CYS A 1 51 ? 11.192  -3.674  1.237   1.00 0.00 ? 51  CYS A N    2  
ATOM   2913  C CA   . CYS A 1 51 ? 11.141  -2.660  2.325   1.00 0.00 ? 51  CYS A CA   2  
ATOM   2914  C C    . CYS A 1 51 ? 12.362  -2.819  3.229   1.00 0.00 ? 51  CYS A C    2  
ATOM   2915  O O    . CYS A 1 51 ? 12.920  -3.891  3.355   1.00 0.00 ? 51  CYS A O    2  
ATOM   2916  C CB   . CYS A 1 51 ? 9.869   -2.868  3.148   1.00 0.00 ? 51  CYS A CB   2  
ATOM   2917  S SG   . CYS A 1 51 ? 8.416   -2.660  2.086   1.00 0.00 ? 51  CYS A SG   2  
ATOM   2918  H H    . CYS A 1 51 ? 10.573  -4.431  1.246   1.00 0.00 ? 51  CYS A H    2  
ATOM   2919  H HA   . CYS A 1 51 ? 11.135  -1.669  1.898   1.00 0.00 ? 51  CYS A HA   2  
ATOM   2920  H HB2  . CYS A 1 51 ? 9.869   -3.864  3.565   1.00 0.00 ? 51  CYS A HB2  2  
ATOM   2921  H HB3  . CYS A 1 51 ? 9.837   -2.146  3.945   1.00 0.00 ? 51  CYS A HB3  2  
ATOM   2922  N N    . ALA A 1 52 ? 12.787  -1.752  3.854   1.00 0.00 ? 52  ALA A N    2  
ATOM   2923  C CA   . ALA A 1 52 ? 13.982  -1.826  4.748   1.00 0.00 ? 52  ALA A CA   2  
ATOM   2924  C C    . ALA A 1 52 ? 13.779  -0.905  5.954   1.00 0.00 ? 52  ALA A C    2  
ATOM   2925  O O    . ALA A 1 52 ? 13.315  0.212   5.824   1.00 0.00 ? 52  ALA A O    2  
ATOM   2926  C CB   . ALA A 1 52 ? 15.222  -1.376  3.973   1.00 0.00 ? 52  ALA A CB   2  
ATOM   2927  H H    . ALA A 1 52 ? 12.323  -0.897  3.729   1.00 0.00 ? 52  ALA A H    2  
ATOM   2928  H HA   . ALA A 1 52 ? 14.123  -2.844  5.092   1.00 0.00 ? 52  ALA A HA   2  
ATOM   2929  H HB1  . ALA A 1 52 ? 15.266  -1.898  3.029   1.00 0.00 ? 52  ALA A HB1  2  
ATOM   2930  H HB2  . ALA A 1 52 ? 15.167  -0.311  3.793   1.00 0.00 ? 52  ALA A HB2  2  
ATOM   2931  H HB3  . ALA A 1 52 ? 16.108  -1.597  4.549   1.00 0.00 ? 52  ALA A HB3  2  
ATOM   2932  N N    . ASP A 1 53 ? 14.126  -1.369  7.125   1.00 0.00 ? 53  ASP A N    2  
ATOM   2933  C CA   . ASP A 1 53 ? 13.957  -0.531  8.347   1.00 0.00 ? 53  ASP A CA   2  
ATOM   2934  C C    . ASP A 1 53 ? 14.954  0.653   8.305   1.00 0.00 ? 53  ASP A C    2  
ATOM   2935  O O    . ASP A 1 53 ? 16.146  0.416   8.320   1.00 0.00 ? 53  ASP A O    2  
ATOM   2936  C CB   . ASP A 1 53 ? 14.269  -1.387  9.578   1.00 0.00 ? 53  ASP A CB   2  
ATOM   2937  C CG   . ASP A 1 53 ? 13.134  -2.385  9.813   1.00 0.00 ? 53  ASP A CG   2  
ATOM   2938  O OD1  . ASP A 1 53 ? 12.184  -2.022  10.485  1.00 0.00 ? 53  ASP A OD1  2  
ATOM   2939  O OD2  . ASP A 1 53 ? 13.237  -3.495  9.317   1.00 0.00 ? 53  ASP A OD2  2  
ATOM   2940  H H    . ASP A 1 53 ? 14.496  -2.273  7.201   1.00 0.00 ? 53  ASP A H    2  
ATOM   2941  H HA   . ASP A 1 53 ? 12.941  -0.194  8.404   1.00 0.00 ? 53  ASP A HA   2  
ATOM   2942  H HB2  . ASP A 1 53 ? 15.194  -1.922  9.418   1.00 0.00 ? 53  ASP A HB2  2  
ATOM   2943  H HB3  . ASP A 1 53 ? 14.369  -0.748  10.443  1.00 0.00 ? 53  ASP A HB3  2  
ATOM   2944  N N    . PRO A 1 54 ? 14.482  1.894   8.260   1.00 0.00 ? 54  PRO A N    2  
ATOM   2945  C CA   . PRO A 1 54 ? 15.407  3.047   8.225   1.00 0.00 ? 54  PRO A CA   2  
ATOM   2946  C C    . PRO A 1 54 ? 16.245  3.085   9.513   1.00 0.00 ? 54  PRO A C    2  
ATOM   2947  O O    . PRO A 1 54 ? 17.169  3.862   9.643   1.00 0.00 ? 54  PRO A O    2  
ATOM   2948  C CB   . PRO A 1 54 ? 14.498  4.293   8.121   1.00 0.00 ? 54  PRO A CB   2  
ATOM   2949  C CG   . PRO A 1 54 ? 13.022  3.802   8.149   1.00 0.00 ? 54  PRO A CG   2  
ATOM   2950  C CD   . PRO A 1 54 ? 13.045  2.258   8.236   1.00 0.00 ? 54  PRO A CD   2  
ATOM   2951  H HA   . PRO A 1 54 ? 16.053  2.983   7.362   1.00 0.00 ? 54  PRO A HA   2  
ATOM   2952  H HB2  . PRO A 1 54 ? 14.681  4.961   8.955   1.00 0.00 ? 54  PRO A HB2  2  
ATOM   2953  H HB3  . PRO A 1 54 ? 14.691  4.813   7.192   1.00 0.00 ? 54  PRO A HB3  2  
ATOM   2954  H HG2  . PRO A 1 54 ? 12.511  4.216   9.012   1.00 0.00 ? 54  PRO A HG2  2  
ATOM   2955  H HG3  . PRO A 1 54 ? 12.512  4.111   7.248   1.00 0.00 ? 54  PRO A HG3  2  
ATOM   2956  H HD2  . PRO A 1 54 ? 12.555  1.929   9.144   1.00 0.00 ? 54  PRO A HD2  2  
ATOM   2957  H HD3  . PRO A 1 54 ? 12.566  1.825   7.369   1.00 0.00 ? 54  PRO A HD3  2  
ATOM   2958  N N    . SER A 1 55 ? 15.914  2.261   10.466  1.00 0.00 ? 55  SER A N    2  
ATOM   2959  C CA   . SER A 1 55 ? 16.676  2.260   11.747  1.00 0.00 ? 55  SER A CA   2  
ATOM   2960  C C    . SER A 1 55 ? 18.019  1.554   11.552  1.00 0.00 ? 55  SER A C    2  
ATOM   2961  O O    . SER A 1 55 ? 18.938  1.728   12.328  1.00 0.00 ? 55  SER A O    2  
ATOM   2962  C CB   . SER A 1 55 ? 15.868  1.527   12.818  1.00 0.00 ? 55  SER A CB   2  
ATOM   2963  O OG   . SER A 1 55 ? 16.584  1.550   14.046  1.00 0.00 ? 55  SER A OG   2  
ATOM   2964  H H    . SER A 1 55 ? 15.157  1.653   10.344  1.00 0.00 ? 55  SER A H    2  
ATOM   2965  H HA   . SER A 1 55 ? 16.848  3.278   12.063  1.00 0.00 ? 55  SER A HA   2  
ATOM   2966  H HB2  . SER A 1 55 ? 14.917  2.015   12.952  1.00 0.00 ? 55  SER A HB2  2  
ATOM   2967  H HB3  . SER A 1 55 ? 15.703  0.503   12.506  1.00 0.00 ? 55  SER A HB3  2  
ATOM   2968  H HG   . SER A 1 55 ? 15.970  1.337   14.752  1.00 0.00 ? 55  SER A HG   2  
ATOM   2969  N N    . GLU A 1 56 ? 18.149  0.763   10.521  1.00 0.00 ? 56  GLU A N    2  
ATOM   2970  C CA   . GLU A 1 56 ? 19.441  0.060   10.285  1.00 0.00 ? 56  GLU A CA   2  
ATOM   2971  C C    . GLU A 1 56 ? 20.415  1.021   9.595   1.00 0.00 ? 56  GLU A C    2  
ATOM   2972  O O    . GLU A 1 56 ? 20.173  1.505   8.506   1.00 0.00 ? 56  GLU A O    2  
ATOM   2973  C CB   . GLU A 1 56 ? 19.206  -1.168  9.405   1.00 0.00 ? 56  GLU A CB   2  
ATOM   2974  C CG   . GLU A 1 56 ? 18.643  -2.313  10.252  1.00 0.00 ? 56  GLU A CG   2  
ATOM   2975  C CD   . GLU A 1 56 ? 19.750  -2.885  11.140  1.00 0.00 ? 56  GLU A CD   2  
ATOM   2976  O OE1  . GLU A 1 56 ? 20.787  -3.240  10.605  1.00 0.00 ? 56  GLU A OE1  2  
ATOM   2977  O OE2  . GLU A 1 56 ? 19.542  -2.958  12.340  1.00 0.00 ? 56  GLU A OE2  2  
ATOM   2978  H H    . GLU A 1 56 ? 17.399  0.638   9.901   1.00 0.00 ? 56  GLU A H    2  
ATOM   2979  H HA   . GLU A 1 56 ? 19.861  -0.249  11.233  1.00 0.00 ? 56  GLU A HA   2  
ATOM   2980  H HB2  . GLU A 1 56 ? 18.501  -0.918  8.630   1.00 0.00 ? 56  GLU A HB2  2  
ATOM   2981  H HB3  . GLU A 1 56 ? 20.138  -1.478  8.961   1.00 0.00 ? 56  GLU A HB3  2  
ATOM   2982  H HG2  . GLU A 1 56 ? 17.839  -1.942  10.872  1.00 0.00 ? 56  GLU A HG2  2  
ATOM   2983  H HG3  . GLU A 1 56 ? 18.267  -3.090  9.604   1.00 0.00 ? 56  GLU A HG3  2  
ATOM   2984  N N    . SER A 1 57 ? 21.504  1.311   10.243  1.00 0.00 ? 57  SER A N    2  
ATOM   2985  C CA   . SER A 1 57 ? 22.510  2.252   9.676   1.00 0.00 ? 57  SER A CA   2  
ATOM   2986  C C    . SER A 1 57 ? 22.874  1.884   8.234   1.00 0.00 ? 57  SER A C    2  
ATOM   2987  O O    . SER A 1 57 ? 23.075  2.748   7.405   1.00 0.00 ? 57  SER A O    2  
ATOM   2988  C CB   . SER A 1 57 ? 23.773  2.215   10.537  1.00 0.00 ? 57  SER A CB   2  
ATOM   2989  O OG   . SER A 1 57 ? 23.466  2.689   11.841  1.00 0.00 ? 57  SER A OG   2  
ATOM   2990  H H    . SER A 1 57 ? 21.659  0.913   11.122  1.00 0.00 ? 57  SER A H    2  
ATOM   2991  H HA   . SER A 1 57 ? 22.106  3.251   9.691   1.00 0.00 ? 57  SER A HA   2  
ATOM   2992  H HB2  . SER A 1 57 ? 24.135  1.203   10.604  1.00 0.00 ? 57  SER A HB2  2  
ATOM   2993  H HB3  . SER A 1 57 ? 24.533  2.838   10.085  1.00 0.00 ? 57  SER A HB3  2  
ATOM   2994  H HG   . SER A 1 57 ? 23.888  2.105   12.475  1.00 0.00 ? 57  SER A HG   2  
ATOM   2995  N N    . TRP A 1 58 ? 22.988  0.622   7.922   1.00 0.00 ? 58  TRP A N    2  
ATOM   2996  C CA   . TRP A 1 58 ? 23.370  0.252   6.531   1.00 0.00 ? 58  TRP A CA   2  
ATOM   2997  C C    . TRP A 1 58 ? 22.313  0.762   5.555   1.00 0.00 ? 58  TRP A C    2  
ATOM   2998  O O    . TRP A 1 58 ? 22.608  1.094   4.426   1.00 0.00 ? 58  TRP A O    2  
ATOM   2999  C CB   . TRP A 1 58 ? 23.566  -1.268  6.411   1.00 0.00 ? 58  TRP A CB   2  
ATOM   3000  C CG   . TRP A 1 58 ? 22.261  -1.995  6.273   1.00 0.00 ? 58  TRP A CG   2  
ATOM   3001  C CD1  . TRP A 1 58 ? 21.670  -2.713  7.256   1.00 0.00 ? 58  TRP A CD1  2  
ATOM   3002  C CD2  . TRP A 1 58 ? 21.404  -2.126  5.099   1.00 0.00 ? 58  TRP A CD2  2  
ATOM   3003  N NE1  . TRP A 1 58 ? 20.503  -3.271  6.764   1.00 0.00 ? 58  TRP A NE1  2  
ATOM   3004  C CE2  . TRP A 1 58 ? 20.289  -2.936  5.445   1.00 0.00 ? 58  TRP A CE2  2  
ATOM   3005  C CE3  . TRP A 1 58 ? 21.477  -1.623  3.779   1.00 0.00 ? 58  TRP A CE3  2  
ATOM   3006  C CZ2  . TRP A 1 58 ? 19.282  -3.237  4.516   1.00 0.00 ? 58  TRP A CZ2  2  
ATOM   3007  C CZ3  . TRP A 1 58 ? 20.466  -1.923  2.841   1.00 0.00 ? 58  TRP A CZ3  2  
ATOM   3008  C CH2  . TRP A 1 58 ? 19.370  -2.728  3.211   1.00 0.00 ? 58  TRP A CH2  2  
ATOM   3009  H H    . TRP A 1 58 ? 22.835  -0.071  8.594   1.00 0.00 ? 58  TRP A H    2  
ATOM   3010  H HA   . TRP A 1 58 ? 24.307  0.740   6.299   1.00 0.00 ? 58  TRP A HA   2  
ATOM   3011  H HB2  . TRP A 1 58 ? 24.175  -1.474  5.544   1.00 0.00 ? 58  TRP A HB2  2  
ATOM   3012  H HB3  . TRP A 1 58 ? 24.079  -1.625  7.292   1.00 0.00 ? 58  TRP A HB3  2  
ATOM   3013  H HD1  . TRP A 1 58 ? 22.049  -2.832  8.260   1.00 0.00 ? 58  TRP A HD1  2  
ATOM   3014  H HE1  . TRP A 1 58 ? 19.891  -3.837  7.275   1.00 0.00 ? 58  TRP A HE1  2  
ATOM   3015  H HE3  . TRP A 1 58 ? 22.311  -1.010  3.486   1.00 0.00 ? 58  TRP A HE3  2  
ATOM   3016  H HZ2  . TRP A 1 58 ? 18.444  -3.856  4.801   1.00 0.00 ? 58  TRP A HZ2  2  
ATOM   3017  H HZ3  . TRP A 1 58 ? 20.531  -1.533  1.836   1.00 0.00 ? 58  TRP A HZ3  2  
ATOM   3018  H HH2  . TRP A 1 58 ? 18.599  -2.957  2.490   1.00 0.00 ? 58  TRP A HH2  2  
ATOM   3019  N N    . VAL A 1 59 ? 21.089  0.857   5.984   1.00 0.00 ? 59  VAL A N    2  
ATOM   3020  C CA   . VAL A 1 59 ? 20.034  1.368   5.074   1.00 0.00 ? 59  VAL A CA   2  
ATOM   3021  C C    . VAL A 1 59 ? 20.312  2.839   4.787   1.00 0.00 ? 59  VAL A C    2  
ATOM   3022  O O    . VAL A 1 59 ? 20.252  3.286   3.659   1.00 0.00 ? 59  VAL A O    2  
ATOM   3023  C CB   . VAL A 1 59 ? 18.672  1.213   5.746   1.00 0.00 ? 59  VAL A CB   2  
ATOM   3024  C CG1  . VAL A 1 59 ? 17.578  1.801   4.851   1.00 0.00 ? 59  VAL A CG1  2  
ATOM   3025  C CG2  . VAL A 1 59 ? 18.410  -0.274  5.972   1.00 0.00 ? 59  VAL A CG2  2  
ATOM   3026  H H    . VAL A 1 59 ? 20.869  0.605   6.904   1.00 0.00 ? 59  VAL A H    2  
ATOM   3027  H HA   . VAL A 1 59 ? 20.050  0.810   4.151   1.00 0.00 ? 59  VAL A HA   2  
ATOM   3028  H HB   . VAL A 1 59 ? 18.675  1.730   6.696   1.00 0.00 ? 59  VAL A HB   2  
ATOM   3029  H HG11 . VAL A 1 59 ? 17.743  1.493   3.830   1.00 0.00 ? 59  VAL A HG11 2  
ATOM   3030  H HG12 . VAL A 1 59 ? 16.613  1.448   5.183   1.00 0.00 ? 59  VAL A HG12 2  
ATOM   3031  H HG13 . VAL A 1 59 ? 17.607  2.879   4.910   1.00 0.00 ? 59  VAL A HG13 2  
ATOM   3032  H HG21 . VAL A 1 59 ? 19.268  -0.718  6.458   1.00 0.00 ? 59  VAL A HG21 2  
ATOM   3033  H HG22 . VAL A 1 59 ? 17.537  -0.397  6.593   1.00 0.00 ? 59  VAL A HG22 2  
ATOM   3034  H HG23 . VAL A 1 59 ? 18.249  -0.759  5.022   1.00 0.00 ? 59  VAL A HG23 2  
ATOM   3035  N N    . GLN A 1 60 ? 20.633  3.593   5.798   1.00 0.00 ? 60  GLN A N    2  
ATOM   3036  C CA   . GLN A 1 60 ? 20.936  5.033   5.576   1.00 0.00 ? 60  GLN A CA   2  
ATOM   3037  C C    . GLN A 1 60 ? 22.197  5.158   4.716   1.00 0.00 ? 60  GLN A C    2  
ATOM   3038  O O    . GLN A 1 60 ? 22.316  6.044   3.893   1.00 0.00 ? 60  GLN A O    2  
ATOM   3039  C CB   . GLN A 1 60 ? 21.163  5.723   6.923   1.00 0.00 ? 60  GLN A CB   2  
ATOM   3040  C CG   . GLN A 1 60 ? 19.941  5.512   7.819   1.00 0.00 ? 60  GLN A CG   2  
ATOM   3041  C CD   . GLN A 1 60 ? 20.238  6.041   9.222   1.00 0.00 ? 60  GLN A CD   2  
ATOM   3042  O OE1  . GLN A 1 60 ? 20.479  5.275   10.135  1.00 0.00 ? 60  GLN A OE1  2  
ATOM   3043  N NE2  . GLN A 1 60 ? 20.233  7.328   9.436   1.00 0.00 ? 60  GLN A NE2  2  
ATOM   3044  H H    . GLN A 1 60 ? 20.688  3.206   6.700   1.00 0.00 ? 60  GLN A H    2  
ATOM   3045  H HA   . GLN A 1 60 ? 20.107  5.500   5.065   1.00 0.00 ? 60  GLN A HA   2  
ATOM   3046  H HB2  . GLN A 1 60 ? 22.037  5.303   7.400   1.00 0.00 ? 60  GLN A HB2  2  
ATOM   3047  H HB3  . GLN A 1 60 ? 21.312  6.781   6.766   1.00 0.00 ? 60  GLN A HB3  2  
ATOM   3048  H HG2  . GLN A 1 60 ? 19.095  6.042   7.404   1.00 0.00 ? 60  GLN A HG2  2  
ATOM   3049  H HG3  . GLN A 1 60 ? 19.713  4.457   7.874   1.00 0.00 ? 60  GLN A HG3  2  
ATOM   3050  H HE21 . GLN A 1 60 ? 20.040  7.946   8.701   1.00 0.00 ? 60  GLN A HE21 2  
ATOM   3051  H HE22 . GLN A 1 60 ? 20.423  7.677   10.332  1.00 0.00 ? 60  GLN A HE22 2  
ATOM   3052  N N    . GLU A 1 61 ? 23.141  4.276   4.907   1.00 0.00 ? 61  GLU A N    2  
ATOM   3053  C CA   . GLU A 1 61 ? 24.401  4.335   4.110   1.00 0.00 ? 61  GLU A CA   2  
ATOM   3054  C C    . GLU A 1 61 ? 24.104  4.069   2.631   1.00 0.00 ? 61  GLU A C    2  
ATOM   3055  O O    . GLU A 1 61 ? 24.522  4.808   1.761   1.00 0.00 ? 61  GLU A O    2  
ATOM   3056  C CB   . GLU A 1 61 ? 25.380  3.281   4.629   1.00 0.00 ? 61  GLU A CB   2  
ATOM   3057  C CG   . GLU A 1 61 ? 26.741  3.470   3.954   1.00 0.00 ? 61  GLU A CG   2  
ATOM   3058  C CD   . GLU A 1 61 ? 27.725  2.425   4.483   1.00 0.00 ? 61  GLU A CD   2  
ATOM   3059  O OE1  . GLU A 1 61 ? 27.658  2.121   5.663   1.00 0.00 ? 61  GLU A OE1  2  
ATOM   3060  O OE2  . GLU A 1 61 ? 28.528  1.946   3.700   1.00 0.00 ? 61  GLU A OE2  2  
ATOM   3061  H H    . GLU A 1 61 ? 23.022  3.574   5.579   1.00 0.00 ? 61  GLU A H    2  
ATOM   3062  H HA   . GLU A 1 61 ? 24.843  5.314   4.213   1.00 0.00 ? 61  GLU A HA   2  
ATOM   3063  H HB2  . GLU A 1 61 ? 25.490  3.386   5.698   1.00 0.00 ? 61  GLU A HB2  2  
ATOM   3064  H HB3  . GLU A 1 61 ? 25.003  2.295   4.401   1.00 0.00 ? 61  GLU A HB3  2  
ATOM   3065  H HG2  . GLU A 1 61 ? 26.632  3.355   2.885   1.00 0.00 ? 61  GLU A HG2  2  
ATOM   3066  H HG3  . GLU A 1 61 ? 27.117  4.458   4.173   1.00 0.00 ? 61  GLU A HG3  2  
ATOM   3067  N N    . TYR A 1 62 ? 23.391  3.017   2.341   1.00 0.00 ? 62  TYR A N    2  
ATOM   3068  C CA   . TYR A 1 62 ? 23.072  2.699   0.918   1.00 0.00 ? 62  TYR A CA   2  
ATOM   3069  C C    . TYR A 1 62 ? 22.251  3.840   0.307   1.00 0.00 ? 62  TYR A C    2  
ATOM   3070  O O    . TYR A 1 62 ? 22.406  4.174   -0.850  1.00 0.00 ? 62  TYR A O    2  
ATOM   3071  C CB   . TYR A 1 62 ? 22.267  1.390   0.848   1.00 0.00 ? 62  TYR A CB   2  
ATOM   3072  C CG   . TYR A 1 62 ? 23.192  0.186   0.914   1.00 0.00 ? 62  TYR A CG   2  
ATOM   3073  C CD1  . TYR A 1 62 ? 24.124  0.052   1.965   1.00 0.00 ? 62  TYR A CD1  2  
ATOM   3074  C CD2  . TYR A 1 62 ? 23.110  -0.813  -0.080  1.00 0.00 ? 62  TYR A CD2  2  
ATOM   3075  C CE1  . TYR A 1 62 ? 24.968  -1.077  2.020   1.00 0.00 ? 62  TYR A CE1  2  
ATOM   3076  C CE2  . TYR A 1 62 ? 23.955  -1.937  -0.024  1.00 0.00 ? 62  TYR A CE2  2  
ATOM   3077  C CZ   . TYR A 1 62 ? 24.883  -2.069  1.025   1.00 0.00 ? 62  TYR A CZ   2  
ATOM   3078  O OH   . TYR A 1 62 ? 25.710  -3.172  1.081   1.00 0.00 ? 62  TYR A OH   2  
ATOM   3079  H H    . TYR A 1 62 ? 23.069  2.434   3.058   1.00 0.00 ? 62  TYR A H    2  
ATOM   3080  H HA   . TYR A 1 62 ? 23.993  2.587   0.363   1.00 0.00 ? 62  TYR A HA   2  
ATOM   3081  H HB2  . TYR A 1 62 ? 21.580  1.354   1.680   1.00 0.00 ? 62  TYR A HB2  2  
ATOM   3082  H HB3  . TYR A 1 62 ? 21.705  1.361   -0.076  1.00 0.00 ? 62  TYR A HB3  2  
ATOM   3083  H HD1  . TYR A 1 62 ? 24.193  0.810   2.727   1.00 0.00 ? 62  TYR A HD1  2  
ATOM   3084  H HD2  . TYR A 1 62 ? 22.399  -0.715  -0.886  1.00 0.00 ? 62  TYR A HD2  2  
ATOM   3085  H HE1  . TYR A 1 62 ? 25.678  -1.182  2.828   1.00 0.00 ? 62  TYR A HE1  2  
ATOM   3086  H HE2  . TYR A 1 62 ? 23.890  -2.698  -0.786  1.00 0.00 ? 62  TYR A HE2  2  
ATOM   3087  H HH   . TYR A 1 62 ? 26.564  -2.886  1.410   1.00 0.00 ? 62  TYR A HH   2  
ATOM   3088  N N    . VAL A 1 63 ? 21.386  4.445   1.073   1.00 0.00 ? 63  VAL A N    2  
ATOM   3089  C CA   . VAL A 1 63 ? 20.574  5.562   0.527   1.00 0.00 ? 63  VAL A CA   2  
ATOM   3090  C C    . VAL A 1 63 ? 21.507  6.715   0.198   1.00 0.00 ? 63  VAL A C    2  
ATOM   3091  O O    . VAL A 1 63 ? 21.369  7.379   -0.808  1.00 0.00 ? 63  VAL A O    2  
ATOM   3092  C CB   . VAL A 1 63 ? 19.547  6.005   1.572   1.00 0.00 ? 63  VAL A CB   2  
ATOM   3093  C CG1  . VAL A 1 63 ? 18.864  7.296   1.114   1.00 0.00 ? 63  VAL A CG1  2  
ATOM   3094  C CG2  . VAL A 1 63 ? 18.493  4.907   1.746   1.00 0.00 ? 63  VAL A CG2  2  
ATOM   3095  H H    . VAL A 1 63 ? 21.281  4.176   2.005   1.00 0.00 ? 63  VAL A H    2  
ATOM   3096  H HA   . VAL A 1 63 ? 20.066  5.238   -0.369  1.00 0.00 ? 63  VAL A HA   2  
ATOM   3097  H HB   . VAL A 1 63 ? 20.048  6.177   2.514   1.00 0.00 ? 63  VAL A HB   2  
ATOM   3098  H HG11 . VAL A 1 63 ? 18.571  7.201   0.079   1.00 0.00 ? 63  VAL A HG11 2  
ATOM   3099  H HG12 . VAL A 1 63 ? 17.989  7.476   1.721   1.00 0.00 ? 63  VAL A HG12 2  
ATOM   3100  H HG13 . VAL A 1 63 ? 19.551  8.123   1.219   1.00 0.00 ? 63  VAL A HG13 2  
ATOM   3101  H HG21 . VAL A 1 63 ? 18.981  3.944   1.800   1.00 0.00 ? 63  VAL A HG21 2  
ATOM   3102  H HG22 . VAL A 1 63 ? 17.939  5.082   2.656   1.00 0.00 ? 63  VAL A HG22 2  
ATOM   3103  H HG23 . VAL A 1 63 ? 17.817  4.920   0.905   1.00 0.00 ? 63  VAL A HG23 2  
ATOM   3104  N N    . TYR A 1 64 ? 22.463  6.953   1.046   1.00 0.00 ? 64  TYR A N    2  
ATOM   3105  C CA   . TYR A 1 64 ? 23.416  8.060   0.797   1.00 0.00 ? 64  TYR A CA   2  
ATOM   3106  C C    . TYR A 1 64 ? 24.182  7.779   -0.493  1.00 0.00 ? 64  TYR A C    2  
ATOM   3107  O O    . TYR A 1 64 ? 24.387  8.650   -1.313  1.00 0.00 ? 64  TYR A O    2  
ATOM   3108  C CB   . TYR A 1 64 ? 24.398  8.151   1.970   1.00 0.00 ? 64  TYR A CB   2  
ATOM   3109  C CG   . TYR A 1 64 ? 25.074  9.504   1.968   1.00 0.00 ? 64  TYR A CG   2  
ATOM   3110  C CD1  . TYR A 1 64 ? 24.357  10.647  2.367   1.00 0.00 ? 64  TYR A CD1  2  
ATOM   3111  C CD2  . TYR A 1 64 ? 26.420  9.620   1.570   1.00 0.00 ? 64  TYR A CD2  2  
ATOM   3112  C CE1  . TYR A 1 64 ? 24.985  11.908  2.368   1.00 0.00 ? 64  TYR A CE1  2  
ATOM   3113  C CE2  . TYR A 1 64 ? 27.048  10.880  1.571   1.00 0.00 ? 64  TYR A CE2  2  
ATOM   3114  C CZ   . TYR A 1 64 ? 26.330  12.024  1.969   1.00 0.00 ? 64  TYR A CZ   2  
ATOM   3115  O OH   . TYR A 1 64 ? 26.946  13.260  1.970   1.00 0.00 ? 64  TYR A OH   2  
ATOM   3116  H H    . TYR A 1 64 ? 22.554  6.399   1.849   1.00 0.00 ? 64  TYR A H    2  
ATOM   3117  H HA   . TYR A 1 64 ? 22.870  8.981   0.704   1.00 0.00 ? 64  TYR A HA   2  
ATOM   3118  H HB2  . TYR A 1 64 ? 23.860  8.017   2.893   1.00 0.00 ? 64  TYR A HB2  2  
ATOM   3119  H HB3  . TYR A 1 64 ? 25.144  7.375   1.878   1.00 0.00 ? 64  TYR A HB3  2  
ATOM   3120  H HD1  . TYR A 1 64 ? 23.325  10.559  2.673   1.00 0.00 ? 64  TYR A HD1  2  
ATOM   3121  H HD2  . TYR A 1 64 ? 26.971  8.743   1.264   1.00 0.00 ? 64  TYR A HD2  2  
ATOM   3122  H HE1  . TYR A 1 64 ? 24.435  12.786  2.673   1.00 0.00 ? 64  TYR A HE1  2  
ATOM   3123  H HE2  . TYR A 1 64 ? 28.080  10.970  1.266   1.00 0.00 ? 64  TYR A HE2  2  
ATOM   3124  H HH   . TYR A 1 64 ? 26.556  13.785  2.672   1.00 0.00 ? 64  TYR A HH   2  
ATOM   3125  N N    . ASP A 1 65 ? 24.605  6.564   -0.669  1.00 0.00 ? 65  ASP A N    2  
ATOM   3126  C CA   . ASP A 1 65 ? 25.364  6.203   -1.899  1.00 0.00 ? 65  ASP A CA   2  
ATOM   3127  C C    . ASP A 1 65 ? 24.485  6.440   -3.130  1.00 0.00 ? 65  ASP A C    2  
ATOM   3128  O O    . ASP A 1 65 ? 24.958  6.823   -4.181  1.00 0.00 ? 65  ASP A O    2  
ATOM   3129  C CB   . ASP A 1 65 ? 25.759  4.724   -1.825  1.00 0.00 ? 65  ASP A CB   2  
ATOM   3130  C CG   . ASP A 1 65 ? 26.983  4.560   -0.918  1.00 0.00 ? 65  ASP A CG   2  
ATOM   3131  O OD1  . ASP A 1 65 ? 26.806  4.568   0.289   1.00 0.00 ? 65  ASP A OD1  2  
ATOM   3132  O OD2  . ASP A 1 65 ? 28.074  4.429   -1.447  1.00 0.00 ? 65  ASP A OD2  2  
ATOM   3133  H H    . ASP A 1 65 ? 24.422  5.883   0.013   1.00 0.00 ? 65  ASP A H    2  
ATOM   3134  H HA   . ASP A 1 65 ? 26.251  6.815   -1.969  1.00 0.00 ? 65  ASP A HA   2  
ATOM   3135  H HB2  . ASP A 1 65 ? 24.935  4.153   -1.422  1.00 0.00 ? 65  ASP A HB2  2  
ATOM   3136  H HB3  . ASP A 1 65 ? 25.995  4.364   -2.812  1.00 0.00 ? 65  ASP A HB3  2  
ATOM   3137  N N    . LEU A 1 66 ? 23.208  6.214   -3.004  1.00 0.00 ? 66  LEU A N    2  
ATOM   3138  C CA   . LEU A 1 66 ? 22.291  6.423   -4.158  1.00 0.00 ? 66  LEU A CA   2  
ATOM   3139  C C    . LEU A 1 66 ? 22.129  7.924   -4.416  1.00 0.00 ? 66  LEU A C    2  
ATOM   3140  O O    . LEU A 1 66 ? 21.927  8.354   -5.534  1.00 0.00 ? 66  LEU A O    2  
ATOM   3141  C CB   . LEU A 1 66 ? 20.930  5.796   -3.828  1.00 0.00 ? 66  LEU A CB   2  
ATOM   3142  C CG   . LEU A 1 66 ? 20.971  4.272   -4.073  1.00 0.00 ? 66  LEU A CG   2  
ATOM   3143  C CD1  . LEU A 1 66 ? 19.867  3.588   -3.264  1.00 0.00 ? 66  LEU A CD1  2  
ATOM   3144  C CD2  . LEU A 1 66 ? 20.746  3.964   -5.562  1.00 0.00 ? 66  LEU A CD2  2  
ATOM   3145  H H    . LEU A 1 66 ? 22.852  5.905   -2.147  1.00 0.00 ? 66  LEU A H    2  
ATOM   3146  H HA   . LEU A 1 66 ? 22.707  5.955   -5.035  1.00 0.00 ? 66  LEU A HA   2  
ATOM   3147  H HB2  . LEU A 1 66 ? 20.701  5.987   -2.788  1.00 0.00 ? 66  LEU A HB2  2  
ATOM   3148  H HB3  . LEU A 1 66 ? 20.169  6.244   -4.444  1.00 0.00 ? 66  LEU A HB3  2  
ATOM   3149  H HG   . LEU A 1 66 ? 21.932  3.882   -3.765  1.00 0.00 ? 66  LEU A HG   2  
ATOM   3150  H HD11 . LEU A 1 66 ? 18.907  3.974   -3.569  1.00 0.00 ? 66  LEU A HD11 2  
ATOM   3151  H HD12 . LEU A 1 66 ? 19.898  2.524   -3.440  1.00 0.00 ? 66  LEU A HD12 2  
ATOM   3152  H HD13 . LEU A 1 66 ? 20.016  3.784   -2.213  1.00 0.00 ? 66  LEU A HD13 2  
ATOM   3153  H HD21 . LEU A 1 66 ? 19.875  4.495   -5.917  1.00 0.00 ? 66  LEU A HD21 2  
ATOM   3154  H HD22 . LEU A 1 66 ? 21.609  4.264   -6.134  1.00 0.00 ? 66  LEU A HD22 2  
ATOM   3155  H HD23 . LEU A 1 66 ? 20.588  2.903   -5.686  1.00 0.00 ? 66  LEU A HD23 2  
ATOM   3156  N N    . GLU A 1 67 ? 22.220  8.722   -3.391  1.00 0.00 ? 67  GLU A N    2  
ATOM   3157  C CA   . GLU A 1 67 ? 22.078  10.195  -3.578  1.00 0.00 ? 67  GLU A CA   2  
ATOM   3158  C C    . GLU A 1 67 ? 23.331  10.735  -4.264  1.00 0.00 ? 67  GLU A C    2  
ATOM   3159  O O    . GLU A 1 67 ? 23.293  11.726  -4.965  1.00 0.00 ? 67  GLU A O    2  
ATOM   3160  C CB   . GLU A 1 67 ? 21.918  10.869  -2.215  1.00 0.00 ? 67  GLU A CB   2  
ATOM   3161  C CG   . GLU A 1 67 ? 20.549  10.524  -1.637  1.00 0.00 ? 67  GLU A CG   2  
ATOM   3162  C CD   . GLU A 1 67 ? 20.304  11.348  -0.372  1.00 0.00 ? 67  GLU A CD   2  
ATOM   3163  O OE1  . GLU A 1 67 ? 21.068  12.267  -0.130  1.00 0.00 ? 67  GLU A OE1  2  
ATOM   3164  O OE2  . GLU A 1 67 ? 19.356  11.045  0.334   1.00 0.00 ? 67  GLU A OE2  2  
ATOM   3165  H H    . GLU A 1 67 ? 22.384  8.354   -2.500  1.00 0.00 ? 67  GLU A H    2  
ATOM   3166  H HA   . GLU A 1 67 ? 21.213  10.401  -4.190  1.00 0.00 ? 67  GLU A HA   2  
ATOM   3167  H HB2  . GLU A 1 67 ? 22.691  10.517  -1.546  1.00 0.00 ? 67  GLU A HB2  2  
ATOM   3168  H HB3  . GLU A 1 67 ? 22.001  11.939  -2.329  1.00 0.00 ? 67  GLU A HB3  2  
ATOM   3169  H HG2  . GLU A 1 67 ? 19.787  10.747  -2.369  1.00 0.00 ? 67  GLU A HG2  2  
ATOM   3170  H HG3  . GLU A 1 67 ? 20.518  9.475   -1.395  1.00 0.00 ? 67  GLU A HG3  2  
ATOM   3171  N N    . LEU A 1 68 ? 24.441  10.084  -4.067  1.00 0.00 ? 68  LEU A N    2  
ATOM   3172  C CA   . LEU A 1 68 ? 25.704  10.549  -4.709  1.00 0.00 ? 68  LEU A CA   2  
ATOM   3173  C C    . LEU A 1 68 ? 25.706  10.140  -6.182  1.00 0.00 ? 68  LEU A C    2  
ATOM   3174  O O    . LEU A 1 68 ? 25.341  10.907  -7.051  1.00 0.00 ? 68  LEU A O    2  
ATOM   3175  C CB   . LEU A 1 68 ? 26.903  9.918   -4.008  1.00 0.00 ? 68  LEU A CB   2  
ATOM   3176  C CG   . LEU A 1 68 ? 26.963  10.386  -2.551  1.00 0.00 ? 68  LEU A CG   2  
ATOM   3177  C CD1  . LEU A 1 68 ? 28.111  9.662   -1.857  1.00 0.00 ? 68  LEU A CD1  2  
ATOM   3178  C CD2  . LEU A 1 68 ? 27.196  11.909  -2.483  1.00 0.00 ? 68  LEU A CD2  2  
ATOM   3179  H H    . LEU A 1 68 ? 24.442  9.286   -3.498  1.00 0.00 ? 68  LEU A H    2  
ATOM   3180  H HA   . LEU A 1 68 ? 25.774  11.619  -4.635  1.00 0.00 ? 68  LEU A HA   2  
ATOM   3181  H HB2  . LEU A 1 68 ? 26.808  8.841   -4.037  1.00 0.00 ? 68  LEU A HB2  2  
ATOM   3182  H HB3  . LEU A 1 68 ? 27.810  10.210  -4.516  1.00 0.00 ? 68  LEU A HB3  2  
ATOM   3183  H HG   . LEU A 1 68 ? 26.035  10.137  -2.057  1.00 0.00 ? 68  LEU A HG   2  
ATOM   3184  H HD11 . LEU A 1 68 ? 28.032  8.603   -2.047  1.00 0.00 ? 68  LEU A HD11 2  
ATOM   3185  H HD12 . LEU A 1 68 ? 29.049  10.030  -2.244  1.00 0.00 ? 68  LEU A HD12 2  
ATOM   3186  H HD13 . LEU A 1 68 ? 28.059  9.846   -0.796  1.00 0.00 ? 68  LEU A HD13 2  
ATOM   3187  H HD21 . LEU A 1 68 ? 27.812  12.225  -3.311  1.00 0.00 ? 68  LEU A HD21 2  
ATOM   3188  H HD22 . LEU A 1 68 ? 26.245  12.421  -2.527  1.00 0.00 ? 68  LEU A HD22 2  
ATOM   3189  H HD23 . LEU A 1 68 ? 27.690  12.164  -1.554  1.00 0.00 ? 68  LEU A HD23 2  
ATOM   3190  N N    . ASN A 1 69 ? 26.118  8.934   -6.470  1.00 0.00 ? 69  ASN A N    2  
ATOM   3191  C CA   . ASN A 1 69 ? 26.148  8.467   -7.887  1.00 0.00 ? 69  ASN A CA   2  
ATOM   3192  C C    . ASN A 1 69 ? 24.799  7.838   -8.245  1.00 0.00 ? 69  ASN A C    2  
ATOM   3193  O O    . ASN A 1 69 ? 23.876  7.980   -7.461  1.00 0.00 ? 69  ASN A O    2  
ATOM   3194  C CB   . ASN A 1 69 ? 27.255  7.424   -8.054  1.00 0.00 ? 69  ASN A CB   2  
ATOM   3195  C CG   . ASN A 1 69 ? 28.607  8.055   -7.716  1.00 0.00 ? 69  ASN A CG   2  
ATOM   3196  O OD1  . ASN A 1 69 ? 28.767  8.650   -6.669  1.00 0.00 ? 69  ASN A OD1  2  
ATOM   3197  N ND2  . ASN A 1 69 ? 29.593  7.950   -8.564  1.00 0.00 ? 69  ASN A ND2  2  
ATOM   3198  O OXT  . ASN A 1 69 ? 24.715  7.224   -9.296  1.00 0.00 ? 69  ASN A OXT  2  
ATOM   3199  H H    . ASN A 1 69 ? 26.408  8.335   -5.754  1.00 0.00 ? 69  ASN A H    2  
ATOM   3200  H HA   . ASN A 1 69 ? 26.340  9.303   -8.542  1.00 0.00 ? 69  ASN A HA   2  
ATOM   3201  H HB2  . ASN A 1 69 ? 27.069  6.592   -7.391  1.00 0.00 ? 69  ASN A HB2  2  
ATOM   3202  H HB3  . ASN A 1 69 ? 27.269  7.074   -9.076  1.00 0.00 ? 69  ASN A HB3  2  
ATOM   3203  H HD21 . ASN A 1 69 ? 29.464  7.469   -9.409  1.00 0.00 ? 69  ASN A HD21 2  
ATOM   3204  H HD22 . ASN A 1 69 ? 30.463  8.351   -8.356  1.00 0.00 ? 69  ASN A HD22 2  
ATOM   3205  N N    . ALA B 1 1  ? 9.141   -15.973 -13.995 1.00 0.00 ? 1   ALA B N    2  
ATOM   3206  C CA   . ALA B 1 1  ? 8.485   -14.810 -13.334 1.00 0.00 ? 1   ALA B CA   2  
ATOM   3207  C C    . ALA B 1 1  ? 8.627   -14.933 -11.810 1.00 0.00 ? 1   ALA B C    2  
ATOM   3208  O O    . ALA B 1 1  ? 7.645   -15.133 -11.123 1.00 0.00 ? 1   ALA B O    2  
ATOM   3209  C CB   . ALA B 1 1  ? 6.999   -14.793 -13.702 1.00 0.00 ? 1   ALA B CB   2  
ATOM   3210  H H1   . ALA B 1 1  ? 9.534   -16.607 -13.271 1.00 0.00 ? 1   ALA B H1   2  
ATOM   3211  H H2   . ALA B 1 1  ? 8.438   -16.489 -14.564 1.00 0.00 ? 1   ALA B H2   2  
ATOM   3212  H H3   . ALA B 1 1  ? 9.907   -15.636 -14.611 1.00 0.00 ? 1   ALA B H3   2  
ATOM   3213  H HA   . ALA B 1 1  ? 8.945   -13.895 -13.671 1.00 0.00 ? 1   ALA B HA   2  
ATOM   3214  H HB1  . ALA B 1 1  ? 6.583   -15.780 -13.560 1.00 0.00 ? 1   ALA B HB1  2  
ATOM   3215  H HB2  . ALA B 1 1  ? 6.480   -14.089 -13.070 1.00 0.00 ? 1   ALA B HB2  2  
ATOM   3216  H HB3  . ALA B 1 1  ? 6.888   -14.500 -14.736 1.00 0.00 ? 1   ALA B HB3  2  
ATOM   3217  N N    . PRO B 1 2  ? 9.842   -14.815 -11.314 1.00 0.00 ? 2   PRO B N    2  
ATOM   3218  C CA   . PRO B 1 2  ? 10.095  -14.920 -9.865  1.00 0.00 ? 2   PRO B CA   2  
ATOM   3219  C C    . PRO B 1 2  ? 9.351   -13.797 -9.125  1.00 0.00 ? 2   PRO B C    2  
ATOM   3220  O O    . PRO B 1 2  ? 9.198   -12.703 -9.629  1.00 0.00 ? 2   PRO B O    2  
ATOM   3221  C CB   . PRO B 1 2  ? 11.631  -14.780 -9.716  1.00 0.00 ? 2   PRO B CB   2  
ATOM   3222  C CG   . PRO B 1 2  ? 12.224  -14.582 -11.142 1.00 0.00 ? 2   PRO B CG   2  
ATOM   3223  C CD   . PRO B 1 2  ? 11.045  -14.572 -12.142 1.00 0.00 ? 2   PRO B CD   2  
ATOM   3224  H HA   . PRO B 1 2  ? 9.772   -15.883 -9.500  1.00 0.00 ? 2   PRO B HA   2  
ATOM   3225  H HB2  . PRO B 1 2  ? 11.873  -13.928 -9.090  1.00 0.00 ? 2   PRO B HB2  2  
ATOM   3226  H HB3  . PRO B 1 2  ? 12.042  -15.679 -9.275  1.00 0.00 ? 2   PRO B HB3  2  
ATOM   3227  H HG2  . PRO B 1 2  ? 12.761  -13.640 -11.190 1.00 0.00 ? 2   PRO B HG2  2  
ATOM   3228  H HG3  . PRO B 1 2  ? 12.898  -15.394 -11.380 1.00 0.00 ? 2   PRO B HG3  2  
ATOM   3229  H HD2  . PRO B 1 2  ? 10.978  -13.611 -12.633 1.00 0.00 ? 2   PRO B HD2  2  
ATOM   3230  H HD3  . PRO B 1 2  ? 11.158  -15.361 -12.872 1.00 0.00 ? 2   PRO B HD3  2  
ATOM   3231  N N    . MET B 1 3  ? 8.889   -14.065 -7.934  1.00 0.00 ? 3   MET B N    2  
ATOM   3232  C CA   . MET B 1 3  ? 8.158   -13.018 -7.164  1.00 0.00 ? 3   MET B CA   2  
ATOM   3233  C C    . MET B 1 3  ? 9.165   -12.054 -6.533  1.00 0.00 ? 3   MET B C    2  
ATOM   3234  O O    . MET B 1 3  ? 10.255  -12.438 -6.158  1.00 0.00 ? 3   MET B O    2  
ATOM   3235  C CB   . MET B 1 3  ? 7.328   -13.681 -6.064  1.00 0.00 ? 3   MET B CB   2  
ATOM   3236  C CG   . MET B 1 3  ? 6.349   -14.678 -6.687  1.00 0.00 ? 3   MET B CG   2  
ATOM   3237  S SD   . MET B 1 3  ? 5.680   -15.755 -5.396  1.00 0.00 ? 3   MET B SD   2  
ATOM   3238  C CE   . MET B 1 3  ? 4.267   -16.385 -6.335  1.00 0.00 ? 3   MET B CE   2  
ATOM   3239  H H    . MET B 1 3  ? 9.023   -14.954 -7.545  1.00 0.00 ? 3   MET B H    2  
ATOM   3240  H HA   . MET B 1 3  ? 7.505   -12.473 -7.829  1.00 0.00 ? 3   MET B HA   2  
ATOM   3241  H HB2  . MET B 1 3  ? 7.985   -14.200 -5.381  1.00 0.00 ? 3   MET B HB2  2  
ATOM   3242  H HB3  . MET B 1 3  ? 6.774   -12.926 -5.526  1.00 0.00 ? 3   MET B HB3  2  
ATOM   3243  H HG2  . MET B 1 3  ? 5.542   -14.140 -7.163  1.00 0.00 ? 3   MET B HG2  2  
ATOM   3244  H HG3  . MET B 1 3  ? 6.865   -15.276 -7.424  1.00 0.00 ? 3   MET B HG3  2  
ATOM   3245  H HE1  . MET B 1 3  ? 4.561   -16.540 -7.364  1.00 0.00 ? 3   MET B HE1  2  
ATOM   3246  H HE2  . MET B 1 3  ? 3.938   -17.320 -5.903  1.00 0.00 ? 3   MET B HE2  2  
ATOM   3247  H HE3  . MET B 1 3  ? 3.461   -15.670 -6.297  1.00 0.00 ? 3   MET B HE3  2  
ATOM   3248  N N    . GLY B 1 4  ? 8.808   -10.805 -6.409  1.00 0.00 ? 4   GLY B N    2  
ATOM   3249  C CA   . GLY B 1 4  ? 9.745   -9.819  -5.800  1.00 0.00 ? 4   GLY B CA   2  
ATOM   3250  C C    . GLY B 1 4  ? 10.214  -10.334 -4.439  1.00 0.00 ? 4   GLY B C    2  
ATOM   3251  O O    . GLY B 1 4  ? 9.886   -11.433 -4.035  1.00 0.00 ? 4   GLY B O    2  
ATOM   3252  H H    . GLY B 1 4  ? 7.923   -10.516 -6.717  1.00 0.00 ? 4   GLY B H    2  
ATOM   3253  H HA2  . GLY B 1 4  ? 10.598  -9.684  -6.450  1.00 0.00 ? 4   GLY B HA2  2  
ATOM   3254  H HA3  . GLY B 1 4  ? 9.240   -8.876  -5.668  1.00 0.00 ? 4   GLY B HA3  2  
ATOM   3255  N N    . SER B 1 5  ? 10.986  -9.555  -3.726  1.00 0.00 ? 5   SER B N    2  
ATOM   3256  C CA   . SER B 1 5  ? 11.479  -10.006 -2.392  1.00 0.00 ? 5   SER B CA   2  
ATOM   3257  C C    . SER B 1 5  ? 10.450  -9.639  -1.309  1.00 0.00 ? 5   SER B C    2  
ATOM   3258  O O    . SER B 1 5  ? 9.852   -10.500 -0.693  1.00 0.00 ? 5   SER B O    2  
ATOM   3259  C CB   . SER B 1 5  ? 12.839  -9.347  -2.102  1.00 0.00 ? 5   SER B CB   2  
ATOM   3260  O OG   . SER B 1 5  ? 13.796  -10.363 -1.827  1.00 0.00 ? 5   SER B OG   2  
ATOM   3261  H H    . SER B 1 5  ? 11.242  -8.673  -4.071  1.00 0.00 ? 5   SER B H    2  
ATOM   3262  H HA   . SER B 1 5  ? 11.606  -11.077 -2.406  1.00 0.00 ? 5   SER B HA   2  
ATOM   3263  H HB2  . SER B 1 5  ? 13.160  -8.791  -2.966  1.00 0.00 ? 5   SER B HB2  2  
ATOM   3264  H HB3  . SER B 1 5  ? 12.762  -8.676  -1.256  1.00 0.00 ? 5   SER B HB3  2  
ATOM   3265  H HG   . SER B 1 5  ? 14.661  -10.029 -2.075  1.00 0.00 ? 5   SER B HG   2  
ATOM   3266  N N    . ASP B 1 6  ? 10.242  -8.371  -1.070  1.00 0.00 ? 6   ASP B N    2  
ATOM   3267  C CA   . ASP B 1 6  ? 9.254   -7.955  -0.026  1.00 0.00 ? 6   ASP B CA   2  
ATOM   3268  C C    . ASP B 1 6  ? 8.769   -6.524  -0.310  1.00 0.00 ? 6   ASP B C    2  
ATOM   3269  O O    . ASP B 1 6  ? 9.102   -5.614  0.424   1.00 0.00 ? 6   ASP B O    2  
ATOM   3270  C CB   . ASP B 1 6  ? 9.919   -7.987  1.357   1.00 0.00 ? 6   ASP B CB   2  
ATOM   3271  C CG   . ASP B 1 6  ? 10.691  -9.297  1.527   1.00 0.00 ? 6   ASP B CG   2  
ATOM   3272  O OD1  . ASP B 1 6  ? 10.071  -10.286 1.882   1.00 0.00 ? 6   ASP B OD1  2  
ATOM   3273  O OD2  . ASP B 1 6  ? 11.890  -9.290  1.300   1.00 0.00 ? 6   ASP B OD2  2  
ATOM   3274  H H    . ASP B 1 6  ? 10.736  -7.692  -1.577  1.00 0.00 ? 6   ASP B H    2  
ATOM   3275  H HA   . ASP B 1 6  ? 8.413   -8.631  -0.032  1.00 0.00 ? 6   ASP B HA   2  
ATOM   3276  H HB2  . ASP B 1 6  ? 10.599  -7.153  1.449   1.00 0.00 ? 6   ASP B HB2  2  
ATOM   3277  H HB3  . ASP B 1 6  ? 9.160   -7.918  2.122   1.00 0.00 ? 6   ASP B HB3  2  
ATOM   3278  N N    . PRO B 1 7  ? 8.000   -6.356  -1.364  1.00 0.00 ? 7   PRO B N    2  
ATOM   3279  C CA   . PRO B 1 7  ? 7.481   -5.024  -1.735  1.00 0.00 ? 7   PRO B CA   2  
ATOM   3280  C C    . PRO B 1 7  ? 6.515   -4.514  -0.642  1.00 0.00 ? 7   PRO B C    2  
ATOM   3281  O O    . PRO B 1 7  ? 6.110   -5.275  0.214   1.00 0.00 ? 7   PRO B O    2  
ATOM   3282  C CB   . PRO B 1 7  ? 6.748   -5.247  -3.081  1.00 0.00 ? 7   PRO B CB   2  
ATOM   3283  C CG   . PRO B 1 7  ? 6.829   -6.767  -3.415  1.00 0.00 ? 7   PRO B CG   2  
ATOM   3284  C CD   . PRO B 1 7  ? 7.597   -7.456  -2.265  1.00 0.00 ? 7   PRO B CD   2  
ATOM   3285  H HA   . PRO B 1 7  ? 8.301   -4.338  -1.866  1.00 0.00 ? 7   PRO B HA   2  
ATOM   3286  H HB2  . PRO B 1 7  ? 5.711   -4.939  -3.001  1.00 0.00 ? 7   PRO B HB2  2  
ATOM   3287  H HB3  . PRO B 1 7  ? 7.232   -4.678  -3.864  1.00 0.00 ? 7   PRO B HB3  2  
ATOM   3288  H HG2  . PRO B 1 7  ? 5.830   -7.180  -3.496  1.00 0.00 ? 7   PRO B HG2  2  
ATOM   3289  H HG3  . PRO B 1 7  ? 7.358   -6.915  -4.347  1.00 0.00 ? 7   PRO B HG3  2  
ATOM   3290  H HD2  . PRO B 1 7  ? 6.950   -8.151  -1.745  1.00 0.00 ? 7   PRO B HD2  2  
ATOM   3291  H HD3  . PRO B 1 7  ? 8.471   -7.967  -2.641  1.00 0.00 ? 7   PRO B HD3  2  
ATOM   3292  N N    . PRO B 1 8  ? 6.165   -3.243  -0.703  1.00 0.00 ? 8   PRO B N    2  
ATOM   3293  C CA   . PRO B 1 8  ? 5.240   -2.642  0.282   1.00 0.00 ? 8   PRO B CA   2  
ATOM   3294  C C    . PRO B 1 8  ? 3.880   -3.358  0.235   1.00 0.00 ? 8   PRO B C    2  
ATOM   3295  O O    . PRO B 1 8  ? 3.771   -4.475  -0.231  1.00 0.00 ? 8   PRO B O    2  
ATOM   3296  C CB   . PRO B 1 8  ? 5.110   -1.160  -0.147  1.00 0.00 ? 8   PRO B CB   2  
ATOM   3297  C CG   . PRO B 1 8  ? 5.895   -0.991  -1.481  1.00 0.00 ? 8   PRO B CG   2  
ATOM   3298  C CD   . PRO B 1 8  ? 6.656   -2.309  -1.741  1.00 0.00 ? 8   PRO B CD   2  
ATOM   3299  H HA   . PRO B 1 8  ? 5.661   -2.706  1.273   1.00 0.00 ? 8   PRO B HA   2  
ATOM   3300  H HB2  . PRO B 1 8  ? 4.068   -0.897  -0.292  1.00 0.00 ? 8   PRO B HB2  2  
ATOM   3301  H HB3  . PRO B 1 8  ? 5.541   -0.517  0.609   1.00 0.00 ? 8   PRO B HB3  2  
ATOM   3302  H HG2  . PRO B 1 8  ? 5.202   -0.795  -2.292  1.00 0.00 ? 8   PRO B HG2  2  
ATOM   3303  H HG3  . PRO B 1 8  ? 6.597   -0.171  -1.398  1.00 0.00 ? 8   PRO B HG3  2  
ATOM   3304  H HD2  . PRO B 1 8  ? 6.433   -2.688  -2.730  1.00 0.00 ? 8   PRO B HD2  2  
ATOM   3305  H HD3  . PRO B 1 8  ? 7.718   -2.154  -1.626  1.00 0.00 ? 8   PRO B HD3  2  
ATOM   3306  N N    . THR B 1 9  ? 2.846   -2.716  0.713   1.00 0.00 ? 9   THR B N    2  
ATOM   3307  C CA   . THR B 1 9  ? 1.494   -3.351  0.699   1.00 0.00 ? 9   THR B CA   2  
ATOM   3308  C C    . THR B 1 9  ? 0.417   -2.267  0.712   1.00 0.00 ? 9   THR B C    2  
ATOM   3309  O O    . THR B 1 9  ? 0.427   -1.373  1.536   1.00 0.00 ? 9   THR B O    2  
ATOM   3310  C CB   . THR B 1 9  ? 1.334   -4.238  1.933   1.00 0.00 ? 9   THR B CB   2  
ATOM   3311  O OG1  . THR B 1 9  ? 2.503   -5.029  2.101   1.00 0.00 ? 9   THR B OG1  2  
ATOM   3312  C CG2  . THR B 1 9  ? 0.118   -5.151  1.755   1.00 0.00 ? 9   THR B CG2  2  
ATOM   3313  H H    . THR B 1 9  ? 2.958   -1.815  1.084   1.00 0.00 ? 9   THR B H    2  
ATOM   3314  H HA   . THR B 1 9  ? 1.383   -3.949  -0.194  1.00 0.00 ? 9   THR B HA   2  
ATOM   3315  H HB   . THR B 1 9  ? 1.189   -3.618  2.804   1.00 0.00 ? 9   THR B HB   2  
ATOM   3316  H HG1  . THR B 1 9  ? 2.825   -5.271  1.230   1.00 0.00 ? 9   THR B HG1  2  
ATOM   3317  H HG21 . THR B 1 9  ? -0.762  -4.549  1.585   1.00 0.00 ? 9   THR B HG21 2  
ATOM   3318  H HG22 . THR B 1 9  ? 0.277   -5.803  0.909   1.00 0.00 ? 9   THR B HG22 2  
ATOM   3319  H HG23 . THR B 1 9  ? -0.019  -5.745  2.646   1.00 0.00 ? 9   THR B HG23 2  
ATOM   3320  N N    . ALA B 1 10 ? -0.513  -2.343  -0.197  1.00 0.00 ? 10  ALA B N    2  
ATOM   3321  C CA   . ALA B 1 10 ? -1.598  -1.326  -0.249  1.00 0.00 ? 10  ALA B CA   2  
ATOM   3322  C C    . ALA B 1 10 ? -2.523  -1.492  0.957   1.00 0.00 ? 10  ALA B C    2  
ATOM   3323  O O    . ALA B 1 10 ? -3.575  -2.093  0.863   1.00 0.00 ? 10  ALA B O    2  
ATOM   3324  C CB   . ALA B 1 10 ? -2.403  -1.521  -1.533  1.00 0.00 ? 10  ALA B CB   2  
ATOM   3325  H H    . ALA B 1 10 ? -0.498  -3.075  -0.849  1.00 0.00 ? 10  ALA B H    2  
ATOM   3326  H HA   . ALA B 1 10 ? -1.168  -0.335  -0.239  1.00 0.00 ? 10  ALA B HA   2  
ATOM   3327  H HB1  . ALA B 1 10 ? -2.643  -2.568  -1.649  1.00 0.00 ? 10  ALA B HB1  2  
ATOM   3328  H HB2  . ALA B 1 10 ? -3.315  -0.947  -1.476  1.00 0.00 ? 10  ALA B HB2  2  
ATOM   3329  H HB3  . ALA B 1 10 ? -1.817  -1.190  -2.377  1.00 0.00 ? 10  ALA B HB3  2  
ATOM   3330  N N    . CYS B 1 11 ? -2.144  -0.951  2.088   1.00 0.00 ? 11  CYS B N    2  
ATOM   3331  C CA   . CYS B 1 11 ? -2.997  -1.057  3.313   1.00 0.00 ? 11  CYS B CA   2  
ATOM   3332  C C    . CYS B 1 11 ? -3.594  0.320   3.614   1.00 0.00 ? 11  CYS B C    2  
ATOM   3333  O O    . CYS B 1 11 ? -2.923  1.329   3.522   1.00 0.00 ? 11  CYS B O    2  
ATOM   3334  C CB   . CYS B 1 11 ? -2.138  -1.511  4.497   1.00 0.00 ? 11  CYS B CB   2  
ATOM   3335  S SG   . CYS B 1 11 ? -1.294  -3.058  4.074   1.00 0.00 ? 11  CYS B SG   2  
ATOM   3336  H H    . CYS B 1 11 ? -1.293  -0.465  2.131   1.00 0.00 ? 11  CYS B H    2  
ATOM   3337  H HA   . CYS B 1 11 ? -3.797  -1.768  3.156   1.00 0.00 ? 11  CYS B HA   2  
ATOM   3338  H HB2  . CYS B 1 11 ? -1.404  -0.751  4.721   1.00 0.00 ? 11  CYS B HB2  2  
ATOM   3339  H HB3  . CYS B 1 11 ? -2.768  -1.669  5.359   1.00 0.00 ? 11  CYS B HB3  2  
ATOM   3340  N N    . CYS B 1 12 ? -4.851  0.374   3.961   1.00 0.00 ? 12  CYS B N    2  
ATOM   3341  C CA   . CYS B 1 12 ? -5.483  1.691   4.256   1.00 0.00 ? 12  CYS B CA   2  
ATOM   3342  C C    . CYS B 1 12 ? -4.952  2.229   5.585   1.00 0.00 ? 12  CYS B C    2  
ATOM   3343  O O    . CYS B 1 12 ? -4.704  1.485   6.513   1.00 0.00 ? 12  CYS B O    2  
ATOM   3344  C CB   . CYS B 1 12 ? -7.003  1.526   4.343   1.00 0.00 ? 12  CYS B CB   2  
ATOM   3345  S SG   . CYS B 1 12 ? -7.657  1.059   2.720   1.00 0.00 ? 12  CYS B SG   2  
ATOM   3346  H H    . CYS B 1 12 ? -5.380  -0.449  4.022   1.00 0.00 ? 12  CYS B H    2  
ATOM   3347  H HA   . CYS B 1 12 ? -5.243  2.388   3.467   1.00 0.00 ? 12  CYS B HA   2  
ATOM   3348  H HB2  . CYS B 1 12 ? -7.241  0.756   5.062   1.00 0.00 ? 12  CYS B HB2  2  
ATOM   3349  H HB3  . CYS B 1 12 ? -7.449  2.459   4.656   1.00 0.00 ? 12  CYS B HB3  2  
ATOM   3350  N N    . PHE B 1 13 ? -4.780  3.523   5.683   1.00 0.00 ? 13  PHE B N    2  
ATOM   3351  C CA   . PHE B 1 13 ? -4.271  4.134   6.950   1.00 0.00 ? 13  PHE B CA   2  
ATOM   3352  C C    . PHE B 1 13 ? -5.444  4.769   7.696   1.00 0.00 ? 13  PHE B C    2  
ATOM   3353  O O    . PHE B 1 13 ? -5.373  5.043   8.877   1.00 0.00 ? 13  PHE B O    2  
ATOM   3354  C CB   . PHE B 1 13 ? -3.242  5.215   6.612   1.00 0.00 ? 13  PHE B CB   2  
ATOM   3355  C CG   . PHE B 1 13 ? -3.918  6.328   5.850   1.00 0.00 ? 13  PHE B CG   2  
ATOM   3356  C CD1  . PHE B 1 13 ? -4.203  6.170   4.481   1.00 0.00 ? 13  PHE B CD1  2  
ATOM   3357  C CD2  . PHE B 1 13 ? -4.268  7.522   6.510   1.00 0.00 ? 13  PHE B CD2  2  
ATOM   3358  C CE1  . PHE B 1 13 ? -4.838  7.206   3.771   1.00 0.00 ? 13  PHE B CE1  2  
ATOM   3359  C CE2  . PHE B 1 13 ? -4.902  8.558   5.800   1.00 0.00 ? 13  PHE B CE2  2  
ATOM   3360  C CZ   . PHE B 1 13 ? -5.188  8.400   4.429   1.00 0.00 ? 13  PHE B CZ   2  
ATOM   3361  H H    . PHE B 1 13 ? -4.992  4.100   4.919   1.00 0.00 ? 13  PHE B H    2  
ATOM   3362  H HA   . PHE B 1 13 ? -3.810  3.379   7.570   1.00 0.00 ? 13  PHE B HA   2  
ATOM   3363  H HB2  . PHE B 1 13 ? -2.819  5.607   7.527   1.00 0.00 ? 13  PHE B HB2  2  
ATOM   3364  H HB3  . PHE B 1 13 ? -2.457  4.789   6.006   1.00 0.00 ? 13  PHE B HB3  2  
ATOM   3365  H HD1  . PHE B 1 13 ? -3.936  5.254   3.976   1.00 0.00 ? 13  PHE B HD1  2  
ATOM   3366  H HD2  . PHE B 1 13 ? -4.048  7.643   7.560   1.00 0.00 ? 13  PHE B HD2  2  
ATOM   3367  H HE1  . PHE B 1 13 ? -5.056  7.084   2.721   1.00 0.00 ? 13  PHE B HE1  2  
ATOM   3368  H HE2  . PHE B 1 13 ? -5.171  9.474   6.306   1.00 0.00 ? 13  PHE B HE2  2  
ATOM   3369  H HZ   . PHE B 1 13 ? -5.675  9.195   3.884   1.00 0.00 ? 13  PHE B HZ   2  
ATOM   3370  N N    . SER B 1 14 ? -6.525  5.003   7.005   1.00 0.00 ? 14  SER B N    2  
ATOM   3371  C CA   . SER B 1 14 ? -7.718  5.618   7.649   1.00 0.00 ? 14  SER B CA   2  
ATOM   3372  C C    . SER B 1 14 ? -8.961  5.246   6.842   1.00 0.00 ? 14  SER B C    2  
ATOM   3373  O O    . SER B 1 14 ? -8.994  4.232   6.173   1.00 0.00 ? 14  SER B O    2  
ATOM   3374  C CB   . SER B 1 14 ? -7.559  7.139   7.673   1.00 0.00 ? 14  SER B CB   2  
ATOM   3375  O OG   . SER B 1 14 ? -7.661  7.642   6.347   1.00 0.00 ? 14  SER B OG   2  
ATOM   3376  H H    . SER B 1 14 ? -6.553  4.770   6.053   1.00 0.00 ? 14  SER B H    2  
ATOM   3377  H HA   . SER B 1 14 ? -7.818  5.248   8.660   1.00 0.00 ? 14  SER B HA   2  
ATOM   3378  H HB2  . SER B 1 14 ? -8.337  7.575   8.278   1.00 0.00 ? 14  SER B HB2  2  
ATOM   3379  H HB3  . SER B 1 14 ? -6.594  7.393   8.093   1.00 0.00 ? 14  SER B HB3  2  
ATOM   3380  H HG   . SER B 1 14 ? -7.771  6.896   5.754   1.00 0.00 ? 14  SER B HG   2  
ATOM   3381  N N    . TYR B 1 15 ? -9.988  6.050   6.896   1.00 0.00 ? 15  TYR B N    2  
ATOM   3382  C CA   . TYR B 1 15 ? -11.228 5.729   6.128   1.00 0.00 ? 15  TYR B CA   2  
ATOM   3383  C C    . TYR B 1 15 ? -11.987 7.022   5.827   1.00 0.00 ? 15  TYR B C    2  
ATOM   3384  O O    . TYR B 1 15 ? -11.836 8.014   6.513   1.00 0.00 ? 15  TYR B O    2  
ATOM   3385  C CB   . TYR B 1 15 ? -12.118 4.795   6.960   1.00 0.00 ? 15  TYR B CB   2  
ATOM   3386  C CG   . TYR B 1 15 ? -11.259 3.780   7.676   1.00 0.00 ? 15  TYR B CG   2  
ATOM   3387  C CD1  . TYR B 1 15 ? -10.930 2.564   7.047   1.00 0.00 ? 15  TYR B CD1  2  
ATOM   3388  C CD2  . TYR B 1 15 ? -10.782 4.053   8.973   1.00 0.00 ? 15  TYR B CD2  2  
ATOM   3389  C CE1  . TYR B 1 15 ? -10.126 1.621   7.717   1.00 0.00 ? 15  TYR B CE1  2  
ATOM   3390  C CE2  . TYR B 1 15 ? -9.977  3.111   9.641   1.00 0.00 ? 15  TYR B CE2  2  
ATOM   3391  C CZ   . TYR B 1 15 ? -9.650  1.895   9.014   1.00 0.00 ? 15  TYR B CZ   2  
ATOM   3392  O OH   . TYR B 1 15 ? -8.861  0.971   9.669   1.00 0.00 ? 15  TYR B OH   2  
ATOM   3393  H H    . TYR B 1 15 ? -9.947  6.863   7.443   1.00 0.00 ? 15  TYR B H    2  
ATOM   3394  H HA   . TYR B 1 15 ? -10.964 5.245   5.197   1.00 0.00 ? 15  TYR B HA   2  
ATOM   3395  H HB2  . TYR B 1 15 ? -12.670 5.371   7.689   1.00 0.00 ? 15  TYR B HB2  2  
ATOM   3396  H HB3  . TYR B 1 15 ? -12.808 4.283   6.309   1.00 0.00 ? 15  TYR B HB3  2  
ATOM   3397  H HD1  . TYR B 1 15 ? -11.295 2.354   6.053   1.00 0.00 ? 15  TYR B HD1  2  
ATOM   3398  H HD2  . TYR B 1 15 ? -11.034 4.987   9.455   1.00 0.00 ? 15  TYR B HD2  2  
ATOM   3399  H HE1  . TYR B 1 15 ? -9.874  0.690   7.237   1.00 0.00 ? 15  TYR B HE1  2  
ATOM   3400  H HE2  . TYR B 1 15 ? -9.612  3.321   10.636  1.00 0.00 ? 15  TYR B HE2  2  
ATOM   3401  H HH   . TYR B 1 15 ? -8.018  0.923   9.211   1.00 0.00 ? 15  TYR B HH   2  
ATOM   3402  N N    . THR B 1 16 ? -12.806 7.021   4.811   1.00 0.00 ? 16  THR B N    2  
ATOM   3403  C CA   . THR B 1 16 ? -13.573 8.254   4.484   1.00 0.00 ? 16  THR B CA   2  
ATOM   3404  C C    . THR B 1 16 ? -14.415 8.647   5.701   1.00 0.00 ? 16  THR B C    2  
ATOM   3405  O O    . THR B 1 16 ? -14.177 8.187   6.801   1.00 0.00 ? 16  THR B O    2  
ATOM   3406  C CB   . THR B 1 16 ? -14.473 7.998   3.267   1.00 0.00 ? 16  THR B CB   2  
ATOM   3407  O OG1  . THR B 1 16 ? -15.292 9.134   3.033   1.00 0.00 ? 16  THR B OG1  2  
ATOM   3408  C CG2  . THR B 1 16 ? -15.355 6.774   3.514   1.00 0.00 ? 16  THR B CG2  2  
ATOM   3409  H H    . THR B 1 16 ? -12.921 6.208   4.272   1.00 0.00 ? 16  THR B H    2  
ATOM   3410  H HA   . THR B 1 16 ? -12.882 9.054   4.258   1.00 0.00 ? 16  THR B HA   2  
ATOM   3411  H HB   . THR B 1 16 ? -13.856 7.819   2.400   1.00 0.00 ? 16  THR B HB   2  
ATOM   3412  H HG1  . THR B 1 16 ? -14.739 9.828   2.668   1.00 0.00 ? 16  THR B HG1  2  
ATOM   3413  H HG21 . THR B 1 16 ? -15.953 6.934   4.397   1.00 0.00 ? 16  THR B HG21 2  
ATOM   3414  H HG22 . THR B 1 16 ? -16.003 6.621   2.663   1.00 0.00 ? 16  THR B HG22 2  
ATOM   3415  H HG23 . THR B 1 16 ? -14.731 5.904   3.652   1.00 0.00 ? 16  THR B HG23 2  
ATOM   3416  N N    . ALA B 1 17 ? -15.394 9.495   5.524   1.00 0.00 ? 17  ALA B N    2  
ATOM   3417  C CA   . ALA B 1 17 ? -16.244 9.917   6.679   1.00 0.00 ? 17  ALA B CA   2  
ATOM   3418  C C    . ALA B 1 17 ? -17.687 10.085  6.203   1.00 0.00 ? 17  ALA B C    2  
ATOM   3419  O O    . ALA B 1 17 ? -18.528 10.614  6.903   1.00 0.00 ? 17  ALA B O    2  
ATOM   3420  C CB   . ALA B 1 17 ? -15.722 11.248  7.230   1.00 0.00 ? 17  ALA B CB   2  
ATOM   3421  H H    . ALA B 1 17 ? -15.569 9.860   4.633   1.00 0.00 ? 17  ALA B H    2  
ATOM   3422  H HA   . ALA B 1 17 ? -16.210 9.167   7.458   1.00 0.00 ? 17  ALA B HA   2  
ATOM   3423  H HB1  . ALA B 1 17 ? -15.452 11.896  6.408   1.00 0.00 ? 17  ALA B HB1  2  
ATOM   3424  H HB2  . ALA B 1 17 ? -16.489 11.721  7.825   1.00 0.00 ? 17  ALA B HB2  2  
ATOM   3425  H HB3  . ALA B 1 17 ? -14.852 11.066  7.843   1.00 0.00 ? 17  ALA B HB3  2  
ATOM   3426  N N    . ARG B 1 18 ? -17.978 9.628   5.014   1.00 0.00 ? 18  ARG B N    2  
ATOM   3427  C CA   . ARG B 1 18 ? -19.366 9.743   4.471   1.00 0.00 ? 18  ARG B CA   2  
ATOM   3428  C C    . ARG B 1 18 ? -19.715 8.449   3.733   1.00 0.00 ? 18  ARG B C    2  
ATOM   3429  O O    . ARG B 1 18 ? -18.991 8.008   2.863   1.00 0.00 ? 18  ARG B O    2  
ATOM   3430  C CB   . ARG B 1 18 ? -19.445 10.915  3.481   1.00 0.00 ? 18  ARG B CB   2  
ATOM   3431  C CG   . ARG B 1 18 ? -19.360 12.267  4.226   1.00 0.00 ? 18  ARG B CG   2  
ATOM   3432  C CD   . ARG B 1 18 ? -17.886 12.678  4.457   1.00 0.00 ? 18  ARG B CD   2  
ATOM   3433  N NE   . ARG B 1 18 ? -17.713 13.189  5.856   1.00 0.00 ? 18  ARG B NE   2  
ATOM   3434  C CZ   . ARG B 1 18 ? -18.542 14.063  6.369   1.00 0.00 ? 18  ARG B CZ   2  
ATOM   3435  N NH1  . ARG B 1 18 ? -19.477 14.598  5.635   1.00 0.00 ? 18  ARG B NH1  2  
ATOM   3436  N NH2  . ARG B 1 18 ? -18.410 14.425  7.616   1.00 0.00 ? 18  ARG B NH2  2  
ATOM   3437  H H    . ARG B 1 18 ? -17.280 9.202   4.474   1.00 0.00 ? 18  ARG B H    2  
ATOM   3438  H HA   . ARG B 1 18 ? -20.071 9.894   5.276   1.00 0.00 ? 18  ARG B HA   2  
ATOM   3439  H HB2  . ARG B 1 18 ? -18.633 10.840  2.772   1.00 0.00 ? 18  ARG B HB2  2  
ATOM   3440  H HB3  . ARG B 1 18 ? -20.383 10.861  2.949   1.00 0.00 ? 18  ARG B HB3  2  
ATOM   3441  H HG2  . ARG B 1 18 ? -19.855 13.021  3.629   1.00 0.00 ? 18  ARG B HG2  2  
ATOM   3442  H HG3  . ARG B 1 18 ? -19.863 12.187  5.178   1.00 0.00 ? 18  ARG B HG3  2  
ATOM   3443  H HD2  . ARG B 1 18 ? -17.239 11.826  4.336   1.00 0.00 ? 18  ARG B HD2  2  
ATOM   3444  H HD3  . ARG B 1 18 ? -17.603 13.439  3.735   1.00 0.00 ? 18  ARG B HD3  2  
ATOM   3445  H HE   . ARG B 1 18 ? -16.983 12.841  6.408   1.00 0.00 ? 18  ARG B HE   2  
ATOM   3446  H HH11 . ARG B 1 18 ? -19.564 14.347  4.674   1.00 0.00 ? 18  ARG B HH11 2  
ATOM   3447  H HH12 . ARG B 1 18 ? -20.109 15.261  6.035   1.00 0.00 ? 18  ARG B HH12 2  
ATOM   3448  H HH21 . ARG B 1 18 ? -17.679 14.037  8.175   1.00 0.00 ? 18  ARG B HH21 2  
ATOM   3449  H HH22 . ARG B 1 18 ? -19.043 15.092  8.011   1.00 0.00 ? 18  ARG B HH22 2  
ATOM   3450  N N    . LYS B 1 19 ? -20.819 7.840   4.067   1.00 0.00 ? 19  LYS B N    2  
ATOM   3451  C CA   . LYS B 1 19 ? -21.204 6.582   3.374   1.00 0.00 ? 19  LYS B CA   2  
ATOM   3452  C C    . LYS B 1 19 ? -21.440 6.887   1.891   1.00 0.00 ? 19  LYS B C    2  
ATOM   3453  O O    . LYS B 1 19 ? -22.160 7.800   1.539   1.00 0.00 ? 19  LYS B O    2  
ATOM   3454  C CB   . LYS B 1 19 ? -22.482 6.011   4.016   1.00 0.00 ? 19  LYS B CB   2  
ATOM   3455  C CG   . LYS B 1 19 ? -23.181 5.042   3.050   1.00 0.00 ? 19  LYS B CG   2  
ATOM   3456  C CD   . LYS B 1 19 ? -24.204 4.196   3.810   1.00 0.00 ? 19  LYS B CD   2  
ATOM   3457  C CE   . LYS B 1 19 ? -25.325 5.081   4.354   1.00 0.00 ? 19  LYS B CE   2  
ATOM   3458  N NZ   . LYS B 1 19 ? -25.808 6.001   3.284   1.00 0.00 ? 19  LYS B NZ   2  
ATOM   3459  H H    . LYS B 1 19 ? -21.393 8.212   4.768   1.00 0.00 ? 19  LYS B H    2  
ATOM   3460  H HA   . LYS B 1 19 ? -20.403 5.862   3.467   1.00 0.00 ? 19  LYS B HA   2  
ATOM   3461  H HB2  . LYS B 1 19 ? -22.218 5.484   4.922   1.00 0.00 ? 19  LYS B HB2  2  
ATOM   3462  H HB3  . LYS B 1 19 ? -23.150 6.820   4.260   1.00 0.00 ? 19  LYS B HB3  2  
ATOM   3463  H HG2  . LYS B 1 19 ? -23.680 5.604   2.275   1.00 0.00 ? 19  LYS B HG2  2  
ATOM   3464  H HG3  . LYS B 1 19 ? -22.444 4.393   2.602   1.00 0.00 ? 19  LYS B HG3  2  
ATOM   3465  H HD2  . LYS B 1 19 ? -24.622 3.456   3.145   1.00 0.00 ? 19  LYS B HD2  2  
ATOM   3466  H HD3  . LYS B 1 19 ? -23.714 3.702   4.630   1.00 0.00 ? 19  LYS B HD3  2  
ATOM   3467  H HE2  . LYS B 1 19 ? -26.141 4.457   4.686   1.00 0.00 ? 19  LYS B HE2  2  
ATOM   3468  H HE3  . LYS B 1 19 ? -24.954 5.659   5.186   1.00 0.00 ? 19  LYS B HE3  2  
ATOM   3469  H HZ1  . LYS B 1 19 ? -25.940 5.468   2.402   1.00 0.00 ? 19  LYS B HZ1  2  
ATOM   3470  H HZ2  . LYS B 1 19 ? -26.714 6.422   3.571   1.00 0.00 ? 19  LYS B HZ2  2  
ATOM   3471  H HZ3  . LYS B 1 19 ? -25.107 6.755   3.134   1.00 0.00 ? 19  LYS B HZ3  2  
ATOM   3472  N N    . LEU B 1 20 ? -20.836 6.126   1.023   1.00 0.00 ? 20  LEU B N    2  
ATOM   3473  C CA   . LEU B 1 20 ? -21.019 6.364   -0.433  1.00 0.00 ? 20  LEU B CA   2  
ATOM   3474  C C    . LEU B 1 20 ? -22.425 5.880   -0.858  1.00 0.00 ? 20  LEU B C    2  
ATOM   3475  O O    . LEU B 1 20 ? -22.728 4.719   -0.664  1.00 0.00 ? 20  LEU B O    2  
ATOM   3476  C CB   . LEU B 1 20 ? -19.976 5.551   -1.199  1.00 0.00 ? 20  LEU B CB   2  
ATOM   3477  C CG   . LEU B 1 20 ? -18.595 5.730   -0.567  1.00 0.00 ? 20  LEU B CG   2  
ATOM   3478  C CD1  . LEU B 1 20 ? -17.550 5.055   -1.453  1.00 0.00 ? 20  LEU B CD1  2  
ATOM   3479  C CD2  . LEU B 1 20 ? -18.268 7.223   -0.441  1.00 0.00 ? 20  LEU B CD2  2  
ATOM   3480  H H    . LEU B 1 20 ? -20.261 5.395   1.331   1.00 0.00 ? 20  LEU B H    2  
ATOM   3481  H HA   . LEU B 1 20 ? -20.879 7.406   -0.640  1.00 0.00 ? 20  LEU B HA   2  
ATOM   3482  H HB2  . LEU B 1 20 ? -20.246 4.505   -1.168  1.00 0.00 ? 20  LEU B HB2  2  
ATOM   3483  H HB3  . LEU B 1 20 ? -19.946 5.880   -2.225  1.00 0.00 ? 20  LEU B HB3  2  
ATOM   3484  H HG   . LEU B 1 20 ? -18.587 5.274   0.413   1.00 0.00 ? 20  LEU B HG   2  
ATOM   3485  H HD11 . LEU B 1 20 ? -17.900 4.073   -1.738  1.00 0.00 ? 20  LEU B HD11 2  
ATOM   3486  H HD12 . LEU B 1 20 ? -17.392 5.653   -2.338  1.00 0.00 ? 20  LEU B HD12 2  
ATOM   3487  H HD13 . LEU B 1 20 ? -16.623 4.964   -0.909  1.00 0.00 ? 20  LEU B HD13 2  
ATOM   3488  H HD21 . LEU B 1 20 ? -18.564 7.735   -1.345  1.00 0.00 ? 20  LEU B HD21 2  
ATOM   3489  H HD22 . LEU B 1 20 ? -18.800 7.639   0.400   1.00 0.00 ? 20  LEU B HD22 2  
ATOM   3490  H HD23 . LEU B 1 20 ? -17.204 7.347   -0.289  1.00 0.00 ? 20  LEU B HD23 2  
ATOM   3491  N N    . PRO B 1 21 ? -23.253 6.737   -1.437  1.00 0.00 ? 21  PRO B N    2  
ATOM   3492  C CA   . PRO B 1 21 ? -24.593 6.301   -1.873  1.00 0.00 ? 21  PRO B CA   2  
ATOM   3493  C C    . PRO B 1 21 ? -24.463 5.097   -2.811  1.00 0.00 ? 21  PRO B C    2  
ATOM   3494  O O    . PRO B 1 21 ? -23.531 5.006   -3.582  1.00 0.00 ? 21  PRO B O    2  
ATOM   3495  C CB   . PRO B 1 21 ? -25.188 7.517   -2.617  1.00 0.00 ? 21  PRO B CB   2  
ATOM   3496  C CG   . PRO B 1 21 ? -24.229 8.718   -2.380  1.00 0.00 ? 21  PRO B CG   2  
ATOM   3497  C CD   . PRO B 1 21 ? -22.955 8.165   -1.703  1.00 0.00 ? 21  PRO B CD   2  
ATOM   3498  H HA   . PRO B 1 21 ? -25.203 6.049   -1.019  1.00 0.00 ? 21  PRO B HA   2  
ATOM   3499  H HB2  . PRO B 1 21 ? -25.262 7.309   -3.681  1.00 0.00 ? 21  PRO B HB2  2  
ATOM   3500  H HB3  . PRO B 1 21 ? -26.167 7.746   -2.230  1.00 0.00 ? 21  PRO B HB3  2  
ATOM   3501  H HG2  . PRO B 1 21 ? -23.977 9.183   -3.326  1.00 0.00 ? 21  PRO B HG2  2  
ATOM   3502  H HG3  . PRO B 1 21 ? -24.698 9.445   -1.732  1.00 0.00 ? 21  PRO B HG3  2  
ATOM   3503  H HD2  . PRO B 1 21 ? -22.108 8.258   -2.370  1.00 0.00 ? 21  PRO B HD2  2  
ATOM   3504  H HD3  . PRO B 1 21 ? -22.767 8.685   -0.774  1.00 0.00 ? 21  PRO B HD3  2  
ATOM   3505  N N    . ARG B 1 22 ? -25.394 4.186   -2.768  1.00 0.00 ? 22  ARG B N    2  
ATOM   3506  C CA   . ARG B 1 22 ? -25.316 3.014   -3.682  1.00 0.00 ? 22  ARG B CA   2  
ATOM   3507  C C    . ARG B 1 22 ? -25.087 3.523   -5.107  1.00 0.00 ? 22  ARG B C    2  
ATOM   3508  O O    . ARG B 1 22 ? -24.419 2.897   -5.905  1.00 0.00 ? 22  ARG B O    2  
ATOM   3509  C CB   . ARG B 1 22 ? -26.621 2.225   -3.622  1.00 0.00 ? 22  ARG B CB   2  
ATOM   3510  C CG   . ARG B 1 22 ? -26.514 1.006   -4.549  1.00 0.00 ? 22  ARG B CG   2  
ATOM   3511  C CD   . ARG B 1 22 ? -27.739 0.087   -4.380  1.00 0.00 ? 22  ARG B CD   2  
ATOM   3512  N NE   . ARG B 1 22 ? -27.305 -1.344  -4.430  1.00 0.00 ? 22  ARG B NE   2  
ATOM   3513  C CZ   . ARG B 1 22 ? -26.502 -1.777  -5.367  1.00 0.00 ? 22  ARG B CZ   2  
ATOM   3514  N NH1  . ARG B 1 22 ? -26.187 -1.013  -6.376  1.00 0.00 ? 22  ARG B NH1  2  
ATOM   3515  N NH2  . ARG B 1 22 ? -26.052 -3.001  -5.318  1.00 0.00 ? 22  ARG B NH2  2  
ATOM   3516  H H    . ARG B 1 22 ? -26.149 4.280   -2.149  1.00 0.00 ? 22  ARG B H    2  
ATOM   3517  H HA   . ARG B 1 22 ? -24.499 2.376   -3.389  1.00 0.00 ? 22  ARG B HA   2  
ATOM   3518  H HB2  . ARG B 1 22 ? -26.795 1.900   -2.607  1.00 0.00 ? 22  ARG B HB2  2  
ATOM   3519  H HB3  . ARG B 1 22 ? -27.438 2.852   -3.946  1.00 0.00 ? 22  ARG B HB3  2  
ATOM   3520  H HG2  . ARG B 1 22 ? -26.454 1.350   -5.570  1.00 0.00 ? 22  ARG B HG2  2  
ATOM   3521  H HG3  . ARG B 1 22 ? -25.618 0.453   -4.306  1.00 0.00 ? 22  ARG B HG3  2  
ATOM   3522  H HD2  . ARG B 1 22 ? -28.201 0.259   -3.423  1.00 0.00 ? 22  ARG B HD2  2  
ATOM   3523  H HD3  . ARG B 1 22 ? -28.459 0.299   -5.164  1.00 0.00 ? 22  ARG B HD3  2  
ATOM   3524  H HE   . ARG B 1 22 ? -27.592 -1.958  -3.722  1.00 0.00 ? 22  ARG B HE   2  
ATOM   3525  H HH11 . ARG B 1 22 ? -26.562 -0.093  -6.443  1.00 0.00 ? 22  ARG B HH11 2  
ATOM   3526  H HH12 . ARG B 1 22 ? -25.569 -1.353  -7.086  1.00 0.00 ? 22  ARG B HH12 2  
ATOM   3527  H HH21 . ARG B 1 22 ? -26.320 -3.603  -4.567  1.00 0.00 ? 22  ARG B HH21 2  
ATOM   3528  H HH22 . ARG B 1 22 ? -25.438 -3.337  -6.033  1.00 0.00 ? 22  ARG B HH22 2  
ATOM   3529  N N    . ASN B 1 23 ? -25.638 4.665   -5.423  1.00 0.00 ? 23  ASN B N    2  
ATOM   3530  C CA   . ASN B 1 23 ? -25.458 5.234   -6.787  1.00 0.00 ? 23  ASN B CA   2  
ATOM   3531  C C    . ASN B 1 23 ? -24.025 5.751   -6.945  1.00 0.00 ? 23  ASN B C    2  
ATOM   3532  O O    . ASN B 1 23 ? -23.725 6.498   -7.855  1.00 0.00 ? 23  ASN B O    2  
ATOM   3533  C CB   . ASN B 1 23 ? -26.441 6.390   -6.991  1.00 0.00 ? 23  ASN B CB   2  
ATOM   3534  C CG   . ASN B 1 23 ? -26.477 6.775   -8.470  1.00 0.00 ? 23  ASN B CG   2  
ATOM   3535  O OD1  . ASN B 1 23 ? -26.517 5.920   -9.332  1.00 0.00 ? 23  ASN B OD1  2  
ATOM   3536  N ND2  . ASN B 1 23 ? -26.464 8.037   -8.803  1.00 0.00 ? 23  ASN B ND2  2  
ATOM   3537  H H    . ASN B 1 23 ? -26.167 5.154   -4.754  1.00 0.00 ? 23  ASN B H    2  
ATOM   3538  H HA   . ASN B 1 23 ? -25.647 4.467   -7.524  1.00 0.00 ? 23  ASN B HA   2  
ATOM   3539  H HB2  . ASN B 1 23 ? -27.427 6.083   -6.674  1.00 0.00 ? 23  ASN B HB2  2  
ATOM   3540  H HB3  . ASN B 1 23 ? -26.123 7.240   -6.407  1.00 0.00 ? 23  ASN B HB3  2  
ATOM   3541  H HD21 . ASN B 1 23 ? -26.432 8.728   -8.108  1.00 0.00 ? 23  ASN B HD21 2  
ATOM   3542  H HD22 . ASN B 1 23 ? -26.488 8.295   -9.748  1.00 0.00 ? 23  ASN B HD22 2  
ATOM   3543  N N    . PHE B 1 24 ? -23.140 5.367   -6.060  1.00 0.00 ? 24  PHE B N    2  
ATOM   3544  C CA   . PHE B 1 24 ? -21.723 5.845   -6.149  1.00 0.00 ? 24  PHE B CA   2  
ATOM   3545  C C    . PHE B 1 24 ? -20.781 4.689   -5.795  1.00 0.00 ? 24  PHE B C    2  
ATOM   3546  O O    . PHE B 1 24 ? -19.693 4.889   -5.293  1.00 0.00 ? 24  PHE B O    2  
ATOM   3547  C CB   . PHE B 1 24 ? -21.529 7.010   -5.160  1.00 0.00 ? 24  PHE B CB   2  
ATOM   3548  C CG   . PHE B 1 24 ? -20.339 7.868   -5.558  1.00 0.00 ? 24  PHE B CG   2  
ATOM   3549  C CD1  . PHE B 1 24 ? -20.313 8.510   -6.816  1.00 0.00 ? 24  PHE B CD1  2  
ATOM   3550  C CD2  . PHE B 1 24 ? -19.261 8.040   -4.663  1.00 0.00 ? 24  PHE B CD2  2  
ATOM   3551  C CE1  . PHE B 1 24 ? -19.215 9.314   -7.174  1.00 0.00 ? 24  PHE B CE1  2  
ATOM   3552  C CE2  . PHE B 1 24 ? -18.165 8.845   -5.026  1.00 0.00 ? 24  PHE B CE2  2  
ATOM   3553  C CZ   . PHE B 1 24 ? -18.142 9.481   -6.281  1.00 0.00 ? 24  PHE B CZ   2  
ATOM   3554  H H    . PHE B 1 24 ? -23.410 4.772   -5.331  1.00 0.00 ? 24  PHE B H    2  
ATOM   3555  H HA   . PHE B 1 24 ? -21.509 6.176   -7.153  1.00 0.00 ? 24  PHE B HA   2  
ATOM   3556  H HB2  . PHE B 1 24 ? -22.418 7.621   -5.154  1.00 0.00 ? 24  PHE B HB2  2  
ATOM   3557  H HB3  . PHE B 1 24 ? -21.368 6.613   -4.166  1.00 0.00 ? 24  PHE B HB3  2  
ATOM   3558  H HD1  . PHE B 1 24 ? -21.135 8.388   -7.506  1.00 0.00 ? 24  PHE B HD1  2  
ATOM   3559  H HD2  . PHE B 1 24 ? -19.276 7.554   -3.700  1.00 0.00 ? 24  PHE B HD2  2  
ATOM   3560  H HE1  . PHE B 1 24 ? -19.196 9.804   -8.137  1.00 0.00 ? 24  PHE B HE1  2  
ATOM   3561  H HE2  . PHE B 1 24 ? -17.340 8.975   -4.341  1.00 0.00 ? 24  PHE B HE2  2  
ATOM   3562  H HZ   . PHE B 1 24 ? -17.300 10.099  -6.557  1.00 0.00 ? 24  PHE B HZ   2  
ATOM   3563  N N    . VAL B 1 25 ? -21.198 3.475   -6.062  1.00 0.00 ? 25  VAL B N    2  
ATOM   3564  C CA   . VAL B 1 25 ? -20.341 2.291   -5.755  1.00 0.00 ? 25  VAL B CA   2  
ATOM   3565  C C    . VAL B 1 25 ? -20.647 1.180   -6.763  1.00 0.00 ? 25  VAL B C    2  
ATOM   3566  O O    . VAL B 1 25 ? -21.502 0.346   -6.538  1.00 0.00 ? 25  VAL B O    2  
ATOM   3567  C CB   . VAL B 1 25 ? -20.648 1.783   -4.344  1.00 0.00 ? 25  VAL B CB   2  
ATOM   3568  C CG1  . VAL B 1 25 ? -19.691 0.645   -3.988  1.00 0.00 ? 25  VAL B CG1  2  
ATOM   3569  C CG2  . VAL B 1 25 ? -20.471 2.918   -3.334  1.00 0.00 ? 25  VAL B CG2  2  
ATOM   3570  H H    . VAL B 1 25 ? -22.078 3.344   -6.470  1.00 0.00 ? 25  VAL B H    2  
ATOM   3571  H HA   . VAL B 1 25 ? -19.297 2.563   -5.823  1.00 0.00 ? 25  VAL B HA   2  
ATOM   3572  H HB   . VAL B 1 25 ? -21.666 1.422   -4.307  1.00 0.00 ? 25  VAL B HB   2  
ATOM   3573  H HG11 . VAL B 1 25 ? -19.810 -0.163  -4.695  1.00 0.00 ? 25  VAL B HG11 2  
ATOM   3574  H HG12 . VAL B 1 25 ? -18.673 1.006   -4.023  1.00 0.00 ? 25  VAL B HG12 2  
ATOM   3575  H HG13 . VAL B 1 25 ? -19.912 0.288   -2.994  1.00 0.00 ? 25  VAL B HG13 2  
ATOM   3576  H HG21 . VAL B 1 25 ? -19.516 3.395   -3.491  1.00 0.00 ? 25  VAL B HG21 2  
ATOM   3577  H HG22 . VAL B 1 25 ? -21.262 3.641   -3.460  1.00 0.00 ? 25  VAL B HG22 2  
ATOM   3578  H HG23 . VAL B 1 25 ? -20.511 2.512   -2.335  1.00 0.00 ? 25  VAL B HG23 2  
ATOM   3579  N N    . VAL B 1 26 ? -19.961 1.164   -7.873  1.00 0.00 ? 26  VAL B N    2  
ATOM   3580  C CA   . VAL B 1 26 ? -20.217 0.112   -8.897  1.00 0.00 ? 26  VAL B CA   2  
ATOM   3581  C C    . VAL B 1 26 ? -19.418 -1.143  -8.556  1.00 0.00 ? 26  VAL B C    2  
ATOM   3582  O O    . VAL B 1 26 ? -19.619 -2.192  -9.134  1.00 0.00 ? 26  VAL B O    2  
ATOM   3583  C CB   . VAL B 1 26 ? -19.782 0.630   -10.266 1.00 0.00 ? 26  VAL B CB   2  
ATOM   3584  C CG1  . VAL B 1 26 ? -20.501 1.945   -10.560 1.00 0.00 ? 26  VAL B CG1  2  
ATOM   3585  C CG2  . VAL B 1 26 ? -18.268 0.865   -10.266 1.00 0.00 ? 26  VAL B CG2  2  
ATOM   3586  H H    . VAL B 1 26 ? -19.279 1.846   -8.039  1.00 0.00 ? 26  VAL B H    2  
ATOM   3587  H HA   . VAL B 1 26 ? -21.270 -0.128  -8.919  1.00 0.00 ? 26  VAL B HA   2  
ATOM   3588  H HB   . VAL B 1 26 ? -20.035 -0.094  -11.020 1.00 0.00 ? 26  VAL B HB   2  
ATOM   3589  H HG11 . VAL B 1 26 ? -20.344 2.627   -9.738  1.00 0.00 ? 26  VAL B HG11 2  
ATOM   3590  H HG12 . VAL B 1 26 ? -20.107 2.377   -11.468 1.00 0.00 ? 26  VAL B HG12 2  
ATOM   3591  H HG13 . VAL B 1 26 ? -21.558 1.759   -10.677 1.00 0.00 ? 26  VAL B HG13 2  
ATOM   3592  H HG21 . VAL B 1 26 ? -17.991 1.420   -9.382  1.00 0.00 ? 26  VAL B HG21 2  
ATOM   3593  H HG22 . VAL B 1 26 ? -17.756 -0.086  -10.271 1.00 0.00 ? 26  VAL B HG22 2  
ATOM   3594  H HG23 . VAL B 1 26 ? -17.991 1.427   -11.146 1.00 0.00 ? 26  VAL B HG23 2  
ATOM   3595  N N    . ASP B 1 27 ? -18.510 -1.047  -7.628  1.00 0.00 ? 27  ASP B N    2  
ATOM   3596  C CA   . ASP B 1 27 ? -17.705 -2.246  -7.269  1.00 0.00 ? 27  ASP B CA   2  
ATOM   3597  C C    . ASP B 1 27 ? -16.898 -1.955  -6.009  1.00 0.00 ? 27  ASP B C    2  
ATOM   3598  O O    . ASP B 1 27 ? -17.061 -0.929  -5.378  1.00 0.00 ? 27  ASP B O    2  
ATOM   3599  C CB   . ASP B 1 27 ? -16.751 -2.578  -8.418  1.00 0.00 ? 27  ASP B CB   2  
ATOM   3600  C CG   . ASP B 1 27 ? -16.177 -3.982  -8.216  1.00 0.00 ? 27  ASP B CG   2  
ATOM   3601  O OD1  . ASP B 1 27 ? -16.952 -4.884  -7.942  1.00 0.00 ? 27  ASP B OD1  2  
ATOM   3602  O OD2  . ASP B 1 27 ? -14.972 -4.131  -8.338  1.00 0.00 ? 27  ASP B OD2  2  
ATOM   3603  H H    . ASP B 1 27 ? -18.354 -0.191  -7.172  1.00 0.00 ? 27  ASP B H    2  
ATOM   3604  H HA   . ASP B 1 27 ? -18.364 -3.084  -7.089  1.00 0.00 ? 27  ASP B HA   2  
ATOM   3605  H HB2  . ASP B 1 27 ? -17.289 -2.540  -9.354  1.00 0.00 ? 27  ASP B HB2  2  
ATOM   3606  H HB3  . ASP B 1 27 ? -15.942 -1.859  -8.438  1.00 0.00 ? 27  ASP B HB3  2  
ATOM   3607  N N    . TYR B 1 28 ? -16.026 -2.848  -5.637  1.00 0.00 ? 28  TYR B N    2  
ATOM   3608  C CA   . TYR B 1 28 ? -15.208 -2.617  -4.418  1.00 0.00 ? 28  TYR B CA   2  
ATOM   3609  C C    . TYR B 1 28 ? -13.920 -3.429  -4.498  1.00 0.00 ? 28  TYR B C    2  
ATOM   3610  O O    . TYR B 1 28 ? -13.629 -4.073  -5.487  1.00 0.00 ? 28  TYR B O    2  
ATOM   3611  C CB   . TYR B 1 28 ? -16.001 -3.010  -3.166  1.00 0.00 ? 28  TYR B CB   2  
ATOM   3612  C CG   . TYR B 1 28 ? -16.109 -4.519  -3.049  1.00 0.00 ? 28  TYR B CG   2  
ATOM   3613  C CD1  . TYR B 1 28 ? -16.796 -5.259  -4.031  1.00 0.00 ? 28  TYR B CD1  2  
ATOM   3614  C CD2  . TYR B 1 28 ? -15.530 -5.182  -1.948  1.00 0.00 ? 28  TYR B CD2  2  
ATOM   3615  C CE1  . TYR B 1 28 ? -16.902 -6.657  -3.914  1.00 0.00 ? 28  TYR B CE1  2  
ATOM   3616  C CE2  . TYR B 1 28 ? -15.636 -6.579  -1.828  1.00 0.00 ? 28  TYR B CE2  2  
ATOM   3617  C CZ   . TYR B 1 28 ? -16.322 -7.318  -2.812  1.00 0.00 ? 28  TYR B CZ   2  
ATOM   3618  O OH   . TYR B 1 28 ? -16.427 -8.689  -2.697  1.00 0.00 ? 28  TYR B OH   2  
ATOM   3619  H H    . TYR B 1 28 ? -15.908 -3.667  -6.160  1.00 0.00 ? 28  TYR B H    2  
ATOM   3620  H HA   . TYR B 1 28 ? -14.951 -1.569  -4.356  1.00 0.00 ? 28  TYR B HA   2  
ATOM   3621  H HB2  . TYR B 1 28 ? -15.502 -2.616  -2.293  1.00 0.00 ? 28  TYR B HB2  2  
ATOM   3622  H HB3  . TYR B 1 28 ? -16.988 -2.586  -3.227  1.00 0.00 ? 28  TYR B HB3  2  
ATOM   3623  H HD1  . TYR B 1 28 ? -17.241 -4.756  -4.876  1.00 0.00 ? 28  TYR B HD1  2  
ATOM   3624  H HD2  . TYR B 1 28 ? -15.002 -4.618  -1.196  1.00 0.00 ? 28  TYR B HD2  2  
ATOM   3625  H HE1  . TYR B 1 28 ? -17.431 -7.223  -4.669  1.00 0.00 ? 28  TYR B HE1  2  
ATOM   3626  H HE2  . TYR B 1 28 ? -15.191 -7.082  -0.981  1.00 0.00 ? 28  TYR B HE2  2  
ATOM   3627  H HH   . TYR B 1 28 ? -17.304 -8.945  -2.992  1.00 0.00 ? 28  TYR B HH   2  
ATOM   3628  N N    . TYR B 1 29 ? -13.144 -3.384  -3.462  1.00 0.00 ? 29  TYR B N    2  
ATOM   3629  C CA   . TYR B 1 29 ? -11.860 -4.125  -3.450  1.00 0.00 ? 29  TYR B CA   2  
ATOM   3630  C C    . TYR B 1 29 ? -11.399 -4.264  -1.993  1.00 0.00 ? 29  TYR B C    2  
ATOM   3631  O O    . TYR B 1 29 ? -11.534 -3.350  -1.211  1.00 0.00 ? 29  TYR B O    2  
ATOM   3632  C CB   . TYR B 1 29 ? -10.843 -3.327  -4.282  1.00 0.00 ? 29  TYR B CB   2  
ATOM   3633  C CG   . TYR B 1 29 ? -9.431  -3.749  -3.955  1.00 0.00 ? 29  TYR B CG   2  
ATOM   3634  C CD1  . TYR B 1 29 ? -8.948  -4.988  -4.407  1.00 0.00 ? 29  TYR B CD1  2  
ATOM   3635  C CD2  . TYR B 1 29 ? -8.602  -2.899  -3.199  1.00 0.00 ? 29  TYR B CD2  2  
ATOM   3636  C CE1  . TYR B 1 29 ? -7.631  -5.384  -4.101  1.00 0.00 ? 29  TYR B CE1  2  
ATOM   3637  C CE2  . TYR B 1 29 ? -7.285  -3.292  -2.893  1.00 0.00 ? 29  TYR B CE2  2  
ATOM   3638  C CZ   . TYR B 1 29 ? -6.800  -4.535  -3.343  1.00 0.00 ? 29  TYR B CZ   2  
ATOM   3639  O OH   . TYR B 1 29 ? -5.508  -4.923  -3.044  1.00 0.00 ? 29  TYR B OH   2  
ATOM   3640  H H    . TYR B 1 29 ? -13.407 -2.852  -2.686  1.00 0.00 ? 29  TYR B H    2  
ATOM   3641  H HA   . TYR B 1 29 ? -11.999 -5.105  -3.883  1.00 0.00 ? 29  TYR B HA   2  
ATOM   3642  H HB2  . TYR B 1 29 ? -11.030 -3.503  -5.332  1.00 0.00 ? 29  TYR B HB2  2  
ATOM   3643  H HB3  . TYR B 1 29 ? -10.961 -2.274  -4.074  1.00 0.00 ? 29  TYR B HB3  2  
ATOM   3644  H HD1  . TYR B 1 29 ? -9.588  -5.636  -4.989  1.00 0.00 ? 29  TYR B HD1  2  
ATOM   3645  H HD2  . TYR B 1 29 ? -8.976  -1.945  -2.857  1.00 0.00 ? 29  TYR B HD2  2  
ATOM   3646  H HE1  . TYR B 1 29 ? -7.259  -6.337  -4.447  1.00 0.00 ? 29  TYR B HE1  2  
ATOM   3647  H HE2  . TYR B 1 29 ? -6.649  -2.641  -2.312  1.00 0.00 ? 29  TYR B HE2  2  
ATOM   3648  H HH   . TYR B 1 29 ? -5.089  -5.211  -3.858  1.00 0.00 ? 29  TYR B HH   2  
ATOM   3649  N N    . GLU B 1 30 ? -10.862 -5.394  -1.617  1.00 0.00 ? 30  GLU B N    2  
ATOM   3650  C CA   . GLU B 1 30 ? -10.402 -5.570  -0.203  1.00 0.00 ? 30  GLU B CA   2  
ATOM   3651  C C    . GLU B 1 30 ? -8.897  -5.301  -0.122  1.00 0.00 ? 30  GLU B C    2  
ATOM   3652  O O    . GLU B 1 30 ? -8.178  -5.430  -1.093  1.00 0.00 ? 30  GLU B O    2  
ATOM   3653  C CB   . GLU B 1 30 ? -10.694 -7.002  0.253   1.00 0.00 ? 30  GLU B CB   2  
ATOM   3654  C CG   . GLU B 1 30 ? -12.184 -7.146  0.576   1.00 0.00 ? 30  GLU B CG   2  
ATOM   3655  C CD   . GLU B 1 30 ? -12.482 -8.592  0.975   1.00 0.00 ? 30  GLU B CD   2  
ATOM   3656  O OE1  . GLU B 1 30 ? -11.543 -9.312  1.269   1.00 0.00 ? 30  GLU B OE1  2  
ATOM   3657  O OE2  . GLU B 1 30 ? -13.647 -8.956  0.979   1.00 0.00 ? 30  GLU B OE2  2  
ATOM   3658  H H    . GLU B 1 30 ? -10.764 -6.127  -2.259  1.00 0.00 ? 30  GLU B H    2  
ATOM   3659  H HA   . GLU B 1 30 ? -10.925 -4.876  0.446   1.00 0.00 ? 30  GLU B HA   2  
ATOM   3660  H HB2  . GLU B 1 30 ? -10.432 -7.686  -0.534  1.00 0.00 ? 30  GLU B HB2  2  
ATOM   3661  H HB3  . GLU B 1 30 ? -10.114 -7.226  1.136   1.00 0.00 ? 30  GLU B HB3  2  
ATOM   3662  H HG2  . GLU B 1 30 ? -12.440 -6.486  1.393   1.00 0.00 ? 30  GLU B HG2  2  
ATOM   3663  H HG3  . GLU B 1 30 ? -12.768 -6.886  -0.293  1.00 0.00 ? 30  GLU B HG3  2  
ATOM   3664  N N    . THR B 1 31 ? -8.418  -4.918  1.030   1.00 0.00 ? 31  THR B N    2  
ATOM   3665  C CA   . THR B 1 31 ? -6.960  -4.627  1.182   1.00 0.00 ? 31  THR B CA   2  
ATOM   3666  C C    . THR B 1 31 ? -6.158  -5.929  1.176   1.00 0.00 ? 31  THR B C    2  
ATOM   3667  O O    . THR B 1 31 ? -6.652  -6.980  0.819   1.00 0.00 ? 31  THR B O    2  
ATOM   3668  C CB   . THR B 1 31 ? -6.730  -3.905  2.511   1.00 0.00 ? 31  THR B CB   2  
ATOM   3669  O OG1  . THR B 1 31 ? -7.450  -4.578  3.526   1.00 0.00 ? 31  THR B OG1  2  
ATOM   3670  C CG2  . THR B 1 31 ? -7.214  -2.459  2.397   1.00 0.00 ? 31  THR B CG2  2  
ATOM   3671  H H    . THR B 1 31 ? -9.021  -4.813  1.797   1.00 0.00 ? 31  THR B H    2  
ATOM   3672  H HA   . THR B 1 31 ? -6.631  -3.997  0.370   1.00 0.00 ? 31  THR B HA   2  
ATOM   3673  H HB   . THR B 1 31 ? -5.680  -3.911  2.762   1.00 0.00 ? 31  THR B HB   2  
ATOM   3674  H HG1  . THR B 1 31 ? -7.133  -5.483  3.565   1.00 0.00 ? 31  THR B HG1  2  
ATOM   3675  H HG21 . THR B 1 31 ? -8.177  -2.438  1.905   1.00 0.00 ? 31  THR B HG21 2  
ATOM   3676  H HG22 . THR B 1 31 ? -7.304  -2.030  3.382   1.00 0.00 ? 31  THR B HG22 2  
ATOM   3677  H HG23 . THR B 1 31 ? -6.504  -1.887  1.817   1.00 0.00 ? 31  THR B HG23 2  
ATOM   3678  N N    . SER B 1 32 ? -4.917  -5.857  1.574   1.00 0.00 ? 32  SER B N    2  
ATOM   3679  C CA   . SER B 1 32 ? -4.059  -7.072  1.604   1.00 0.00 ? 32  SER B CA   2  
ATOM   3680  C C    . SER B 1 32 ? -4.283  -7.828  2.914   1.00 0.00 ? 32  SER B C    2  
ATOM   3681  O O    . SER B 1 32 ? -5.371  -7.855  3.454   1.00 0.00 ? 32  SER B O    2  
ATOM   3682  C CB   . SER B 1 32 ? -2.593  -6.651  1.513   1.00 0.00 ? 32  SER B CB   2  
ATOM   3683  O OG   . SER B 1 32 ? -2.413  -5.823  0.371   1.00 0.00 ? 32  SER B OG   2  
ATOM   3684  H H    . SER B 1 32 ? -4.548  -4.995  1.857   1.00 0.00 ? 32  SER B H    2  
ATOM   3685  H HA   . SER B 1 32 ? -4.299  -7.712  0.772   1.00 0.00 ? 32  SER B HA   2  
ATOM   3686  H HB2  . SER B 1 32 ? -2.323  -6.098  2.397   1.00 0.00 ? 32  SER B HB2  2  
ATOM   3687  H HB3  . SER B 1 32 ? -1.971  -7.531  1.435   1.00 0.00 ? 32  SER B HB3  2  
ATOM   3688  H HG   . SER B 1 32 ? -1.927  -6.327  -0.286  1.00 0.00 ? 32  SER B HG   2  
ATOM   3689  N N    . SER B 1 33 ? -3.252  -8.443  3.424   1.00 0.00 ? 33  SER B N    2  
ATOM   3690  C CA   . SER B 1 33 ? -3.373  -9.210  4.700   1.00 0.00 ? 33  SER B CA   2  
ATOM   3691  C C    . SER B 1 33 ? -2.107  -8.995  5.524   1.00 0.00 ? 33  SER B C    2  
ATOM   3692  O O    . SER B 1 33 ? -2.145  -8.916  6.737   1.00 0.00 ? 33  SER B O    2  
ATOM   3693  C CB   . SER B 1 33 ? -3.509  -10.694 4.379   1.00 0.00 ? 33  SER B CB   2  
ATOM   3694  O OG   . SER B 1 33 ? -2.221  -11.238 4.124   1.00 0.00 ? 33  SER B OG   2  
ATOM   3695  H H    . SER B 1 33 ? -2.390  -8.403  2.961   1.00 0.00 ? 33  SER B H    2  
ATOM   3696  H HA   . SER B 1 33 ? -4.235  -8.874  5.261   1.00 0.00 ? 33  SER B HA   2  
ATOM   3697  H HB2  . SER B 1 33 ? -3.958  -11.209 5.211   1.00 0.00 ? 33  SER B HB2  2  
ATOM   3698  H HB3  . SER B 1 33 ? -4.133  -10.808 3.507   1.00 0.00 ? 33  SER B HB3  2  
ATOM   3699  H HG   . SER B 1 33 ? -1.998  -11.057 3.208   1.00 0.00 ? 33  SER B HG   2  
ATOM   3700  N N    . LEU B 1 34 ? -0.988  -8.910  4.860   1.00 0.00 ? 34  LEU B N    2  
ATOM   3701  C CA   . LEU B 1 34 ? 0.315   -8.706  5.562   1.00 0.00 ? 34  LEU B CA   2  
ATOM   3702  C C    . LEU B 1 34 ? 0.147   -7.711  6.712   1.00 0.00 ? 34  LEU B C    2  
ATOM   3703  O O    . LEU B 1 34 ? 0.450   -8.003  7.852   1.00 0.00 ? 34  LEU B O    2  
ATOM   3704  C CB   . LEU B 1 34 ? 1.344   -8.149  4.575   1.00 0.00 ? 34  LEU B CB   2  
ATOM   3705  C CG   . LEU B 1 34 ? 1.256   -8.894  3.243   1.00 0.00 ? 34  LEU B CG   2  
ATOM   3706  C CD1  . LEU B 1 34 ? 2.405   -8.444  2.338   1.00 0.00 ? 34  LEU B CD1  2  
ATOM   3707  C CD2  . LEU B 1 34 ? 1.356   -10.403 3.489   1.00 0.00 ? 34  LEU B CD2  2  
ATOM   3708  H H    . LEU B 1 34 ? -1.004  -8.989  3.886   1.00 0.00 ? 34  LEU B H    2  
ATOM   3709  H HA   . LEU B 1 34 ? 0.665   -9.647  5.949   1.00 0.00 ? 34  LEU B HA   2  
ATOM   3710  H HB2  . LEU B 1 34 ? 1.154   -7.098  4.409   1.00 0.00 ? 34  LEU B HB2  2  
ATOM   3711  H HB3  . LEU B 1 34 ? 2.331   -8.272  4.985   1.00 0.00 ? 34  LEU B HB3  2  
ATOM   3712  H HG   . LEU B 1 34 ? 0.317   -8.666  2.764   1.00 0.00 ? 34  LEU B HG   2  
ATOM   3713  H HD11 . LEU B 1 34 ? 2.512   -7.368  2.396   1.00 0.00 ? 34  LEU B HD11 2  
ATOM   3714  H HD12 . LEU B 1 34 ? 3.323   -8.913  2.660   1.00 0.00 ? 34  LEU B HD12 2  
ATOM   3715  H HD13 . LEU B 1 34 ? 2.192   -8.728  1.320   1.00 0.00 ? 34  LEU B HD13 2  
ATOM   3716  H HD21 . LEU B 1 34 ? 2.157   -10.601 4.186   1.00 0.00 ? 34  LEU B HD21 2  
ATOM   3717  H HD22 . LEU B 1 34 ? 0.425   -10.763 3.897   1.00 0.00 ? 34  LEU B HD22 2  
ATOM   3718  H HD23 . LEU B 1 34 ? 1.559   -10.906 2.555   1.00 0.00 ? 34  LEU B HD23 2  
ATOM   3719  N N    . CYS B 1 35 ? -0.332  -6.538  6.416   1.00 0.00 ? 35  CYS B N    2  
ATOM   3720  C CA   . CYS B 1 35 ? -0.517  -5.523  7.487   1.00 0.00 ? 35  CYS B CA   2  
ATOM   3721  C C    . CYS B 1 35 ? -1.658  -5.964  8.409   1.00 0.00 ? 35  CYS B C    2  
ATOM   3722  O O    . CYS B 1 35 ? -2.725  -6.326  7.964   1.00 0.00 ? 35  CYS B O    2  
ATOM   3723  C CB   . CYS B 1 35 ? -0.840  -4.163  6.856   1.00 0.00 ? 35  CYS B CB   2  
ATOM   3724  S SG   . CYS B 1 35 ? -1.954  -4.387  5.447   1.00 0.00 ? 35  CYS B SG   2  
ATOM   3725  H H    . CYS B 1 35 ? -0.566  -6.327  5.489   1.00 0.00 ? 35  CYS B H    2  
ATOM   3726  H HA   . CYS B 1 35 ? 0.394   -5.443  8.061   1.00 0.00 ? 35  CYS B HA   2  
ATOM   3727  H HB2  . CYS B 1 35 ? -1.312  -3.528  7.588   1.00 0.00 ? 35  CYS B HB2  2  
ATOM   3728  H HB3  . CYS B 1 35 ? 0.076   -3.699  6.518   1.00 0.00 ? 35  CYS B HB3  2  
ATOM   3729  N N    . SER B 1 36 ? -1.425  -5.962  9.691   1.00 0.00 ? 36  SER B N    2  
ATOM   3730  C CA   . SER B 1 36 ? -2.480  -6.394  10.654  1.00 0.00 ? 36  SER B CA   2  
ATOM   3731  C C    . SER B 1 36 ? -3.665  -5.415  10.657  1.00 0.00 ? 36  SER B C    2  
ATOM   3732  O O    . SER B 1 36 ? -4.299  -5.223  11.675  1.00 0.00 ? 36  SER B O    2  
ATOM   3733  C CB   . SER B 1 36 ? -1.880  -6.459  12.058  1.00 0.00 ? 36  SER B CB   2  
ATOM   3734  O OG   . SER B 1 36 ? -0.950  -7.531  12.121  1.00 0.00 ? 36  SER B OG   2  
ATOM   3735  H H    . SER B 1 36 ? -0.547  -5.685  10.025  1.00 0.00 ? 36  SER B H    2  
ATOM   3736  H HA   . SER B 1 36 ? -2.833  -7.376  10.375  1.00 0.00 ? 36  SER B HA   2  
ATOM   3737  H HB2  . SER B 1 36 ? -1.372  -5.536  12.278  1.00 0.00 ? 36  SER B HB2  2  
ATOM   3738  H HB3  . SER B 1 36 ? -2.672  -6.613  12.780  1.00 0.00 ? 36  SER B HB3  2  
ATOM   3739  H HG   . SER B 1 36 ? -0.066  -7.162  12.047  1.00 0.00 ? 36  SER B HG   2  
ATOM   3740  N N    . GLN B 1 37 ? -3.985  -4.788  9.549   1.00 0.00 ? 37  GLN B N    2  
ATOM   3741  C CA   . GLN B 1 37 ? -5.138  -3.832  9.559   1.00 0.00 ? 37  GLN B CA   2  
ATOM   3742  C C    . GLN B 1 37 ? -5.754  -3.699  8.157   1.00 0.00 ? 37  GLN B C    2  
ATOM   3743  O O    . GLN B 1 37 ? -5.703  -2.636  7.574   1.00 0.00 ? 37  GLN B O    2  
ATOM   3744  C CB   . GLN B 1 37 ? -4.649  -2.458  10.029  1.00 0.00 ? 37  GLN B CB   2  
ATOM   3745  C CG   . GLN B 1 37 ? -3.347  -2.096  9.306   1.00 0.00 ? 37  GLN B CG   2  
ATOM   3746  C CD   . GLN B 1 37 ? -2.880  -0.712  9.763   1.00 0.00 ? 37  GLN B CD   2  
ATOM   3747  O OE1  . GLN B 1 37 ? -3.561  0.272   9.554   1.00 0.00 ? 37  GLN B OE1  2  
ATOM   3748  N NE2  . GLN B 1 37 ? -1.737  -0.594  10.382  1.00 0.00 ? 37  GLN B NE2  2  
ATOM   3749  H H    . GLN B 1 37 ? -3.475  -4.939  8.726   1.00 0.00 ? 37  GLN B H    2  
ATOM   3750  H HA   . GLN B 1 37 ? -5.896  -4.188  10.244  1.00 0.00 ? 37  GLN B HA   2  
ATOM   3751  H HB2  . GLN B 1 37 ? -5.402  -1.714  9.812   1.00 0.00 ? 37  GLN B HB2  2  
ATOM   3752  H HB3  . GLN B 1 37 ? -4.469  -2.486  11.094  1.00 0.00 ? 37  GLN B HB3  2  
ATOM   3753  H HG2  . GLN B 1 37 ? -2.589  -2.827  9.541   1.00 0.00 ? 37  GLN B HG2  2  
ATOM   3754  H HG3  . GLN B 1 37 ? -3.519  -2.081  8.241   1.00 0.00 ? 37  GLN B HG3  2  
ATOM   3755  H HE21 . GLN B 1 37 ? -1.187  -1.388  10.550  1.00 0.00 ? 37  GLN B HE21 2  
ATOM   3756  H HE22 . GLN B 1 37 ? -1.429  0.287   10.678  1.00 0.00 ? 37  GLN B HE22 2  
ATOM   3757  N N    . PRO B 1 38 ? -6.346  -4.764  7.661   1.00 0.00 ? 38  PRO B N    2  
ATOM   3758  C CA   . PRO B 1 38 ? -6.997  -4.738  6.336   1.00 0.00 ? 38  PRO B CA   2  
ATOM   3759  C C    . PRO B 1 38 ? -8.232  -3.826  6.402   1.00 0.00 ? 38  PRO B C    2  
ATOM   3760  O O    . PRO B 1 38 ? -8.533  -3.240  7.423   1.00 0.00 ? 38  PRO B O    2  
ATOM   3761  C CB   . PRO B 1 38 ? -7.400  -6.208  6.064   1.00 0.00 ? 38  PRO B CB   2  
ATOM   3762  C CG   . PRO B 1 38 ? -7.104  -7.020  7.360   1.00 0.00 ? 38  PRO B CG   2  
ATOM   3763  C CD   . PRO B 1 38 ? -6.411  -6.067  8.361   1.00 0.00 ? 38  PRO B CD   2  
ATOM   3764  H HA   . PRO B 1 38 ? -6.311  -4.387  5.572   1.00 0.00 ? 38  PRO B HA   2  
ATOM   3765  H HB2  . PRO B 1 38 ? -8.453  -6.271  5.816   1.00 0.00 ? 38  PRO B HB2  2  
ATOM   3766  H HB3  . PRO B 1 38 ? -6.812  -6.604  5.248   1.00 0.00 ? 38  PRO B HB3  2  
ATOM   3767  H HG2  . PRO B 1 38 ? -8.033  -7.391  7.781   1.00 0.00 ? 38  PRO B HG2  2  
ATOM   3768  H HG3  . PRO B 1 38 ? -6.450  -7.852  7.135   1.00 0.00 ? 38  PRO B HG3  2  
ATOM   3769  H HD2  . PRO B 1 38 ? -6.997  -5.980  9.267   1.00 0.00 ? 38  PRO B HD2  2  
ATOM   3770  H HD3  . PRO B 1 38 ? -5.416  -6.416  8.589   1.00 0.00 ? 38  PRO B HD3  2  
ATOM   3771  N N    . ALA B 1 39 ? -8.942  -3.710  5.319   1.00 0.00 ? 39  ALA B N    2  
ATOM   3772  C CA   . ALA B 1 39 ? -10.154 -2.856  5.291   1.00 0.00 ? 39  ALA B CA   2  
ATOM   3773  C C    . ALA B 1 39 ? -10.862 -3.083  3.959   1.00 0.00 ? 39  ALA B C    2  
ATOM   3774  O O    . ALA B 1 39 ? -10.307 -3.679  3.057   1.00 0.00 ? 39  ALA B O    2  
ATOM   3775  C CB   . ALA B 1 39 ? -9.752  -1.384  5.409   1.00 0.00 ? 39  ALA B CB   2  
ATOM   3776  H H    . ALA B 1 39 ? -8.682  -4.196  4.518   1.00 0.00 ? 39  ALA B H    2  
ATOM   3777  H HA   . ALA B 1 39 ? -10.809 -3.123  6.104   1.00 0.00 ? 39  ALA B HA   2  
ATOM   3778  H HB1  . ALA B 1 39 ? -9.063  -1.264  6.232   1.00 0.00 ? 39  ALA B HB1  2  
ATOM   3779  H HB2  . ALA B 1 39 ? -9.277  -1.067  4.492   1.00 0.00 ? 39  ALA B HB2  2  
ATOM   3780  H HB3  . ALA B 1 39 ? -10.631 -0.784  5.585   1.00 0.00 ? 39  ALA B HB3  2  
ATOM   3781  N N    . VAL B 1 40 ? -12.064 -2.598  3.809   1.00 0.00 ? 40  VAL B N    2  
ATOM   3782  C CA   . VAL B 1 40 ? -12.779 -2.771  2.510   1.00 0.00 ? 40  VAL B CA   2  
ATOM   3783  C C    . VAL B 1 40 ? -12.605 -1.482  1.712   1.00 0.00 ? 40  VAL B C    2  
ATOM   3784  O O    . VAL B 1 40 ? -12.567 -0.400  2.265   1.00 0.00 ? 40  VAL B O    2  
ATOM   3785  C CB   . VAL B 1 40 ? -14.269 -3.042  2.758   1.00 0.00 ? 40  VAL B CB   2  
ATOM   3786  C CG1  . VAL B 1 40 ? -15.059 -2.827  1.462   1.00 0.00 ? 40  VAL B CG1  2  
ATOM   3787  C CG2  . VAL B 1 40 ? -14.446 -4.492  3.211   1.00 0.00 ? 40  VAL B CG2  2  
ATOM   3788  H H    . VAL B 1 40 ? -12.489 -2.099  4.542   1.00 0.00 ? 40  VAL B H    2  
ATOM   3789  H HA   . VAL B 1 40 ? -12.349 -3.599  1.950   1.00 0.00 ? 40  VAL B HA   2  
ATOM   3790  H HB   . VAL B 1 40 ? -14.637 -2.374  3.523   1.00 0.00 ? 40  VAL B HB   2  
ATOM   3791  H HG11 . VAL B 1 40 ? -14.523 -3.276  0.639   1.00 0.00 ? 40  VAL B HG11 2  
ATOM   3792  H HG12 . VAL B 1 40 ? -16.033 -3.285  1.549   1.00 0.00 ? 40  VAL B HG12 2  
ATOM   3793  H HG13 . VAL B 1 40 ? -15.172 -1.769  1.281   1.00 0.00 ? 40  VAL B HG13 2  
ATOM   3794  H HG21 . VAL B 1 40 ? -13.774 -4.697  4.031   1.00 0.00 ? 40  VAL B HG21 2  
ATOM   3795  H HG22 . VAL B 1 40 ? -15.465 -4.648  3.529   1.00 0.00 ? 40  VAL B HG22 2  
ATOM   3796  H HG23 . VAL B 1 40 ? -14.221 -5.154  2.387   1.00 0.00 ? 40  VAL B HG23 2  
ATOM   3797  N N    . VAL B 1 41 ? -12.478 -1.597  0.419   1.00 0.00 ? 41  VAL B N    2  
ATOM   3798  C CA   . VAL B 1 41 ? -12.280 -0.392  -0.446  1.00 0.00 ? 41  VAL B CA   2  
ATOM   3799  C C    . VAL B 1 41 ? -13.416 -0.302  -1.468  1.00 0.00 ? 41  VAL B C    2  
ATOM   3800  O O    . VAL B 1 41 ? -13.608 -1.187  -2.272  1.00 0.00 ? 41  VAL B O    2  
ATOM   3801  C CB   . VAL B 1 41 ? -10.935 -0.528  -1.161  1.00 0.00 ? 41  VAL B CB   2  
ATOM   3802  C CG1  . VAL B 1 41 ? -10.494 0.826   -1.706  1.00 0.00 ? 41  VAL B CG1  2  
ATOM   3803  C CG2  . VAL B 1 41 ? -9.887  -1.033  -0.167  1.00 0.00 ? 41  VAL B CG2  2  
ATOM   3804  H H    . VAL B 1 41 ? -12.503 -2.488  0.014   1.00 0.00 ? 41  VAL B H    2  
ATOM   3805  H HA   . VAL B 1 41 ? -12.274 0.500   0.157   1.00 0.00 ? 41  VAL B HA   2  
ATOM   3806  H HB   . VAL B 1 41 ? -11.028 -1.226  -1.977  1.00 0.00 ? 41  VAL B HB   2  
ATOM   3807  H HG11 . VAL B 1 41 ? -11.314 1.289   -2.233  1.00 0.00 ? 41  VAL B HG11 2  
ATOM   3808  H HG12 . VAL B 1 41 ? -10.185 1.460   -0.888  1.00 0.00 ? 41  VAL B HG12 2  
ATOM   3809  H HG13 . VAL B 1 41 ? -9.666  0.675   -2.379  1.00 0.00 ? 41  VAL B HG13 2  
ATOM   3810  H HG21 . VAL B 1 41 ? -9.877  -0.391  0.702   1.00 0.00 ? 41  VAL B HG21 2  
ATOM   3811  H HG22 . VAL B 1 41 ? -10.128 -2.041  0.133   1.00 0.00 ? 41  VAL B HG22 2  
ATOM   3812  H HG23 . VAL B 1 41 ? -8.913  -1.020  -0.633  1.00 0.00 ? 41  VAL B HG23 2  
ATOM   3813  N N    . PHE B 1 42 ? -14.180 0.758   -1.443  1.00 0.00 ? 42  PHE B N    2  
ATOM   3814  C CA   . PHE B 1 42 ? -15.312 0.888   -2.411  1.00 0.00 ? 42  PHE B CA   2  
ATOM   3815  C C    . PHE B 1 42 ? -14.853 1.625   -3.673  1.00 0.00 ? 42  PHE B C    2  
ATOM   3816  O O    . PHE B 1 42 ? -14.193 2.643   -3.611  1.00 0.00 ? 42  PHE B O    2  
ATOM   3817  C CB   . PHE B 1 42 ? -16.456 1.677   -1.764  1.00 0.00 ? 42  PHE B CB   2  
ATOM   3818  C CG   . PHE B 1 42 ? -17.184 0.808   -0.762  1.00 0.00 ? 42  PHE B CG   2  
ATOM   3819  C CD1  . PHE B 1 42 ? -17.879 -0.340  -1.197  1.00 0.00 ? 42  PHE B CD1  2  
ATOM   3820  C CD2  . PHE B 1 42 ? -17.179 1.149   0.605   1.00 0.00 ? 42  PHE B CD2  2  
ATOM   3821  C CE1  . PHE B 1 42 ? -18.563 -1.143  -0.265  1.00 0.00 ? 42  PHE B CE1  2  
ATOM   3822  C CE2  . PHE B 1 42 ? -17.865 0.345   1.536   1.00 0.00 ? 42  PHE B CE2  2  
ATOM   3823  C CZ   . PHE B 1 42 ? -18.556 -0.801  1.099   1.00 0.00 ? 42  PHE B CZ   2  
ATOM   3824  H H    . PHE B 1 42 ? -14.017 1.464   -0.781  1.00 0.00 ? 42  PHE B H    2  
ATOM   3825  H HA   . PHE B 1 42 ? -15.668 -0.094  -2.685  1.00 0.00 ? 42  PHE B HA   2  
ATOM   3826  H HB2  . PHE B 1 42 ? -16.054 2.546   -1.265  1.00 0.00 ? 42  PHE B HB2  2  
ATOM   3827  H HB3  . PHE B 1 42 ? -17.150 1.996   -2.529  1.00 0.00 ? 42  PHE B HB3  2  
ATOM   3828  H HD1  . PHE B 1 42 ? -17.886 -0.603  -2.244  1.00 0.00 ? 42  PHE B HD1  2  
ATOM   3829  H HD2  . PHE B 1 42 ? -16.647 2.028   0.942   1.00 0.00 ? 42  PHE B HD2  2  
ATOM   3830  H HE1  . PHE B 1 42 ? -19.094 -2.023  -0.599  1.00 0.00 ? 42  PHE B HE1  2  
ATOM   3831  H HE2  . PHE B 1 42 ? -17.860 0.609   2.583   1.00 0.00 ? 42  PHE B HE2  2  
ATOM   3832  H HZ   . PHE B 1 42 ? -19.084 -1.418  1.812   1.00 0.00 ? 42  PHE B HZ   2  
ATOM   3833  N N    . GLN B 1 43 ? -15.229 1.122   -4.821  1.00 0.00 ? 43  GLN B N    2  
ATOM   3834  C CA   . GLN B 1 43 ? -14.861 1.783   -6.109  1.00 0.00 ? 43  GLN B CA   2  
ATOM   3835  C C    . GLN B 1 43 ? -16.073 2.607   -6.563  1.00 0.00 ? 43  GLN B C    2  
ATOM   3836  O O    . GLN B 1 43 ? -17.162 2.077   -6.698  1.00 0.00 ? 43  GLN B O    2  
ATOM   3837  C CB   . GLN B 1 43 ? -14.533 0.701   -7.140  1.00 0.00 ? 43  GLN B CB   2  
ATOM   3838  C CG   . GLN B 1 43 ? -13.310 -0.093  -6.677  1.00 0.00 ? 43  GLN B CG   2  
ATOM   3839  C CD   . GLN B 1 43 ? -13.196 -1.379  -7.497  1.00 0.00 ? 43  GLN B CD   2  
ATOM   3840  O OE1  . GLN B 1 43 ? -13.773 -2.391  -7.149  1.00 0.00 ? 43  GLN B OE1  2  
ATOM   3841  N NE2  . GLN B 1 43 ? -12.471 -1.384  -8.583  1.00 0.00 ? 43  GLN B NE2  2  
ATOM   3842  H H    . GLN B 1 43 ? -15.780 0.311   -4.835  1.00 0.00 ? 43  GLN B H    2  
ATOM   3843  H HA   . GLN B 1 43 ? -14.009 2.429   -5.966  1.00 0.00 ? 43  GLN B HA   2  
ATOM   3844  H HB2  . GLN B 1 43 ? -15.378 0.037   -7.240  1.00 0.00 ? 43  GLN B HB2  2  
ATOM   3845  H HB3  . GLN B 1 43 ? -14.321 1.154   -8.091  1.00 0.00 ? 43  GLN B HB3  2  
ATOM   3846  H HG2  . GLN B 1 43 ? -12.420 0.503   -6.816  1.00 0.00 ? 43  GLN B HG2  2  
ATOM   3847  H HG3  . GLN B 1 43 ? -13.416 -0.345  -5.632  1.00 0.00 ? 43  GLN B HG3  2  
ATOM   3848  H HE21 . GLN B 1 43 ? -12.006 -0.569  -8.865  1.00 0.00 ? 43  GLN B HE21 2  
ATOM   3849  H HE22 . GLN B 1 43 ? -12.391 -2.202  -9.115  1.00 0.00 ? 43  GLN B HE22 2  
ATOM   3850  N N    . THR B 1 44 ? -15.920 3.906   -6.753  1.00 0.00 ? 44  THR B N    2  
ATOM   3851  C CA   . THR B 1 44 ? -17.114 4.747   -7.136  1.00 0.00 ? 44  THR B CA   2  
ATOM   3852  C C    . THR B 1 44 ? -17.168 5.040   -8.635  1.00 0.00 ? 44  THR B C    2  
ATOM   3853  O O    . THR B 1 44 ? -16.565 4.368   -9.448  1.00 0.00 ? 44  THR B O    2  
ATOM   3854  C CB   . THR B 1 44 ? -17.053 6.078   -6.392  1.00 0.00 ? 44  THR B CB   2  
ATOM   3855  O OG1  . THR B 1 44 ? -16.177 6.955   -7.081  1.00 0.00 ? 44  THR B OG1  2  
ATOM   3856  C CG2  . THR B 1 44 ? -16.538 5.848   -4.969  1.00 0.00 ? 44  THR B CG2  2  
ATOM   3857  H H    . THR B 1 44 ? -15.036 4.333   -6.607  1.00 0.00 ? 44  THR B H    2  
ATOM   3858  H HA   . THR B 1 44 ? -18.024 4.237   -6.850  1.00 0.00 ? 44  THR B HA   2  
ATOM   3859  H HB   . THR B 1 44 ? -18.037 6.513   -6.350  1.00 0.00 ? 44  THR B HB   2  
ATOM   3860  H HG1  . THR B 1 44 ? -16.546 7.119   -7.952  1.00 0.00 ? 44  THR B HG1  2  
ATOM   3861  H HG21 . THR B 1 44 ? -17.017 4.976   -4.548  1.00 0.00 ? 44  THR B HG21 2  
ATOM   3862  H HG22 . THR B 1 44 ? -15.469 5.695   -4.993  1.00 0.00 ? 44  THR B HG22 2  
ATOM   3863  H HG23 . THR B 1 44 ? -16.764 6.711   -4.361  1.00 0.00 ? 44  THR B HG23 2  
ATOM   3864  N N    . LYS B 1 45 ? -17.925 6.055   -8.992  1.00 0.00 ? 45  LYS B N    2  
ATOM   3865  C CA   . LYS B 1 45 ? -18.087 6.449   -10.424 1.00 0.00 ? 45  LYS B CA   2  
ATOM   3866  C C    . LYS B 1 45 ? -17.314 7.737   -10.712 1.00 0.00 ? 45  LYS B C    2  
ATOM   3867  O O    . LYS B 1 45 ? -16.972 8.019   -11.844 1.00 0.00 ? 45  LYS B O    2  
ATOM   3868  C CB   . LYS B 1 45 ? -19.563 6.719   -10.702 1.00 0.00 ? 45  LYS B CB   2  
ATOM   3869  C CG   . LYS B 1 45 ? -20.388 5.502   -10.312 1.00 0.00 ? 45  LYS B CG   2  
ATOM   3870  C CD   . LYS B 1 45 ? -21.855 5.746   -10.678 1.00 0.00 ? 45  LYS B CD   2  
ATOM   3871  C CE   . LYS B 1 45 ? -22.586 4.412   -10.753 1.00 0.00 ? 45  LYS B CE   2  
ATOM   3872  N NZ   . LYS B 1 45 ? -22.176 3.688   -11.989 1.00 0.00 ? 45  LYS B NZ   2  
ATOM   3873  H H    . LYS B 1 45 ? -18.401 6.561   -8.301  1.00 0.00 ? 45  LYS B H    2  
ATOM   3874  H HA   . LYS B 1 45 ? -17.744 5.655   -11.070 1.00 0.00 ? 45  LYS B HA   2  
ATOM   3875  H HB2  . LYS B 1 45 ? -19.888 7.573   -10.127 1.00 0.00 ? 45  LYS B HB2  2  
ATOM   3876  H HB3  . LYS B 1 45 ? -19.702 6.918   -11.752 1.00 0.00 ? 45  LYS B HB3  2  
ATOM   3877  H HG2  . LYS B 1 45 ? -20.016 4.639   -10.845 1.00 0.00 ? 45  LYS B HG2  2  
ATOM   3878  H HG3  . LYS B 1 45 ? -20.305 5.336   -9.249  1.00 0.00 ? 45  LYS B HG3  2  
ATOM   3879  H HD2  . LYS B 1 45 ? -22.314 6.366   -9.922  1.00 0.00 ? 45  LYS B HD2  2  
ATOM   3880  H HD3  . LYS B 1 45 ? -21.920 6.240   -11.637 1.00 0.00 ? 45  LYS B HD3  2  
ATOM   3881  H HE2  . LYS B 1 45 ? -22.334 3.821   -9.888  1.00 0.00 ? 45  LYS B HE2  2  
ATOM   3882  H HE3  . LYS B 1 45 ? -23.646 4.591   -10.775 1.00 0.00 ? 45  LYS B HE3  2  
ATOM   3883  H HZ1  . LYS B 1 45 ? -21.142 3.728   -12.087 1.00 0.00 ? 45  LYS B HZ1  2  
ATOM   3884  H HZ2  . LYS B 1 45 ? -22.481 2.695   -11.926 1.00 0.00 ? 45  LYS B HZ2  2  
ATOM   3885  H HZ3  . LYS B 1 45 ? -22.618 4.135   -12.816 1.00 0.00 ? 45  LYS B HZ3  2  
ATOM   3886  N N    . ARG B 1 46 ? -17.055 8.537   -9.701  1.00 0.00 ? 46  ARG B N    2  
ATOM   3887  C CA   . ARG B 1 46 ? -16.327 9.829   -9.920  1.00 0.00 ? 46  ARG B CA   2  
ATOM   3888  C C    . ARG B 1 46 ? -15.192 9.928   -8.898  1.00 0.00 ? 46  ARG B C    2  
ATOM   3889  O O    . ARG B 1 46 ? -15.066 10.887  -8.167  1.00 0.00 ? 46  ARG B O    2  
ATOM   3890  C CB   . ARG B 1 46 ? -17.316 10.999  -9.741  1.00 0.00 ? 46  ARG B CB   2  
ATOM   3891  C CG   . ARG B 1 46 ? -16.834 12.256  -10.494 1.00 0.00 ? 46  ARG B CG   2  
ATOM   3892  C CD   . ARG B 1 46 ? -15.659 12.917  -9.767  1.00 0.00 ? 46  ARG B CD   2  
ATOM   3893  N NE   . ARG B 1 46 ? -15.457 14.290  -10.310 1.00 0.00 ? 46  ARG B NE   2  
ATOM   3894  C CZ   . ARG B 1 46 ? -14.723 15.149  -9.656  1.00 0.00 ? 46  ARG B CZ   2  
ATOM   3895  N NH1  . ARG B 1 46 ? -14.169 14.806  -8.525  1.00 0.00 ? 46  ARG B NH1  2  
ATOM   3896  N NH2  . ARG B 1 46 ? -14.543 16.349  -10.133 1.00 0.00 ? 46  ARG B NH2  2  
ATOM   3897  H H    . ARG B 1 46 ? -17.355 8.294   -8.800  1.00 0.00 ? 46  ARG B H    2  
ATOM   3898  H HA   . ARG B 1 46 ? -15.907 9.854   -10.915 1.00 0.00 ? 46  ARG B HA   2  
ATOM   3899  H HB2  . ARG B 1 46 ? -18.281 10.706  -10.128 1.00 0.00 ? 46  ARG B HB2  2  
ATOM   3900  H HB3  . ARG B 1 46 ? -17.415 11.229  -8.690  1.00 0.00 ? 46  ARG B HB3  2  
ATOM   3901  H HG2  . ARG B 1 46 ? -16.528 11.985  -11.493 1.00 0.00 ? 46  ARG B HG2  2  
ATOM   3902  H HG3  . ARG B 1 46 ? -17.650 12.962  -10.556 1.00 0.00 ? 46  ARG B HG3  2  
ATOM   3903  H HD2  . ARG B 1 46 ? -15.872 12.981  -8.711  1.00 0.00 ? 46  ARG B HD2  2  
ATOM   3904  H HD3  . ARG B 1 46 ? -14.762 12.338  -9.927  1.00 0.00 ? 46  ARG B HD3  2  
ATOM   3905  H HE   . ARG B 1 46 ? -15.875 14.548  -11.157 1.00 0.00 ? 46  ARG B HE   2  
ATOM   3906  H HH11 . ARG B 1 46 ? -14.308 13.885  -8.160  1.00 0.00 ? 46  ARG B HH11 2  
ATOM   3907  H HH12 . ARG B 1 46 ? -13.606 15.464  -8.025  1.00 0.00 ? 46  ARG B HH12 2  
ATOM   3908  H HH21 . ARG B 1 46 ? -14.969 16.612  -11.000 1.00 0.00 ? 46  ARG B HH21 2  
ATOM   3909  H HH22 . ARG B 1 46 ? -13.981 17.007  -9.633  1.00 0.00 ? 46  ARG B HH22 2  
ATOM   3910  N N    . SER B 1 47 ? -14.360 8.933   -8.850  1.00 0.00 ? 47  SER B N    2  
ATOM   3911  C CA   . SER B 1 47 ? -13.222 8.947   -7.907  1.00 0.00 ? 47  SER B CA   2  
ATOM   3912  C C    . SER B 1 47 ? -12.305 7.790   -8.276  1.00 0.00 ? 47  SER B C    2  
ATOM   3913  O O    . SER B 1 47 ? -11.839 7.688   -9.393  1.00 0.00 ? 47  SER B O    2  
ATOM   3914  C CB   . SER B 1 47 ? -13.716 8.808   -6.461  1.00 0.00 ? 47  SER B CB   2  
ATOM   3915  O OG   . SER B 1 47 ? -14.114 7.468   -6.215  1.00 0.00 ? 47  SER B OG   2  
ATOM   3916  H H    . SER B 1 47 ? -14.481 8.165   -9.443  1.00 0.00 ? 47  SER B H    2  
ATOM   3917  H HA   . SER B 1 47 ? -12.684 9.871   -8.014  1.00 0.00 ? 47  SER B HA   2  
ATOM   3918  H HB2  . SER B 1 47 ? -12.920 9.069   -5.781  1.00 0.00 ? 47  SER B HB2  2  
ATOM   3919  H HB3  . SER B 1 47 ? -14.551 9.478   -6.301  1.00 0.00 ? 47  SER B HB3  2  
ATOM   3920  H HG   . SER B 1 47 ? -14.293 7.379   -5.276  1.00 0.00 ? 47  SER B HG   2  
ATOM   3921  N N    . LYS B 1 48 ? -12.064 6.913   -7.362  1.00 0.00 ? 48  LYS B N    2  
ATOM   3922  C CA   . LYS B 1 48 ? -11.197 5.745   -7.649  1.00 0.00 ? 48  LYS B CA   2  
ATOM   3923  C C    . LYS B 1 48 ? -11.498 4.676   -6.614  1.00 0.00 ? 48  LYS B C    2  
ATOM   3924  O O    . LYS B 1 48 ? -12.394 3.869   -6.770  1.00 0.00 ? 48  LYS B O    2  
ATOM   3925  C CB   . LYS B 1 48 ? -9.718  6.143   -7.542  1.00 0.00 ? 48  LYS B CB   2  
ATOM   3926  C CG   . LYS B 1 48 ? -9.326  7.053   -8.712  1.00 0.00 ? 48  LYS B CG   2  
ATOM   3927  C CD   . LYS B 1 48 ? -7.801  7.104   -8.832  1.00 0.00 ? 48  LYS B CD   2  
ATOM   3928  C CE   . LYS B 1 48 ? -7.409  7.950   -10.046 1.00 0.00 ? 48  LYS B CE   2  
ATOM   3929  N NZ   . LYS B 1 48 ? -5.983  7.694   -10.389 1.00 0.00 ? 48  LYS B NZ   2  
ATOM   3930  H H    . LYS B 1 48 ? -12.476 7.006   -6.484  1.00 0.00 ? 48  LYS B H    2  
ATOM   3931  H HA   . LYS B 1 48 ? -11.406 5.366   -8.638  1.00 0.00 ? 48  LYS B HA   2  
ATOM   3932  H HB2  . LYS B 1 48 ? -9.555  6.666   -6.612  1.00 0.00 ? 48  LYS B HB2  2  
ATOM   3933  H HB3  . LYS B 1 48 ? -9.108  5.251   -7.563  1.00 0.00 ? 48  LYS B HB3  2  
ATOM   3934  H HG2  . LYS B 1 48 ? -9.745  6.666   -9.629  1.00 0.00 ? 48  LYS B HG2  2  
ATOM   3935  H HG3  . LYS B 1 48 ? -9.701  8.049   -8.534  1.00 0.00 ? 48  LYS B HG3  2  
ATOM   3936  H HD2  . LYS B 1 48 ? -7.384  7.542   -7.937  1.00 0.00 ? 48  LYS B HD2  2  
ATOM   3937  H HD3  . LYS B 1 48 ? -7.416  6.102   -8.955  1.00 0.00 ? 48  LYS B HD3  2  
ATOM   3938  H HE2  . LYS B 1 48 ? -8.035  7.686   -10.887 1.00 0.00 ? 48  LYS B HE2  2  
ATOM   3939  H HE3  . LYS B 1 48 ? -7.542  8.995   -9.813  1.00 0.00 ? 48  LYS B HE3  2  
ATOM   3940  H HZ1  . LYS B 1 48 ? -5.589  6.990   -9.731  1.00 0.00 ? 48  LYS B HZ1  2  
ATOM   3941  H HZ2  . LYS B 1 48 ? -5.918  7.333   -11.362 1.00 0.00 ? 48  LYS B HZ2  2  
ATOM   3942  H HZ3  . LYS B 1 48 ? -5.444  8.580   -10.314 1.00 0.00 ? 48  LYS B HZ3  2  
ATOM   3943  N N    . GLN B 1 49 ? -10.747 4.687   -5.544  1.00 0.00 ? 49  GLN B N    2  
ATOM   3944  C CA   . GLN B 1 49 ? -10.936 3.698   -4.447  1.00 0.00 ? 49  GLN B CA   2  
ATOM   3945  C C    . GLN B 1 49 ? -11.103 4.463   -3.123  1.00 0.00 ? 49  GLN B C    2  
ATOM   3946  O O    . GLN B 1 49 ? -10.480 5.484   -2.903  1.00 0.00 ? 49  GLN B O    2  
ATOM   3947  C CB   . GLN B 1 49 ? -9.680  2.798   -4.398  1.00 0.00 ? 49  GLN B CB   2  
ATOM   3948  C CG   . GLN B 1 49 ? -9.980  1.415   -4.997  1.00 0.00 ? 49  GLN B CG   2  
ATOM   3949  C CD   . GLN B 1 49 ? -8.761  0.507   -4.826  1.00 0.00 ? 49  GLN B CD   2  
ATOM   3950  O OE1  . GLN B 1 49 ? -8.848  -0.689  -5.021  1.00 0.00 ? 49  GLN B OE1  2  
ATOM   3951  N NE2  . GLN B 1 49 ? -7.620  1.029   -4.467  1.00 0.00 ? 49  GLN B NE2  2  
ATOM   3952  H H    . GLN B 1 49 ? -10.045 5.365   -5.460  1.00 0.00 ? 49  GLN B H    2  
ATOM   3953  H HA   . GLN B 1 49 ? -11.822 3.100   -4.628  1.00 0.00 ? 49  GLN B HA   2  
ATOM   3954  H HB2  . GLN B 1 49 ? -8.893  3.263   -4.972  1.00 0.00 ? 49  GLN B HB2  2  
ATOM   3955  H HB3  . GLN B 1 49 ? -9.347  2.682   -3.379  1.00 0.00 ? 49  GLN B HB3  2  
ATOM   3956  H HG2  . GLN B 1 49 ? -10.829 0.979   -4.493  1.00 0.00 ? 49  GLN B HG2  2  
ATOM   3957  H HG3  . GLN B 1 49 ? -10.202 1.521   -6.048  1.00 0.00 ? 49  GLN B HG3  2  
ATOM   3958  H HE21 . GLN B 1 49 ? -7.548  1.993   -4.311  1.00 0.00 ? 49  GLN B HE21 2  
ATOM   3959  H HE22 . GLN B 1 49 ? -6.833  0.455   -4.355  1.00 0.00 ? 49  GLN B HE22 2  
ATOM   3960  N N    . VAL B 1 50 ? -11.938 3.972   -2.241  1.00 0.00 ? 50  VAL B N    2  
ATOM   3961  C CA   . VAL B 1 50 ? -12.150 4.655   -0.924  1.00 0.00 ? 50  VAL B CA   2  
ATOM   3962  C C    . VAL B 1 50 ? -12.159 3.607   0.181   1.00 0.00 ? 50  VAL B C    2  
ATOM   3963  O O    . VAL B 1 50 ? -12.938 2.679   0.156   1.00 0.00 ? 50  VAL B O    2  
ATOM   3964  C CB   . VAL B 1 50 ? -13.490 5.395   -0.936  1.00 0.00 ? 50  VAL B CB   2  
ATOM   3965  C CG1  . VAL B 1 50 ? -13.566 6.325   0.278   1.00 0.00 ? 50  VAL B CG1  2  
ATOM   3966  C CG2  . VAL B 1 50 ? -13.610 6.213   -2.227  1.00 0.00 ? 50  VAL B CG2  2  
ATOM   3967  H H    . VAL B 1 50 ? -12.425 3.145   -2.443  1.00 0.00 ? 50  VAL B H    2  
ATOM   3968  H HA   . VAL B 1 50 ? -11.350 5.358   -0.738  1.00 0.00 ? 50  VAL B HA   2  
ATOM   3969  H HB   . VAL B 1 50 ? -14.298 4.678   -0.887  1.00 0.00 ? 50  VAL B HB   2  
ATOM   3970  H HG11 . VAL B 1 50 ? -13.469 5.746   1.183   1.00 0.00 ? 50  VAL B HG11 2  
ATOM   3971  H HG12 . VAL B 1 50 ? -12.767 7.049   0.226   1.00 0.00 ? 50  VAL B HG12 2  
ATOM   3972  H HG13 . VAL B 1 50 ? -14.517 6.838   0.279   1.00 0.00 ? 50  VAL B HG13 2  
ATOM   3973  H HG21 . VAL B 1 50 ? -12.652 6.652   -2.469  1.00 0.00 ? 50  VAL B HG21 2  
ATOM   3974  H HG22 . VAL B 1 50 ? -13.921 5.566   -3.032  1.00 0.00 ? 50  VAL B HG22 2  
ATOM   3975  H HG23 . VAL B 1 50 ? -14.342 6.997   -2.093  1.00 0.00 ? 50  VAL B HG23 2  
ATOM   3976  N N    . CYS B 1 51 ? -11.301 3.747   1.153   1.00 0.00 ? 51  CYS B N    2  
ATOM   3977  C CA   . CYS B 1 51 ? -11.254 2.749   2.256   1.00 0.00 ? 51  CYS B CA   2  
ATOM   3978  C C    . CYS B 1 51 ? -12.477 2.921   3.154   1.00 0.00 ? 51  CYS B C    2  
ATOM   3979  O O    . CYS B 1 51 ? -13.035 3.995   3.264   1.00 0.00 ? 51  CYS B O    2  
ATOM   3980  C CB   . CYS B 1 51 ? -9.983  2.969   3.079   1.00 0.00 ? 51  CYS B CB   2  
ATOM   3981  S SG   . CYS B 1 51 ? -8.528  2.745   2.025   1.00 0.00 ? 51  CYS B SG   2  
ATOM   3982  H H    . CYS B 1 51 ? -10.682 4.505   1.153   1.00 0.00 ? 51  CYS B H    2  
ATOM   3983  H HA   . CYS B 1 51 ? -11.245 1.752   1.842   1.00 0.00 ? 51  CYS B HA   2  
ATOM   3984  H HB2  . CYS B 1 51 ? -9.985  3.970   3.483   1.00 0.00 ? 51  CYS B HB2  2  
ATOM   3985  H HB3  . CYS B 1 51 ? -9.954  2.258   3.886   1.00 0.00 ? 51  CYS B HB3  2  
ATOM   3986  N N    . ALA B 1 52 ? -12.904 1.863   3.793   1.00 0.00 ? 52  ALA B N    2  
ATOM   3987  C CA   . ALA B 1 52 ? -14.102 1.950   4.683   1.00 0.00 ? 52  ALA B CA   2  
ATOM   3988  C C    . ALA B 1 52 ? -13.902 1.045   5.902   1.00 0.00 ? 52  ALA B C    2  
ATOM   3989  O O    . ALA B 1 52 ? -13.437 -0.073  5.790   1.00 0.00 ? 52  ALA B O    2  
ATOM   3990  C CB   . ALA B 1 52 ? -15.339 1.488   3.910   1.00 0.00 ? 52  ALA B CB   2  
ATOM   3991  H H    . ALA B 1 52 ? -12.440 1.006   3.681   1.00 0.00 ? 52  ALA B H    2  
ATOM   3992  H HA   . ALA B 1 52 ? -14.244 2.972   5.012   1.00 0.00 ? 52  ALA B HA   2  
ATOM   3993  H HB1  . ALA B 1 52 ? -15.381 1.998   2.959   1.00 0.00 ? 52  ALA B HB1  2  
ATOM   3994  H HB2  . ALA B 1 52 ? -15.283 0.421   3.745   1.00 0.00 ? 52  ALA B HB2  2  
ATOM   3995  H HB3  . ALA B 1 52 ? -16.227 1.718   4.481   1.00 0.00 ? 52  ALA B HB3  2  
ATOM   3996  N N    . ASP B 1 53 ? -14.251 1.526   7.065   1.00 0.00 ? 53  ASP B N    2  
ATOM   3997  C CA   . ASP B 1 53 ? -14.086 0.705   8.300   1.00 0.00 ? 53  ASP B CA   2  
ATOM   3998  C C    . ASP B 1 53 ? -15.084 -0.480  8.272   1.00 0.00 ? 53  ASP B C    2  
ATOM   3999  O O    . ASP B 1 53 ? -16.274 -0.242  8.279   1.00 0.00 ? 53  ASP B O    2  
ATOM   4000  C CB   . ASP B 1 53 ? -14.402 1.577   9.518   1.00 0.00 ? 53  ASP B CB   2  
ATOM   4001  C CG   . ASP B 1 53 ? -13.267 2.579   9.741   1.00 0.00 ? 53  ASP B CG   2  
ATOM   4002  O OD1  . ASP B 1 53 ? -12.319 2.226   10.421  1.00 0.00 ? 53  ASP B OD1  2  
ATOM   4003  O OD2  . ASP B 1 53 ? -13.369 3.683   9.230   1.00 0.00 ? 53  ASP B OD2  2  
ATOM   4004  H H    . ASP B 1 53 ? -14.622 2.431   7.128   1.00 0.00 ? 53  ASP B H    2  
ATOM   4005  H HA   . ASP B 1 53 ? -13.070 0.368   8.364   1.00 0.00 ? 53  ASP B HA   2  
ATOM   4006  H HB2  . ASP B 1 53 ? -15.325 2.111   9.347   1.00 0.00 ? 53  ASP B HB2  2  
ATOM   4007  H HB3  . ASP B 1 53 ? -14.503 0.951   10.391  1.00 0.00 ? 53  ASP B HB3  2  
ATOM   4008  N N    . PRO B 1 54 ? -14.612 -1.721  8.245   1.00 0.00 ? 54  PRO B N    2  
ATOM   4009  C CA   . PRO B 1 54 ? -15.536 -2.875  8.224   1.00 0.00 ? 54  PRO B CA   2  
ATOM   4010  C C    . PRO B 1 54 ? -16.376 -2.895  9.510   1.00 0.00 ? 54  PRO B C    2  
ATOM   4011  O O    . PRO B 1 54 ? -17.301 -3.670  9.648   1.00 0.00 ? 54  PRO B O    2  
ATOM   4012  C CB   . PRO B 1 54 ? -14.626 -4.122  8.140   1.00 0.00 ? 54  PRO B CB   2  
ATOM   4013  C CG   . PRO B 1 54 ? -13.151 -3.630  8.165   1.00 0.00 ? 54  PRO B CG   2  
ATOM   4014  C CD   . PRO B 1 54 ? -13.174 -2.086  8.230   1.00 0.00 ? 54  PRO B CD   2  
ATOM   4015  H HA   . PRO B 1 54 ? -16.179 -2.823  7.358   1.00 0.00 ? 54  PRO B HA   2  
ATOM   4016  H HB2  . PRO B 1 54 ? -14.812 -4.778  8.983   1.00 0.00 ? 54  PRO B HB2  2  
ATOM   4017  H HB3  . PRO B 1 54 ? -14.817 -4.654  7.217   1.00 0.00 ? 54  PRO B HB3  2  
ATOM   4018  H HG2  . PRO B 1 54 ? -12.642 -4.032  9.036   1.00 0.00 ? 54  PRO B HG2  2  
ATOM   4019  H HG3  . PRO B 1 54 ? -12.638 -3.951  7.269   1.00 0.00 ? 54  PRO B HG3  2  
ATOM   4020  H HD2  . PRO B 1 54 ? -12.687 -1.744  9.135   1.00 0.00 ? 54  PRO B HD2  2  
ATOM   4021  H HD3  . PRO B 1 54 ? -12.693 -1.664  7.358   1.00 0.00 ? 54  PRO B HD3  2  
ATOM   4022  N N    . SER B 1 55 ? -16.050 -2.057  10.452  1.00 0.00 ? 55  SER B N    2  
ATOM   4023  C CA   . SER B 1 55 ? -16.815 -2.037  11.731  1.00 0.00 ? 55  SER B CA   2  
ATOM   4024  C C    . SER B 1 55 ? -18.158 -1.334  11.522  1.00 0.00 ? 55  SER B C    2  
ATOM   4025  O O    . SER B 1 55 ? -19.078 -1.498  12.297  1.00 0.00 ? 55  SER B O    2  
ATOM   4026  C CB   . SER B 1 55 ? -16.010 -1.289  12.794  1.00 0.00 ? 55  SER B CB   2  
ATOM   4027  O OG   . SER B 1 55 ? -16.730 -1.296  14.020  1.00 0.00 ? 55  SER B OG   2  
ATOM   4028  H H    . SER B 1 55 ? -15.292 -1.451  10.324  1.00 0.00 ? 55  SER B H    2  
ATOM   4029  H HA   . SER B 1 55 ? -16.988 -3.051  12.061  1.00 0.00 ? 55  SER B HA   2  
ATOM   4030  H HB2  . SER B 1 55 ? -15.060 -1.776  12.938  1.00 0.00 ? 55  SER B HB2  2  
ATOM   4031  H HB3  . SER B 1 55 ? -15.844 -0.271  12.467  1.00 0.00 ? 55  SER B HB3  2  
ATOM   4032  H HG   . SER B 1 55 ? -16.118 -1.073  14.725  1.00 0.00 ? 55  SER B HG   2  
ATOM   4033  N N    . GLU B 1 56 ? -18.284 -0.558  10.480  1.00 0.00 ? 56  GLU B N    2  
ATOM   4034  C CA   . GLU B 1 56 ? -19.576 0.141   10.231  1.00 0.00 ? 56  GLU B CA   2  
ATOM   4035  C C    . GLU B 1 56 ? -20.548 -0.830  9.552   1.00 0.00 ? 56  GLU B C    2  
ATOM   4036  O O    . GLU B 1 56 ? -20.302 -1.328  8.470   1.00 0.00 ? 56  GLU B O    2  
ATOM   4037  C CB   . GLU B 1 56 ? -19.338 1.357   9.334   1.00 0.00 ? 56  GLU B CB   2  
ATOM   4038  C CG   . GLU B 1 56 ? -18.777 2.514   10.166  1.00 0.00 ? 56  GLU B CG   2  
ATOM   4039  C CD   . GLU B 1 56 ? -19.886 3.097   11.043  1.00 0.00 ? 56  GLU B CD   2  
ATOM   4040  O OE1  . GLU B 1 56 ? -20.922 3.445   10.500  1.00 0.00 ? 56  GLU B OE1  2  
ATOM   4041  O OE2  . GLU B 1 56 ? -19.682 3.187   12.242  1.00 0.00 ? 56  GLU B OE2  2  
ATOM   4042  H H    . GLU B 1 56 ? -17.533 -0.441  9.860   1.00 0.00 ? 56  GLU B H    2  
ATOM   4043  H HA   . GLU B 1 56 ? -19.999 0.464   11.172  1.00 0.00 ? 56  GLU B HA   2  
ATOM   4044  H HB2  . GLU B 1 56 ? -18.631 1.097   8.564   1.00 0.00 ? 56  GLU B HB2  2  
ATOM   4045  H HB3  . GLU B 1 56 ? -20.269 1.660   8.883   1.00 0.00 ? 56  GLU B HB3  2  
ATOM   4046  H HG2  . GLU B 1 56 ? -17.975 2.150   10.794  1.00 0.00 ? 56  GLU B HG2  2  
ATOM   4047  H HG3  . GLU B 1 56 ? -18.399 3.282   9.508   1.00 0.00 ? 56  GLU B HG3  2  
ATOM   4048  N N    . SER B 1 57 ? -21.639 -1.110  10.201  1.00 0.00 ? 57  SER B N    2  
ATOM   4049  C CA   . SER B 1 57 ? -22.643 -2.059  9.643   1.00 0.00 ? 57  SER B CA   2  
ATOM   4050  C C    . SER B 1 57 ? -23.003 -1.711  8.196   1.00 0.00 ? 57  SER B C    2  
ATOM   4051  O O    . SER B 1 57 ? -23.202 -2.588  7.378   1.00 0.00 ? 57  SER B O    2  
ATOM   4052  C CB   . SER B 1 57 ? -23.908 -2.010  10.500  1.00 0.00 ? 57  SER B CB   2  
ATOM   4053  O OG   . SER B 1 57 ? -23.605 -2.465  11.812  1.00 0.00 ? 57  SER B OG   2  
ATOM   4054  H H    . SER B 1 57 ? -21.796 -0.701  11.074  1.00 0.00 ? 57  SER B H    2  
ATOM   4055  H HA   . SER B 1 57 ? -22.239 -3.057  9.674   1.00 0.00 ? 57  SER B HA   2  
ATOM   4056  H HB2  . SER B 1 57 ? -24.271 -0.997  10.551  1.00 0.00 ? 57  SER B HB2  2  
ATOM   4057  H HB3  . SER B 1 57 ? -24.668 -2.639  10.055  1.00 0.00 ? 57  SER B HB3  2  
ATOM   4058  H HG   . SER B 1 57 ? -24.029 -1.872  12.437  1.00 0.00 ? 57  SER B HG   2  
ATOM   4059  N N    . TRP B 1 58 ? -23.116 -0.454  7.866   1.00 0.00 ? 58  TRP B N    2  
ATOM   4060  C CA   . TRP B 1 58 ? -23.494 -0.104  6.469   1.00 0.00 ? 58  TRP B CA   2  
ATOM   4061  C C    . TRP B 1 58 ? -22.434 -0.628  5.502   1.00 0.00 ? 58  TRP B C    2  
ATOM   4062  O O    . TRP B 1 58 ? -22.727 -0.975  4.378   1.00 0.00 ? 58  TRP B O    2  
ATOM   4063  C CB   . TRP B 1 58 ? -23.690 1.414   6.327   1.00 0.00 ? 58  TRP B CB   2  
ATOM   4064  C CG   . TRP B 1 58 ? -22.385 2.140   6.183   1.00 0.00 ? 58  TRP B CG   2  
ATOM   4065  C CD1  . TRP B 1 58 ? -21.796 2.871   7.157   1.00 0.00 ? 58  TRP B CD1  2  
ATOM   4066  C CD2  . TRP B 1 58 ? -21.524 2.254   5.008   1.00 0.00 ? 58  TRP B CD2  2  
ATOM   4067  N NE1  . TRP B 1 58 ? -20.628 3.422   6.661   1.00 0.00 ? 58  TRP B NE1  2  
ATOM   4068  C CE2  . TRP B 1 58 ? -20.410 3.069   5.347   1.00 0.00 ? 58  TRP B CE2  2  
ATOM   4069  C CE3  . TRP B 1 58 ? -21.593 1.732   3.696   1.00 0.00 ? 58  TRP B CE3  2  
ATOM   4070  C CZ2  . TRP B 1 58 ? -19.400 3.358   4.416   1.00 0.00 ? 58  TRP B CZ2  2  
ATOM   4071  C CZ3  . TRP B 1 58 ? -20.579 2.020   2.756   1.00 0.00 ? 58  TRP B CZ3  2  
ATOM   4072  C CH2  . TRP B 1 58 ? -19.486 2.830   3.118   1.00 0.00 ? 58  TRP B CH2  2  
ATOM   4073  H H    . TRP B 1 58 ? -22.965 0.249   8.529   1.00 0.00 ? 58  TRP B H    2  
ATOM   4074  H HA   . TRP B 1 58 ? -24.431 -0.595  6.241   1.00 0.00 ? 58  TRP B HA   2  
ATOM   4075  H HB2  . TRP B 1 58 ? -24.297 1.608   5.456   1.00 0.00 ? 58  TRP B HB2  2  
ATOM   4076  H HB3  . TRP B 1 58 ? -24.205 1.784   7.201   1.00 0.00 ? 58  TRP B HB3  2  
ATOM   4077  H HD1  . TRP B 1 58 ? -22.177 3.004   8.158   1.00 0.00 ? 58  TRP B HD1  2  
ATOM   4078  H HE1  . TRP B 1 58 ? -20.017 3.995   7.165   1.00 0.00 ? 58  TRP B HE1  2  
ATOM   4079  H HE3  . TRP B 1 58 ? -22.427 1.115   3.410   1.00 0.00 ? 58  TRP B HE3  2  
ATOM   4080  H HZ2  . TRP B 1 58 ? -18.564 3.980   4.695   1.00 0.00 ? 58  TRP B HZ2  2  
ATOM   4081  H HZ3  . TRP B 1 58 ? -20.642 1.615   1.757   1.00 0.00 ? 58  TRP B HZ3  2  
ATOM   4082  H HH2  . TRP B 1 58 ? -18.712 3.048   2.396   1.00 0.00 ? 58  TRP B HH2  2  
ATOM   4083  N N    . VAL B 1 59 ? -21.212 -0.716  5.937   1.00 0.00 ? 59  VAL B N    2  
ATOM   4084  C CA   . VAL B 1 59 ? -20.154 -1.240  5.037   1.00 0.00 ? 59  VAL B CA   2  
ATOM   4085  C C    . VAL B 1 59 ? -20.431 -2.715  4.770   1.00 0.00 ? 59  VAL B C    2  
ATOM   4086  O O    . VAL B 1 59 ? -20.369 -3.177  3.649   1.00 0.00 ? 59  VAL B O    2  
ATOM   4087  C CB   . VAL B 1 59 ? -18.794 -1.076  5.711   1.00 0.00 ? 59  VAL B CB   2  
ATOM   4088  C CG1  . VAL B 1 59 ? -17.698 -1.676  4.827   1.00 0.00 ? 59  VAL B CG1  2  
ATOM   4089  C CG2  . VAL B 1 59 ? -18.532 0.415   5.916   1.00 0.00 ? 59  VAL B CG2  2  
ATOM   4090  H H    . VAL B 1 59 ? -20.994 -0.451  6.854   1.00 0.00 ? 59  VAL B H    2  
ATOM   4091  H HA   . VAL B 1 59 ? -20.167 -0.696  4.106   1.00 0.00 ? 59  VAL B HA   2  
ATOM   4092  H HB   . VAL B 1 59 ? -18.799 -1.579  6.667   1.00 0.00 ? 59  VAL B HB   2  
ATOM   4093  H HG11 . VAL B 1 59 ? -17.859 -1.383  3.802   1.00 0.00 ? 59  VAL B HG11 2  
ATOM   4094  H HG12 . VAL B 1 59 ? -16.734 -1.319  5.155   1.00 0.00 ? 59  VAL B HG12 2  
ATOM   4095  H HG13 . VAL B 1 59 ? -17.726 -2.753  4.901   1.00 0.00 ? 59  VAL B HG13 2  
ATOM   4096  H HG21 . VAL B 1 59 ? -19.392 0.865   6.394   1.00 0.00 ? 59  VAL B HG21 2  
ATOM   4097  H HG22 . VAL B 1 59 ? -17.661 0.545   6.537   1.00 0.00 ? 59  VAL B HG22 2  
ATOM   4098  H HG23 . VAL B 1 59 ? -18.369 0.886   4.960   1.00 0.00 ? 59  VAL B HG23 2  
ATOM   4099  N N    . GLN B 1 60 ? -20.755 -3.454  5.790   1.00 0.00 ? 60  GLN B N    2  
ATOM   4100  C CA   . GLN B 1 60 ? -21.057 -4.898  5.588   1.00 0.00 ? 60  GLN B CA   2  
ATOM   4101  C C    . GLN B 1 60 ? -22.316 -5.035  4.726   1.00 0.00 ? 60  GLN B C    2  
ATOM   4102  O O    . GLN B 1 60 ? -22.434 -5.932  3.915   1.00 0.00 ? 60  GLN B O    2  
ATOM   4103  C CB   . GLN B 1 60 ? -21.288 -5.569  6.944   1.00 0.00 ? 60  GLN B CB   2  
ATOM   4104  C CG   . GLN B 1 60 ? -20.069 -5.344  7.840   1.00 0.00 ? 60  GLN B CG   2  
ATOM   4105  C CD   . GLN B 1 60 ? -20.370 -5.853  9.250   1.00 0.00 ? 60  GLN B CD   2  
ATOM   4106  O OE1  . GLN B 1 60 ? -20.613 -5.075  10.151  1.00 0.00 ? 60  GLN B OE1  2  
ATOM   4107  N NE2  . GLN B 1 60 ? -20.366 -7.138  9.482   1.00 0.00 ? 60  GLN B NE2  2  
ATOM   4108  H H    . GLN B 1 60 ? -20.813 -3.056  6.687   1.00 0.00 ? 60  GLN B H    2  
ATOM   4109  H HA   . GLN B 1 60 ? -20.227 -5.372  5.087   1.00 0.00 ? 60  GLN B HA   2  
ATOM   4110  H HB2  . GLN B 1 60 ? -22.163 -5.142  7.412   1.00 0.00 ? 60  GLN B HB2  2  
ATOM   4111  H HB3  . GLN B 1 60 ? -21.436 -6.629  6.801   1.00 0.00 ? 60  GLN B HB3  2  
ATOM   4112  H HG2  . GLN B 1 60 ? -19.222 -5.880  7.435   1.00 0.00 ? 60  GLN B HG2  2  
ATOM   4113  H HG3  . GLN B 1 60 ? -19.842 -4.290  7.881   1.00 0.00 ? 60  GLN B HG3  2  
ATOM   4114  H HE21 . GLN B 1 60 ? -20.170 -7.766  8.755   1.00 0.00 ? 60  GLN B HE21 2  
ATOM   4115  H HE22 . GLN B 1 60 ? -20.557 -7.475  10.382  1.00 0.00 ? 60  GLN B HE22 2  
ATOM   4116  N N    . GLU B 1 61 ? -23.261 -4.150  4.901   1.00 0.00 ? 61  GLU B N    2  
ATOM   4117  C CA   . GLU B 1 61 ? -24.519 -4.221  4.102   1.00 0.00 ? 61  GLU B CA   2  
ATOM   4118  C C    . GLU B 1 61 ? -24.218 -3.975  2.621   1.00 0.00 ? 61  GLU B C    2  
ATOM   4119  O O    . GLU B 1 61 ? -24.632 -4.726  1.760   1.00 0.00 ? 61  GLU B O    2  
ATOM   4120  C CB   . GLU B 1 61 ? -25.500 -3.158  4.603   1.00 0.00 ? 61  GLU B CB   2  
ATOM   4121  C CG   . GLU B 1 61 ? -26.858 -3.358  3.928   1.00 0.00 ? 61  GLU B CG   2  
ATOM   4122  C CD   . GLU B 1 61 ? -27.843 -2.306  4.439   1.00 0.00 ? 61  GLU B CD   2  
ATOM   4123  O OE1  . GLU B 1 61 ? -27.779 -1.985  5.615   1.00 0.00 ? 61  GLU B OE1  2  
ATOM   4124  O OE2  . GLU B 1 61 ? -28.644 -1.838  3.647   1.00 0.00 ? 61  GLU B OE2  2  
ATOM   4125  H H    . GLU B 1 61 ? -23.143 -3.438  5.564   1.00 0.00 ? 61  GLU B H    2  
ATOM   4126  H HA   . GLU B 1 61 ? -24.961 -5.197  4.218   1.00 0.00 ? 61  GLU B HA   2  
ATOM   4127  H HB2  . GLU B 1 61 ? -25.612 -3.249  5.674   1.00 0.00 ? 61  GLU B HB2  2  
ATOM   4128  H HB3  . GLU B 1 61 ? -25.122 -2.176  4.363   1.00 0.00 ? 61  GLU B HB3  2  
ATOM   4129  H HG2  . GLU B 1 61 ? -26.746 -3.258  2.858   1.00 0.00 ? 61  GLU B HG2  2  
ATOM   4130  H HG3  . GLU B 1 61 ? -27.235 -4.343  4.159   1.00 0.00 ? 61  GLU B HG3  2  
ATOM   4131  N N    . TYR B 1 62 ? -23.503 -2.928  2.318   1.00 0.00 ? 62  TYR B N    2  
ATOM   4132  C CA   . TYR B 1 62 ? -23.181 -2.629  0.892   1.00 0.00 ? 62  TYR B CA   2  
ATOM   4133  C C    . TYR B 1 62 ? -22.359 -3.779  0.299   1.00 0.00 ? 62  TYR B C    2  
ATOM   4134  O O    . TYR B 1 62 ? -22.509 -4.128  -0.854  1.00 0.00 ? 62  TYR B O    2  
ATOM   4135  C CB   . TYR B 1 62 ? -22.375 -1.322  0.805   1.00 0.00 ? 62  TYR B CB   2  
ATOM   4136  C CG   . TYR B 1 62 ? -23.300 -0.116  0.851   1.00 0.00 ? 62  TYR B CG   2  
ATOM   4137  C CD1  . TYR B 1 62 ? -24.235 0.033   1.899   1.00 0.00 ? 62  TYR B CD1  2  
ATOM   4138  C CD2  . TYR B 1 62 ? -23.216 0.869   -0.156  1.00 0.00 ? 62  TYR B CD2  2  
ATOM   4139  C CE1  . TYR B 1 62 ? -25.079 1.161   1.935   1.00 0.00 ? 62  TYR B CE1  2  
ATOM   4140  C CE2  . TYR B 1 62 ? -24.061 1.992   -0.118  1.00 0.00 ? 62  TYR B CE2  2  
ATOM   4141  C CZ   . TYR B 1 62 ? -24.992 2.139   0.927   1.00 0.00 ? 62  TYR B CZ   2  
ATOM   4142  O OH   . TYR B 1 62 ? -25.818 3.243   0.964   1.00 0.00 ? 62  TYR B OH   2  
ATOM   4143  H H    . TYR B 1 62 ? -23.183 -2.334  3.028   1.00 0.00 ? 62  TYR B H    2  
ATOM   4144  H HA   . TYR B 1 62 ? -24.100 -2.525  0.332   1.00 0.00 ? 62  TYR B HA   2  
ATOM   4145  H HB2  . TYR B 1 62 ? -21.690 -1.273  1.638   1.00 0.00 ? 62  TYR B HB2  2  
ATOM   4146  H HB3  . TYR B 1 62 ? -21.812 -1.306  -0.118  1.00 0.00 ? 62  TYR B HB3  2  
ATOM   4147  H HD1  . TYR B 1 62 ? -24.307 -0.715  2.671   1.00 0.00 ? 62  TYR B HD1  2  
ATOM   4148  H HD2  . TYR B 1 62 ? -22.502 0.759   -0.960  1.00 0.00 ? 62  TYR B HD2  2  
ATOM   4149  H HE1  . TYR B 1 62 ? -25.792 1.277   2.739   1.00 0.00 ? 62  TYR B HE1  2  
ATOM   4150  H HE2  . TYR B 1 62 ? -23.993 2.744   -0.891  1.00 0.00 ? 62  TYR B HE2  2  
ATOM   4151  H HH   . TYR B 1 62 ? -26.674 2.962   1.294   1.00 0.00 ? 62  TYR B HH   2  
ATOM   4152  N N    . VAL B 1 63 ? -21.496 -4.373  1.075   1.00 0.00 ? 63  VAL B N    2  
ATOM   4153  C CA   . VAL B 1 63 ? -20.680 -5.497  0.548   1.00 0.00 ? 63  VAL B CA   2  
ATOM   4154  C C    . VAL B 1 63 ? -21.614 -6.656  0.232   1.00 0.00 ? 63  VAL B C    2  
ATOM   4155  O O    . VAL B 1 63 ? -21.473 -7.333  -0.764  1.00 0.00 ? 63  VAL B O    2  
ATOM   4156  C CB   . VAL B 1 63 ? -19.658 -5.926  1.602   1.00 0.00 ? 63  VAL B CB   2  
ATOM   4157  C CG1  . VAL B 1 63 ? -18.973 -7.224  1.163   1.00 0.00 ? 63  VAL B CG1  2  
ATOM   4158  C CG2  . VAL B 1 63 ? -18.605 -4.826  1.764   1.00 0.00 ? 63  VAL B CG2  2  
ATOM   4159  H H    . VAL B 1 63 ? -21.393 -4.091  2.005   1.00 0.00 ? 63  VAL B H    2  
ATOM   4160  H HA   . VAL B 1 63 ? -20.171 -5.186  -0.351  1.00 0.00 ? 63  VAL B HA   2  
ATOM   4161  H HB   . VAL B 1 63 ? -20.162 -6.085  2.544   1.00 0.00 ? 63  VAL B HB   2  
ATOM   4162  H HG11 . VAL B 1 63 ? -18.678 -7.144  0.128   1.00 0.00 ? 63  VAL B HG11 2  
ATOM   4163  H HG12 . VAL B 1 63 ? -18.099 -7.395  1.775   1.00 0.00 ? 63  VAL B HG12 2  
ATOM   4164  H HG13 . VAL B 1 63 ? -19.660 -8.050  1.279   1.00 0.00 ? 63  VAL B HG13 2  
ATOM   4165  H HG21 . VAL B 1 63 ? -19.092 -3.862  1.802   1.00 0.00 ? 63  VAL B HG21 2  
ATOM   4166  H HG22 . VAL B 1 63 ? -18.053 -4.988  2.677   1.00 0.00 ? 63  VAL B HG22 2  
ATOM   4167  H HG23 . VAL B 1 63 ? -17.926 -4.851  0.924   1.00 0.00 ? 63  VAL B HG23 2  
ATOM   4168  N N    . TYR B 1 64 ? -22.572 -6.881  1.080   1.00 0.00 ? 64  TYR B N    2  
ATOM   4169  C CA   . TYR B 1 64 ? -23.524 -7.992  0.845   1.00 0.00 ? 64  TYR B CA   2  
ATOM   4170  C C    . TYR B 1 64 ? -24.288 -7.729  -0.450  1.00 0.00 ? 64  TYR B C    2  
ATOM   4171  O O    . TYR B 1 64 ? -24.489 -8.612  -1.259  1.00 0.00 ? 64  TYR B O    2  
ATOM   4172  C CB   . TYR B 1 64 ? -24.510 -8.066  2.016   1.00 0.00 ? 64  TYR B CB   2  
ATOM   4173  C CG   . TYR B 1 64 ? -25.186 -9.418  2.033   1.00 0.00 ? 64  TYR B CG   2  
ATOM   4174  C CD1  . TYR B 1 64 ? -24.469 -10.557 2.449   1.00 0.00 ? 64  TYR B CD1  2  
ATOM   4175  C CD2  . TYR B 1 64 ? -26.531 -9.541  1.632   1.00 0.00 ? 64  TYR B CD2  2  
ATOM   4176  C CE1  . TYR B 1 64 ? -25.098 -11.817 2.465   1.00 0.00 ? 64  TYR B CE1  2  
ATOM   4177  C CE2  . TYR B 1 64 ? -27.159 -10.801 1.648   1.00 0.00 ? 64  TYR B CE2  2  
ATOM   4178  C CZ   . TYR B 1 64 ? -26.443 -11.940 2.065   1.00 0.00 ? 64  TYR B CZ   2  
ATOM   4179  O OH   . TYR B 1 64 ? -27.058 -13.175 2.081   1.00 0.00 ? 64  TYR B OH   2  
ATOM   4180  H H    . TYR B 1 64 ? -22.665 -6.316  1.875   1.00 0.00 ? 64  TYR B H    2  
ATOM   4181  H HA   . TYR B 1 64 ? -22.977 -8.913  0.768   1.00 0.00 ? 64  TYR B HA   2  
ATOM   4182  H HB2  . TYR B 1 64 ? -23.973 -7.919  2.939   1.00 0.00 ? 64  TYR B HB2  2  
ATOM   4183  H HB3  . TYR B 1 64 ? -25.256 -7.291  1.911   1.00 0.00 ? 64  TYR B HB3  2  
ATOM   4184  H HD1  . TYR B 1 64 ? -23.439 -10.464 2.756   1.00 0.00 ? 64  TYR B HD1  2  
ATOM   4185  H HD2  . TYR B 1 64 ? -27.081 -8.668  1.312   1.00 0.00 ? 64  TYR B HD2  2  
ATOM   4186  H HE1  . TYR B 1 64 ? -24.549 -12.691 2.785   1.00 0.00 ? 64  TYR B HE1  2  
ATOM   4187  H HE2  . TYR B 1 64 ? -28.190 -10.895 1.342   1.00 0.00 ? 64  TYR B HE2  2  
ATOM   4188  H HH   . TYR B 1 64 ? -26.670 -13.690 2.792   1.00 0.00 ? 64  TYR B HH   2  
ATOM   4189  N N    . ASP B 1 65 ? -24.710 -6.515  -0.645  1.00 0.00 ? 65  ASP B N    2  
ATOM   4190  C CA   . ASP B 1 65 ? -25.465 -6.172  -1.883  1.00 0.00 ? 65  ASP B CA   2  
ATOM   4191  C C    . ASP B 1 65 ? -24.582 -6.427  -3.107  1.00 0.00 ? 65  ASP B C    2  
ATOM   4192  O O    . ASP B 1 65 ? -25.052 -6.824  -4.154  1.00 0.00 ? 65  ASP B O    2  
ATOM   4193  C CB   . ASP B 1 65 ? -25.860 -4.693  -1.831  1.00 0.00 ? 65  ASP B CB   2  
ATOM   4194  C CG   . ASP B 1 65 ? -27.086 -4.516  -0.930  1.00 0.00 ? 65  ASP B CG   2  
ATOM   4195  O OD1  . ASP B 1 65 ? -26.913 -4.508  0.278   1.00 0.00 ? 65  ASP B OD1  2  
ATOM   4196  O OD2  . ASP B 1 65 ? -28.176 -4.393  -1.463  1.00 0.00 ? 65  ASP B OD2  2  
ATOM   4197  H H    . ASP B 1 65 ? -24.528 -5.826  0.028   1.00 0.00 ? 65  ASP B H    2  
ATOM   4198  H HA   . ASP B 1 65 ? -26.352 -6.785  -1.946  1.00 0.00 ? 65  ASP B HA   2  
ATOM   4199  H HB2  . ASP B 1 65 ? -25.037 -4.116  -1.433  1.00 0.00 ? 65  ASP B HB2  2  
ATOM   4200  H HB3  . ASP B 1 65 ? -26.093 -4.346  -2.824  1.00 0.00 ? 65  ASP B HB3  2  
ATOM   4201  N N    . LEU B 1 66 ? -23.306 -6.200  -2.981  1.00 0.00 ? 66  LEU B N    2  
ATOM   4202  C CA   . LEU B 1 66 ? -22.386 -6.425  -4.130  1.00 0.00 ? 66  LEU B CA   2  
ATOM   4203  C C    . LEU B 1 66 ? -22.222 -7.930  -4.365  1.00 0.00 ? 66  LEU B C    2  
ATOM   4204  O O    . LEU B 1 66 ? -22.018 -8.375  -5.477  1.00 0.00 ? 66  LEU B O    2  
ATOM   4205  C CB   . LEU B 1 66 ? -21.025 -5.793  -3.804  1.00 0.00 ? 66  LEU B CB   2  
ATOM   4206  C CG   . LEU B 1 66 ? -21.067 -4.273  -4.071  1.00 0.00 ? 66  LEU B CG   2  
ATOM   4207  C CD1  . LEU B 1 66 ? -19.963 -3.578  -3.269  1.00 0.00 ? 66  LEU B CD1  2  
ATOM   4208  C CD2  . LEU B 1 66 ? -20.836 -3.985  -5.564  1.00 0.00 ? 66  LEU B CD2  2  
ATOM   4209  H H    . LEU B 1 66 ? -22.951 -5.878  -2.128  1.00 0.00 ? 66  LEU B H    2  
ATOM   4210  H HA   . LEU B 1 66 ? -22.799 -5.969  -5.015  1.00 0.00 ? 66  LEU B HA   2  
ATOM   4211  H HB2  . LEU B 1 66 ? -20.800 -5.970  -2.762  1.00 0.00 ? 66  LEU B HB2  2  
ATOM   4212  H HB3  . LEU B 1 66 ? -20.263 -6.250  -4.412  1.00 0.00 ? 66  LEU B HB3  2  
ATOM   4213  H HG   . LEU B 1 66 ? -22.027 -3.879  -3.771  1.00 0.00 ? 66  LEU B HG   2  
ATOM   4214  H HD11 . LEU B 1 66 ? -19.003 -3.968  -3.566  1.00 0.00 ? 66  LEU B HD11 2  
ATOM   4215  H HD12 . LEU B 1 66 ? -19.995 -2.515  -3.460  1.00 0.00 ? 66  LEU B HD12 2  
ATOM   4216  H HD13 . LEU B 1 66 ? -20.116 -3.758  -2.216  1.00 0.00 ? 66  LEU B HD13 2  
ATOM   4217  H HD21 . LEU B 1 66 ? -19.965 -4.522  -5.909  1.00 0.00 ? 66  LEU B HD21 2  
ATOM   4218  H HD22 . LEU B 1 66 ? -21.699 -4.293  -6.134  1.00 0.00 ? 66  LEU B HD22 2  
ATOM   4219  H HD23 . LEU B 1 66 ? -20.678 -2.926  -5.702  1.00 0.00 ? 66  LEU B HD23 2  
ATOM   4220  N N    . GLU B 1 67 ? -22.317 -8.713  -3.331  1.00 0.00 ? 67  GLU B N    2  
ATOM   4221  C CA   . GLU B 1 67 ? -22.175 -10.188 -3.496  1.00 0.00 ? 67  GLU B CA   2  
ATOM   4222  C C    . GLU B 1 67 ? -23.426 -10.737 -4.177  1.00 0.00 ? 67  GLU B C    2  
ATOM   4223  O O    . GLU B 1 67 ? -23.386 -11.738 -4.864  1.00 0.00 ? 67  GLU B O    2  
ATOM   4224  C CB   . GLU B 1 67 ? -22.019 -10.843 -2.123  1.00 0.00 ? 67  GLU B CB   2  
ATOM   4225  C CG   . GLU B 1 67 ? -20.651 -10.490 -1.546  1.00 0.00 ? 67  GLU B CG   2  
ATOM   4226  C CD   . GLU B 1 67 ? -20.409 -11.295 -0.268  1.00 0.00 ? 67  GLU B CD   2  
ATOM   4227  O OE1  . GLU B 1 67 ? -21.173 -12.212 -0.016  1.00 0.00 ? 67  GLU B OE1  2  
ATOM   4228  O OE2  . GLU B 1 67 ? -19.463 -10.983 0.435   1.00 0.00 ? 67  GLU B OE2  2  
ATOM   4229  H H    . GLU B 1 67 ? -22.484 -8.332  -2.444  1.00 0.00 ? 67  GLU B H    2  
ATOM   4230  H HA   . GLU B 1 67 ? -21.308 -10.403 -4.102  1.00 0.00 ? 67  GLU B HA   2  
ATOM   4231  H HB2  . GLU B 1 67 ? -22.794 -10.482 -1.462  1.00 0.00 ? 67  GLU B HB2  2  
ATOM   4232  H HB3  . GLU B 1 67 ? -22.101 -11.914 -2.222  1.00 0.00 ? 67  GLU B HB3  2  
ATOM   4233  H HG2  . GLU B 1 67 ? -19.887 -10.724 -2.272  1.00 0.00 ? 67  GLU B HG2  2  
ATOM   4234  H HG3  . GLU B 1 67 ? -20.621 -9.437  -1.318  1.00 0.00 ? 67  GLU B HG3  2  
ATOM   4235  N N    . LEU B 1 68 ? -24.537 -10.083 -3.993  1.00 0.00 ? 68  LEU B N    2  
ATOM   4236  C CA   . LEU B 1 68 ? -25.797 -10.559 -4.632  1.00 0.00 ? 68  LEU B CA   2  
ATOM   4237  C C    . LEU B 1 68 ? -25.796 -10.170 -6.111  1.00 0.00 ? 68  LEU B C    2  
ATOM   4238  O O    . LEU B 1 68 ? -25.428 -10.949 -6.968  1.00 0.00 ? 68  LEU B O    2  
ATOM   4239  C CB   . LEU B 1 68 ? -26.998 -9.917  -3.944  1.00 0.00 ? 68  LEU B CB   2  
ATOM   4240  C CG   . LEU B 1 68 ? -27.062 -10.365 -2.480  1.00 0.00 ? 68  LEU B CG   2  
ATOM   4241  C CD1  . LEU B 1 68 ? -28.212 -9.631  -1.799  1.00 0.00 ? 68  LEU B CD1  2  
ATOM   4242  C CD2  . LEU B 1 68 ? -27.295 -11.887 -2.390  1.00 0.00 ? 68  LEU B CD2  2  
ATOM   4243  H H    . LEU B 1 68 ? -24.539 -9.278  -3.435  1.00 0.00 ? 68  LEU B H    2  
ATOM   4244  H HA   . LEU B 1 68 ? -25.867 -11.627 -4.543  1.00 0.00 ? 68  LEU B HA   2  
ATOM   4245  H HB2  . LEU B 1 68 ? -26.903 -8.841  -3.987  1.00 0.00 ? 68  LEU B HB2  2  
ATOM   4246  H HB3  . LEU B 1 68 ? -27.904 -10.217 -4.449  1.00 0.00 ? 68  LEU B HB3  2  
ATOM   4247  H HG   . LEU B 1 68 ? -26.135 -10.109 -1.987  1.00 0.00 ? 68  LEU B HG   2  
ATOM   4248  H HD11 . LEU B 1 68 ? -28.133 -8.575  -2.004  1.00 0.00 ? 68  LEU B HD11 2  
ATOM   4249  H HD12 . LEU B 1 68 ? -29.149 -10.005 -2.184  1.00 0.00 ? 68  LEU B HD12 2  
ATOM   4250  H HD13 . LEU B 1 68 ? -28.164 -9.799  -0.735  1.00 0.00 ? 68  LEU B HD13 2  
ATOM   4251  H HD21 . LEU B 1 68 ? -27.909 -12.214 -3.217  1.00 0.00 ? 68  LEU B HD21 2  
ATOM   4252  H HD22 . LEU B 1 68 ? -26.345 -12.399 -2.425  1.00 0.00 ? 68  LEU B HD22 2  
ATOM   4253  H HD23 . LEU B 1 68 ? -27.792 -12.128 -1.460  1.00 0.00 ? 68  LEU B HD23 2  
ATOM   4254  N N    . ASN B 1 69 ? -26.206 -8.968  -6.417  1.00 0.00 ? 69  ASN B N    2  
ATOM   4255  C CA   . ASN B 1 69 ? -26.232 -8.521  -7.841  1.00 0.00 ? 69  ASN B CA   2  
ATOM   4256  C C    . ASN B 1 69 ? -24.883 -7.897  -8.203  1.00 0.00 ? 69  ASN B C    2  
ATOM   4257  O O    . ASN B 1 69 ? -23.961 -8.027  -7.415  1.00 0.00 ? 69  ASN B O    2  
ATOM   4258  C CB   . ASN B 1 69 ? -27.339 -7.481  -8.026  1.00 0.00 ? 69  ASN B CB   2  
ATOM   4259  C CG   . ASN B 1 69 ? -28.691 -8.106  -7.681  1.00 0.00 ? 69  ASN B CG   2  
ATOM   4260  O OD1  . ASN B 1 69 ? -28.855 -8.687  -6.626  1.00 0.00 ? 69  ASN B OD1  2  
ATOM   4261  N ND2  . ASN B 1 69 ? -29.676 -8.013  -8.534  1.00 0.00 ? 69  ASN B ND2  2  
ATOM   4262  O OXT  . ASN B 1 69 ? -24.795 -7.298  -9.262  1.00 0.00 ? 69  ASN B OXT  2  
ATOM   4263  H H    . ASN B 1 69 ? -26.498 -8.358  -5.711  1.00 0.00 ? 69  ASN B H    2  
ATOM   4264  H HA   . ASN B 1 69 ? -26.423 -9.366  -8.484  1.00 0.00 ? 69  ASN B HA   2  
ATOM   4265  H HB2  . ASN B 1 69 ? -27.154 -6.639  -7.373  1.00 0.00 ? 69  ASN B HB2  2  
ATOM   4266  H HB3  . ASN B 1 69 ? -27.350 -7.145  -9.051  1.00 0.00 ? 69  ASN B HB3  2  
ATOM   4267  H HD21 . ASN B 1 69 ? -29.544 -7.545  -9.384  1.00 0.00 ? 69  ASN B HD21 2  
ATOM   4268  H HD22 . ASN B 1 69 ? -30.546 -8.412  -8.322  1.00 0.00 ? 69  ASN B HD22 2  
HETATM 4269  O O    . HOH C 2 .  ? 6.136   1.574   5.506   1.00 0.00 ? 201 HOH A O    2  
HETATM 4270  H H1   . HOH C 2 .  ? 5.401   2.172   5.367   1.00 0.00 ? 201 HOH A H1   2  
HETATM 4271  H H2   . HOH C 2 .  ? 6.764   2.079   6.024   1.00 0.00 ? 201 HOH A H2   2  
HETATM 4272  O O    . HOH C 2 .  ? 4.210   5.674   6.296   1.00 0.00 ? 202 HOH A O    2  
HETATM 4273  H H1   . HOH C 2 .  ? 3.343   5.989   6.042   1.00 0.00 ? 202 HOH A H1   2  
HETATM 4274  H H2   . HOH C 2 .  ? 4.444   5.040   5.618   1.00 0.00 ? 202 HOH A H2   2  
HETATM 4275  O O    . HOH D 2 .  ? -6.257  -1.440  5.509   1.00 0.00 ? 301 HOH B O    2  
HETATM 4276  H H1   . HOH D 2 .  ? -5.577  -2.074  5.285   1.00 0.00 ? 301 HOH B H1   2  
HETATM 4277  H H2   . HOH D 2 .  ? -6.888  -1.936  6.033   1.00 0.00 ? 301 HOH B H2   2  
HETATM 4278  O O    . HOH D 2 .  ? -4.334  -5.526  6.361   1.00 0.00 ? 302 HOH B O    2  
HETATM 4279  H H1   . HOH D 2 .  ? -3.507  -5.963  6.155   1.00 0.00 ? 302 HOH B H1   2  
HETATM 4280  H H2   . HOH D 2 .  ? -4.641  -5.187  5.520   1.00 0.00 ? 302 HOH B H2   2  
ATOM   4281  N N    . ALA A 1 1  ? -7.965  14.716  -13.052 1.00 3.98 ? 1   ALA A N    3  
ATOM   4282  C CA   . ALA A 1 1  ? -7.238  15.841  -12.405 1.00 3.41 ? 1   ALA A CA   3  
ATOM   4283  C C    . ALA A 1 1  ? -7.448  15.810  -10.875 1.00 2.89 ? 1   ALA A C    3  
ATOM   4284  O O    . ALA A 1 1  ? -6.493  15.948  -10.137 1.00 2.91 ? 1   ALA A O    3  
ATOM   4285  C CB   . ALA A 1 1  ? -7.724  17.183  -13.004 1.00 3.83 ? 1   ALA A CB   3  
ATOM   4286  H H1   . ALA A 1 1  ? -8.125  13.961  -12.355 1.00 4.21 ? 1   ALA A H1   3  
ATOM   4287  H H2   . ALA A 1 1  ? -8.879  15.056  -13.413 1.00 4.33 ? 1   ALA A H2   3  
ATOM   4288  H H3   . ALA A 1 1  ? -7.400  14.347  -13.843 1.00 4.29 ? 1   ALA A H3   3  
ATOM   4289  H HA   . ALA A 1 1  ? -6.183  15.725  -12.607 1.00 3.58 ? 1   ALA A HA   3  
ATOM   4290  H HB1  . ALA A 1 1  ? -8.471  16.986  -13.757 1.00 4.06 ? 1   ALA A HB1  3  
ATOM   4291  H HB2  . ALA A 1 1  ? -8.156  17.806  -12.231 1.00 4.06 ? 1   ALA A HB2  3  
ATOM   4292  H HB3  . ALA A 1 1  ? -6.891  17.706  -13.459 1.00 4.22 ? 1   ALA A HB3  3  
ATOM   4293  N N    . PRO A 1 2  ? -8.678  15.641  -10.429 1.00 2.53 ? 2   PRO A N    3  
ATOM   4294  C CA   . PRO A 1 2  ? -8.966  15.612  -8.983  1.00 2.14 ? 2   PRO A CA   3  
ATOM   4295  C C    . PRO A 1 2  ? -8.352  14.351  -8.356  1.00 1.85 ? 2   PRO A C    3  
ATOM   4296  O O    . PRO A 1 2  ? -8.245  13.321  -8.989  1.00 1.89 ? 2   PRO A O    3  
ATOM   4297  C CB   . PRO A 1 2  ? -10.512 15.601  -8.884  1.00 1.96 ? 2   PRO A CB   3  
ATOM   4298  C CG   . PRO A 1 2  ? -11.070 15.568  -10.338 1.00 2.21 ? 2   PRO A CG   3  
ATOM   4299  C CD   . PRO A 1 2  ? -9.864  15.471  -11.298 1.00 2.60 ? 2   PRO A CD   3  
ATOM   4300  H HA   . PRO A 1 2  ? -8.569  16.495  -8.505  1.00 2.39 ? 2   PRO A HA   3  
ATOM   4301  H HB2  . PRO A 1 2  ? -10.849 14.728  -8.335  1.00 1.69 ? 2   PRO A HB2  3  
ATOM   4302  H HB3  . PRO A 1 2  ? -10.857 16.496  -8.384  1.00 2.13 ? 2   PRO A HB3  3  
ATOM   4303  H HG2  . PRO A 1 2  ? -11.719 14.709  -10.464 1.00 2.13 ? 2   PRO A HG2  3  
ATOM   4304  H HG3  . PRO A 1 2  ? -11.627 16.474  -10.541 1.00 2.39 ? 2   PRO A HG3  3  
ATOM   4305  H HD2  . PRO A 1 2  ? -9.851  14.498  -11.769 1.00 2.71 ? 2   PRO A HD2  3  
ATOM   4306  H HD3  . PRO A 1 2  ? -9.903  16.251  -12.040 1.00 2.93 ? 2   PRO A HD3  3  
ATOM   4307  N N    . MET A 1 3  ? -7.950  14.428  -7.117  1.00 1.69 ? 3   MET A N    3  
ATOM   4308  C CA   . MET A 1 3  ? -7.349  13.238  -6.455  1.00 1.53 ? 3   MET A CA   3  
ATOM   4309  C C    . MET A 1 3  ? -8.463  12.282  -6.024  1.00 1.17 ? 3   MET A C    3  
ATOM   4310  O O    . MET A 1 3  ? -9.609  12.664  -5.904  1.00 0.99 ? 3   MET A O    3  
ATOM   4311  C CB   . MET A 1 3  ? -6.553  13.683  -5.226  1.00 1.63 ? 3   MET A CB   3  
ATOM   4312  C CG   . MET A 1 3  ? -5.265  14.375  -5.676  1.00 2.15 ? 3   MET A CG   3  
ATOM   4313  S SD   . MET A 1 3  ? -4.418  15.070  -4.235  1.00 2.54 ? 3   MET A SD   3  
ATOM   4314  C CE   . MET A 1 3  ? -3.109  15.935  -5.137  1.00 3.59 ? 3   MET A CE   3  
ATOM   4315  H H    . MET A 1 3  ? -8.047  15.268  -6.621  1.00 1.78 ? 3   MET A H    3  
ATOM   4316  H HA   . MET A 1 3  ? -6.690  12.734  -7.147  1.00 1.74 ? 3   MET A HA   3  
ATOM   4317  H HB2  . MET A 1 3  ? -7.149  14.373  -4.644  1.00 1.99 ? 3   MET A HB2  3  
ATOM   4318  H HB3  . MET A 1 3  ? -6.307  12.823  -4.624  1.00 1.87 ? 3   MET A HB3  3  
ATOM   4319  H HG2  . MET A 1 3  ? -4.621  13.655  -6.159  1.00 2.61 ? 3   MET A HG2  3  
ATOM   4320  H HG3  . MET A 1 3  ? -5.504  15.167  -6.369  1.00 2.68 ? 3   MET A HG3  3  
ATOM   4321  H HE1  . MET A 1 3  ? -3.546  16.502  -5.948  1.00 3.92 ? 3   MET A HE1  3  
ATOM   4322  H HE2  . MET A 1 3  ? -2.588  16.601  -4.463  1.00 4.04 ? 3   MET A HE2  3  
ATOM   4323  H HE3  . MET A 1 3  ? -2.411  15.217  -5.539  1.00 4.01 ? 3   MET A HE3  3  
ATOM   4324  N N    . GLY A 1 4  ? -8.139  11.038  -5.796  1.00 1.14 ? 4   GLY A N    3  
ATOM   4325  C CA   . GLY A 1 4  ? -9.186  10.063  -5.378  1.00 0.89 ? 4   GLY A CA   3  
ATOM   4326  C C    . GLY A 1 4  ? -9.822  10.527  -4.067  1.00 0.62 ? 4   GLY A C    3  
ATOM   4327  O O    . GLY A 1 4  ? -9.556  11.610  -3.589  1.00 0.70 ? 4   GLY A O    3  
ATOM   4328  H H    . GLY A 1 4  ? -7.209  10.745  -5.900  1.00 1.36 ? 4   GLY A H    3  
ATOM   4329  H HA2  . GLY A 1 4  ? -9.941  10.003  -6.147  1.00 0.84 ? 4   GLY A HA2  3  
ATOM   4330  H HA3  . GLY A 1 4  ? -8.741  9.092   -5.234  1.00 1.04 ? 4   GLY A HA3  3  
ATOM   4331  N N    . SER A 1 5  ? -10.664 9.715   -3.481  1.00 0.44 ? 5   SER A N    3  
ATOM   4332  C CA   . SER A 1 5  ? -11.319 10.114  -2.200  1.00 0.30 ? 5   SER A CA   3  
ATOM   4333  C C    . SER A 1 5  ? -10.418 9.717   -1.018  1.00 0.27 ? 5   SER A C    3  
ATOM   4334  O O    . SER A 1 5  ? -9.933  10.558  -0.288  1.00 0.30 ? 5   SER A O    3  
ATOM   4335  C CB   . SER A 1 5  ? -12.697 9.439   -2.099  1.00 0.49 ? 5   SER A CB   3  
ATOM   4336  O OG   . SER A 1 5  ? -13.688 10.438  -1.901  1.00 1.52 ? 5   SER A OG   3  
ATOM   4337  H H    . SER A 1 5  ? -10.867 8.845   -3.884  1.00 0.56 ? 5   SER A H    3  
ATOM   4338  H HA   . SER A 1 5  ? -11.455 11.184  -2.194  1.00 0.39 ? 5   SER A HA   3  
ATOM   4339  H HB2  . SER A 1 5  ? -12.908 8.914   -3.015  1.00 0.93 ? 5   SER A HB2  3  
ATOM   4340  H HB3  . SER A 1 5  ? -12.715 8.737   -1.275  1.00 0.96 ? 5   SER A HB3  3  
ATOM   4341  H HG   . SER A 1 5  ? -13.287 11.292  -2.072  1.00 2.00 ? 5   SER A HG   3  
ATOM   4342  N N    . ASP A 1 6  ? -10.185 8.443   -0.828  1.00 0.24 ? 6   ASP A N    3  
ATOM   4343  C CA   . ASP A 1 6  ? -9.309  8.003   0.303   1.00 0.23 ? 6   ASP A CA   3  
ATOM   4344  C C    . ASP A 1 6  ? -8.757  6.596   0.016   1.00 0.21 ? 6   ASP A C    3  
ATOM   4345  O O    . ASP A 1 6  ? -9.131  5.648   0.678   1.00 0.20 ? 6   ASP A O    3  
ATOM   4346  C CB   . ASP A 1 6  ? -10.123 7.974   1.608   1.00 0.25 ? 6   ASP A CB   3  
ATOM   4347  C CG   . ASP A 1 6  ? -9.172  8.000   2.808   1.00 1.26 ? 6   ASP A CG   3  
ATOM   4348  O OD1  . ASP A 1 6  ? -7.986  7.803   2.603   1.00 2.03 ? 6   ASP A OD1  3  
ATOM   4349  O OD2  . ASP A 1 6  ? -9.647  8.218   3.910   1.00 2.00 ? 6   ASP A OD2  3  
ATOM   4350  H H    . ASP A 1 6  ? -10.580 7.778   -1.433  1.00 0.24 ? 6   ASP A H    3  
ATOM   4351  H HA   . ASP A 1 6  ? -8.489  8.697   0.409   1.00 0.25 ? 6   ASP A HA   3  
ATOM   4352  H HB2  . ASP A 1 6  ? -10.772 8.835   1.648   1.00 0.79 ? 6   ASP A HB2  3  
ATOM   4353  H HB3  . ASP A 1 6  ? -10.719 7.074   1.647   1.00 0.94 ? 6   ASP A HB3  3  
ATOM   4354  N N    . PRO A 1 7  ? -7.884  6.489   -0.964  1.00 0.22 ? 7   PRO A N    3  
ATOM   4355  C CA   . PRO A 1 7  ? -7.295  5.187   -1.329  1.00 0.22 ? 7   PRO A CA   3  
ATOM   4356  C C    . PRO A 1 7  ? -6.432  4.654   -0.164  1.00 0.20 ? 7   PRO A C    3  
ATOM   4357  O O    . PRO A 1 7  ? -6.120  5.394   0.747   1.00 0.20 ? 7   PRO A O    3  
ATOM   4358  C CB   . PRO A 1 7  ? -6.432  5.478   -2.582  1.00 0.25 ? 7   PRO A CB   3  
ATOM   4359  C CG   . PRO A 1 7  ? -6.525  7.007   -2.869  1.00 0.27 ? 7   PRO A CG   3  
ATOM   4360  C CD   . PRO A 1 7  ? -7.424  7.634   -1.780  1.00 0.26 ? 7   PRO A CD   3  
ATOM   4361  H HA   . PRO A 1 7  ? -8.080  4.491   -1.571  1.00 0.21 ? 7   PRO A HA   3  
ATOM   4362  H HB2  . PRO A 1 7  ? -5.401  5.195   -2.404  1.00 0.26 ? 7   PRO A HB2  3  
ATOM   4363  H HB3  . PRO A 1 7  ? -6.815  4.928   -3.431  1.00 0.27 ? 7   PRO A HB3  3  
ATOM   4364  H HG2  . PRO A 1 7  ? -5.535  7.449   -2.834  1.00 0.28 ? 7   PRO A HG2  3  
ATOM   4365  H HG3  . PRO A 1 7  ? -6.963  7.175   -3.843  1.00 0.29 ? 7   PRO A HG3  3  
ATOM   4366  H HD2  . PRO A 1 7  ? -6.853  8.324   -1.173  1.00 0.28 ? 7   PRO A HD2  3  
ATOM   4367  H HD3  . PRO A 1 7  ? -8.270  8.135   -2.225  1.00 0.28 ? 7   PRO A HD3  3  
ATOM   4368  N N    . PRO A 1 8  ? -6.060  3.390   -0.230  1.00 0.21 ? 8   PRO A N    3  
ATOM   4369  C CA   . PRO A 1 8  ? -5.222  2.774   0.820   1.00 0.22 ? 8   PRO A CA   3  
ATOM   4370  C C    . PRO A 1 8  ? -3.860  3.482   0.871   1.00 0.22 ? 8   PRO A C    3  
ATOM   4371  O O    . PRO A 1 8  ? -3.714  4.602   0.423   1.00 0.22 ? 8   PRO A O    3  
ATOM   4372  C CB   . PRO A 1 8  ? -5.070  1.295   0.386   1.00 0.24 ? 8   PRO A CB   3  
ATOM   4373  C CG   . PRO A 1 8  ? -5.701  1.159   -1.028  1.00 0.26 ? 8   PRO A CG   3  
ATOM   4374  C CD   . PRO A 1 8  ? -6.436  2.482   -1.335  1.00 0.24 ? 8   PRO A CD   3  
ATOM   4375  H HA   . PRO A 1 8  ? -5.715  2.835   1.778   1.00 0.22 ? 8   PRO A HA   3  
ATOM   4376  H HB2  . PRO A 1 8  ? -4.023  1.013   0.357   1.00 0.26 ? 8   PRO A HB2  3  
ATOM   4377  H HB3  . PRO A 1 8  ? -5.596  0.652   1.080   1.00 0.25 ? 8   PRO A HB3  3  
ATOM   4378  H HG2  . PRO A 1 8  ? -4.922  0.988   -1.763  1.00 0.28 ? 8   PRO A HG2  3  
ATOM   4379  H HG3  . PRO A 1 8  ? -6.404  0.336   -1.046  1.00 0.27 ? 8   PRO A HG3  3  
ATOM   4380  H HD2  . PRO A 1 8  ? -6.115  2.888   -2.286  1.00 0.25 ? 8   PRO A HD2  3  
ATOM   4381  H HD3  . PRO A 1 8  ? -7.503  2.322   -1.335  1.00 0.24 ? 8   PRO A HD3  3  
ATOM   4382  N N    . THR A 1 9  ? -2.862  2.833   1.410   1.00 0.23 ? 9   THR A N    3  
ATOM   4383  C CA   . THR A 1 9  ? -1.511  3.463   1.484   1.00 0.24 ? 9   THR A CA   3  
ATOM   4384  C C    . THR A 1 9  ? -0.442  2.373   1.493   1.00 0.24 ? 9   THR A C    3  
ATOM   4385  O O    . THR A 1 9  ? -0.426  1.506   2.345   1.00 0.25 ? 9   THR A O    3  
ATOM   4386  C CB   . THR A 1 9  ? -1.404  4.294   2.762   1.00 0.25 ? 9   THR A CB   3  
ATOM   4387  O OG1  . THR A 1 9  ? -2.539  5.141   2.869   1.00 0.26 ? 9   THR A OG1  3  
ATOM   4388  C CG2  . THR A 1 9  ? -0.131  5.142   2.715   1.00 0.29 ? 9   THR A CG2  3  
ATOM   4389  H H    . THR A 1 9  ? -3.000  1.928   1.764   1.00 0.24 ? 9   THR A H    3  
ATOM   4390  H HA   . THR A 1 9  ? -1.357  4.101   0.624   1.00 0.25 ? 9   THR A HA   3  
ATOM   4391  H HB   . THR A 1 9  ? -1.363  3.636   3.616   1.00 0.26 ? 9   THR A HB   3  
ATOM   4392  H HG1  . THR A 1 9  ? -2.494  5.592   3.715   1.00 0.86 ? 9   THR A HG1  3  
ATOM   4393  H HG21 . THR A 1 9  ? 0.719   4.505   2.520   1.00 1.07 ? 9   THR A HG21 3  
ATOM   4394  H HG22 . THR A 1 9  ? -0.216  5.878   1.928   1.00 1.03 ? 9   THR A HG22 3  
ATOM   4395  H HG23 . THR A 1 9  ? 0.004   5.643   3.662   1.00 1.07 ? 9   THR A HG23 3  
ATOM   4396  N N    . ALA A 1 10 ? 0.452   2.414   0.547   1.00 0.23 ? 10  ALA A N    3  
ATOM   4397  C CA   . ALA A 1 10 ? 1.525   1.387   0.485   1.00 0.23 ? 10  ALA A CA   3  
ATOM   4398  C C    . ALA A 1 10 ? 2.473   1.559   1.672   1.00 0.22 ? 10  ALA A C    3  
ATOM   4399  O O    . ALA A 1 10 ? 3.523   2.161   1.555   1.00 0.27 ? 10  ALA A O    3  
ATOM   4400  C CB   . ALA A 1 10 ? 2.308   1.560   -0.815  1.00 0.23 ? 10  ALA A CB   3  
ATOM   4401  H H    . ALA A 1 10 ? 0.416   3.124   -0.128  1.00 0.22 ? 10  ALA A H    3  
ATOM   4402  H HA   . ALA A 1 10 ? 1.087   0.400   0.516   1.00 0.24 ? 10  ALA A HA   3  
ATOM   4403  H HB1  . ALA A 1 10 ? 2.560   2.603   -0.945  1.00 0.99 ? 10  ALA A HB1  3  
ATOM   4404  H HB2  . ALA A 1 10 ? 3.213   0.973   -0.770  1.00 0.99 ? 10  ALA A HB2  3  
ATOM   4405  H HB3  . ALA A 1 10 ? 1.703   1.229   -1.646  1.00 0.99 ? 10  ALA A HB3  3  
ATOM   4406  N N    . CYS A 1 11 ? 2.112   1.025   2.810   1.00 0.25 ? 11  CYS A N    3  
ATOM   4407  C CA   . CYS A 1 11 ? 2.985   1.136   4.019   1.00 0.25 ? 11  CYS A CA   3  
ATOM   4408  C C    . CYS A 1 11 ? 3.588   -0.239  4.311   1.00 0.25 ? 11  CYS A C    3  
ATOM   4409  O O    . CYS A 1 11 ? 2.908   -1.244  4.278   1.00 0.26 ? 11  CYS A O    3  
ATOM   4410  C CB   . CYS A 1 11 ? 2.143   1.592   5.214   1.00 0.25 ? 11  CYS A CB   3  
ATOM   4411  S SG   . CYS A 1 11 ? 1.189   3.061   4.753   1.00 0.33 ? 11  CYS A SG   3  
ATOM   4412  H H    . CYS A 1 11 ? 1.262   0.539   2.869   1.00 0.30 ? 11  CYS A H    3  
ATOM   4413  H HA   . CYS A 1 11 ? 3.781   1.848   3.846   1.00 0.25 ? 11  CYS A HA   3  
ATOM   4414  H HB2  . CYS A 1 11 ? 1.468   0.799   5.502   1.00 0.29 ? 11  CYS A HB2  3  
ATOM   4415  H HB3  . CYS A 1 11 ? 2.793   1.830   6.043   1.00 0.29 ? 11  CYS A HB3  3  
ATOM   4416  N N    . CYS A 1 12 ? 4.862   -0.293  4.584   1.00 0.24 ? 12  CYS A N    3  
ATOM   4417  C CA   . CYS A 1 12 ? 5.503   -1.608  4.866   1.00 0.24 ? 12  CYS A CA   3  
ATOM   4418  C C    . CYS A 1 12 ? 5.050   -2.117  6.234   1.00 0.24 ? 12  CYS A C    3  
ATOM   4419  O O    . CYS A 1 12 ? 4.919   -1.361  7.177   1.00 0.27 ? 12  CYS A O    3  
ATOM   4420  C CB   . CYS A 1 12 ? 7.025   -1.449  4.859   1.00 0.24 ? 12  CYS A CB   3  
ATOM   4421  S SG   . CYS A 1 12 ? 7.575   -0.953  3.207   1.00 0.24 ? 12  CYS A SG   3  
ATOM   4422  H H    . CYS A 1 12 ? 5.397   0.527   4.597   1.00 0.24 ? 12  CYS A H    3  
ATOM   4423  H HA   . CYS A 1 12 ? 5.213   -2.318  4.106   1.00 0.26 ? 12  CYS A HA   3  
ATOM   4424  H HB2  . CYS A 1 12 ? 7.312   -0.693  5.575   1.00 0.27 ? 12  CYS A HB2  3  
ATOM   4425  H HB3  . CYS A 1 12 ? 7.486   -2.389  5.125   1.00 0.24 ? 12  CYS A HB3  3  
ATOM   4426  N N    . PHE A 1 13 ? 4.821   -3.399  6.350   1.00 0.25 ? 13  PHE A N    3  
ATOM   4427  C CA   . PHE A 1 13 ? 4.386   -3.985  7.655   1.00 0.27 ? 13  PHE A CA   3  
ATOM   4428  C C    . PHE A 1 13 ? 5.589   -4.682  8.298   1.00 0.24 ? 13  PHE A C    3  
ATOM   4429  O O    . PHE A 1 13 ? 5.597   -4.986  9.474   1.00 0.26 ? 13  PHE A O    3  
ATOM   4430  C CB   . PHE A 1 13 ? 3.269   -5.006  7.408   1.00 0.30 ? 13  PHE A CB   3  
ATOM   4431  C CG   . PHE A 1 13 ? 3.834   -6.205  6.685   1.00 0.31 ? 13  PHE A CG   3  
ATOM   4432  C CD1  . PHE A 1 13 ? 4.114   -6.126  5.309   1.00 0.31 ? 13  PHE A CD1  3  
ATOM   4433  C CD2  . PHE A 1 13 ? 4.096   -7.394  7.391   1.00 0.35 ? 13  PHE A CD2  3  
ATOM   4434  C CE1  . PHE A 1 13 ? 4.653   -7.238  4.637   1.00 0.34 ? 13  PHE A CE1  3  
ATOM   4435  C CE2  . PHE A 1 13 ? 4.635   -8.506  6.721   1.00 0.37 ? 13  PHE A CE2  3  
ATOM   4436  C CZ   . PHE A 1 13 ? 4.914   -8.428  5.342   1.00 0.37 ? 13  PHE A CZ   3  
ATOM   4437  H H    . PHE A 1 13 ? 4.944   -3.985  5.574   1.00 0.25 ? 13  PHE A H    3  
ATOM   4438  H HA   . PHE A 1 13 ? 4.024   -3.207  8.311   1.00 0.29 ? 13  PHE A HA   3  
ATOM   4439  H HB2  . PHE A 1 13 ? 2.849   -5.318  8.353   1.00 0.33 ? 13  PHE A HB2  3  
ATOM   4440  H HB3  . PHE A 1 13 ? 2.496   -4.554  6.803   1.00 0.31 ? 13  PHE A HB3  3  
ATOM   4441  H HD1  . PHE A 1 13 ? 3.911   -5.213  4.768   1.00 0.30 ? 13  PHE A HD1  3  
ATOM   4442  H HD2  . PHE A 1 13 ? 3.880   -7.453  8.448   1.00 0.36 ? 13  PHE A HD2  3  
ATOM   4443  H HE1  . PHE A 1 13 ? 4.865   -7.177  3.581   1.00 0.36 ? 13  PHE A HE1  3  
ATOM   4444  H HE2  . PHE A 1 13 ? 4.835   -9.419  7.263   1.00 0.40 ? 13  PHE A HE2  3  
ATOM   4445  H HZ   . PHE A 1 13 ? 5.329   -9.282  4.826   1.00 0.40 ? 13  PHE A HZ   3  
ATOM   4446  N N    . SER A 1 14 ? 6.605   -4.931  7.518   1.00 0.21 ? 14  SER A N    3  
ATOM   4447  C CA   . SER A 1 14 ? 7.822   -5.604  8.048   1.00 0.20 ? 14  SER A CA   3  
ATOM   4448  C C    . SER A 1 14 ? 9.009   -5.249  7.151   1.00 0.18 ? 14  SER A C    3  
ATOM   4449  O O    . SER A 1 14 ? 8.999   -4.243  6.469   1.00 0.17 ? 14  SER A O    3  
ATOM   4450  C CB   . SER A 1 14 ? 7.613   -7.119  8.046   1.00 0.20 ? 14  SER A CB   3  
ATOM   4451  O OG   . SER A 1 14 ? 7.400   -7.560  6.712   1.00 0.25 ? 14  SER A OG   3  
ATOM   4452  H H    . SER A 1 14 ? 6.567   -4.672  6.573   1.00 0.21 ? 14  SER A H    3  
ATOM   4453  H HA   . SER A 1 14 ? 8.016   -5.266  9.056   1.00 0.22 ? 14  SER A HA   3  
ATOM   4454  H HB2  . SER A 1 14 ? 8.486   -7.606  8.446   1.00 0.24 ? 14  SER A HB2  3  
ATOM   4455  H HB3  . SER A 1 14 ? 6.756   -7.363  8.658   1.00 0.24 ? 14  SER A HB3  3  
ATOM   4456  H HG   . SER A 1 14 ? 7.083   -8.466  6.746   1.00 0.84 ? 14  SER A HG   3  
ATOM   4457  N N    . TYR A 1 15 ? 10.036  -6.058  7.141   1.00 0.19 ? 15  TYR A N    3  
ATOM   4458  C CA   . TYR A 1 15 ? 11.219  -5.747  6.282   1.00 0.20 ? 15  TYR A CA   3  
ATOM   4459  C C    . TYR A 1 15 ? 11.965  -7.040  5.949   1.00 0.24 ? 15  TYR A C    3  
ATOM   4460  O O    . TYR A 1 15 ? 11.843  -8.033  6.636   1.00 0.29 ? 15  TYR A O    3  
ATOM   4461  C CB   . TYR A 1 15 ? 12.163  -4.796  7.032   1.00 0.22 ? 15  TYR A CB   3  
ATOM   4462  C CG   . TYR A 1 15 ? 11.360  -3.766  7.790   1.00 0.21 ? 15  TYR A CG   3  
ATOM   4463  C CD1  . TYR A 1 15 ? 10.932  -2.591  7.145   1.00 0.21 ? 15  TYR A CD1  3  
ATOM   4464  C CD2  . TYR A 1 15 ? 11.038  -3.984  9.144   1.00 0.25 ? 15  TYR A CD2  3  
ATOM   4465  C CE1  . TYR A 1 15 ? 10.183  -1.632  7.854   1.00 0.23 ? 15  TYR A CE1  3  
ATOM   4466  C CE2  . TYR A 1 15 ? 10.289  -3.025  9.853   1.00 0.28 ? 15  TYR A CE2  3  
ATOM   4467  C CZ   . TYR A 1 15 ? 9.861   -1.850  9.207   1.00 0.27 ? 15  TYR A CZ   3  
ATOM   4468  O OH   . TYR A 1 15 ? 9.127   -0.909  9.901   1.00 0.32 ? 15  TYR A OH   3  
ATOM   4469  H H    . TYR A 1 15 ? 10.031  -6.863  7.698   1.00 0.21 ? 15  TYR A H    3  
ATOM   4470  H HA   . TYR A 1 15 ? 10.889  -5.281  5.362   1.00 0.18 ? 15  TYR A HA   3  
ATOM   4471  H HB2  . TYR A 1 15 ? 12.768  -5.358  7.730   1.00 0.25 ? 15  TYR A HB2  3  
ATOM   4472  H HB3  . TYR A 1 15 ? 12.804  -4.298  6.323   1.00 0.22 ? 15  TYR A HB3  3  
ATOM   4473  H HD1  . TYR A 1 15 ? 11.178  -2.424  6.106   1.00 0.20 ? 15  TYR A HD1  3  
ATOM   4474  H HD2  . TYR A 1 15 ? 11.367  -4.886  9.639   1.00 0.27 ? 15  TYR A HD2  3  
ATOM   4475  H HE1  . TYR A 1 15 ? 9.854   -0.731  7.360   1.00 0.24 ? 15  TYR A HE1  3  
ATOM   4476  H HE2  . TYR A 1 15 ? 10.043  -3.192  10.891  1.00 0.33 ? 15  TYR A HE2  3  
ATOM   4477  H HH   . TYR A 1 15 ? 9.460   -0.877  10.802  1.00 0.89 ? 15  TYR A HH   3  
ATOM   4478  N N    . THR A 1 16 ? 12.746  -7.029  4.903   1.00 0.22 ? 16  THR A N    3  
ATOM   4479  C CA   . THR A 1 16 ? 13.510  -8.253  4.539   1.00 0.28 ? 16  THR A CA   3  
ATOM   4480  C C    . THR A 1 16 ? 14.407  -8.637  5.721   1.00 0.32 ? 16  THR A C    3  
ATOM   4481  O O    . THR A 1 16 ? 14.191  -8.202  6.834   1.00 0.38 ? 16  THR A O    3  
ATOM   4482  C CB   . THR A 1 16 ? 14.352  -7.980  3.285   1.00 0.28 ? 16  THR A CB   3  
ATOM   4483  O OG1  . THR A 1 16 ? 15.195  -9.092  3.022   1.00 0.39 ? 16  THR A OG1  3  
ATOM   4484  C CG2  . THR A 1 16 ? 15.206  -6.728  3.491   1.00 0.27 ? 16  THR A CG2  3  
ATOM   4485  H H    . THR A 1 16 ? 12.840  -6.210  4.367   1.00 0.19 ? 16  THR A H    3  
ATOM   4486  H HA   . THR A 1 16 ? 12.819  -9.060  4.340   1.00 0.30 ? 16  THR A HA   3  
ATOM   4487  H HB   . THR A 1 16 ? 13.697  -7.824  2.442   1.00 0.27 ? 16  THR A HB   3  
ATOM   4488  H HG1  . THR A 1 16 ? 16.101  -8.826  3.192   1.00 0.86 ? 16  THR A HG1  3  
ATOM   4489  H HG21 . THR A 1 16 ? 15.790  -6.834  4.393   1.00 1.04 ? 16  THR A HG21 3  
ATOM   4490  H HG22 . THR A 1 16 ? 15.868  -6.602  2.646   1.00 1.06 ? 16  THR A HG22 3  
ATOM   4491  H HG23 . THR A 1 16 ? 14.564  -5.864  3.576   1.00 1.07 ? 16  THR A HG23 3  
ATOM   4492  N N    . ALA A 1 17 ? 15.408  -9.448  5.500   1.00 0.36 ? 17  ALA A N    3  
ATOM   4493  C CA   . ALA A 1 17 ? 16.306  -9.854  6.625   1.00 0.42 ? 17  ALA A CA   3  
ATOM   4494  C C    . ALA A 1 17 ? 17.736  -9.996  6.106   1.00 0.45 ? 17  ALA A C    3  
ATOM   4495  O O    . ALA A 1 17 ? 18.582  -10.592 6.742   1.00 0.63 ? 17  ALA A O    3  
ATOM   4496  C CB   . ALA A 1 17 ? 15.833  -11.195 7.189   1.00 0.50 ? 17  ALA A CB   3  
ATOM   4497  H H    . ALA A 1 17 ? 15.568  -9.795  4.599   1.00 0.39 ? 17  ALA A H    3  
ATOM   4498  H HA   . ALA A 1 17 ? 16.282  -9.107  7.406   1.00 0.42 ? 17  ALA A HA   3  
ATOM   4499  H HB1  . ALA A 1 17 ? 15.801  -11.928 6.396   1.00 1.12 ? 17  ALA A HB1  3  
ATOM   4500  H HB2  . ALA A 1 17 ? 16.516  -11.523 7.957   1.00 1.12 ? 17  ALA A HB2  3  
ATOM   4501  H HB3  . ALA A 1 17 ? 14.845  -11.079 7.610   1.00 1.18 ? 17  ALA A HB3  3  
ATOM   4502  N N    . ARG A 1 18 ? 18.014  -9.448  4.953   1.00 0.47 ? 18  ARG A N    3  
ATOM   4503  C CA   . ARG A 1 18 ? 19.392  -9.542  4.384   1.00 0.48 ? 18  ARG A CA   3  
ATOM   4504  C C    . ARG A 1 18 ? 19.723  -8.241  3.652   1.00 0.41 ? 18  ARG A C    3  
ATOM   4505  O O    . ARG A 1 18 ? 18.949  -7.755  2.851   1.00 0.37 ? 18  ARG A O    3  
ATOM   4506  C CB   . ARG A 1 18 ? 19.456  -10.712 3.395   1.00 0.53 ? 18  ARG A CB   3  
ATOM   4507  C CG   . ARG A 1 18 ? 19.503  -12.044 4.161   1.00 0.70 ? 18  ARG A CG   3  
ATOM   4508  C CD   . ARG A 1 18 ? 20.833  -12.183 4.941   1.00 1.15 ? 18  ARG A CD   3  
ATOM   4509  N NE   . ARG A 1 18 ? 21.409  -13.553 4.736   1.00 1.96 ? 18  ARG A NE   3  
ATOM   4510  C CZ   . ARG A 1 18 ? 20.670  -14.627 4.845   1.00 2.64 ? 18  ARG A CZ   3  
ATOM   4511  N NH1  . ARG A 1 18 ? 19.428  -14.538 5.231   1.00 2.84 ? 18  ARG A NH1  3  
ATOM   4512  N NH2  . ARG A 1 18 ? 21.189  -15.798 4.594   1.00 3.63 ? 18  ARG A NH2  3  
ATOM   4513  H H    . ARG A 1 18 ? 17.315  -8.970  4.460   1.00 0.61 ? 18  ARG A H    3  
ATOM   4514  H HA   . ARG A 1 18 ? 20.109  -9.698  5.178   1.00 0.52 ? 18  ARG A HA   3  
ATOM   4515  H HB2  . ARG A 1 18 ? 18.579  -10.693 2.763   1.00 0.55 ? 18  ARG A HB2  3  
ATOM   4516  H HB3  . ARG A 1 18 ? 20.339  -10.619 2.782   1.00 0.55 ? 18  ARG A HB3  3  
ATOM   4517  H HG2  . ARG A 1 18 ? 18.670  -12.079 4.849   1.00 1.27 ? 18  ARG A HG2  3  
ATOM   4518  H HG3  . ARG A 1 18 ? 19.415  -12.856 3.455   1.00 1.20 ? 18  ARG A HG3  3  
ATOM   4519  H HD2  . ARG A 1 18 ? 21.552  -11.466 4.580   1.00 1.77 ? 18  ARG A HD2  3  
ATOM   4520  H HD3  . ARG A 1 18 ? 20.656  -12.000 5.997   1.00 1.64 ? 18  ARG A HD3  3  
ATOM   4521  H HE   . ARG A 1 18 ? 22.353  -13.644 4.489   1.00 2.46 ? 18  ARG A HE   3  
ATOM   4522  H HH11 . ARG A 1 18 ? 19.035  -13.650 5.449   1.00 2.56 ? 18  ARG A HH11 3  
ATOM   4523  H HH12 . ARG A 1 18 ? 18.870  -15.365 5.309   1.00 3.61 ? 18  ARG A HH12 3  
ATOM   4524  H HH21 . ARG A 1 18 ? 22.147  -15.873 4.320   1.00 3.98 ? 18  ARG A HH21 3  
ATOM   4525  H HH22 . ARG A 1 18 ? 20.627  -16.621 4.678   1.00 4.24 ? 18  ARG A HH22 3  
ATOM   4526  N N    . LYS A 1 19 ? 20.872  -7.678  3.909   1.00 0.40 ? 19  LYS A N    3  
ATOM   4527  C CA   . LYS A 1 19 ? 21.250  -6.416  3.216   1.00 0.35 ? 19  LYS A CA   3  
ATOM   4528  C C    . LYS A 1 19 ? 21.343  -6.702  1.715   1.00 0.31 ? 19  LYS A C    3  
ATOM   4529  O O    . LYS A 1 19 ? 22.036  -7.602  1.285   1.00 0.33 ? 19  LYS A O    3  
ATOM   4530  C CB   . LYS A 1 19 ? 22.606  -5.928  3.764   1.00 0.38 ? 19  LYS A CB   3  
ATOM   4531  C CG   . LYS A 1 19 ? 23.150  -4.737  2.947   1.00 0.40 ? 19  LYS A CG   3  
ATOM   4532  C CD   . LYS A 1 19 ? 24.625  -4.495  3.297   1.00 0.62 ? 19  LYS A CD   3  
ATOM   4533  C CE   . LYS A 1 19 ? 24.812  -4.443  4.816   1.00 0.97 ? 19  LYS A CE   3  
ATOM   4534  N NZ   . LYS A 1 19 ? 24.839  -5.830  5.361   1.00 1.79 ? 19  LYS A NZ   3  
ATOM   4535  H H    . LYS A 1 19 ? 21.486  -8.089  4.552   1.00 0.43 ? 19  LYS A H    3  
ATOM   4536  H HA   . LYS A 1 19 ? 20.494  -5.664  3.394   1.00 0.35 ? 19  LYS A HA   3  
ATOM   4537  H HB2  . LYS A 1 19 ? 22.477  -5.619  4.791   1.00 0.45 ? 19  LYS A HB2  3  
ATOM   4538  H HB3  . LYS A 1 19 ? 23.312  -6.736  3.731   1.00 0.41 ? 19  LYS A HB3  3  
ATOM   4539  H HG2  . LYS A 1 19 ? 23.076  -4.942  1.892   1.00 0.68 ? 19  LYS A HG2  3  
ATOM   4540  H HG3  . LYS A 1 19 ? 22.582  -3.854  3.180   1.00 0.68 ? 19  LYS A HG3  3  
ATOM   4541  H HD2  . LYS A 1 19 ? 25.224  -5.294  2.889   1.00 1.50 ? 19  LYS A HD2  3  
ATOM   4542  H HD3  . LYS A 1 19 ? 24.942  -3.555  2.868   1.00 1.32 ? 19  LYS A HD3  3  
ATOM   4543  H HE2  . LYS A 1 19 ? 25.744  -3.948  5.046   1.00 1.40 ? 19  LYS A HE2  3  
ATOM   4544  H HE3  . LYS A 1 19 ? 23.996  -3.897  5.263   1.00 1.44 ? 19  LYS A HE3  3  
ATOM   4545  H HZ1  . LYS A 1 19 ? 24.896  -6.510  4.575   1.00 2.18 ? 19  LYS A HZ1  3  
ATOM   4546  H HZ2  . LYS A 1 19 ? 25.668  -5.944  5.978   1.00 2.30 ? 19  LYS A HZ2  3  
ATOM   4547  H HZ3  . LYS A 1 19 ? 23.975  -6.005  5.910   1.00 2.23 ? 19  LYS A HZ3  3  
ATOM   4548  N N    . LEU A 1 20 ? 20.648  -5.940  0.917   1.00 0.27 ? 20  LEU A N    3  
ATOM   4549  C CA   . LEU A 1 20 ? 20.694  -6.164  -0.554  1.00 0.27 ? 20  LEU A CA   3  
ATOM   4550  C C    . LEU A 1 20 ? 22.054  -5.673  -1.103  1.00 0.27 ? 20  LEU A C    3  
ATOM   4551  O O    . LEU A 1 20 ? 22.337  -4.496  -0.999  1.00 0.27 ? 20  LEU A O    3  
ATOM   4552  C CB   . LEU A 1 20 ? 19.587  -5.344  -1.219  1.00 0.24 ? 20  LEU A CB   3  
ATOM   4553  C CG   . LEU A 1 20 ? 18.249  -5.565  -0.508  1.00 0.23 ? 20  LEU A CG   3  
ATOM   4554  C CD1  . LEU A 1 20 ? 17.135  -4.925  -1.339  1.00 0.22 ? 20  LEU A CD1  3  
ATOM   4555  C CD2  . LEU A 1 20 ? 17.971  -7.065  -0.360  1.00 0.27 ? 20  LEU A CD2  3  
ATOM   4556  H H    . LEU A 1 20 ? 20.097  -5.219  1.286   1.00 0.27 ? 20  LEU A H    3  
ATOM   4557  H HA   . LEU A 1 20 ? 20.537  -7.204  -0.758  1.00 0.29 ? 20  LEU A HA   3  
ATOM   4558  H HB2  . LEU A 1 20 ? 19.844  -4.296  -1.170  1.00 0.24 ? 20  LEU A HB2  3  
ATOM   4559  H HB3  . LEU A 1 20 ? 19.496  -5.639  -2.252  1.00 0.27 ? 20  LEU A HB3  3  
ATOM   4560  H HG   . LEU A 1 20 ? 18.281  -5.102  0.467   1.00 0.21 ? 20  LEU A HG   3  
ATOM   4561  H HD11 . LEU A 1 20 ? 17.446  -3.943  -1.663  1.00 1.05 ? 20  LEU A HD11 3  
ATOM   4562  H HD12 . LEU A 1 20 ? 16.934  -5.541  -2.203  1.00 1.00 ? 20  LEU A HD12 3  
ATOM   4563  H HD13 . LEU A 1 20 ? 16.243  -4.843  -0.740  1.00 1.00 ? 20  LEU A HD13 3  
ATOM   4564  H HD21 . LEU A 1 20 ? 18.232  -7.574  -1.275  1.00 1.05 ? 20  LEU A HD21 3  
ATOM   4565  H HD22 . LEU A 1 20 ? 18.558  -7.461  0.455   1.00 1.03 ? 20  LEU A HD22 3  
ATOM   4566  H HD23 . LEU A 1 20 ? 16.921  -7.219  -0.150  1.00 1.05 ? 20  LEU A HD23 3  
ATOM   4567  N N    . PRO A 1 21 ? 22.865  -6.543  -1.684  1.00 0.31 ? 21  PRO A N    3  
ATOM   4568  C CA   . PRO A 1 21 ? 24.163  -6.105  -2.235  1.00 0.34 ? 21  PRO A CA   3  
ATOM   4569  C C    . PRO A 1 21 ? 23.947  -4.953  -3.219  1.00 0.30 ? 21  PRO A C    3  
ATOM   4570  O O    . PRO A 1 21 ? 22.956  -4.903  -3.916  1.00 0.29 ? 21  PRO A O    3  
ATOM   4571  C CB   . PRO A 1 21 ? 24.732  -7.348  -2.953  1.00 0.39 ? 21  PRO A CB   3  
ATOM   4572  C CG   . PRO A 1 21 ? 23.842  -8.557  -2.550  1.00 0.42 ? 21  PRO A CG   3  
ATOM   4573  C CD   . PRO A 1 21 ? 22.590  -7.991  -1.846  1.00 0.35 ? 21  PRO A CD   3  
ATOM   4574  H HA   . PRO A 1 21 ? 24.822  -5.799  -1.437  1.00 0.36 ? 21  PRO A HA   3  
ATOM   4575  H HB2  . PRO A 1 21 ? 24.700  -7.208  -4.028  1.00 0.39 ? 21  PRO A HB2  3  
ATOM   4576  H HB3  . PRO A 1 21 ? 25.750  -7.521  -2.644  1.00 0.43 ? 21  PRO A HB3  3  
ATOM   4577  H HG2  . PRO A 1 21 ? 23.554  -9.114  -3.433  1.00 0.45 ? 21  PRO A HG2  3  
ATOM   4578  H HG3  . PRO A 1 21 ? 24.381  -9.203  -1.871  1.00 0.47 ? 21  PRO A HG3  3  
ATOM   4579  H HD2  . PRO A 1 21 ? 21.714  -8.145  -2.465  1.00 0.35 ? 21  PRO A HD2  3  
ATOM   4580  H HD3  . PRO A 1 21 ? 22.458  -8.455  -0.879  1.00 0.37 ? 21  PRO A HD3  3  
ATOM   4581  N N    . ARG A 1 22 ? 24.874  -4.038  -3.295  1.00 0.31 ? 22  ARG A N    3  
ATOM   4582  C CA   . ARG A 1 22 ? 24.721  -2.911  -4.255  1.00 0.30 ? 22  ARG A CA   3  
ATOM   4583  C C    . ARG A 1 22 ? 24.383  -3.493  -5.633  1.00 0.31 ? 22  ARG A C    3  
ATOM   4584  O O    . ARG A 1 22 ? 23.628  -2.927  -6.397  1.00 0.31 ? 22  ARG A O    3  
ATOM   4585  C CB   . ARG A 1 22 ? 26.040  -2.117  -4.317  1.00 0.33 ? 22  ARG A CB   3  
ATOM   4586  C CG   . ARG A 1 22 ? 25.768  -0.654  -4.700  1.00 0.69 ? 22  ARG A CG   3  
ATOM   4587  C CD   . ARG A 1 22 ? 25.108  -0.578  -6.085  1.00 1.24 ? 22  ARG A CD   3  
ATOM   4588  N NE   . ARG A 1 22 ? 25.438  0.731   -6.716  1.00 1.34 ? 22  ARG A NE   3  
ATOM   4589  C CZ   . ARG A 1 22 ? 25.243  0.907   -7.994  1.00 2.07 ? 22  ARG A CZ   3  
ATOM   4590  N NH1  . ARG A 1 22 ? 24.759  -0.063  -8.720  1.00 2.89 ? 22  ARG A NH1  3  
ATOM   4591  N NH2  . ARG A 1 22 ? 25.533  2.054   -8.546  1.00 2.44 ? 22  ARG A NH2  3  
ATOM   4592  H H    . ARG A 1 22 ? 25.674  -4.101  -2.734  1.00 0.33 ? 22  ARG A H    3  
ATOM   4593  H HA   . ARG A 1 22 ? 23.917  -2.267  -3.927  1.00 0.28 ? 22  ARG A HA   3  
ATOM   4594  H HB2  . ARG A 1 22 ? 26.516  -2.146  -3.348  1.00 0.51 ? 22  ARG A HB2  3  
ATOM   4595  H HB3  . ARG A 1 22 ? 26.701  -2.561  -5.050  1.00 0.49 ? 22  ARG A HB3  3  
ATOM   4596  H HG2  . ARG A 1 22 ? 25.114  -0.209  -3.964  1.00 1.24 ? 22  ARG A HG2  3  
ATOM   4597  H HG3  . ARG A 1 22 ? 26.702  -0.112  -4.722  1.00 1.29 ? 22  ARG A HG3  3  
ATOM   4598  H HD2  . ARG A 1 22 ? 25.474  -1.378  -6.713  1.00 1.83 ? 22  ARG A HD2  3  
ATOM   4599  H HD3  . ARG A 1 22 ? 24.036  -0.663  -5.979  1.00 1.88 ? 22  ARG A HD3  3  
ATOM   4600  H HE   . ARG A 1 22 ? 25.801  1.460   -6.171  1.00 1.53 ? 22  ARG A HE   3  
ATOM   4601  H HH11 . ARG A 1 22 ? 24.538  -0.941  -8.298  1.00 2.92 ? 22  ARG A HH11 3  
ATOM   4602  H HH12 . ARG A 1 22 ? 24.610  0.072   -9.700  1.00 3.67 ? 22  ARG A HH12 3  
ATOM   4603  H HH21 . ARG A 1 22 ? 25.903  2.797   -7.989  1.00 2.35 ? 22  ARG A HH21 3  
ATOM   4604  H HH22 . ARG A 1 22 ? 25.384  2.190   -9.526  1.00 3.12 ? 22  ARG A HH22 3  
ATOM   4605  N N    . ASN A 1 23 ? 24.938  -4.635  -5.944  1.00 0.34 ? 23  ASN A N    3  
ATOM   4606  C CA   . ASN A 1 23 ? 24.656  -5.273  -7.260  1.00 0.37 ? 23  ASN A CA   3  
ATOM   4607  C C    . ASN A 1 23 ? 23.222  -5.809  -7.276  1.00 0.37 ? 23  ASN A C    3  
ATOM   4608  O O    . ASN A 1 23 ? 22.858  -6.605  -8.118  1.00 0.40 ? 23  ASN A O    3  
ATOM   4609  C CB   . ASN A 1 23 ? 25.633  -6.429  -7.485  1.00 0.42 ? 23  ASN A CB   3  
ATOM   4610  C CG   . ASN A 1 23 ? 25.516  -6.925  -8.927  1.00 1.47 ? 23  ASN A CG   3  
ATOM   4611  O OD1  . ASN A 1 23 ? 25.421  -8.112  -9.168  1.00 2.16 ? 23  ASN A OD1  3  
ATOM   4612  N ND2  . ASN A 1 23 ? 25.519  -6.058  -9.904  1.00 2.38 ? 23  ASN A ND2  3  
ATOM   4613  H H    . ASN A 1 23 ? 25.537  -5.078  -5.303  1.00 0.35 ? 23  ASN A H    3  
ATOM   4614  H HA   . ASN A 1 23 ? 24.776  -4.543  -8.047  1.00 0.38 ? 23  ASN A HA   3  
ATOM   4615  H HB2  . ASN A 1 23 ? 26.642  -6.088  -7.302  1.00 1.04 ? 23  ASN A HB2  3  
ATOM   4616  H HB3  . ASN A 1 23 ? 25.397  -7.237  -6.809  1.00 1.07 ? 23  ASN A HB3  3  
ATOM   4617  H HD21 . ASN A 1 23 ? 25.595  -5.101  -9.710  1.00 2.56 ? 23  ASN A HD21 3  
ATOM   4618  H HD22 . ASN A 1 23 ? 25.444  -6.366  -10.831 1.00 3.17 ? 23  ASN A HD22 3  
ATOM   4619  N N    . PHE A 1 24 ? 22.407  -5.384  -6.345  1.00 0.33 ? 24  PHE A N    3  
ATOM   4620  C CA   . PHE A 1 24 ? 20.992  -5.872  -6.293  1.00 0.33 ? 24  PHE A CA   3  
ATOM   4621  C C    . PHE A 1 24 ? 20.075  -4.700  -5.933  1.00 0.30 ? 24  PHE A C    3  
ATOM   4622  O O    . PHE A 1 24 ? 19.013  -4.877  -5.372  1.00 0.28 ? 24  PHE A O    3  
ATOM   4623  C CB   . PHE A 1 24 ? 20.883  -6.970  -5.220  1.00 0.33 ? 24  PHE A CB   3  
ATOM   4624  C CG   . PHE A 1 24 ? 19.672  -7.847  -5.472  1.00 0.35 ? 24  PHE A CG   3  
ATOM   4625  C CD1  . PHE A 1 24 ? 19.573  -8.587  -6.667  1.00 0.39 ? 24  PHE A CD1  3  
ATOM   4626  C CD2  . PHE A 1 24 ? 18.648  -7.937  -4.505  1.00 0.35 ? 24  PHE A CD2  3  
ATOM   4627  C CE1  . PHE A 1 24 ? 18.457  -9.411  -6.895  1.00 0.41 ? 24  PHE A CE1  3  
ATOM   4628  C CE2  . PHE A 1 24 ? 17.531  -8.762  -4.736  1.00 0.37 ? 24  PHE A CE2  3  
ATOM   4629  C CZ   . PHE A 1 24 ? 17.436  -9.498  -5.930  1.00 0.41 ? 24  PHE A CZ   3  
ATOM   4630  H H    . PHE A 1 24 ? 22.728  -4.749  -5.673  1.00 0.31 ? 24  PHE A H    3  
ATOM   4631  H HA   . PHE A 1 24 ? 20.700  -6.267  -7.257  1.00 0.36 ? 24  PHE A HA   3  
ATOM   4632  H HB2  . PHE A 1 24 ? 21.772  -7.580  -5.245  1.00 0.35 ? 24  PHE A HB2  3  
ATOM   4633  H HB3  . PHE A 1 24 ? 20.796  -6.511  -4.243  1.00 0.31 ? 24  PHE A HB3  3  
ATOM   4634  H HD1  . PHE A 1 24 ? 20.354  -8.527  -7.410  1.00 0.40 ? 24  PHE A HD1  3  
ATOM   4635  H HD2  . PHE A 1 24 ? 18.719  -7.373  -3.589  1.00 0.32 ? 24  PHE A HD2  3  
ATOM   4636  H HE1  . PHE A 1 24 ? 18.385  -9.976  -7.809  1.00 0.44 ? 24  PHE A HE1  3  
ATOM   4637  H HE2  . PHE A 1 24 ? 16.749  -8.832  -3.994  1.00 0.37 ? 24  PHE A HE2  3  
ATOM   4638  H HZ   . PHE A 1 24 ? 16.578  -10.130 -6.104  1.00 0.43 ? 24  PHE A HZ   3  
ATOM   4639  N N    . VAL A 1 25 ? 20.484  -3.500  -6.257  1.00 0.30 ? 25  VAL A N    3  
ATOM   4640  C CA   . VAL A 1 25 ? 19.647  -2.304  -5.943  1.00 0.28 ? 25  VAL A CA   3  
ATOM   4641  C C    . VAL A 1 25 ? 19.895  -1.229  -7.003  1.00 0.30 ? 25  VAL A C    3  
ATOM   4642  O O    . VAL A 1 25 ? 20.747  -0.377  -6.848  1.00 0.31 ? 25  VAL A O    3  
ATOM   4643  C CB   . VAL A 1 25 ? 20.033  -1.751  -4.569  1.00 0.24 ? 25  VAL A CB   3  
ATOM   4644  C CG1  . VAL A 1 25 ? 19.101  -0.595  -4.205  1.00 0.22 ? 25  VAL A CG1  3  
ATOM   4645  C CG2  . VAL A 1 25 ? 19.903  -2.850  -3.515  1.00 0.23 ? 25  VAL A CG2  3  
ATOM   4646  H H    . VAL A 1 25 ? 21.345  -3.385  -6.711  1.00 0.31 ? 25  VAL A H    3  
ATOM   4647  H HA   . VAL A 1 25 ? 18.603  -2.577  -5.943  1.00 0.27 ? 25  VAL A HA   3  
ATOM   4648  H HB   . VAL A 1 25 ? 21.054  -1.396  -4.599  1.00 0.25 ? 25  VAL A HB   3  
ATOM   4649  H HG11 . VAL A 1 25 ? 18.079  -0.944  -4.200  1.00 1.03 ? 25  VAL A HG11 3  
ATOM   4650  H HG12 . VAL A 1 25 ? 19.360  -0.223  -3.225  1.00 1.04 ? 25  VAL A HG12 3  
ATOM   4651  H HG13 . VAL A 1 25 ? 19.208  0.198   -4.931  1.00 1.04 ? 25  VAL A HG13 3  
ATOM   4652  H HG21 . VAL A 1 25 ? 18.939  -3.327  -3.608  1.00 1.04 ? 25  VAL A HG21 3  
ATOM   4653  H HG22 . VAL A 1 25 ? 20.685  -3.583  -3.658  1.00 1.07 ? 25  VAL A HG22 3  
ATOM   4654  H HG23 . VAL A 1 25 ? 19.996  -2.414  -2.532  1.00 1.01 ? 25  VAL A HG23 3  
ATOM   4655  N N    . VAL A 1 26 ? 19.160  -1.263  -8.082  1.00 0.33 ? 26  VAL A N    3  
ATOM   4656  C CA   . VAL A 1 26 ? 19.356  -0.247  -9.152  1.00 0.36 ? 26  VAL A CA   3  
ATOM   4657  C C    . VAL A 1 26 ? 18.599  1.028   -8.790  1.00 0.35 ? 26  VAL A C    3  
ATOM   4658  O O    . VAL A 1 26 ? 18.790  2.065   -9.393  1.00 0.37 ? 26  VAL A O    3  
ATOM   4659  C CB   . VAL A 1 26 ? 18.822  -0.800  -10.472 1.00 0.41 ? 26  VAL A CB   3  
ATOM   4660  C CG1  . VAL A 1 26 ? 19.618  -2.044  -10.863 1.00 0.78 ? 26  VAL A CG1  3  
ATOM   4661  C CG2  . VAL A 1 26 ? 17.345  -1.169  -10.313 1.00 0.61 ? 26  VAL A CG2  3  
ATOM   4662  H H    . VAL A 1 26 ? 18.480  -1.958  -8.190  1.00 0.33 ? 26  VAL A H    3  
ATOM   4663  H HA   . VAL A 1 26 ? 20.407  -0.023  -9.252  1.00 0.37 ? 26  VAL A HA   3  
ATOM   4664  H HB   . VAL A 1 26 ? 18.926  -0.051  -11.240 1.00 0.58 ? 26  VAL A HB   3  
ATOM   4665  H HG11 . VAL A 1 26 ? 19.723  -2.687  -10.002 1.00 1.32 ? 26  VAL A HG11 3  
ATOM   4666  H HG12 . VAL A 1 26 ? 19.098  -2.573  -11.647 1.00 1.36 ? 26  VAL A HG12 3  
ATOM   4667  H HG13 . VAL A 1 26 ? 20.596  -1.749  -11.214 1.00 1.31 ? 26  VAL A HG13 3  
ATOM   4668  H HG21 . VAL A 1 26 ? 17.232  -1.858  -9.491  1.00 1.18 ? 26  VAL A HG21 3  
ATOM   4669  H HG22 . VAL A 1 26 ? 16.768  -0.276  -10.118 1.00 1.34 ? 26  VAL A HG22 3  
ATOM   4670  H HG23 . VAL A 1 26 ? 16.990  -1.633  -11.222 1.00 1.17 ? 26  VAL A HG23 3  
ATOM   4671  N N    . ASP A 1 27 ? 17.741  0.963   -7.812  1.00 0.32 ? 27  ASP A N    3  
ATOM   4672  C CA   . ASP A 1 27 ? 16.978  2.178   -7.423  1.00 0.31 ? 27  ASP A CA   3  
ATOM   4673  C C    . ASP A 1 27 ? 16.235  1.908   -6.120  1.00 0.27 ? 27  ASP A C    3  
ATOM   4674  O O    . ASP A 1 27 ? 16.423  0.888   -5.486  1.00 0.25 ? 27  ASP A O    3  
ATOM   4675  C CB   . ASP A 1 27 ? 15.970  2.521   -8.523  1.00 0.34 ? 27  ASP A CB   3  
ATOM   4676  C CG   . ASP A 1 27 ? 15.413  3.926   -8.286  1.00 0.35 ? 27  ASP A CG   3  
ATOM   4677  O OD1  . ASP A 1 27 ? 16.208  4.838   -8.129  1.00 1.09 ? 27  ASP A OD1  3  
ATOM   4678  O OD2  . ASP A 1 27 ? 14.201  4.066   -8.266  1.00 1.13 ? 27  ASP A OD2  3  
ATOM   4679  H H    . ASP A 1 27 ? 17.597  0.114   -7.336  1.00 0.30 ? 27  ASP A H    3  
ATOM   4680  H HA   . ASP A 1 27 ? 17.659  3.004   -7.286  1.00 0.31 ? 27  ASP A HA   3  
ATOM   4681  H HB2  . ASP A 1 27 ? 16.462  2.485   -9.484  1.00 0.37 ? 27  ASP A HB2  3  
ATOM   4682  H HB3  . ASP A 1 27 ? 15.159  1.807   -8.507  1.00 0.34 ? 27  ASP A HB3  3  
ATOM   4683  N N    . TYR A 1 28 ? 15.389  2.811   -5.710  1.00 0.26 ? 28  TYR A N    3  
ATOM   4684  C CA   . TYR A 1 28 ? 14.634  2.597   -4.447  1.00 0.23 ? 28  TYR A CA   3  
ATOM   4685  C C    . TYR A 1 28 ? 13.348  3.414   -4.468  1.00 0.25 ? 28  TYR A C    3  
ATOM   4686  O O    . TYR A 1 28 ? 13.009  4.051   -5.446  1.00 0.29 ? 28  TYR A O    3  
ATOM   4687  C CB   . TYR A 1 28 ? 15.493  2.996   -3.241  1.00 0.19 ? 28  TYR A CB   3  
ATOM   4688  C CG   . TYR A 1 28 ? 15.617  4.505   -3.141  1.00 0.21 ? 28  TYR A CG   3  
ATOM   4689  C CD1  . TYR A 1 28 ? 16.245  5.237   -4.168  1.00 0.25 ? 28  TYR A CD1  3  
ATOM   4690  C CD2  . TYR A 1 28 ? 15.114  5.178   -2.008  1.00 0.19 ? 28  TYR A CD2  3  
ATOM   4691  C CE1  . TYR A 1 28 ? 16.368  6.635   -4.065  1.00 0.26 ? 28  TYR A CE1  3  
ATOM   4692  C CE2  . TYR A 1 28 ? 15.238  6.574   -1.902  1.00 0.22 ? 28  TYR A CE2  3  
ATOM   4693  C CZ   . TYR A 1 28 ? 15.865  7.304   -2.931  1.00 0.25 ? 28  TYR A CZ   3  
ATOM   4694  O OH   . TYR A 1 28 ? 15.987  8.676   -2.829  1.00 0.28 ? 28  TYR A OH   3  
ATOM   4695  H H    . TYR A 1 28 ? 15.247  3.626   -6.236  1.00 0.28 ? 28  TYR A H    3  
ATOM   4696  H HA   . TYR A 1 28 ? 14.378  1.550   -4.362  1.00 0.23 ? 28  TYR A HA   3  
ATOM   4697  H HB2  . TYR A 1 28 ? 15.038  2.611   -2.341  1.00 0.17 ? 28  TYR A HB2  3  
ATOM   4698  H HB3  . TYR A 1 28 ? 16.472  2.565   -3.350  1.00 0.19 ? 28  TYR A HB3  3  
ATOM   4699  H HD1  . TYR A 1 28 ? 16.632  4.729   -5.038  1.00 0.27 ? 28  TYR A HD1  3  
ATOM   4700  H HD2  . TYR A 1 28 ? 14.632  4.621   -1.220  1.00 0.17 ? 28  TYR A HD2  3  
ATOM   4701  H HE1  . TYR A 1 28 ? 16.852  7.193   -4.853  1.00 0.30 ? 28  TYR A HE1  3  
ATOM   4702  H HE2  . TYR A 1 28 ? 14.852  7.085   -1.031  1.00 0.23 ? 28  TYR A HE2  3  
ATOM   4703  H HH   . TYR A 1 28 ? 15.401  8.974   -2.129  1.00 0.98 ? 28  TYR A HH   3  
ATOM   4704  N N    . TYR A 1 29 ? 12.623  3.379   -3.394  1.00 0.23 ? 29  TYR A N    3  
ATOM   4705  C CA   . TYR A 1 29 ? 11.343  4.124   -3.324  1.00 0.25 ? 29  TYR A CA   3  
ATOM   4706  C C    . TYR A 1 29 ? 10.956  4.288   -1.850  1.00 0.22 ? 29  TYR A C    3  
ATOM   4707  O O    . TYR A 1 29 ? 11.040  3.360   -1.078  1.00 0.23 ? 29  TYR A O    3  
ATOM   4708  C CB   . TYR A 1 29 ? 10.280  3.315   -4.091  1.00 0.29 ? 29  TYR A CB   3  
ATOM   4709  C CG   . TYR A 1 29 ? 8.886   3.723   -3.668  1.00 0.31 ? 29  TYR A CG   3  
ATOM   4710  C CD1  . TYR A 1 29 ? 8.474   5.057   -3.821  1.00 0.36 ? 29  TYR A CD1  3  
ATOM   4711  C CD2  . TYR A 1 29 ? 8.006   2.769   -3.120  1.00 0.35 ? 29  TYR A CD2  3  
ATOM   4712  C CE1  . TYR A 1 29 ? 7.178   5.443   -3.426  1.00 0.39 ? 29  TYR A CE1  3  
ATOM   4713  C CE2  . TYR A 1 29 ? 6.710   3.152   -2.726  1.00 0.38 ? 29  TYR A CE2  3  
ATOM   4714  C CZ   . TYR A 1 29 ? 6.296   4.491   -2.878  1.00 0.36 ? 29  TYR A CZ   3  
ATOM   4715  O OH   . TYR A 1 29 ? 5.027   4.869   -2.491  1.00 0.39 ? 29  TYR A OH   3  
ATOM   4716  H H    . TYR A 1 29 ? 12.921  2.850   -2.628  1.00 0.20 ? 29  TYR A H    3  
ATOM   4717  H HA   . TYR A 1 29 ? 11.461  5.095   -3.781  1.00 0.28 ? 29  TYR A HA   3  
ATOM   4718  H HB2  . TYR A 1 29 ? 10.395  3.494   -5.149  1.00 0.32 ? 29  TYR A HB2  3  
ATOM   4719  H HB3  . TYR A 1 29 ? 10.424  2.264   -3.892  1.00 0.27 ? 29  TYR A HB3  3  
ATOM   4720  H HD1  . TYR A 1 29 ? 9.152   5.784   -4.244  1.00 0.42 ? 29  TYR A HD1  3  
ATOM   4721  H HD2  . TYR A 1 29 ? 8.324   1.740   -3.007  1.00 0.40 ? 29  TYR A HD2  3  
ATOM   4722  H HE1  . TYR A 1 29 ? 6.861   6.468   -3.543  1.00 0.46 ? 29  TYR A HE1  3  
ATOM   4723  H HE2  . TYR A 1 29 ? 6.034   2.422   -2.305  1.00 0.44 ? 29  TYR A HE2  3  
ATOM   4724  H HH   . TYR A 1 29 ? 4.960   4.755   -1.540  1.00 0.97 ? 29  TYR A HH   3  
ATOM   4725  N N    . GLU A 1 30 ? 10.535  5.455   -1.446  1.00 0.22 ? 30  GLU A N    3  
ATOM   4726  C CA   . GLU A 1 30 ? 10.148  5.649   -0.014  1.00 0.20 ? 30  GLU A CA   3  
ATOM   4727  C C    . GLU A 1 30 ? 8.649   5.383   0.142   1.00 0.21 ? 30  GLU A C    3  
ATOM   4728  O O    . GLU A 1 30 ? 7.887   5.486   -0.798  1.00 0.24 ? 30  GLU A O    3  
ATOM   4729  C CB   . GLU A 1 30 ? 10.468  7.085   0.413   1.00 0.22 ? 30  GLU A CB   3  
ATOM   4730  C CG   . GLU A 1 30 ? 11.969  7.221   0.680   1.00 0.25 ? 30  GLU A CG   3  
ATOM   4731  C CD   . GLU A 1 30 ? 12.280  8.648   1.135   1.00 0.69 ? 30  GLU A CD   3  
ATOM   4732  O OE1  . GLU A 1 30 ? 11.486  9.528   0.844   1.00 1.43 ? 30  GLU A OE1  3  
ATOM   4733  O OE2  . GLU A 1 30 ? 13.306  8.838   1.767   1.00 1.35 ? 30  GLU A OE2  3  
ATOM   4734  H H    . GLU A 1 30 ? 10.472  6.201   -2.078  1.00 0.25 ? 30  GLU A H    3  
ATOM   4735  H HA   . GLU A 1 30 ? 10.701  4.958   0.611   1.00 0.18 ? 30  GLU A HA   3  
ATOM   4736  H HB2  . GLU A 1 30 ? 10.183  7.760   -0.374  1.00 0.26 ? 30  GLU A HB2  3  
ATOM   4737  H HB3  . GLU A 1 30 ? 9.922   7.325   1.312   1.00 0.25 ? 30  GLU A HB3  3  
ATOM   4738  H HG2  . GLU A 1 30 ? 12.262  6.524   1.452   1.00 0.59 ? 30  GLU A HG2  3  
ATOM   4739  H HG3  . GLU A 1 30 ? 12.517  7.007   -0.225  1.00 0.45 ? 30  GLU A HG3  3  
ATOM   4740  N N    . THR A 1 31 ? 8.224   5.031   1.323   1.00 0.19 ? 31  THR A N    3  
ATOM   4741  C CA   . THR A 1 31 ? 6.778   4.741   1.552   1.00 0.21 ? 31  THR A CA   3  
ATOM   4742  C C    . THR A 1 31 ? 5.970   6.039   1.538   1.00 0.25 ? 31  THR A C    3  
ATOM   4743  O O    . THR A 1 31 ? 6.432   7.072   1.094   1.00 0.27 ? 31  THR A O    3  
ATOM   4744  C CB   . THR A 1 31 ? 6.616   4.077   2.918   1.00 0.20 ? 31  THR A CB   3  
ATOM   4745  O OG1  . THR A 1 31 ? 7.270   4.873   3.890   1.00 0.21 ? 31  THR A OG1  3  
ATOM   4746  C CG2  . THR A 1 31 ? 7.232   2.677   2.882   1.00 0.20 ? 31  THR A CG2  3  
ATOM   4747  H H    . THR A 1 31 ? 8.863   4.946   2.064   1.00 0.18 ? 31  THR A H    3  
ATOM   4748  H HA   . THR A 1 31 ? 6.414   4.079   0.782   1.00 0.22 ? 31  THR A HA   3  
ATOM   4749  H HB   . THR A 1 31 ? 5.570   4.000   3.169   1.00 0.22 ? 31  THR A HB   3  
ATOM   4750  H HG1  . THR A 1 31 ? 8.198   4.932   3.650   1.00 0.73 ? 31  THR A HG1  3  
ATOM   4751  H HG21 . THR A 1 31 ? 8.178   2.710   2.361   1.00 1.04 ? 31  THR A HG21 3  
ATOM   4752  H HG22 . THR A 1 31 ? 7.390   2.327   3.892   1.00 1.04 ? 31  THR A HG22 3  
ATOM   4753  H HG23 . THR A 1 31 ? 6.563   2.003   2.369   1.00 1.00 ? 31  THR A HG23 3  
ATOM   4754  N N    . SER A 1 32 ? 4.764   5.983   2.033   1.00 0.27 ? 32  SER A N    3  
ATOM   4755  C CA   . SER A 1 32 ? 3.902   7.196   2.069   1.00 0.31 ? 32  SER A CA   3  
ATOM   4756  C C    . SER A 1 32 ? 4.186   7.982   3.347   1.00 0.33 ? 32  SER A C    3  
ATOM   4757  O O    . SER A 1 32 ? 5.304   8.056   3.815   1.00 0.33 ? 32  SER A O    3  
ATOM   4758  C CB   . SER A 1 32 ? 2.437   6.768   2.061   1.00 0.33 ? 32  SER A CB   3  
ATOM   4759  O OG   . SER A 1 32 ? 2.209   5.888   0.968   1.00 1.27 ? 32  SER A OG   3  
ATOM   4760  H H    . SER A 1 32 ? 4.422   5.136   2.386   1.00 0.26 ? 32  SER A H    3  
ATOM   4761  H HA   . SER A 1 32 ? 4.099   7.816   1.211   1.00 0.34 ? 32  SER A HA   3  
ATOM   4762  H HB2  . SER A 1 32 ? 2.207   6.258   2.982   1.00 0.94 ? 32  SER A HB2  3  
ATOM   4763  H HB3  . SER A 1 32 ? 1.808   7.643   1.971   1.00 0.85 ? 32  SER A HB3  3  
ATOM   4764  H HG   . SER A 1 32 ? 1.523   6.271   0.417   1.00 1.72 ? 32  SER A HG   3  
ATOM   4765  N N    . SER A 1 33 ? 3.169   8.566   3.912   1.00 0.36 ? 33  SER A N    3  
ATOM   4766  C CA   . SER A 1 33 ? 3.339   9.356   5.167   1.00 0.40 ? 33  SER A CA   3  
ATOM   4767  C C    . SER A 1 33 ? 2.100   9.158   6.035   1.00 0.40 ? 33  SER A C    3  
ATOM   4768  O O    . SER A 1 33 ? 2.174   9.092   7.246   1.00 0.42 ? 33  SER A O    3  
ATOM   4769  C CB   . SER A 1 33 ? 3.469   10.833  4.815   1.00 0.46 ? 33  SER A CB   3  
ATOM   4770  O OG   . SER A 1 33 ? 2.174   11.378  4.595   1.00 0.48 ? 33  SER A OG   3  
ATOM   4771  H H    . SER A 1 33 ? 2.283   8.483   3.506   1.00 0.37 ? 33  SER A H    3  
ATOM   4772  H HA   . SER A 1 33 ? 4.218   9.026   5.703   1.00 0.39 ? 33  SER A HA   3  
ATOM   4773  H HB2  . SER A 1 33 ? 3.946   11.362  5.622   1.00 0.48 ? 33  SER A HB2  3  
ATOM   4774  H HB3  . SER A 1 33 ? 4.062   10.928  3.920   1.00 0.46 ? 33  SER A HB3  3  
ATOM   4775  H HG   . SER A 1 33 ? 2.280   12.280  4.284   1.00 1.00 ? 33  SER A HG   3  
ATOM   4776  N N    . LEU A 1 34 ? 0.961   9.068   5.404   1.00 0.39 ? 34  LEU A N    3  
ATOM   4777  C CA   . LEU A 1 34 ? -0.322  8.874   6.141   1.00 0.39 ? 34  LEU A CA   3  
ATOM   4778  C C    . LEU A 1 34 ? -0.124  7.897   7.301   1.00 0.37 ? 34  LEU A C    3  
ATOM   4779  O O    . LEU A 1 34 ? -0.381  8.211   8.446   1.00 0.40 ? 34  LEU A O    3  
ATOM   4780  C CB   . LEU A 1 34 ? -1.376  8.306   5.185   1.00 0.36 ? 34  LEU A CB   3  
ATOM   4781  C CG   . LEU A 1 34 ? -1.283  8.998   3.824   1.00 0.39 ? 34  LEU A CG   3  
ATOM   4782  C CD1  . LEU A 1 34 ? -2.453  8.551   2.943   1.00 0.40 ? 34  LEU A CD1  3  
ATOM   4783  C CD2  . LEU A 1 34 ? -1.332  10.518  4.015   1.00 0.45 ? 34  LEU A CD2  3  
ATOM   4784  H H    . LEU A 1 34 ? 0.952   9.134   4.430   1.00 0.39 ? 34  LEU A H    3  
ATOM   4785  H HA   . LEU A 1 34 ? -0.662  9.822   6.522   1.00 0.43 ? 34  LEU A HA   3  
ATOM   4786  H HB2  . LEU A 1 34 ? -1.214  7.244   5.055   1.00 0.34 ? 34  LEU A HB2  3  
ATOM   4787  H HB3  . LEU A 1 34 ? -2.355  8.468   5.599   1.00 0.37 ? 34  LEU A HB3  3  
ATOM   4788  H HG   . LEU A 1 34 ? -0.357  8.724   3.345   1.00 0.39 ? 34  LEU A HG   3  
ATOM   4789  H HD11 . LEU A 1 34 ? -2.614  7.488   3.066   1.00 1.04 ? 34  LEU A HD11 3  
ATOM   4790  H HD12 . LEU A 1 34 ? -3.346  9.087   3.229   1.00 1.09 ? 34  LEU A HD12 3  
ATOM   4791  H HD13 . LEU A 1 34 ? -2.224  8.760   1.911   1.00 1.11 ? 34  LEU A HD13 3  
ATOM   4792  H HD21 . LEU A 1 34 ? -2.119  10.768  4.711   1.00 1.14 ? 34  LEU A HD21 3  
ATOM   4793  H HD22 . LEU A 1 34 ? -0.385  10.862  4.403   1.00 1.13 ? 34  LEU A HD22 3  
ATOM   4794  H HD23 . LEU A 1 34 ? -1.527  10.993  3.065   1.00 1.05 ? 34  LEU A HD23 3  
ATOM   4795  N N    . CYS A 1 35 ? 0.327   6.712   7.008   1.00 0.33 ? 35  CYS A N    3  
ATOM   4796  C CA   . CYS A 1 35 ? 0.538   5.711   8.087   1.00 0.34 ? 35  CYS A CA   3  
ATOM   4797  C C    . CYS A 1 35 ? 1.733   6.140   8.947   1.00 0.39 ? 35  CYS A C    3  
ATOM   4798  O O    . CYS A 1 35 ? 2.785   6.472   8.446   1.00 0.38 ? 35  CYS A O    3  
ATOM   4799  C CB   . CYS A 1 35 ? 0.798   4.333   7.469   1.00 0.32 ? 35  CYS A CB   3  
ATOM   4800  S SG   . CYS A 1 35 ? 1.849   4.504   6.004   1.00 0.39 ? 35  CYS A SG   3  
ATOM   4801  H H    . CYS A 1 35 ? 0.525   6.481   6.076   1.00 0.31 ? 35  CYS A H    3  
ATOM   4802  H HA   . CYS A 1 35 ? -0.349  5.667   8.704   1.00 0.36 ? 35  CYS A HA   3  
ATOM   4803  H HB2  . CYS A 1 35 ? 1.290   3.701   8.190   1.00 0.43 ? 35  CYS A HB2  3  
ATOM   4804  H HB3  . CYS A 1 35 ? -0.144  3.886   7.184   1.00 0.34 ? 35  CYS A HB3  3  
ATOM   4805  N N    . SER A 1 36 ? 1.561   6.162   10.239  1.00 0.44 ? 36  SER A N    3  
ATOM   4806  C CA   . SER A 1 36 ? 2.670   6.586   11.145  1.00 0.51 ? 36  SER A CA   3  
ATOM   4807  C C    . SER A 1 36 ? 3.840   5.590   11.108  1.00 0.51 ? 36  SER A C    3  
ATOM   4808  O O    . SER A 1 36 ? 4.521   5.407   12.097  1.00 0.58 ? 36  SER A O    3  
ATOM   4809  C CB   . SER A 1 36 ? 2.139   6.681   12.575  1.00 0.59 ? 36  SER A CB   3  
ATOM   4810  O OG   . SER A 1 36 ? 1.533   5.447   12.934  1.00 1.41 ? 36  SER A OG   3  
ATOM   4811  H H    . SER A 1 36 ? 0.694   5.911   10.618  1.00 0.45 ? 36  SER A H    3  
ATOM   4812  H HA   . SER A 1 36 ? 3.025   7.559   10.838  1.00 0.53 ? 36  SER A HA   3  
ATOM   4813  H HB2  . SER A 1 36 ? 2.952   6.887   13.250  1.00 1.10 ? 36  SER A HB2  3  
ATOM   4814  H HB3  . SER A 1 36 ? 1.413   7.482   12.635  1.00 1.27 ? 36  SER A HB3  3  
ATOM   4815  H HG   . SER A 1 36 ? 1.118   5.081   12.150  1.00 1.84 ? 36  SER A HG   3  
ATOM   4816  N N    . GLN A 1 37 ? 4.096   4.937   10.000  1.00 0.45 ? 37  GLN A N    3  
ATOM   4817  C CA   . GLN A 1 37 ? 5.238   3.966   9.973   1.00 0.47 ? 37  GLN A CA   3  
ATOM   4818  C C    . GLN A 1 37 ? 5.785   3.799   8.546   1.00 0.36 ? 37  GLN A C    3  
ATOM   4819  O O    . GLN A 1 37 ? 5.686   2.728   7.982   1.00 0.35 ? 37  GLN A O    3  
ATOM   4820  C CB   . GLN A 1 37 ? 4.754   2.609   10.491  1.00 0.55 ? 37  GLN A CB   3  
ATOM   4821  C CG   . GLN A 1 37 ? 3.412   2.260   9.843   1.00 0.78 ? 37  GLN A CG   3  
ATOM   4822  C CD   . GLN A 1 37 ? 2.974   0.866   10.296  1.00 0.79 ? 37  GLN A CD   3  
ATOM   4823  O OE1  . GLN A 1 37 ? 1.814   0.644   10.581  1.00 1.24 ? 37  GLN A OE1  3  
ATOM   4824  N NE2  . GLN A 1 37 ? 3.859   -0.090  10.375  1.00 1.47 ? 37  GLN A NE2  3  
ATOM   4825  H H    . GLN A 1 37 ? 3.550   5.079   9.199   1.00 0.41 ? 37  GLN A H    3  
ATOM   4826  H HA   . GLN A 1 37 ? 6.033   4.324   10.613  1.00 0.54 ? 37  GLN A HA   3  
ATOM   4827  H HB2  . GLN A 1 37 ? 5.482   1.848   10.246  1.00 0.86 ? 37  GLN A HB2  3  
ATOM   4828  H HB3  . GLN A 1 37 ? 4.632   2.657   11.564  1.00 1.06 ? 37  GLN A HB3  3  
ATOM   4829  H HG2  . GLN A 1 37 ? 2.669   2.986   10.141  1.00 1.27 ? 37  GLN A HG2  3  
ATOM   4830  H HG3  . GLN A 1 37 ? 3.517   2.271   8.769   1.00 1.13 ? 37  GLN A HG3  3  
ATOM   4831  H HE21 . GLN A 1 37 ? 4.795   0.089   10.145  1.00 2.19 ? 37  GLN A HE21 3  
ATOM   4832  H HE22 . GLN A 1 37 ? 3.587   -0.986  10.664  1.00 1.53 ? 37  GLN A HE22 3  
ATOM   4833  N N    . PRO A 1 38 ? 6.370   4.845   8.006   1.00 0.34 ? 38  PRO A N    3  
ATOM   4834  C CA   . PRO A 1 38 ? 6.955   4.789   6.652   1.00 0.26 ? 38  PRO A CA   3  
ATOM   4835  C C    . PRO A 1 38 ? 8.218   3.913   6.683   1.00 0.25 ? 38  PRO A C    3  
ATOM   4836  O O    . PRO A 1 38 ? 8.626   3.425   7.718   1.00 0.27 ? 38  PRO A O    3  
ATOM   4837  C CB   . PRO A 1 38 ? 7.306   6.257   6.316   1.00 0.33 ? 38  PRO A CB   3  
ATOM   4838  C CG   . PRO A 1 38 ? 7.127   7.087   7.622   1.00 0.43 ? 38  PRO A CG   3  
ATOM   4839  C CD   . PRO A 1 38 ? 6.489   6.158   8.679   1.00 0.43 ? 38  PRO A CD   3  
ATOM   4840  H HA   . PRO A 1 38 ? 6.240   4.397   5.937   1.00 0.23 ? 38  PRO A HA   3  
ATOM   4841  H HB2  . PRO A 1 38 ? 8.330   6.333   5.963   1.00 0.32 ? 38  PRO A HB2  3  
ATOM   4842  H HB3  . PRO A 1 38 ? 6.634   6.632   5.555   1.00 0.34 ? 38  PRO A HB3  3  
ATOM   4843  H HG2  . PRO A 1 38 ? 8.092   7.440   7.968   1.00 0.50 ? 38  PRO A HG2  3  
ATOM   4844  H HG3  . PRO A 1 38 ? 6.477   7.934   7.438   1.00 0.48 ? 38  PRO A HG3  3  
ATOM   4845  H HD2  . PRO A 1 38 ? 7.128   6.080   9.549   1.00 0.50 ? 38  PRO A HD2  3  
ATOM   4846  H HD3  . PRO A 1 38 ? 5.513   6.520   8.962   1.00 0.45 ? 38  PRO A HD3  3  
ATOM   4847  N N    . ALA A 1 39 ? 8.838   3.725   5.554   1.00 0.23 ? 39  ALA A N    3  
ATOM   4848  C CA   . ALA A 1 39 ? 10.072  2.903   5.490   1.00 0.22 ? 39  ALA A CA   3  
ATOM   4849  C C    . ALA A 1 39 ? 10.714  3.118   4.123   1.00 0.19 ? 39  ALA A C    3  
ATOM   4850  O O    . ALA A 1 39 ? 10.119  3.707   3.243   1.00 0.22 ? 39  ALA A O    3  
ATOM   4851  C CB   . ALA A 1 39 ? 9.719   1.424   5.660   1.00 0.23 ? 39  ALA A CB   3  
ATOM   4852  H H    . ALA A 1 39 ? 8.495   4.135   4.740   1.00 0.23 ? 39  ALA A H    3  
ATOM   4853  H HA   . ALA A 1 39 ? 10.754  3.209   6.267   1.00 0.24 ? 39  ALA A HA   3  
ATOM   4854  H HB1  . ALA A 1 39 ? 9.064   1.306   6.510   1.00 1.03 ? 39  ALA A HB1  3  
ATOM   4855  H HB2  . ALA A 1 39 ? 9.220   1.068   4.770   1.00 1.03 ? 39  ALA A HB2  3  
ATOM   4856  H HB3  . ALA A 1 39 ? 10.622  0.855   5.818   1.00 0.99 ? 39  ALA A HB3  3  
ATOM   4857  N N    . VAL A 1 40 ? 11.910  2.632   3.920   1.00 0.15 ? 40  VAL A N    3  
ATOM   4858  C CA   . VAL A 1 40 ? 12.567  2.797   2.589   1.00 0.13 ? 40  VAL A CA   3  
ATOM   4859  C C    . VAL A 1 40 ? 12.370  1.500   1.810   1.00 0.13 ? 40  VAL A C    3  
ATOM   4860  O O    . VAL A 1 40 ? 12.452  0.417   2.354   1.00 0.18 ? 40  VAL A O    3  
ATOM   4861  C CB   . VAL A 1 40 ? 14.063  3.083   2.776   1.00 0.12 ? 40  VAL A CB   3  
ATOM   4862  C CG1  . VAL A 1 40 ? 14.812  2.847   1.458   1.00 0.12 ? 40  VAL A CG1  3  
ATOM   4863  C CG2  . VAL A 1 40 ? 14.243  4.543   3.193   1.00 0.16 ? 40  VAL A CG2  3  
ATOM   4864  H H    . VAL A 1 40 ? 12.369  2.144   4.638   1.00 0.14 ? 40  VAL A H    3  
ATOM   4865  H HA   . VAL A 1 40 ? 12.108  3.617   2.041   1.00 0.16 ? 40  VAL A HA   3  
ATOM   4866  H HB   . VAL A 1 40 ? 14.464  2.433   3.540   1.00 0.11 ? 40  VAL A HB   3  
ATOM   4867  H HG11 . VAL A 1 40 ? 14.245  3.277   0.645   1.00 1.04 ? 40  VAL A HG11 3  
ATOM   4868  H HG12 . VAL A 1 40 ? 15.785  3.312   1.504   1.00 1.02 ? 40  VAL A HG12 3  
ATOM   4869  H HG13 . VAL A 1 40 ? 14.925  1.786   1.294   1.00 1.00 ? 40  VAL A HG13 3  
ATOM   4870  H HG21 . VAL A 1 40 ? 13.576  4.767   4.010   1.00 0.99 ? 40  VAL A HG21 3  
ATOM   4871  H HG22 . VAL A 1 40 ? 15.265  4.704   3.504   1.00 1.06 ? 40  VAL A HG22 3  
ATOM   4872  H HG23 . VAL A 1 40 ? 14.016  5.185   2.355   1.00 1.01 ? 40  VAL A HG23 3  
ATOM   4873  N N    . VAL A 1 41 ? 12.094  1.611   0.541   1.00 0.15 ? 41  VAL A N    3  
ATOM   4874  C CA   . VAL A 1 41 ? 11.864  0.401   -0.309  1.00 0.16 ? 41  VAL A CA   3  
ATOM   4875  C C    . VAL A 1 41 ? 12.953  0.316   -1.381  1.00 0.16 ? 41  VAL A C    3  
ATOM   4876  O O    . VAL A 1 41 ? 13.060  1.169   -2.234  1.00 0.18 ? 41  VAL A O    3  
ATOM   4877  C CB   . VAL A 1 41 ? 10.489  0.525   -0.970  1.00 0.21 ? 41  VAL A CB   3  
ATOM   4878  C CG1  . VAL A 1 41 ? 10.035  -0.832  -1.492  1.00 0.25 ? 41  VAL A CG1  3  
ATOM   4879  C CG2  . VAL A 1 41 ? 9.479   1.029   0.064   1.00 0.23 ? 41  VAL A CG2  3  
ATOM   4880  H H    . VAL A 1 41 ? 12.029  2.504   0.144   1.00 0.20 ? 41  VAL A H    3  
ATOM   4881  H HA   . VAL A 1 41 ? 11.888  -0.491  0.297   1.00 0.15 ? 41  VAL A HA   3  
ATOM   4882  H HB   . VAL A 1 41 ? 10.544  1.220   -1.793  1.00 0.22 ? 41  VAL A HB   3  
ATOM   4883  H HG11 . VAL A 1 41 ? 10.039  -1.550  -0.684  1.00 0.99 ? 41  VAL A HG11 3  
ATOM   4884  H HG12 . VAL A 1 41 ? 9.035   -0.739  -1.884  1.00 1.08 ? 41  VAL A HG12 3  
ATOM   4885  H HG13 . VAL A 1 41 ? 10.701  -1.163  -2.274  1.00 1.04 ? 41  VAL A HG13 3  
ATOM   4886  H HG21 . VAL A 1 41 ? 9.506   0.389   0.934   1.00 1.06 ? 41  VAL A HG21 3  
ATOM   4887  H HG22 . VAL A 1 41 ? 9.730   2.038   0.354   1.00 1.03 ? 41  VAL A HG22 3  
ATOM   4888  H HG23 . VAL A 1 41 ? 8.488   1.013   -0.364  1.00 1.04 ? 41  VAL A HG23 3  
ATOM   4889  N N    . PHE A 1 42 ? 13.767  -0.704  -1.344  1.00 0.15 ? 42  PHE A N    3  
ATOM   4890  C CA   . PHE A 1 42 ? 14.853  -0.825  -2.363  1.00 0.17 ? 42  PHE A CA   3  
ATOM   4891  C C    . PHE A 1 42 ? 14.332  -1.574  -3.591  1.00 0.21 ? 42  PHE A C    3  
ATOM   4892  O O    . PHE A 1 42 ? 13.686  -2.597  -3.482  1.00 0.23 ? 42  PHE A O    3  
ATOM   4893  C CB   . PHE A 1 42 ? 16.031  -1.606  -1.771  1.00 0.16 ? 42  PHE A CB   3  
ATOM   4894  C CG   . PHE A 1 42 ? 16.798  -0.734  -0.800  1.00 0.14 ? 42  PHE A CG   3  
ATOM   4895  C CD1  . PHE A 1 42 ? 17.460  0.422   -1.260  1.00 0.14 ? 42  PHE A CD1  3  
ATOM   4896  C CD2  . PHE A 1 42 ? 16.860  -1.083  0.564   1.00 0.13 ? 42  PHE A CD2  3  
ATOM   4897  C CE1  . PHE A 1 42 ? 18.181  1.227   -0.358  1.00 0.14 ? 42  PHE A CE1  3  
ATOM   4898  C CE2  . PHE A 1 42 ? 17.581  -0.278  1.464   1.00 0.14 ? 42  PHE A CE2  3  
ATOM   4899  C CZ   . PHE A 1 42 ? 18.242  0.877   1.003   1.00 0.14 ? 42  PHE A CZ   3  
ATOM   4900  H H    . PHE A 1 42 ? 13.671  -1.384  -0.646  1.00 0.15 ? 42  PHE A H    3  
ATOM   4901  H HA   . PHE A 1 42 ? 15.186  0.158   -2.659  1.00 0.17 ? 42  PHE A HA   3  
ATOM   4902  H HB2  . PHE A 1 42 ? 15.658  -2.479  -1.258  1.00 0.16 ? 42  PHE A HB2  3  
ATOM   4903  H HB3  . PHE A 1 42 ? 16.692  -1.916  -2.568  1.00 0.18 ? 42  PHE A HB3  3  
ATOM   4904  H HD1  . PHE A 1 42 ? 17.416  0.691   -2.305  1.00 0.16 ? 42  PHE A HD1  3  
ATOM   4905  H HD2  . PHE A 1 42 ? 16.353  -1.967  0.919   1.00 0.14 ? 42  PHE A HD2  3  
ATOM   4906  H HE1  . PHE A 1 42 ? 18.687  2.113   -0.711  1.00 0.16 ? 42  PHE A HE1  3  
ATOM   4907  H HE2  . PHE A 1 42 ? 17.629  -0.548  2.509   1.00 0.16 ? 42  PHE A HE2  3  
ATOM   4908  H HZ   . PHE A 1 42 ? 18.797  1.495   1.694   1.00 0.16 ? 42  PHE A HZ   3  
ATOM   4909  N N    . GLN A 1 43 ? 14.634  -1.079  -4.763  1.00 0.24 ? 43  GLN A N    3  
ATOM   4910  C CA   . GLN A 1 43 ? 14.190  -1.763  -6.013  1.00 0.28 ? 43  GLN A CA   3  
ATOM   4911  C C    . GLN A 1 43 ? 15.355  -2.626  -6.502  1.00 0.30 ? 43  GLN A C    3  
ATOM   4912  O O    . GLN A 1 43 ? 16.445  -2.127  -6.713  1.00 0.30 ? 43  GLN A O    3  
ATOM   4913  C CB   . GLN A 1 43 ? 13.828  -0.707  -7.058  1.00 0.32 ? 43  GLN A CB   3  
ATOM   4914  C CG   . GLN A 1 43 ? 12.602  0.078   -6.587  1.00 0.32 ? 43  GLN A CG   3  
ATOM   4915  C CD   . GLN A 1 43 ? 12.414  1.312   -7.472  1.00 0.58 ? 43  GLN A CD   3  
ATOM   4916  O OE1  . GLN A 1 43 ? 12.251  2.410   -6.978  1.00 1.29 ? 43  GLN A OE1  3  
ATOM   4917  N NE2  . GLN A 1 43 ? 12.428  1.176   -8.770  1.00 1.31 ? 43  GLN A NE2  3  
ATOM   4918  H H    . GLN A 1 43 ? 15.173  -0.263  -4.822  1.00 0.23 ? 43  GLN A H    3  
ATOM   4919  H HA   . GLN A 1 43 ? 13.337  -2.385  -5.807  1.00 0.29 ? 43  GLN A HA   3  
ATOM   4920  H HB2  . GLN A 1 43 ? 14.660  -0.033  -7.188  1.00 0.32 ? 43  GLN A HB2  3  
ATOM   4921  H HB3  . GLN A 1 43 ? 13.604  -1.184  -7.995  1.00 0.36 ? 43  GLN A HB3  3  
ATOM   4922  H HG2  . GLN A 1 43 ? 11.725  -0.551  -6.654  1.00 0.36 ? 43  GLN A HG2  3  
ATOM   4923  H HG3  . GLN A 1 43 ? 12.743  0.389   -5.564  1.00 0.40 ? 43  GLN A HG3  3  
ATOM   4924  H HE21 . GLN A 1 43 ? 12.558  0.290   -9.168  1.00 2.01 ? 43  GLN A HE21 3  
ATOM   4925  H HE22 . GLN A 1 43 ? 12.308  1.959   -9.345  1.00 1.45 ? 43  GLN A HE22 3  
ATOM   4926  N N    . THR A 1 44 ? 15.163  -3.927  -6.636  1.00 0.32 ? 44  THR A N    3  
ATOM   4927  C CA   . THR A 1 44 ? 16.313  -4.810  -7.049  1.00 0.34 ? 44  THR A CA   3  
ATOM   4928  C C    . THR A 1 44 ? 16.276  -5.152  -8.538  1.00 0.39 ? 44  THR A C    3  
ATOM   4929  O O    . THR A 1 44 ? 15.719  -4.437  -9.348  1.00 0.41 ? 44  THR A O    3  
ATOM   4930  C CB   . THR A 1 44 ? 16.261  -6.107  -6.246  1.00 0.34 ? 44  THR A CB   3  
ATOM   4931  O OG1  . THR A 1 44 ? 15.332  -6.993  -6.848  1.00 0.38 ? 44  THR A OG1  3  
ATOM   4932  C CG2  . THR A 1 44 ? 15.818  -5.791  -4.819  1.00 0.29 ? 44  THR A CG2  3  
ATOM   4933  H H    . THR A 1 44 ? 14.277  -4.326  -6.428  1.00 0.32 ? 44  THR A H    3  
ATOM   4934  H HA   . THR A 1 44 ? 17.249  -4.310  -6.831  1.00 0.33 ? 44  THR A HA   3  
ATOM   4935  H HB   . THR A 1 44 ? 17.240  -6.565  -6.224  1.00 0.35 ? 44  THR A HB   3  
ATOM   4936  H HG1  . THR A 1 44 ? 15.825  -7.715  -7.246  1.00 0.77 ? 44  THR A HG1  3  
ATOM   4937  H HG21 . THR A 1 44 ? 16.432  -4.998  -4.420  1.00 1.03 ? 44  THR A HG21 3  
ATOM   4938  H HG22 . THR A 1 44 ? 14.786  -5.476  -4.828  1.00 1.00 ? 44  THR A HG22 3  
ATOM   4939  H HG23 . THR A 1 44 ? 15.921  -6.670  -4.204  1.00 1.07 ? 44  THR A HG23 3  
ATOM   4940  N N    . LYS A 1 45 ? 16.903  -6.252  -8.894  1.00 0.43 ? 45  LYS A N    3  
ATOM   4941  C CA   . LYS A 1 45 ? 16.968  -6.690  -10.325 1.00 0.48 ? 45  LYS A CA   3  
ATOM   4942  C C    . LYS A 1 45 ? 16.232  -8.024  -10.509 1.00 0.51 ? 45  LYS A C    3  
ATOM   4943  O O    . LYS A 1 45 ? 15.787  -8.342  -11.594 1.00 0.56 ? 45  LYS A O    3  
ATOM   4944  C CB   . LYS A 1 45 ? 18.438  -6.884  -10.718 1.00 0.50 ? 45  LYS A CB   3  
ATOM   4945  C CG   . LYS A 1 45 ? 19.282  -5.714  -10.207 1.00 0.46 ? 45  LYS A CG   3  
ATOM   4946  C CD   . LYS A 1 45 ? 20.744  -5.937  -10.606 1.00 0.49 ? 45  LYS A CD   3  
ATOM   4947  C CE   . LYS A 1 45 ? 21.570  -4.693  -10.272 1.00 0.54 ? 45  LYS A CE   3  
ATOM   4948  N NZ   . LYS A 1 45 ? 23.015  -5.054  -10.233 1.00 1.55 ? 45  LYS A NZ   3  
ATOM   4949  H H    . LYS A 1 45 ? 17.354  -6.790  -8.210  1.00 0.44 ? 45  LYS A H    3  
ATOM   4950  H HA   . LYS A 1 45 ? 16.523  -5.941  -10.965 1.00 0.49 ? 45  LYS A HA   3  
ATOM   4951  H HB2  . LYS A 1 45 ? 18.808  -7.804  -10.288 1.00 0.51 ? 45  LYS A HB2  3  
ATOM   4952  H HB3  . LYS A 1 45 ? 18.518  -6.937  -11.792 1.00 0.57 ? 45  LYS A HB3  3  
ATOM   4953  H HG2  . LYS A 1 45 ? 18.923  -4.794  -10.643 1.00 0.50 ? 45  LYS A HG2  3  
ATOM   4954  H HG3  . LYS A 1 45 ? 19.211  -5.659  -9.132  1.00 0.42 ? 45  LYS A HG3  3  
ATOM   4955  H HD2  . LYS A 1 45 ? 21.138  -6.786  -10.065 1.00 0.51 ? 45  LYS A HD2  3  
ATOM   4956  H HD3  . LYS A 1 45 ? 20.801  -6.130  -11.666 1.00 0.63 ? 45  LYS A HD3  3  
ATOM   4957  H HE2  . LYS A 1 45 ? 21.409  -3.940  -11.030 1.00 0.95 ? 45  LYS A HE2  3  
ATOM   4958  H HE3  . LYS A 1 45 ? 21.271  -4.305  -9.309  1.00 1.20 ? 45  LYS A HE3  3  
ATOM   4959  H HZ1  . LYS A 1 45 ? 23.150  -5.995  -10.652 1.00 2.16 ? 45  LYS A HZ1  3  
ATOM   4960  H HZ2  . LYS A 1 45 ? 23.562  -4.355  -10.774 1.00 2.09 ? 45  LYS A HZ2  3  
ATOM   4961  H HZ3  . LYS A 1 45 ? 23.344  -5.063  -9.246  1.00 2.04 ? 45  LYS A HZ3  3  
ATOM   4962  N N    . ARG A 1 46 ? 16.111  -8.812  -9.463  1.00 0.50 ? 46  ARG A N    3  
ATOM   4963  C CA   . ARG A 1 46 ? 15.413  -10.141 -9.574  1.00 0.54 ? 46  ARG A CA   3  
ATOM   4964  C C    . ARG A 1 46 ? 14.206  -10.142 -8.636  1.00 0.49 ? 46  ARG A C    3  
ATOM   4965  O O    . ARG A 1 46 ? 13.883  -11.125 -8.006  1.00 0.48 ? 46  ARG A O    3  
ATOM   4966  C CB   . ARG A 1 46 ? 16.397  -11.264 -9.187  1.00 0.59 ? 46  ARG A CB   3  
ATOM   4967  C CG   . ARG A 1 46 ? 15.931  -12.646 -9.730  1.00 0.72 ? 46  ARG A CG   3  
ATOM   4968  C CD   . ARG A 1 46 ? 15.021  -13.388 -8.721  1.00 0.92 ? 46  ARG A CD   3  
ATOM   4969  N NE   . ARG A 1 46 ? 15.364  -14.847 -8.719  1.00 1.48 ? 46  ARG A NE   3  
ATOM   4970  C CZ   . ARG A 1 46 ? 15.494  -15.515 -9.835  1.00 2.13 ? 46  ARG A CZ   3  
ATOM   4971  N NH1  . ARG A 1 46 ? 15.166  -14.975 -10.975 1.00 2.62 ? 46  ARG A NH1  3  
ATOM   4972  N NH2  . ARG A 1 46 ? 15.906  -16.754 -9.802  1.00 2.82 ? 46  ARG A NH2  3  
ATOM   4973  H H    . ARG A 1 46 ? 16.484  -8.532  -8.600  1.00 0.48 ? 46  ARG A H    3  
ATOM   4974  H HA   . ARG A 1 46 ? 15.069  -10.289 -10.587 1.00 0.59 ? 46  ARG A HA   3  
ATOM   4975  H HB2  . ARG A 1 46 ? 17.364  -11.032 -9.613  1.00 0.68 ? 46  ARG A HB2  3  
ATOM   4976  H HB3  . ARG A 1 46 ? 16.491  -11.303 -8.117  1.00 0.53 ? 46  ARG A HB3  3  
ATOM   4977  H HG2  . ARG A 1 46 ? 15.398  -12.506 -10.657 1.00 0.90 ? 46  ARG A HG2  3  
ATOM   4978  H HG3  . ARG A 1 46 ? 16.803  -13.257 -9.923  1.00 1.21 ? 46  ARG A HG3  3  
ATOM   4979  H HD2  . ARG A 1 46 ? 15.180  -13.020 -7.725  1.00 1.48 ? 46  ARG A HD2  3  
ATOM   4980  H HD3  . ARG A 1 46 ? 13.980  -13.242 -8.992  1.00 1.01 ? 46  ARG A HD3  3  
ATOM   4981  H HE   . ARG A 1 46 ? 15.540  -15.296 -7.867  1.00 1.94 ? 46  ARG A HE   3  
ATOM   4982  H HH11 . ARG A 1 46 ? 14.809  -14.046 -11.003 1.00 2.46 ? 46  ARG A HH11 3  
ATOM   4983  H HH12 . ARG A 1 46 ? 15.274  -15.494 -11.823 1.00 3.45 ? 46  ARG A HH12 3  
ATOM   4984  H HH21 . ARG A 1 46 ? 16.121  -17.185 -8.925  1.00 2.97 ? 46  ARG A HH21 3  
ATOM   4985  H HH22 . ARG A 1 46 ? 16.007  -17.271 -10.651 1.00 3.45 ? 46  ARG A HH22 3  
ATOM   4986  N N    . SER A 1 47 ? 13.530  -9.036  -8.559  1.00 0.46 ? 47  SER A N    3  
ATOM   4987  C CA   . SER A 1 47 ? 12.334  -8.935  -7.696  1.00 0.42 ? 47  SER A CA   3  
ATOM   4988  C C    . SER A 1 47 ? 11.578  -7.686  -8.125  1.00 0.42 ? 47  SER A C    3  
ATOM   4989  O O    . SER A 1 47 ? 11.242  -7.520  -9.281  1.00 0.46 ? 47  SER A O    3  
ATOM   4990  C CB   . SER A 1 47 ? 12.750  -8.831  -6.221  1.00 0.38 ? 47  SER A CB   3  
ATOM   4991  O OG   . SER A 1 47 ? 13.266  -7.535  -5.960  1.00 1.07 ? 47  SER A OG   3  
ATOM   4992  H H    . SER A 1 47 ? 13.805  -8.257  -9.082  1.00 0.47 ? 47  SER A H    3  
ATOM   4993  H HA   . SER A 1 47 ? 11.712  -9.799  -7.838  1.00 0.44 ? 47  SER A HA   3  
ATOM   4994  H HB2  . SER A 1 47 ? 11.894  -9.000  -5.589  1.00 0.76 ? 47  SER A HB2  3  
ATOM   4995  H HB3  . SER A 1 47 ? 13.502  -9.580  -6.004  1.00 0.86 ? 47  SER A HB3  3  
ATOM   4996  H HG   . SER A 1 47 ? 13.321  -7.423  -5.008  1.00 1.44 ? 47  SER A HG   3  
ATOM   4997  N N    . LYS A 1 48 ? 11.336  -6.796  -7.226  1.00 0.38 ? 48  LYS A N    3  
ATOM   4998  C CA   . LYS A 1 48 ? 10.638  -5.541  -7.593  1.00 0.40 ? 48  LYS A CA   3  
ATOM   4999  C C    . LYS A 1 48 ? 10.875  -4.523  -6.487  1.00 0.35 ? 48  LYS A C    3  
ATOM   5000  O O    . LYS A 1 48 ? 11.645  -3.602  -6.641  1.00 0.34 ? 48  LYS A O    3  
ATOM   5001  C CB   . LYS A 1 48 ? 9.123   -5.781  -7.808  1.00 0.44 ? 48  LYS A CB   3  
ATOM   5002  C CG   . LYS A 1 48 ? 8.642   -7.017  -7.040  1.00 1.11 ? 48  LYS A CG   3  
ATOM   5003  C CD   . LYS A 1 48 ? 7.110   -7.093  -7.149  1.00 1.38 ? 48  LYS A CD   3  
ATOM   5004  C CE   . LYS A 1 48 ? 6.595   -8.468  -6.696  1.00 2.13 ? 48  LYS A CE   3  
ATOM   5005  N NZ   . LYS A 1 48 ? 5.273   -8.729  -7.331  1.00 2.73 ? 48  LYS A NZ   3  
ATOM   5006  H H    . LYS A 1 48 ? 11.650  -6.932  -6.314  1.00 0.36 ? 48  LYS A H    3  
ATOM   5007  H HA   . LYS A 1 48 ? 11.071  -5.159  -8.507  1.00 0.43 ? 48  LYS A HA   3  
ATOM   5008  H HB2  . LYS A 1 48 ? 8.564   -4.919  -7.473  1.00 0.92 ? 48  LYS A HB2  3  
ATOM   5009  H HB3  . LYS A 1 48 ? 8.933   -5.931  -8.862  1.00 0.85 ? 48  LYS A HB3  3  
ATOM   5010  H HG2  . LYS A 1 48 ? 9.084   -7.901  -7.472  1.00 1.64 ? 48  LYS A HG2  3  
ATOM   5011  H HG3  . LYS A 1 48 ? 8.926   -6.938  -6.002  1.00 1.69 ? 48  LYS A HG3  3  
ATOM   5012  H HD2  . LYS A 1 48 ? 6.671   -6.328  -6.526  1.00 1.70 ? 48  LYS A HD2  3  
ATOM   5013  H HD3  . LYS A 1 48 ? 6.816   -6.927  -8.175  1.00 1.63 ? 48  LYS A HD3  3  
ATOM   5014  H HE2  . LYS A 1 48 ? 7.290   -9.239  -6.992  1.00 2.60 ? 48  LYS A HE2  3  
ATOM   5015  H HE3  . LYS A 1 48 ? 6.482   -8.476  -5.624  1.00 2.56 ? 48  LYS A HE3  3  
ATOM   5016  H HZ1  . LYS A 1 48 ? 4.967   -7.883  -7.856  1.00 3.01 ? 48  LYS A HZ1  3  
ATOM   5017  H HZ2  . LYS A 1 48 ? 5.354   -9.533  -7.985  1.00 3.07 ? 48  LYS A HZ2  3  
ATOM   5018  H HZ3  . LYS A 1 48 ? 4.573   -8.954  -6.597  1.00 3.23 ? 48  LYS A HZ3  3  
ATOM   5019  N N    . GLN A 1 49 ? 10.212  -4.692  -5.372  1.00 0.33 ? 49  GLN A N    3  
ATOM   5020  C CA   . GLN A 1 49 ? 10.368  -3.743  -4.229  1.00 0.30 ? 49  GLN A CA   3  
ATOM   5021  C C    . GLN A 1 49 ? 10.639  -4.528  -2.936  1.00 0.25 ? 49  GLN A C    3  
ATOM   5022  O O    . GLN A 1 49 ? 10.101  -5.598  -2.714  1.00 0.26 ? 49  GLN A O    3  
ATOM   5023  C CB   . GLN A 1 49 ? 9.061   -2.939  -4.090  1.00 0.35 ? 49  GLN A CB   3  
ATOM   5024  C CG   . GLN A 1 49 ? 9.144   -1.643  -4.907  1.00 0.82 ? 49  GLN A CG   3  
ATOM   5025  C CD   . GLN A 1 49 ? 7.775   -0.960  -4.924  1.00 0.89 ? 49  GLN A CD   3  
ATOM   5026  O OE1  . GLN A 1 49 ? 7.599   0.060   -5.559  1.00 1.53 ? 49  GLN A OE1  3  
ATOM   5027  N NE2  . GLN A 1 49 ? 6.790   -1.486  -4.247  1.00 1.52 ? 49  GLN A NE2  3  
ATOM   5028  H H    . GLN A 1 49 ? 9.599   -5.450  -5.288  1.00 0.36 ? 49  GLN A H    3  
ATOM   5029  H HA   . GLN A 1 49 ? 11.195  -3.068  -4.411  1.00 0.32 ? 49  GLN A HA   3  
ATOM   5030  H HB2  . GLN A 1 49 ? 8.239   -3.536  -4.459  1.00 0.76 ? 49  GLN A HB2  3  
ATOM   5031  H HB3  . GLN A 1 49 ? 8.884   -2.697  -3.055  1.00 0.86 ? 49  GLN A HB3  3  
ATOM   5032  H HG2  . GLN A 1 49 ? 9.871   -0.982  -4.460  1.00 1.46 ? 49  GLN A HG2  3  
ATOM   5033  H HG3  . GLN A 1 49 ? 9.441   -1.874  -5.919  1.00 1.32 ? 49  GLN A HG3  3  
ATOM   5034  H HE21 . GLN A 1 49 ? 6.931   -2.309  -3.734  1.00 2.12 ? 49  GLN A HE21 3  
ATOM   5035  H HE22 . GLN A 1 49 ? 5.909   -1.056  -4.251  1.00 1.80 ? 49  GLN A HE22 3  
ATOM   5036  N N    . VAL A 1 50 ? 11.465  -3.989  -2.075  1.00 0.23 ? 50  VAL A N    3  
ATOM   5037  C CA   . VAL A 1 50 ? 11.778  -4.669  -0.781  1.00 0.19 ? 50  VAL A CA   3  
ATOM   5038  C C    . VAL A 1 50 ? 11.823  -3.621  0.323   1.00 0.16 ? 50  VAL A C    3  
ATOM   5039  O O    . VAL A 1 50 ? 12.580  -2.676  0.258   1.00 0.15 ? 50  VAL A O    3  
ATOM   5040  C CB   . VAL A 1 50 ? 13.132  -5.374  -0.877  1.00 0.22 ? 50  VAL A CB   3  
ATOM   5041  C CG1  . VAL A 1 50 ? 13.338  -6.255  0.358   1.00 0.24 ? 50  VAL A CG1  3  
ATOM   5042  C CG2  . VAL A 1 50 ? 13.161  -6.240  -2.140  1.00 0.31 ? 50  VAL A CG2  3  
ATOM   5043  H H    . VAL A 1 50 ? 11.875  -3.122  -2.277  1.00 0.26 ? 50  VAL A H    3  
ATOM   5044  H HA   . VAL A 1 50 ? 11.008  -5.394  -0.550  1.00 0.20 ? 50  VAL A HA   3  
ATOM   5045  H HB   . VAL A 1 50 ? 13.921  -4.638  -0.926  1.00 0.24 ? 50  VAL A HB   3  
ATOM   5046  H HG11 . VAL A 1 50 ? 12.523  -6.956  0.440   1.00 1.07 ? 50  VAL A HG11 3  
ATOM   5047  H HG12 . VAL A 1 50 ? 14.269  -6.794  0.264   1.00 1.04 ? 50  VAL A HG12 3  
ATOM   5048  H HG13 . VAL A 1 50 ? 13.369  -5.634  1.241   1.00 1.03 ? 50  VAL A HG13 3  
ATOM   5049  H HG21 . VAL A 1 50 ? 12.205  -6.727  -2.269  1.00 1.10 ? 50  VAL A HG21 3  
ATOM   5050  H HG22 . VAL A 1 50 ? 13.362  -5.614  -2.994  1.00 1.02 ? 50  VAL A HG22 3  
ATOM   5051  H HG23 . VAL A 1 50 ? 13.937  -6.988  -2.051  1.00 1.09 ? 50  VAL A HG23 3  
ATOM   5052  N N    . CYS A 1 51 ? 11.016  -3.775  1.335   1.00 0.16 ? 51  CYS A N    3  
ATOM   5053  C CA   . CYS A 1 51 ? 11.005  -2.776  2.435   1.00 0.15 ? 51  CYS A CA   3  
ATOM   5054  C C    . CYS A 1 51 ? 12.276  -2.923  3.268   1.00 0.14 ? 51  CYS A C    3  
ATOM   5055  O O    . CYS A 1 51 ? 12.846  -3.991  3.367   1.00 0.16 ? 51  CYS A O    3  
ATOM   5056  C CB   . CYS A 1 51 ? 9.783   -3.022  3.321   1.00 0.17 ? 51  CYS A CB   3  
ATOM   5057  S SG   . CYS A 1 51 ? 8.276   -2.661  2.385   1.00 0.21 ? 51  CYS A SG   3  
ATOM   5058  H H    . CYS A 1 51 ? 10.412  -4.544  1.366   1.00 0.19 ? 51  CYS A H    3  
ATOM   5059  H HA   . CYS A 1 51 ? 10.956  -1.779  2.023   1.00 0.15 ? 51  CYS A HA   3  
ATOM   5060  H HB2  . CYS A 1 51 ? 9.770   -4.054  3.639   1.00 0.19 ? 51  CYS A HB2  3  
ATOM   5061  H HB3  . CYS A 1 51 ? 9.832   -2.381  4.185   1.00 0.18 ? 51  CYS A HB3  3  
ATOM   5062  N N    . ALA A 1 52 ? 12.731  -1.850  3.861   1.00 0.12 ? 52  ALA A N    3  
ATOM   5063  C CA   . ALA A 1 52 ? 13.975  -1.911  4.683   1.00 0.13 ? 52  ALA A CA   3  
ATOM   5064  C C    . ALA A 1 52 ? 13.825  -1.005  5.906   1.00 0.15 ? 52  ALA A C    3  
ATOM   5065  O O    . ALA A 1 52 ? 13.363  0.116   5.811   1.00 0.15 ? 52  ALA A O    3  
ATOM   5066  C CB   . ALA A 1 52 ? 15.158  -1.431  3.839   1.00 0.11 ? 52  ALA A CB   3  
ATOM   5067  H H    . ALA A 1 52 ? 12.256  -0.998  3.757   1.00 0.13 ? 52  ALA A H    3  
ATOM   5068  H HA   . ALA A 1 52 ? 14.156  -2.928  5.008   1.00 0.14 ? 52  ALA A HA   3  
ATOM   5069  H HB1  . ALA A 1 52 ? 14.884  -0.526  3.318   1.00 1.04 ? 52  ALA A HB1  3  
ATOM   5070  H HB2  . ALA A 1 52 ? 16.001  -1.234  4.484   1.00 1.02 ? 52  ALA A HB2  3  
ATOM   5071  H HB3  . ALA A 1 52 ? 15.423  -2.193  3.123   1.00 1.01 ? 52  ALA A HB3  3  
ATOM   5072  N N    . ASP A 1 53 ? 14.211  -1.487  7.055   1.00 0.18 ? 53  ASP A N    3  
ATOM   5073  C CA   . ASP A 1 53 ? 14.096  -0.670  8.295   1.00 0.22 ? 53  ASP A CA   3  
ATOM   5074  C C    . ASP A 1 53 ? 15.109  0.507   8.231   1.00 0.21 ? 53  ASP A C    3  
ATOM   5075  O O    . ASP A 1 53 ? 16.297  0.257   8.190   1.00 0.22 ? 53  ASP A O    3  
ATOM   5076  C CB   . ASP A 1 53 ? 14.424  -1.563  9.503   1.00 0.27 ? 53  ASP A CB   3  
ATOM   5077  C CG   . ASP A 1 53 ? 15.496  -2.583  9.110   1.00 1.35 ? 53  ASP A CG   3  
ATOM   5078  O OD1  . ASP A 1 53 ? 16.292  -2.272  8.241   1.00 2.10 ? 53  ASP A OD1  3  
ATOM   5079  O OD2  . ASP A 1 53 ? 15.500  -3.659  9.686   1.00 2.17 ? 53  ASP A OD2  3  
ATOM   5080  H H    . ASP A 1 53 ? 14.579  -2.395  7.103   1.00 0.19 ? 53  ASP A H    3  
ATOM   5081  H HA   . ASP A 1 53 ? 13.086  -0.317  8.384   1.00 0.22 ? 53  ASP A HA   3  
ATOM   5082  H HB2  . ASP A 1 53 ? 14.785  -0.957  10.322  1.00 1.05 ? 53  ASP A HB2  3  
ATOM   5083  H HB3  . ASP A 1 53 ? 13.533  -2.089  9.814   1.00 1.03 ? 53  ASP A HB3  3  
ATOM   5084  N N    . PRO A 1 54 ? 14.648  1.757   8.223   1.00 0.22 ? 54  PRO A N    3  
ATOM   5085  C CA   . PRO A 1 54 ? 15.578  2.908   8.163   1.00 0.24 ? 54  PRO A CA   3  
ATOM   5086  C C    . PRO A 1 54 ? 16.499  2.923   9.396   1.00 0.28 ? 54  PRO A C    3  
ATOM   5087  O O    . PRO A 1 54 ? 17.392  3.739   9.503   1.00 0.30 ? 54  PRO A O    3  
ATOM   5088  C CB   . PRO A 1 54 ? 14.670  4.160   8.148   1.00 0.27 ? 54  PRO A CB   3  
ATOM   5089  C CG   . PRO A 1 54 ? 13.193  3.674   8.211   1.00 0.27 ? 54  PRO A CG   3  
ATOM   5090  C CD   . PRO A 1 54 ? 13.212  2.130   8.266   1.00 0.24 ? 54  PRO A CD   3  
ATOM   5091  H HA   . PRO A 1 54 ? 16.165  2.866   7.259   1.00 0.21 ? 54  PRO A HA   3  
ATOM   5092  H HB2  . PRO A 1 54 ? 14.887  4.789   9.004   1.00 0.30 ? 54  PRO A HB2  3  
ATOM   5093  H HB3  . PRO A 1 54 ? 14.828  4.722   7.237   1.00 0.26 ? 54  PRO A HB3  3  
ATOM   5094  H HG2  . PRO A 1 54 ? 12.711  4.073   9.097   1.00 0.31 ? 54  PRO A HG2  3  
ATOM   5095  H HG3  . PRO A 1 54 ? 12.658  4.002   7.332   1.00 0.27 ? 54  PRO A HG3  3  
ATOM   5096  H HD2  . PRO A 1 54 ? 12.758  1.786   9.187   1.00 0.26 ? 54  PRO A HD2  3  
ATOM   5097  H HD3  . PRO A 1 54 ? 12.695  1.717   7.411   1.00 0.21 ? 54  PRO A HD3  3  
ATOM   5098  N N    . SER A 1 55 ? 16.273  2.047   10.330  1.00 0.31 ? 55  SER A N    3  
ATOM   5099  C CA   . SER A 1 55 ? 17.118  2.033   11.561  1.00 0.36 ? 55  SER A CA   3  
ATOM   5100  C C    . SER A 1 55 ? 18.485  1.409   11.265  1.00 0.36 ? 55  SER A C    3  
ATOM   5101  O O    . SER A 1 55 ? 19.443  1.635   11.978  1.00 0.40 ? 55  SER A O    3  
ATOM   5102  C CB   . SER A 1 55 ? 16.415  1.219   12.648  1.00 0.40 ? 55  SER A CB   3  
ATOM   5103  O OG   . SER A 1 55 ? 17.130  1.351   13.870  1.00 1.42 ? 55  SER A OG   3  
ATOM   5104  H H    . SER A 1 55 ? 15.534  1.412   10.234  1.00 0.30 ? 55  SER A H    3  
ATOM   5105  H HA   . SER A 1 55 ? 17.256  3.046   11.911  1.00 0.39 ? 55  SER A HA   3  
ATOM   5106  H HB2  . SER A 1 55 ? 15.412  1.585   12.784  1.00 0.99 ? 55  SER A HB2  3  
ATOM   5107  H HB3  . SER A 1 55 ? 16.379  0.179   12.350  1.00 1.11 ? 55  SER A HB3  3  
ATOM   5108  H HG   . SER A 1 55 ? 16.744  2.079   14.362  1.00 1.89 ? 55  SER A HG   3  
ATOM   5109  N N    . GLU A 1 56 ? 18.592  0.628   10.226  1.00 0.33 ? 56  GLU A N    3  
ATOM   5110  C CA   . GLU A 1 56 ? 19.906  -0.001  9.899   1.00 0.34 ? 56  GLU A CA   3  
ATOM   5111  C C    . GLU A 1 56 ? 20.779  1.005   9.143   1.00 0.33 ? 56  GLU A C    3  
ATOM   5112  O O    . GLU A 1 56 ? 20.425  1.494   8.088   1.00 0.29 ? 56  GLU A O    3  
ATOM   5113  C CB   . GLU A 1 56 ? 19.674  -1.252  9.044   1.00 0.31 ? 56  GLU A CB   3  
ATOM   5114  C CG   . GLU A 1 56 ? 19.289  -2.445  9.934   1.00 0.35 ? 56  GLU A CG   3  
ATOM   5115  C CD   . GLU A 1 56 ? 18.222  -2.028  10.954  1.00 1.30 ? 56  GLU A CD   3  
ATOM   5116  O OE1  . GLU A 1 56 ? 17.281  -1.360  10.559  1.00 2.08 ? 56  GLU A OE1  3  
ATOM   5117  O OE2  . GLU A 1 56 ? 18.365  -2.386  12.111  1.00 2.01 ? 56  GLU A OE2  3  
ATOM   5118  H H    . GLU A 1 56 ? 17.810  0.455   9.660   1.00 0.30 ? 56  GLU A H    3  
ATOM   5119  H HA   . GLU A 1 56 ? 20.406  -0.281  10.816  1.00 0.37 ? 56  GLU A HA   3  
ATOM   5120  H HB2  . GLU A 1 56 ? 18.875  -1.057  8.347   1.00 0.28 ? 56  GLU A HB2  3  
ATOM   5121  H HB3  . GLU A 1 56 ? 20.576  -1.490  8.500   1.00 0.31 ? 56  GLU A HB3  3  
ATOM   5122  H HG2  . GLU A 1 56 ? 18.902  -3.241  9.316   1.00 0.87 ? 56  GLU A HG2  3  
ATOM   5123  H HG3  . GLU A 1 56 ? 20.165  -2.794  10.460  1.00 1.00 ? 56  GLU A HG3  3  
ATOM   5124  N N    . SER A 1 57 ? 21.913  1.324   9.695   1.00 0.37 ? 57  SER A N    3  
ATOM   5125  C CA   . SER A 1 57 ? 22.832  2.308   9.056   1.00 0.38 ? 57  SER A CA   3  
ATOM   5126  C C    . SER A 1 57 ? 23.067  1.979   7.578   1.00 0.35 ? 57  SER A C    3  
ATOM   5127  O O    . SER A 1 57 ? 23.144  2.866   6.751   1.00 0.34 ? 57  SER A O    3  
ATOM   5128  C CB   . SER A 1 57 ? 24.171  2.294   9.792   1.00 0.44 ? 57  SER A CB   3  
ATOM   5129  O OG   . SER A 1 57 ? 25.037  3.259   9.210   1.00 1.37 ? 57  SER A OG   3  
ATOM   5130  H H    . SER A 1 57 ? 22.160  0.920   10.550  1.00 0.41 ? 57  SER A H    3  
ATOM   5131  H HA   . SER A 1 57 ? 22.401  3.292   9.132   1.00 0.38 ? 57  SER A HA   3  
ATOM   5132  H HB2  . SER A 1 57 ? 24.017  2.538   10.830  1.00 1.21 ? 57  SER A HB2  3  
ATOM   5133  H HB3  . SER A 1 57 ? 24.611  1.309   9.719   1.00 1.06 ? 57  SER A HB3  3  
ATOM   5134  H HG   . SER A 1 57 ? 24.814  3.333   8.278   1.00 1.80 ? 57  SER A HG   3  
ATOM   5135  N N    . TRP A 1 58 ? 23.208  0.729   7.231   1.00 0.34 ? 58  TRP A N    3  
ATOM   5136  C CA   . TRP A 1 58 ? 23.466  0.403   5.799   1.00 0.32 ? 58  TRP A CA   3  
ATOM   5137  C C    . TRP A 1 58 ? 22.301  0.896   4.945   1.00 0.27 ? 58  TRP A C    3  
ATOM   5138  O O    . TRP A 1 58 ? 22.477  1.295   3.813   1.00 0.27 ? 58  TRP A O    3  
ATOM   5139  C CB   . TRP A 1 58 ? 23.699  -1.107  5.618   1.00 0.34 ? 58  TRP A CB   3  
ATOM   5140  C CG   . TRP A 1 58 ? 22.414  -1.877  5.607   1.00 0.31 ? 58  TRP A CG   3  
ATOM   5141  C CD1  . TRP A 1 58 ? 21.973  -2.654  6.623   1.00 0.32 ? 58  TRP A CD1  3  
ATOM   5142  C CD2  . TRP A 1 58 ? 21.422  -1.993  4.543   1.00 0.27 ? 58  TRP A CD2  3  
ATOM   5143  N NE1  . TRP A 1 58 ? 20.776  -3.241  6.254   1.00 0.29 ? 58  TRP A NE1  3  
ATOM   5144  C CE2  . TRP A 1 58 ? 20.388  -2.861  4.988   1.00 0.26 ? 58  TRP A CE2  3  
ATOM   5145  C CE3  . TRP A 1 58 ? 21.313  -1.436  3.246   1.00 0.27 ? 58  TRP A CE3  3  
ATOM   5146  C CZ2  . TRP A 1 58 ? 19.285  -3.165  4.180   1.00 0.25 ? 58  TRP A CZ2  3  
ATOM   5147  C CZ3  . TRP A 1 58 ? 20.203  -1.740  2.428   1.00 0.27 ? 58  TRP A CZ3  3  
ATOM   5148  C CH2  . TRP A 1 58 ? 19.191  -2.602  2.896   1.00 0.26 ? 58  TRP A CH2  3  
ATOM   5149  H H    . TRP A 1 58 ? 23.154  0.018   7.901   1.00 0.36 ? 58  TRP A H    3  
ATOM   5150  H HA   . TRP A 1 58 ? 24.359  0.928   5.489   1.00 0.35 ? 58  TRP A HA   3  
ATOM   5151  H HB2  . TRP A 1 58 ? 24.214  -1.273  4.684   1.00 0.35 ? 58  TRP A HB2  3  
ATOM   5152  H HB3  . TRP A 1 58 ? 24.320  -1.465  6.427   1.00 0.38 ? 58  TRP A HB3  3  
ATOM   5153  H HD1  . TRP A 1 58 ? 22.477  -2.799  7.567   1.00 0.36 ? 58  TRP A HD1  3  
ATOM   5154  H HE1  . TRP A 1 58 ? 20.253  -3.852  6.808   1.00 0.30 ? 58  TRP A HE1  3  
ATOM   5155  H HE3  . TRP A 1 58 ? 22.084  -0.781  2.877   1.00 0.29 ? 58  TRP A HE3  3  
ATOM   5156  H HZ2  . TRP A 1 58 ? 18.511  -3.825  4.541   1.00 0.25 ? 58  TRP A HZ2  3  
ATOM   5157  H HZ3  . TRP A 1 58 ? 20.130  -1.310  1.441   1.00 0.29 ? 58  TRP A HZ3  3  
ATOM   5158  H HH2  . TRP A 1 58 ? 18.344  -2.833  2.268   1.00 0.27 ? 58  TRP A HH2  3  
ATOM   5159  N N    . VAL A 1 59 ? 21.119  0.904   5.482   1.00 0.24 ? 59  VAL A N    3  
ATOM   5160  C CA   . VAL A 1 59 ? 19.962  1.397   4.691   1.00 0.20 ? 59  VAL A CA   3  
ATOM   5161  C C    . VAL A 1 59 ? 20.166  2.881   4.409   1.00 0.22 ? 59  VAL A C    3  
ATOM   5162  O O    . VAL A 1 59 ? 20.026  3.336   3.293   1.00 0.21 ? 59  VAL A O    3  
ATOM   5163  C CB   . VAL A 1 59 ? 18.681  1.186   5.493   1.00 0.19 ? 59  VAL A CB   3  
ATOM   5164  C CG1  . VAL A 1 59 ? 17.481  1.739   4.718   1.00 0.18 ? 59  VAL A CG1  3  
ATOM   5165  C CG2  . VAL A 1 59 ? 18.500  -0.313  5.731   1.00 0.19 ? 59  VAL A CG2  3  
ATOM   5166  H H    . VAL A 1 59 ? 20.993  0.600   6.405   1.00 0.26 ? 59  VAL A H    3  
ATOM   5167  H HA   . VAL A 1 59 ? 19.903  0.856   3.759   1.00 0.20 ? 59  VAL A HA   3  
ATOM   5168  H HB   . VAL A 1 59 ? 18.761  1.695   6.441   1.00 0.21 ? 59  VAL A HB   3  
ATOM   5169  H HG11 . VAL A 1 59 ? 17.562  1.464   3.679   1.00 1.01 ? 59  VAL A HG11 3  
ATOM   5170  H HG12 . VAL A 1 59 ? 16.568  1.331   5.128   1.00 1.03 ? 59  VAL A HG12 3  
ATOM   5171  H HG13 . VAL A 1 59 ? 17.463  2.816   4.805   1.00 0.98 ? 59  VAL A HG13 3  
ATOM   5172  H HG21 . VAL A 1 59 ? 19.416  -0.722  6.131   1.00 1.00 ? 59  VAL A HG21 3  
ATOM   5173  H HG22 . VAL A 1 59 ? 17.695  -0.473  6.431   1.00 1.04 ? 59  VAL A HG22 3  
ATOM   5174  H HG23 . VAL A 1 59 ? 18.271  -0.799  4.796   1.00 1.05 ? 59  VAL A HG23 3  
ATOM   5175  N N    . GLN A 1 60 ? 20.516  3.634   5.409   1.00 0.25 ? 60  GLN A N    3  
ATOM   5176  C CA   . GLN A 1 60 ? 20.750  5.088   5.188   1.00 0.28 ? 60  GLN A CA   3  
ATOM   5177  C C    . GLN A 1 60 ? 21.963  5.266   4.269   1.00 0.30 ? 60  GLN A C    3  
ATOM   5178  O O    . GLN A 1 60 ? 22.009  6.162   3.449   1.00 0.31 ? 60  GLN A O    3  
ATOM   5179  C CB   . GLN A 1 60 ? 21.016  5.774   6.529   1.00 0.33 ? 60  GLN A CB   3  
ATOM   5180  C CG   . GLN A 1 60 ? 20.931  7.291   6.354   1.00 1.25 ? 60  GLN A CG   3  
ATOM   5181  C CD   . GLN A 1 60 ? 21.049  7.972   7.718   1.00 1.65 ? 60  GLN A CD   3  
ATOM   5182  O OE1  . GLN A 1 60 ? 20.673  7.407   8.726   1.00 2.33 ? 60  GLN A OE1  3  
ATOM   5183  N NE2  . GLN A 1 60 ? 21.559  9.170   7.794   1.00 2.14 ? 60  GLN A NE2  3  
ATOM   5184  H H    . GLN A 1 60 ? 20.637  3.240   6.302   1.00 0.27 ? 60  GLN A H    3  
ATOM   5185  H HA   . GLN A 1 60 ? 19.880  5.525   4.723   1.00 0.28 ? 60  GLN A HA   3  
ATOM   5186  H HB2  . GLN A 1 60 ? 20.279  5.452   7.251   1.00 0.91 ? 60  GLN A HB2  3  
ATOM   5187  H HB3  . GLN A 1 60 ? 22.003  5.510   6.880   1.00 0.88 ? 60  GLN A HB3  3  
ATOM   5188  H HG2  . GLN A 1 60 ? 21.734  7.626   5.712   1.00 1.90 ? 60  GLN A HG2  3  
ATOM   5189  H HG3  . GLN A 1 60 ? 19.983  7.549   5.906   1.00 1.91 ? 60  GLN A HG3  3  
ATOM   5190  H HE21 . GLN A 1 60 ? 21.862  9.627   6.980   1.00 2.43 ? 60  GLN A HE21 3  
ATOM   5191  H HE22 . GLN A 1 60 ? 21.640  9.615   8.664   1.00 2.66 ? 60  GLN A HE22 3  
ATOM   5192  N N    . GLU A 1 61 ? 22.947  4.418   4.406   1.00 0.31 ? 61  GLU A N    3  
ATOM   5193  C CA   . GLU A 1 61 ? 24.165  4.530   3.550   1.00 0.33 ? 61  GLU A CA   3  
ATOM   5194  C C    . GLU A 1 61 ? 23.808  4.259   2.087   1.00 0.31 ? 61  GLU A C    3  
ATOM   5195  O O    . GLU A 1 61 ? 24.164  5.010   1.201   1.00 0.32 ? 61  GLU A O    3  
ATOM   5196  C CB   . GLU A 1 61 ? 25.209  3.513   4.016   1.00 0.35 ? 61  GLU A CB   3  
ATOM   5197  C CG   . GLU A 1 61 ? 26.538  3.785   3.308   1.00 0.40 ? 61  GLU A CG   3  
ATOM   5198  C CD   . GLU A 1 61 ? 27.612  2.848   3.860   1.00 1.29 ? 61  GLU A CD   3  
ATOM   5199  O OE1  . GLU A 1 61 ? 28.225  3.201   4.854   1.00 1.99 ? 61  GLU A OE1  3  
ATOM   5200  O OE2  . GLU A 1 61 ? 27.806  1.792   3.280   1.00 2.03 ? 61  GLU A OE2  3  
ATOM   5201  H H    . GLU A 1 61 ? 22.886  3.708   5.077   1.00 0.31 ? 61  GLU A H    3  
ATOM   5202  H HA   . GLU A 1 61 ? 24.572  5.525   3.638   1.00 0.36 ? 61  GLU A HA   3  
ATOM   5203  H HB2  . GLU A 1 61 ? 25.345  3.601   5.084   1.00 0.37 ? 61  GLU A HB2  3  
ATOM   5204  H HB3  . GLU A 1 61 ? 24.872  2.517   3.775   1.00 0.33 ? 61  GLU A HB3  3  
ATOM   5205  H HG2  . GLU A 1 61 ? 26.421  3.615   2.247   1.00 0.84 ? 61  GLU A HG2  3  
ATOM   5206  H HG3  . GLU A 1 61 ? 26.834  4.809   3.477   1.00 0.95 ? 61  GLU A HG3  3  
ATOM   5207  N N    . TYR A 1 62 ? 23.114  3.186   1.825   1.00 0.28 ? 62  TYR A N    3  
ATOM   5208  C CA   . TYR A 1 62 ? 22.740  2.862   0.417   1.00 0.28 ? 62  TYR A CA   3  
ATOM   5209  C C    . TYR A 1 62 ? 21.864  3.982   -0.152  1.00 0.28 ? 62  TYR A C    3  
ATOM   5210  O O    . TYR A 1 62 ? 21.952  4.317   -1.317  1.00 0.30 ? 62  TYR A O    3  
ATOM   5211  C CB   . TYR A 1 62 ? 21.970  1.531   0.376   1.00 0.25 ? 62  TYR A CB   3  
ATOM   5212  C CG   . TYR A 1 62 ? 22.932  0.353   0.388   1.00 0.27 ? 62  TYR A CG   3  
ATOM   5213  C CD1  . TYR A 1 62 ? 23.945  0.259   1.365   1.00 0.29 ? 62  TYR A CD1  3  
ATOM   5214  C CD2  . TYR A 1 62 ? 22.806  -0.660  -0.587  1.00 0.27 ? 62  TYR A CD2  3  
ATOM   5215  C CE1  . TYR A 1 62 ? 24.825  -0.841  1.366   1.00 0.32 ? 62  TYR A CE1  3  
ATOM   5216  C CE2  . TYR A 1 62 ? 23.688  -1.757  -0.586  1.00 0.29 ? 62  TYR A CE2  3  
ATOM   5217  C CZ   . TYR A 1 62 ? 24.697  -1.847  0.391   1.00 0.31 ? 62  TYR A CZ   3  
ATOM   5218  O OH   . TYR A 1 62 ? 25.559  -2.924  0.393   1.00 0.34 ? 62  TYR A OH   3  
ATOM   5219  H H    . TYR A 1 62 ? 22.841  2.592   2.555   1.00 0.28 ? 62  TYR A H    3  
ATOM   5220  H HA   . TYR A 1 62 ? 23.639  2.778   -0.179  1.00 0.30 ? 62  TYR A HA   3  
ATOM   5221  H HB2  . TYR A 1 62 ? 21.326  1.469   1.241   1.00 0.24 ? 62  TYR A HB2  3  
ATOM   5222  H HB3  . TYR A 1 62 ? 21.366  1.491   -0.519  1.00 0.25 ? 62  TYR A HB3  3  
ATOM   5223  H HD1  . TYR A 1 62 ? 24.050  1.028   2.112   1.00 0.30 ? 62  TYR A HD1  3  
ATOM   5224  H HD2  . TYR A 1 62 ? 22.033  -0.593  -1.339  1.00 0.27 ? 62  TYR A HD2  3  
ATOM   5225  H HE1  . TYR A 1 62 ? 25.600  -0.912  2.117   1.00 0.35 ? 62  TYR A HE1  3  
ATOM   5226  H HE2  . TYR A 1 62 ? 23.588  -2.529  -1.334  1.00 0.30 ? 62  TYR A HE2  3  
ATOM   5227  H HH   . TYR A 1 62 ? 25.217  -3.580  -0.218  1.00 0.89 ? 62  TYR A HH   3  
ATOM   5228  N N    . VAL A 1 63 ? 21.027  4.571   0.656   1.00 0.27 ? 63  VAL A N    3  
ATOM   5229  C CA   . VAL A 1 63 ? 20.164  5.669   0.152   1.00 0.28 ? 63  VAL A CA   3  
ATOM   5230  C C    . VAL A 1 63 ? 21.058  6.839   -0.229  1.00 0.32 ? 63  VAL A C    3  
ATOM   5231  O O    . VAL A 1 63 ? 20.851  7.502   -1.224  1.00 0.34 ? 63  VAL A O    3  
ATOM   5232  C CB   . VAL A 1 63 ? 19.190  6.098   1.253   1.00 0.28 ? 63  VAL A CB   3  
ATOM   5233  C CG1  . VAL A 1 63 ? 18.462  7.379   0.833   1.00 0.32 ? 63  VAL A CG1  3  
ATOM   5234  C CG2  . VAL A 1 63 ? 18.166  4.985   1.486   1.00 0.25 ? 63  VAL A CG2  3  
ATOM   5235  H H    . VAL A 1 63 ? 20.977  4.302   1.593   1.00 0.26 ? 63  VAL A H    3  
ATOM   5236  H HA   . VAL A 1 63 ? 19.614  5.333   -0.713  1.00 0.28 ? 63  VAL A HA   3  
ATOM   5237  H HB   . VAL A 1 63 ? 19.741  6.280   2.164   1.00 0.30 ? 63  VAL A HB   3  
ATOM   5238  H HG11 . VAL A 1 63 ? 18.110  7.277   -0.182  1.00 1.08 ? 63  VAL A HG11 3  
ATOM   5239  H HG12 . VAL A 1 63 ? 17.622  7.548   1.491   1.00 1.07 ? 63  VAL A HG12 3  
ATOM   5240  H HG13 . VAL A 1 63 ? 19.142  8.217   0.896   1.00 1.05 ? 63  VAL A HG13 3  
ATOM   5241  H HG21 . VAL A 1 63 ? 18.670  4.029   1.509   1.00 1.00 ? 63  VAL A HG21 3  
ATOM   5242  H HG22 . VAL A 1 63 ? 17.664  5.149   2.427   1.00 1.05 ? 63  VAL A HG22 3  
ATOM   5243  H HG23 . VAL A 1 63 ? 17.441  4.988   0.685   1.00 1.03 ? 63  VAL A HG23 3  
ATOM   5244  N N    . TYR A 1 64 ? 22.059  7.089   0.562   1.00 0.34 ? 64  TYR A N    3  
ATOM   5245  C CA   . TYR A 1 64 ? 22.980  8.210   0.259   1.00 0.38 ? 64  TYR A CA   3  
ATOM   5246  C C    . TYR A 1 64 ? 23.687  7.931   -1.065  1.00 0.38 ? 64  TYR A C    3  
ATOM   5247  O O    . TYR A 1 64 ? 23.828  8.796   -1.905  1.00 0.41 ? 64  TYR A O    3  
ATOM   5248  C CB   . TYR A 1 64 ? 24.016  8.328   1.381   1.00 0.41 ? 64  TYR A CB   3  
ATOM   5249  C CG   . TYR A 1 64 ? 24.666  9.693   1.338   1.00 0.46 ? 64  TYR A CG   3  
ATOM   5250  C CD1  . TYR A 1 64 ? 23.954  10.825  1.778   1.00 0.48 ? 64  TYR A CD1  3  
ATOM   5251  C CD2  . TYR A 1 64 ? 25.984  9.832   0.859   1.00 0.49 ? 64  TYR A CD2  3  
ATOM   5252  C CE1  . TYR A 1 64 ? 24.559  12.096  1.739   1.00 0.52 ? 64  TYR A CE1  3  
ATOM   5253  C CE2  . TYR A 1 64 ? 26.588  11.103  0.820   1.00 0.54 ? 64  TYR A CE2  3  
ATOM   5254  C CZ   . TYR A 1 64 ? 25.875  12.235  1.260   1.00 0.55 ? 64  TYR A CZ   3  
ATOM   5255  O OH   . TYR A 1 64 ? 26.467  13.481  1.222   1.00 0.60 ? 64  TYR A OH   3  
ATOM   5256  H H    . TYR A 1 64 ? 22.205  6.536   1.357   1.00 0.33 ? 64  TYR A H    3  
ATOM   5257  H HA   . TYR A 1 64 ? 22.413  9.121   0.185   1.00 0.40 ? 64  TYR A HA   3  
ATOM   5258  H HB2  . TYR A 1 64 ? 23.526  8.191   2.331   1.00 0.41 ? 64  TYR A HB2  3  
ATOM   5259  H HB3  . TYR A 1 64 ? 24.771  7.564   1.258   1.00 0.40 ? 64  TYR A HB3  3  
ATOM   5260  H HD1  . TYR A 1 64 ? 22.944  10.718  2.145   1.00 0.47 ? 64  TYR A HD1  3  
ATOM   5261  H HD2  . TYR A 1 64 ? 26.531  8.964   0.522   1.00 0.49 ? 64  TYR A HD2  3  
ATOM   5262  H HE1  . TYR A 1 64 ? 24.013  12.964  2.077   1.00 0.55 ? 64  TYR A HE1  3  
ATOM   5263  H HE2  . TYR A 1 64 ? 27.598  11.210  0.453   1.00 0.56 ? 64  TYR A HE2  3  
ATOM   5264  H HH   . TYR A 1 64 ? 27.366  13.393  1.550   1.00 1.08 ? 64  TYR A HH   3  
ATOM   5265  N N    . ASP A 1 65 ? 24.129  6.722   -1.248  1.00 0.36 ? 65  ASP A N    3  
ATOM   5266  C CA   . ASP A 1 65 ? 24.834  6.362   -2.510  1.00 0.37 ? 65  ASP A CA   3  
ATOM   5267  C C    . ASP A 1 65 ? 23.884  6.543   -3.697  1.00 0.37 ? 65  ASP A C    3  
ATOM   5268  O O    . ASP A 1 65 ? 24.288  6.928   -4.777  1.00 0.40 ? 65  ASP A O    3  
ATOM   5269  C CB   . ASP A 1 65 ? 25.285  4.900   -2.430  1.00 0.35 ? 65  ASP A CB   3  
ATOM   5270  C CG   . ASP A 1 65 ? 26.553  4.796   -1.579  1.00 0.39 ? 65  ASP A CG   3  
ATOM   5271  O OD1  . ASP A 1 65 ? 27.444  5.607   -1.776  1.00 1.15 ? 65  ASP A OD1  3  
ATOM   5272  O OD2  . ASP A 1 65 ? 26.612  3.908   -0.744  1.00 1.11 ? 65  ASP A OD2  3  
ATOM   5273  H H    . ASP A 1 65 ? 23.996  6.047   -0.549  1.00 0.34 ? 65  ASP A H    3  
ATOM   5274  H HA   . ASP A 1 65 ? 25.694  7.003   -2.638  1.00 0.41 ? 65  ASP A HA   3  
ATOM   5275  H HB2  . ASP A 1 65 ? 24.501  4.308   -1.980  1.00 0.32 ? 65  ASP A HB2  3  
ATOM   5276  H HB3  . ASP A 1 65 ? 25.488  4.530   -3.421  1.00 0.36 ? 65  ASP A HB3  3  
ATOM   5277  N N    . LEU A 1 66 ? 22.627  6.267   -3.503  1.00 0.33 ? 66  LEU A N    3  
ATOM   5278  C CA   . LEU A 1 66 ? 21.644  6.417   -4.610  1.00 0.34 ? 66  LEU A CA   3  
ATOM   5279  C C    . LEU A 1 66 ? 21.409  7.906   -4.883  1.00 0.39 ? 66  LEU A C    3  
ATOM   5280  O O    . LEU A 1 66 ? 21.125  8.308   -5.994  1.00 0.42 ? 66  LEU A O    3  
ATOM   5281  C CB   . LEU A 1 66 ? 20.330  5.744   -4.195  1.00 0.31 ? 66  LEU A CB   3  
ATOM   5282  C CG   . LEU A 1 66 ? 20.420  4.218   -4.413  1.00 0.28 ? 66  LEU A CG   3  
ATOM   5283  C CD1  . LEU A 1 66 ? 19.389  3.507   -3.535  1.00 0.24 ? 66  LEU A CD1  3  
ATOM   5284  C CD2  . LEU A 1 66 ? 20.131  3.870   -5.883  1.00 0.30 ? 66  LEU A CD2  3  
ATOM   5285  H H    . LEU A 1 66 ? 22.328  5.956   -2.624  1.00 0.31 ? 66  LEU A H    3  
ATOM   5286  H HA   . LEU A 1 66 ? 22.032  5.948   -5.500  1.00 0.35 ? 66  LEU A HA   3  
ATOM   5287  H HB2  . LEU A 1 66 ? 20.149  5.947   -3.147  1.00 0.29 ? 66  LEU A HB2  3  
ATOM   5288  H HB3  . LEU A 1 66 ? 19.519  6.149   -4.777  1.00 0.33 ? 66  LEU A HB3  3  
ATOM   5289  H HG   . LEU A 1 66 ? 21.411  3.874   -4.149  1.00 0.27 ? 66  LEU A HG   3  
ATOM   5290  H HD11 . LEU A 1 66 ? 19.554  3.770   -2.501  1.00 1.02 ? 66  LEU A HD11 3  
ATOM   5291  H HD12 . LEU A 1 66 ? 18.397  3.810   -3.828  1.00 1.06 ? 66  LEU A HD12 3  
ATOM   5292  H HD13 . LEU A 1 66 ? 19.488  2.439   -3.656  1.00 1.04 ? 66  LEU A HD13 3  
ATOM   5293  H HD21 . LEU A 1 66 ? 19.230  4.370   -6.206  1.00 1.05 ? 66  LEU A HD21 3  
ATOM   5294  H HD22 . LEU A 1 66 ? 20.956  4.181   -6.504  1.00 1.06 ? 66  LEU A HD22 3  
ATOM   5295  H HD23 . LEU A 1 66 ? 19.998  2.802   -5.976  1.00 1.07 ? 66  LEU A HD23 3  
ATOM   5296  N N    . GLU A 1 67 ? 21.532  8.725   -3.878  1.00 0.40 ? 67  GLU A N    3  
ATOM   5297  C CA   . GLU A 1 67 ? 21.325  10.188  -4.077  1.00 0.45 ? 67  GLU A CA   3  
ATOM   5298  C C    . GLU A 1 67 ? 22.514  10.760  -4.845  1.00 0.50 ? 67  GLU A C    3  
ATOM   5299  O O    . GLU A 1 67 ? 22.396  11.731  -5.565  1.00 0.55 ? 67  GLU A O    3  
ATOM   5300  C CB   . GLU A 1 67 ? 21.225  10.875  -2.714  1.00 0.46 ? 67  GLU A CB   3  
ATOM   5301  C CG   . GLU A 1 67 ? 19.945  10.429  -2.003  1.00 0.44 ? 67  GLU A CG   3  
ATOM   5302  C CD   . GLU A 1 67 ? 18.746  11.200  -2.561  1.00 1.13 ? 67  GLU A CD   3  
ATOM   5303  O OE1  . GLU A 1 67 ? 18.307  10.867  -3.651  1.00 1.81 ? 67  GLU A OE1  3  
ATOM   5304  O OE2  . GLU A 1 67 ? 18.286  12.109  -1.890  1.00 1.88 ? 67  GLU A OE2  3  
ATOM   5305  H H    . GLU A 1 67 ? 21.763  8.377   -2.994  1.00 0.38 ? 67  GLU A H    3  
ATOM   5306  H HA   . GLU A 1 67 ? 20.415  10.355  -4.635  1.00 0.46 ? 67  GLU A HA   3  
ATOM   5307  H HB2  . GLU A 1 67 ? 22.083  10.603  -2.114  1.00 0.45 ? 67  GLU A HB2  3  
ATOM   5308  H HB3  . GLU A 1 67 ? 21.210  11.946  -2.850  1.00 0.50 ? 67  GLU A HB3  3  
ATOM   5309  H HG2  . GLU A 1 67 ? 19.796  9.370   -2.159  1.00 0.93 ? 67  GLU A HG2  3  
ATOM   5310  H HG3  . GLU A 1 67 ? 20.037  10.626  -0.947  1.00 0.85 ? 67  GLU A HG3  3  
ATOM   5311  N N    . LEU A 1 68 ? 23.661  10.160  -4.698  1.00 0.49 ? 68  LEU A N    3  
ATOM   5312  C CA   . LEU A 1 68 ? 24.864  10.662  -5.421  1.00 0.54 ? 68  LEU A CA   3  
ATOM   5313  C C    . LEU A 1 68 ? 24.793  10.230  -6.889  1.00 0.56 ? 68  LEU A C    3  
ATOM   5314  O O    . LEU A 1 68 ? 23.949  10.683  -7.637  1.00 0.62 ? 68  LEU A O    3  
ATOM   5315  C CB   . LEU A 1 68 ? 26.127  10.086  -4.784  1.00 0.55 ? 68  LEU A CB   3  
ATOM   5316  C CG   . LEU A 1 68 ? 26.258  10.586  -3.342  1.00 0.55 ? 68  LEU A CG   3  
ATOM   5317  C CD1  . LEU A 1 68 ? 27.467  9.912   -2.704  1.00 0.56 ? 68  LEU A CD1  3  
ATOM   5318  C CD2  . LEU A 1 68 ? 26.445  12.118  -3.314  1.00 0.61 ? 68  LEU A CD2  3  
ATOM   5319  H H    . LEU A 1 68 ? 23.729  9.377   -4.111  1.00 0.46 ? 68  LEU A H    3  
ATOM   5320  H HA   . LEU A 1 68 ? 24.897  11.736  -5.365  1.00 0.58 ? 68  LEU A HA   3  
ATOM   5321  H HB2  . LEU A 1 68 ? 26.068  9.007   -4.786  1.00 0.51 ? 68  LEU A HB2  3  
ATOM   5322  H HB3  . LEU A 1 68 ? 26.991  10.400  -5.351  1.00 0.59 ? 68  LEU A HB3  3  
ATOM   5323  H HG   . LEU A 1 68 ? 25.369  10.318  -2.789  1.00 0.52 ? 68  LEU A HG   3  
ATOM   5324  H HD11 . LEU A 1 68 ? 27.350  8.840   -2.760  1.00 1.21 ? 68  LEU A HD11 3  
ATOM   5325  H HD12 . LEU A 1 68 ? 28.360  10.206  -3.236  1.00 1.13 ? 68  LEU A HD12 3  
ATOM   5326  H HD13 . LEU A 1 68 ? 27.544  10.215  -1.672  1.00 1.15 ? 68  LEU A HD13 3  
ATOM   5327  H HD21 . LEU A 1 68 ? 26.999  12.435  -4.185  1.00 1.15 ? 68  LEU A HD21 3  
ATOM   5328  H HD22 . LEU A 1 68 ? 25.478  12.598  -3.308  1.00 1.17 ? 68  LEU A HD22 3  
ATOM   5329  H HD23 . LEU A 1 68 ? 26.987  12.405  -2.423  1.00 1.22 ? 68  LEU A HD23 3  
ATOM   5330  N N    . ASN A 1 69 ? 25.670  9.356   -7.308  1.00 0.61 ? 69  ASN A N    3  
ATOM   5331  C CA   . ASN A 1 69 ? 25.653  8.894   -8.726  1.00 0.64 ? 69  ASN A CA   3  
ATOM   5332  C C    . ASN A 1 69 ? 24.736  7.675   -8.855  1.00 0.70 ? 69  ASN A C    3  
ATOM   5333  O O    . ASN A 1 69 ? 25.254  6.570   -8.887  1.00 1.15 ? 69  ASN A O    3  
ATOM   5334  C CB   . ASN A 1 69 ? 27.072  8.509   -9.151  1.00 0.82 ? 69  ASN A CB   3  
ATOM   5335  C CG   . ASN A 1 69 ? 27.683  7.574   -8.106  1.00 1.67 ? 69  ASN A CG   3  
ATOM   5336  O OD1  . ASN A 1 69 ? 28.869  7.312   -8.127  1.00 2.45 ? 69  ASN A OD1  3  
ATOM   5337  N ND2  . ASN A 1 69 ? 26.917  7.054   -7.185  1.00 2.41 ? 69  ASN A ND2  3  
ATOM   5338  O OXT  . ASN A 1 69 ? 23.534  7.868   -8.921  1.00 1.44 ? 69  ASN A OXT  3  
ATOM   5339  H H    . ASN A 1 69 ? 26.341  9.003   -6.689  1.00 0.69 ? 69  ASN A H    3  
ATOM   5340  H HA   . ASN A 1 69 ? 25.291  9.687   -9.364  1.00 0.62 ? 69  ASN A HA   3  
ATOM   5341  H HB2  . ASN A 1 69 ? 27.037  8.007   -10.108 1.00 1.41 ? 69  ASN A HB2  3  
ATOM   5342  H HB3  . ASN A 1 69 ? 27.677  9.399   -9.233  1.00 1.27 ? 69  ASN A HB3  3  
ATOM   5343  H HD21 . ASN A 1 69 ? 25.960  7.266   -7.167  1.00 2.52 ? 69  ASN A HD21 3  
ATOM   5344  H HD22 . ASN A 1 69 ? 27.300  6.454   -6.511  1.00 3.22 ? 69  ASN A HD22 3  
ATOM   5345  N N    . ALA B 1 1  ? 7.895   -14.842 -12.822 1.00 3.98 ? 1   ALA B N    3  
ATOM   5346  C CA   . ALA B 1 1  ? 7.166   -15.958 -12.162 1.00 3.41 ? 1   ALA B CA   3  
ATOM   5347  C C    . ALA B 1 1  ? 7.370   -15.905 -10.631 1.00 2.89 ? 1   ALA B C    3  
ATOM   5348  O O    . ALA B 1 1  ? 6.414   -16.032 -9.893  1.00 2.91 ? 1   ALA B O    3  
ATOM   5349  C CB   . ALA B 1 1  ? 7.653   -17.309 -12.740 1.00 3.83 ? 1   ALA B CB   3  
ATOM   5350  H H1   . ALA B 1 1  ? 8.052   -14.077 -12.136 1.00 4.21 ? 1   ALA B H1   3  
ATOM   5351  H H2   . ALA B 1 1  ? 8.810   -15.187 -13.175 1.00 4.33 ? 1   ALA B H2   3  
ATOM   5352  H H3   . ALA B 1 1  ? 7.332   -14.484 -13.620 1.00 4.29 ? 1   ALA B H3   3  
ATOM   5353  H HA   . ALA B 1 1  ? 6.112   -15.844 -12.367 1.00 3.58 ? 1   ALA B HA   3  
ATOM   5354  H HB1  . ALA B 1 1  ? 8.403   -17.121 -13.494 1.00 4.06 ? 1   ALA B HB1  3  
ATOM   5355  H HB2  . ALA B 1 1  ? 8.083   -17.920 -11.957 1.00 4.06 ? 1   ALA B HB2  3  
ATOM   5356  H HB3  . ALA B 1 1  ? 6.822   -17.837 -13.190 1.00 4.22 ? 1   ALA B HB3  3  
ATOM   5357  N N    . PRO B 1 2  ? 8.600   -15.730 -10.184 1.00 2.53 ? 2   PRO B N    3  
ATOM   5358  C CA   . PRO B 1 2  ? 8.885   -15.680 -8.738  1.00 2.14 ? 2   PRO B CA   3  
ATOM   5359  C C    . PRO B 1 2  ? 8.268   -14.412 -8.131  1.00 1.85 ? 2   PRO B C    3  
ATOM   5360  O O    . PRO B 1 2  ? 8.163   -13.390 -8.779  1.00 1.89 ? 2   PRO B O    3  
ATOM   5361  C CB   . PRO B 1 2  ? 10.429  -15.668 -8.635  1.00 1.96 ? 2   PRO B CB   3  
ATOM   5362  C CG   . PRO B 1 2  ? 10.993  -15.656 -10.087 1.00 2.21 ? 2   PRO B CG   3  
ATOM   5363  C CD   . PRO B 1 2  ? 9.789   -15.572 -11.052 1.00 2.60 ? 2   PRO B CD   3  
ATOM   5364  H HA   . PRO B 1 2  ? 8.486   -16.557 -8.250  1.00 2.39 ? 2   PRO B HA   3  
ATOM   5365  H HB2  . PRO B 1 2  ? 10.765  -14.787 -8.098  1.00 1.68 ? 2   PRO B HB2  3  
ATOM   5366  H HB3  . PRO B 1 2  ? 10.773  -16.556 -8.121  1.00 2.13 ? 2   PRO B HB3  3  
ATOM   5367  H HG2  . PRO B 1 2  ? 11.642  -14.798 -10.224 1.00 2.13 ? 2   PRO B HG2  3  
ATOM   5368  H HG3  . PRO B 1 2  ? 11.549  -16.565 -10.276 1.00 2.39 ? 2   PRO B HG3  3  
ATOM   5369  H HD2  . PRO B 1 2  ? 9.777   -14.606 -11.537 1.00 2.71 ? 2   PRO B HD2  3  
ATOM   5370  H HD3  . PRO B 1 2  ? 9.829   -16.363 -11.783 1.00 2.93 ? 2   PRO B HD3  3  
ATOM   5371  N N    . MET B 1 3  ? 7.864   -14.470 -6.891  1.00 1.69 ? 3   MET B N    3  
ATOM   5372  C CA   . MET B 1 3  ? 7.259   -13.270 -6.248  1.00 1.53 ? 3   MET B CA   3  
ATOM   5373  C C    . MET B 1 3  ? 8.373   -12.308 -5.828  1.00 1.17 ? 3   MET B C    3  
ATOM   5374  O O    . MET B 1 3  ? 9.519   -12.690 -5.699  1.00 0.99 ? 3   MET B O    3  
ATOM   5375  C CB   . MET B 1 3  ? 6.461   -13.699 -5.014  1.00 1.63 ? 3   MET B CB   3  
ATOM   5376  C CG   . MET B 1 3  ? 5.174   -14.397 -5.458  1.00 2.15 ? 3   MET B CG   3  
ATOM   5377  S SD   . MET B 1 3  ? 4.323   -15.072 -4.011  1.00 2.54 ? 3   MET B SD   3  
ATOM   5378  C CE   . MET B 1 3  ? 3.016   -15.949 -4.904  1.00 3.59 ? 3   MET B CE   3  
ATOM   5379  H H    . MET B 1 3  ? 7.958   -15.304 -6.384  1.00 1.78 ? 3   MET B H    3  
ATOM   5380  H HA   . MET B 1 3  ? 6.603   -12.778 -6.950  1.00 1.74 ? 3   MET B HA   3  
ATOM   5381  H HB2  . MET B 1 3  ? 7.054   -14.380 -4.421  1.00 1.99 ? 3   MET B HB2  3  
ATOM   5382  H HB3  . MET B 1 3  ? 6.212   -12.830 -4.426  1.00 1.87 ? 3   MET B HB3  3  
ATOM   5383  H HG2  . MET B 1 3  ? 4.531   -13.684 -5.954  1.00 2.61 ? 3   MET B HG2  3  
ATOM   5384  H HG3  . MET B 1 3  ? 5.415   -15.199 -6.140  1.00 2.68 ? 3   MET B HG3  3  
ATOM   5385  H HE1  . MET B 1 3  ? 3.455   -16.528 -5.705  1.00 3.92 ? 3   MET B HE1  3  
ATOM   5386  H HE2  . MET B 1 3  ? 2.493   -16.606 -4.223  1.00 4.04 ? 3   MET B HE2  3  
ATOM   5387  H HE3  . MET B 1 3  ? 2.320   -15.237 -5.318  1.00 4.01 ? 3   MET B HE3  3  
ATOM   5388  N N    . GLY B 1 4  ? 8.048   -11.062 -5.618  1.00 1.14 ? 4   GLY B N    3  
ATOM   5389  C CA   . GLY B 1 4  ? 9.094   -10.081 -5.211  1.00 0.89 ? 4   GLY B CA   3  
ATOM   5390  C C    . GLY B 1 4  ? 9.727   -10.526 -3.893  1.00 0.62 ? 4   GLY B C    3  
ATOM   5391  O O    . GLY B 1 4  ? 9.461   -11.604 -3.399  1.00 0.70 ? 4   GLY B O    3  
ATOM   5392  H H    . GLY B 1 4  ? 7.119   -10.771 -5.729  1.00 1.36 ? 4   GLY B H    3  
ATOM   5393  H HA2  . GLY B 1 4  ? 9.852   -10.032 -5.979  1.00 0.84 ? 4   GLY B HA2  3  
ATOM   5394  H HA3  . GLY B 1 4  ? 8.649   -9.108  -5.081  1.00 1.04 ? 4   GLY B HA3  3  
ATOM   5395  N N    . SER B 1 5  ? 10.568  -9.706  -3.316  1.00 0.44 ? 5   SER B N    3  
ATOM   5396  C CA   . SER B 1 5  ? 11.218  -10.088 -2.027  1.00 0.30 ? 5   SER B CA   3  
ATOM   5397  C C    . SER B 1 5  ? 10.314  -9.673  -0.853  1.00 0.27 ? 5   SER B C    3  
ATOM   5398  O O    . SER B 1 5  ? 9.828   -10.505 -0.112  1.00 0.30 ? 5   SER B O    3  
ATOM   5399  C CB   . SER B 1 5  ? 12.596  -9.410  -1.931  1.00 0.49 ? 5   SER B CB   3  
ATOM   5400  O OG   . SER B 1 5  ? 13.587  -10.407 -1.717  1.00 1.52 ? 5   SER B OG   3  
ATOM   5401  H H    . SER B 1 5  ? 10.772  -8.842  -3.729  1.00 0.56 ? 5   SER B H    3  
ATOM   5402  H HA   . SER B 1 5  ? 11.353  -11.157 -2.005  1.00 0.39 ? 5   SER B HA   3  
ATOM   5403  H HB2  . SER B 1 5  ? 12.810  -8.899  -2.854  1.00 0.93 ? 5   SER B HB2  3  
ATOM   5404  H HB3  . SER B 1 5  ? 12.612  -8.697  -1.117  1.00 0.96 ? 5   SER B HB3  3  
ATOM   5405  H HG   . SER B 1 5  ? 13.185  -11.264 -1.877  1.00 2.00 ? 5   SER B HG   3  
ATOM   5406  N N    . ASP B 1 6  ? 10.082  -8.398  -0.682  1.00 0.24 ? 6   ASP B N    3  
ATOM   5407  C CA   . ASP B 1 6  ? 9.202   -7.941  0.441   1.00 0.23 ? 6   ASP B CA   3  
ATOM   5408  C C    . ASP B 1 6  ? 8.651   -6.539  0.132   1.00 0.21 ? 6   ASP B C    3  
ATOM   5409  O O    . ASP B 1 6  ? 9.023   -5.582  0.781   1.00 0.20 ? 6   ASP B O    3  
ATOM   5410  C CB   . ASP B 1 6  ? 10.012  -7.894  1.748   1.00 0.25 ? 6   ASP B CB   3  
ATOM   5411  C CG   . ASP B 1 6  ? 9.058   -7.903  2.945   1.00 1.26 ? 6   ASP B CG   3  
ATOM   5412  O OD1  . ASP B 1 6  ? 7.872   -7.709  2.734   1.00 2.03 ? 6   ASP B OD1  3  
ATOM   5413  O OD2  . ASP B 1 6  ? 9.530   -8.105  4.052   1.00 2.00 ? 6   ASP B OD2  3  
ATOM   5414  H H    . ASP B 1 6  ? 10.477  -7.741  -1.295  1.00 0.23 ? 6   ASP B H    3  
ATOM   5415  H HA   . ASP B 1 6  ? 8.382   -8.635  0.555   1.00 0.25 ? 6   ASP B HA   3  
ATOM   5416  H HB2  . ASP B 1 6  ? 10.661  -8.755  1.801   1.00 0.79 ? 6   ASP B HB2  3  
ATOM   5417  H HB3  . ASP B 1 6  ? 10.608  -6.994  1.777   1.00 0.94 ? 6   ASP B HB3  3  
ATOM   5418  N N    . PRO B 1 7  ? 7.781   -6.446  -0.852  1.00 0.22 ? 7   PRO B N    3  
ATOM   5419  C CA   . PRO B 1 7  ? 7.192   -5.148  -1.237  1.00 0.22 ? 7   PRO B CA   3  
ATOM   5420  C C    . PRO B 1 7  ? 6.326   -4.600  -0.081  1.00 0.20 ? 7   PRO B C    3  
ATOM   5421  O O    . PRO B 1 7  ? 6.011   -5.327  0.840   1.00 0.20 ? 7   PRO B O    3  
ATOM   5422  C CB   . PRO B 1 7  ? 6.333   -5.458  -2.487  1.00 0.25 ? 7   PRO B CB   3  
ATOM   5423  C CG   . PRO B 1 7  ? 6.426   -6.990  -2.751  1.00 0.27 ? 7   PRO B CG   3  
ATOM   5424  C CD   . PRO B 1 7  ? 7.323   -7.601  -1.651  1.00 0.26 ? 7   PRO B CD   3  
ATOM   5425  H HA   . PRO B 1 7  ? 7.978   -4.456  -1.487  1.00 0.21 ? 7   PRO B HA   3  
ATOM   5426  H HB2  . PRO B 1 7  ? 5.300   -5.172  -2.316  1.00 0.26 ? 7   PRO B HB2  3  
ATOM   5427  H HB3  . PRO B 1 7  ? 6.718   -4.919  -3.342  1.00 0.27 ? 7   PRO B HB3  3  
ATOM   5428  H HG2  . PRO B 1 7  ? 5.437   -7.432  -2.715  1.00 0.28 ? 7   PRO B HG2  3  
ATOM   5429  H HG3  . PRO B 1 7  ? 6.866   -7.172  -3.723  1.00 0.29 ? 7   PRO B HG3  3  
ATOM   5430  H HD2  . PRO B 1 7  ? 6.750   -8.283  -1.037  1.00 0.28 ? 7   PRO B HD2  3  
ATOM   5431  H HD3  . PRO B 1 7  ? 8.169   -8.109  -2.088  1.00 0.28 ? 7   PRO B HD3  3  
ATOM   5432  N N    . PRO B 1 8  ? 5.954   -3.337  -0.166  1.00 0.21 ? 8   PRO B N    3  
ATOM   5433  C CA   . PRO B 1 8  ? 5.114   -2.706  0.872   1.00 0.22 ? 8   PRO B CA   3  
ATOM   5434  C C    . PRO B 1 8  ? 3.752   -3.413  0.930   1.00 0.22 ? 8   PRO B C    3  
ATOM   5435  O O    . PRO B 1 8  ? 3.607   -4.539  0.495   1.00 0.22 ? 8   PRO B O    3  
ATOM   5436  C CB   . PRO B 1 8  ? 4.963   -1.233  0.419   1.00 0.24 ? 8   PRO B CB   3  
ATOM   5437  C CG   . PRO B 1 8  ? 5.598   -1.117  -0.997  1.00 0.26 ? 8   PRO B CG   3  
ATOM   5438  C CD   . PRO B 1 8  ? 6.334   -2.443  -1.283  1.00 0.24 ? 8   PRO B CD   3  
ATOM   5439  H HA   . PRO B 1 8  ? 5.603   -2.754  1.833   1.00 0.22 ? 8   PRO B HA   3  
ATOM   5440  H HB2  . PRO B 1 8  ? 3.916   -0.952  0.381   1.00 0.26 ? 8   PRO B HB2  3  
ATOM   5441  H HB3  . PRO B 1 8  ? 5.487   -0.581  1.103   1.00 0.25 ? 8   PRO B HB3  3  
ATOM   5442  H HG2  . PRO B 1 8  ? 4.822   -0.956  -1.736  1.00 0.28 ? 8   PRO B HG2  3  
ATOM   5443  H HG3  . PRO B 1 8  ? 6.300   -0.294  -1.024  1.00 0.27 ? 8   PRO B HG3  3  
ATOM   5444  H HD2  . PRO B 1 8  ? 6.015   -2.863  -2.229  1.00 0.25 ? 8   PRO B HD2  3  
ATOM   5445  H HD3  . PRO B 1 8  ? 7.400   -2.284  -1.282  1.00 0.24 ? 8   PRO B HD3  3  
ATOM   5446  N N    . THR B 1 9  ? 2.752   -2.757  1.458   1.00 0.23 ? 9   THR B N    3  
ATOM   5447  C CA   . THR B 1 9  ? 1.401   -3.385  1.537   1.00 0.24 ? 9   THR B CA   3  
ATOM   5448  C C    . THR B 1 9  ? 0.332   -2.295  1.528   1.00 0.24 ? 9   THR B C    3  
ATOM   5449  O O    . THR B 1 9  ? 0.314   -1.416  2.366   1.00 0.25 ? 9   THR B O    3  
ATOM   5450  C CB   . THR B 1 9  ? 1.290   -4.198  2.826   1.00 0.25 ? 9   THR B CB   3  
ATOM   5451  O OG1  . THR B 1 9  ? 2.424   -5.044  2.948   1.00 0.26 ? 9   THR B OG1  3  
ATOM   5452  C CG2  . THR B 1 9  ? 0.018   -5.047  2.787   1.00 0.29 ? 9   THR B CG2  3  
ATOM   5453  H H    . THR B 1 9  ? 2.889   -1.848  1.800   1.00 0.24 ? 9   THR B H    3  
ATOM   5454  H HA   . THR B 1 9  ? 1.249   -4.034  0.686   1.00 0.25 ? 9   THR B HA   3  
ATOM   5455  H HB   . THR B 1 9  ? 1.247   -3.527  3.669   1.00 0.26 ? 9   THR B HB   3  
ATOM   5456  H HG1  . THR B 1 9  ? 2.377   -5.483  3.801   1.00 0.86 ? 9   THR B HG1  3  
ATOM   5457  H HG21 . THR B 1 9  ? -0.833  -4.413  2.581   1.00 1.07 ? 9   THR B HG21 3  
ATOM   5458  H HG22 . THR B 1 9  ? 0.105   -5.793  2.011   1.00 1.03 ? 9   THR B HG22 3  
ATOM   5459  H HG23 . THR B 1 9  ? -0.121  -5.535  3.741   1.00 1.07 ? 9   THR B HG23 3  
ATOM   5460  N N    . ALA B 1 10 ? -0.560  -2.350  0.580   1.00 0.23 ? 10  ALA B N    3  
ATOM   5461  C CA   . ALA B 1 10 ? -1.633  -1.323  0.500   1.00 0.23 ? 10  ALA B CA   3  
ATOM   5462  C C    . ALA B 1 10 ? -2.583  -1.480  1.686   1.00 0.22 ? 10  ALA B C    3  
ATOM   5463  O O    . ALA B 1 10 ? -3.633  -2.082  1.576   1.00 0.27 ? 10  ALA B O    3  
ATOM   5464  C CB   . ALA B 1 10 ? -2.412  -1.515  -0.800  1.00 0.23 ? 10  ALA B CB   3  
ATOM   5465  H H    . ALA B 1 10 ? -0.522  -3.068  -0.085  1.00 0.22 ? 10  ALA B H    3  
ATOM   5466  H HA   . ALA B 1 10 ? -1.194  -0.336  0.517   1.00 0.24 ? 10  ALA B HA   3  
ATOM   5467  H HB1  . ALA B 1 10 ? -2.664  -2.559  -0.916  1.00 0.99 ? 10  ALA B HB1  3  
ATOM   5468  H HB2  . ALA B 1 10 ? -3.317  -0.927  -0.766  1.00 0.99 ? 10  ALA B HB2  3  
ATOM   5469  H HB3  . ALA B 1 10 ? -1.804  -1.196  -1.633  1.00 0.99 ? 10  ALA B HB3  3  
ATOM   5470  N N    . CYS B 1 11 ? -2.227  -0.929  2.818   1.00 0.25 ? 11  CYS B N    3  
ATOM   5471  C CA   . CYS B 1 11 ? -3.103  -1.022  4.026   1.00 0.25 ? 11  CYS B CA   3  
ATOM   5472  C C    . CYS B 1 11 ? -3.707  0.355   4.297   1.00 0.25 ? 11  CYS B C    3  
ATOM   5473  O O    . CYS B 1 11 ? -3.026  1.361   4.251   1.00 0.26 ? 11  CYS B O    3  
ATOM   5474  C CB   . CYS B 1 11 ? -2.265  -1.462  5.229   1.00 0.25 ? 11  CYS B CB   3  
ATOM   5475  S SG   . CYS B 1 11 ? -1.310  -2.937  4.791   1.00 0.34 ? 11  CYS B SG   3  
ATOM   5476  H H    . CYS B 1 11 ? -1.377  -0.442  2.872   1.00 0.30 ? 11  CYS B H    3  
ATOM   5477  H HA   . CYS B 1 11 ? -3.898  -1.737  3.861   1.00 0.25 ? 11  CYS B HA   3  
ATOM   5478  H HB2  . CYS B 1 11 ? -1.591  -0.666  5.509   1.00 0.29 ? 11  CYS B HB2  3  
ATOM   5479  H HB3  . CYS B 1 11 ? -2.918  -1.690  6.059   1.00 0.29 ? 11  CYS B HB3  3  
ATOM   5480  N N    . CYS B 1 12 ? -4.981  0.415   4.566   1.00 0.24 ? 12  CYS B N    3  
ATOM   5481  C CA   . CYS B 1 12 ? -5.622  1.733   4.827   1.00 0.24 ? 12  CYS B CA   3  
ATOM   5482  C C    . CYS B 1 12 ? -5.173  2.262   6.190   1.00 0.24 ? 12  CYS B C    3  
ATOM   5483  O O    . CYS B 1 12 ? -5.046  1.519   7.144   1.00 0.27 ? 12  CYS B O    3  
ATOM   5484  C CB   . CYS B 1 12 ? -7.145  1.575   4.819   1.00 0.24 ? 12  CYS B CB   3  
ATOM   5485  S SG   . CYS B 1 12 ? -7.689  1.056   3.172   1.00 0.24 ? 12  CYS B SG   3  
ATOM   5486  H H    . CYS B 1 12 ? -5.517  -0.405  4.590   1.00 0.24 ? 12  CYS B H    3  
ATOM   5487  H HA   . CYS B 1 12 ? -5.330  2.432   4.057   1.00 0.26 ? 12  CYS B HA   3  
ATOM   5488  H HB2  . CYS B 1 12 ? -7.434  0.830   5.544   1.00 0.27 ? 12  CYS B HB2  3  
ATOM   5489  H HB3  . CYS B 1 12 ? -7.605  2.519   5.069   1.00 0.24 ? 12  CYS B HB3  3  
ATOM   5490  N N    . PHE B 1 13 ? -4.945  3.546   6.288   1.00 0.25 ? 13  PHE B N    3  
ATOM   5491  C CA   . PHE B 1 13 ? -4.513  4.149   7.587   1.00 0.27 ? 13  PHE B CA   3  
ATOM   5492  C C    . PHE B 1 13 ? -5.717  4.855   8.216   1.00 0.24 ? 13  PHE B C    3  
ATOM   5493  O O    . PHE B 1 13 ? -5.728  5.175   9.387   1.00 0.26 ? 13  PHE B O    3  
ATOM   5494  C CB   . PHE B 1 13 ? -3.395  5.166   7.328   1.00 0.30 ? 13  PHE B CB   3  
ATOM   5495  C CG   . PHE B 1 13 ? -3.959  6.355   6.586   1.00 0.31 ? 13  PHE B CG   3  
ATOM   5496  C CD1  . PHE B 1 13 ? -4.234  6.257   5.210   1.00 0.31 ? 13  PHE B CD1  3  
ATOM   5497  C CD2  . PHE B 1 13 ? -4.221  7.555   7.275   1.00 0.35 ? 13  PHE B CD2  3  
ATOM   5498  C CE1  . PHE B 1 13 ? -4.771  7.359   4.522   1.00 0.34 ? 13  PHE B CE1  3  
ATOM   5499  C CE2  . PHE B 1 13 ? -4.760  8.657   6.587   1.00 0.37 ? 13  PHE B CE2  3  
ATOM   5500  C CZ   . PHE B 1 13 ? -5.035  8.561   5.209   1.00 0.37 ? 13  PHE B CZ   3  
ATOM   5501  H H    . PHE B 1 13 ? -5.065  4.119   5.504   1.00 0.25 ? 13  PHE B H    3  
ATOM   5502  H HA   . PHE B 1 13 ? -4.152  3.381   8.254   1.00 0.29 ? 13  PHE B HA   3  
ATOM   5503  H HB2  . PHE B 1 13 ? -2.979  5.492   8.270   1.00 0.33 ? 13  PHE B HB2  3  
ATOM   5504  H HB3  . PHE B 1 13 ? -2.620  4.707   6.732   1.00 0.31 ? 13  PHE B HB3  3  
ATOM   5505  H HD1  . PHE B 1 13 ? -4.030  5.337   4.682   1.00 0.30 ? 13  PHE B HD1  3  
ATOM   5506  H HD2  . PHE B 1 13 ? -4.010  7.628   8.331   1.00 0.36 ? 13  PHE B HD2  3  
ATOM   5507  H HE1  . PHE B 1 13 ? -4.980  7.284   3.466   1.00 0.36 ? 13  PHE B HE1  3  
ATOM   5508  H HE2  . PHE B 1 13 ? -4.961  9.577   7.116   1.00 0.40 ? 13  PHE B HE2  3  
ATOM   5509  H HZ   . PHE B 1 13 ? -5.449  9.406   4.680   1.00 0.40 ? 13  PHE B HZ   3  
ATOM   5510  N N    . SER B 1 14 ? -6.732  5.093   7.429   1.00 0.21 ? 14  SER B N    3  
ATOM   5511  C CA   . SER B 1 14 ? -7.951  5.774   7.947   1.00 0.20 ? 14  SER B CA   3  
ATOM   5512  C C    . SER B 1 14 ? -9.135  5.406   7.051   1.00 0.18 ? 14  SER B C    3  
ATOM   5513  O O    . SER B 1 14 ? -9.122  4.391   6.384   1.00 0.17 ? 14  SER B O    3  
ATOM   5514  C CB   . SER B 1 14 ? -7.742  7.288   7.924   1.00 0.20 ? 14  SER B CB   3  
ATOM   5515  O OG   . SER B 1 14 ? -7.525  7.711   6.584   1.00 0.25 ? 14  SER B OG   3  
ATOM   5516  H H    . SER B 1 14 ? -6.691  4.820   6.489   1.00 0.21 ? 14  SER B H    3  
ATOM   5517  H HA   . SER B 1 14 ? -8.147  5.449   8.958   1.00 0.22 ? 14  SER B HA   3  
ATOM   5518  H HB2  . SER B 1 14 ? -8.616  7.781   8.313   1.00 0.24 ? 14  SER B HB2  3  
ATOM   5519  H HB3  . SER B 1 14 ? -6.885  7.541   8.535   1.00 0.24 ? 14  SER B HB3  3  
ATOM   5520  H HG   . SER B 1 14 ? -7.207  8.617   6.606   1.00 0.84 ? 14  SER B HG   3  
ATOM   5521  N N    . TYR B 1 15 ? -10.161 6.214   7.027   1.00 0.19 ? 15  TYR B N    3  
ATOM   5522  C CA   . TYR B 1 15 ? -11.342 5.891   6.169   1.00 0.20 ? 15  TYR B CA   3  
ATOM   5523  C C    . TYR B 1 15 ? -12.086 7.179   5.815   1.00 0.24 ? 15  TYR B C    3  
ATOM   5524  O O    . TYR B 1 15 ? -11.967 8.183   6.489   1.00 0.29 ? 15  TYR B O    3  
ATOM   5525  C CB   . TYR B 1 15 ? -12.289 4.951   6.929   1.00 0.22 ? 15  TYR B CB   3  
ATOM   5526  C CG   . TYR B 1 15 ? -11.487 3.932   7.704   1.00 0.21 ? 15  TYR B CG   3  
ATOM   5527  C CD1  . TYR B 1 15 ? -11.058 2.748   7.076   1.00 0.21 ? 15  TYR B CD1  3  
ATOM   5528  C CD2  . TYR B 1 15 ? -11.170 4.169   9.055   1.00 0.25 ? 15  TYR B CD2  3  
ATOM   5529  C CE1  . TYR B 1 15 ? -10.310 1.800   7.801   1.00 0.23 ? 15  TYR B CE1  3  
ATOM   5530  C CE2  . TYR B 1 15 ? -10.423 3.220   9.779   1.00 0.28 ? 15  TYR B CE2  3  
ATOM   5531  C CZ   . TYR B 1 15 ? -9.992  2.036   9.153   1.00 0.27 ? 15  TYR B CZ   3  
ATOM   5532  O OH   . TYR B 1 15 ? -9.260  1.105   9.862   1.00 0.32 ? 15  TYR B OH   3  
ATOM   5533  H H    . TYR B 1 15 ? -10.158 7.028   7.573   1.00 0.21 ? 15  TYR B H    3  
ATOM   5534  H HA   . TYR B 1 15 ? -11.009 5.412   5.257   1.00 0.18 ? 15  TYR B HA   3  
ATOM   5535  H HB2  . TYR B 1 15 ? -12.895 5.523   7.617   1.00 0.25 ? 15  TYR B HB2  3  
ATOM   5536  H HB3  . TYR B 1 15 ? -12.928 4.442   6.226   1.00 0.22 ? 15  TYR B HB3  3  
ATOM   5537  H HD1  . TYR B 1 15 ? -11.301 2.566   6.041   1.00 0.20 ? 15  TYR B HD1  3  
ATOM   5538  H HD2  . TYR B 1 15 ? -11.500 5.077   9.537   1.00 0.27 ? 15  TYR B HD2  3  
ATOM   5539  H HE1  . TYR B 1 15 ? -9.979  0.891   7.320   1.00 0.24 ? 15  TYR B HE1  3  
ATOM   5540  H HE2  . TYR B 1 15 ? -10.180 3.401   10.816  1.00 0.33 ? 15  TYR B HE2  3  
ATOM   5541  H HH   . TYR B 1 15 ? -9.597  1.085   10.761  1.00 0.89 ? 15  TYR B HH   3  
ATOM   5542  N N    . THR B 1 16 ? -12.866 7.153   4.767   1.00 0.22 ? 16  THR B N    3  
ATOM   5543  C CA   . THR B 1 16 ? -13.629 8.373   4.384   1.00 0.28 ? 16  THR B CA   3  
ATOM   5544  C C    . THR B 1 16 ? -14.528 8.774   5.557   1.00 0.32 ? 16  THR B C    3  
ATOM   5545  O O    . THR B 1 16 ? -14.315 8.354   6.677   1.00 0.38 ? 16  THR B O    3  
ATOM   5546  C CB   . THR B 1 16 ? -14.467 8.082   3.132   1.00 0.28 ? 16  THR B CB   3  
ATOM   5547  O OG1  . THR B 1 16 ? -15.308 9.191   2.852   1.00 0.39 ? 16  THR B OG1  3  
ATOM   5548  C CG2  . THR B 1 16 ? -15.322 6.833   3.354   1.00 0.27 ? 16  THR B CG2  3  
ATOM   5549  H H    . THR B 1 16 ? -12.958 6.328   4.242   1.00 0.19 ? 16  THR B H    3  
ATOM   5550  H HA   . THR B 1 16 ? -12.936 9.176   4.176   1.00 0.30 ? 16  THR B HA   3  
ATOM   5551  H HB   . THR B 1 16 ? -13.809 7.913   2.294   1.00 0.27 ? 16  THR B HB   3  
ATOM   5552  H HG1  . THR B 1 16 ? -16.216 8.925   3.021   1.00 0.86 ? 16  THR B HG1  3  
ATOM   5553  H HG21 . THR B 1 16 ? -15.908 6.952   4.252   1.00 1.04 ? 16  THR B HG21 3  
ATOM   5554  H HG22 . THR B 1 16 ? -15.981 6.695   2.508   1.00 1.06 ? 16  THR B HG22 3  
ATOM   5555  H HG23 . THR B 1 16 ? -14.680 5.971   3.452   1.00 1.07 ? 16  THR B HG23 3  
ATOM   5556  N N    . ALA B 1 17 ? -15.528 9.581   5.323   1.00 0.36 ? 17  ALA B N    3  
ATOM   5557  C CA   . ALA B 1 17 ? -16.429 10.003  6.439   1.00 0.42 ? 17  ALA B CA   3  
ATOM   5558  C C    . ALA B 1 17 ? -17.858 10.137  5.915   1.00 0.45 ? 17  ALA B C    3  
ATOM   5559  O O    . ALA B 1 17 ? -18.706 10.743  6.541   1.00 0.63 ? 17  ALA B O    3  
ATOM   5560  C CB   . ALA B 1 17 ? -15.959 11.351  6.986   1.00 0.50 ? 17  ALA B CB   3  
ATOM   5561  H H    . ALA B 1 17 ? -15.686 9.915   4.418   1.00 0.39 ? 17  ALA B H    3  
ATOM   5562  H HA   . ALA B 1 17 ? -16.408 9.267   7.231   1.00 0.42 ? 17  ALA B HA   3  
ATOM   5563  H HB1  . ALA B 1 17 ? -15.925 12.073  6.183   1.00 1.12 ? 17  ALA B HB1  3  
ATOM   5564  H HB2  . ALA B 1 17 ? -16.644 11.691  7.747   1.00 1.12 ? 17  ALA B HB2  3  
ATOM   5565  H HB3  . ALA B 1 17 ? -14.972 11.242  7.412   1.00 1.18 ? 17  ALA B HB3  3  
ATOM   5566  N N    . ARG B 1 18 ? -18.134 9.573   4.770   1.00 0.47 ? 18  ARG B N    3  
ATOM   5567  C CA   . ARG B 1 18 ? -19.509 9.660   4.195   1.00 0.48 ? 18  ARG B CA   3  
ATOM   5568  C C    . ARG B 1 18 ? -19.839 8.348   3.479   1.00 0.41 ? 18  ARG B C    3  
ATOM   5569  O O    . ARG B 1 18 ? -19.062 7.850   2.689   1.00 0.37 ? 18  ARG B O    3  
ATOM   5570  C CB   . ARG B 1 18 ? -19.570 10.815  3.190   1.00 0.53 ? 18  ARG B CB   3  
ATOM   5571  C CG   . ARG B 1 18 ? -19.620 12.158  3.937   1.00 0.70 ? 18  ARG B CG   3  
ATOM   5572  C CD   . ARG B 1 18 ? -20.953 12.309  4.710   1.00 1.15 ? 18  ARG B CD   3  
ATOM   5573  N NE   . ARG B 1 18 ? -21.528 13.675  4.484   1.00 1.96 ? 18  ARG B NE   3  
ATOM   5574  C CZ   . ARG B 1 18 ? -20.789 14.751  4.581   1.00 2.64 ? 18  ARG B CZ   3  
ATOM   5575  N NH1  . ARG B 1 18 ? -19.547 14.668  4.972   1.00 2.84 ? 18  ARG B NH1  3  
ATOM   5576  N NH2  . ARG B 1 18 ? -21.307 15.919  4.313   1.00 3.63 ? 18  ARG B NH2  3  
ATOM   5577  H H    . ARG B 1 18 ? -17.432 9.089   4.285   1.00 0.61 ? 18  ARG B H    3  
ATOM   5578  H HA   . ARG B 1 18 ? -20.229 9.827   4.984   1.00 0.52 ? 18  ARG B HA   3  
ATOM   5579  H HB2  . ARG B 1 18 ? -18.692 10.787  2.561   1.00 0.55 ? 18  ARG B HB2  3  
ATOM   5580  H HB3  . ARG B 1 18 ? -20.453 10.713  2.576   1.00 0.55 ? 18  ARG B HB3  3  
ATOM   5581  H HG2  . ARG B 1 18 ? -18.789 12.203  4.627   1.00 1.27 ? 18  ARG B HG2  3  
ATOM   5582  H HG3  . ARG B 1 18 ? -19.529 12.960  3.220   1.00 1.20 ? 18  ARG B HG3  3  
ATOM   5583  H HD2  . ARG B 1 18 ? -21.670 11.587  4.358   1.00 1.77 ? 18  ARG B HD2  3  
ATOM   5584  H HD3  . ARG B 1 18 ? -20.778 12.140  5.769   1.00 1.64 ? 18  ARG B HD3  3  
ATOM   5585  H HE   . ARG B 1 18 ? -22.471 13.762  4.234   1.00 2.46 ? 18  ARG B HE   3  
ATOM   5586  H HH11 . ARG B 1 18 ? -19.155 13.782  5.203   1.00 2.56 ? 18  ARG B HH11 3  
ATOM   5587  H HH12 . ARG B 1 18 ? -18.990 15.495  5.040   1.00 3.61 ? 18  ARG B HH12 3  
ATOM   5588  H HH21 . ARG B 1 18 ? -22.264 15.989  4.034   1.00 3.98 ? 18  ARG B HH21 3  
ATOM   5589  H HH22 . ARG B 1 18 ? -20.745 16.743  4.385   1.00 4.24 ? 18  ARG B HH22 3  
ATOM   5590  N N    . LYS B 1 19 ? -20.988 7.789   3.742   1.00 0.40 ? 19  LYS B N    3  
ATOM   5591  C CA   . LYS B 1 19 ? -21.365 6.517   3.065   1.00 0.35 ? 19  LYS B CA   3  
ATOM   5592  C C    . LYS B 1 19 ? -21.453 6.782   1.561   1.00 0.31 ? 19  LYS B C    3  
ATOM   5593  O O    . LYS B 1 19 ? -22.146 7.676   1.117   1.00 0.33 ? 19  LYS B O    3  
ATOM   5594  C CB   . LYS B 1 19 ? -22.722 6.037   3.617   1.00 0.38 ? 19  LYS B CB   3  
ATOM   5595  C CG   . LYS B 1 19 ? -23.265 4.835   2.816   1.00 0.40 ? 19  LYS B CG   3  
ATOM   5596  C CD   . LYS B 1 19 ? -24.739 4.597   3.165   1.00 0.62 ? 19  LYS B CD   3  
ATOM   5597  C CE   . LYS B 1 19 ? -24.930 4.567   4.684   1.00 0.97 ? 19  LYS B CE   3  
ATOM   5598  N NZ   . LYS B 1 19 ? -24.961 5.961   5.209   1.00 1.79 ? 19  LYS B NZ   3  
ATOM   5599  H H    . LYS B 1 19 ? -21.604 8.208   4.378   1.00 0.43 ? 19  LYS B H    3  
ATOM   5600  H HA   . LYS B 1 19 ? -20.610 5.769   3.257   1.00 0.35 ? 19  LYS B HA   3  
ATOM   5601  H HB2  . LYS B 1 19 ? -22.596 5.742   4.648   1.00 0.45 ? 19  LYS B HB2  3  
ATOM   5602  H HB3  . LYS B 1 19 ? -23.429 6.844   3.571   1.00 0.41 ? 19  LYS B HB3  3  
ATOM   5603  H HG2  . LYS B 1 19 ? -23.187 5.024   1.758   1.00 0.68 ? 19  LYS B HG2  3  
ATOM   5604  H HG3  . LYS B 1 19 ? -22.696 3.955   3.062   1.00 0.68 ? 19  LYS B HG3  3  
ATOM   5605  H HD2  . LYS B 1 19 ? -25.338 5.391   2.744   1.00 1.50 ? 19  LYS B HD2  3  
ATOM   5606  H HD3  . LYS B 1 19 ? -25.055 3.652   2.747   1.00 1.32 ? 19  LYS B HD3  3  
ATOM   5607  H HE2  . LYS B 1 19 ? -25.864 4.076   4.918   1.00 1.40 ? 19  LYS B HE2  3  
ATOM   5608  H HE3  . LYS B 1 19 ? -24.117 4.028   5.141   1.00 1.44 ? 19  LYS B HE3  3  
ATOM   5609  H HZ1  . LYS B 1 19 ? -25.014 6.631   4.413   1.00 2.18 ? 19  LYS B HZ1  3  
ATOM   5610  H HZ2  . LYS B 1 19 ? -25.791 6.084   5.822   1.00 2.30 ? 19  LYS B HZ2  3  
ATOM   5611  H HZ3  . LYS B 1 19 ? -24.097 6.145   5.758   1.00 2.23 ? 19  LYS B HZ3  3  
ATOM   5612  N N    . LEU B 1 20 ? -20.757 6.008   0.775   1.00 0.27 ? 20  LEU B N    3  
ATOM   5613  C CA   . LEU B 1 20 ? -20.799 6.211   -0.698  1.00 0.27 ? 20  LEU B CA   3  
ATOM   5614  C C    . LEU B 1 20 ? -22.157 5.713   -1.245  1.00 0.27 ? 20  LEU B C    3  
ATOM   5615  O O    . LEU B 1 20 ? -22.440 4.538   -1.125  1.00 0.27 ? 20  LEU B O    3  
ATOM   5616  C CB   . LEU B 1 20 ? -19.690 5.383   -1.349  1.00 0.24 ? 20  LEU B CB   3  
ATOM   5617  C CG   . LEU B 1 20 ? -18.354 5.614   -0.638  1.00 0.23 ? 20  LEU B CG   3  
ATOM   5618  C CD1  . LEU B 1 20 ? -17.238 4.963   -1.456  1.00 0.22 ? 20  LEU B CD1  3  
ATOM   5619  C CD2  . LEU B 1 20 ? -18.075 7.116   -0.510  1.00 0.27 ? 20  LEU B CD2  3  
ATOM   5620  H H    . LEU B 1 20 ? -20.206 5.293   1.156   1.00 0.27 ? 20  LEU B H    3  
ATOM   5621  H HA   . LEU B 1 20 ? -20.642 7.249   -0.917  1.00 0.29 ? 20  LEU B HA   3  
ATOM   5622  H HB2  . LEU B 1 20 ? -19.946 4.336   -1.286  1.00 0.24 ? 20  LEU B HB2  3  
ATOM   5623  H HB3  . LEU B 1 20 ? -19.595 5.664   -2.386  1.00 0.27 ? 20  LEU B HB3  3  
ATOM   5624  H HG   . LEU B 1 20 ? -18.389 5.165   0.345   1.00 0.21 ? 20  LEU B HG   3  
ATOM   5625  H HD11 . LEU B 1 20 ? -17.547 3.975   -1.767  1.00 1.05 ? 20  LEU B HD11 3  
ATOM   5626  H HD12 . LEU B 1 20 ? -17.034 5.566   -2.329  1.00 1.00 ? 20  LEU B HD12 3  
ATOM   5627  H HD13 . LEU B 1 20 ? -16.347 4.888   -0.854  1.00 1.00 ? 20  LEU B HD13 3  
ATOM   5628  H HD21 . LEU B 1 20 ? -18.335 7.611   -1.432  1.00 1.05 ? 20  LEU B HD21 3  
ATOM   5629  H HD22 . LEU B 1 20 ? -18.666 7.523   0.297   1.00 1.03 ? 20  LEU B HD22 3  
ATOM   5630  H HD23 . LEU B 1 20 ? -17.026 7.272   -0.300  1.00 1.05 ? 20  LEU B HD23 3  
ATOM   5631  N N    . PRO B 1 21 ? -22.966 6.576   -1.841  1.00 0.31 ? 21  PRO B N    3  
ATOM   5632  C CA   . PRO B 1 21 ? -24.262 6.129   -2.387  1.00 0.34 ? 21  PRO B CA   3  
ATOM   5633  C C    . PRO B 1 21 ? -24.044 4.964   -3.355  1.00 0.30 ? 21  PRO B C    3  
ATOM   5634  O O    . PRO B 1 21 ? -23.051 4.903   -4.050  1.00 0.29 ? 21  PRO B O    3  
ATOM   5635  C CB   . PRO B 1 21 ? -24.830 7.363   -3.124  1.00 0.39 ? 21  PRO B CB   3  
ATOM   5636  C CG   . PRO B 1 21 ? -23.941 8.576   -2.738  1.00 0.42 ? 21  PRO B CG   3  
ATOM   5637  C CD   . PRO B 1 21 ? -22.691 8.021   -2.022  1.00 0.35 ? 21  PRO B CD   3  
ATOM   5638  H HA   . PRO B 1 21 ? -24.925 5.835   -1.588  1.00 0.36 ? 21  PRO B HA   3  
ATOM   5639  H HB2  . PRO B 1 21 ? -24.795 7.208   -4.199  1.00 0.39 ? 21  PRO B HB2  3  
ATOM   5640  H HB3  . PRO B 1 21 ? -25.848 7.540   -2.823  1.00 0.43 ? 21  PRO B HB3  3  
ATOM   5641  H HG2  . PRO B 1 21 ? -23.650 9.123   -3.628  1.00 0.45 ? 21  PRO B HG2  3  
ATOM   5642  H HG3  . PRO B 1 21 ? -24.481 9.233   -2.069  1.00 0.47 ? 21  PRO B HG3  3  
ATOM   5643  H HD2  . PRO B 1 21 ? -21.813 8.165   -2.639  1.00 0.35 ? 21  PRO B HD2  3  
ATOM   5644  H HD3  . PRO B 1 21 ? -22.561 8.499   -1.060  1.00 0.37 ? 21  PRO B HD3  3  
ATOM   5645  N N    . ARG B 1 22 ? -24.970 4.048   -3.421  1.00 0.31 ? 22  ARG B N    3  
ATOM   5646  C CA   . ARG B 1 22 ? -24.815 2.907   -4.364  1.00 0.30 ? 22  ARG B CA   3  
ATOM   5647  C C    . ARG B 1 22 ? -24.474 3.470   -5.749  1.00 0.31 ? 22  ARG B C    3  
ATOM   5648  O O    . ARG B 1 22 ? -23.716 2.893   -6.504  1.00 0.31 ? 22  ARG B O    3  
ATOM   5649  C CB   . ARG B 1 22 ? -26.134 2.113   -4.419  1.00 0.33 ? 22  ARG B CB   3  
ATOM   5650  C CG   . ARG B 1 22 ? -25.861 0.644   -4.781  1.00 0.69 ? 22  ARG B CG   3  
ATOM   5651  C CD   . ARG B 1 22 ? -25.197 0.549   -6.163  1.00 1.24 ? 22  ARG B CD   3  
ATOM   5652  N NE   . ARG B 1 22 ? -25.526 -0.769  -6.776  1.00 1.34 ? 22  ARG B NE   3  
ATOM   5653  C CZ   . ARG B 1 22 ? -25.328 -0.963  -8.051  1.00 2.07 ? 22  ARG B CZ   3  
ATOM   5654  N NH1  . ARG B 1 22 ? -24.841 -0.004  -8.789  1.00 2.89 ? 22  ARG B NH1  3  
ATOM   5655  N NH2  . ARG B 1 22 ? -25.616 -2.117  -8.587  1.00 2.44 ? 22  ARG B NH2  3  
ATOM   5656  H H    . ARG B 1 22 ? -25.773 4.120   -2.863  1.00 0.33 ? 22  ARG B H    3  
ATOM   5657  H HA   . ARG B 1 22 ? -24.012 2.268   -4.025  1.00 0.28 ? 22  ARG B HA   3  
ATOM   5658  H HB2  . ARG B 1 22 ? -26.612 2.156   -3.452  1.00 0.51 ? 22  ARG B HB2  3  
ATOM   5659  H HB3  . ARG B 1 22 ? -26.792 2.546   -5.159  1.00 0.49 ? 22  ARG B HB3  3  
ATOM   5660  H HG2  . ARG B 1 22 ? -25.209 0.209   -4.037  1.00 1.24 ? 22  ARG B HG2  3  
ATOM   5661  H HG3  . ARG B 1 22 ? -26.794 0.103   -4.797  1.00 1.29 ? 22  ARG B HG3  3  
ATOM   5662  H HD2  . ARG B 1 22 ? -25.561 1.341   -6.803  1.00 1.83 ? 22  ARG B HD2  3  
ATOM   5663  H HD3  . ARG B 1 22 ? -24.126 0.635   -6.056  1.00 1.88 ? 22  ARG B HD3  3  
ATOM   5664  H HE   . ARG B 1 22 ? -25.891 -1.490  -6.222  1.00 1.53 ? 22  ARG B HE   3  
ATOM   5665  H HH11 . ARG B 1 22 ? -24.621 0.881   -8.379  1.00 2.92 ? 22  ARG B HH11 3  
ATOM   5666  H HH12 . ARG B 1 22 ? -24.690 -0.152  -9.767  1.00 3.67 ? 22  ARG B HH12 3  
ATOM   5667  H HH21 . ARG B 1 22 ? -25.988 -2.853  -8.021  1.00 2.35 ? 22  ARG B HH21 3  
ATOM   5668  H HH22 . ARG B 1 22 ? -25.463 -2.267  -9.565  1.00 3.12 ? 22  ARG B HH22 3  
ATOM   5669  N N    . ASN B 1 23 ? -25.027 4.607   -6.078  1.00 0.34 ? 23  ASN B N    3  
ATOM   5670  C CA   . ASN B 1 23 ? -24.742 5.227   -7.403  1.00 0.37 ? 23  ASN B CA   3  
ATOM   5671  C C    . ASN B 1 23 ? -23.308 5.763   -7.422  1.00 0.37 ? 23  ASN B C    3  
ATOM   5672  O O    . ASN B 1 23 ? -22.941 6.546   -8.275  1.00 0.40 ? 23  ASN B O    3  
ATOM   5673  C CB   . ASN B 1 23 ? -25.718 6.380   -7.647  1.00 0.42 ? 23  ASN B CB   3  
ATOM   5674  C CG   . ASN B 1 23 ? -25.597 6.855   -9.095  1.00 1.47 ? 23  ASN B CG   3  
ATOM   5675  O OD1  . ASN B 1 23 ? -25.501 8.038   -9.353  1.00 2.16 ? 23  ASN B OD1  3  
ATOM   5676  N ND2  . ASN B 1 23 ? -25.597 5.976   -10.060 1.00 2.38 ? 23  ASN B ND2  3  
ATOM   5677  H H    . ASN B 1 23 ? -25.628 5.059   -5.445  1.00 0.35 ? 23  ASN B H    3  
ATOM   5678  H HA   . ASN B 1 23 ? -24.859 4.487   -8.179  1.00 0.38 ? 23  ASN B HA   3  
ATOM   5679  H HB2  . ASN B 1 23 ? -26.727 6.041   -7.461  1.00 1.04 ? 23  ASN B HB2  3  
ATOM   5680  H HB3  . ASN B 1 23 ? -25.484 7.197   -6.981  1.00 1.07 ? 23  ASN B HB3  3  
ATOM   5681  H HD21 . ASN B 1 23 ? -25.675 5.021   -9.852  1.00 2.56 ? 23  ASN B HD21 3  
ATOM   5682  H HD22 . ASN B 1 23 ? -25.520 6.270   -10.991 1.00 3.17 ? 23  ASN B HD22 3  
ATOM   5683  N N    . PHE B 1 24 ? -22.495 5.351   -6.483  1.00 0.33 ? 24  PHE B N    3  
ATOM   5684  C CA   . PHE B 1 24 ? -21.080 5.840   -6.434  1.00 0.33 ? 24  PHE B CA   3  
ATOM   5685  C C    . PHE B 1 24 ? -20.165 4.672   -6.055  1.00 0.30 ? 24  PHE B C    3  
ATOM   5686  O O    . PHE B 1 24 ? -19.103 4.857   -5.494  1.00 0.28 ? 24  PHE B O    3  
ATOM   5687  C CB   . PHE B 1 24 ? -20.974 6.952   -5.376  1.00 0.33 ? 24  PHE B CB   3  
ATOM   5688  C CG   . PHE B 1 24 ? -19.763 7.825   -5.637  1.00 0.35 ? 24  PHE B CG   3  
ATOM   5689  C CD1  . PHE B 1 24 ? -19.660 8.550   -6.842  1.00 0.39 ? 24  PHE B CD1  3  
ATOM   5690  C CD2  . PHE B 1 24 ? -18.741 7.930   -4.669  1.00 0.35 ? 24  PHE B CD2  3  
ATOM   5691  C CE1  . PHE B 1 24 ? -18.543 9.369   -7.079  1.00 0.41 ? 24  PHE B CE1  3  
ATOM   5692  C CE2  . PHE B 1 24 ? -17.624 8.750   -4.907  1.00 0.37 ? 24  PHE B CE2  3  
ATOM   5693  C CZ   . PHE B 1 24 ? -17.525 9.471   -6.112  1.00 0.41 ? 24  PHE B CZ   3  
ATOM   5694  H H    . PHE B 1 24 ? -22.817 4.725   -5.803  1.00 0.31 ? 24  PHE B H    3  
ATOM   5695  H HA   . PHE B 1 24 ? -20.786 6.220   -7.402  1.00 0.36 ? 24  PHE B HA   3  
ATOM   5696  H HB2  . PHE B 1 24 ? -21.863 7.562   -5.413  1.00 0.35 ? 24  PHE B HB2  3  
ATOM   5697  H HB3  . PHE B 1 24 ? -20.890 6.508   -4.393  1.00 0.31 ? 24  PHE B HB3  3  
ATOM   5698  H HD1  . PHE B 1 24 ? -20.439 8.478   -7.586  1.00 0.40 ? 24  PHE B HD1  3  
ATOM   5699  H HD2  . PHE B 1 24 ? -18.816 7.379   -3.744  1.00 0.32 ? 24  PHE B HD2  3  
ATOM   5700  H HE1  . PHE B 1 24 ? -18.468 9.921   -8.001  1.00 0.44 ? 24  PHE B HE1  3  
ATOM   5701  H HE2  . PHE B 1 24 ? -16.844 8.832   -4.165  1.00 0.37 ? 24  PHE B HE2  3  
ATOM   5702  H HZ   . PHE B 1 24 ? -16.667 10.100  -6.293  1.00 0.43 ? 24  PHE B HZ   3  
ATOM   5703  N N    . VAL B 1 25 ? -20.572 3.468   -6.364  1.00 0.30 ? 25  VAL B N    3  
ATOM   5704  C CA   . VAL B 1 25 ? -19.737 2.277   -6.030  1.00 0.28 ? 25  VAL B CA   3  
ATOM   5705  C C    . VAL B 1 25 ? -19.982 1.187   -7.076  1.00 0.30 ? 25  VAL B C    3  
ATOM   5706  O O    . VAL B 1 25 ? -20.835 0.337   -6.911  1.00 0.31 ? 25  VAL B O    3  
ATOM   5707  C CB   . VAL B 1 25 ? -20.127 1.743   -4.650  1.00 0.24 ? 25  VAL B CB   3  
ATOM   5708  C CG1  . VAL B 1 25 ? -19.195 0.592   -4.267  1.00 0.22 ? 25  VAL B CG1  3  
ATOM   5709  C CG2  . VAL B 1 25 ? -19.999 2.857   -3.611  1.00 0.23 ? 25  VAL B CG2  3  
ATOM   5710  H H    . VAL B 1 25 ? -21.432 3.347   -6.818  1.00 0.31 ? 25  VAL B H    3  
ATOM   5711  H HA   . VAL B 1 25 ? -18.693 2.549   -6.031  1.00 0.27 ? 25  VAL B HA   3  
ATOM   5712  H HB   . VAL B 1 25 ? -21.147 1.387   -4.677  1.00 0.25 ? 25  VAL B HB   3  
ATOM   5713  H HG11 . VAL B 1 25 ? -18.173 0.941   -4.264  1.00 1.03 ? 25  VAL B HG11 3  
ATOM   5714  H HG12 . VAL B 1 25 ? -19.456 0.233   -3.282  1.00 1.04 ? 25  VAL B HG12 3  
ATOM   5715  H HG13 . VAL B 1 25 ? -19.300 -0.211  -4.981  1.00 1.04 ? 25  VAL B HG13 3  
ATOM   5716  H HG21 . VAL B 1 25 ? -19.035 3.333   -3.707  1.00 1.04 ? 25  VAL B HG21 3  
ATOM   5717  H HG22 . VAL B 1 25 ? -20.780 3.587   -3.766  1.00 1.07 ? 25  VAL B HG22 3  
ATOM   5718  H HG23 . VAL B 1 25 ? -20.095 2.435   -2.622  1.00 1.01 ? 25  VAL B HG23 3  
ATOM   5719  N N    . VAL B 1 26 ? -19.244 1.206   -8.153  1.00 0.33 ? 26  VAL B N    3  
ATOM   5720  C CA   . VAL B 1 26 ? -19.436 0.175   -9.209  1.00 0.36 ? 26  VAL B CA   3  
ATOM   5721  C C    . VAL B 1 26 ? -18.681 -1.095  -8.827  1.00 0.35 ? 26  VAL B C    3  
ATOM   5722  O O    . VAL B 1 26 ? -18.870 -2.141  -9.416  1.00 0.37 ? 26  VAL B O    3  
ATOM   5723  C CB   . VAL B 1 26 ? -18.899 0.708   -10.535 1.00 0.41 ? 26  VAL B CB   3  
ATOM   5724  C CG1  . VAL B 1 26 ? -19.694 1.947   -10.946 1.00 0.78 ? 26  VAL B CG1  3  
ATOM   5725  C CG2  . VAL B 1 26 ? -17.422 1.080   -10.378 1.00 0.61 ? 26  VAL B CG2  3  
ATOM   5726  H H    . VAL B 1 26 ? -18.564 1.900   -8.268  1.00 0.33 ? 26  VAL B H    3  
ATOM   5727  H HA   . VAL B 1 26 ? -20.488 -0.050  -9.308  1.00 0.37 ? 26  VAL B HA   3  
ATOM   5728  H HB   . VAL B 1 26 ? -19.001 -0.051  -11.293 1.00 0.58 ? 26  VAL B HB   3  
ATOM   5729  H HG11 . VAL B 1 26 ? -19.801 2.602   -10.094 1.00 1.32 ? 26  VAL B HG11 3  
ATOM   5730  H HG12 . VAL B 1 26 ? -19.172 2.466   -11.736 1.00 1.36 ? 26  VAL B HG12 3  
ATOM   5731  H HG13 . VAL B 1 26 ? -20.671 1.648   -11.295 1.00 1.31 ? 26  VAL B HG13 3  
ATOM   5732  H HG21 . VAL B 1 26 ? -17.311 1.781   -9.564  1.00 1.18 ? 26  VAL B HG21 3  
ATOM   5733  H HG22 . VAL B 1 26 ? -16.847 0.190   -10.168 1.00 1.34 ? 26  VAL B HG22 3  
ATOM   5734  H HG23 . VAL B 1 26 ? -17.065 1.531   -11.292 1.00 1.17 ? 26  VAL B HG23 3  
ATOM   5735  N N    . ASP B 1 27 ? -17.825 -1.016  -7.848  1.00 0.32 ? 27  ASP B N    3  
ATOM   5736  C CA   . ASP B 1 27 ? -17.063 -2.225  -7.439  1.00 0.31 ? 27  ASP B CA   3  
ATOM   5737  C C    . ASP B 1 27 ? -16.324 -1.937  -6.138  1.00 0.27 ? 27  ASP B C    3  
ATOM   5738  O O    . ASP B 1 27 ? -16.514 -0.908  -5.519  1.00 0.25 ? 27  ASP B O    3  
ATOM   5739  C CB   . ASP B 1 27 ? -16.053 -2.584  -8.532  1.00 0.34 ? 27  ASP B CB   3  
ATOM   5740  C CG   . ASP B 1 27 ? -15.496 -3.985  -8.273  1.00 0.35 ? 27  ASP B CG   3  
ATOM   5741  O OD1  . ASP B 1 27 ? -16.292 -4.895  -8.105  1.00 1.09 ? 27  ASP B OD1  3  
ATOM   5742  O OD2  . ASP B 1 27 ? -14.284 -4.125  -8.248  1.00 1.13 ? 27  ASP B OD2  3  
ATOM   5743  H H    . ASP B 1 27 ? -17.683 -0.161  -7.384  1.00 0.30 ? 27  ASP B H    3  
ATOM   5744  H HA   . ASP B 1 27 ? -17.745 -3.049  -7.292  1.00 0.31 ? 27  ASP B HA   3  
ATOM   5745  H HB2  . ASP B 1 27 ? -16.542 -2.562  -9.495  1.00 0.37 ? 27  ASP B HB2  3  
ATOM   5746  H HB3  . ASP B 1 27 ? -15.242 -1.870  -8.524  1.00 0.34 ? 27  ASP B HB3  3  
ATOM   5747  N N    . TYR B 1 28 ? -15.479 -2.835  -5.714  1.00 0.26 ? 28  TYR B N    3  
ATOM   5748  C CA   . TYR B 1 28 ? -14.728 -2.603  -4.451  1.00 0.23 ? 28  TYR B CA   3  
ATOM   5749  C C    . TYR B 1 28 ? -13.441 -3.420  -4.457  1.00 0.25 ? 28  TYR B C    3  
ATOM   5750  O O    . TYR B 1 28 ? -13.102 -4.071  -5.425  1.00 0.29 ? 28  TYR B O    3  
ATOM   5751  C CB   . TYR B 1 28 ? -15.591 -2.985  -3.243  1.00 0.19 ? 28  TYR B CB   3  
ATOM   5752  C CG   . TYR B 1 28 ? -15.715 -4.492  -3.120  1.00 0.21 ? 28  TYR B CG   3  
ATOM   5753  C CD1  . TYR B 1 28 ? -16.340 -5.239  -4.140  1.00 0.25 ? 28  TYR B CD1  3  
ATOM   5754  C CD2  . TYR B 1 28 ? -15.215 -5.149  -1.977  1.00 0.19 ? 28  TYR B CD2  3  
ATOM   5755  C CE1  . TYR B 1 28 ? -16.464 -6.635  -4.017  1.00 0.27 ? 28  TYR B CE1  3  
ATOM   5756  C CE2  . TYR B 1 28 ? -15.338 -6.544  -1.853  1.00 0.22 ? 28  TYR B CE2  3  
ATOM   5757  C CZ   . TYR B 1 28 ? -15.963 -7.289  -2.873  1.00 0.25 ? 28  TYR B CZ   3  
ATOM   5758  O OH   . TYR B 1 28 ? -16.085 -8.659  -2.751  1.00 0.28 ? 28  TYR B OH   3  
ATOM   5759  H H    . TYR B 1 28 ? -15.336 -3.656  -6.227  1.00 0.28 ? 28  TYR B H    3  
ATOM   5760  H HA   . TYR B 1 28 ? -14.472 -1.556  -4.380  1.00 0.23 ? 28  TYR B HA   3  
ATOM   5761  H HB2  . TYR B 1 28 ? -15.137 -2.588  -2.346  1.00 0.17 ? 28  TYR B HB2  3  
ATOM   5762  H HB3  . TYR B 1 28 ? -16.570 -2.556  -3.360  1.00 0.19 ? 28  TYR B HB3  3  
ATOM   5763  H HD1  . TYR B 1 28 ? -16.724 -4.742  -5.017  1.00 0.27 ? 28  TYR B HD1  3  
ATOM   5764  H HD2  . TYR B 1 28 ? -14.735 -4.581  -1.196  1.00 0.17 ? 28  TYR B HD2  3  
ATOM   5765  H HE1  . TYR B 1 28 ? -16.945 -7.204  -4.799  1.00 0.30 ? 28  TYR B HE1  3  
ATOM   5766  H HE2  . TYR B 1 28 ? -14.955 -7.043  -0.973  1.00 0.23 ? 28  TYR B HE2  3  
ATOM   5767  H HH   . TYR B 1 28 ? -15.502 -8.946  -2.046  1.00 0.98 ? 28  TYR B HH   3  
ATOM   5768  N N    . TYR B 1 29 ? -12.720 -3.370  -3.382  1.00 0.23 ? 29  TYR B N    3  
ATOM   5769  C CA   . TYR B 1 29 ? -11.440 -4.113  -3.299  1.00 0.25 ? 29  TYR B CA   3  
ATOM   5770  C C    . TYR B 1 29 ? -11.057 -4.256  -1.820  1.00 0.22 ? 29  TYR B C    3  
ATOM   5771  O O    . TYR B 1 29 ? -11.143 -3.318  -1.062  1.00 0.23 ? 29  TYR B O    3  
ATOM   5772  C CB   . TYR B 1 29 ? -10.375 -3.316  -4.072  1.00 0.29 ? 29  TYR B CB   3  
ATOM   5773  C CG   . TYR B 1 29 ? -8.982  -3.718  -3.641  1.00 0.31 ? 29  TYR B CG   3  
ATOM   5774  C CD1  . TYR B 1 29 ? -8.569  -5.054  -3.774  1.00 0.36 ? 29  TYR B CD1  3  
ATOM   5775  C CD2  . TYR B 1 29 ? -8.104  -2.755  -3.104  1.00 0.35 ? 29  TYR B CD2  3  
ATOM   5776  C CE1  . TYR B 1 29 ? -7.275  -5.434  -3.369  1.00 0.39 ? 29  TYR B CE1  3  
ATOM   5777  C CE2  . TYR B 1 29 ? -6.809  -3.134  -2.700  1.00 0.38 ? 29  TYR B CE2  3  
ATOM   5778  C CZ   . TYR B 1 29 ? -6.395  -4.474  -2.832  1.00 0.36 ? 29  TYR B CZ   3  
ATOM   5779  O OH   . TYR B 1 29 ? -5.126  -4.846  -2.436  1.00 0.39 ? 29  TYR B OH   3  
ATOM   5780  H H    . TYR B 1 29 ? -13.020 -2.830  -2.625  1.00 0.20 ? 29  TYR B H    3  
ATOM   5781  H HA   . TYR B 1 29 ? -11.557 -5.091  -3.741  1.00 0.28 ? 29  TYR B HA   3  
ATOM   5782  H HB2  . TYR B 1 29 ? -10.487 -3.510  -5.129  1.00 0.32 ? 29  TYR B HB2  3  
ATOM   5783  H HB3  . TYR B 1 29 ? -10.520 -2.261  -3.890  1.00 0.27 ? 29  TYR B HB3  3  
ATOM   5784  H HD1  . TYR B 1 29 ? -9.246  -5.787  -4.188  1.00 0.42 ? 29  TYR B HD1  3  
ATOM   5785  H HD2  . TYR B 1 29 ? -8.423  -1.726  -3.006  1.00 0.40 ? 29  TYR B HD2  3  
ATOM   5786  H HE1  . TYR B 1 29 ? -6.957  -6.461  -3.470  1.00 0.46 ? 29  TYR B HE1  3  
ATOM   5787  H HE2  . TYR B 1 29 ? -6.135  -2.398  -2.288  1.00 0.44 ? 29  TYR B HE2  3  
ATOM   5788  H HH   . TYR B 1 29 ? -5.062  -4.719  -1.487  1.00 0.97 ? 29  TYR B HH   3  
ATOM   5789  N N    . GLU B 1 30 ? -10.638 -5.418  -1.399  1.00 0.22 ? 30  GLU B N    3  
ATOM   5790  C CA   . GLU B 1 30 ? -10.255 -5.592  0.036   1.00 0.20 ? 30  GLU B CA   3  
ATOM   5791  C C    . GLU B 1 30 ? -8.755  -5.324  0.193   1.00 0.21 ? 30  GLU B C    3  
ATOM   5792  O O    . GLU B 1 30 ? -7.991  -5.440  -0.744  1.00 0.24 ? 30  GLU B O    3  
ATOM   5793  C CB   . GLU B 1 30 ? -10.575 -7.021  0.483   1.00 0.22 ? 30  GLU B CB   3  
ATOM   5794  C CG   . GLU B 1 30 ? -12.078 -7.154  0.748   1.00 0.25 ? 30  GLU B CG   3  
ATOM   5795  C CD   . GLU B 1 30 ? -12.389 -8.575  1.221   1.00 0.69 ? 30  GLU B CD   3  
ATOM   5796  O OE1  . GLU B 1 30 ? -11.594 -9.458  0.945   1.00 1.43 ? 30  GLU B OE1  3  
ATOM   5797  O OE2  . GLU B 1 30 ? -13.417 -8.755  1.854   1.00 1.35 ? 30  GLU B OE2  3  
ATOM   5798  H H    . GLU B 1 30 ? -10.573 -6.174  -2.020  1.00 0.25 ? 30  GLU B H    3  
ATOM   5799  H HA   . GLU B 1 30 ? -10.808 -4.892  0.652   1.00 0.18 ? 30  GLU B HA   3  
ATOM   5800  H HB2  . GLU B 1 30 ? -10.287 -7.708  -0.293  1.00 0.26 ? 30  GLU B HB2  3  
ATOM   5801  H HB3  . GLU B 1 30 ? -10.032 -7.250  1.388   1.00 0.25 ? 30  GLU B HB3  3  
ATOM   5802  H HG2  . GLU B 1 30 ? -12.373 -6.446  1.509   1.00 0.59 ? 30  GLU B HG2  3  
ATOM   5803  H HG3  . GLU B 1 30 ? -12.624 -6.952  -0.162  1.00 0.45 ? 30  GLU B HG3  3  
ATOM   5804  N N    . THR B 1 31 ? -8.334  -4.956  1.370   1.00 0.19 ? 31  THR B N    3  
ATOM   5805  C CA   . THR B 1 31 ? -6.889  -4.663  1.599   1.00 0.21 ? 31  THR B CA   3  
ATOM   5806  C C    . THR B 1 31 ? -6.081  -5.960  1.605   1.00 0.25 ? 31  THR B C    3  
ATOM   5807  O O    . THR B 1 31 ? -6.541  -6.999  1.175   1.00 0.27 ? 31  THR B O    3  
ATOM   5808  C CB   . THR B 1 31 ? -6.731  -3.979  2.955   1.00 0.20 ? 31  THR B CB   3  
ATOM   5809  O OG1  . THR B 1 31 ? -7.387  -4.762  3.938   1.00 0.21 ? 31  THR B OG1  3  
ATOM   5810  C CG2  . THR B 1 31 ? -7.347  -2.580  2.900   1.00 0.20 ? 31  THR B CG2  3  
ATOM   5811  H H    . THR B 1 31 ? -8.974  -4.860  2.107   1.00 0.18 ? 31  THR B H    3  
ATOM   5812  H HA   . THR B 1 31 ? -6.523  -4.010  0.822   1.00 0.22 ? 31  THR B HA   3  
ATOM   5813  H HB   . THR B 1 31 ? -5.685  -3.899  3.209   1.00 0.22 ? 31  THR B HB   3  
ATOM   5814  H HG1  . THR B 1 31 ? -8.314  -4.824  3.696   1.00 0.73 ? 31  THR B HG1  3  
ATOM   5815  H HG21 . THR B 1 31 ? -8.290  -2.619  2.377   1.00 1.04 ? 31  THR B HG21 3  
ATOM   5816  H HG22 . THR B 1 31 ? -7.507  -2.217  3.902   1.00 1.04 ? 31  THR B HG22 3  
ATOM   5817  H HG23 . THR B 1 31 ? -6.675  -1.913  2.378   1.00 1.00 ? 31  THR B HG23 3  
ATOM   5818  N N    . SER B 1 32 ? -4.876  -5.898  2.102   1.00 0.27 ? 32  SER B N    3  
ATOM   5819  C CA   . SER B 1 32 ? -4.015  -7.109  2.159   1.00 0.31 ? 32  SER B CA   3  
ATOM   5820  C C    . SER B 1 32 ? -4.302  -7.878  3.446   1.00 0.33 ? 32  SER B C    3  
ATOM   5821  O O    . SER B 1 32 ? -5.422  -7.945  3.913   1.00 0.33 ? 32  SER B O    3  
ATOM   5822  C CB   . SER B 1 32 ? -2.549  -6.682  2.149   1.00 0.33 ? 32  SER B CB   3  
ATOM   5823  O OG   . SER B 1 32 ? -2.318  -5.817  1.045   1.00 1.27 ? 32  SER B OG   3  
ATOM   5824  H H    . SER B 1 32 ? -4.536  -5.045  2.445   1.00 0.26 ? 32  SER B H    3  
ATOM   5825  H HA   . SER B 1 32 ? -4.209  -7.741  1.308   1.00 0.34 ? 32  SER B HA   3  
ATOM   5826  H HB2  . SER B 1 32 ? -2.321  -6.159  3.063   1.00 0.94 ? 32  SER B HB2  3  
ATOM   5827  H HB3  . SER B 1 32 ? -1.920  -7.559  2.072   1.00 0.85 ? 32  SER B HB3  3  
ATOM   5828  H HG   . SER B 1 32 ? -1.632  -6.208  0.499   1.00 1.72 ? 32  SER B HG   3  
ATOM   5829  N N    . SER B 1 33 ? -3.287  -8.453  4.022   1.00 0.36 ? 33  SER B N    3  
ATOM   5830  C CA   . SER B 1 33 ? -3.459  -9.226  5.289   1.00 0.40 ? 33  SER B CA   3  
ATOM   5831  C C    . SER B 1 33 ? -2.224  -9.016  6.156   1.00 0.40 ? 33  SER B C    3  
ATOM   5832  O O    . SER B 1 33 ? -2.301  -8.933  7.366   1.00 0.42 ? 33  SER B O    3  
ATOM   5833  C CB   . SER B 1 33 ? -3.588  -10.708 4.957   1.00 0.46 ? 33  SER B CB   3  
ATOM   5834  O OG   . SER B 1 33 ? -2.293  -11.256 4.747   1.00 0.48 ? 33  SER B OG   3  
ATOM   5835  H H    . SER B 1 33 ? -2.398  -8.376  3.617   1.00 0.37 ? 33  SER B H    3  
ATOM   5836  H HA   . SER B 1 33 ? -4.340  -8.889  5.817   1.00 0.39 ? 33  SER B HA   3  
ATOM   5837  H HB2  . SER B 1 33 ? -4.069  -11.225 5.769   1.00 0.48 ? 33  SER B HB2  3  
ATOM   5838  H HB3  . SER B 1 33 ? -4.179  -10.816 4.061   1.00 0.46 ? 33  SER B HB3  3  
ATOM   5839  H HG   . SER B 1 33 ? -2.399  -12.162 4.449   1.00 1.00 ? 33  SER B HG   3  
ATOM   5840  N N    . LEU B 1 34 ? -1.083  -8.935  5.528   1.00 0.39 ? 34  LEU B N    3  
ATOM   5841  C CA   . LEU B 1 34 ? 0.199   -8.730  6.266   1.00 0.39 ? 34  LEU B CA   3  
ATOM   5842  C C    . LEU B 1 34 ? -0.002  -7.737  7.412   1.00 0.37 ? 34  LEU B C    3  
ATOM   5843  O O    . LEU B 1 34 ? 0.251   -8.035  8.562   1.00 0.40 ? 34  LEU B O    3  
ATOM   5844  C CB   . LEU B 1 34 ? 1.255   -8.175  5.305   1.00 0.36 ? 34  LEU B CB   3  
ATOM   5845  C CG   . LEU B 1 34 ? 1.166   -8.886  3.953   1.00 0.39 ? 34  LEU B CG   3  
ATOM   5846  C CD1  . LEU B 1 34 ? 2.338   -8.452  3.070   1.00 0.40 ? 34  LEU B CD1  3  
ATOM   5847  C CD2  . LEU B 1 34 ? 1.214   -10.404 4.165   1.00 0.45 ? 34  LEU B CD2  3  
ATOM   5848  H H    . LEU B 1 34 ? -1.070  -9.014  4.554   1.00 0.39 ? 34  LEU B H    3  
ATOM   5849  H HA   . LEU B 1 34 ? 0.536   -9.672  6.662   1.00 0.43 ? 34  LEU B HA   3  
ATOM   5850  H HB2  . LEU B 1 34 ? 1.093   -7.116  5.160   1.00 0.34 ? 34  LEU B HB2  3  
ATOM   5851  H HB3  . LEU B 1 34 ? 2.234   -8.332  5.725   1.00 0.37 ? 34  LEU B HB3  3  
ATOM   5852  H HG   . LEU B 1 34 ? 0.241   -8.619  3.468   1.00 0.39 ? 34  LEU B HG   3  
ATOM   5853  H HD11 . LEU B 1 34 ? 2.499   -7.389  3.178   1.00 1.04 ? 34  LEU B HD11 3  
ATOM   5854  H HD12 . LEU B 1 34 ? 3.230   -8.983  3.366   1.00 1.09 ? 34  LEU B HD12 3  
ATOM   5855  H HD13 . LEU B 1 34 ? 2.112   -8.676  2.039   1.00 1.12 ? 34  LEU B HD13 3  
ATOM   5856  H HD21 . LEU B 1 34 ? 1.999   -10.644 4.867   1.00 1.14 ? 34  LEU B HD21 3  
ATOM   5857  H HD22 . LEU B 1 34 ? 0.266   -10.743 4.556   1.00 1.13 ? 34  LEU B HD22 3  
ATOM   5858  H HD23 . LEU B 1 34 ? 1.411   -10.892 3.223   1.00 1.05 ? 34  LEU B HD23 3  
ATOM   5859  N N    . CYS B 1 35 ? -0.453  -6.556  7.100   1.00 0.33 ? 35  CYS B N    3  
ATOM   5860  C CA   . CYS B 1 35 ? -0.667  -5.541  8.165   1.00 0.34 ? 35  CYS B CA   3  
ATOM   5861  C C    . CYS B 1 35 ? -1.864  -5.958  9.027   1.00 0.39 ? 35  CYS B C    3  
ATOM   5862  O O    . CYS B 1 35 ? -2.915  -6.296  8.527   1.00 0.39 ? 35  CYS B O    3  
ATOM   5863  C CB   . CYS B 1 35 ? -0.925  -4.171  7.525   1.00 0.32 ? 35  CYS B CB   3  
ATOM   5864  S SG   . CYS B 1 35 ? -1.971  -4.363  6.062   1.00 0.40 ? 35  CYS B SG   3  
ATOM   5865  H H    . CYS B 1 35 ? -0.649  -6.339  6.164   1.00 0.31 ? 35  CYS B H    3  
ATOM   5866  H HA   . CYS B 1 35 ? 0.218   -5.486  8.783   1.00 0.36 ? 35  CYS B HA   3  
ATOM   5867  H HB2  . CYS B 1 35 ? -1.420  -3.528  8.236   1.00 0.45 ? 35  CYS B HB2  3  
ATOM   5868  H HB3  . CYS B 1 35 ? 0.016   -3.728  7.237   1.00 0.35 ? 35  CYS B HB3  3  
ATOM   5869  N N    . SER B 1 36 ? -1.697  -5.961  10.320  1.00 0.44 ? 36  SER B N    3  
ATOM   5870  C CA   . SER B 1 36 ? -2.808  -6.373  11.229  1.00 0.51 ? 36  SER B CA   3  
ATOM   5871  C C    . SER B 1 36 ? -3.978  -5.376  11.174  1.00 0.51 ? 36  SER B C    3  
ATOM   5872  O O    . SER B 1 36 ? -4.661  -5.180  12.159  1.00 0.58 ? 36  SER B O    3  
ATOM   5873  C CB   . SER B 1 36 ? -2.281  -6.447  12.662  1.00 0.59 ? 36  SER B CB   3  
ATOM   5874  O OG   . SER B 1 36 ? -1.675  -5.208  13.005  1.00 1.41 ? 36  SER B OG   3  
ATOM   5875  H H    . SER B 1 36 ? -0.830  -5.704  10.697  1.00 0.45 ? 36  SER B H    3  
ATOM   5876  H HA   . SER B 1 36 ? -3.162  -7.348  10.935  1.00 0.53 ? 36  SER B HA   3  
ATOM   5877  H HB2  . SER B 1 36 ? -3.096  -6.643  13.337  1.00 1.10 ? 36  SER B HB2  3  
ATOM   5878  H HB3  . SER B 1 36 ? -1.555  -7.247  12.735  1.00 1.26 ? 36  SER B HB3  3  
ATOM   5879  H HG   . SER B 1 36 ? -1.258  -4.852  12.216  1.00 1.84 ? 36  SER B HG   3  
ATOM   5880  N N    . GLN B 1 37 ? -4.230  -4.739  10.056  1.00 0.45 ? 37  GLN B N    3  
ATOM   5881  C CA   . GLN B 1 37 ? -5.372  -3.770  10.012  1.00 0.47 ? 37  GLN B CA   3  
ATOM   5882  C C    . GLN B 1 37 ? -5.916  -3.621  8.583   1.00 0.36 ? 37  GLN B C    3  
ATOM   5883  O O    . GLN B 1 37 ? -5.815  -2.559  8.003   1.00 0.35 ? 37  GLN B O    3  
ATOM   5884  C CB   . GLN B 1 37 ? -4.890  -2.405  10.513  1.00 0.55 ? 37  GLN B CB   3  
ATOM   5885  C CG   . GLN B 1 37 ? -3.546  -2.064  9.863   1.00 0.78 ? 37  GLN B CG   3  
ATOM   5886  C CD   . GLN B 1 37 ? -3.108  -0.664  10.298  1.00 0.79 ? 37  GLN B CD   3  
ATOM   5887  O OE1  . GLN B 1 37 ? -1.949  -0.439  10.583  1.00 1.24 ? 37  GLN B OE1  3  
ATOM   5888  N NE2  . GLN B 1 37 ? -3.994  0.292   10.362  1.00 1.48 ? 37  GLN B NE2  3  
ATOM   5889  H H    . GLN B 1 37 ? -3.683  -4.893  9.260   1.00 0.41 ? 37  GLN B H    3  
ATOM   5890  H HA   . GLN B 1 37 ? -6.169  -4.118  10.656  1.00 0.54 ? 37  GLN B HA   3  
ATOM   5891  H HB2  . GLN B 1 37 ? -5.617  -1.648  10.256  1.00 0.86 ? 37  GLN B HB2  3  
ATOM   5892  H HB3  . GLN B 1 37 ? -4.769  -2.438  11.586  1.00 1.06 ? 37  GLN B HB3  3  
ATOM   5893  H HG2  . GLN B 1 37 ? -2.804  -2.786  10.173  1.00 1.28 ? 37  GLN B HG2  3  
ATOM   5894  H HG3  . GLN B 1 37 ? -3.648  -2.090  8.790   1.00 1.14 ? 37  GLN B HG3  3  
ATOM   5895  H HE21 . GLN B 1 37 ? -4.929  0.111   10.131  1.00 2.20 ? 37  GLN B HE21 3  
ATOM   5896  H HE22 . GLN B 1 37 ? -3.723  1.192   10.638  1.00 1.54 ? 37  GLN B HE22 3  
ATOM   5897  N N    . PRO B 1 38 ? -6.499  -4.676  8.055   1.00 0.34 ? 38  PRO B N    3  
ATOM   5898  C CA   . PRO B 1 38 ? -7.080  -4.639  6.699   1.00 0.26 ? 38  PRO B CA   3  
ATOM   5899  C C    . PRO B 1 38 ? -8.344  -3.762  6.713   1.00 0.25 ? 38  PRO B C    3  
ATOM   5900  O O    . PRO B 1 38 ? -8.755  -3.260  7.741   1.00 0.27 ? 38  PRO B O    3  
ATOM   5901  C CB   . PRO B 1 38 ? -7.431  -6.112  6.383   1.00 0.33 ? 38  PRO B CB   3  
ATOM   5902  C CG   . PRO B 1 38 ? -7.255  -6.923  7.701   1.00 0.43 ? 38  PRO B CG   3  
ATOM   5903  C CD   . PRO B 1 38 ? -6.621  -5.979  8.746   1.00 0.43 ? 38  PRO B CD   3  
ATOM   5904  H HA   . PRO B 1 38 ? -6.363  -4.257  5.981   1.00 0.23 ? 38  PRO B HA   3  
ATOM   5905  H HB2  . PRO B 1 38 ? -8.453  -6.191  6.027   1.00 0.32 ? 38  PRO B HB2  3  
ATOM   5906  H HB3  . PRO B 1 38 ? -6.756  -6.496  5.630   1.00 0.34 ? 38  PRO B HB3  3  
ATOM   5907  H HG2  . PRO B 1 38 ? -8.221  -7.270  8.049   1.00 0.50 ? 38  PRO B HG2  3  
ATOM   5908  H HG3  . PRO B 1 38 ? -6.605  -7.771  7.531   1.00 0.48 ? 38  PRO B HG3  3  
ATOM   5909  H HD2  . PRO B 1 38 ? -7.262  -5.888  9.614   1.00 0.50 ? 38  PRO B HD2  3  
ATOM   5910  H HD3  . PRO B 1 38 ? -5.645  -6.336  9.037   1.00 0.45 ? 38  PRO B HD3  3  
ATOM   5911  N N    . ALA B 1 39 ? -8.959  -3.590  5.581   1.00 0.23 ? 39  ALA B N    3  
ATOM   5912  C CA   . ALA B 1 39 ? -10.194 -2.770  5.502   1.00 0.22 ? 39  ALA B CA   3  
ATOM   5913  C C    . ALA B 1 39 ? -10.832 -3.003  4.136   1.00 0.19 ? 39  ALA B C    3  
ATOM   5914  O O    . ALA B 1 39 ? -10.234 -3.605  3.266   1.00 0.22 ? 39  ALA B O    3  
ATOM   5915  C CB   . ALA B 1 39 ? -9.840  -1.288  5.652   1.00 0.23 ? 39  ALA B CB   3  
ATOM   5916  H H    . ALA B 1 39 ? -8.613  -4.011  4.775   1.00 0.23 ? 39  ALA B H    3  
ATOM   5917  H HA   . ALA B 1 39 ? -10.878 -3.064  6.281   1.00 0.24 ? 39  ALA B HA   3  
ATOM   5918  H HB1  . ALA B 1 39 ? -9.188  -1.158  6.503   1.00 1.03 ? 39  ALA B HB1  3  
ATOM   5919  H HB2  . ALA B 1 39 ? -9.340  -0.945  4.758   1.00 1.03 ? 39  ALA B HB2  3  
ATOM   5920  H HB3  . ALA B 1 39 ? -10.745 -0.717  5.800   1.00 0.99 ? 39  ALA B HB3  3  
ATOM   5921  N N    . VAL B 1 40 ? -12.027 -2.520  3.924   1.00 0.15 ? 40  VAL B N    3  
ATOM   5922  C CA   . VAL B 1 40 ? -12.680 -2.704  2.593   1.00 0.13 ? 40  VAL B CA   3  
ATOM   5923  C C    . VAL B 1 40 ? -12.481 -1.417  1.796   1.00 0.13 ? 40  VAL B C    3  
ATOM   5924  O O    . VAL B 1 40 ? -12.564 -0.327  2.325   1.00 0.18 ? 40  VAL B O    3  
ATOM   5925  C CB   . VAL B 1 40 ? -14.178 -2.987  2.779   1.00 0.12 ? 40  VAL B CB   3  
ATOM   5926  C CG1  . VAL B 1 40 ? -14.921 -2.770  1.456   1.00 0.12 ? 40  VAL B CG1  3  
ATOM   5927  C CG2  . VAL B 1 40 ? -14.359 -4.440  3.218   1.00 0.16 ? 40  VAL B CG2  3  
ATOM   5928  H H    . VAL B 1 40 ? -12.487 -2.022  4.632   1.00 0.14 ? 40  VAL B H    3  
ATOM   5929  H HA   . VAL B 1 40 ? -12.219 -3.532  2.058   1.00 0.16 ? 40  VAL B HA   3  
ATOM   5930  H HB   . VAL B 1 40 ? -14.581 -2.327  3.534   1.00 0.11 ? 40  VAL B HB   3  
ATOM   5931  H HG11 . VAL B 1 40 ? -14.353 -3.211  0.651   1.00 1.04 ? 40  VAL B HG11 3  
ATOM   5932  H HG12 . VAL B 1 40 ? -15.896 -3.234  1.506   1.00 1.02 ? 40  VAL B HG12 3  
ATOM   5933  H HG13 . VAL B 1 40 ? -15.035 -1.711  1.278   1.00 1.00 ? 40  VAL B HG13 3  
ATOM   5934  H HG21 . VAL B 1 40 ? -13.693 -4.653  4.040   1.00 0.99 ? 40  VAL B HG21 3  
ATOM   5935  H HG22 . VAL B 1 40 ? -15.380 -4.597  3.528   1.00 1.06 ? 40  VAL B HG22 3  
ATOM   5936  H HG23 . VAL B 1 40 ? -14.130 -5.095  2.388   1.00 1.01 ? 40  VAL B HG23 3  
ATOM   5937  N N    . VAL B 1 41 ? -12.202 -1.548  0.529   1.00 0.15 ? 41  VAL B N    3  
ATOM   5938  C CA   . VAL B 1 41 ? -11.969 -0.348  -0.337  1.00 0.16 ? 41  VAL B CA   3  
ATOM   5939  C C    . VAL B 1 41 ? -13.055 -0.279  -1.413  1.00 0.16 ? 41  VAL B C    3  
ATOM   5940  O O    . VAL B 1 41 ? -13.160 -1.144  -2.254  1.00 0.18 ? 41  VAL B O    3  
ATOM   5941  C CB   . VAL B 1 41 ? -10.593 -0.483  -0.992  1.00 0.21 ? 41  VAL B CB   3  
ATOM   5942  C CG1  . VAL B 1 41 ? -10.136 0.868   -1.531  1.00 0.25 ? 41  VAL B CG1  3  
ATOM   5943  C CG2  . VAL B 1 41 ? -9.585  -0.972  0.051   1.00 0.23 ? 41  VAL B CG2  3  
ATOM   5944  H H    . VAL B 1 41 ? -12.136 -2.445  0.145   1.00 0.20 ? 41  VAL B H    3  
ATOM   5945  H HA   . VAL B 1 41 ? -11.995 0.551   0.258   1.00 0.15 ? 41  VAL B HA   3  
ATOM   5946  H HB   . VAL B 1 41 ? -10.645 -1.190  -1.806  1.00 0.22 ? 41  VAL B HB   3  
ATOM   5947  H HG11 . VAL B 1 41 ? -10.144 1.597   -0.734  1.00 0.99 ? 41  VAL B HG11 3  
ATOM   5948  H HG12 . VAL B 1 41 ? -9.135  0.768   -1.921  1.00 1.08 ? 41  VAL B HG12 3  
ATOM   5949  H HG13 . VAL B 1 41 ? -10.801 1.187   -2.320  1.00 1.04 ? 41  VAL B HG13 3  
ATOM   5950  H HG21 . VAL B 1 41 ? -9.615  -0.320  0.912   1.00 1.06 ? 41  VAL B HG21 3  
ATOM   5951  H HG22 . VAL B 1 41 ? -9.838  -1.977  0.354   1.00 1.03 ? 41  VAL B HG22 3  
ATOM   5952  H HG23 . VAL B 1 41 ? -8.593  -0.961  -0.373  1.00 1.04 ? 41  VAL B HG23 3  
ATOM   5953  N N    . PHE B 1 42 ? -13.869 0.741   -1.393  1.00 0.15 ? 42  PHE B N    3  
ATOM   5954  C CA   . PHE B 1 42 ? -14.951 0.848   -2.416  1.00 0.17 ? 42  PHE B CA   3  
ATOM   5955  C C    . PHE B 1 42 ? -14.429 1.580   -3.653  1.00 0.21 ? 42  PHE B C    3  
ATOM   5956  O O    . PHE B 1 42 ? -13.783 2.605   -3.557  1.00 0.23 ? 42  PHE B O    3  
ATOM   5957  C CB   . PHE B 1 42 ? -16.132 1.637   -1.839  1.00 0.16 ? 42  PHE B CB   3  
ATOM   5958  C CG   . PHE B 1 42 ? -16.902 0.779   -0.858  1.00 0.14 ? 42  PHE B CG   3  
ATOM   5959  C CD1  . PHE B 1 42 ? -17.563 -0.383  -1.304  1.00 0.14 ? 42  PHE B CD1  3  
ATOM   5960  C CD2  . PHE B 1 42 ? -16.967 1.147   0.501   1.00 0.13 ? 42  PHE B CD2  3  
ATOM   5961  C CE1  . PHE B 1 42 ? -18.286 -1.175  -0.392  1.00 0.14 ? 42  PHE B CE1  3  
ATOM   5962  C CE2  . PHE B 1 42 ? -17.692 0.355   1.411   1.00 0.14 ? 42  PHE B CE2  3  
ATOM   5963  C CZ   . PHE B 1 42 ? -18.351 -0.807  0.965   1.00 0.14 ? 42  PHE B CZ   3  
ATOM   5964  H H    . PHE B 1 42 ? -13.775 1.432   -0.704  1.00 0.15 ? 42  PHE B H    3  
ATOM   5965  H HA   . PHE B 1 42 ? -15.285 -0.139  -2.699  1.00 0.17 ? 42  PHE B HA   3  
ATOM   5966  H HB2  . PHE B 1 42 ? -15.761 2.518   -1.337  1.00 0.16 ? 42  PHE B HB2  3  
ATOM   5967  H HB3  . PHE B 1 42 ? -16.791 1.936   -2.641  1.00 0.18 ? 42  PHE B HB3  3  
ATOM   5968  H HD1  . PHE B 1 42 ? -17.516 -0.666  -2.344  1.00 0.16 ? 42  PHE B HD1  3  
ATOM   5969  H HD2  . PHE B 1 42 ? -16.461 2.037   0.845   1.00 0.14 ? 42  PHE B HD2  3  
ATOM   5970  H HE1  . PHE B 1 42 ? -18.792 -2.066  -0.734  1.00 0.16 ? 42  PHE B HE1  3  
ATOM   5971  H HE2  . PHE B 1 42 ? -17.742 0.639   2.451   1.00 0.16 ? 42  PHE B HE2  3  
ATOM   5972  H HZ   . PHE B 1 42 ? -18.907 -1.414  1.662   1.00 0.16 ? 42  PHE B HZ   3  
ATOM   5973  N N    . GLN B 1 43 ? -14.727 1.069   -4.819  1.00 0.24 ? 43  GLN B N    3  
ATOM   5974  C CA   . GLN B 1 43 ? -14.280 1.735   -6.078  1.00 0.28 ? 43  GLN B CA   3  
ATOM   5975  C C    . GLN B 1 43 ? -15.443 2.591   -6.582  1.00 0.30 ? 43  GLN B C    3  
ATOM   5976  O O    . GLN B 1 43 ? -16.532 2.088   -6.789  1.00 0.30 ? 43  GLN B O    3  
ATOM   5977  C CB   . GLN B 1 43 ? -13.915 0.664   -7.107  1.00 0.32 ? 43  GLN B CB   3  
ATOM   5978  C CG   . GLN B 1 43 ? -12.689 -0.115  -6.621  1.00 0.32 ? 43  GLN B CG   3  
ATOM   5979  C CD   . GLN B 1 43 ? -12.499 -1.360  -7.488  1.00 0.58 ? 43  GLN B CD   3  
ATOM   5980  O OE1  . GLN B 1 43 ? -12.338 -2.450  -6.978  1.00 1.29 ? 43  GLN B OE1  3  
ATOM   5981  N NE2  . GLN B 1 43 ? -12.510 -1.242  -8.788  1.00 1.31 ? 43  GLN B NE2  3  
ATOM   5982  H H    . GLN B 1 43 ? -15.266 0.252   -4.868  1.00 0.23 ? 43  GLN B H    3  
ATOM   5983  H HA   . GLN B 1 43 ? -13.427 2.359   -5.877  1.00 0.29 ? 43  GLN B HA   3  
ATOM   5984  H HB2  . GLN B 1 43 ? -14.746 -0.012  -7.229  1.00 0.32 ? 43  GLN B HB2  3  
ATOM   5985  H HB3  . GLN B 1 43 ? -13.688 1.128   -8.050  1.00 0.36 ? 43  GLN B HB3  3  
ATOM   5986  H HG2  . GLN B 1 43 ? -11.813 0.514   -6.694  1.00 0.36 ? 43  GLN B HG2  3  
ATOM   5987  H HG3  . GLN B 1 43 ? -12.834 -0.410  -5.594  1.00 0.40 ? 43  GLN B HG3  3  
ATOM   5988  H HE21 . GLN B 1 43 ? -12.639 -0.362  -9.199  1.00 2.01 ? 43  GLN B HE21 3  
ATOM   5989  H HE22 . GLN B 1 43 ? -12.389 -2.035  -9.352  1.00 1.45 ? 43  GLN B HE22 3  
ATOM   5990  N N    . THR B 1 44 ? -15.250 3.889   -6.732  1.00 0.32 ? 44  THR B N    3  
ATOM   5991  C CA   . THR B 1 44 ? -16.400 4.766   -7.162  1.00 0.34 ? 44  THR B CA   3  
ATOM   5992  C C    . THR B 1 44 ? -16.359 5.088   -8.656  1.00 0.39 ? 44  THR B C    3  
ATOM   5993  O O    . THR B 1 44 ? -15.800 4.361   -9.454  1.00 0.41 ? 44  THR B O    3  
ATOM   5994  C CB   . THR B 1 44 ? -16.350 6.075   -6.377  1.00 0.34 ? 44  THR B CB   3  
ATOM   5995  O OG1  . THR B 1 44 ? -15.419 6.952   -6.990  1.00 0.38 ? 44  THR B OG1  3  
ATOM   5996  C CG2  . THR B 1 44 ? -15.911 5.779   -4.944  1.00 0.29 ? 44  THR B CG2  3  
ATOM   5997  H H    . THR B 1 44 ? -14.366 4.291   -6.528  1.00 0.32 ? 44  THR B H    3  
ATOM   5998  H HA   . THR B 1 44 ? -17.336 4.270   -6.940  1.00 0.33 ? 44  THR B HA   3  
ATOM   5999  H HB   . THR B 1 44 ? -17.329 6.532   -6.364  1.00 0.35 ? 44  THR B HB   3  
ATOM   6000  H HG1  . THR B 1 44 ? -15.910 7.668   -7.398  1.00 0.77 ? 44  THR B HG1  3  
ATOM   6001  H HG21 . THR B 1 44 ? -16.527 4.991   -4.537  1.00 1.03 ? 44  THR B HG21 3  
ATOM   6002  H HG22 . THR B 1 44 ? -14.879 5.463   -4.946  1.00 1.00 ? 44  THR B HG22 3  
ATOM   6003  H HG23 . THR B 1 44 ? -16.016 6.667   -4.342  1.00 1.07 ? 44  THR B HG23 3  
ATOM   6004  N N    . LYS B 1 45 ? -16.985 6.184   -9.029  1.00 0.43 ? 45  LYS B N    3  
ATOM   6005  C CA   . LYS B 1 45 ? -17.045 6.600   -10.466 1.00 0.48 ? 45  LYS B CA   3  
ATOM   6006  C C    . LYS B 1 45 ? -16.308 7.932   -10.667 1.00 0.51 ? 45  LYS B C    3  
ATOM   6007  O O    . LYS B 1 45 ? -15.861 8.235   -11.755 1.00 0.56 ? 45  LYS B O    3  
ATOM   6008  C CB   . LYS B 1 45 ? -18.515 6.789   -10.866 1.00 0.50 ? 45  LYS B CB   3  
ATOM   6009  C CG   . LYS B 1 45 ? -19.359 5.626   -10.341 1.00 0.46 ? 45  LYS B CG   3  
ATOM   6010  C CD   . LYS B 1 45 ? -20.820 5.844   -10.746 1.00 0.49 ? 45  LYS B CD   3  
ATOM   6011  C CE   . LYS B 1 45 ? -21.648 4.604   -10.398 1.00 0.54 ? 45  LYS B CE   3  
ATOM   6012  N NZ   . LYS B 1 45 ? -23.093 4.966   -10.368 1.00 1.55 ? 45  LYS B NZ   3  
ATOM   6013  H H    . LYS B 1 45 ? -17.437 6.729   -8.353  1.00 0.44 ? 45  LYS B H    3  
ATOM   6014  H HA   . LYS B 1 45 ? -16.598 5.842   -11.094 1.00 0.49 ? 45  LYS B HA   3  
ATOM   6015  H HB2  . LYS B 1 45 ? -18.885 7.715   -10.449 1.00 0.51 ? 45  LYS B HB2  3  
ATOM   6016  H HB3  . LYS B 1 45 ? -18.592 6.826   -11.940 1.00 0.57 ? 45  LYS B HB3  3  
ATOM   6017  H HG2  . LYS B 1 45 ? -19.000 4.700   -10.762 1.00 0.50 ? 45  LYS B HG2  3  
ATOM   6018  H HG3  . LYS B 1 45 ? -19.292 5.586   -9.264  1.00 0.42 ? 45  LYS B HG3  3  
ATOM   6019  H HD2  . LYS B 1 45 ? -21.215 6.699   -10.219 1.00 0.51 ? 45  LYS B HD2  3  
ATOM   6020  H HD3  . LYS B 1 45 ? -20.874 6.021   -11.810 1.00 0.63 ? 45  LYS B HD3  3  
ATOM   6021  H HE2  . LYS B 1 45 ? -21.485 3.841   -11.144 1.00 0.95 ? 45  LYS B HE2  3  
ATOM   6022  H HE3  . LYS B 1 45 ? -21.352 4.230   -9.428  1.00 1.20 ? 45  LYS B HE3  3  
ATOM   6023  H HZ1  . LYS B 1 45 ? -23.226 5.901   -10.800 1.00 2.16 ? 45  LYS B HZ1  3  
ATOM   6024  H HZ2  . LYS B 1 45 ? -23.639 4.259   -10.900 1.00 2.09 ? 45  LYS B HZ2  3  
ATOM   6025  H HZ3  . LYS B 1 45 ? -23.424 4.988   -9.381  1.00 2.04 ? 45  LYS B HZ3  3  
ATOM   6026  N N    . ARG B 1 46 ? -16.190 8.734   -9.631  1.00 0.50 ? 46  ARG B N    3  
ATOM   6027  C CA   . ARG B 1 46 ? -15.492 10.061  -9.759  1.00 0.54 ? 46  ARG B CA   3  
ATOM   6028  C C    . ARG B 1 46 ? -14.289 10.076  -8.818  1.00 0.49 ? 46  ARG B C    3  
ATOM   6029  O O    . ARG B 1 46 ? -13.966 11.068  -8.201  1.00 0.48 ? 46  ARG B O    3  
ATOM   6030  C CB   . ARG B 1 46 ? -16.478 11.191  -9.392  1.00 0.59 ? 46  ARG B CB   3  
ATOM   6031  C CG   . ARG B 1 46 ? -16.009 12.564  -9.952  1.00 0.72 ? 46  ARG B CG   3  
ATOM   6032  C CD   . ARG B 1 46 ? -15.102 13.320  -8.950  1.00 0.92 ? 46  ARG B CD   3  
ATOM   6033  N NE   . ARG B 1 46 ? -15.446 14.779  -8.971  1.00 1.48 ? 46  ARG B NE   3  
ATOM   6034  C CZ   . ARG B 1 46 ? -15.572 15.433  -10.095 1.00 2.13 ? 46  ARG B CZ   3  
ATOM   6035  N NH1  . ARG B 1 46 ? -15.241 14.875  -11.228 1.00 2.62 ? 46  ARG B NH1  3  
ATOM   6036  N NH2  . ARG B 1 46 ? -15.984 16.671  -10.081 1.00 2.82 ? 46  ARG B NH2  3  
ATOM   6037  H H    . ARG B 1 46 ? -16.566 8.467   -8.766  1.00 0.48 ? 46  ARG B H    3  
ATOM   6038  H HA   . ARG B 1 46 ? -15.145 10.195  -10.773 1.00 0.59 ? 46  ARG B HA   3  
ATOM   6039  H HB2  . ARG B 1 46 ? -17.443 10.952  -9.817  1.00 0.68 ? 46  ARG B HB2  3  
ATOM   6040  H HB3  . ARG B 1 46 ? -16.574 11.244  -8.322  1.00 0.53 ? 46  ARG B HB3  3  
ATOM   6041  H HG2  . ARG B 1 46 ? -15.474 12.411  -10.875 1.00 0.90 ? 46  ARG B HG2  3  
ATOM   6042  H HG3  . ARG B 1 46 ? -16.881 13.172  -10.156 1.00 1.21 ? 46  ARG B HG3  3  
ATOM   6043  H HD2  . ARG B 1 46 ? -15.263 12.966  -7.949  1.00 1.48 ? 46  ARG B HD2  3  
ATOM   6044  H HD3  . ARG B 1 46 ? -14.061 13.170  -9.217  1.00 1.01 ? 46  ARG B HD3  3  
ATOM   6045  H HE   . ARG B 1 46 ? -15.623 15.240  -8.125  1.00 1.94 ? 46  ARG B HE   3  
ATOM   6046  H HH11 . ARG B 1 46 ? -14.884 13.946  -11.242 1.00 2.46 ? 46  ARG B HH11 3  
ATOM   6047  H HH12 . ARG B 1 46 ? -15.347 15.382  -12.083 1.00 3.45 ? 46  ARG B HH12 3  
ATOM   6048  H HH21 . ARG B 1 46 ? -16.202 17.114  -9.212  1.00 2.97 ? 46  ARG B HH21 3  
ATOM   6049  H HH22 . ARG B 1 46 ? -16.082 17.175  -10.938 1.00 3.45 ? 46  ARG B HH22 3  
ATOM   6050  N N    . SER B 1 47 ? -13.612 8.970   -8.723  1.00 0.46 ? 47  SER B N    3  
ATOM   6051  C CA   . SER B 1 47 ? -12.420 8.882   -7.855  1.00 0.42 ? 47  SER B CA   3  
ATOM   6052  C C    . SER B 1 47 ? -11.662 7.627   -8.266  1.00 0.42 ? 47  SER B C    3  
ATOM   6053  O O    . SER B 1 47 ? -11.323 7.446   -9.419  1.00 0.46 ? 47  SER B O    3  
ATOM   6054  C CB   . SER B 1 47 ? -12.838 8.799   -6.381  1.00 0.38 ? 47  SER B CB   3  
ATOM   6055  O OG   . SER B 1 47 ? -13.356 7.507   -6.103  1.00 1.07 ? 47  SER B OG   3  
ATOM   6056  H H    . SER B 1 47 ? -13.886 8.185   -9.237  1.00 0.47 ? 47  SER B H    3  
ATOM   6057  H HA   . SER B 1 47 ? -11.796 9.743   -8.008  1.00 0.44 ? 47  SER B HA   3  
ATOM   6058  H HB2  . SER B 1 47 ? -11.984 8.977   -5.748  1.00 0.76 ? 47  SER B HB2  3  
ATOM   6059  H HB3  . SER B 1 47 ? -13.591 9.551   -6.177  1.00 0.86 ? 47  SER B HB3  3  
ATOM   6060  H HG   . SER B 1 47 ? -13.413 7.408   -5.150  1.00 1.44 ? 47  SER B HG   3  
ATOM   6061  N N    . LYS B 1 48 ? -11.422 6.750   -7.354  1.00 0.38 ? 48  LYS B N    3  
ATOM   6062  C CA   . LYS B 1 48 ? -10.722 5.490   -7.701  1.00 0.40 ? 48  LYS B CA   3  
ATOM   6063  C C    . LYS B 1 48 ? -10.963 4.488   -6.581  1.00 0.35 ? 48  LYS B C    3  
ATOM   6064  O O    . LYS B 1 48 ? -11.733 3.564   -6.724  1.00 0.34 ? 48  LYS B O    3  
ATOM   6065  C CB   . LYS B 1 48 ? -9.208  5.727   -7.915  1.00 0.44 ? 48  LYS B CB   3  
ATOM   6066  C CG   . LYS B 1 48 ? -8.728  6.974   -7.163  1.00 1.11 ? 48  LYS B CG   3  
ATOM   6067  C CD   . LYS B 1 48 ? -7.195  7.049   -7.268  1.00 1.38 ? 48  LYS B CD   3  
ATOM   6068  C CE   . LYS B 1 48 ? -6.683  8.430   -6.833  1.00 2.13 ? 48  LYS B CE   3  
ATOM   6069  N NZ   . LYS B 1 48 ? -5.358  8.681   -7.468  1.00 2.73 ? 48  LYS B NZ   3  
ATOM   6070  H H    . LYS B 1 48 ? -11.739 6.899   -6.444  1.00 0.36 ? 48  LYS B H    3  
ATOM   6071  H HA   . LYS B 1 48 ? -11.153 5.094   -8.610  1.00 0.43 ? 48  LYS B HA   3  
ATOM   6072  H HB2  . LYS B 1 48 ? -8.650  4.869   -7.566  1.00 0.92 ? 48  LYS B HB2  3  
ATOM   6073  H HB3  . LYS B 1 48 ? -9.015  5.862   -8.970  1.00 0.85 ? 48  LYS B HB3  3  
ATOM   6074  H HG2  . LYS B 1 48 ? -9.169  7.852   -7.608  1.00 1.64 ? 48  LYS B HG2  3  
ATOM   6075  H HG3  . LYS B 1 48 ? -9.015  6.909   -6.125  1.00 1.69 ? 48  LYS B HG3  3  
ATOM   6076  H HD2  . LYS B 1 48 ? -6.759  6.291   -6.634  1.00 1.70 ? 48  LYS B HD2  3  
ATOM   6077  H HD3  . LYS B 1 48 ? -6.899  6.868   -8.292  1.00 1.63 ? 48  LYS B HD3  3  
ATOM   6078  H HE2  . LYS B 1 48 ? -7.376  9.197   -7.142  1.00 2.60 ? 48  LYS B HE2  3  
ATOM   6079  H HE3  . LYS B 1 48 ? -6.572  8.453   -5.761  1.00 2.56 ? 48  LYS B HE3  3  
ATOM   6080  H HZ1  . LYS B 1 48 ? -5.051  7.829   -7.980  1.00 3.01 ? 48  LYS B HZ1  3  
ATOM   6081  H HZ2  . LYS B 1 48 ? -5.438  9.477   -8.134  1.00 3.07 ? 48  LYS B HZ2  3  
ATOM   6082  H HZ3  . LYS B 1 48 ? -4.660  8.916   -6.735  1.00 3.23 ? 48  LYS B HZ3  3  
ATOM   6083  N N    . GLN B 1 49 ? -10.303 4.672   -5.467  1.00 0.33 ? 49  GLN B N    3  
ATOM   6084  C CA   . GLN B 1 49 ? -10.462 3.739   -4.311  1.00 0.30 ? 49  GLN B CA   3  
ATOM   6085  C C    . GLN B 1 49 ? -10.736 4.543   -3.029  1.00 0.25 ? 49  GLN B C    3  
ATOM   6086  O O    . GLN B 1 49 ? -10.199 5.616   -2.822  1.00 0.26 ? 49  GLN B O    3  
ATOM   6087  C CB   . GLN B 1 49 ? -9.154  2.938   -4.157  1.00 0.35 ? 49  GLN B CB   3  
ATOM   6088  C CG   . GLN B 1 49 ? -9.237  1.630   -4.955  1.00 0.82 ? 49  GLN B CG   3  
ATOM   6089  C CD   . GLN B 1 49 ? -7.867  0.948   -4.959  1.00 0.89 ? 49  GLN B CD   3  
ATOM   6090  O OE1  . GLN B 1 49 ? -7.690  -0.081  -5.579  1.00 1.53 ? 49  GLN B OE1  3  
ATOM   6091  N NE2  . GLN B 1 49 ? -6.884  1.482   -4.287  1.00 1.52 ? 49  GLN B NE2  3  
ATOM   6092  H H    . GLN B 1 49 ? -9.690  5.431   -5.391  1.00 0.36 ? 49  GLN B H    3  
ATOM   6093  H HA   . GLN B 1 49 ? -11.289 3.063   -4.486  1.00 0.32 ? 49  GLN B HA   3  
ATOM   6094  H HB2  . GLN B 1 49 ? -8.332  3.528   -4.532  1.00 0.76 ? 49  GLN B HB2  3  
ATOM   6095  H HB3  . GLN B 1 49 ? -8.982  2.710   -3.118  1.00 0.86 ? 49  GLN B HB3  3  
ATOM   6096  H HG2  . GLN B 1 49 ? -9.965  0.976   -4.501  1.00 1.46 ? 49  GLN B HG2  3  
ATOM   6097  H HG3  . GLN B 1 49 ? -9.530  1.846   -5.972  1.00 1.32 ? 49  GLN B HG3  3  
ATOM   6098  H HE21 . GLN B 1 49 ? -7.028  2.313   -3.787  1.00 2.12 ? 49  GLN B HE21 3  
ATOM   6099  H HE22 . GLN B 1 49 ? -6.003  1.053   -4.283  1.00 1.80 ? 49  GLN B HE22 3  
ATOM   6100  N N    . VAL B 1 50 ? -11.565 4.016   -2.164  1.00 0.23 ? 50  VAL B N    3  
ATOM   6101  C CA   . VAL B 1 50 ? -11.881 4.714   -0.880  1.00 0.19 ? 50  VAL B CA   3  
ATOM   6102  C C    . VAL B 1 50 ? -11.930 3.681   0.239   1.00 0.16 ? 50  VAL B C    3  
ATOM   6103  O O    . VAL B 1 50 ? -12.686 2.736   0.185   1.00 0.15 ? 50  VAL B O    3  
ATOM   6104  C CB   . VAL B 1 50 ? -13.236 5.418   -0.990  1.00 0.22 ? 50  VAL B CB   3  
ATOM   6105  C CG1  . VAL B 1 50 ? -13.445 6.315   0.233   1.00 0.24 ? 50  VAL B CG1  3  
ATOM   6106  C CG2  . VAL B 1 50 ? -13.261 6.267   -2.265  1.00 0.31 ? 50  VAL B CG2  3  
ATOM   6107  H H    . VAL B 1 50 ? -11.975 3.146   -2.354  1.00 0.26 ? 50  VAL B H    3  
ATOM   6108  H HA   . VAL B 1 50 ? -11.113 5.441   -0.657  1.00 0.20 ? 50  VAL B HA   3  
ATOM   6109  H HB   . VAL B 1 50 ? -14.025 4.680   -1.030  1.00 0.24 ? 50  VAL B HB   3  
ATOM   6110  H HG11 . VAL B 1 50 ? -12.630 7.018   0.307   1.00 1.07 ? 50  VAL B HG11 3  
ATOM   6111  H HG12 . VAL B 1 50 ? -14.376 6.853   0.128   1.00 1.04 ? 50  VAL B HG12 3  
ATOM   6112  H HG13 . VAL B 1 50 ? -13.479 5.707   1.124   1.00 1.03 ? 50  VAL B HG13 3  
ATOM   6113  H HG21 . VAL B 1 50 ? -12.305 6.750   -2.399  1.00 1.10 ? 50  VAL B HG21 3  
ATOM   6114  H HG22 . VAL B 1 50 ? -13.460 5.628   -3.110  1.00 1.02 ? 50  VAL B HG22 3  
ATOM   6115  H HG23 . VAL B 1 50 ? -14.037 7.015   -2.188  1.00 1.09 ? 50  VAL B HG23 3  
ATOM   6116  N N    . CYS B 1 51 ? -11.127 3.850   1.251   1.00 0.16 ? 51  CYS B N    3  
ATOM   6117  C CA   . CYS B 1 51 ? -11.118 2.866   2.366   1.00 0.15 ? 51  CYS B CA   3  
ATOM   6118  C C    . CYS B 1 51 ? -12.391 3.026   3.193   1.00 0.14 ? 51  CYS B C    3  
ATOM   6119  O O    . CYS B 1 51 ? -12.961 4.095   3.275   1.00 0.16 ? 51  CYS B O    3  
ATOM   6120  C CB   . CYS B 1 51 ? -9.898  3.125   3.250   1.00 0.17 ? 51  CYS B CB   3  
ATOM   6121  S SG   . CYS B 1 51 ? -8.389  2.750   2.323   1.00 0.21 ? 51  CYS B SG   3  
ATOM   6122  H H    . CYS B 1 51 ? -10.522 4.619   1.272   1.00 0.19 ? 51  CYS B H    3  
ATOM   6123  H HA   . CYS B 1 51 ? -11.068 1.865   1.967   1.00 0.15 ? 51  CYS B HA   3  
ATOM   6124  H HB2  . CYS B 1 51 ? -9.886  4.162   3.553   1.00 0.19 ? 51  CYS B HB2  3  
ATOM   6125  H HB3  . CYS B 1 51 ? -9.949  2.496   4.123   1.00 0.18 ? 51  CYS B HB3  3  
ATOM   6126  N N    . ALA B 1 52 ? -12.848 1.961   3.798   1.00 0.12 ? 52  ALA B N    3  
ATOM   6127  C CA   . ALA B 1 52 ? -14.095 2.033   4.615   1.00 0.13 ? 52  ALA B CA   3  
ATOM   6128  C C    . ALA B 1 52 ? -13.948 1.144   5.852   1.00 0.15 ? 52  ALA B C    3  
ATOM   6129  O O    . ALA B 1 52 ? -13.485 0.022   5.774   1.00 0.15 ? 52  ALA B O    3  
ATOM   6130  C CB   . ALA B 1 52 ? -15.275 1.541   3.777   1.00 0.11 ? 52  ALA B CB   3  
ATOM   6131  H H    . ALA B 1 52 ? -12.373 1.107   3.708   1.00 0.13 ? 52  ALA B H    3  
ATOM   6132  H HA   . ALA B 1 52 ? -14.276 3.055   4.926   1.00 0.14 ? 52  ALA B HA   3  
ATOM   6133  H HB1  . ALA B 1 52 ? -15.000 0.629   3.269   1.00 1.04 ? 52  ALA B HB1  3  
ATOM   6134  H HB2  . ALA B 1 52 ? -16.120 1.353   4.420   1.00 1.02 ? 52  ALA B HB2  3  
ATOM   6135  H HB3  . ALA B 1 52 ? -15.538 2.293   3.048   1.00 1.01 ? 52  ALA B HB3  3  
ATOM   6136  N N    . ASP B 1 53 ? -14.337 1.643   6.992   1.00 0.18 ? 53  ASP B N    3  
ATOM   6137  C CA   . ASP B 1 53 ? -14.224 0.843   8.245   1.00 0.22 ? 53  ASP B CA   3  
ATOM   6138  C C    . ASP B 1 53 ? -15.237 -0.335  8.195   1.00 0.21 ? 53  ASP B C    3  
ATOM   6139  O O    . ASP B 1 53 ? -16.426 -0.085  8.147   1.00 0.22 ? 53  ASP B O    3  
ATOM   6140  C CB   . ASP B 1 53 ? -14.556 1.753   9.439   1.00 0.27 ? 53  ASP B CB   3  
ATOM   6141  C CG   . ASP B 1 53 ? -15.626 2.769   9.029   1.00 1.35 ? 53  ASP B CG   3  
ATOM   6142  O OD1  . ASP B 1 53 ? -16.421 2.444   8.162   1.00 2.10 ? 53  ASP B OD1  3  
ATOM   6143  O OD2  . ASP B 1 53 ? -15.633 3.852   9.590   1.00 2.17 ? 53  ASP B OD2  3  
ATOM   6144  H H    . ASP B 1 53 ? -14.705 2.551   7.027   1.00 0.19 ? 53  ASP B H    3  
ATOM   6145  H HA   . ASP B 1 53 ? -13.216 0.491   8.341   1.00 0.22 ? 53  ASP B HA   3  
ATOM   6146  H HB2  . ASP B 1 53 ? -14.920 1.158   10.265  1.00 1.05 ? 53  ASP B HB2  3  
ATOM   6147  H HB3  . ASP B 1 53 ? -13.666 2.283   9.746   1.00 1.03 ? 53  ASP B HB3  3  
ATOM   6148  N N    . PRO B 1 54 ? -14.776 -1.584  8.206   1.00 0.22 ? 54  PRO B N    3  
ATOM   6149  C CA   . PRO B 1 54 ? -15.707 -2.736  8.160   1.00 0.24 ? 54  PRO B CA   3  
ATOM   6150  C C    . PRO B 1 54 ? -16.631 -2.734  9.390   1.00 0.28 ? 54  PRO B C    3  
ATOM   6151  O O    . PRO B 1 54 ? -17.525 -3.549  9.506   1.00 0.30 ? 54  PRO B O    3  
ATOM   6152  C CB   . PRO B 1 54 ? -14.798 -3.988  8.164   1.00 0.27 ? 54  PRO B CB   3  
ATOM   6153  C CG   . PRO B 1 54 ? -13.323 -3.501  8.224   1.00 0.27 ? 54  PRO B CG   3  
ATOM   6154  C CD   . PRO B 1 54 ? -13.342 -1.957  8.258   1.00 0.24 ? 54  PRO B CD   3  
ATOM   6155  H HA   . PRO B 1 54 ? -16.292 -2.707  7.252   1.00 0.21 ? 54  PRO B HA   3  
ATOM   6156  H HB2  . PRO B 1 54 ? -15.017 -4.606  9.029   1.00 0.30 ? 54  PRO B HB2  3  
ATOM   6157  H HB3  . PRO B 1 54 ? -14.955 -4.563  7.261   1.00 0.26 ? 54  PRO B HB3  3  
ATOM   6158  H HG2  . PRO B 1 54 ? -12.842 -3.888  9.118   1.00 0.31 ? 54  PRO B HG2  3  
ATOM   6159  H HG3  . PRO B 1 54 ? -12.785 -3.843  7.352   1.00 0.27 ? 54  PRO B HG3  3  
ATOM   6160  H HD2  . PRO B 1 54 ? -12.889 -1.600  9.175   1.00 0.26 ? 54  PRO B HD2  3  
ATOM   6161  H HD3  . PRO B 1 54 ? -12.821 -1.557  7.399   1.00 0.21 ? 54  PRO B HD3  3  
ATOM   6162  N N    . SER B 1 55 ? -16.408 -1.845  10.313  1.00 0.31 ? 55  SER B N    3  
ATOM   6163  C CA   . SER B 1 55 ? -17.256 -1.813  11.541  1.00 0.36 ? 55  SER B CA   3  
ATOM   6164  C C    . SER B 1 55 ? -18.623 -1.193  11.233  1.00 0.36 ? 55  SER B C    3  
ATOM   6165  O O    . SER B 1 55 ? -19.582 -1.410  11.946  1.00 0.40 ? 55  SER B O    3  
ATOM   6166  C CB   . SER B 1 55 ? -16.556 -0.984  12.618  1.00 0.40 ? 55  SER B CB   3  
ATOM   6167  O OG   . SER B 1 55 ? -17.275 -1.098  13.840  1.00 1.42 ? 55  SER B OG   3  
ATOM   6168  H H    . SER B 1 55 ? -15.669 -1.212  10.210  1.00 0.30 ? 55  SER B H    3  
ATOM   6169  H HA   . SER B 1 55 ? -17.395 -2.821  11.904  1.00 0.39 ? 55  SER B HA   3  
ATOM   6170  H HB2  . SER B 1 55 ? -15.553 -1.349  12.761  1.00 0.99 ? 55  SER B HB2  3  
ATOM   6171  H HB3  . SER B 1 55 ? -16.519 0.051   12.306  1.00 1.11 ? 55  SER B HB3  3  
ATOM   6172  H HG   . SER B 1 55 ? -16.891 -1.820  14.343  1.00 1.89 ? 55  SER B HG   3  
ATOM   6173  N N    . GLU B 1 56 ? -18.726 -0.428  10.181  1.00 0.33 ? 56  GLU B N    3  
ATOM   6174  C CA   . GLU B 1 56 ? -20.039 0.197   9.842   1.00 0.33 ? 56  GLU B CA   3  
ATOM   6175  C C    . GLU B 1 56 ? -20.911 -0.820  9.098   1.00 0.33 ? 56  GLU B C    3  
ATOM   6176  O O    . GLU B 1 56 ? -20.553 -1.323  8.051   1.00 0.29 ? 56  GLU B O    3  
ATOM   6177  C CB   . GLU B 1 56 ? -19.805 1.435   8.970   1.00 0.31 ? 56  GLU B CB   3  
ATOM   6178  C CG   . GLU B 1 56 ? -19.423 2.641   9.846   1.00 0.35 ? 56  GLU B CG   3  
ATOM   6179  C CD   . GLU B 1 56 ? -18.359 2.239   10.873  1.00 1.30 ? 56  GLU B CD   3  
ATOM   6180  O OE1  . GLU B 1 56 ? -17.417 1.566   10.491  1.00 2.08 ? 56  GLU B OE1  3  
ATOM   6181  O OE2  . GLU B 1 56 ? -18.505 2.613   12.025  1.00 2.01 ? 56  GLU B OE2  3  
ATOM   6182  H H    . GLU B 1 56 ? -17.943 -0.263  9.615   1.00 0.30 ? 56  GLU B H    3  
ATOM   6183  H HA   . GLU B 1 56 ? -20.542 0.489   10.753  1.00 0.37 ? 56  GLU B HA   3  
ATOM   6184  H HB2  . GLU B 1 56 ? -19.004 1.232   8.279   1.00 0.28 ? 56  GLU B HB2  3  
ATOM   6185  H HB3  . GLU B 1 56 ? -20.705 1.667   8.420   1.00 0.31 ? 56  GLU B HB3  3  
ATOM   6186  H HG2  . GLU B 1 56 ? -19.034 3.429   9.217   1.00 0.87 ? 56  GLU B HG2  3  
ATOM   6187  H HG3  . GLU B 1 56 ? -20.300 2.998   10.363  1.00 1.00 ? 56  GLU B HG3  3  
ATOM   6188  N N    . SER B 1 57 ? -22.046 -1.131  9.652   1.00 0.37 ? 57  SER B N    3  
ATOM   6189  C CA   . SER B 1 57 ? -22.963 -2.123  9.024   1.00 0.38 ? 57  SER B CA   3  
ATOM   6190  C C    . SER B 1 57 ? -23.195 -1.816  7.542   1.00 0.35 ? 57  SER B C    3  
ATOM   6191  O O    . SER B 1 57 ? -23.270 -2.713  6.727   1.00 0.34 ? 57  SER B O    3  
ATOM   6192  C CB   . SER B 1 57 ? -24.305 -2.100  9.757   1.00 0.44 ? 57  SER B CB   3  
ATOM   6193  O OG   . SER B 1 57 ? -25.169 -3.072  9.185   1.00 1.37 ? 57  SER B OG   3  
ATOM   6194  H H    . SER B 1 57 ? -22.295 -0.714  10.500  1.00 0.41 ? 57  SER B H    3  
ATOM   6195  H HA   . SER B 1 57 ? -22.532 -3.106  9.114   1.00 0.38 ? 57  SER B HA   3  
ATOM   6196  H HB2  . SER B 1 57 ? -24.153 -2.330  10.798  1.00 1.21 ? 57  SER B HB2  3  
ATOM   6197  H HB3  . SER B 1 57 ? -24.745 -1.114  9.668   1.00 1.06 ? 57  SER B HB3  3  
ATOM   6198  H HG   . SER B 1 57 ? -24.944 -3.160  8.255   1.00 1.80 ? 57  SER B HG   3  
ATOM   6199  N N    . TRP B 1 58 ? -23.335 -0.571  7.175   1.00 0.34 ? 58  TRP B N    3  
ATOM   6200  C CA   . TRP B 1 58 ? -23.588 -0.265  5.739   1.00 0.32 ? 58  TRP B CA   3  
ATOM   6201  C C    . TRP B 1 58 ? -22.422 -0.770  4.894   1.00 0.27 ? 58  TRP B C    3  
ATOM   6202  O O    . TRP B 1 58 ? -22.595 -1.185  3.768   1.00 0.27 ? 58  TRP B O    3  
ATOM   6203  C CB   . TRP B 1 58 ? -23.821 1.242   5.535   1.00 0.34 ? 58  TRP B CB   3  
ATOM   6204  C CG   . TRP B 1 58 ? -22.536 2.012   5.517   1.00 0.31 ? 58  TRP B CG   3  
ATOM   6205  C CD1  . TRP B 1 58 ? -22.097 2.803   6.524   1.00 0.32 ? 58  TRP B CD1  3  
ATOM   6206  C CD2  . TRP B 1 58 ? -21.541 2.114   4.454   1.00 0.27 ? 58  TRP B CD2  3  
ATOM   6207  N NE1  . TRP B 1 58 ? -20.900 3.385   6.150   1.00 0.29 ? 58  TRP B NE1  3  
ATOM   6208  C CE2  . TRP B 1 58 ? -20.508 2.987   4.891   1.00 0.26 ? 58  TRP B CE2  3  
ATOM   6209  C CE3  . TRP B 1 58 ? -21.428 1.538   3.166   1.00 0.27 ? 58  TRP B CE3  3  
ATOM   6210  C CZ2  . TRP B 1 58 ? -19.402 3.281   4.080   1.00 0.25 ? 58  TRP B CZ2  3  
ATOM   6211  C CZ3  . TRP B 1 58 ? -20.316 1.831   2.348   1.00 0.27 ? 58  TRP B CZ3  3  
ATOM   6212  C CH2  . TRP B 1 58 ? -19.305 2.700   2.805   1.00 0.26 ? 58  TRP B CH2  3  
ATOM   6213  H H    . TRP B 1 58 ? -23.283 0.149   7.835   1.00 0.36 ? 58  TRP B H    3  
ATOM   6214  H HA   . TRP B 1 58 ? -24.479 -0.795  5.433   1.00 0.35 ? 58  TRP B HA   3  
ATOM   6215  H HB2  . TRP B 1 58 ? -24.332 1.395   4.598   1.00 0.35 ? 58  TRP B HB2  3  
ATOM   6216  H HB3  . TRP B 1 58 ? -24.444 1.612   6.338   1.00 0.38 ? 58  TRP B HB3  3  
ATOM   6217  H HD1  . TRP B 1 58 ? -22.604 2.962   7.464   1.00 0.36 ? 58  TRP B HD1  3  
ATOM   6218  H HE1  . TRP B 1 58 ? -20.378 4.004   6.697   1.00 0.30 ? 58  TRP B HE1  3  
ATOM   6219  H HE3  . TRP B 1 58 ? -22.198 0.877   2.804   1.00 0.29 ? 58  TRP B HE3  3  
ATOM   6220  H HZ2  . TRP B 1 58 ? -18.630 3.946   4.435   1.00 0.25 ? 58  TRP B HZ2  3  
ATOM   6221  H HZ3  . TRP B 1 58 ? -20.240 1.387   1.366   1.00 0.29 ? 58  TRP B HZ3  3  
ATOM   6222  H HH2  . TRP B 1 58 ? -18.457 2.921   2.177   1.00 0.27 ? 58  TRP B HH2  3  
ATOM   6223  N N    . VAL B 1 59 ? -21.240 -0.770  5.434   1.00 0.24 ? 59  VAL B N    3  
ATOM   6224  C CA   . VAL B 1 59 ? -20.082 -1.274  4.654   1.00 0.20 ? 59  VAL B CA   3  
ATOM   6225  C C    . VAL B 1 59 ? -20.283 -2.761  4.393   1.00 0.22 ? 59  VAL B C    3  
ATOM   6226  O O    . VAL B 1 59 ? -20.141 -3.233  3.284   1.00 0.21 ? 59  VAL B O    3  
ATOM   6227  C CB   . VAL B 1 59 ? -18.802 -1.051  5.456   1.00 0.19 ? 59  VAL B CB   3  
ATOM   6228  C CG1  . VAL B 1 59 ? -17.600 -1.616  4.693   1.00 0.18 ? 59  VAL B CG1  3  
ATOM   6229  C CG2  . VAL B 1 59 ? -18.623 0.450   5.674   1.00 0.19 ? 59  VAL B CG2  3  
ATOM   6230  H H    . VAL B 1 59 ? -21.116 -0.454  6.354   1.00 0.26 ? 59  VAL B H    3  
ATOM   6231  H HA   . VAL B 1 59 ? -20.019 -0.747  3.716   1.00 0.20 ? 59  VAL B HA   3  
ATOM   6232  H HB   . VAL B 1 59 ? -18.885 -1.548  6.412   1.00 0.21 ? 59  VAL B HB   3  
ATOM   6233  H HG11 . VAL B 1 59 ? -17.679 -1.356  3.649   1.00 1.01 ? 59  VAL B HG11 3  
ATOM   6234  H HG12 . VAL B 1 59 ? -16.688 -1.203  5.099   1.00 1.03 ? 59  VAL B HG12 3  
ATOM   6235  H HG13 . VAL B 1 59 ? -17.583 -2.691  4.794   1.00 0.98 ? 59  VAL B HG13 3  
ATOM   6236  H HG21 . VAL B 1 59 ? -19.539 0.865   6.066   1.00 1.00 ? 59  VAL B HG21 3  
ATOM   6237  H HG22 . VAL B 1 59 ? -17.819 0.620   6.373   1.00 1.04 ? 59  VAL B HG22 3  
ATOM   6238  H HG23 . VAL B 1 59 ? -18.390 0.923   4.733   1.00 1.05 ? 59  VAL B HG23 3  
ATOM   6239  N N    . GLN B 1 60 ? -20.636 -3.501  5.402   1.00 0.25 ? 60  GLN B N    3  
ATOM   6240  C CA   . GLN B 1 60 ? -20.871 -4.957  5.201   1.00 0.28 ? 60  GLN B CA   3  
ATOM   6241  C C    . GLN B 1 60 ? -22.081 -5.149  4.282   1.00 0.30 ? 60  GLN B C    3  
ATOM   6242  O O    . GLN B 1 60 ? -22.125 -6.056  3.474   1.00 0.31 ? 60  GLN B O    3  
ATOM   6243  C CB   . GLN B 1 60 ? -21.141 -5.625  6.551   1.00 0.33 ? 60  GLN B CB   3  
ATOM   6244  C CG   . GLN B 1 60 ? -21.054 -7.145  6.397   1.00 1.25 ? 60  GLN B CG   3  
ATOM   6245  C CD   . GLN B 1 60 ? -21.177 -7.806  7.771   1.00 1.65 ? 60  GLN B CD   3  
ATOM   6246  O OE1  . GLN B 1 60 ? -20.804 -7.227  8.772   1.00 2.33 ? 60  GLN B OE1  3  
ATOM   6247  N NE2  . GLN B 1 60 ? -21.688 -9.003  7.862   1.00 2.14 ? 60  GLN B NE2  3  
ATOM   6248  H H    . GLN B 1 60 ? -20.762 -3.095  6.289   1.00 0.27 ? 60  GLN B H    3  
ATOM   6249  H HA   . GLN B 1 60 ? -20.000 -5.401  4.744   1.00 0.28 ? 60  GLN B HA   3  
ATOM   6250  H HB2  . GLN B 1 60 ? -20.406 -5.292  7.270   1.00 0.91 ? 60  GLN B HB2  3  
ATOM   6251  H HB3  . GLN B 1 60 ? -22.128 -5.356  6.894   1.00 0.88 ? 60  GLN B HB3  3  
ATOM   6252  H HG2  . GLN B 1 60 ? -21.857 -7.488  5.758   1.00 1.90 ? 60  GLN B HG2  3  
ATOM   6253  H HG3  . GLN B 1 60 ? -20.105 -7.409  5.956   1.00 1.91 ? 60  GLN B HG3  3  
ATOM   6254  H HE21 . GLN B 1 60 ? -21.988 -9.470  7.055   1.00 2.43 ? 60  GLN B HE21 3  
ATOM   6255  H HE22 . GLN B 1 60 ? -21.770 -9.436  8.737   1.00 2.66 ? 60  GLN B HE22 3  
ATOM   6256  N N    . GLU B 1 61 ? -23.065 -4.300  4.404   1.00 0.31 ? 61  GLU B N    3  
ATOM   6257  C CA   . GLU B 1 61 ? -24.281 -4.424  3.546   1.00 0.33 ? 61  GLU B CA   3  
ATOM   6258  C C    . GLU B 1 61 ? -23.920 -4.172  2.080   1.00 0.31 ? 61  GLU B C    3  
ATOM   6259  O O    . GLU B 1 61 ? -24.274 -4.936  1.204   1.00 0.32 ? 61  GLU B O    3  
ATOM   6260  C CB   . GLU B 1 61 ? -25.326 -3.400  3.995   1.00 0.35 ? 61  GLU B CB   3  
ATOM   6261  C CG   . GLU B 1 61 ? -26.653 -3.682  3.286   1.00 0.40 ? 61  GLU B CG   3  
ATOM   6262  C CD   . GLU B 1 61 ? -27.730 -2.736  3.823   1.00 1.29 ? 61  GLU B CD   3  
ATOM   6263  O OE1  . GLU B 1 61 ? -28.344 -3.076  4.820   1.00 1.99 ? 61  GLU B OE1  3  
ATOM   6264  O OE2  . GLU B 1 61 ? -27.921 -1.688  3.227   1.00 2.03 ? 61  GLU B OE2  3  
ATOM   6265  H H    . GLU B 1 61 ? -23.006 -3.579  5.065   1.00 0.31 ? 61  GLU B H    3  
ATOM   6266  H HA   . GLU B 1 61 ? -24.689 -5.417  3.646   1.00 0.36 ? 61  GLU B HA   3  
ATOM   6267  H HB2  . GLU B 1 61 ? -25.465 -3.472  5.064   1.00 0.37 ? 61  GLU B HB2  3  
ATOM   6268  H HB3  . GLU B 1 61 ? -24.989 -2.407  3.741   1.00 0.33 ? 61  GLU B HB3  3  
ATOM   6269  H HG2  . GLU B 1 61 ? -26.534 -3.527  2.223   1.00 0.84 ? 61  GLU B HG2  3  
ATOM   6270  H HG3  . GLU B 1 61 ? -26.950 -4.703  3.470   1.00 0.95 ? 61  GLU B HG3  3  
ATOM   6271  N N    . TYR B 1 62 ? -23.224 -3.104  1.805   1.00 0.28 ? 62  TYR B N    3  
ATOM   6272  C CA   . TYR B 1 62 ? -22.848 -2.799  0.395   1.00 0.28 ? 62  TYR B CA   3  
ATOM   6273  C C    . TYR B 1 62 ? -21.970 -3.927  -0.157  1.00 0.28 ? 62  TYR B C    3  
ATOM   6274  O O    . TYR B 1 62 ? -22.055 -4.279  -1.317  1.00 0.30 ? 62  TYR B O    3  
ATOM   6275  C CB   . TYR B 1 62 ? -22.078 -1.469  0.336   1.00 0.25 ? 62  TYR B CB   3  
ATOM   6276  C CG   . TYR B 1 62 ? -23.039 -0.291  0.328   1.00 0.27 ? 62  TYR B CG   3  
ATOM   6277  C CD1  . TYR B 1 62 ? -24.055 -0.184  1.302   1.00 0.29 ? 62  TYR B CD1  3  
ATOM   6278  C CD2  . TYR B 1 62 ? -22.911 0.707   -0.661  1.00 0.27 ? 62  TYR B CD2  3  
ATOM   6279  C CE1  . TYR B 1 62 ? -24.935 0.916   1.284   1.00 0.32 ? 62  TYR B CE1  3  
ATOM   6280  C CE2  . TYR B 1 62 ? -23.792 1.804   -0.676  1.00 0.29 ? 62  TYR B CE2  3  
ATOM   6281  C CZ   . TYR B 1 62 ? -24.804 1.909   0.296   1.00 0.31 ? 62  TYR B CZ   3  
ATOM   6282  O OH   . TYR B 1 62 ? -25.667 2.986   0.281   1.00 0.34 ? 62  TYR B OH   3  
ATOM   6283  H H    . TYR B 1 62 ? -22.955 -2.500  2.527   1.00 0.28 ? 62  TYR B H    3  
ATOM   6284  H HA   . TYR B 1 62 ? -23.744 -2.724  -0.205  1.00 0.30 ? 62  TYR B HA   3  
ATOM   6285  H HB2  . TYR B 1 62 ? -21.435 -1.394  1.202   1.00 0.24 ? 62  TYR B HB2  3  
ATOM   6286  H HB3  . TYR B 1 62 ? -21.471 -1.442  -0.558  1.00 0.25 ? 62  TYR B HB3  3  
ATOM   6287  H HD1  . TYR B 1 62 ? -24.162 -0.941  2.059   1.00 0.30 ? 62  TYR B HD1  3  
ATOM   6288  H HD2  . TYR B 1 62 ? -22.135 0.631   -1.409  1.00 0.27 ? 62  TYR B HD2  3  
ATOM   6289  H HE1  . TYR B 1 62 ? -25.711 0.999   2.032   1.00 0.35 ? 62  TYR B HE1  3  
ATOM   6290  H HE2  . TYR B 1 62 ? -23.690 2.567   -1.435  1.00 0.30 ? 62  TYR B HE2  3  
ATOM   6291  H HH   . TYR B 1 62 ? -25.322 3.633   -0.339  1.00 0.89 ? 62  TYR B HH   3  
ATOM   6292  N N    . VAL B 1 63 ? -21.135 -4.504  0.661   1.00 0.27 ? 63  VAL B N    3  
ATOM   6293  C CA   . VAL B 1 63 ? -20.271 -5.611  0.176   1.00 0.28 ? 63  VAL B CA   3  
ATOM   6294  C C    . VAL B 1 63 ? -21.164 -6.785  -0.192  1.00 0.32 ? 63  VAL B C    3  
ATOM   6295  O O    . VAL B 1 63 ? -20.954 -7.462  -1.177  1.00 0.34 ? 63  VAL B O    3  
ATOM   6296  C CB   . VAL B 1 63 ? -19.300 -6.023  1.285   1.00 0.28 ? 63  VAL B CB   3  
ATOM   6297  C CG1  . VAL B 1 63 ? -18.571 -7.310  0.886   1.00 0.32 ? 63  VAL B CG1  3  
ATOM   6298  C CG2  . VAL B 1 63 ? -18.276 -4.907  1.505   1.00 0.25 ? 63  VAL B CG2  3  
ATOM   6299  H H    . VAL B 1 63 ? -21.088 -4.222  1.596   1.00 0.26 ? 63  VAL B H    3  
ATOM   6300  H HA   . VAL B 1 63 ? -19.717 -5.286  -0.693  1.00 0.28 ? 63  VAL B HA   3  
ATOM   6301  H HB   . VAL B 1 63 ? -19.853 -6.193  2.197   1.00 0.30 ? 63  VAL B HB   3  
ATOM   6302  H HG11 . VAL B 1 63 ? -18.216 -7.222  -0.131  1.00 1.08 ? 63  VAL B HG11 3  
ATOM   6303  H HG12 . VAL B 1 63 ? -17.732 -7.470  1.547   1.00 1.07 ? 63  VAL B HG12 3  
ATOM   6304  H HG13 . VAL B 1 63 ? -19.251 -8.146  0.958   1.00 1.05 ? 63  VAL B HG13 3  
ATOM   6305  H HG21 . VAL B 1 63 ? -18.780 -3.951  1.513   1.00 1.00 ? 63  VAL B HG21 3  
ATOM   6306  H HG22 . VAL B 1 63 ? -17.776 -5.059  2.450   1.00 1.05 ? 63  VAL B HG22 3  
ATOM   6307  H HG23 . VAL B 1 63 ? -17.549 -4.921  0.706   1.00 1.03 ? 63  VAL B HG23 3  
ATOM   6308  N N    . TYR B 1 64 ? -22.167 -7.025  0.599   1.00 0.34 ? 64  TYR B N    3  
ATOM   6309  C CA   . TYR B 1 64 ? -23.087 -8.149  0.310   1.00 0.38 ? 64  TYR B CA   3  
ATOM   6310  C C    . TYR B 1 64 ? -23.790 -7.888  -1.019  1.00 0.39 ? 64  TYR B C    3  
ATOM   6311  O O    . TYR B 1 64 ? -23.930 -8.765  -1.848  1.00 0.41 ? 64  TYR B O    3  
ATOM   6312  C CB   . TYR B 1 64 ? -24.126 -8.250  1.431   1.00 0.41 ? 64  TYR B CB   3  
ATOM   6313  C CG   . TYR B 1 64 ? -24.777 -9.615  1.406   1.00 0.46 ? 64  TYR B CG   3  
ATOM   6314  C CD1  . TYR B 1 64 ? -24.066 -10.742 1.864   1.00 0.48 ? 64  TYR B CD1  3  
ATOM   6315  C CD2  . TYR B 1 64 ? -26.093 -9.762  0.925   1.00 0.49 ? 64  TYR B CD2  3  
ATOM   6316  C CE1  . TYR B 1 64 ? -24.670 -12.013 1.841   1.00 0.52 ? 64  TYR B CE1  3  
ATOM   6317  C CE2  . TYR B 1 64 ? -26.697 -11.034 0.902   1.00 0.54 ? 64  TYR B CE2  3  
ATOM   6318  C CZ   . TYR B 1 64 ? -25.985 -12.159 1.359   1.00 0.55 ? 64  TYR B CZ   3  
ATOM   6319  O OH   . TYR B 1 64 ? -26.578 -13.405 1.337   1.00 0.60 ? 64  TYR B OH   3  
ATOM   6320  H H    . TYR B 1 64 ? -22.316 -6.459  1.386   1.00 0.33 ? 64  TYR B H    3  
ATOM   6321  H HA   . TYR B 1 64 ? -22.520 -9.061  0.251   1.00 0.40 ? 64  TYR B HA   3  
ATOM   6322  H HB2  . TYR B 1 64 ? -23.639 -8.100  2.380   1.00 0.41 ? 64  TYR B HB2  3  
ATOM   6323  H HB3  . TYR B 1 64 ? -24.881 -7.489  1.295   1.00 0.40 ? 64  TYR B HB3  3  
ATOM   6324  H HD1  . TYR B 1 64 ? -23.056 -10.630 2.233   1.00 0.47 ? 64  TYR B HD1  3  
ATOM   6325  H HD2  . TYR B 1 64 ? -26.639 -8.899  0.573   1.00 0.49 ? 64  TYR B HD2  3  
ATOM   6326  H HE1  . TYR B 1 64 ? -24.125 -12.878 2.192   1.00 0.55 ? 64  TYR B HE1  3  
ATOM   6327  H HE2  . TYR B 1 64 ? -27.706 -11.146 0.534   1.00 0.56 ? 64  TYR B HE2  3  
ATOM   6328  H HH   . TYR B 1 64 ? -27.477 -13.313 1.661   1.00 1.08 ? 64  TYR B HH   3  
ATOM   6329  N N    . ASP B 1 65 ? -24.231 -6.683  -1.220  1.00 0.36 ? 65  ASP B N    3  
ATOM   6330  C CA   . ASP B 1 65 ? -24.933 -6.340  -2.489  1.00 0.37 ? 65  ASP B CA   3  
ATOM   6331  C C    . ASP B 1 65 ? -23.981 -6.537  -3.672  1.00 0.37 ? 65  ASP B C    3  
ATOM   6332  O O    . ASP B 1 65 ? -24.380 -6.938  -4.746  1.00 0.40 ? 65  ASP B O    3  
ATOM   6333  C CB   . ASP B 1 65 ? -25.385 -4.877  -2.431  1.00 0.35 ? 65  ASP B CB   3  
ATOM   6334  C CG   . ASP B 1 65 ? -26.656 -4.761  -1.586  1.00 0.39 ? 65  ASP B CG   3  
ATOM   6335  O OD1  . ASP B 1 65 ? -27.546 -5.574  -1.775  1.00 1.15 ? 65  ASP B OD1  3  
ATOM   6336  O OD2  . ASP B 1 65 ? -26.717 -3.862  -0.764  1.00 1.11 ? 65  ASP B OD2  3  
ATOM   6337  H H    . ASP B 1 65 ? -24.100 -5.997  -0.531  1.00 0.34 ? 65  ASP B H    3  
ATOM   6338  H HA   . ASP B 1 65 ? -25.794 -6.982  -2.611  1.00 0.41 ? 65  ASP B HA   3  
ATOM   6339  H HB2  . ASP B 1 65 ? -24.602 -4.278  -1.986  1.00 0.32 ? 65  ASP B HB2  3  
ATOM   6340  H HB3  . ASP B 1 65 ? -25.584 -4.520  -3.427  1.00 0.36 ? 65  ASP B HB3  3  
ATOM   6341  N N    . LEU B 1 66 ? -22.724 -6.259  -3.477  1.00 0.33 ? 66  LEU B N    3  
ATOM   6342  C CA   . LEU B 1 66 ? -21.738 -6.425  -4.580  1.00 0.34 ? 66  LEU B CA   3  
ATOM   6343  C C    . LEU B 1 66 ? -21.502 -7.917  -4.830  1.00 0.39 ? 66  LEU B C    3  
ATOM   6344  O O    . LEU B 1 66 ? -21.215 -8.334  -5.935  1.00 0.42 ? 66  LEU B O    3  
ATOM   6345  C CB   . LEU B 1 66 ? -20.424 -5.746  -4.171  1.00 0.31 ? 66  LEU B CB   3  
ATOM   6346  C CG   . LEU B 1 66 ? -20.515 -4.224  -4.411  1.00 0.28 ? 66  LEU B CG   3  
ATOM   6347  C CD1  . LEU B 1 66 ? -19.485 -3.500  -3.539  1.00 0.24 ? 66  LEU B CD1  3  
ATOM   6348  C CD2  . LEU B 1 66 ? -20.221 -3.896  -5.884  1.00 0.30 ? 66  LEU B CD2  3  
ATOM   6349  H H    . LEU B 1 66 ? -22.428 -5.936  -2.602  1.00 0.31 ? 66  LEU B H    3  
ATOM   6350  H HA   . LEU B 1 66 ? -22.123 -5.969  -5.477  1.00 0.35 ? 66  LEU B HA   3  
ATOM   6351  H HB2  . LEU B 1 66 ? -20.247 -5.934  -3.121  1.00 0.29 ? 66  LEU B HB2  3  
ATOM   6352  H HB3  . LEU B 1 66 ? -19.613 -6.158  -4.745  1.00 0.33 ? 66  LEU B HB3  3  
ATOM   6353  H HG   . LEU B 1 66 ? -21.506 -3.876  -4.154  1.00 0.27 ? 66  LEU B HG   3  
ATOM   6354  H HD11 . LEU B 1 66 ? -19.654 -3.748  -2.502  1.00 1.02 ? 66  LEU B HD11 3  
ATOM   6355  H HD12 . LEU B 1 66 ? -18.493 -3.808  -3.826  1.00 1.06 ? 66  LEU B HD12 3  
ATOM   6356  H HD13 . LEU B 1 66 ? -19.584 -2.434  -3.676  1.00 1.04 ? 66  LEU B HD13 3  
ATOM   6357  H HD21 . LEU B 1 66 ? -19.318 -4.399  -6.198  1.00 1.05 ? 66  LEU B HD21 3  
ATOM   6358  H HD22 . LEU B 1 66 ? -21.045 -4.216  -6.503  1.00 1.06 ? 66  LEU B HD22 3  
ATOM   6359  H HD23 . LEU B 1 66 ? -20.088 -2.829  -5.993  1.00 1.07 ? 66  LEU B HD23 3  
ATOM   6360  N N    . GLU B 1 67 ? -21.628 -8.722  -3.815  1.00 0.40 ? 67  GLU B N    3  
ATOM   6361  C CA   . GLU B 1 67 ? -21.419 -10.187 -3.993  1.00 0.45 ? 67  GLU B CA   3  
ATOM   6362  C C    . GLU B 1 67 ? -22.607 -10.770 -4.756  1.00 0.50 ? 67  GLU B C    3  
ATOM   6363  O O    . GLU B 1 67 ? -22.487 -11.752 -5.462  1.00 0.55 ? 67  GLU B O    3  
ATOM   6364  C CB   . GLU B 1 67 ? -21.324 -10.855 -2.620  1.00 0.46 ? 67  GLU B CB   3  
ATOM   6365  C CG   . GLU B 1 67 ? -20.046 -10.400 -1.912  1.00 0.44 ? 67  GLU B CG   3  
ATOM   6366  C CD   . GLU B 1 67 ? -18.845 -11.178 -2.456  1.00 1.13 ? 67  GLU B CD   3  
ATOM   6367  O OE1  . GLU B 1 67 ? -18.404 -10.861 -3.549  1.00 1.81 ? 67  GLU B OE1  3  
ATOM   6368  O OE2  . GLU B 1 67 ? -18.387 -12.078 -1.771  1.00 1.88 ? 67  GLU B OE2  3  
ATOM   6369  H H    . GLU B 1 67 ? -21.862 -8.362  -2.936  1.00 0.38 ? 67  GLU B H    3  
ATOM   6370  H HA   . GLU B 1 67 ? -20.509 -10.363 -4.547  1.00 0.46 ? 67  GLU B HA   3  
ATOM   6371  H HB2  . GLU B 1 67 ? -22.183 -10.575 -2.026  1.00 0.45 ? 67  GLU B HB2  3  
ATOM   6372  H HB3  . GLU B 1 67 ? -21.308 -11.928 -2.741  1.00 0.50 ? 67  GLU B HB3  3  
ATOM   6373  H HG2  . GLU B 1 67 ? -19.897 -9.343  -2.083  1.00 0.93 ? 67  GLU B HG2  3  
ATOM   6374  H HG3  . GLU B 1 67 ? -20.141 -10.583 -0.853  1.00 0.85 ? 67  GLU B HG3  3  
ATOM   6375  N N    . LEU B 1 68 ? -23.755 -10.169 -4.620  1.00 0.49 ? 68  LEU B N    3  
ATOM   6376  C CA   . LEU B 1 68 ? -24.956 -10.681 -5.340  1.00 0.54 ? 68  LEU B CA   3  
ATOM   6377  C C    . LEU B 1 68 ? -24.879 -10.269 -6.813  1.00 0.56 ? 68  LEU B C    3  
ATOM   6378  O O    . LEU B 1 68 ? -24.035 -10.733 -7.552  1.00 0.62 ? 68  LEU B O    3  
ATOM   6379  C CB   . LEU B 1 68 ? -26.220 -10.097 -4.714  1.00 0.55 ? 68  LEU B CB   3  
ATOM   6380  C CG   . LEU B 1 68 ? -26.356 -10.575 -3.266  1.00 0.55 ? 68  LEU B CG   3  
ATOM   6381  C CD1  . LEU B 1 68 ? -27.567 -9.892  -2.642  1.00 0.56 ? 68  LEU B CD1  3  
ATOM   6382  C CD2  . LEU B 1 68 ? -26.543 -12.106 -3.217  1.00 0.61 ? 68  LEU B CD2  3  
ATOM   6383  H H    . LEU B 1 68 ? -23.825 -9.377  -4.045  1.00 0.46 ? 68  LEU B H    3  
ATOM   6384  H HA   . LEU B 1 68 ? -24.989 -11.753 -5.268  1.00 0.58 ? 68  LEU B HA   3  
ATOM   6385  H HB2  . LEU B 1 68 ? -26.162 -9.018  -4.732  1.00 0.51 ? 68  LEU B HB2  3  
ATOM   6386  H HB3  . LEU B 1 68 ? -27.082 -10.418 -5.279  1.00 0.59 ? 68  LEU B HB3  3  
ATOM   6387  H HG   . LEU B 1 68 ? -25.469 -10.300 -2.714  1.00 0.52 ? 68  LEU B HG   3  
ATOM   6388  H HD11 . LEU B 1 68 ? -27.449 -8.822  -2.713  1.00 1.21 ? 68  LEU B HD11 3  
ATOM   6389  H HD12 . LEU B 1 68 ? -28.458 -10.193 -3.171  1.00 1.13 ? 68  LEU B HD12 3  
ATOM   6390  H HD13 . LEU B 1 68 ? -27.646 -10.181 -1.605  1.00 1.15 ? 68  LEU B HD13 3  
ATOM   6391  H HD21 . LEU B 1 68 ? -27.094 -12.436 -4.085  1.00 1.15 ? 68  LEU B HD21 3  
ATOM   6392  H HD22 . LEU B 1 68 ? -25.575 -12.587 -3.202  1.00 1.17 ? 68  LEU B HD22 3  
ATOM   6393  H HD23 . LEU B 1 68 ? -27.087 -12.381 -2.323  1.00 1.22 ? 68  LEU B HD23 3  
ATOM   6394  N N    . ASN B 1 69 ? -25.755 -9.401  -7.246  1.00 0.61 ? 69  ASN B N    3  
ATOM   6395  C CA   . ASN B 1 69 ? -25.735 -8.959  -8.672  1.00 0.64 ? 69  ASN B CA   3  
ATOM   6396  C C    . ASN B 1 69 ? -24.819 -7.743  -8.815  1.00 0.70 ? 69  ASN B C    3  
ATOM   6397  O O    . ASN B 1 69 ? -25.335 -6.639  -8.864  1.00 1.15 ? 69  ASN B O    3  
ATOM   6398  C CB   . ASN B 1 69 ? -27.153 -8.580  -9.106  1.00 0.82 ? 69  ASN B CB   3  
ATOM   6399  C CG   . ASN B 1 69 ? -27.767 -7.631  -8.075  1.00 1.67 ? 69  ASN B CG   3  
ATOM   6400  O OD1  . ASN B 1 69 ? -28.953 -7.370  -8.103  1.00 2.45 ? 69  ASN B OD1  3  
ATOM   6401  N ND2  . ASN B 1 69 ? -27.004 -7.099  -7.159  1.00 2.41 ? 69  ASN B ND2  3  
ATOM   6402  O OXT  . ASN B 1 69 ? -23.615 -7.936  -8.875  1.00 1.44 ? 69  ASN B OXT  3  
ATOM   6403  H H    . ASN B 1 69 ? -26.429 -9.040  -6.635  1.00 0.69 ? 69  ASN B H    3  
ATOM   6404  H HA   . ASN B 1 69 ? -25.371 -9.761  -9.297  1.00 0.62 ? 69  ASN B HA   3  
ATOM   6405  H HB2  . ASN B 1 69 ? -27.115 -8.092  -10.070 1.00 1.42 ? 69  ASN B HB2  3  
ATOM   6406  H HB3  . ASN B 1 69 ? -27.758 -9.471  -9.177  1.00 1.27 ? 69  ASN B HB3  3  
ATOM   6407  H HD21 . ASN B 1 69 ? -26.047 -7.309  -7.137  1.00 2.52 ? 69  ASN B HD21 3  
ATOM   6408  H HD22 . ASN B 1 69 ? -27.388 -6.489  -6.496  1.00 3.22 ? 69  ASN B HD22 3  
HETATM 6409  O O    . HOH C 2 .  ? 6.332   1.520   5.946   1.00 0.36 ? 201 HOH A O    3  
HETATM 6410  H H1   . HOH C 2 .  ? 5.497   1.954   6.122   1.00 0.78 ? 201 HOH A H1   3  
HETATM 6411  H H2   . HOH C 2 .  ? 6.978   2.038   6.428   1.00 0.36 ? 201 HOH A H2   3  
HETATM 6412  O O    . HOH C 2 .  ? 4.303   5.582   6.786   1.00 0.70 ? 202 HOH A O    3  
HETATM 6413  H H1   . HOH C 2 .  ? 3.498   5.864   6.352   1.00 1.01 ? 202 HOH A H1   3  
HETATM 6414  H H2   . HOH C 2 .  ? 4.012   4.946   7.440   1.00 1.21 ? 202 HOH A H2   3  
HETATM 6415  O O    . HOH D 2 .  ? -6.459  -1.378  5.950   1.00 0.35 ? 301 HOH B O    3  
HETATM 6416  H H1   . HOH D 2 .  ? -5.749  -1.223  6.574   1.00 0.68 ? 301 HOH B H1   3  
HETATM 6417  H H2   . HOH D 2 .  ? -7.099  -1.898  6.437   1.00 0.31 ? 301 HOH B H2   3  
HETATM 6418  O O    . HOH D 2 .  ? -4.428  -5.431  6.851   1.00 1.65 ? 302 HOH B O    3  
HETATM 6419  H H1   . HOH D 2 .  ? -4.434  -4.650  6.296   1.00 1.48 ? 302 HOH B H1   3  
HETATM 6420  H H2   . HOH D 2 .  ? -4.656  -5.107  7.722   1.00 2.04 ? 302 HOH B H2   3  
ATOM   6421  N N    . ALA A 1 1  ? -8.048  16.194  -13.626 1.00 3.98 ? 1   ALA A N    4  
ATOM   6422  C CA   . ALA A 1 1  ? -7.291  15.461  -12.570 1.00 3.41 ? 1   ALA A CA   4  
ATOM   6423  C C    . ALA A 1 1  ? -8.038  15.566  -11.232 1.00 2.89 ? 1   ALA A C    4  
ATOM   6424  O O    . ALA A 1 1  ? -7.558  16.206  -10.317 1.00 2.91 ? 1   ALA A O    4  
ATOM   6425  C CB   . ALA A 1 1  ? -5.901  16.084  -12.423 1.00 3.83 ? 1   ALA A CB   4  
ATOM   6426  H H1   . ALA A 1 1  ? -9.006  16.403  -13.283 1.00 4.33 ? 1   ALA A H1   4  
ATOM   6427  H H2   . ALA A 1 1  ? -7.560  17.084  -13.846 1.00 4.29 ? 1   ALA A H2   4  
ATOM   6428  H H3   . ALA A 1 1  ? -8.105  15.606  -14.482 1.00 4.21 ? 1   ALA A H3   4  
ATOM   6429  H HA   . ALA A 1 1  ? -7.189  14.425  -12.852 1.00 3.58 ? 1   ALA A HA   4  
ATOM   6430  H HB1  . ALA A 1 1  ? -5.444  16.179  -13.397 1.00 4.06 ? 1   ALA A HB1  4  
ATOM   6431  H HB2  . ALA A 1 1  ? -5.990  17.060  -11.970 1.00 4.06 ? 1   ALA A HB2  4  
ATOM   6432  H HB3  . ALA A 1 1  ? -5.288  15.451  -11.798 1.00 4.22 ? 1   ALA A HB3  4  
ATOM   6433  N N    . PRO A 1 2  ? -9.193  14.939  -11.147 1.00 2.53 ? 2   PRO A N    4  
ATOM   6434  C CA   . PRO A 1 2  ? -9.997  14.974  -9.910  1.00 2.14 ? 2   PRO A CA   4  
ATOM   6435  C C    . PRO A 1 2  ? -9.222  14.300  -8.768  1.00 1.85 ? 2   PRO A C    4  
ATOM   6436  O O    . PRO A 1 2  ? -8.520  13.329  -8.970  1.00 1.89 ? 2   PRO A O    4  
ATOM   6437  C CB   . PRO A 1 2  ? -11.293 14.197  -10.253 1.00 1.96 ? 2   PRO A CB   4  
ATOM   6438  C CG   . PRO A 1 2  ? -11.158 13.688  -11.720 1.00 2.21 ? 2   PRO A CG   4  
ATOM   6439  C CD   . PRO A 1 2  ? -9.787  14.158  -12.254 1.00 2.60 ? 2   PRO A CD   4  
ATOM   6440  H HA   . PRO A 1 2  ? -10.235 15.994  -9.648  1.00 2.39 ? 2   PRO A HA   4  
ATOM   6441  H HB2  . PRO A 1 2  ? -11.420 13.357  -9.578  1.00 1.69 ? 2   PRO A HB2  4  
ATOM   6442  H HB3  . PRO A 1 2  ? -12.149 14.854  -10.175 1.00 2.13 ? 2   PRO A HB3  4  
ATOM   6443  H HG2  . PRO A 1 2  ? -11.215 12.605  -11.740 1.00 2.13 ? 2   PRO A HG2  4  
ATOM   6444  H HG3  . PRO A 1 2  ? -11.951 14.102  -12.330 1.00 2.39 ? 2   PRO A HG3  4  
ATOM   6445  H HD2  . PRO A 1 2  ? -9.165  13.305  -12.491 1.00 2.71 ? 2   PRO A HD2  4  
ATOM   6446  H HD3  . PRO A 1 2  ? -9.912  14.786  -13.125 1.00 2.93 ? 2   PRO A HD3  4  
ATOM   6447  N N    . MET A 1 3  ? -9.344  14.810  -7.573  1.00 1.69 ? 3   MET A N    4  
ATOM   6448  C CA   . MET A 1 3  ? -8.618  14.201  -6.424  1.00 1.53 ? 3   MET A CA   4  
ATOM   6449  C C    . MET A 1 3  ? -9.374  12.961  -5.941  1.00 1.17 ? 3   MET A C    4  
ATOM   6450  O O    . MET A 1 3  ? -10.546 13.021  -5.625  1.00 0.99 ? 3   MET A O    4  
ATOM   6451  C CB   . MET A 1 3  ? -8.520  15.218  -5.286  1.00 1.63 ? 3   MET A CB   4  
ATOM   6452  C CG   . MET A 1 3  ? -7.804  16.474  -5.787  1.00 2.15 ? 3   MET A CG   4  
ATOM   6453  S SD   . MET A 1 3  ? -7.926  17.778  -4.537  1.00 2.54 ? 3   MET A SD   4  
ATOM   6454  C CE   . MET A 1 3  ? -6.780  18.943  -5.313  1.00 3.59 ? 3   MET A CE   4  
ATOM   6455  H H    . MET A 1 3  ? -9.916  15.593  -7.432  1.00 1.78 ? 3   MET A H    4  
ATOM   6456  H HA   . MET A 1 3  ? -7.624  13.916  -6.738  1.00 1.74 ? 3   MET A HA   4  
ATOM   6457  H HB2  . MET A 1 3  ? -9.514  15.479  -4.951  1.00 1.99 ? 3   MET A HB2  4  
ATOM   6458  H HB3  . MET A 1 3  ? -7.964  14.791  -4.467  1.00 1.87 ? 3   MET A HB3  4  
ATOM   6459  H HG2  . MET A 1 3  ? -6.763  16.247  -5.969  1.00 2.61 ? 3   MET A HG2  4  
ATOM   6460  H HG3  . MET A 1 3  ? -8.265  16.811  -6.704  1.00 2.68 ? 3   MET A HG3  4  
ATOM   6461  H HE1  . MET A 1 3  ? -5.832  18.452  -5.487  1.00 3.92 ? 3   MET A HE1  4  
ATOM   6462  H HE2  . MET A 1 3  ? -7.193  19.283  -6.252  1.00 4.04 ? 3   MET A HE2  4  
ATOM   6463  H HE3  . MET A 1 3  ? -6.629  19.789  -4.662  1.00 4.01 ? 3   MET A HE3  4  
ATOM   6464  N N    . GLY A 1 4  ? -8.712  11.837  -5.881  1.00 1.14 ? 4   GLY A N    4  
ATOM   6465  C CA   . GLY A 1 4  ? -9.393  10.594  -5.418  1.00 0.89 ? 4   GLY A CA   4  
ATOM   6466  C C    . GLY A 1 4  ? -10.086 10.855  -4.082  1.00 0.62 ? 4   GLY A C    4  
ATOM   6467  O O    . GLY A 1 4  ? -9.960  11.916  -3.504  1.00 0.70 ? 4   GLY A O    4  
ATOM   6468  H H    . GLY A 1 4  ? -7.768  11.810  -6.141  1.00 1.36 ? 4   GLY A H    4  
ATOM   6469  H HA2  . GLY A 1 4  ? -10.126 10.290  -6.153  1.00 0.84 ? 4   GLY A HA2  4  
ATOM   6470  H HA3  . GLY A 1 4  ? -8.666  9.811   -5.291  1.00 1.04 ? 4   GLY A HA3  4  
ATOM   6471  N N    . SER A 1 5  ? -10.822 9.895   -3.584  1.00 0.44 ? 5   SER A N    4  
ATOM   6472  C CA   . SER A 1 5  ? -11.526 10.090  -2.284  1.00 0.30 ? 5   SER A CA   4  
ATOM   6473  C C    . SER A 1 5  ? -10.594 9.689   -1.124  1.00 0.27 ? 5   SER A C    4  
ATOM   6474  O O    . SER A 1 5  ? -10.122 10.529  -0.384  1.00 0.30 ? 5   SER A O    4  
ATOM   6475  C CB   . SER A 1 5  ? -12.817 9.255   -2.273  1.00 0.49 ? 5   SER A CB   4  
ATOM   6476  O OG   . SER A 1 5  ? -13.932 10.129  -2.144  1.00 1.52 ? 5   SER A OG   4  
ATOM   6477  H H    . SER A 1 5  ? -10.912 9.047   -4.066  1.00 0.56 ? 5   SER A H    4  
ATOM   6478  H HA   . SER A 1 5  ? -11.787 11.131  -2.179  1.00 0.39 ? 5   SER A HA   4  
ATOM   6479  H HB2  . SER A 1 5  ? -12.902 8.717   -3.202  1.00 0.93 ? 5   SER A HB2  4  
ATOM   6480  H HB3  . SER A 1 5  ? -12.805 8.552   -1.452  1.00 0.96 ? 5   SER A HB3  4  
ATOM   6481  H HG   . SER A 1 5  ? -14.160 10.449  -3.019  1.00 2.00 ? 5   SER A HG   4  
ATOM   6482  N N    . ASP A 1 6  ? -10.321 8.418   -0.959  1.00 0.24 ? 6   ASP A N    4  
ATOM   6483  C CA   . ASP A 1 6  ? -9.416  7.993   0.156   1.00 0.23 ? 6   ASP A CA   4  
ATOM   6484  C C    . ASP A 1 6  ? -8.844  6.596   -0.139  1.00 0.21 ? 6   ASP A C    4  
ATOM   6485  O O    . ASP A 1 6  ? -9.218  5.636   0.506   1.00 0.20 ? 6   ASP A O    4  
ATOM   6486  C CB   . ASP A 1 6  ? -10.202 7.954   1.479   1.00 0.25 ? 6   ASP A CB   4  
ATOM   6487  C CG   . ASP A 1 6  ? -9.228  8.009   2.660   1.00 1.26 ? 6   ASP A CG   4  
ATOM   6488  O OD1  . ASP A 1 6  ? -8.050  7.778   2.441   1.00 2.03 ? 6   ASP A OD1  4  
ATOM   6489  O OD2  . ASP A 1 6  ? -9.678  8.282   3.761   1.00 2.00 ? 6   ASP A OD2  4  
ATOM   6490  H H    . ASP A 1 6  ? -10.705 7.748   -1.567  1.00 0.24 ? 6   ASP A H    4  
ATOM   6491  H HA   . ASP A 1 6  ? -8.606  8.702   0.244   1.00 0.25 ? 6   ASP A HA   4  
ATOM   6492  H HB2  . ASP A 1 6  ? -10.869 8.802   1.527   1.00 0.79 ? 6   ASP A HB2  4  
ATOM   6493  H HB3  . ASP A 1 6  ? -10.778 7.042   1.537   1.00 0.94 ? 6   ASP A HB3  4  
ATOM   6494  N N    . PRO A 1 7  ? -7.960  6.511   -1.108  1.00 0.22 ? 7   PRO A N    4  
ATOM   6495  C CA   . PRO A 1 7  ? -7.353  5.219   -1.481  1.00 0.22 ? 7   PRO A CA   4  
ATOM   6496  C C    . PRO A 1 7  ? -6.468  4.697   -0.327  1.00 0.20 ? 7   PRO A C    4  
ATOM   6497  O O    . PRO A 1 7  ? -6.143  5.442   0.576   1.00 0.20 ? 7   PRO A O    4  
ATOM   6498  C CB   . PRO A 1 7  ? -6.514  5.527   -2.745  1.00 0.25 ? 7   PRO A CB   4  
ATOM   6499  C CG   . PRO A 1 7  ? -6.614  7.060   -3.011  1.00 0.27 ? 7   PRO A CG   4  
ATOM   6500  C CD   . PRO A 1 7  ? -7.504  7.669   -1.905  1.00 0.26 ? 7   PRO A CD   4  
ATOM   6501  H HA   . PRO A 1 7  ? -8.131  4.515   -1.712  1.00 0.21 ? 7   PRO A HA   4  
ATOM   6502  H HB2  . PRO A 1 7  ? -5.479  5.242   -2.589  1.00 0.26 ? 7   PRO A HB2  4  
ATOM   6503  H HB3  . PRO A 1 7  ? -6.912  4.986   -3.594  1.00 0.27 ? 7   PRO A HB3  4  
ATOM   6504  H HG2  . PRO A 1 7  ? -5.625  7.504   -2.982  1.00 0.28 ? 7   PRO A HG2  4  
ATOM   6505  H HG3  . PRO A 1 7  ? -7.062  7.240   -3.980  1.00 0.29 ? 7   PRO A HG3  4  
ATOM   6506  H HD2  . PRO A 1 7  ? -6.925  8.346   -1.289  1.00 0.28 ? 7   PRO A HD2  4  
ATOM   6507  H HD3  . PRO A 1 7  ? -8.353  8.182   -2.333  1.00 0.28 ? 7   PRO A HD3  4  
ATOM   6508  N N    . PRO A 1 8  ? -6.095  3.431   -0.389  1.00 0.21 ? 8   PRO A N    4  
ATOM   6509  C CA   . PRO A 1 8  ? -5.240  2.821   0.653   1.00 0.22 ? 8   PRO A CA   4  
ATOM   6510  C C    . PRO A 1 8  ? -3.872  3.521   0.683   1.00 0.22 ? 8   PRO A C    4  
ATOM   6511  O O    . PRO A 1 8  ? -3.728  4.644   0.239   1.00 0.22 ? 8   PRO A O    4  
ATOM   6512  C CB   . PRO A 1 8  ? -5.101  1.337   0.229   1.00 0.24 ? 8   PRO A CB   4  
ATOM   6513  C CG   . PRO A 1 8  ? -5.746  1.194   -1.179  1.00 0.26 ? 8   PRO A CG   4  
ATOM   6514  C CD   . PRO A 1 8  ? -6.488  2.514   -1.482  1.00 0.24 ? 8   PRO A CD   4  
ATOM   6515  H HA   . PRO A 1 8  ? -5.718  2.890   1.618   1.00 0.22 ? 8   PRO A HA   4  
ATOM   6516  H HB2  . PRO A 1 8  ? -4.056  1.048   0.190   1.00 0.26 ? 8   PRO A HB2  4  
ATOM   6517  H HB3  . PRO A 1 8  ? -5.624  0.703   0.932   1.00 0.25 ? 8   PRO A HB3  4  
ATOM   6518  H HG2  . PRO A 1 8  ? -4.975  1.023   -1.921  1.00 0.28 ? 8   PRO A HG2  4  
ATOM   6519  H HG3  . PRO A 1 8  ? -6.446  0.369   -1.186  1.00 0.27 ? 8   PRO A HG3  4  
ATOM   6520  H HD2  . PRO A 1 8  ? -6.182  2.913   -2.441  1.00 0.25 ? 8   PRO A HD2  4  
ATOM   6521  H HD3  . PRO A 1 8  ? -7.554  2.352   -1.463  1.00 0.24 ? 8   PRO A HD3  4  
ATOM   6522  N N    . THR A 1 9  ? -2.869  2.864   1.203   1.00 0.23 ? 9   THR A N    4  
ATOM   6523  C CA   . THR A 1 9  ? -1.513  3.483   1.264   1.00 0.24 ? 9   THR A CA   4  
ATOM   6524  C C    . THR A 1 9  ? -0.452  2.384   1.269   1.00 0.24 ? 9   THR A C    4  
ATOM   6525  O O    . THR A 1 9  ? -0.441  1.517   2.120   1.00 0.25 ? 9   THR A O    4  
ATOM   6526  C CB   . THR A 1 9  ? -1.391  4.313   2.541   1.00 0.25 ? 9   THR A CB   4  
ATOM   6527  O OG1  . THR A 1 9  ? -2.535  5.144   2.673   1.00 0.26 ? 9   THR A OG1  4  
ATOM   6528  C CG2  . THR A 1 9  ? -0.132  5.181   2.472   1.00 0.29 ? 9   THR A CG2  4  
ATOM   6529  H H    . THR A 1 9  ? -3.009  1.958   1.556   1.00 0.24 ? 9   THR A H    4  
ATOM   6530  H HA   . THR A 1 9  ? -1.361  4.117   0.402   1.00 0.25 ? 9   THR A HA   4  
ATOM   6531  H HB   . THR A 1 9  ? -1.323  3.652   3.390   1.00 0.26 ? 9   THR A HB   4  
ATOM   6532  H HG1  . THR A 1 9  ? -2.447  5.642   3.489   1.00 0.86 ? 9   THR A HG1  4  
ATOM   6533  H HG21 . THR A 1 9  ? 0.728   4.555   2.281   1.00 1.03 ? 9   THR A HG21 4  
ATOM   6534  H HG22 . THR A 1 9  ? -0.235  5.904   1.675   1.00 1.07 ? 9   THR A HG22 4  
ATOM   6535  H HG23 . THR A 1 9  ? 0.000   5.696   3.411   1.00 1.07 ? 9   THR A HG23 4  
ATOM   6536  N N    . ALA A 1 10 ? 0.441   2.418   0.321   1.00 0.23 ? 10  ALA A N    4  
ATOM   6537  C CA   . ALA A 1 10 ? 1.506   1.383   0.259   1.00 0.23 ? 10  ALA A CA   4  
ATOM   6538  C C    . ALA A 1 10 ? 2.465   1.560   1.435   1.00 0.22 ? 10  ALA A C    4  
ATOM   6539  O O    . ALA A 1 10 ? 3.523   2.141   1.302   1.00 0.27 ? 10  ALA A O    4  
ATOM   6540  C CB   . ALA A 1 10 ? 2.278   1.539   -1.050  1.00 0.23 ? 10  ALA A CB   4  
ATOM   6541  H H    . ALA A 1 10 ? 0.410   3.129   -0.353  1.00 0.22 ? 10  ALA A H    4  
ATOM   6542  H HA   . ALA A 1 10 ? 1.062   0.399   0.302   1.00 0.24 ? 10  ALA A HA   4  
ATOM   6543  H HB1  . ALA A 1 10 ? 2.582   2.569   -1.166  1.00 0.99 ? 10  ALA A HB1  4  
ATOM   6544  H HB2  . ALA A 1 10 ? 3.151   0.906   -1.031  1.00 0.99 ? 10  ALA A HB2  4  
ATOM   6545  H HB3  . ALA A 1 10 ? 1.643   1.256   -1.877  1.00 0.99 ? 10  ALA A HB3  4  
ATOM   6546  N N    . CYS A 1 11 ? 2.105   1.048   2.585   1.00 0.25 ? 11  CYS A N    4  
ATOM   6547  C CA   . CYS A 1 11 ? 2.990   1.164   3.786   1.00 0.25 ? 11  CYS A CA   4  
ATOM   6548  C C    . CYS A 1 11 ? 3.575   -0.215  4.094   1.00 0.25 ? 11  CYS A C    4  
ATOM   6549  O O    . CYS A 1 11 ? 2.885   -1.215  4.046   1.00 0.26 ? 11  CYS A O    4  
ATOM   6550  C CB   . CYS A 1 11 ? 2.166   1.650   4.982   1.00 0.25 ? 11  CYS A CB   4  
ATOM   6551  S SG   . CYS A 1 11 ? 1.242   3.134   4.515   1.00 0.33 ? 11  CYS A SG   4  
ATOM   6552  H H    . CYS A 1 11 ? 1.249   0.577   2.659   1.00 0.30 ? 11  CYS A H    4  
ATOM   6553  H HA   . CYS A 1 11 ? 3.795   1.862   3.596   1.00 0.25 ? 11  CYS A HA   4  
ATOM   6554  H HB2  . CYS A 1 11 ? 1.476   0.875   5.282   1.00 0.29 ? 11  CYS A HB2  4  
ATOM   6555  H HB3  . CYS A 1 11 ? 2.827   1.881   5.805   1.00 0.29 ? 11  CYS A HB3  4  
ATOM   6556  N N    . CYS A 1 12 ? 4.841   -0.282  4.396   1.00 0.24 ? 12  CYS A N    4  
ATOM   6557  C CA   . CYS A 1 12 ? 5.461   -1.603  4.693   1.00 0.24 ? 12  CYS A CA   4  
ATOM   6558  C C    . CYS A 1 12 ? 4.988   -2.098  6.059   1.00 0.24 ? 12  CYS A C    4  
ATOM   6559  O O    . CYS A 1 12 ? 4.816   -1.331  6.985   1.00 0.27 ? 12  CYS A O    4  
ATOM   6560  C CB   . CYS A 1 12 ? 6.985   -1.466  4.703   1.00 0.24 ? 12  CYS A CB   4  
ATOM   6561  S SG   . CYS A 1 12 ? 7.558   -0.956  3.064   1.00 0.24 ? 12  CYS A SG   4  
ATOM   6562  H H    . CYS A 1 12 ? 5.384   0.533   4.421   1.00 0.24 ? 12  CYS A H    4  
ATOM   6563  H HA   . CYS A 1 12 ? 5.171   -2.314  3.934   1.00 0.26 ? 12  CYS A HA   4  
ATOM   6564  H HB2  . CYS A 1 12 ? 7.276   -0.726  5.432   1.00 0.27 ? 12  CYS A HB2  4  
ATOM   6565  H HB3  . CYS A 1 12 ? 7.430   -2.416  4.960   1.00 0.24 ? 12  CYS A HB3  4  
ATOM   6566  N N    . PHE A 1 13 ? 4.788   -3.385  6.193   1.00 0.25 ? 13  PHE A N    4  
ATOM   6567  C CA   . PHE A 1 13 ? 4.338   -3.959  7.496   1.00 0.27 ? 13  PHE A CA   4  
ATOM   6568  C C    . PHE A 1 13 ? 5.541   -4.619  8.172   1.00 0.24 ? 13  PHE A C    4  
ATOM   6569  O O    . PHE A 1 13 ? 5.540   -4.888  9.357   1.00 0.26 ? 13  PHE A O    4  
ATOM   6570  C CB   . PHE A 1 13 ? 3.250   -5.008  7.242   1.00 0.30 ? 13  PHE A CB   4  
ATOM   6571  C CG   . PHE A 1 13 ? 3.848   -6.180  6.503   1.00 0.31 ? 13  PHE A CG   4  
ATOM   6572  C CD1  . PHE A 1 13 ? 4.117   -6.079  5.127   1.00 0.31 ? 13  PHE A CD1  4  
ATOM   6573  C CD2  . PHE A 1 13 ? 4.146   -7.371  7.195   1.00 0.35 ? 13  PHE A CD2  4  
ATOM   6574  C CE1  . PHE A 1 13 ? 4.684   -7.167  4.439   1.00 0.34 ? 13  PHE A CE1  4  
ATOM   6575  C CE2  . PHE A 1 13 ? 4.715   -8.459  6.508   1.00 0.37 ? 13  PHE A CE2  4  
ATOM   6576  C CZ   . PHE A 1 13 ? 4.984   -8.358  5.130   1.00 0.37 ? 13  PHE A CZ   4  
ATOM   6577  H H    . PHE A 1 13 ? 4.944   -3.979  5.430   1.00 0.25 ? 13  PHE A H    4  
ATOM   6578  H HA   . PHE A 1 13 ? 3.945   -3.180  8.132   1.00 0.29 ? 13  PHE A HA   4  
ATOM   6579  H HB2  . PHE A 1 13 ? 2.844   -5.342  8.186   1.00 0.33 ? 13  PHE A HB2  4  
ATOM   6580  H HB3  . PHE A 1 13 ? 2.462   -4.572  6.645   1.00 0.31 ? 13  PHE A HB3  4  
ATOM   6581  H HD1  . PHE A 1 13 ? 3.886   -5.167  4.595   1.00 0.30 ? 13  PHE A HD1  4  
ATOM   6582  H HD2  . PHE A 1 13 ? 3.939   -7.447  8.252   1.00 0.36 ? 13  PHE A HD2  4  
ATOM   6583  H HE1  . PHE A 1 13 ? 4.890   -7.089  3.383   1.00 0.36 ? 13  PHE A HE1  4  
ATOM   6584  H HE2  . PHE A 1 13 ? 4.943   -9.372  7.039   1.00 0.40 ? 13  PHE A HE2  4  
ATOM   6585  H HZ   . PHE A 1 13 ? 5.420   -9.193  4.602   1.00 0.40 ? 13  PHE A HZ   4  
ATOM   6586  N N    . SER A 1 14 ? 6.570   -4.878  7.411   1.00 0.21 ? 14  SER A N    4  
ATOM   6587  C CA   . SER A 1 14 ? 7.790   -5.517  7.974   1.00 0.20 ? 14  SER A CA   4  
ATOM   6588  C C    . SER A 1 14 ? 8.981   -5.184  7.074   1.00 0.18 ? 14  SER A C    4  
ATOM   6589  O O    . SER A 1 14 ? 9.006   -4.159  6.421   1.00 0.17 ? 14  SER A O    4  
ATOM   6590  C CB   . SER A 1 14 ? 7.597   -7.033  8.027   1.00 0.20 ? 14  SER A CB   4  
ATOM   6591  O OG   . SER A 1 14 ? 7.445   -7.534  6.706   1.00 0.25 ? 14  SER A OG   4  
ATOM   6592  H H    . SER A 1 14 ? 6.539   -4.648  6.459   1.00 0.21 ? 14  SER A H    4  
ATOM   6593  H HA   . SER A 1 14 ? 7.972   -5.138  8.970   1.00 0.22 ? 14  SER A HA   4  
ATOM   6594  H HB2  . SER A 1 14 ? 8.458   -7.492  8.484   1.00 0.24 ? 14  SER A HB2  4  
ATOM   6595  H HB3  . SER A 1 14 ? 6.717   -7.262  8.614   1.00 0.24 ? 14  SER A HB3  4  
ATOM   6596  H HG   . SER A 1 14 ? 8.319   -7.624  6.320   1.00 0.84 ? 14  SER A HG   4  
ATOM   6597  N N    . TYR A 1 15 ? 9.970   -6.036  7.029   1.00 0.19 ? 15  TYR A N    4  
ATOM   6598  C CA   . TYR A 1 15 ? 11.157  -5.758  6.166   1.00 0.20 ? 15  TYR A CA   4  
ATOM   6599  C C    . TYR A 1 15 ? 11.830  -7.075  5.786   1.00 0.24 ? 15  TYR A C    4  
ATOM   6600  O O    . TYR A 1 15 ? 11.613  -8.096  6.410   1.00 0.29 ? 15  TYR A O    4  
ATOM   6601  C CB   . TYR A 1 15 ? 12.155  -4.877  6.929   1.00 0.22 ? 15  TYR A CB   4  
ATOM   6602  C CG   . TYR A 1 15 ? 11.411  -3.824  7.716   1.00 0.21 ? 15  TYR A CG   4  
ATOM   6603  C CD1  . TYR A 1 15 ? 11.022  -2.622  7.093   1.00 0.21 ? 15  TYR A CD1  4  
ATOM   6604  C CD2  . TYR A 1 15 ? 11.105  -4.045  9.072   1.00 0.25 ? 15  TYR A CD2  4  
ATOM   6605  C CE1  . TYR A 1 15 ? 10.328  -1.642  7.827   1.00 0.23 ? 15  TYR A CE1  4  
ATOM   6606  C CE2  . TYR A 1 15 ? 10.411  -3.064  9.807   1.00 0.28 ? 15  TYR A CE2  4  
ATOM   6607  C CZ   . TYR A 1 15 ? 10.022  -1.862  9.184   1.00 0.27 ? 15  TYR A CZ   4  
ATOM   6608  O OH   . TYR A 1 15 ? 9.342   -0.901  9.903   1.00 0.32 ? 15  TYR A OH   4  
ATOM   6609  H H    . TYR A 1 15 ? 9.934   -6.858  7.562   1.00 0.21 ? 15  TYR A H    4  
ATOM   6610  H HA   . TYR A 1 15 ? 10.842  -5.250  5.264   1.00 0.18 ? 15  TYR A HA   4  
ATOM   6611  H HB2  . TYR A 1 15 ? 12.731  -5.488  7.610   1.00 0.25 ? 15  TYR A HB2  4  
ATOM   6612  H HB3  . TYR A 1 15 ? 12.819  -4.397  6.229   1.00 0.22 ? 15  TYR A HB3  4  
ATOM   6613  H HD1  . TYR A 1 15 ? 11.256  -2.452  6.053   1.00 0.20 ? 15  TYR A HD1  4  
ATOM   6614  H HD2  . TYR A 1 15 ? 11.403  -4.967  9.549   1.00 0.27 ? 15  TYR A HD2  4  
ATOM   6615  H HE1  . TYR A 1 15 ? 10.030  -0.720  7.351   1.00 0.24 ? 15  TYR A HE1  4  
ATOM   6616  H HE2  . TYR A 1 15 ? 10.176  -3.234  10.848  1.00 0.33 ? 15  TYR A HE2  4  
ATOM   6617  H HH   . TYR A 1 15 ? 9.545   -1.029  10.833  1.00 0.89 ? 15  TYR A HH   4  
ATOM   6618  N N    . THR A 1 16 ? 12.651  -7.062  4.771   1.00 0.22 ? 16  THR A N    4  
ATOM   6619  C CA   . THR A 1 16 ? 13.343  -8.318  4.367   1.00 0.28 ? 16  THR A CA   4  
ATOM   6620  C C    . THR A 1 16 ? 14.215  -8.799  5.529   1.00 0.32 ? 16  THR A C    4  
ATOM   6621  O O    . THR A 1 16 ? 13.900  -8.581  6.682   1.00 0.38 ? 16  THR A O    4  
ATOM   6622  C CB   . THR A 1 16 ? 14.192  -8.064  3.114   1.00 0.28 ? 16  THR A CB   4  
ATOM   6623  O OG1  . THR A 1 16 ? 14.856  -9.262  2.737   1.00 0.39 ? 16  THR A OG1  4  
ATOM   6624  C CG2  . THR A 1 16 ? 15.223  -6.968  3.386   1.00 0.27 ? 16  THR A CG2  4  
ATOM   6625  H H    . THR A 1 16 ? 12.821  -6.224  4.286   1.00 0.19 ? 16  THR A H    4  
ATOM   6626  H HA   . THR A 1 16 ? 12.602  -9.074  4.148   1.00 0.30 ? 16  THR A HA   4  
ATOM   6627  H HB   . THR A 1 16 ? 13.548  -7.748  2.308   1.00 0.27 ? 16  THR A HB   4  
ATOM   6628  H HG1  . THR A 1 16 ? 14.210  -9.972  2.741   1.00 0.86 ? 16  THR A HG1  4  
ATOM   6629  H HG21 . THR A 1 16 ? 14.740  -6.128  3.861   1.00 1.04 ? 16  THR A HG21 4  
ATOM   6630  H HG22 . THR A 1 16 ? 15.997  -7.354  4.033   1.00 1.06 ? 16  THR A HG22 4  
ATOM   6631  H HG23 . THR A 1 16 ? 15.663  -6.649  2.451   1.00 1.07 ? 16  THR A HG23 4  
ATOM   6632  N N    . ALA A 1 17 ? 15.307  -9.457  5.249   1.00 0.36 ? 17  ALA A N    4  
ATOM   6633  C CA   . ALA A 1 17 ? 16.186  -9.950  6.350   1.00 0.42 ? 17  ALA A CA   4  
ATOM   6634  C C    . ALA A 1 17 ? 17.642  -9.921  5.887   1.00 0.45 ? 17  ALA A C    4  
ATOM   6635  O O    . ALA A 1 17 ? 18.545  -9.668  6.661   1.00 0.63 ? 17  ALA A O    4  
ATOM   6636  C CB   . ALA A 1 17 ? 15.787  -11.384 6.707   1.00 0.50 ? 17  ALA A CB   4  
ATOM   6637  H H    . ALA A 1 17 ? 15.549  -9.629  4.318   1.00 0.39 ? 17  ALA A H    4  
ATOM   6638  H HA   . ALA A 1 17 ? 16.075  -9.319  7.220   1.00 0.42 ? 17  ALA A HA   4  
ATOM   6639  H HB1  . ALA A 1 17 ? 15.635  -11.950 5.800   1.00 1.18 ? 17  ALA A HB1  4  
ATOM   6640  H HB2  . ALA A 1 17 ? 16.569  -11.841 7.293   1.00 1.12 ? 17  ALA A HB2  4  
ATOM   6641  H HB3  . ALA A 1 17 ? 14.871  -11.369 7.278   1.00 1.12 ? 17  ALA A HB3  4  
ATOM   6642  N N    . ARG A 1 18 ? 17.878  -10.170 4.628   1.00 0.47 ? 18  ARG A N    4  
ATOM   6643  C CA   . ARG A 1 18 ? 19.275  -10.149 4.102   1.00 0.48 ? 18  ARG A CA   4  
ATOM   6644  C C    . ARG A 1 18 ? 19.560  -8.775  3.493   1.00 0.41 ? 18  ARG A C    4  
ATOM   6645  O O    . ARG A 1 18 ? 18.809  -8.279  2.677   1.00 0.37 ? 18  ARG A O    4  
ATOM   6646  C CB   . ARG A 1 18 ? 19.428  -11.229 3.020   1.00 0.53 ? 18  ARG A CB   4  
ATOM   6647  C CG   . ARG A 1 18 ? 19.637  -12.599 3.674   1.00 0.70 ? 18  ARG A CG   4  
ATOM   6648  C CD   . ARG A 1 18 ? 18.393  -12.993 4.474   1.00 1.15 ? 18  ARG A CD   4  
ATOM   6649  N NE   . ARG A 1 18 ? 18.405  -14.465 4.711   1.00 1.96 ? 18  ARG A NE   4  
ATOM   6650  C CZ   . ARG A 1 18 ? 17.626  -14.988 5.617   1.00 2.64 ? 18  ARG A CZ   4  
ATOM   6651  N NH1  . ARG A 1 18 ? 16.845  -14.221 6.326   1.00 2.84 ? 18  ARG A NH1  4  
ATOM   6652  N NH2  . ARG A 1 18 ? 17.631  -16.277 5.817   1.00 3.63 ? 18  ARG A NH2  4  
ATOM   6653  H H    . ARG A 1 18 ? 17.133  -10.366 4.024   1.00 0.61 ? 18  ARG A H    4  
ATOM   6654  H HA   . ARG A 1 18 ? 19.976  -10.339 4.905   1.00 0.52 ? 18  ARG A HA   4  
ATOM   6655  H HB2  . ARG A 1 18 ? 18.536  -11.254 2.412   1.00 0.55 ? 18  ARG A HB2  4  
ATOM   6656  H HB3  . ARG A 1 18 ? 20.280  -10.998 2.396   1.00 0.55 ? 18  ARG A HB3  4  
ATOM   6657  H HG2  . ARG A 1 18 ? 19.818  -13.337 2.906   1.00 1.27 ? 18  ARG A HG2  4  
ATOM   6658  H HG3  . ARG A 1 18 ? 20.489  -12.555 4.336   1.00 1.20 ? 18  ARG A HG3  4  
ATOM   6659  H HD2  . ARG A 1 18 ? 18.395  -12.475 5.422   1.00 1.77 ? 18  ARG A HD2  4  
ATOM   6660  H HD3  . ARG A 1 18 ? 17.504  -12.728 3.920   1.00 1.64 ? 18  ARG A HD3  4  
ATOM   6661  H HE   . ARG A 1 18 ? 18.996  -15.041 4.182   1.00 2.46 ? 18  ARG A HE   4  
ATOM   6662  H HH11 . ARG A 1 18 ? 16.843  -13.233 6.174   1.00 2.56 ? 18  ARG A HH11 4  
ATOM   6663  H HH12 . ARG A 1 18 ? 16.247  -14.621 7.021   1.00 3.61 ? 18  ARG A HH12 4  
ATOM   6664  H HH21 . ARG A 1 18 ? 18.232  -16.864 5.276   1.00 3.98 ? 18  ARG A HH21 4  
ATOM   6665  H HH22 . ARG A 1 18 ? 17.034  -16.677 6.512   1.00 4.24 ? 18  ARG A HH22 4  
ATOM   6666  N N    . LYS A 1 19 ? 20.643  -8.160  3.878   1.00 0.40 ? 19  LYS A N    4  
ATOM   6667  C CA   . LYS A 1 19 ? 20.979  -6.824  3.316   1.00 0.35 ? 19  LYS A CA   4  
ATOM   6668  C C    . LYS A 1 19 ? 21.196  -6.976  1.807   1.00 0.31 ? 19  LYS A C    4  
ATOM   6669  O O    . LYS A 1 19 ? 21.929  -7.835  1.361   1.00 0.33 ? 19  LYS A O    4  
ATOM   6670  C CB   . LYS A 1 19 ? 22.251  -6.303  4.004   1.00 0.38 ? 19  LYS A CB   4  
ATOM   6671  C CG   . LYS A 1 19 ? 22.835  -5.105  3.258   1.00 0.40 ? 19  LYS A CG   4  
ATOM   6672  C CD   . LYS A 1 19 ? 24.070  -4.617  4.015   1.00 0.62 ? 19  LYS A CD   4  
ATOM   6673  C CE   . LYS A 1 19 ? 24.869  -3.665  3.133   1.00 0.97 ? 19  LYS A CE   4  
ATOM   6674  N NZ   . LYS A 1 19 ? 25.641  -4.451  2.130   1.00 1.79 ? 19  LYS A NZ   4  
ATOM   6675  H H    . LYS A 1 19 ? 21.239  -8.579  4.533   1.00 0.43 ? 19  LYS A H    4  
ATOM   6676  H HA   . LYS A 1 19 ? 20.163  -6.140  3.496   1.00 0.35 ? 19  LYS A HA   4  
ATOM   6677  H HB2  . LYS A 1 19 ? 22.009  -6.002  5.012   1.00 0.45 ? 19  LYS A HB2  4  
ATOM   6678  H HB3  . LYS A 1 19 ? 22.989  -7.083  4.039   1.00 0.41 ? 19  LYS A HB3  4  
ATOM   6679  H HG2  . LYS A 1 19 ? 23.124  -5.395  2.258   1.00 0.68 ? 19  LYS A HG2  4  
ATOM   6680  H HG3  . LYS A 1 19 ? 22.105  -4.312  3.212   1.00 0.68 ? 19  LYS A HG3  4  
ATOM   6681  H HD2  . LYS A 1 19 ? 23.764  -4.106  4.914   1.00 1.50 ? 19  LYS A HD2  4  
ATOM   6682  H HD3  . LYS A 1 19 ? 24.690  -5.462  4.278   1.00 1.32 ? 19  LYS A HD3  4  
ATOM   6683  H HE2  . LYS A 1 19 ? 24.192  -2.994  2.625   1.00 1.40 ? 19  LYS A HE2  4  
ATOM   6684  H HE3  . LYS A 1 19 ? 25.548  -3.099  3.748   1.00 1.44 ? 19  LYS A HE3  4  
ATOM   6685  H HZ1  . LYS A 1 19 ? 25.821  -5.406  2.502   1.00 2.18 ? 19  LYS A HZ1  4  
ATOM   6686  H HZ2  . LYS A 1 19 ? 25.097  -4.519  1.247   1.00 2.30 ? 19  LYS A HZ2  4  
ATOM   6687  H HZ3  . LYS A 1 19 ? 26.546  -3.977  1.940   1.00 2.23 ? 19  LYS A HZ3  4  
ATOM   6688  N N    . LEU A 1 20 ? 20.550  -6.162  1.019   1.00 0.27 ? 20  LEU A N    4  
ATOM   6689  C CA   . LEU A 1 20 ? 20.703  -6.275  -0.458  1.00 0.27 ? 20  LEU A CA   4  
ATOM   6690  C C    . LEU A 1 20 ? 22.094  -5.753  -0.891  1.00 0.27 ? 20  LEU A C    4  
ATOM   6691  O O    . LEU A 1 20 ? 22.369  -4.585  -0.696  1.00 0.27 ? 20  LEU A O    4  
ATOM   6692  C CB   . LEU A 1 20 ? 19.640  -5.411  -1.143  1.00 0.24 ? 20  LEU A CB   4  
ATOM   6693  C CG   . LEU A 1 20 ? 18.276  -5.621  -0.486  1.00 0.23 ? 20  LEU A CG   4  
ATOM   6694  C CD1  . LEU A 1 20 ? 17.206  -4.935  -1.335  1.00 0.22 ? 20  LEU A CD1  4  
ATOM   6695  C CD2  . LEU A 1 20 ? 17.960  -7.117  -0.391  1.00 0.27 ? 20  LEU A CD2  4  
ATOM   6696  H H    . LEU A 1 20 ? 19.951  -5.484  1.399   1.00 0.27 ? 20  LEU A H    4  
ATOM   6697  H HA   . LEU A 1 20 ? 20.558  -7.296  -0.747  1.00 0.29 ? 20  LEU A HA   4  
ATOM   6698  H HB2  . LEU A 1 20 ? 19.916  -4.370  -1.058  1.00 0.24 ? 20  LEU A HB2  4  
ATOM   6699  H HB3  . LEU A 1 20 ? 19.579  -5.680  -2.186  1.00 0.27 ? 20  LEU A HB3  4  
ATOM   6700  H HG   . LEU A 1 20 ? 18.285  -5.188  0.504   1.00 0.21 ? 20  LEU A HG   4  
ATOM   6701  H HD11 . LEU A 1 20 ? 17.545  -3.948  -1.613  1.00 1.00 ? 20  LEU A HD11 4  
ATOM   6702  H HD12 . LEU A 1 20 ? 17.027  -5.518  -2.226  1.00 1.05 ? 20  LEU A HD12 4  
ATOM   6703  H HD13 . LEU A 1 20 ? 16.295  -4.856  -0.766  1.00 1.00 ? 20  LEU A HD13 4  
ATOM   6704  H HD21 . LEU A 1 20 ? 18.209  -7.598  -1.324  1.00 1.03 ? 20  LEU A HD21 4  
ATOM   6705  H HD22 . LEU A 1 20 ? 18.537  -7.556  0.408   1.00 1.05 ? 20  LEU A HD22 4  
ATOM   6706  H HD23 . LEU A 1 20 ? 16.906  -7.250  -0.187  1.00 1.05 ? 20  LEU A HD23 4  
ATOM   6707  N N    . PRO A 1 21 ? 22.936  -6.588  -1.484  1.00 0.31 ? 21  PRO A N    4  
ATOM   6708  C CA   . PRO A 1 21 ? 24.259  -6.116  -1.937  1.00 0.34 ? 21  PRO A CA   4  
ATOM   6709  C C    . PRO A 1 21 ? 24.080  -4.947  -2.910  1.00 0.30 ? 21  PRO A C    4  
ATOM   6710  O O    . PRO A 1 21 ? 23.118  -4.892  -3.648  1.00 0.29 ? 21  PRO A O    4  
ATOM   6711  C CB   . PRO A 1 21 ? 24.896  -7.331  -2.650  1.00 0.39 ? 21  PRO A CB   4  
ATOM   6712  C CG   . PRO A 1 21 ? 23.972  -8.554  -2.393  1.00 0.42 ? 21  PRO A CG   4  
ATOM   6713  C CD   . PRO A 1 21 ? 22.675  -8.023  -1.747  1.00 0.35 ? 21  PRO A CD   4  
ATOM   6714  H HA   . PRO A 1 21 ? 24.862  -5.816  -1.094  1.00 0.36 ? 21  PRO A HA   4  
ATOM   6715  H HB2  . PRO A 1 21 ? 24.972  -7.144  -3.718  1.00 0.39 ? 21  PRO A HB2  4  
ATOM   6716  H HB3  . PRO A 1 21 ? 25.877  -7.521  -2.252  1.00 0.43 ? 21  PRO A HB3  4  
ATOM   6717  H HG2  . PRO A 1 21 ? 23.747  -9.051  -3.330  1.00 0.45 ? 21  PRO A HG2  4  
ATOM   6718  H HG3  . PRO A 1 21 ? 24.456  -9.248  -1.720  1.00 0.47 ? 21  PRO A HG3  4  
ATOM   6719  H HD2  . PRO A 1 21 ? 21.843  -8.137  -2.433  1.00 0.35 ? 21  PRO A HD2  4  
ATOM   6720  H HD3  . PRO A 1 21 ? 22.475  -8.541  -0.820  1.00 0.37 ? 21  PRO A HD3  4  
ATOM   6721  N N    . ARG A 1 22 ? 25.000  -4.025  -2.934  1.00 0.31 ? 22  ARG A N    4  
ATOM   6722  C CA   . ARG A 1 22 ? 24.874  -2.887  -3.885  1.00 0.30 ? 22  ARG A CA   4  
ATOM   6723  C C    . ARG A 1 22 ? 24.612  -3.449  -5.285  1.00 0.31 ? 22  ARG A C    4  
ATOM   6724  O O    . ARG A 1 22 ? 23.916  -2.858  -6.086  1.00 0.31 ? 22  ARG A O    4  
ATOM   6725  C CB   . ARG A 1 22 ? 26.171  -2.074  -3.891  1.00 0.33 ? 22  ARG A CB   4  
ATOM   6726  C CG   . ARG A 1 22 ? 25.946  -0.758  -4.637  1.00 0.69 ? 22  ARG A CG   4  
ATOM   6727  C CD   . ARG A 1 22 ? 27.182  0.131   -4.485  1.00 1.24 ? 22  ARG A CD   4  
ATOM   6728  N NE   . ARG A 1 22 ? 26.959  1.418   -5.202  1.00 1.34 ? 22  ARG A NE   4  
ATOM   6729  C CZ   . ARG A 1 22 ? 27.738  2.439   -4.968  1.00 2.07 ? 22  ARG A CZ   4  
ATOM   6730  N NH1  . ARG A 1 22 ? 28.711  2.332   -4.106  1.00 2.89 ? 22  ARG A NH1  4  
ATOM   6731  N NH2  . ARG A 1 22 ? 27.543  3.565   -5.596  1.00 2.44 ? 22  ARG A NH2  4  
ATOM   6732  H H    . ARG A 1 22 ? 25.779  -4.089  -2.342  1.00 0.33 ? 22  ARG A H    4  
ATOM   6733  H HA   . ARG A 1 22 ? 24.051  -2.256  -3.588  1.00 0.28 ? 22  ARG A HA   4  
ATOM   6734  H HB2  . ARG A 1 22 ? 26.469  -1.867  -2.873  1.00 0.51 ? 22  ARG A HB2  4  
ATOM   6735  H HB3  . ARG A 1 22 ? 26.948  -2.639  -4.386  1.00 0.49 ? 22  ARG A HB3  4  
ATOM   6736  H HG2  . ARG A 1 22 ? 25.776  -0.962  -5.684  1.00 1.24 ? 22  ARG A HG2  4  
ATOM   6737  H HG3  . ARG A 1 22 ? 25.088  -0.251  -4.225  1.00 1.29 ? 22  ARG A HG3  4  
ATOM   6738  H HD2  . ARG A 1 22 ? 27.355  0.329   -3.438  1.00 1.83 ? 22  ARG A HD2  4  
ATOM   6739  H HD3  . ARG A 1 22 ? 28.040  -0.371  -4.905  1.00 1.88 ? 22  ARG A HD3  4  
ATOM   6740  H HE   . ARG A 1 22 ? 26.228  1.498   -5.849  1.00 1.53 ? 22  ARG A HE   4  
ATOM   6741  H HH11 . ARG A 1 22 ? 28.860  1.468   -3.624  1.00 2.92 ? 22  ARG A HH11 4  
ATOM   6742  H HH12 . ARG A 1 22 ? 29.309  3.113   -3.925  1.00 3.67 ? 22  ARG A HH12 4  
ATOM   6743  H HH21 . ARG A 1 22 ? 26.798  3.648   -6.256  1.00 2.35 ? 22  ARG A HH21 4  
ATOM   6744  H HH22 . ARG A 1 22 ? 28.141  4.348   -5.416  1.00 3.12 ? 22  ARG A HH22 4  
ATOM   6745  N N    . ASN A 1 23 ? 25.166  -4.598  -5.576  1.00 0.34 ? 23  ASN A N    4  
ATOM   6746  C CA   . ASN A 1 23 ? 24.955  -5.217  -6.916  1.00 0.37 ? 23  ASN A CA   4  
ATOM   6747  C C    . ASN A 1 23 ? 23.525  -5.756  -7.015  1.00 0.37 ? 23  ASN A C    4  
ATOM   6748  O O    . ASN A 1 23 ? 23.204  -6.527  -7.898  1.00 0.40 ? 23  ASN A O    4  
ATOM   6749  C CB   . ASN A 1 23 ? 25.946  -6.366  -7.108  1.00 0.42 ? 23  ASN A CB   4  
ATOM   6750  C CG   . ASN A 1 23 ? 27.374  -5.834  -6.980  1.00 1.47 ? 23  ASN A CG   4  
ATOM   6751  O OD1  . ASN A 1 23 ? 28.123  -5.836  -7.936  1.00 2.16 ? 23  ASN A OD1  4  
ATOM   6752  N ND2  . ASN A 1 23 ? 27.786  -5.375  -5.830  1.00 2.38 ? 23  ASN A ND2  4  
ATOM   6753  H H    . ASN A 1 23 ? 25.718  -5.058  -4.905  1.00 0.35 ? 23  ASN A H    4  
ATOM   6754  H HA   . ASN A 1 23 ? 25.112  -4.474  -7.683  1.00 0.38 ? 23  ASN A HA   4  
ATOM   6755  H HB2  . ASN A 1 23 ? 25.772  -7.121  -6.354  1.00 1.04 ? 23  ASN A HB2  4  
ATOM   6756  H HB3  . ASN A 1 23 ? 25.811  -6.797  -8.089  1.00 1.07 ? 23  ASN A HB3  4  
ATOM   6757  H HD21 . ASN A 1 23 ? 27.182  -5.373  -5.058  1.00 2.56 ? 23  ASN A HD21 4  
ATOM   6758  H HD22 . ASN A 1 23 ? 28.700  -5.032  -5.738  1.00 3.17 ? 23  ASN A HD22 4  
ATOM   6759  N N    . PHE A 1 24 ? 22.666  -5.364  -6.110  1.00 0.33 ? 24  PHE A N    4  
ATOM   6760  C CA   . PHE A 1 24 ? 21.252  -5.857  -6.137  1.00 0.33 ? 24  PHE A CA   4  
ATOM   6761  C C    . PHE A 1 24 ? 20.315  -4.694  -5.798  1.00 0.30 ? 24  PHE A C    4  
ATOM   6762  O O    . PHE A 1 24 ? 19.234  -4.884  -5.277  1.00 0.28 ? 24  PHE A O    4  
ATOM   6763  C CB   . PHE A 1 24 ? 21.097  -6.978  -5.092  1.00 0.33 ? 24  PHE A CB   4  
ATOM   6764  C CG   . PHE A 1 24 ? 19.906  -7.859  -5.419  1.00 0.35 ? 24  PHE A CG   4  
ATOM   6765  C CD1  . PHE A 1 24 ? 19.864  -8.572  -6.635  1.00 0.39 ? 24  PHE A CD1  4  
ATOM   6766  C CD2  . PHE A 1 24 ? 18.842  -7.980  -4.499  1.00 0.35 ? 24  PHE A CD2  4  
ATOM   6767  C CE1  . PHE A 1 24 ? 18.766  -9.400  -6.930  1.00 0.41 ? 24  PHE A CE1  4  
ATOM   6768  C CE2  . PHE A 1 24 ? 17.743  -8.808  -4.798  1.00 0.37 ? 24  PHE A CE2  4  
ATOM   6769  C CZ   . PHE A 1 24 ? 17.705  -9.518  -6.011  1.00 0.41 ? 24  PHE A CZ   4  
ATOM   6770  H H    . PHE A 1 24 ? 22.953  -4.748  -5.403  1.00 0.31 ? 24  PHE A H    4  
ATOM   6771  H HA   . PHE A 1 24 ? 21.009  -6.233  -7.122  1.00 0.36 ? 24  PHE A HA   4  
ATOM   6772  H HB2  . PHE A 1 24 ? 21.990  -7.582  -5.086  1.00 0.35 ? 24  PHE A HB2  4  
ATOM   6773  H HB3  . PHE A 1 24 ? 20.961  -6.539  -4.112  1.00 0.31 ? 24  PHE A HB3  4  
ATOM   6774  H HD1  . PHE A 1 24 ? 20.677  -8.489  -7.342  1.00 0.40 ? 24  PHE A HD1  4  
ATOM   6775  H HD2  . PHE A 1 24 ? 18.869  -7.435  -3.567  1.00 0.32 ? 24  PHE A HD2  4  
ATOM   6776  H HE1  . PHE A 1 24 ? 18.737  -9.946  -7.859  1.00 0.44 ? 24  PHE A HE1  4  
ATOM   6777  H HE2  . PHE A 1 24 ? 16.930  -8.902  -4.093  1.00 0.37 ? 24  PHE A HE2  4  
ATOM   6778  H HZ   . PHE A 1 24 ? 16.863  -10.154 -6.239  1.00 0.43 ? 24  PHE A HZ   4  
ATOM   6779  N N    . VAL A 1 25 ? 20.727  -3.490  -6.095  1.00 0.30 ? 25  VAL A N    4  
ATOM   6780  C CA   . VAL A 1 25 ? 19.875  -2.300  -5.799  1.00 0.28 ? 25  VAL A CA   4  
ATOM   6781  C C    . VAL A 1 25 ? 20.161  -1.211  -6.835  1.00 0.30 ? 25  VAL A C    4  
ATOM   6782  O O    . VAL A 1 25 ? 21.025  -0.377  -6.650  1.00 0.31 ? 25  VAL A O    4  
ATOM   6783  C CB   . VAL A 1 25 ? 20.206  -1.764  -4.404  1.00 0.24 ? 25  VAL A CB   4  
ATOM   6784  C CG1  . VAL A 1 25 ? 19.271  -0.603  -4.064  1.00 0.22 ? 25  VAL A CG1  4  
ATOM   6785  C CG2  . VAL A 1 25 ? 20.025  -2.874  -3.367  1.00 0.23 ? 25  VAL A CG2  4  
ATOM   6786  H H    . VAL A 1 25 ? 21.603  -3.366  -6.517  1.00 0.31 ? 25  VAL A H    4  
ATOM   6787  H HA   . VAL A 1 25 ? 18.831  -2.576  -5.843  1.00 0.27 ? 25  VAL A HA   4  
ATOM   6788  H HB   . VAL A 1 25 ? 21.229  -1.416  -4.387  1.00 0.25 ? 25  VAL A HB   4  
ATOM   6789  H HG11 . VAL A 1 25 ? 18.246  -0.943  -4.105  1.00 1.04 ? 25  VAL A HG11 4  
ATOM   6790  H HG12 . VAL A 1 25 ? 19.493  -0.245  -3.071  1.00 1.03 ? 25  VAL A HG12 4  
ATOM   6791  H HG13 . VAL A 1 25 ? 19.414  0.196   -4.776  1.00 1.04 ? 25  VAL A HG13 4  
ATOM   6792  H HG21 . VAL A 1 25 ? 19.065  -3.347  -3.509  1.00 1.07 ? 25  VAL A HG21 4  
ATOM   6793  H HG22 . VAL A 1 25 ? 20.810  -3.608  -3.482  1.00 1.01 ? 25  VAL A HG22 4  
ATOM   6794  H HG23 . VAL A 1 25 ? 20.074  -2.448  -2.376  1.00 1.04 ? 25  VAL A HG23 4  
ATOM   6795  N N    . VAL A 1 26 ? 19.447  -1.214  -7.928  1.00 0.33 ? 26  VAL A N    4  
ATOM   6796  C CA   . VAL A 1 26 ? 19.681  -0.184  -8.977  1.00 0.36 ? 26  VAL A CA   4  
ATOM   6797  C C    . VAL A 1 26 ? 18.888  1.077   -8.647  1.00 0.35 ? 26  VAL A C    4  
ATOM   6798  O O    . VAL A 1 26 ? 19.077  2.115   -9.251  1.00 0.37 ? 26  VAL A O    4  
ATOM   6799  C CB   . VAL A 1 26 ? 19.226  -0.735  -10.328 1.00 0.41 ? 26  VAL A CB   4  
ATOM   6800  C CG1  . VAL A 1 26 ? 20.065  -1.962  -10.685 1.00 0.78 ? 26  VAL A CG1  4  
ATOM   6801  C CG2  . VAL A 1 26 ? 17.749  -1.130  -10.250 1.00 0.61 ? 26  VAL A CG2  4  
ATOM   6802  H H    . VAL A 1 26 ? 18.758  -1.897  -8.062  1.00 0.33 ? 26  VAL A H    4  
ATOM   6803  H HA   . VAL A 1 26 ? 20.733  0.056   -9.023  1.00 0.37 ? 26  VAL A HA   4  
ATOM   6804  H HB   . VAL A 1 26 ? 19.357  0.021   -11.084 1.00 0.58 ? 26  VAL A HB   4  
ATOM   6805  H HG11 . VAL A 1 26 ? 20.153  -2.600  -9.818  1.00 1.32 ? 26  VAL A HG11 4  
ATOM   6806  H HG12 . VAL A 1 26 ? 19.587  -2.507  -11.486 1.00 1.36 ? 26  VAL A HG12 4  
ATOM   6807  H HG13 . VAL A 1 26 ? 21.048  -1.647  -11.002 1.00 1.31 ? 26  VAL A HG13 4  
ATOM   6808  H HG21 . VAL A 1 26 ? 17.605  -1.831  -9.442  1.00 1.34 ? 26  VAL A HG21 4  
ATOM   6809  H HG22 . VAL A 1 26 ? 17.149  -0.250  -10.072 1.00 1.17 ? 26  VAL A HG22 4  
ATOM   6810  H HG23 . VAL A 1 26 ? 17.449  -1.587  -11.181 1.00 1.18 ? 26  VAL A HG23 4  
ATOM   6811  N N    . ASP A 1 27 ? 18.003  1.003   -7.694  1.00 0.32 ? 27  ASP A N    4  
ATOM   6812  C CA   . ASP A 1 27 ? 17.206  2.209   -7.336  1.00 0.31 ? 27  ASP A CA   4  
ATOM   6813  C C    . ASP A 1 27 ? 16.432  1.938   -6.051  1.00 0.27 ? 27  ASP A C    4  
ATOM   6814  O O    . ASP A 1 27 ? 16.614  0.924   -5.408  1.00 0.25 ? 27  ASP A O    4  
ATOM   6815  C CB   . ASP A 1 27 ? 16.225  2.529   -8.467  1.00 0.34 ? 27  ASP A CB   4  
ATOM   6816  C CG   . ASP A 1 27 ? 15.656  3.935   -8.267  1.00 0.35 ? 27  ASP A CG   4  
ATOM   6817  O OD1  . ASP A 1 27 ? 16.409  4.883   -8.414  1.00 1.09 ? 27  ASP A OD1  4  
ATOM   6818  O OD2  . ASP A 1 27 ? 14.478  4.039   -7.971  1.00 1.13 ? 27  ASP A OD2  4  
ATOM   6819  H H    . ASP A 1 27 ? 17.860  0.156   -7.215  1.00 0.30 ? 27  ASP A H    4  
ATOM   6820  H HA   . ASP A 1 27 ? 17.870  3.047   -7.186  1.00 0.31 ? 27  ASP A HA   4  
ATOM   6821  H HB2  . ASP A 1 27 ? 16.742  2.480   -9.415  1.00 0.37 ? 27  ASP A HB2  4  
ATOM   6822  H HB3  . ASP A 1 27 ? 15.417  1.810   -8.460  1.00 0.34 ? 27  ASP A HB3  4  
ATOM   6823  N N    . TYR A 1 28 ? 15.566  2.835   -5.667  1.00 0.26 ? 28  TYR A N    4  
ATOM   6824  C CA   . TYR A 1 28 ? 14.785  2.616   -4.420  1.00 0.23 ? 28  TYR A CA   4  
ATOM   6825  C C    . TYR A 1 28 ? 13.486  3.415   -4.468  1.00 0.25 ? 28  TYR A C    4  
ATOM   6826  O O    . TYR A 1 28 ? 13.157  4.042   -5.456  1.00 0.29 ? 28  TYR A O    4  
ATOM   6827  C CB   . TYR A 1 28 ? 15.613  3.029   -3.197  1.00 0.19 ? 28  TYR A CB   4  
ATOM   6828  C CG   . TYR A 1 28 ? 15.707  4.540   -3.093  1.00 0.21 ? 28  TYR A CG   4  
ATOM   6829  C CD1  . TYR A 1 28 ? 16.343  5.283   -4.106  1.00 0.25 ? 28  TYR A CD1  4  
ATOM   6830  C CD2  . TYR A 1 28 ? 15.168  5.203   -1.970  1.00 0.19 ? 28  TYR A CD2  4  
ATOM   6831  C CE1  . TYR A 1 28 ? 16.438  6.683   -4.000  1.00 0.26 ? 28  TYR A CE1  4  
ATOM   6832  C CE2  . TYR A 1 28 ? 15.264  6.601   -1.862  1.00 0.22 ? 28  TYR A CE2  4  
ATOM   6833  C CZ   . TYR A 1 28 ? 15.899  7.343   -2.877  1.00 0.25 ? 28  TYR A CZ   4  
ATOM   6834  O OH   . TYR A 1 28 ? 15.993  8.716   -2.772  1.00 0.28 ? 28  TYR A OH   4  
ATOM   6835  H H    . TYR A 1 28 ? 15.431  3.647   -6.198  1.00 0.28 ? 28  TYR A H    4  
ATOM   6836  H HA   . TYR A 1 28 ? 14.541  1.568   -4.338  1.00 0.23 ? 28  TYR A HA   4  
ATOM   6837  H HB2  . TYR A 1 28 ? 15.147  2.636   -2.306  1.00 0.17 ? 28  TYR A HB2  4  
ATOM   6838  H HB3  . TYR A 1 28 ? 16.602  2.616   -3.287  1.00 0.19 ? 28  TYR A HB3  4  
ATOM   6839  H HD1  . TYR A 1 28 ? 16.757  4.781   -4.966  1.00 0.27 ? 28  TYR A HD1  4  
ATOM   6840  H HD2  . TYR A 1 28 ? 14.681  4.636   -1.193  1.00 0.17 ? 28  TYR A HD2  4  
ATOM   6841  H HE1  . TYR A 1 28 ? 16.928  7.250   -4.778  1.00 0.30 ? 28  TYR A HE1  4  
ATOM   6842  H HE2  . TYR A 1 28 ? 14.851  7.104   -0.998  1.00 0.23 ? 28  TYR A HE2  4  
ATOM   6843  H HH   . TYR A 1 28 ? 15.127  9.088   -2.957  1.00 0.98 ? 28  TYR A HH   4  
ATOM   6844  N N    . TYR A 1 29 ? 12.745  3.373   -3.405  1.00 0.23 ? 29  TYR A N    4  
ATOM   6845  C CA   . TYR A 1 29 ? 11.452  4.097   -3.354  1.00 0.25 ? 29  TYR A CA   4  
ATOM   6846  C C    . TYR A 1 29 ? 11.045  4.256   -1.885  1.00 0.22 ? 29  TYR A C    4  
ATOM   6847  O O    . TYR A 1 29 ? 11.156  3.335   -1.106  1.00 0.23 ? 29  TYR A O    4  
ATOM   6848  C CB   . TYR A 1 29 ? 10.413  3.271   -4.130  1.00 0.29 ? 29  TYR A CB   4  
ATOM   6849  C CG   . TYR A 1 29 ? 9.010   3.680   -3.748  1.00 0.31 ? 29  TYR A CG   4  
ATOM   6850  C CD1  . TYR A 1 29 ? 8.518   4.938   -4.134  1.00 0.36 ? 29  TYR A CD1  4  
ATOM   6851  C CD2  . TYR A 1 29 ? 8.198   2.801   -3.006  1.00 0.35 ? 29  TYR A CD2  4  
ATOM   6852  C CE1  . TYR A 1 29 ? 7.212   5.322   -3.777  1.00 0.39 ? 29  TYR A CE1  4  
ATOM   6853  C CE2  . TYR A 1 29 ? 6.892   3.183   -2.648  1.00 0.38 ? 29  TYR A CE2  4  
ATOM   6854  C CZ   . TYR A 1 29 ? 6.398   4.445   -3.034  1.00 0.36 ? 29  TYR A CZ   4  
ATOM   6855  O OH   . TYR A 1 29 ? 5.117   4.821   -2.683  1.00 0.39 ? 29  TYR A OH   4  
ATOM   6856  H H    . TYR A 1 29 ? 13.041  2.852   -2.633  1.00 0.20 ? 29  TYR A H    4  
ATOM   6857  H HA   . TYR A 1 29 ? 11.561  5.070   -3.811  1.00 0.28 ? 29  TYR A HA   4  
ATOM   6858  H HB2  . TYR A 1 29 ? 10.553  3.432   -5.189  1.00 0.32 ? 29  TYR A HB2  4  
ATOM   6859  H HB3  . TYR A 1 29 ? 10.556  2.223   -3.909  1.00 0.27 ? 29  TYR A HB3  4  
ATOM   6860  H HD1  . TYR A 1 29 ? 9.145   5.608   -4.706  1.00 0.42 ? 29  TYR A HD1  4  
ATOM   6861  H HD2  . TYR A 1 29 ? 8.579   1.831   -2.713  1.00 0.40 ? 29  TYR A HD2  4  
ATOM   6862  H HE1  . TYR A 1 29 ? 6.834   6.290   -4.072  1.00 0.46 ? 29  TYR A HE1  4  
ATOM   6863  H HE2  . TYR A 1 29 ? 6.269   2.509   -2.078  1.00 0.44 ? 29  TYR A HE2  4  
ATOM   6864  H HH   . TYR A 1 29 ? 4.793   4.197   -2.029  1.00 0.97 ? 29  TYR A HH   4  
ATOM   6865  N N    . GLU A 1 30 ? 10.579  5.413   -1.493  1.00 0.22 ? 30  GLU A N    4  
ATOM   6866  C CA   . GLU A 1 30 ? 10.172  5.609   -0.066  1.00 0.20 ? 30  GLU A CA   4  
ATOM   6867  C C    . GLU A 1 30 ? 8.667   5.364   0.075   1.00 0.21 ? 30  GLU A C    4  
ATOM   6868  O O    . GLU A 1 30 ? 7.919   5.458   -0.878  1.00 0.24 ? 30  GLU A O    4  
ATOM   6869  C CB   . GLU A 1 30 ? 10.500  7.040   0.365   1.00 0.22 ? 30  GLU A CB   4  
ATOM   6870  C CG   . GLU A 1 30 ? 12.006  7.174   0.596   1.00 0.25 ? 30  GLU A CG   4  
ATOM   6871  C CD   . GLU A 1 30 ? 12.340  8.624   0.955   1.00 0.69 ? 30  GLU A CD   4  
ATOM   6872  O OE1  . GLU A 1 30 ? 11.624  9.504   0.507   1.00 1.35 ? 30  GLU A OE1  4  
ATOM   6873  O OE2  . GLU A 1 30 ? 13.307  8.828   1.671   1.00 1.43 ? 30  GLU A OE2  4  
ATOM   6874  H H    . GLU A 1 30 ? 10.497  6.150   -2.133  1.00 0.25 ? 30  GLU A H    4  
ATOM   6875  H HA   . GLU A 1 30 ? 10.708  4.915   0.569   1.00 0.18 ? 30  GLU A HA   4  
ATOM   6876  H HB2  . GLU A 1 30 ? 10.193  7.723   -0.408  1.00 0.26 ? 30  GLU A HB2  4  
ATOM   6877  H HB3  . GLU A 1 30 ? 9.975   7.272   1.280   1.00 0.25 ? 30  GLU A HB3  4  
ATOM   6878  H HG2  . GLU A 1 30 ? 12.305  6.524   1.406   1.00 0.59 ? 30  GLU A HG2  4  
ATOM   6879  H HG3  . GLU A 1 30 ? 12.535  6.898   -0.304  1.00 0.45 ? 30  GLU A HG3  4  
ATOM   6880  N N    . THR A 1 31 ? 8.223   5.036   1.257   1.00 0.19 ? 31  THR A N    4  
ATOM   6881  C CA   . THR A 1 31 ? 6.768   4.769   1.471   1.00 0.21 ? 31  THR A CA   4  
ATOM   6882  C C    . THR A 1 31 ? 5.976   6.076   1.447   1.00 0.25 ? 31  THR A C    4  
ATOM   6883  O O    . THR A 1 31 ? 6.463   7.109   1.031   1.00 0.27 ? 31  THR A O    4  
ATOM   6884  C CB   . THR A 1 31 ? 6.580   4.102   2.833   1.00 0.20 ? 31  THR A CB   4  
ATOM   6885  O OG1  . THR A 1 31 ? 7.286   4.847   3.809   1.00 0.21 ? 31  THR A OG1  4  
ATOM   6886  C CG2  . THR A 1 31 ? 7.115   2.672   2.772   1.00 0.20 ? 31  THR A CG2  4  
ATOM   6887  H H    . THR A 1 31 ? 8.850   4.958   2.007   1.00 0.18 ? 31  THR A H    4  
ATOM   6888  H HA   . THR A 1 31 ? 6.404   4.112   0.697   1.00 0.22 ? 31  THR A HA   4  
ATOM   6889  H HB   . THR A 1 31 ? 5.533   4.082   3.092   1.00 0.22 ? 31  THR A HB   4  
ATOM   6890  H HG1  . THR A 1 31 ? 7.754   5.556   3.361   1.00 0.73 ? 31  THR A HG1  4  
ATOM   6891  H HG21 . THR A 1 31 ? 8.137   2.684   2.424   1.00 1.04 ? 31  THR A HG21 4  
ATOM   6892  H HG22 . THR A 1 31 ? 7.074   2.230   3.755   1.00 1.00 ? 31  THR A HG22 4  
ATOM   6893  H HG23 . THR A 1 31 ? 6.510   2.090   2.091   1.00 1.04 ? 31  THR A HG23 4  
ATOM   6894  N N    . SER A 1 32 ? 4.752   6.031   1.900   1.00 0.27 ? 32  SER A N    4  
ATOM   6895  C CA   . SER A 1 32 ? 3.904   7.254   1.922   1.00 0.31 ? 32  SER A CA   4  
ATOM   6896  C C    . SER A 1 32 ? 4.153   8.023   3.217   1.00 0.33 ? 32  SER A C    4  
ATOM   6897  O O    . SER A 1 32 ? 5.254   8.072   3.726   1.00 0.33 ? 32  SER A O    4  
ATOM   6898  C CB   . SER A 1 32 ? 2.433   6.846   1.852   1.00 0.33 ? 32  SER A CB   4  
ATOM   6899  O OG   . SER A 1 32 ? 1.641   7.993   1.569   1.00 1.27 ? 32  SER A OG   4  
ATOM   6900  H H    . SER A 1 32 ? 4.389   5.183   2.231   1.00 0.26 ? 32  SER A H    4  
ATOM   6901  H HA   . SER A 1 32 ? 4.140   7.882   1.079   1.00 0.34 ? 32  SER A HA   4  
ATOM   6902  H HB2  . SER A 1 32 ? 2.295   6.117   1.072   1.00 0.94 ? 32  SER A HB2  4  
ATOM   6903  H HB3  . SER A 1 32 ? 2.138   6.417   2.800   1.00 0.85 ? 32  SER A HB3  4  
ATOM   6904  H HG   . SER A 1 32 ? 1.137   8.207   2.357   1.00 1.72 ? 32  SER A HG   4  
ATOM   6905  N N    . SER A 1 33 ? 3.126   8.621   3.753   1.00 0.36 ? 33  SER A N    4  
ATOM   6906  C CA   . SER A 1 33 ? 3.271   9.397   5.023   1.00 0.40 ? 33  SER A CA   4  
ATOM   6907  C C    . SER A 1 33 ? 2.026   9.174   5.877   1.00 0.40 ? 33  SER A C    4  
ATOM   6908  O O    . SER A 1 33 ? 2.092   9.097   7.088   1.00 0.42 ? 33  SER A O    4  
ATOM   6909  C CB   . SER A 1 33 ? 3.385   10.881  4.692   1.00 0.46 ? 33  SER A CB   4  
ATOM   6910  O OG   . SER A 1 33 ? 2.086   11.412  4.462   1.00 0.48 ? 33  SER A OG   4  
ATOM   6911  H H    . SER A 1 33 ? 2.253   8.561   3.316   1.00 0.37 ? 33  SER A H    4  
ATOM   6912  H HA   . SER A 1 33 ? 4.148   9.073   5.564   1.00 0.39 ? 33  SER A HA   4  
ATOM   6913  H HB2  . SER A 1 33 ? 3.845   11.405  5.513   1.00 0.48 ? 33  SER A HB2  4  
ATOM   6914  H HB3  . SER A 1 33 ? 3.989   10.996  3.807   1.00 0.46 ? 33  SER A HB3  4  
ATOM   6915  H HG   . SER A 1 33 ? 2.128   12.362  4.586   1.00 1.00 ? 33  SER A HG   4  
ATOM   6916  N N    . LEU A 1 34 ? 0.894   9.080   5.237   1.00 0.39 ? 34  LEU A N    4  
ATOM   6917  C CA   . LEU A 1 34 ? -0.393  8.866   5.966   1.00 0.39 ? 34  LEU A CA   4  
ATOM   6918  C C    . LEU A 1 34 ? -0.193  7.879   7.118   1.00 0.37 ? 34  LEU A C    4  
ATOM   6919  O O    . LEU A 1 34 ? -0.471  8.178   8.263   1.00 0.40 ? 34  LEU A O    4  
ATOM   6920  C CB   . LEU A 1 34 ? -1.435  8.294   4.999   1.00 0.36 ? 34  LEU A CB   4  
ATOM   6921  C CG   . LEU A 1 34 ? -1.359  9.018   3.653   1.00 0.39 ? 34  LEU A CG   4  
ATOM   6922  C CD1  . LEU A 1 34 ? -2.516  8.558   2.762   1.00 0.40 ? 34  LEU A CD1  4  
ATOM   6923  C CD2  . LEU A 1 34 ? -1.450  10.531  3.878   1.00 0.45 ? 34  LEU A CD2  4  
ATOM   6924  H H    . LEU A 1 34 ? 0.890   9.158   4.264   1.00 0.39 ? 34  LEU A H    4  
ATOM   6925  H HA   . LEU A 1 34 ? -0.745  9.805   6.354   1.00 0.43 ? 34  LEU A HA   4  
ATOM   6926  H HB2  . LEU A 1 34 ? -1.248  7.240   4.847   1.00 0.34 ? 34  LEU A HB2  4  
ATOM   6927  H HB3  . LEU A 1 34 ? -2.417  8.426   5.418   1.00 0.37 ? 34  LEU A HB3  4  
ATOM   6928  H HG   . LEU A 1 34 ? -0.425  8.780   3.170   1.00 0.39 ? 34  LEU A HG   4  
ATOM   6929  H HD11 . LEU A 1 34 ? -2.651  7.489   2.866   1.00 1.11 ? 34  LEU A HD11 4  
ATOM   6930  H HD12 . LEU A 1 34 ? -3.422  9.066   3.054   1.00 1.04 ? 34  LEU A HD12 4  
ATOM   6931  H HD13 . LEU A 1 34 ? -2.288  8.790   1.733   1.00 1.09 ? 34  LEU A HD13 4  
ATOM   6932  H HD21 . LEU A 1 34 ? -2.249  10.744  4.573   1.00 1.05 ? 34  LEU A HD21 4  
ATOM   6933  H HD22 . LEU A 1 34 ? -0.516  10.892  4.283   1.00 1.14 ? 34  LEU A HD22 4  
ATOM   6934  H HD23 . LEU A 1 34 ? -1.649  11.023  2.937   1.00 1.13 ? 34  LEU A HD23 4  
ATOM   6935  N N    . CYS A 1 35 ? 0.283   6.706   6.818   1.00 0.33 ? 35  CYS A N    4  
ATOM   6936  C CA   . CYS A 1 35 ? 0.496   5.698   7.890   1.00 0.34 ? 35  CYS A CA   4  
ATOM   6937  C C    . CYS A 1 35 ? 1.667   6.142   8.775   1.00 0.39 ? 35  CYS A C    4  
ATOM   6938  O O    . CYS A 1 35 ? 2.727   6.480   8.297   1.00 0.38 ? 35  CYS A O    4  
ATOM   6939  C CB   . CYS A 1 35 ? 0.797   4.333   7.258   1.00 0.32 ? 35  CYS A CB   4  
ATOM   6940  S SG   . CYS A 1 35 ? 1.869   4.549   5.816   1.00 0.39 ? 35  CYS A SG   4  
ATOM   6941  H H    . CYS A 1 35 ? 0.495   6.489   5.886   1.00 0.31 ? 35  CYS A H    4  
ATOM   6942  H HA   . CYS A 1 35 ? -0.399  5.624   8.490   1.00 0.36 ? 35  CYS A HA   4  
ATOM   6943  H HB2  . CYS A 1 35 ? 1.291   3.702   7.979   1.00 0.43 ? 35  CYS A HB2  4  
ATOM   6944  H HB3  . CYS A 1 35 ? -0.128  3.869   6.950   1.00 0.34 ? 35  CYS A HB3  4  
ATOM   6945  N N    . SER A 1 36 ? 1.466   6.169   10.063  1.00 0.44 ? 36  SER A N    4  
ATOM   6946  C CA   . SER A 1 36 ? 2.549   6.607   10.992  1.00 0.51 ? 36  SER A CA   4  
ATOM   6947  C C    . SER A 1 36 ? 3.730   5.621   10.986  1.00 0.51 ? 36  SER A C    4  
ATOM   6948  O O    . SER A 1 36 ? 4.392   5.452   11.991  1.00 0.58 ? 36  SER A O    4  
ATOM   6949  C CB   . SER A 1 36 ? 1.985   6.703   12.409  1.00 0.59 ? 36  SER A CB   4  
ATOM   6950  O OG   . SER A 1 36 ? 1.099   7.813   12.487  1.00 1.41 ? 36  SER A OG   4  
ATOM   6951  H H    . SER A 1 36 ? 0.593   5.910   10.423  1.00 0.45 ? 36  SER A H    4  
ATOM   6952  H HA   . SER A 1 36 ? 2.902   7.582   10.688  1.00 0.53 ? 36  SER A HA   4  
ATOM   6953  H HB2  . SER A 1 36 ? 1.443   5.802   12.645  1.00 1.10 ? 36  SER A HB2  4  
ATOM   6954  H HB3  . SER A 1 36 ? 2.797   6.827   13.112  1.00 1.27 ? 36  SER A HB3  4  
ATOM   6955  H HG   . SER A 1 36 ? 0.804   7.893   13.397  1.00 1.84 ? 36  SER A HG   4  
ATOM   6956  N N    . GLN A 1 37 ? 4.017   4.965   9.889   1.00 0.45 ? 37  GLN A N    4  
ATOM   6957  C CA   . GLN A 1 37 ? 5.168   4.006   9.892   1.00 0.47 ? 37  GLN A CA   4  
ATOM   6958  C C    . GLN A 1 37 ? 5.742   3.829   8.479   1.00 0.36 ? 37  GLN A C    4  
ATOM   6959  O O    . GLN A 1 37 ? 5.654   2.755   7.920   1.00 0.35 ? 37  GLN A O    4  
ATOM   6960  C CB   . GLN A 1 37 ? 4.689   2.649   10.418  1.00 0.55 ? 37  GLN A CB   4  
ATOM   6961  C CG   . GLN A 1 37 ? 3.362   2.279   9.754   1.00 0.78 ? 37  GLN A CG   4  
ATOM   6962  C CD   . GLN A 1 37 ? 2.938   0.880   10.205  1.00 0.79 ? 37  GLN A CD   4  
ATOM   6963  O OE1  . GLN A 1 37 ? 3.771   0.029   10.448  1.00 1.24 ? 37  GLN A OE1  4  
ATOM   6964  N NE2  . GLN A 1 37 ? 1.669   0.604   10.329  1.00 1.47 ? 37  GLN A NE2  4  
ATOM   6965  H H    . GLN A 1 37 ? 3.487   5.097   9.075   1.00 0.41 ? 37  GLN A H    4  
ATOM   6966  H HA   . GLN A 1 37 ? 5.949   4.379   10.542  1.00 0.54 ? 37  GLN A HA   4  
ATOM   6967  H HB2  . GLN A 1 37 ? 5.429   1.894   10.192  1.00 0.86 ? 37  GLN A HB2  4  
ATOM   6968  H HB3  . GLN A 1 37 ? 4.549   2.707   11.487  1.00 1.06 ? 37  GLN A HB3  4  
ATOM   6969  H HG2  . GLN A 1 37 ? 2.604   2.994   10.039  1.00 1.27 ? 37  GLN A HG2  4  
ATOM   6970  H HG3  . GLN A 1 37 ? 3.480   2.288   8.680   1.00 1.13 ? 37  GLN A HG3  4  
ATOM   6971  H HE21 . GLN A 1 37 ? 0.997   1.289   10.132  1.00 2.19 ? 37  GLN A HE21 4  
ATOM   6972  H HE22 . GLN A 1 37 ? 1.387   -0.290  10.617  1.00 1.53 ? 37  GLN A HE22 4  
ATOM   6973  N N    . PRO A 1 38 ? 6.333   4.874   7.941   1.00 0.34 ? 38  PRO A N    4  
ATOM   6974  C CA   . PRO A 1 38 ? 6.942   4.812   6.599   1.00 0.26 ? 38  PRO A CA   4  
ATOM   6975  C C    . PRO A 1 38 ? 8.205   3.938   6.655   1.00 0.25 ? 38  PRO A C    4  
ATOM   6976  O O    . PRO A 1 38 ? 8.603   3.465   7.701   1.00 0.27 ? 38  PRO A O    4  
ATOM   6977  C CB   . PRO A 1 38 ? 7.296   6.279   6.260   1.00 0.33 ? 38  PRO A CB   4  
ATOM   6978  C CG   . PRO A 1 38 ? 7.082   7.119   7.554   1.00 0.43 ? 38  PRO A CG   4  
ATOM   6979  C CD   . PRO A 1 38 ? 6.436   6.191   8.609   1.00 0.43 ? 38  PRO A CD   4  
ATOM   6980  H HA   . PRO A 1 38 ? 6.241   4.415   5.872   1.00 0.23 ? 38  PRO A HA   4  
ATOM   6981  H HB2  . PRO A 1 38 ? 8.328   6.355   5.932   1.00 0.32 ? 38  PRO A HB2  4  
ATOM   6982  H HB3  . PRO A 1 38 ? 6.643   6.645   5.480   1.00 0.34 ? 38  PRO A HB3  4  
ATOM   6983  H HG2  . PRO A 1 38 ? 8.035   7.489   7.914   1.00 0.50 ? 38  PRO A HG2  4  
ATOM   6984  H HG3  . PRO A 1 38 ? 6.424   7.954   7.349   1.00 0.48 ? 38  PRO A HG3  4  
ATOM   6985  H HD2  . PRO A 1 38 ? 7.066   6.122   9.486   1.00 0.50 ? 38  PRO A HD2  4  
ATOM   6986  H HD3  . PRO A 1 38 ? 5.456   6.549   8.877   1.00 0.45 ? 38  PRO A HD3  4  
ATOM   6987  N N    . ALA A 1 39 ? 8.832   3.735   5.534   1.00 0.23 ? 39  ALA A N    4  
ATOM   6988  C CA   . ALA A 1 39 ? 10.065  2.914   5.488   1.00 0.22 ? 39  ALA A CA   4  
ATOM   6989  C C    . ALA A 1 39 ? 10.718  3.128   4.127   1.00 0.19 ? 39  ALA A C    4  
ATOM   6990  O O    . ALA A 1 39 ? 10.122  3.698   3.235   1.00 0.22 ? 39  ALA A O    4  
ATOM   6991  C CB   . ALA A 1 39 ? 9.712   1.435   5.659   1.00 0.23 ? 39  ALA A CB   4  
ATOM   6992  H H    . ALA A 1 39 ? 8.493   4.133   4.714   1.00 0.23 ? 39  ALA A H    4  
ATOM   6993  H HA   . ALA A 1 39 ? 10.739  3.223   6.271   1.00 0.24 ? 39  ALA A HA   4  
ATOM   6994  H HB1  . ALA A 1 39 ? 9.149   1.303   6.571   1.00 1.03 ? 39  ALA A HB1  4  
ATOM   6995  H HB2  . ALA A 1 39 ? 9.117   1.107   4.818   1.00 0.99 ? 39  ALA A HB2  4  
ATOM   6996  H HB3  . ALA A 1 39 ? 10.619  0.851   5.706   1.00 1.03 ? 39  ALA A HB3  4  
ATOM   6997  N N    . VAL A 1 40 ? 11.924  2.663   3.941   1.00 0.15 ? 40  VAL A N    4  
ATOM   6998  C CA   . VAL A 1 40 ? 12.589  2.833   2.614   1.00 0.13 ? 40  VAL A CA   4  
ATOM   6999  C C    . VAL A 1 40 ? 12.394  1.539   1.832   1.00 0.13 ? 40  VAL A C    4  
ATOM   7000  O O    . VAL A 1 40 ? 12.407  0.460   2.392   1.00 0.18 ? 40  VAL A O    4  
ATOM   7001  C CB   . VAL A 1 40 ? 14.086  3.110   2.810   1.00 0.12 ? 40  VAL A CB   4  
ATOM   7002  C CG1  . VAL A 1 40 ? 14.838  2.880   1.495   1.00 0.12 ? 40  VAL A CG1  4  
ATOM   7003  C CG2  . VAL A 1 40 ? 14.271  4.565   3.241   1.00 0.16 ? 40  VAL A CG2  4  
ATOM   7004  H H    . VAL A 1 40 ? 12.386  2.189   4.666   1.00 0.14 ? 40  VAL A H    4  
ATOM   7005  H HA   . VAL A 1 40 ? 12.136  3.656   2.067   1.00 0.16 ? 40  VAL A HA   4  
ATOM   7006  H HB   . VAL A 1 40 ? 14.480  2.453   3.573   1.00 0.11 ? 40  VAL A HB   4  
ATOM   7007  H HG11 . VAL A 1 40 ? 14.277  3.314   0.681   1.00 1.02 ? 40  VAL A HG11 4  
ATOM   7008  H HG12 . VAL A 1 40 ? 15.813  3.340   1.548   1.00 1.00 ? 40  VAL A HG12 4  
ATOM   7009  H HG13 . VAL A 1 40 ? 14.950  1.819   1.327   1.00 1.04 ? 40  VAL A HG13 4  
ATOM   7010  H HG21 . VAL A 1 40 ? 13.645  4.770   4.094   1.00 1.06 ? 40  VAL A HG21 4  
ATOM   7011  H HG22 . VAL A 1 40 ? 15.305  4.733   3.500   1.00 1.01 ? 40  VAL A HG22 4  
ATOM   7012  H HG23 . VAL A 1 40 ? 13.995  5.217   2.424   1.00 0.99 ? 40  VAL A HG23 4  
ATOM   7013  N N    . VAL A 1 41 ? 12.200  1.642   0.544   1.00 0.15 ? 41  VAL A N    4  
ATOM   7014  C CA   . VAL A 1 41 ? 11.985  0.422   -0.296  1.00 0.16 ? 41  VAL A CA   4  
ATOM   7015  C C    . VAL A 1 41 ? 13.078  0.335   -1.363  1.00 0.16 ? 41  VAL A C    4  
ATOM   7016  O O    . VAL A 1 41 ? 13.214  1.204   -2.195  1.00 0.18 ? 41  VAL A O    4  
ATOM   7017  C CB   . VAL A 1 41 ? 10.608  0.504   -0.965  1.00 0.21 ? 41  VAL A CB   4  
ATOM   7018  C CG1  . VAL A 1 41 ? 10.184  -0.887  -1.433  1.00 0.25 ? 41  VAL A CG1  4  
ATOM   7019  C CG2  . VAL A 1 41 ? 9.584   1.025   0.047   1.00 0.23 ? 41  VAL A CG2  4  
ATOM   7020  H H    . VAL A 1 41 ? 12.189  2.529   0.129   1.00 0.20 ? 41  VAL A H    4  
ATOM   7021  H HA   . VAL A 1 41 ? 12.027  -0.457  0.320   1.00 0.15 ? 41  VAL A HA   4  
ATOM   7022  H HB   . VAL A 1 41 ? 10.654  1.169   -1.813  1.00 0.22 ? 41  VAL A HB   4  
ATOM   7023  H HG11 . VAL A 1 41 ? 10.165  -1.562  -0.589  1.00 1.08 ? 41  VAL A HG11 4  
ATOM   7024  H HG12 . VAL A 1 41 ? 9.199   -0.831  -1.869  1.00 1.04 ? 41  VAL A HG12 4  
ATOM   7025  H HG13 . VAL A 1 41 ? 10.887  -1.249  -2.167  1.00 0.99 ? 41  VAL A HG13 4  
ATOM   7026  H HG21 . VAL A 1 41 ? 9.590   0.395   0.924   1.00 1.03 ? 41  VAL A HG21 4  
ATOM   7027  H HG22 . VAL A 1 41 ? 9.836   2.036   0.330   1.00 1.04 ? 41  VAL A HG22 4  
ATOM   7028  H HG23 . VAL A 1 41 ? 8.600   1.011   -0.398  1.00 1.06 ? 41  VAL A HG23 4  
ATOM   7029  N N    . PHE A 1 42 ? 13.868  -0.706  -1.344  1.00 0.15 ? 42  PHE A N    4  
ATOM   7030  C CA   . PHE A 1 42 ? 14.960  -0.832  -2.355  1.00 0.17 ? 42  PHE A CA   4  
ATOM   7031  C C    . PHE A 1 42 ? 14.458  -1.581  -3.591  1.00 0.21 ? 42  PHE A C    4  
ATOM   7032  O O    . PHE A 1 42 ? 13.798  -2.597  -3.495  1.00 0.23 ? 42  PHE A O    4  
ATOM   7033  C CB   . PHE A 1 42 ? 16.134  -1.611  -1.752  1.00 0.16 ? 42  PHE A CB   4  
ATOM   7034  C CG   . PHE A 1 42 ? 16.904  -0.734  -0.787  1.00 0.14 ? 42  PHE A CG   4  
ATOM   7035  C CD1  . PHE A 1 42 ? 17.559  0.426   -1.251  1.00 0.14 ? 42  PHE A CD1  4  
ATOM   7036  C CD2  . PHE A 1 42 ? 16.977  -1.083  0.576   1.00 0.13 ? 42  PHE A CD2  4  
ATOM   7037  C CE1  . PHE A 1 42 ? 18.281  1.234   -0.352  1.00 0.14 ? 42  PHE A CE1  4  
ATOM   7038  C CE2  . PHE A 1 42 ? 17.701  -0.276  1.472   1.00 0.14 ? 42  PHE A CE2  4  
ATOM   7039  C CZ   . PHE A 1 42 ? 18.353  0.883   1.009   1.00 0.14 ? 42  PHE A CZ   4  
ATOM   7040  H H    . PHE A 1 42 ? 13.749  -1.398  -0.661  1.00 0.15 ? 42  PHE A H    4  
ATOM   7041  H HA   . PHE A 1 42 ? 15.297  0.150   -2.648  1.00 0.17 ? 42  PHE A HA   4  
ATOM   7042  H HB2  . PHE A 1 42 ? 15.756  -2.479  -1.231  1.00 0.16 ? 42  PHE A HB2  4  
ATOM   7043  H HB3  . PHE A 1 42 ? 16.797  -1.932  -2.544  1.00 0.18 ? 42  PHE A HB3  4  
ATOM   7044  H HD1  . PHE A 1 42 ? 17.508  0.697   -2.294  1.00 0.16 ? 42  PHE A HD1  4  
ATOM   7045  H HD2  . PHE A 1 42 ? 16.476  -1.970  0.934   1.00 0.14 ? 42  PHE A HD2  4  
ATOM   7046  H HE1  . PHE A 1 42 ? 18.781  2.123   -0.708  1.00 0.16 ? 42  PHE A HE1  4  
ATOM   7047  H HE2  . PHE A 1 42 ? 17.756  -0.548  2.514   1.00 0.16 ? 42  PHE A HE2  4  
ATOM   7048  H HZ   . PHE A 1 42 ? 18.909  1.502   1.697   1.00 0.16 ? 42  PHE A HZ   4  
ATOM   7049  N N    . GLN A 1 43 ? 14.801  -1.095  -4.755  1.00 0.24 ? 43  GLN A N    4  
ATOM   7050  C CA   . GLN A 1 43 ? 14.392  -1.775  -6.019  1.00 0.28 ? 43  GLN A CA   4  
ATOM   7051  C C    . GLN A 1 43 ? 15.580  -2.623  -6.480  1.00 0.30 ? 43  GLN A C    4  
ATOM   7052  O O    . GLN A 1 43 ? 16.671  -2.108  -6.657  1.00 0.30 ? 43  GLN A O    4  
ATOM   7053  C CB   . GLN A 1 43 ? 14.057  -0.713  -7.068  1.00 0.32 ? 43  GLN A CB   4  
ATOM   7054  C CG   . GLN A 1 43 ? 12.843  0.097   -6.606  1.00 0.32 ? 43  GLN A CG   4  
ATOM   7055  C CD   . GLN A 1 43 ? 12.721  1.364   -7.453  1.00 0.58 ? 43  GLN A CD   4  
ATOM   7056  O OE1  . GLN A 1 43 ? 12.317  2.400   -6.962  1.00 1.29 ? 43  GLN A OE1  4  
ATOM   7057  N NE2  . GLN A 1 43 ? 13.055  1.326   -8.714  1.00 1.31 ? 43  GLN A NE2  4  
ATOM   7058  H H    . GLN A 1 43 ? 15.354  -0.287  -4.797  1.00 0.23 ? 43  GLN A H    4  
ATOM   7059  H HA   . GLN A 1 43 ? 13.536  -2.404  -5.842  1.00 0.29 ? 43  GLN A HA   4  
ATOM   7060  H HB2  . GLN A 1 43 ? 14.903  -0.055  -7.191  1.00 0.32 ? 43  GLN A HB2  4  
ATOM   7061  H HB3  . GLN A 1 43 ? 13.830  -1.186  -8.005  1.00 0.36 ? 43  GLN A HB3  4  
ATOM   7062  H HG2  . GLN A 1 43 ? 11.951  -0.500  -6.720  1.00 0.36 ? 43  GLN A HG2  4  
ATOM   7063  H HG3  . GLN A 1 43 ? 12.963  0.369   -5.569  1.00 0.40 ? 43  GLN A HG3  4  
ATOM   7064  H HE21 . GLN A 1 43 ? 13.380  0.492   -9.109  1.00 2.01 ? 43  GLN A HE21 4  
ATOM   7065  H HE22 . GLN A 1 43 ? 12.979  2.133   -9.265  1.00 1.45 ? 43  GLN A HE22 4  
ATOM   7066  N N    . THR A 1 44 ? 15.409  -3.925  -6.631  1.00 0.32 ? 44  THR A N    4  
ATOM   7067  C CA   . THR A 1 44 ? 16.583  -4.784  -7.022  1.00 0.34 ? 44  THR A CA   4  
ATOM   7068  C C    . THR A 1 44 ? 16.595  -5.091  -8.518  1.00 0.39 ? 44  THR A C    4  
ATOM   7069  O O    . THR A 1 44 ? 16.020  -4.388  -9.324  1.00 0.41 ? 44  THR A O    4  
ATOM   7070  C CB   . THR A 1 44 ? 16.516  -6.103  -6.255  1.00 0.34 ? 44  THR A CB   4  
ATOM   7071  O OG1  . THR A 1 44 ? 15.621  -6.982  -6.916  1.00 0.38 ? 44  THR A OG1  4  
ATOM   7072  C CG2  . THR A 1 44 ? 16.015  -5.836  -4.835  1.00 0.29 ? 44  THR A CG2  4  
ATOM   7073  H H    . THR A 1 44 ? 14.522  -4.340  -6.455  1.00 0.32 ? 44  THR A H    4  
ATOM   7074  H HA   . THR A 1 44 ? 17.503  -4.281  -6.762  1.00 0.33 ? 44  THR A HA   4  
ATOM   7075  H HB   . THR A 1 44 ? 17.498  -6.549  -6.211  1.00 0.35 ? 44  THR A HB   4  
ATOM   7076  H HG1  . THR A 1 44 ? 14.932  -6.453  -7.324  1.00 0.77 ? 44  THR A HG1  4  
ATOM   7077  H HG21 . THR A 1 44 ? 16.508  -4.961  -4.435  1.00 1.07 ? 44  THR A HG21 4  
ATOM   7078  H HG22 . THR A 1 44 ? 14.950  -5.668  -4.859  1.00 1.03 ? 44  THR A HG22 4  
ATOM   7079  H HG23 . THR A 1 44 ? 16.231  -6.687  -4.209  1.00 1.00 ? 44  THR A HG23 4  
ATOM   7080  N N    . LYS A 1 45 ? 17.280  -6.152  -8.879  1.00 0.43 ? 45  LYS A N    4  
ATOM   7081  C CA   . LYS A 1 45 ? 17.391  -6.558  -10.314 1.00 0.48 ? 45  LYS A CA   4  
ATOM   7082  C C    . LYS A 1 45 ? 16.651  -7.881  -10.541 1.00 0.51 ? 45  LYS A C    4  
ATOM   7083  O O    . LYS A 1 45 ? 16.279  -8.202  -11.652 1.00 0.56 ? 45  LYS A O    4  
ATOM   7084  C CB   . LYS A 1 45 ? 18.873  -6.757  -10.663 1.00 0.50 ? 45  LYS A CB   4  
ATOM   7085  C CG   . LYS A 1 45 ? 19.707  -5.604  -10.101 1.00 0.46 ? 45  LYS A CG   4  
ATOM   7086  C CD   . LYS A 1 45 ? 21.181  -5.833  -10.447 1.00 0.49 ? 45  LYS A CD   4  
ATOM   7087  C CE   . LYS A 1 45 ? 22.005  -4.605  -10.049 1.00 0.54 ? 45  LYS A CE   4  
ATOM   7088  N NZ   . LYS A 1 45 ? 23.444  -4.983  -9.955  1.00 1.55 ? 45  LYS A NZ   4  
ATOM   7089  H H    . LYS A 1 45 ? 17.738  -6.683  -8.195  1.00 0.44 ? 45  LYS A H    4  
ATOM   7090  H HA   . LYS A 1 45 ? 16.971  -5.793  -10.952 1.00 0.49 ? 45  LYS A HA   4  
ATOM   7091  H HB2  . LYS A 1 45 ? 19.221  -7.687  -10.238 1.00 0.51 ? 45  LYS A HB2  4  
ATOM   7092  H HB3  . LYS A 1 45 ? 18.987  -6.789  -11.734 1.00 0.57 ? 45  LYS A HB3  4  
ATOM   7093  H HG2  . LYS A 1 45 ? 19.373  -4.674  -10.538 1.00 0.50 ? 45  LYS A HG2  4  
ATOM   7094  H HG3  . LYS A 1 45 ? 19.594  -5.563  -9.028  1.00 0.42 ? 45  LYS A HG3  4  
ATOM   7095  H HD2  . LYS A 1 45 ? 21.544  -6.698  -9.911  1.00 0.51 ? 45  LYS A HD2  4  
ATOM   7096  H HD3  . LYS A 1 45 ? 21.280  -6.001  -11.508 1.00 0.63 ? 45  LYS A HD3  4  
ATOM   7097  H HE2  . LYS A 1 45 ? 21.885  -3.835  -10.795 1.00 0.95 ? 45  LYS A HE2  4  
ATOM   7098  H HE3  . LYS A 1 45 ? 21.668  -4.236  -9.091  1.00 1.20 ? 45  LYS A HE3  4  
ATOM   7099  H HZ1  . LYS A 1 45 ? 23.534  -6.018  -9.990  1.00 2.09 ? 45  LYS A HZ1  4  
ATOM   7100  H HZ2  . LYS A 1 45 ? 23.966  -4.561  -10.751 1.00 2.04 ? 45  LYS A HZ2  4  
ATOM   7101  H HZ3  . LYS A 1 45 ? 23.837  -4.634  -9.058  1.00 2.16 ? 45  LYS A HZ3  4  
ATOM   7102  N N    . ARG A 1 46 ? 16.449  -8.660  -9.500  1.00 0.50 ? 46  ARG A N    4  
ATOM   7103  C CA   . ARG A 1 46 ? 15.746  -9.978  -9.658  1.00 0.54 ? 46  ARG A CA   4  
ATOM   7104  C C    . ARG A 1 46 ? 14.580  -10.033 -8.663  1.00 0.49 ? 46  ARG A C    4  
ATOM   7105  O O    . ARG A 1 46 ? 14.401  -10.986 -7.936  1.00 0.48 ? 46  ARG A O    4  
ATOM   7106  C CB   . ARG A 1 46 ? 16.752  -11.115 -9.378  1.00 0.59 ? 46  ARG A CB   4  
ATOM   7107  C CG   . ARG A 1 46 ? 16.317  -12.434 -10.056 1.00 0.72 ? 46  ARG A CG   4  
ATOM   7108  C CD   . ARG A 1 46 ? 15.196  -13.129 -9.270  1.00 0.92 ? 46  ARG A CD   4  
ATOM   7109  N NE   . ARG A 1 46 ? 15.143  -14.565 -9.664  1.00 1.48 ? 46  ARG A NE   4  
ATOM   7110  C CZ   . ARG A 1 46 ? 14.482  -15.419 -8.932  1.00 2.13 ? 46  ARG A CZ   4  
ATOM   7111  N NH1  . ARG A 1 46 ? 13.870  -15.017 -7.853  1.00 2.62 ? 46  ARG A NH1  4  
ATOM   7112  N NH2  . ARG A 1 46 ? 14.436  -16.677 -9.279  1.00 2.82 ? 46  ARG A NH2  4  
ATOM   7113  H H    . ARG A 1 46 ? 16.768  -8.382  -8.616  1.00 0.48 ? 46  ARG A H    4  
ATOM   7114  H HA   . ARG A 1 46 ? 15.356  -10.073 -10.661 1.00 0.59 ? 46  ARG A HA   4  
ATOM   7115  H HB2  . ARG A 1 46 ? 17.718  -10.827 -9.767  1.00 0.68 ? 46  ARG A HB2  4  
ATOM   7116  H HB3  . ARG A 1 46 ? 16.834  -11.268 -8.313  1.00 0.53 ? 46  ARG A HB3  4  
ATOM   7117  H HG2  . ARG A 1 46 ? 15.973  -12.232 -11.058 1.00 0.90 ? 46  ARG A HG2  4  
ATOM   7118  H HG3  . ARG A 1 46 ? 17.168  -13.096 -10.107 1.00 1.21 ? 46  ARG A HG3  4  
ATOM   7119  H HD2  . ARG A 1 46 ? 15.390  -13.060 -8.211  1.00 1.48 ? 46  ARG A HD2  4  
ATOM   7120  H HD3  . ARG A 1 46 ? 14.250  -12.663 -9.502  1.00 1.01 ? 46  ARG A HD3  4  
ATOM   7121  H HE   . ARG A 1 46 ? 15.604  -14.868 -10.475 1.00 1.94 ? 46  ARG A HE   4  
ATOM   7122  H HH11 . ARG A 1 46 ? 13.906  -14.054 -7.586  1.00 2.46 ? 46  ARG A HH11 4  
ATOM   7123  H HH12 . ARG A 1 46 ? 13.364  -15.672 -7.292  1.00 3.45 ? 46  ARG A HH12 4  
ATOM   7124  H HH21 . ARG A 1 46 ? 14.906  -16.986 -10.105 1.00 2.97 ? 46  ARG A HH21 4  
ATOM   7125  H HH22 . ARG A 1 46 ? 13.930  -17.331 -8.717  1.00 3.45 ? 46  ARG A HH22 4  
ATOM   7126  N N    . SER A 1 47 ? 13.780  -9.006  -8.635  1.00 0.46 ? 47  SER A N    4  
ATOM   7127  C CA   . SER A 1 47 ? 12.616  -8.978  -7.720  1.00 0.42 ? 47  SER A CA   4  
ATOM   7128  C C    . SER A 1 47 ? 11.749  -7.787  -8.111  1.00 0.42 ? 47  SER A C    4  
ATOM   7129  O O    . SER A 1 47 ? 11.302  -7.675  -9.235  1.00 0.46 ? 47  SER A O    4  
ATOM   7130  C CB   . SER A 1 47 ? 13.076  -8.852  -6.261  1.00 0.38 ? 47  SER A CB   4  
ATOM   7131  O OG   . SER A 1 47 ? 13.559  -7.538  -6.024  1.00 1.07 ? 47  SER A OG   4  
ATOM   7132  H H    . SER A 1 47 ? 13.940  -8.246  -9.228  1.00 0.47 ? 47  SER A H    4  
ATOM   7133  H HA   . SER A 1 47 ? 12.048  -9.882  -7.839  1.00 0.44 ? 47  SER A HA   4  
ATOM   7134  H HB2  . SER A 1 47 ? 12.246  -9.047  -5.601  1.00 0.76 ? 47  SER A HB2  4  
ATOM   7135  H HB3  . SER A 1 47 ? 13.859  -9.576  -6.067  1.00 0.86 ? 47  SER A HB3  4  
ATOM   7136  H HG   . SER A 1 47 ? 13.260  -7.266  -5.152  1.00 1.44 ? 47  SER A HG   4  
ATOM   7137  N N    . LYS A 1 48 ? 11.533  -6.888  -7.209  1.00 0.38 ? 48  LYS A N    4  
ATOM   7138  C CA   . LYS A 1 48 ? 10.724  -5.688  -7.530  1.00 0.40 ? 48  LYS A CA   4  
ATOM   7139  C C    . LYS A 1 48 ? 11.011  -4.631  -6.467  1.00 0.35 ? 48  LYS A C    4  
ATOM   7140  O O    . LYS A 1 48 ? 11.947  -3.870  -6.589  1.00 0.34 ? 48  LYS A O    4  
ATOM   7141  C CB   . LYS A 1 48 ? 9.217   -6.029  -7.593  1.00 0.44 ? 48  LYS A CB   4  
ATOM   7142  C CG   . LYS A 1 48 ? 8.852   -7.179  -6.637  1.00 1.11 ? 48  LYS A CG   4  
ATOM   7143  C CD   . LYS A 1 48 ? 7.403   -7.617  -6.899  1.00 1.38 ? 48  LYS A CD   4  
ATOM   7144  C CE   . LYS A 1 48 ? 6.453   -6.420  -6.783  1.00 2.13 ? 48  LYS A CE   4  
ATOM   7145  N NZ   . LYS A 1 48 ? 5.072   -6.911  -6.507  1.00 2.73 ? 48  LYS A NZ   4  
ATOM   7146  H H    . LYS A 1 48 ? 11.931  -6.985  -6.324  1.00 0.36 ? 48  LYS A H    4  
ATOM   7147  H HA   . LYS A 1 48 ? 11.041  -5.303  -8.491  1.00 0.43 ? 48  LYS A HA   4  
ATOM   7148  H HB2  . LYS A 1 48 ? 8.645   -5.155  -7.330  1.00 0.92 ? 48  LYS A HB2  4  
ATOM   7149  H HB3  . LYS A 1 48 ? 8.964   -6.320  -8.602  1.00 0.85 ? 48  LYS A HB3  4  
ATOM   7150  H HG2  . LYS A 1 48 ? 9.509   -8.017  -6.806  1.00 1.64 ? 48  LYS A HG2  4  
ATOM   7151  H HG3  . LYS A 1 48 ? 8.944   -6.850  -5.615  1.00 1.69 ? 48  LYS A HG3  4  
ATOM   7152  H HD2  . LYS A 1 48 ? 7.330   -8.036  -7.893  1.00 1.70 ? 48  LYS A HD2  4  
ATOM   7153  H HD3  . LYS A 1 48 ? 7.118   -8.365  -6.177  1.00 1.63 ? 48  LYS A HD3  4  
ATOM   7154  H HE2  . LYS A 1 48 ? 6.773   -5.777  -5.976  1.00 2.60 ? 48  LYS A HE2  4  
ATOM   7155  H HE3  . LYS A 1 48 ? 6.457   -5.866  -7.710  1.00 2.56 ? 48  LYS A HE3  4  
ATOM   7156  H HZ1  . LYS A 1 48 ? 5.072   -7.950  -6.484  1.00 3.07 ? 48  LYS A HZ1  4  
ATOM   7157  H HZ2  . LYS A 1 48 ? 4.752   -6.546  -5.588  1.00 3.23 ? 48  LYS A HZ2  4  
ATOM   7158  H HZ3  . LYS A 1 48 ? 4.431   -6.579  -7.257  1.00 3.01 ? 48  LYS A HZ3  4  
ATOM   7159  N N    . GLN A 1 49 ? 10.227  -4.597  -5.416  1.00 0.33 ? 49  GLN A N    4  
ATOM   7160  C CA   . GLN A 1 49 ? 10.450  -3.605  -4.315  1.00 0.30 ? 49  GLN A CA   4  
ATOM   7161  C C    . GLN A 1 49 ? 10.710  -4.380  -3.008  1.00 0.25 ? 49  GLN A C    4  
ATOM   7162  O O    . GLN A 1 49 ? 10.164  -5.447  -2.782  1.00 0.26 ? 49  GLN A O    4  
ATOM   7163  C CB   . GLN A 1 49 ? 9.206   -2.689  -4.163  1.00 0.35 ? 49  GLN A CB   4  
ATOM   7164  C CG   . GLN A 1 49 ? 8.339   -2.734  -5.426  1.00 0.82 ? 49  GLN A CG   4  
ATOM   7165  C CD   . GLN A 1 49 ? 9.144   -2.221  -6.621  1.00 0.89 ? 49  GLN A CD   4  
ATOM   7166  O OE1  . GLN A 1 49 ? 9.353   -2.934  -7.582  1.00 1.53 ? 49  GLN A OE1  4  
ATOM   7167  N NE2  . GLN A 1 49 ? 9.605   -1.000  -6.603  1.00 1.52 ? 49  GLN A NE2  4  
ATOM   7168  H H    . GLN A 1 49 ? 9.492   -5.235  -5.344  1.00 0.36 ? 49  GLN A H    4  
ATOM   7169  H HA   . GLN A 1 49 ? 11.320  -2.998  -4.537  1.00 0.32 ? 49  GLN A HA   4  
ATOM   7170  H HB2  . GLN A 1 49 ? 8.610   -3.008  -3.322  1.00 0.76 ? 49  GLN A HB2  4  
ATOM   7171  H HB3  . GLN A 1 49 ? 9.527   -1.672  -4.002  1.00 0.86 ? 49  GLN A HB3  4  
ATOM   7172  H HG2  . GLN A 1 49 ? 8.014   -3.746  -5.608  1.00 1.46 ? 49  GLN A HG2  4  
ATOM   7173  H HG3  . GLN A 1 49 ? 7.473   -2.104  -5.285  1.00 1.32 ? 49  GLN A HG3  4  
ATOM   7174  H HE21 . GLN A 1 49 ? 9.432   -0.424  -5.830  1.00 2.12 ? 49  GLN A HE21 4  
ATOM   7175  H HE22 . GLN A 1 49 ? 10.120  -0.660  -7.364  1.00 1.80 ? 49  GLN A HE22 4  
ATOM   7176  N N    . VAL A 1 50 ? 11.548  -3.853  -2.148  1.00 0.23 ? 50  VAL A N    4  
ATOM   7177  C CA   . VAL A 1 50 ? 11.855  -4.549  -0.857  1.00 0.19 ? 50  VAL A CA   4  
ATOM   7178  C C    . VAL A 1 50 ? 11.894  -3.525  0.268   1.00 0.16 ? 50  VAL A C    4  
ATOM   7179  O O    . VAL A 1 50 ? 12.675  -2.601  0.240   1.00 0.15 ? 50  VAL A O    4  
ATOM   7180  C CB   . VAL A 1 50 ? 13.213  -5.243  -0.958  1.00 0.22 ? 50  VAL A CB   4  
ATOM   7181  C CG1  . VAL A 1 50 ? 13.402  -6.169  0.245   1.00 0.24 ? 50  VAL A CG1  4  
ATOM   7182  C CG2  . VAL A 1 50 ? 13.267  -6.051  -2.257  1.00 0.31 ? 50  VAL A CG2  4  
ATOM   7183  H H    . VAL A 1 50 ? 11.980  -2.998  -2.354  1.00 0.26 ? 50  VAL A H    4  
ATOM   7184  H HA   . VAL A 1 50 ? 11.091  -5.284  -0.640  1.00 0.20 ? 50  VAL A HA   4  
ATOM   7185  H HB   . VAL A 1 50 ? 14.000  -4.502  -0.963  1.00 0.24 ? 50  VAL A HB   4  
ATOM   7186  H HG11 . VAL A 1 50 ? 12.564  -6.844  0.314   1.00 1.03 ? 50  VAL A HG11 4  
ATOM   7187  H HG12 . VAL A 1 50 ? 14.314  -6.736  0.128   1.00 1.07 ? 50  VAL A HG12 4  
ATOM   7188  H HG13 . VAL A 1 50 ? 13.461  -5.578  1.147   1.00 1.04 ? 50  VAL A HG13 4  
ATOM   7189  H HG21 . VAL A 1 50 ? 12.312  -6.527  -2.427  1.00 1.02 ? 50  VAL A HG21 4  
ATOM   7190  H HG22 . VAL A 1 50 ? 13.486  -5.388  -3.077  1.00 1.09 ? 50  VAL A HG22 4  
ATOM   7191  H HG23 . VAL A 1 50 ? 14.039  -6.805  -2.188  1.00 1.10 ? 50  VAL A HG23 4  
ATOM   7192  N N    . CYS A 1 51 ? 11.065  -3.689  1.258   1.00 0.16 ? 51  CYS A N    4  
ATOM   7193  C CA   . CYS A 1 51 ? 11.045  -2.717  2.385   1.00 0.15 ? 51  CYS A CA   4  
ATOM   7194  C C    . CYS A 1 51 ? 12.300  -2.896  3.236   1.00 0.14 ? 51  CYS A C    4  
ATOM   7195  O O    . CYS A 1 51 ? 12.853  -3.973  3.332   1.00 0.16 ? 51  CYS A O    4  
ATOM   7196  C CB   . CYS A 1 51 ? 9.806   -2.974  3.240   1.00 0.17 ? 51  CYS A CB   4  
ATOM   7197  S SG   . CYS A 1 51 ? 8.319   -2.646  2.261   1.00 0.21 ? 51  CYS A SG   4  
ATOM   7198  H H    . CYS A 1 51 ? 10.448  -4.449  1.259   1.00 0.19 ? 51  CYS A H    4  
ATOM   7199  H HA   . CYS A 1 51 ? 11.011  -1.711  1.998   1.00 0.15 ? 51  CYS A HA   4  
ATOM   7200  H HB2  . CYS A 1 51 ? 9.801   -4.003  3.568   1.00 0.19 ? 51  CYS A HB2  4  
ATOM   7201  H HB3  . CYS A 1 51 ? 9.822   -2.324  4.098   1.00 0.18 ? 51  CYS A HB3  4  
ATOM   7202  N N    . ALA A 1 52 ? 12.762  -1.835  3.846   1.00 0.12 ? 52  ALA A N    4  
ATOM   7203  C CA   . ALA A 1 52 ? 13.994  -1.920  4.686   1.00 0.13 ? 52  ALA A CA   4  
ATOM   7204  C C    . ALA A 1 52 ? 13.832  -1.024  5.917   1.00 0.15 ? 52  ALA A C    4  
ATOM   7205  O O    . ALA A 1 52 ? 13.380  0.103   5.823   1.00 0.15 ? 52  ALA A O    4  
ATOM   7206  C CB   . ALA A 1 52 ? 15.195  -1.439  3.869   1.00 0.11 ? 52  ALA A CB   4  
ATOM   7207  H H    . ALA A 1 52 ? 12.302  -0.976  3.742   1.00 0.13 ? 52  ALA A H    4  
ATOM   7208  H HA   . ALA A 1 52 ? 14.157  -2.943  5.002   1.00 0.14 ? 52  ALA A HA   4  
ATOM   7209  H HB1  . ALA A 1 52 ? 15.191  -1.923  2.904   1.00 1.01 ? 52  ALA A HB1  4  
ATOM   7210  H HB2  . ALA A 1 52 ? 15.134  -0.369  3.736   1.00 1.04 ? 52  ALA A HB2  4  
ATOM   7211  H HB3  . ALA A 1 52 ? 16.108  -1.685  4.391   1.00 1.02 ? 52  ALA A HB3  4  
ATOM   7212  N N    . ASP A 1 53 ? 14.198  -1.517  7.068   1.00 0.18 ? 53  ASP A N    4  
ATOM   7213  C CA   . ASP A 1 53 ? 14.068  -0.703  8.309   1.00 0.22 ? 53  ASP A CA   4  
ATOM   7214  C C    . ASP A 1 53 ? 15.077  0.471   8.261   1.00 0.21 ? 53  ASP A C    4  
ATOM   7215  O O    . ASP A 1 53 ? 16.265  0.222   8.230   1.00 0.22 ? 53  ASP A O    4  
ATOM   7216  C CB   . ASP A 1 53 ? 14.397  -1.588  9.516   1.00 0.27 ? 53  ASP A CB   4  
ATOM   7217  C CG   . ASP A 1 53 ? 13.978  -0.877  10.803  1.00 1.35 ? 53  ASP A CG   4  
ATOM   7218  O OD1  . ASP A 1 53 ? 13.127  -0.006  10.725  1.00 2.17 ? 53  ASP A OD1  4  
ATOM   7219  O OD2  . ASP A 1 53 ? 14.515  -1.215  11.845  1.00 2.10 ? 53  ASP A OD2  4  
ATOM   7220  H H    . ASP A 1 53 ? 14.556  -2.429  7.116   1.00 0.19 ? 53  ASP A H    4  
ATOM   7221  H HA   . ASP A 1 53 ? 13.057  -0.357  8.395   1.00 0.22 ? 53  ASP A HA   4  
ATOM   7222  H HB2  . ASP A 1 53 ? 13.863  -2.524  9.431   1.00 1.05 ? 53  ASP A HB2  4  
ATOM   7223  H HB3  . ASP A 1 53 ? 15.459  -1.780  9.541   1.00 1.03 ? 53  ASP A HB3  4  
ATOM   7224  N N    . PRO A 1 54 ? 14.616  1.718   8.253   1.00 0.22 ? 54  PRO A N    4  
ATOM   7225  C CA   . PRO A 1 54 ? 15.549  2.866   8.206   1.00 0.24 ? 54  PRO A CA   4  
ATOM   7226  C C    . PRO A 1 54 ? 16.465  2.859   9.441   1.00 0.28 ? 54  PRO A C    4  
ATOM   7227  O O    . PRO A 1 54 ? 17.379  3.652   9.552   1.00 0.30 ? 54  PRO A O    4  
ATOM   7228  C CB   . PRO A 1 54 ? 14.645  4.121   8.198   1.00 0.27 ? 54  PRO A CB   4  
ATOM   7229  C CG   . PRO A 1 54 ? 13.167  3.639   8.246   1.00 0.27 ? 54  PRO A CG   4  
ATOM   7230  C CD   . PRO A 1 54 ? 13.180  2.095   8.286   1.00 0.24 ? 54  PRO A CD   4  
ATOM   7231  H HA   . PRO A 1 54 ? 16.140  2.828   7.303   1.00 0.21 ? 54  PRO A HA   4  
ATOM   7232  H HB2  . PRO A 1 54 ? 14.859  4.740   9.061   1.00 0.30 ? 54  PRO A HB2  4  
ATOM   7233  H HB3  . PRO A 1 54 ? 14.814  4.689   7.294   1.00 0.26 ? 54  PRO A HB3  4  
ATOM   7234  H HG2  . PRO A 1 54 ? 12.679  4.031   9.133   1.00 0.31 ? 54  PRO A HG2  4  
ATOM   7235  H HG3  . PRO A 1 54 ? 12.638  3.977   7.365   1.00 0.27 ? 54  PRO A HG3  4  
ATOM   7236  H HD2  . PRO A 1 54 ? 12.717  1.743   9.200   1.00 0.26 ? 54  PRO A HD2  4  
ATOM   7237  H HD3  . PRO A 1 54 ? 12.670  1.690   7.423   1.00 0.21 ? 54  PRO A HD3  4  
ATOM   7238  N N    . SER A 1 55 ? 16.214  1.986   10.373  1.00 0.31 ? 55  SER A N    4  
ATOM   7239  C CA   . SER A 1 55 ? 17.055  1.946   11.605  1.00 0.36 ? 55  SER A CA   4  
ATOM   7240  C C    . SER A 1 55 ? 18.397  1.271   11.307  1.00 0.36 ? 55  SER A C    4  
ATOM   7241  O O    . SER A 1 55 ? 19.358  1.443   12.032  1.00 0.40 ? 55  SER A O    4  
ATOM   7242  C CB   . SER A 1 55 ? 16.322  1.162   12.692  1.00 0.40 ? 55  SER A CB   4  
ATOM   7243  O OG   . SER A 1 55 ? 16.938  1.415   13.949  1.00 1.42 ? 55  SER A OG   4  
ATOM   7244  H H    . SER A 1 55 ? 15.462  1.369   10.272  1.00 0.30 ? 55  SER A H    4  
ATOM   7245  H HA   . SER A 1 55 ? 17.231  2.954   11.949  1.00 0.39 ? 55  SER A HA   4  
ATOM   7246  H HB2  . SER A 1 55 ? 15.293  1.473   12.733  1.00 0.99 ? 55  SER A HB2  4  
ATOM   7247  H HB3  . SER A 1 55 ? 16.368  0.104   12.465  1.00 1.11 ? 55  SER A HB3  4  
ATOM   7248  H HG   . SER A 1 55 ? 16.243  1.597   14.587  1.00 1.89 ? 55  SER A HG   4  
ATOM   7249  N N    . GLU A 1 56 ? 18.481  0.508   10.251  1.00 0.33 ? 56  GLU A N    4  
ATOM   7250  C CA   . GLU A 1 56 ? 19.772  -0.166  9.924   1.00 0.34 ? 56  GLU A CA   4  
ATOM   7251  C C    . GLU A 1 56 ? 20.691  0.825   9.198   1.00 0.33 ? 56  GLU A C    4  
ATOM   7252  O O    . GLU A 1 56 ? 20.364  1.354   8.155   1.00 0.29 ? 56  GLU A O    4  
ATOM   7253  C CB   . GLU A 1 56 ? 19.501  -1.380  9.033   1.00 0.31 ? 56  GLU A CB   4  
ATOM   7254  C CG   . GLU A 1 56 ? 19.034  -2.560  9.891   1.00 0.35 ? 56  GLU A CG   4  
ATOM   7255  C CD   . GLU A 1 56 ? 18.430  -3.640  8.990   1.00 1.30 ? 56  GLU A CD   4  
ATOM   7256  O OE1  . GLU A 1 56 ? 18.436  -3.449  7.785   1.00 2.01 ? 56  GLU A OE1  4  
ATOM   7257  O OE2  . GLU A 1 56 ? 17.972  -4.638  9.521   1.00 2.08 ? 56  GLU A OE2  4  
ATOM   7258  H H    . GLU A 1 56 ? 17.700  0.380   9.674   1.00 0.30 ? 56  GLU A H    4  
ATOM   7259  H HA   . GLU A 1 56 ? 20.251  -0.487  10.837  1.00 0.37 ? 56  GLU A HA   4  
ATOM   7260  H HB2  . GLU A 1 56 ? 18.733  -1.131  8.322   1.00 0.28 ? 56  GLU A HB2  4  
ATOM   7261  H HB3  . GLU A 1 56 ? 20.404  -1.654  8.509   1.00 0.31 ? 56  GLU A HB3  4  
ATOM   7262  H HG2  . GLU A 1 56 ? 19.877  -2.970  10.429  1.00 0.87 ? 56  GLU A HG2  4  
ATOM   7263  H HG3  . GLU A 1 56 ? 18.287  -2.221  10.594  1.00 1.00 ? 56  GLU A HG3  4  
ATOM   7264  N N    . SER A 1 57 ? 21.832  1.087   9.767   1.00 0.37 ? 57  SER A N    4  
ATOM   7265  C CA   . SER A 1 57 ? 22.793  2.051   9.158   1.00 0.38 ? 57  SER A CA   4  
ATOM   7266  C C    . SER A 1 57 ? 23.042  1.749   7.676   1.00 0.35 ? 57  SER A C    4  
ATOM   7267  O O    . SER A 1 57 ? 23.132  2.650   6.867   1.00 0.34 ? 57  SER A O    4  
ATOM   7268  C CB   . SER A 1 57 ? 24.120  1.979   9.914   1.00 0.44 ? 57  SER A CB   4  
ATOM   7269  O OG   . SER A 1 57 ? 23.931  2.448   11.242  1.00 1.37 ? 57  SER A OG   4  
ATOM   7270  H H    . SER A 1 57 ? 22.058  0.653   10.612  1.00 0.41 ? 57  SER A H    4  
ATOM   7271  H HA   . SER A 1 57 ? 22.394  3.048   9.250   1.00 0.38 ? 57  SER A HA   4  
ATOM   7272  H HB2  . SER A 1 57 ? 24.463  0.958   9.944   1.00 1.21 ? 57  SER A HB2  4  
ATOM   7273  H HB3  . SER A 1 57 ? 24.855  2.589   9.407   1.00 1.06 ? 57  SER A HB3  4  
ATOM   7274  H HG   . SER A 1 57 ? 23.340  3.205   11.208  1.00 1.80 ? 57  SER A HG   4  
ATOM   7275  N N    . TRP A 1 58 ? 23.184  0.505   7.308   1.00 0.34 ? 58  TRP A N    4  
ATOM   7276  C CA   . TRP A 1 58 ? 23.459  0.200   5.874   1.00 0.32 ? 58  TRP A CA   4  
ATOM   7277  C C    . TRP A 1 58 ? 22.319  0.724   5.003   1.00 0.27 ? 58  TRP A C    4  
ATOM   7278  O O    . TRP A 1 58 ? 22.507  1.048   3.849   1.00 0.27 ? 58  TRP A O    4  
ATOM   7279  C CB   . TRP A 1 58 ? 23.672  -1.310  5.673   1.00 0.34 ? 58  TRP A CB   4  
ATOM   7280  C CG   . TRP A 1 58 ? 22.373  -2.053  5.655   1.00 0.31 ? 58  TRP A CG   4  
ATOM   7281  C CD1  . TRP A 1 58 ? 21.887  -2.781  6.686   1.00 0.32 ? 58  TRP A CD1  4  
ATOM   7282  C CD2  . TRP A 1 58 ? 21.411  -2.190  4.567   1.00 0.27 ? 58  TRP A CD2  4  
ATOM   7283  N NE1  . TRP A 1 58 ? 20.686  -3.352  6.305   1.00 0.29 ? 58  TRP A NE1  4  
ATOM   7284  C CE2  . TRP A 1 58 ? 20.345  -3.016  5.013   1.00 0.26 ? 58  TRP A CE2  4  
ATOM   7285  C CE3  . TRP A 1 58 ? 21.353  -1.679  3.249   1.00 0.27 ? 58  TRP A CE3  4  
ATOM   7286  C CZ2  . TRP A 1 58 ? 19.261  -3.328  4.183   1.00 0.25 ? 58  TRP A CZ2  4  
ATOM   7287  C CZ3  . TRP A 1 58 ? 20.263  -1.991  2.409   1.00 0.27 ? 58  TRP A CZ3  4  
ATOM   7288  C CH2  . TRP A 1 58 ? 19.218  -2.814  2.878   1.00 0.26 ? 58  TRP A CH2  4  
ATOM   7289  H H    . TRP A 1 58 ? 23.123  -0.216  7.966   1.00 0.36 ? 58  TRP A H    4  
ATOM   7290  H HA   . TRP A 1 58 ? 24.366  0.715   5.587   1.00 0.35 ? 58  TRP A HA   4  
ATOM   7291  H HB2  . TRP A 1 58 ? 24.180  -1.473  4.736   1.00 0.35 ? 58  TRP A HB2  4  
ATOM   7292  H HB3  . TRP A 1 58 ? 24.286  -1.688  6.477   1.00 0.38 ? 58  TRP A HB3  4  
ATOM   7293  H HD1  . TRP A 1 58 ? 22.361  -2.899  7.650   1.00 0.36 ? 58  TRP A HD1  4  
ATOM   7294  H HE1  . TRP A 1 58 ? 20.132  -3.928  6.868   1.00 0.30 ? 58  TRP A HE1  4  
ATOM   7295  H HE3  . TRP A 1 58 ? 22.150  -1.051  2.881   1.00 0.29 ? 58  TRP A HE3  4  
ATOM   7296  H HZ2  . TRP A 1 58 ? 18.462  -3.958  4.546   1.00 0.25 ? 58  TRP A HZ2  4  
ATOM   7297  H HZ3  . TRP A 1 58 ? 20.228  -1.598  1.405   1.00 0.29 ? 58  TRP A HZ3  4  
ATOM   7298  H HH2  . TRP A 1 58 ? 18.384  -3.051  2.233   1.00 0.27 ? 58  TRP A HH2  4  
ATOM   7299  N N    . VAL A 1 59 ? 21.142  0.833   5.547   1.00 0.24 ? 59  VAL A N    4  
ATOM   7300  C CA   . VAL A 1 59 ? 20.009  1.359   4.743   1.00 0.20 ? 59  VAL A CA   4  
ATOM   7301  C C    . VAL A 1 59 ? 20.228  2.848   4.502   1.00 0.22 ? 59  VAL A C    4  
ATOM   7302  O O    . VAL A 1 59 ? 20.113  3.334   3.396   1.00 0.21 ? 59  VAL A O    4  
ATOM   7303  C CB   . VAL A 1 59 ? 18.703  1.142   5.505   1.00 0.19 ? 59  VAL A CB   4  
ATOM   7304  C CG1  . VAL A 1 59 ? 17.530  1.720   4.706   1.00 0.18 ? 59  VAL A CG1  4  
ATOM   7305  C CG2  . VAL A 1 59 ? 18.504  -0.360  5.709   1.00 0.19 ? 59  VAL A CG2  4  
ATOM   7306  H H    . VAL A 1 59 ? 21.008  0.583   6.486   1.00 0.26 ? 59  VAL A H    4  
ATOM   7307  H HA   . VAL A 1 59 ? 19.967  0.843   3.797   1.00 0.20 ? 59  VAL A HA   4  
ATOM   7308  H HB   . VAL A 1 59 ? 18.758  1.634   6.465   1.00 0.21 ? 59  VAL A HB   4  
ATOM   7309  H HG11 . VAL A 1 59 ? 17.643  1.470   3.664   1.00 1.01 ? 59  VAL A HG11 4  
ATOM   7310  H HG12 . VAL A 1 59 ? 16.603  1.308   5.077   1.00 1.03 ? 59  VAL A HG12 4  
ATOM   7311  H HG13 . VAL A 1 59 ? 17.515  2.793   4.818   1.00 0.98 ? 59  VAL A HG13 4  
ATOM   7312  H HG21 . VAL A 1 59 ? 19.399  -0.782  6.143   1.00 1.04 ? 59  VAL A HG21 4  
ATOM   7313  H HG22 . VAL A 1 59 ? 17.667  -0.526  6.368   1.00 1.05 ? 59  VAL A HG22 4  
ATOM   7314  H HG23 . VAL A 1 59 ? 18.313  -0.829  4.758   1.00 1.00 ? 59  VAL A HG23 4  
ATOM   7315  N N    . GLN A 1 60 ? 20.556  3.576   5.530   1.00 0.25 ? 60  GLN A N    4  
ATOM   7316  C CA   . GLN A 1 60 ? 20.795  5.036   5.357   1.00 0.28 ? 60  GLN A CA   4  
ATOM   7317  C C    . GLN A 1 60 ? 22.007  5.252   4.446   1.00 0.30 ? 60  GLN A C    4  
ATOM   7318  O O    . GLN A 1 60 ? 22.039  6.162   3.643   1.00 0.31 ? 60  GLN A O    4  
ATOM   7319  C CB   . GLN A 1 60 ? 21.060  5.675   6.723   1.00 0.33 ? 60  GLN A CB   4  
ATOM   7320  C CG   . GLN A 1 60 ? 19.844  5.466   7.628   1.00 1.25 ? 60  GLN A CG   4  
ATOM   7321  C CD   . GLN A 1 60 ? 20.017  6.281   8.911   1.00 1.65 ? 60  GLN A CD   4  
ATOM   7322  O OE1  . GLN A 1 60 ? 19.047  6.669   9.533   1.00 2.33 ? 60  GLN A OE1  4  
ATOM   7323  N NE2  . GLN A 1 60 ? 21.219  6.561   9.336   1.00 2.14 ? 60  GLN A NE2  4  
ATOM   7324  H H    . GLN A 1 60 ? 20.651  3.158   6.416   1.00 0.27 ? 60  GLN A H    4  
ATOM   7325  H HA   . GLN A 1 60 ? 19.925  5.492   4.908   1.00 0.28 ? 60  GLN A HA   4  
ATOM   7326  H HB2  . GLN A 1 60 ? 21.929  5.218   7.172   1.00 0.91 ? 60  GLN A HB2  4  
ATOM   7327  H HB3  . GLN A 1 60 ? 21.234  6.734   6.597   1.00 0.88 ? 60  GLN A HB3  4  
ATOM   7328  H HG2  . GLN A 1 60 ? 18.951  5.788   7.113   1.00 1.90 ? 60  GLN A HG2  4  
ATOM   7329  H HG3  . GLN A 1 60 ? 19.759  4.419   7.879   1.00 1.91 ? 60  GLN A HG3  4  
ATOM   7330  H HE21 . GLN A 1 60 ? 22.001  6.247   8.835   1.00 2.43 ? 60  GLN A HE21 4  
ATOM   7331  H HE22 . GLN A 1 60 ? 21.339  7.082   10.157  1.00 2.66 ? 60  GLN A HE22 4  
ATOM   7332  N N    . GLU A 1 61 ? 23.007  4.422   4.572   1.00 0.31 ? 61  GLU A N    4  
ATOM   7333  C CA   . GLU A 1 61 ? 24.225  4.577   3.721   1.00 0.33 ? 61  GLU A CA   4  
ATOM   7334  C C    . GLU A 1 61 ? 23.872  4.336   2.250   1.00 0.31 ? 61  GLU A C    4  
ATOM   7335  O O    . GLU A 1 61 ? 24.241  5.100   1.381   1.00 0.32 ? 61  GLU A O    4  
ATOM   7336  C CB   . GLU A 1 61 ? 25.284  3.566   4.161   1.00 0.35 ? 61  GLU A CB   4  
ATOM   7337  C CG   . GLU A 1 61 ? 26.598  3.853   3.431   1.00 0.40 ? 61  GLU A CG   4  
ATOM   7338  C CD   . GLU A 1 61 ? 27.688  2.915   3.952   1.00 1.29 ? 61  GLU A CD   4  
ATOM   7339  O OE1  . GLU A 1 61 ? 28.264  3.222   4.982   1.00 2.03 ? 61  GLU A OE1  4  
ATOM   7340  O OE2  . GLU A 1 61 ? 27.928  1.904   3.312   1.00 1.99 ? 61  GLU A OE2  4  
ATOM   7341  H H    . GLU A 1 61 ? 22.960  3.699   5.231   1.00 0.31 ? 61  GLU A H    4  
ATOM   7342  H HA   . GLU A 1 61 ? 24.614  5.576   3.834   1.00 0.36 ? 61  GLU A HA   4  
ATOM   7343  H HB2  . GLU A 1 61 ? 25.439  3.648   5.228   1.00 0.37 ? 61  GLU A HB2  4  
ATOM   7344  H HB3  . GLU A 1 61 ? 24.952  2.567   3.921   1.00 0.33 ? 61  GLU A HB3  4  
ATOM   7345  H HG2  . GLU A 1 61 ? 26.462  3.694   2.371   1.00 0.84 ? 61  GLU A HG2  4  
ATOM   7346  H HG3  . GLU A 1 61 ? 26.893  4.877   3.608   1.00 0.95 ? 61  GLU A HG3  4  
ATOM   7347  N N    . TYR A 1 62 ? 23.167  3.278   1.966   1.00 0.28 ? 62  TYR A N    4  
ATOM   7348  C CA   . TYR A 1 62 ? 22.796  2.983   0.551   1.00 0.28 ? 62  TYR A CA   4  
ATOM   7349  C C    . TYR A 1 62 ? 21.927  4.118   0.001   1.00 0.28 ? 62  TYR A C    4  
ATOM   7350  O O    . TYR A 1 62 ? 22.011  4.467   -1.160  1.00 0.30 ? 62  TYR A O    4  
ATOM   7351  C CB   . TYR A 1 62 ? 22.023  1.655   0.482   1.00 0.25 ? 62  TYR A CB   4  
ATOM   7352  C CG   . TYR A 1 62 ? 22.983  0.477   0.465   1.00 0.27 ? 62  TYR A CG   4  
ATOM   7353  C CD1  . TYR A 1 62 ? 24.021  0.379   1.418   1.00 0.29 ? 62  TYR A CD1  4  
ATOM   7354  C CD2  . TYR A 1 62 ? 22.838  -0.529  -0.514  1.00 0.27 ? 62  TYR A CD2  4  
ATOM   7355  C CE1  . TYR A 1 62 ? 24.905  -0.716  1.387   1.00 0.32 ? 62  TYR A CE1  4  
ATOM   7356  C CE2  . TYR A 1 62 ? 23.721  -1.622  -0.541  1.00 0.29 ? 62  TYR A CE2  4  
ATOM   7357  C CZ   . TYR A 1 62 ? 24.755  -1.716  0.408   1.00 0.31 ? 62  TYR A CZ   4  
ATOM   7358  O OH   . TYR A 1 62 ? 25.624  -2.787  0.379   1.00 0.34 ? 62  TYR A OH   4  
ATOM   7359  H H    . TYR A 1 62 ? 22.884  2.674   2.683   1.00 0.28 ? 62  TYR A H    4  
ATOM   7360  H HA   . TYR A 1 62 ? 23.696  2.907   -0.044  1.00 0.30 ? 62  TYR A HA   4  
ATOM   7361  H HB2  . TYR A 1 62 ? 21.380  1.574   1.347   1.00 0.24 ? 62  TYR A HB2  4  
ATOM   7362  H HB3  . TYR A 1 62 ? 21.416  1.635   -0.412  1.00 0.25 ? 62  TYR A HB3  4  
ATOM   7363  H HD1  . TYR A 1 62 ? 24.141  1.141   2.170   1.00 0.30 ? 62  TYR A HD1  4  
ATOM   7364  H HD2  . TYR A 1 62 ? 22.044  -0.459  -1.243  1.00 0.27 ? 62  TYR A HD2  4  
ATOM   7365  H HE1  . TYR A 1 62 ? 25.698  -0.790  2.116   1.00 0.35 ? 62  TYR A HE1  4  
ATOM   7366  H HE2  . TYR A 1 62 ? 23.607  -2.391  -1.291  1.00 0.30 ? 62  TYR A HE2  4  
ATOM   7367  H HH   . TYR A 1 62 ? 26.217  -2.709  1.129   1.00 0.89 ? 62  TYR A HH   4  
ATOM   7368  N N    . VAL A 1 63 ? 21.105  4.703   0.823   1.00 0.27 ? 63  VAL A N    4  
ATOM   7369  C CA   . VAL A 1 63 ? 20.250  5.818   0.343   1.00 0.28 ? 63  VAL A CA   4  
ATOM   7370  C C    . VAL A 1 63 ? 21.155  6.979   -0.041  1.00 0.32 ? 63  VAL A C    4  
ATOM   7371  O O    . VAL A 1 63 ? 20.948  7.649   -1.030  1.00 0.34 ? 63  VAL A O    4  
ATOM   7372  C CB   . VAL A 1 63 ? 19.297  6.246   1.462   1.00 0.28 ? 63  VAL A CB   4  
ATOM   7373  C CG1  . VAL A 1 63 ? 18.587  7.545   1.074   1.00 0.32 ? 63  VAL A CG1  4  
ATOM   7374  C CG2  . VAL A 1 63 ? 18.257  5.146   1.689   1.00 0.25 ? 63  VAL A CG2  4  
ATOM   7375  H H    . VAL A 1 63 ? 21.060  4.423   1.756   1.00 0.26 ? 63  VAL A H    4  
ATOM   7376  H HA   . VAL A 1 63 ? 19.683  5.498   -0.519  1.00 0.28 ? 63  VAL A HA   4  
ATOM   7377  H HB   . VAL A 1 63 ? 19.862  6.402   2.370   1.00 0.30 ? 63  VAL A HB   4  
ATOM   7378  H HG11 . VAL A 1 63 ? 18.224  7.469   0.060   1.00 1.07 ? 63  VAL A HG11 4  
ATOM   7379  H HG12 . VAL A 1 63 ? 17.755  7.714   1.742   1.00 1.05 ? 63  VAL A HG12 4  
ATOM   7380  H HG13 . VAL A 1 63 ? 19.280  8.370   1.147   1.00 1.08 ? 63  VAL A HG13 4  
ATOM   7381  H HG21 . VAL A 1 63 ? 18.745  4.182   1.690   1.00 1.00 ? 63  VAL A HG21 4  
ATOM   7382  H HG22 . VAL A 1 63 ? 17.769  5.303   2.639   1.00 1.05 ? 63  VAL A HG22 4  
ATOM   7383  H HG23 . VAL A 1 63 ? 17.523  5.175   0.896   1.00 1.03 ? 63  VAL A HG23 4  
ATOM   7384  N N    . TYR A 1 64 ? 22.166  7.214   0.743   1.00 0.34 ? 64  TYR A N    4  
ATOM   7385  C CA   . TYR A 1 64 ? 23.098  8.324   0.437   1.00 0.38 ? 64  TYR A CA   4  
ATOM   7386  C C    . TYR A 1 64 ? 23.799  8.039   -0.889  1.00 0.38 ? 64  TYR A C    4  
ATOM   7387  O O    . TYR A 1 64 ? 23.948  8.903   -1.729  1.00 0.41 ? 64  TYR A O    4  
ATOM   7388  C CB   . TYR A 1 64 ? 24.140  8.431   1.553   1.00 0.41 ? 64  TYR A CB   4  
ATOM   7389  C CG   . TYR A 1 64 ? 24.823  9.778   1.489   1.00 0.46 ? 64  TYR A CG   4  
ATOM   7390  C CD1  . TYR A 1 64 ? 24.144  10.932  1.924   1.00 0.48 ? 64  TYR A CD1  4  
ATOM   7391  C CD2  . TYR A 1 64 ? 26.139  9.881   0.994   1.00 0.49 ? 64  TYR A CD2  4  
ATOM   7392  C CE1  . TYR A 1 64 ? 24.779  12.188  1.865   1.00 0.52 ? 64  TYR A CE1  4  
ATOM   7393  C CE2  . TYR A 1 64 ? 26.773  11.136  0.934   1.00 0.54 ? 64  TYR A CE2  4  
ATOM   7394  C CZ   . TYR A 1 64 ? 26.094  12.289  1.371   1.00 0.55 ? 64  TYR A CZ   4  
ATOM   7395  O OH   . TYR A 1 64 ? 26.716  13.520  1.312   1.00 0.60 ? 64  TYR A OH   4  
ATOM   7396  H H    . TYR A 1 64 ? 22.314  6.654   1.533   1.00 0.33 ? 64  TYR A H    4  
ATOM   7397  H HA   . TYR A 1 64 ? 22.543  9.241   0.366   1.00 0.40 ? 64  TYR A HA   4  
ATOM   7398  H HB2  . TYR A 1 64 ? 23.651  8.318   2.507   1.00 0.41 ? 64  TYR A HB2  4  
ATOM   7399  H HB3  . TYR A 1 64 ? 24.877  7.648   1.437   1.00 0.40 ? 64  TYR A HB3  4  
ATOM   7400  H HD1  . TYR A 1 64 ? 23.136  10.855  2.304   1.00 0.47 ? 64  TYR A HD1  4  
ATOM   7401  H HD2  . TYR A 1 64 ? 26.660  8.995   0.660   1.00 0.49 ? 64  TYR A HD2  4  
ATOM   7402  H HE1  . TYR A 1 64 ? 24.258  13.073  2.199   1.00 0.55 ? 64  TYR A HE1  4  
ATOM   7403  H HE2  . TYR A 1 64 ? 27.782  11.214  0.555   1.00 0.56 ? 64  TYR A HE2  4  
ATOM   7404  H HH   . TYR A 1 64 ? 27.659  13.370  1.208   1.00 1.08 ? 64  TYR A HH   4  
ATOM   7405  N N    . ASP A 1 65 ? 24.234  6.828   -1.072  1.00 0.36 ? 65  ASP A N    4  
ATOM   7406  C CA   . ASP A 1 65 ? 24.934  6.460   -2.334  1.00 0.37 ? 65  ASP A CA   4  
ATOM   7407  C C    . ASP A 1 65 ? 23.987  6.645   -3.523  1.00 0.37 ? 65  ASP A C    4  
ATOM   7408  O O    . ASP A 1 65 ? 24.395  7.031   -4.601  1.00 0.40 ? 65  ASP A O    4  
ATOM   7409  C CB   . ASP A 1 65 ? 25.377  4.995   -2.251  1.00 0.35 ? 65  ASP A CB   4  
ATOM   7410  C CG   . ASP A 1 65 ? 26.640  4.883   -1.394  1.00 0.39 ? 65  ASP A CG   4  
ATOM   7411  O OD1  . ASP A 1 65 ? 27.664  5.397   -1.814  1.00 1.15 ? 65  ASP A OD1  4  
ATOM   7412  O OD2  . ASP A 1 65 ? 26.562  4.285   -0.334  1.00 1.11 ? 65  ASP A OD2  4  
ATOM   7413  H H    . ASP A 1 65 ? 24.098  6.154   -0.371  1.00 0.34 ? 65  ASP A H    4  
ATOM   7414  H HA   . ASP A 1 65 ? 25.800  7.093   -2.463  1.00 0.41 ? 65  ASP A HA   4  
ATOM   7415  H HB2  . ASP A 1 65 ? 24.587  4.408   -1.804  1.00 0.32 ? 65  ASP A HB2  4  
ATOM   7416  H HB3  . ASP A 1 65 ? 25.582  4.624   -3.241  1.00 0.36 ? 65  ASP A HB3  4  
ATOM   7417  N N    . LEU A 1 66 ? 22.730  6.369   -3.333  1.00 0.33 ? 66  LEU A N    4  
ATOM   7418  C CA   . LEU A 1 66 ? 21.753  6.522   -4.445  1.00 0.34 ? 66  LEU A CA   4  
ATOM   7419  C C    . LEU A 1 66 ? 21.509  8.010   -4.713  1.00 0.39 ? 66  LEU A C    4  
ATOM   7420  O O    . LEU A 1 66 ? 21.215  8.412   -5.821  1.00 0.42 ? 66  LEU A O    4  
ATOM   7421  C CB   . LEU A 1 66 ? 20.439  5.841   -4.043  1.00 0.31 ? 66  LEU A CB   4  
ATOM   7422  C CG   . LEU A 1 66 ? 20.538  4.317   -4.270  1.00 0.28 ? 66  LEU A CG   4  
ATOM   7423  C CD1  . LEU A 1 66 ? 19.501  3.597   -3.405  1.00 0.24 ? 66  LEU A CD1  4  
ATOM   7424  C CD2  . LEU A 1 66 ? 20.262  3.976   -5.744  1.00 0.30 ? 66  LEU A CD2  4  
ATOM   7425  H H    . LEU A 1 66 ? 22.428  6.057   -2.456  1.00 0.31 ? 66  LEU A H    4  
ATOM   7426  H HA   . LEU A 1 66 ? 22.147  6.060   -5.335  1.00 0.35 ? 66  LEU A HA   4  
ATOM   7427  H HB2  . LEU A 1 66 ? 20.252  6.036   -2.994  1.00 0.29 ? 66  LEU A HB2  4  
ATOM   7428  H HB3  . LEU A 1 66 ? 19.630  6.245   -4.626  1.00 0.33 ? 66  LEU A HB3  4  
ATOM   7429  H HG   . LEU A 1 66 ? 21.528  3.974   -3.999  1.00 0.27 ? 66  LEU A HG   4  
ATOM   7430  H HD11 . LEU A 1 66 ? 19.660  3.849   -2.367  1.00 1.02 ? 66  LEU A HD11 4  
ATOM   7431  H HD12 . LEU A 1 66 ? 18.512  3.903   -3.701  1.00 1.06 ? 66  LEU A HD12 4  
ATOM   7432  H HD13 . LEU A 1 66 ? 19.603  2.530   -3.535  1.00 1.04 ? 66  LEU A HD13 4  
ATOM   7433  H HD21 . LEU A 1 66 ? 19.362  4.474   -6.072  1.00 1.07 ? 66  LEU A HD21 4  
ATOM   7434  H HD22 . LEU A 1 66 ? 21.092  4.294   -6.355  1.00 1.05 ? 66  LEU A HD22 4  
ATOM   7435  H HD23 . LEU A 1 66 ? 20.136  2.909   -5.845  1.00 1.06 ? 66  LEU A HD23 4  
ATOM   7436  N N    . GLU A 1 67 ? 21.635  8.828   -3.709  1.00 0.40 ? 67  GLU A N    4  
ATOM   7437  C CA   . GLU A 1 67 ? 21.419  10.291  -3.906  1.00 0.45 ? 67  GLU A CA   4  
ATOM   7438  C C    . GLU A 1 67 ? 22.592  10.866  -4.695  1.00 0.50 ? 67  GLU A C    4  
ATOM   7439  O O    . GLU A 1 67 ? 22.457  11.834  -5.417  1.00 0.55 ? 67  GLU A O    4  
ATOM   7440  C CB   . GLU A 1 67 ? 21.342  10.979  -2.542  1.00 0.46 ? 67  GLU A CB   4  
ATOM   7441  C CG   . GLU A 1 67 ? 20.063  10.549  -1.817  1.00 0.44 ? 67  GLU A CG   4  
ATOM   7442  C CD   . GLU A 1 67 ? 18.871  11.358  -2.338  1.00 1.13 ? 67  GLU A CD   4  
ATOM   7443  O OE1  . GLU A 1 67 ? 18.611  12.415  -1.786  1.00 1.88 ? 67  GLU A OE1  4  
ATOM   7444  O OE2  . GLU A 1 67 ? 18.240  10.907  -3.279  1.00 1.81 ? 67  GLU A OE2  4  
ATOM   7445  H H    . GLU A 1 67 ? 21.874  8.481   -2.827  1.00 0.38 ? 67  GLU A H    4  
ATOM   7446  H HA   . GLU A 1 67 ? 20.499  10.453  -4.449  1.00 0.46 ? 67  GLU A HA   4  
ATOM   7447  H HB2  . GLU A 1 67 ? 22.202  10.696  -1.951  1.00 0.45 ? 67  GLU A HB2  4  
ATOM   7448  H HB3  . GLU A 1 67 ? 21.338  12.051  -2.678  1.00 0.50 ? 67  GLU A HB3  4  
ATOM   7449  H HG2  . GLU A 1 67 ? 19.886  9.498   -1.989  1.00 0.93 ? 67  GLU A HG2  4  
ATOM   7450  H HG3  . GLU A 1 67 ? 20.179  10.725  -0.758  1.00 0.85 ? 67  GLU A HG3  4  
ATOM   7451  N N    . LEU A 1 68 ? 23.744  10.271  -4.566  1.00 0.49 ? 68  LEU A N    4  
ATOM   7452  C CA   . LEU A 1 68 ? 24.933  10.776  -5.311  1.00 0.54 ? 68  LEU A CA   4  
ATOM   7453  C C    . LEU A 1 68 ? 24.838  10.341  -6.774  1.00 0.56 ? 68  LEU A C    4  
ATOM   7454  O O    . LEU A 1 68 ? 24.387  11.082  -7.624  1.00 0.62 ? 68  LEU A O    4  
ATOM   7455  C CB   . LEU A 1 68 ? 26.207  10.204  -4.697  1.00 0.55 ? 68  LEU A CB   4  
ATOM   7456  C CG   . LEU A 1 68 ? 26.351  10.685  -3.251  1.00 0.55 ? 68  LEU A CG   4  
ATOM   7457  C CD1  . LEU A 1 68 ? 27.581  10.022  -2.640  1.00 0.56 ? 68  LEU A CD1  4  
ATOM   7458  C CD2  . LEU A 1 68 ? 26.517  12.219  -3.207  1.00 0.61 ? 68  LEU A CD2  4  
ATOM   7459  H H    . LEU A 1 68 ? 23.824  9.491   -3.978  1.00 0.46 ? 68  LEU A H    4  
ATOM   7460  H HA   . LEU A 1 68 ? 24.964  11.848  -5.257  1.00 0.58 ? 68  LEU A HA   4  
ATOM   7461  H HB2  . LEU A 1 68 ? 26.158  9.123   -4.713  1.00 0.51 ? 68  LEU A HB2  4  
ATOM   7462  H HB3  . LEU A 1 68 ? 27.061  10.532  -5.270  1.00 0.59 ? 68  LEU A HB3  4  
ATOM   7463  H HG   . LEU A 1 68 ? 25.475  10.399  -2.690  1.00 0.52 ? 68  LEU A HG   4  
ATOM   7464  H HD11 . LEU A 1 68 ? 27.493  8.951   -2.739  1.00 1.15 ? 68  LEU A HD11 4  
ATOM   7465  H HD12 . LEU A 1 68 ? 28.464  10.363  -3.159  1.00 1.21 ? 68  LEU A HD12 4  
ATOM   7466  H HD13 . LEU A 1 68 ? 27.649  10.286  -1.597  1.00 1.13 ? 68  LEU A HD13 4  
ATOM   7467  H HD21 . LEU A 1 68 ? 27.062  12.555  -4.078  1.00 1.17 ? 68  LEU A HD21 4  
ATOM   7468  H HD22 . LEU A 1 68 ? 25.543  12.686  -3.189  1.00 1.22 ? 68  LEU A HD22 4  
ATOM   7469  H HD23 . LEU A 1 68 ? 27.060  12.503  -2.316  1.00 1.15 ? 68  LEU A HD23 4  
ATOM   7470  N N    . ASN A 1 69 ? 25.261  9.143   -7.074  1.00 0.61 ? 69  ASN A N    4  
ATOM   7471  C CA   . ASN A 1 69 ? 25.198  8.652   -8.482  1.00 0.64 ? 69  ASN A CA   4  
ATOM   7472  C C    . ASN A 1 69 ? 23.846  7.982   -8.729  1.00 0.70 ? 69  ASN A C    4  
ATOM   7473  O O    . ASN A 1 69 ? 23.402  7.248   -7.860  1.00 1.15 ? 69  ASN A O    4  
ATOM   7474  C CB   . ASN A 1 69 ? 26.320  7.637   -8.715  1.00 0.82 ? 69  ASN A CB   4  
ATOM   7475  C CG   . ASN A 1 69 ? 26.124  6.436   -7.786  1.00 1.67 ? 69  ASN A CG   4  
ATOM   7476  O OD1  . ASN A 1 69 ? 26.475  6.490   -6.624  1.00 2.45 ? 69  ASN A OD1  4  
ATOM   7477  N ND2  . ASN A 1 69 ? 25.576  5.348   -8.252  1.00 2.41 ? 69  ASN A ND2  4  
ATOM   7478  O OXT  . ASN A 1 69 ? 23.276  8.213   -9.782  1.00 1.44 ? 69  ASN A OXT  4  
ATOM   7479  H H    . ASN A 1 69 ? 25.620  8.563   -6.373  1.00 0.69 ? 69  ASN A H    4  
ATOM   7480  H HA   . ASN A 1 69 ? 25.319  9.481   -9.162  1.00 0.62 ? 69  ASN A HA   4  
ATOM   7481  H HB2  . ASN A 1 69 ? 26.295  7.305   -9.743  1.00 1.41 ? 69  ASN A HB2  4  
ATOM   7482  H HB3  . ASN A 1 69 ? 27.273  8.098   -8.507  1.00 1.27 ? 69  ASN A HB3  4  
ATOM   7483  H HD21 . ASN A 1 69 ? 25.293  5.305   -9.190  1.00 2.52 ? 69  ASN A HD21 4  
ATOM   7484  H HD22 . ASN A 1 69 ? 25.446  4.574   -7.665  1.00 3.22 ? 69  ASN A HD22 4  
ATOM   7485  N N    . ALA B 1 1  ? 7.980   -16.325 -13.375 1.00 3.98 ? 1   ALA B N    4  
ATOM   7486  C CA   . ALA B 1 1  ? 7.221   -15.577 -12.332 1.00 3.41 ? 1   ALA B CA   4  
ATOM   7487  C C    . ALA B 1 1  ? 7.964   -15.662 -10.990 1.00 2.89 ? 1   ALA B C    4  
ATOM   7488  O O    . ALA B 1 1  ? 7.482   -16.290 -10.068 1.00 2.91 ? 1   ALA B O    4  
ATOM   7489  C CB   . ALA B 1 1  ? 5.830   -16.198 -12.179 1.00 3.83 ? 1   ALA B CB   4  
ATOM   7490  H H1   . ALA B 1 1  ? 8.939   -16.528 -13.027 1.00 4.33 ? 1   ALA B H1   4  
ATOM   7491  H H2   . ALA B 1 1  ? 7.493   -17.218 -13.585 1.00 4.29 ? 1   ALA B H2   4  
ATOM   7492  H H3   . ALA B 1 1  ? 8.039   -15.748 -14.239 1.00 4.21 ? 1   ALA B H3   4  
ATOM   7493  H HA   . ALA B 1 1  ? 7.119   -14.545 -12.629 1.00 3.58 ? 1   ALA B HA   4  
ATOM   7494  H HB1  . ALA B 1 1  ? 5.377   -16.308 -13.154 1.00 4.06 ? 1   ALA B HB1  4  
ATOM   7495  H HB2  . ALA B 1 1  ? 5.918   -17.167 -11.713 1.00 4.06 ? 1   ALA B HB2  4  
ATOM   7496  H HB3  . ALA B 1 1  ? 5.215   -15.557 -11.565 1.00 4.22 ? 1   ALA B HB3  4  
ATOM   7497  N N    . PRO B 1 2  ? 9.119   -15.035 -10.911 1.00 2.53 ? 2   PRO B N    4  
ATOM   7498  C CA   . PRO B 1 2  ? 9.920   -15.051 -9.671  1.00 2.14 ? 2   PRO B CA   4  
ATOM   7499  C C    . PRO B 1 2  ? 9.141   -14.362 -8.541  1.00 1.85 ? 2   PRO B C    4  
ATOM   7500  O O    . PRO B 1 2  ? 8.440   -13.394 -8.758  1.00 1.89 ? 2   PRO B O    4  
ATOM   7501  C CB   . PRO B 1 2  ? 11.216  -14.279 -10.022 1.00 1.96 ? 2   PRO B CB   4  
ATOM   7502  C CG   . PRO B 1 2  ? 11.086  -13.792 -11.496 1.00 2.21 ? 2   PRO B CG   4  
ATOM   7503  C CD   . PRO B 1 2  ? 9.715   -14.270 -12.028 1.00 2.60 ? 2   PRO B CD   4  
ATOM   7504  H HA   . PRO B 1 2  ? 10.156  -16.068 -9.394  1.00 2.39 ? 2   PRO B HA   4  
ATOM   7505  H HB2  . PRO B 1 2  ? 11.341  -13.431 -9.359  1.00 1.68 ? 2   PRO B HB2  4  
ATOM   7506  H HB3  . PRO B 1 2  ? 12.072  -14.935 -9.932  1.00 2.13 ? 2   PRO B HB3  4  
ATOM   7507  H HG2  . PRO B 1 2  ? 11.142  -12.709 -11.531 1.00 2.13 ? 2   PRO B HG2  4  
ATOM   7508  H HG3  . PRO B 1 2  ? 11.879  -14.214 -12.098 1.00 2.39 ? 2   PRO B HG3  4  
ATOM   7509  H HD2  . PRO B 1 2  ? 9.094   -13.420 -12.278 1.00 2.71 ? 2   PRO B HD2  4  
ATOM   7510  H HD3  . PRO B 1 2  ? 9.843   -14.910 -12.889 1.00 2.93 ? 2   PRO B HD3  4  
ATOM   7511  N N    . MET B 1 3  ? 9.261   -14.856 -7.339  1.00 1.69 ? 3   MET B N    4  
ATOM   7512  C CA   . MET B 1 3  ? 8.530   -14.230 -6.201  1.00 1.53 ? 3   MET B CA   4  
ATOM   7513  C C    . MET B 1 3  ? 9.285   -12.983 -5.733  1.00 1.17 ? 3   MET B C    4  
ATOM   7514  O O    . MET B 1 3  ? 10.456  -13.039 -5.413  1.00 0.99 ? 3   MET B O    4  
ATOM   7515  C CB   . MET B 1 3  ? 8.430   -15.232 -5.049  1.00 1.63 ? 3   MET B CB   4  
ATOM   7516  C CG   . MET B 1 3  ? 7.715   -16.495 -5.533  1.00 2.15 ? 3   MET B CG   4  
ATOM   7517  S SD   . MET B 1 3  ? 7.833   -17.780 -4.265  1.00 2.54 ? 3   MET B SD   4  
ATOM   7518  C CE   . MET B 1 3  ? 6.689   -18.957 -5.027  1.00 3.59 ? 3   MET B CE   4  
ATOM   7519  H H    . MET B 1 3  ? 9.832   -15.637 -7.185  1.00 1.78 ? 3   MET B H    4  
ATOM   7520  H HA   . MET B 1 3  ? 7.537   -13.950 -6.521  1.00 1.74 ? 3   MET B HA   4  
ATOM   7521  H HB2  . MET B 1 3  ? 9.423   -15.488 -4.707  1.00 1.99 ? 3   MET B HB2  4  
ATOM   7522  H HB3  . MET B 1 3  ? 7.871   -14.793 -4.237  1.00 1.87 ? 3   MET B HB3  4  
ATOM   7523  H HG2  . MET B 1 3  ? 6.676   -16.270 -5.722  1.00 2.61 ? 3   MET B HG2  4  
ATOM   7524  H HG3  . MET B 1 3  ? 8.178   -16.844 -6.444  1.00 2.68 ? 3   MET B HG3  4  
ATOM   7525  H HE1  . MET B 1 3  ? 5.742   -18.469 -5.211  1.00 3.92 ? 3   MET B HE1  4  
ATOM   7526  H HE2  . MET B 1 3  ? 7.106   -19.309 -5.961  1.00 4.04 ? 3   MET B HE2  4  
ATOM   7527  H HE3  . MET B 1 3  ? 6.537   -19.794 -4.366  1.00 4.01 ? 3   MET B HE3  4  
ATOM   7528  N N    . GLY B 1 4  ? 8.624   -11.859 -5.690  1.00 1.14 ? 4   GLY B N    4  
ATOM   7529  C CA   . GLY B 1 4  ? 9.303   -10.610 -5.243  1.00 0.89 ? 4   GLY B CA   4  
ATOM   7530  C C    . GLY B 1 4  ? 9.993   -10.852 -3.902  1.00 0.62 ? 4   GLY B C    4  
ATOM   7531  O O    . GLY B 1 4  ? 9.865   -11.904 -3.308  1.00 0.70 ? 4   GLY B O    4  
ATOM   7532  H H    . GLY B 1 4  ? 7.679   -11.837 -5.953  1.00 1.36 ? 4   GLY B H    4  
ATOM   7533  H HA2  . GLY B 1 4  ? 10.037  -10.317 -5.980  1.00 0.84 ? 4   GLY B HA2  4  
ATOM   7534  H HA3  . GLY B 1 4  ? 8.574   -9.826  -5.130  1.00 1.04 ? 4   GLY B HA3  4  
ATOM   7535  N N    . SER B 1 5  ? 10.726  -9.884  -3.415  1.00 0.44 ? 5   SER B N    4  
ATOM   7536  C CA   . SER B 1 5  ? 11.426  -10.061 -2.110  1.00 0.30 ? 5   SER B CA   4  
ATOM   7537  C C    . SER B 1 5  ? 10.492  -9.644  -0.959  1.00 0.27 ? 5   SER B C    4  
ATOM   7538  O O    . SER B 1 5  ? 10.018  -10.474 -0.208  1.00 0.30 ? 5   SER B O    4  
ATOM   7539  C CB   . SER B 1 5  ? 12.718  -9.227  -2.108  1.00 0.49 ? 5   SER B CB   4  
ATOM   7540  O OG   . SER B 1 5  ? 13.832  -10.099 -1.963  1.00 1.52 ? 5   SER B OG   4  
ATOM   7541  H H    . SER B 1 5  ? 10.818  -9.043  -3.909  1.00 0.56 ? 5   SER B H    4  
ATOM   7542  H HA   . SER B 1 5  ? 11.687  -11.101 -1.990  1.00 0.39 ? 5   SER B HA   4  
ATOM   7543  H HB2  . SER B 1 5  ? 12.806  -8.702  -3.043  1.00 0.93 ? 5   SER B HB2  4  
ATOM   7544  H HB3  . SER B 1 5  ? 12.704  -8.513  -1.296  1.00 0.96 ? 5   SER B HB3  4  
ATOM   7545  H HG   . SER B 1 5  ? 14.064  -10.431 -2.833  1.00 2.00 ? 5   SER B HG   4  
ATOM   7546  N N    . ASP B 1 6  ? 10.218  -8.372  -0.813  1.00 0.24 ? 6   ASP B N    4  
ATOM   7547  C CA   . ASP B 1 6  ? 9.309   -7.931  0.295   1.00 0.23 ? 6   ASP B CA   4  
ATOM   7548  C C    . ASP B 1 6  ? 8.739   -6.539  -0.021  1.00 0.21 ? 6   ASP B C    4  
ATOM   7549  O O    . ASP B 1 6  ? 9.110   -5.569  0.610   1.00 0.20 ? 6   ASP B O    4  
ATOM   7550  C CB   . ASP B 1 6  ? 10.092  -7.873  1.619   1.00 0.25 ? 6   ASP B CB   4  
ATOM   7551  C CG   . ASP B 1 6  ? 9.115   -7.912  2.797   1.00 1.26 ? 6   ASP B CG   4  
ATOM   7552  O OD1  . ASP B 1 6  ? 7.937   -7.683  2.572   1.00 2.03 ? 6   ASP B OD1  4  
ATOM   7553  O OD2  . ASP B 1 6  ? 9.561   -8.168  3.903   1.00 2.00 ? 6   ASP B OD2  4  
ATOM   7554  H H    . ASP B 1 6  ? 10.604  -7.709  -1.429  1.00 0.23 ? 6   ASP B H    4  
ATOM   7555  H HA   . ASP B 1 6  ? 8.499   -8.638  0.391   1.00 0.25 ? 6   ASP B HA   4  
ATOM   7556  H HB2  . ASP B 1 6  ? 10.759  -8.720  1.679   1.00 0.79 ? 6   ASP B HB2  4  
ATOM   7557  H HB3  . ASP B 1 6  ? 10.668  -6.960  1.665   1.00 0.94 ? 6   ASP B HB3  4  
ATOM   7558  N N    . PRO B 1 7  ? 7.857   -6.466  -0.994  1.00 0.22 ? 7   PRO B N    4  
ATOM   7559  C CA   . PRO B 1 7  ? 7.251   -5.181  -1.387  1.00 0.22 ? 7   PRO B CA   4  
ATOM   7560  C C    . PRO B 1 7  ? 6.362   -4.642  -0.243  1.00 0.20 ? 7   PRO B C    4  
ATOM   7561  O O    . PRO B 1 7  ? 6.035   -5.375  0.669   1.00 0.20 ? 7   PRO B O    4  
ATOM   7562  C CB   . PRO B 1 7  ? 6.416   -5.506  -2.650  1.00 0.25 ? 7   PRO B CB   4  
ATOM   7563  C CG   . PRO B 1 7  ? 6.516   -7.042  -2.894  1.00 0.27 ? 7   PRO B CG   4  
ATOM   7564  C CD   . PRO B 1 7  ? 7.403   -7.636  -1.776  1.00 0.26 ? 7   PRO B CD   4  
ATOM   7565  H HA   . PRO B 1 7  ? 8.029   -4.480  -1.625  1.00 0.21 ? 7   PRO B HA   4  
ATOM   7566  H HB2  . PRO B 1 7  ? 5.380   -5.219  -2.500  1.00 0.26 ? 7   PRO B HB2  4  
ATOM   7567  H HB3  . PRO B 1 7  ? 6.816   -4.977  -3.504  1.00 0.27 ? 7   PRO B HB3  4  
ATOM   7568  H HG2  . PRO B 1 7  ? 5.528   -7.486  -2.860  1.00 0.28 ? 7   PRO B HG2  4  
ATOM   7569  H HG3  . PRO B 1 7  ? 6.967   -7.236  -3.858  1.00 0.29 ? 7   PRO B HG3  4  
ATOM   7570  H HD2  . PRO B 1 7  ? 6.823   -8.304  -1.153  1.00 0.28 ? 7   PRO B HD2  4  
ATOM   7571  H HD3  . PRO B 1 7  ? 8.254   -8.154  -2.195  1.00 0.28 ? 7   PRO B HD3  4  
ATOM   7572  N N    . PRO B 1 8  ? 5.990   -3.377  -0.324  1.00 0.21 ? 8   PRO B N    4  
ATOM   7573  C CA   . PRO B 1 8  ? 5.132   -2.752  0.706   1.00 0.22 ? 8   PRO B CA   4  
ATOM   7574  C C    . PRO B 1 8  ? 3.765   -3.453  0.743   1.00 0.22 ? 8   PRO B C    4  
ATOM   7575  O O    . PRO B 1 8  ? 3.622   -4.580  0.313   1.00 0.22 ? 8   PRO B O    4  
ATOM   7576  C CB   . PRO B 1 8  ? 4.993   -1.275  0.262   1.00 0.24 ? 8   PRO B CB   4  
ATOM   7577  C CG   . PRO B 1 8  ? 5.643   -1.152  -1.146  1.00 0.26 ? 8   PRO B CG   4  
ATOM   7578  C CD   . PRO B 1 8  ? 6.385   -2.475  -1.429  1.00 0.24 ? 8   PRO B CD   4  
ATOM   7579  H HA   . PRO B 1 8  ? 5.608   -2.808  1.674   1.00 0.22 ? 8   PRO B HA   4  
ATOM   7580  H HB2  . PRO B 1 8  ? 3.949   -0.986  0.217   1.00 0.26 ? 8   PRO B HB2  4  
ATOM   7581  H HB3  . PRO B 1 8  ? 5.516   -0.631  0.957   1.00 0.25 ? 8   PRO B HB3  4  
ATOM   7582  H HG2  . PRO B 1 8  ? 4.874   -0.990  -1.893  1.00 0.28 ? 8   PRO B HG2  4  
ATOM   7583  H HG3  . PRO B 1 8  ? 6.343   -0.327  -1.163  1.00 0.27 ? 8   PRO B HG3  4  
ATOM   7584  H HD2  . PRO B 1 8  ? 6.082   -2.889  -2.383  1.00 0.25 ? 8   PRO B HD2  4  
ATOM   7585  H HD3  . PRO B 1 8  ? 7.451   -2.313  -1.409  1.00 0.24 ? 8   PRO B HD3  4  
ATOM   7586  N N    . THR B 1 9  ? 2.760   -2.787  1.251   1.00 0.23 ? 9   THR B N    4  
ATOM   7587  C CA   . THR B 1 9  ? 1.404   -3.405  1.316   1.00 0.24 ? 9   THR B CA   4  
ATOM   7588  C C    . THR B 1 9  ? 0.343   -2.308  1.303   1.00 0.24 ? 9   THR B C    4  
ATOM   7589  O O    . THR B 1 9  ? 0.329   -1.429  2.142   1.00 0.25 ? 9   THR B O    4  
ATOM   7590  C CB   . THR B 1 9  ? 1.278   -4.218  2.604   1.00 0.25 ? 9   THR B CB   4  
ATOM   7591  O OG1  . THR B 1 9  ? 2.423   -5.046  2.751   1.00 0.26 ? 9   THR B OG1  4  
ATOM   7592  C CG2  . THR B 1 9  ? 0.019   -5.087  2.544   1.00 0.29 ? 9   THR B CG2  4  
ATOM   7593  H H    . THR B 1 9  ? 2.899   -1.878  1.591   1.00 0.24 ? 9   THR B H    4  
ATOM   7594  H HA   . THR B 1 9  ? 1.254   -4.053  0.463   1.00 0.25 ? 9   THR B HA   4  
ATOM   7595  H HB   . THR B 1 9  ? 1.208   -3.546  3.444   1.00 0.26 ? 9   THR B HB   4  
ATOM   7596  H HG1  . THR B 1 9  ? 2.332   -5.533  3.574   1.00 0.86 ? 9   THR B HG1  4  
ATOM   7597  H HG21 . THR B 1 9  ? -0.841  -4.464  2.342   1.00 1.03 ? 9   THR B HG21 4  
ATOM   7598  H HG22 . THR B 1 9  ? 0.123   -5.821  1.759   1.00 1.07 ? 9   THR B HG22 4  
ATOM   7599  H HG23 . THR B 1 9  ? -0.115  -5.590  3.490   1.00 1.07 ? 9   THR B HG23 4  
ATOM   7600  N N    . ALA B 1 10 ? -0.547  -2.355  0.354   1.00 0.23 ? 10  ALA B N    4  
ATOM   7601  C CA   . ALA B 1 10 ? -1.613  -1.322  0.274   1.00 0.23 ? 10  ALA B CA   4  
ATOM   7602  C C    . ALA B 1 10 ? -2.575  -1.481  1.450   1.00 0.22 ? 10  ALA B C    4  
ATOM   7603  O O    . ALA B 1 10 ? -3.633  -2.065  1.322   1.00 0.27 ? 10  ALA B O    4  
ATOM   7604  C CB   . ALA B 1 10 ? -2.381  -1.496  -1.035  1.00 0.23 ? 10  ALA B CB   4  
ATOM   7605  H H    . ALA B 1 10 ? -0.514  -3.075  -0.310  1.00 0.22 ? 10  ALA B H    4  
ATOM   7606  H HA   . ALA B 1 10 ? -1.168  -0.336  0.303   1.00 0.24 ? 10  ALA B HA   4  
ATOM   7607  H HB1  . ALA B 1 10 ? -2.685  -2.527  -1.138  1.00 0.99 ? 10  ALA B HB1  4  
ATOM   7608  H HB2  . ALA B 1 10 ? -3.255  -0.863  -1.027  1.00 0.99 ? 10  ALA B HB2  4  
ATOM   7609  H HB3  . ALA B 1 10 ? -1.745  -1.224  -1.864  1.00 0.99 ? 10  ALA B HB3  4  
ATOM   7610  N N    . CYS B 1 11 ? -2.219  -0.954  2.594   1.00 0.25 ? 11  CYS B N    4  
ATOM   7611  C CA   . CYS B 1 11 ? -3.108  -1.053  3.793   1.00 0.25 ? 11  CYS B CA   4  
ATOM   7612  C C    . CYS B 1 11 ? -3.693  0.331   4.080   1.00 0.25 ? 11  CYS B C    4  
ATOM   7613  O O    . CYS B 1 11 ? -3.004  1.330   4.019   1.00 0.26 ? 11  CYS B O    4  
ATOM   7614  C CB   . CYS B 1 11 ? -2.287  -1.520  4.998   1.00 0.25 ? 11  CYS B CB   4  
ATOM   7615  S SG   . CYS B 1 11 ? -1.361  -3.013  4.554   1.00 0.34 ? 11  CYS B SG   4  
ATOM   7616  H H    . CYS B 1 11 ? -1.364  -0.481  2.663   1.00 0.30 ? 11  CYS B H    4  
ATOM   7617  H HA   . CYS B 1 11 ? -3.911  -1.753  3.611   1.00 0.25 ? 11  CYS B HA   4  
ATOM   7618  H HB2  . CYS B 1 11 ? -1.597  -0.743  5.289   1.00 0.29 ? 11  CYS B HB2  4  
ATOM   7619  H HB3  . CYS B 1 11 ? -2.950  -1.741  5.821   1.00 0.29 ? 11  CYS B HB3  4  
ATOM   7620  N N    . CYS B 1 12 ? -4.960  0.401   4.379   1.00 0.24 ? 12  CYS B N    4  
ATOM   7621  C CA   . CYS B 1 12 ? -5.581  1.726   4.655   1.00 0.24 ? 12  CYS B CA   4  
ATOM   7622  C C    . CYS B 1 12 ? -5.112  2.241   6.016   1.00 0.24 ? 12  CYS B C    4  
ATOM   7623  O O    . CYS B 1 12 ? -4.942  1.486   6.953   1.00 0.27 ? 12  CYS B O    4  
ATOM   7624  C CB   . CYS B 1 12 ? -7.105  1.588   4.662   1.00 0.24 ? 12  CYS B CB   4  
ATOM   7625  S SG   . CYS B 1 12 ? -7.673  1.056   3.028   1.00 0.24 ? 12  CYS B SG   4  
ATOM   7626  H H    . CYS B 1 12 ? -5.503  -0.413  4.413   1.00 0.24 ? 12  CYS B H    4  
ATOM   7627  H HA   . CYS B 1 12 ? -5.288  2.427   3.886   1.00 0.26 ? 12  CYS B HA   4  
ATOM   7628  H HB2  . CYS B 1 12 ? -7.399  0.858   5.401   1.00 0.27 ? 12  CYS B HB2  4  
ATOM   7629  H HB3  . CYS B 1 12 ? -7.550  2.543   4.904   1.00 0.24 ? 12  CYS B HB3  4  
ATOM   7630  N N    . PHE B 1 13 ? -4.912  3.529   6.131   1.00 0.25 ? 13  PHE B N    4  
ATOM   7631  C CA   . PHE B 1 13 ? -4.466  4.122   7.428   1.00 0.27 ? 13  PHE B CA   4  
ATOM   7632  C C    . PHE B 1 13 ? -5.671  4.792   8.090   1.00 0.24 ? 13  PHE B C    4  
ATOM   7633  O O    . PHE B 1 13 ? -5.673  5.077   9.271   1.00 0.26 ? 13  PHE B O    4  
ATOM   7634  C CB   . PHE B 1 13 ? -3.376  5.167   7.161   1.00 0.30 ? 13  PHE B CB   4  
ATOM   7635  C CG   . PHE B 1 13 ? -3.972  6.329   6.404   1.00 0.31 ? 13  PHE B CG   4  
ATOM   7636  C CD1  . PHE B 1 13 ? -4.239  6.208   5.028   1.00 0.31 ? 13  PHE B CD1  4  
ATOM   7637  C CD2  . PHE B 1 13 ? -4.273  7.529   7.078   1.00 0.35 ? 13  PHE B CD2  4  
ATOM   7638  C CE1  . PHE B 1 13 ? -4.804  7.286   4.324   1.00 0.34 ? 13  PHE B CE1  4  
ATOM   7639  C CE2  . PHE B 1 13 ? -4.840  8.607   6.375   1.00 0.37 ? 13  PHE B CE2  4  
ATOM   7640  C CZ   . PHE B 1 13 ? -5.105  8.487   4.997   1.00 0.37 ? 13  PHE B CZ   4  
ATOM   7641  H H    . PHE B 1 13 ? -5.066  4.112   5.359   1.00 0.25 ? 13  PHE B H    4  
ATOM   7642  H HA   . PHE B 1 13 ? -4.074  3.352   8.076   1.00 0.29 ? 13  PHE B HA   4  
ATOM   7643  H HB2  . PHE B 1 13 ? -2.973  5.515   8.101   1.00 0.33 ? 13  PHE B HB2  4  
ATOM   7644  H HB3  . PHE B 1 13 ? -2.587  4.723   6.573   1.00 0.31 ? 13  PHE B HB3  4  
ATOM   7645  H HD1  . PHE B 1 13 ? -4.004  5.288   4.511   1.00 0.30 ? 13  PHE B HD1  4  
ATOM   7646  H HD2  . PHE B 1 13 ? -4.068  7.621   8.135   1.00 0.36 ? 13  PHE B HD2  4  
ATOM   7647  H HE1  . PHE B 1 13 ? -5.006  7.193   3.268   1.00 0.36 ? 13  PHE B HE1  4  
ATOM   7648  H HE2  . PHE B 1 13 ? -5.069  9.527   6.891   1.00 0.40 ? 13  PHE B HE2  4  
ATOM   7649  H HZ   . PHE B 1 13 ? -5.540  9.315   4.456   1.00 0.40 ? 13  PHE B HZ   4  
ATOM   7650  N N    . SER B 1 14 ? -6.697  5.039   7.323   1.00 0.21 ? 14  SER B N    4  
ATOM   7651  C CA   . SER B 1 14 ? -7.920  5.685   7.874   1.00 0.20 ? 14  SER B CA   4  
ATOM   7652  C C    . SER B 1 14 ? -9.107  5.339   6.975   1.00 0.18 ? 14  SER B C    4  
ATOM   7653  O O    . SER B 1 14 ? -9.130  4.306   6.337   1.00 0.17 ? 14  SER B O    4  
ATOM   7654  C CB   . SER B 1 14 ? -7.727  7.202   7.905   1.00 0.20 ? 14  SER B CB   4  
ATOM   7655  O OG   . SER B 1 14 ? -7.571  7.684   6.577   1.00 0.25 ? 14  SER B OG   4  
ATOM   7656  H H    . SER B 1 14 ? -6.664  4.795   6.374   1.00 0.21 ? 14  SER B H    4  
ATOM   7657  H HA   . SER B 1 14 ? -8.104  5.321   8.874   1.00 0.22 ? 14  SER B HA   4  
ATOM   7658  H HB2  . SER B 1 14 ? -8.589  7.667   8.352   1.00 0.24 ? 14  SER B HB2  4  
ATOM   7659  H HB3  . SER B 1 14 ? -6.848  7.440   8.492   1.00 0.24 ? 14  SER B HB3  4  
ATOM   7660  H HG   . SER B 1 14 ? -8.444  7.769   6.188   1.00 0.84 ? 14  SER B HG   4  
ATOM   7661  N N    . TYR B 1 15 ? -10.096 6.190   6.914   1.00 0.19 ? 15  TYR B N    4  
ATOM   7662  C CA   . TYR B 1 15 ? -11.281 5.901   6.052   1.00 0.20 ? 15  TYR B CA   4  
ATOM   7663  C C    . TYR B 1 15 ? -11.954 7.213   5.653   1.00 0.24 ? 15  TYR B C    4  
ATOM   7664  O O    . TYR B 1 15 ? -11.738 8.242   6.263   1.00 0.29 ? 15  TYR B O    4  
ATOM   7665  C CB   . TYR B 1 15 ? -12.281 5.030   6.826   1.00 0.22 ? 15  TYR B CB   4  
ATOM   7666  C CG   . TYR B 1 15 ? -11.539 3.988   7.628   1.00 0.21 ? 15  TYR B CG   4  
ATOM   7667  C CD1  . TYR B 1 15 ? -11.150 2.778   7.024   1.00 0.21 ? 15  TYR B CD1  4  
ATOM   7668  C CD2  . TYR B 1 15 ? -11.237 4.228   8.983   1.00 0.25 ? 15  TYR B CD2  4  
ATOM   7669  C CE1  . TYR B 1 15 ? -10.457 1.808   7.774   1.00 0.23 ? 15  TYR B CE1  4  
ATOM   7670  C CE2  . TYR B 1 15 ? -10.545 3.259   9.732   1.00 0.28 ? 15  TYR B CE2  4  
ATOM   7671  C CZ   . TYR B 1 15 ? -10.155 2.048   9.129   1.00 0.27 ? 15  TYR B CZ   4  
ATOM   7672  O OH   . TYR B 1 15 ? -9.477  1.097   9.863   1.00 0.32 ? 15  TYR B OH   4  
ATOM   7673  H H    . TYR B 1 15 ? -10.061 7.020   7.436   1.00 0.21 ? 15  TYR B H    4  
ATOM   7674  H HA   . TYR B 1 15 ? -10.963 5.380   5.158   1.00 0.18 ? 15  TYR B HA   4  
ATOM   7675  H HB2  . TYR B 1 15 ? -12.859 5.651   7.497   1.00 0.25 ? 15  TYR B HB2  4  
ATOM   7676  H HB3  . TYR B 1 15 ? -12.943 4.542   6.130   1.00 0.22 ? 15  TYR B HB3  4  
ATOM   7677  H HD1  . TYR B 1 15 ? -11.380 2.593   5.986   1.00 0.20 ? 15  TYR B HD1  4  
ATOM   7678  H HD2  . TYR B 1 15 ? -11.536 5.157   9.447   1.00 0.27 ? 15  TYR B HD2  4  
ATOM   7679  H HE1  . TYR B 1 15 ? -10.158 0.880   7.311   1.00 0.24 ? 15  TYR B HE1  4  
ATOM   7680  H HE2  . TYR B 1 15 ? -10.313 3.443   10.771  1.00 0.33 ? 15  TYR B HE2  4  
ATOM   7681  H HH   . TYR B 1 15 ? -9.681  1.237   10.790  1.00 0.89 ? 15  TYR B HH   4  
ATOM   7682  N N    . THR B 1 16 ? -12.772 7.185   4.637   1.00 0.22 ? 16  THR B N    4  
ATOM   7683  C CA   . THR B 1 16 ? -13.461 8.435   4.212   1.00 0.28 ? 16  THR B CA   4  
ATOM   7684  C C    . THR B 1 16 ? -14.338 8.933   5.365   1.00 0.32 ? 16  THR B C    4  
ATOM   7685  O O    . THR B 1 16 ? -14.025 8.731   6.522   1.00 0.38 ? 16  THR B O    4  
ATOM   7686  C CB   . THR B 1 16 ? -14.308 8.164   2.960   1.00 0.28 ? 16  THR B CB   4  
ATOM   7687  O OG1  . THR B 1 16 ? -14.970 9.356   2.565   1.00 0.39 ? 16  THR B OG1  4  
ATOM   7688  C CG2  . THR B 1 16 ? -15.340 7.072   3.245   1.00 0.27 ? 16  THR B CG2  4  
ATOM   7689  H H    . THR B 1 16 ? -12.940 6.341   4.162   1.00 0.19 ? 16  THR B H    4  
ATOM   7690  H HA   . THR B 1 16 ? -12.720 9.188   3.985   1.00 0.30 ? 16  THR B HA   4  
ATOM   7691  H HB   . THR B 1 16 ? -13.661 7.836   2.161   1.00 0.27 ? 16  THR B HB   4  
ATOM   7692  H HG1  . THR B 1 16 ? -14.326 10.066  2.561   1.00 0.86 ? 16  THR B HG1  4  
ATOM   7693  H HG21 . THR B 1 16 ? -14.858 6.238   3.733   1.00 1.04 ? 16  THR B HG21 4  
ATOM   7694  H HG22 . THR B 1 16 ? -16.115 7.466   3.884   1.00 1.06 ? 16  THR B HG22 4  
ATOM   7695  H HG23 . THR B 1 16 ? -15.777 6.740   2.314   1.00 1.07 ? 16  THR B HG23 4  
ATOM   7696  N N    . ALA B 1 17 ? -15.429 9.586   5.073   1.00 0.36 ? 17  ALA B N    4  
ATOM   7697  C CA   . ALA B 1 17 ? -16.311 10.095  6.164   1.00 0.42 ? 17  ALA B CA   4  
ATOM   7698  C C    . ALA B 1 17 ? -17.766 10.058  5.699   1.00 0.45 ? 17  ALA B C    4  
ATOM   7699  O O    . ALA B 1 17 ? -18.671 9.816   6.472   1.00 0.63 ? 17  ALA B O    4  
ATOM   7700  C CB   . ALA B 1 17 ? -15.913 11.532  6.501   1.00 0.50 ? 17  ALA B CB   4  
ATOM   7701  H H    . ALA B 1 17 ? -15.668 9.745   4.138   1.00 0.39 ? 17  ALA B H    4  
ATOM   7702  H HA   . ALA B 1 17 ? -16.203 9.476   7.044   1.00 0.42 ? 17  ALA B HA   4  
ATOM   7703  H HB1  . ALA B 1 17 ? -15.759 12.087  5.587   1.00 1.18 ? 17  ALA B HB1  4  
ATOM   7704  H HB2  . ALA B 1 17 ? -16.697 11.998  7.079   1.00 1.12 ? 17  ALA B HB2  4  
ATOM   7705  H HB3  . ALA B 1 17 ? -14.998 11.526  7.077   1.00 1.12 ? 17  ALA B HB3  4  
ATOM   7706  N N    . ARG B 1 18 ? -17.998 10.289  4.435   1.00 0.47 ? 18  ARG B N    4  
ATOM   7707  C CA   . ARG B 1 18 ? -19.394 10.262  3.905   1.00 0.48 ? 18  ARG B CA   4  
ATOM   7708  C C    . ARG B 1 18 ? -19.677 8.879   3.315   1.00 0.41 ? 18  ARG B C    4  
ATOM   7709  O O    . ARG B 1 18 ? -18.924 8.371   2.508   1.00 0.37 ? 18  ARG B O    4  
ATOM   7710  C CB   . ARG B 1 18 ? -19.543 11.326  2.808   1.00 0.53 ? 18  ARG B CB   4  
ATOM   7711  C CG   . ARG B 1 18 ? -19.754 12.705  3.441   1.00 0.70 ? 18  ARG B CG   4  
ATOM   7712  C CD   . ARG B 1 18 ? -18.512 13.111  4.239   1.00 1.15 ? 18  ARG B CD   4  
ATOM   7713  N NE   . ARG B 1 18 ? -18.526 14.586  4.456   1.00 1.96 ? 18  ARG B NE   4  
ATOM   7714  C CZ   . ARG B 1 18 ? -17.750 15.121  5.357   1.00 2.64 ? 18  ARG B CZ   4  
ATOM   7715  N NH1  . ARG B 1 18 ? -16.970 14.364  6.078   1.00 2.84 ? 18  ARG B NH1  4  
ATOM   7716  N NH2  . ARG B 1 18 ? -17.755 16.412  5.539   1.00 3.63 ? 18  ARG B NH2  4  
ATOM   7717  H H    . ARG B 1 18 ? -17.252 10.478  3.830   1.00 0.61 ? 18  ARG B H    4  
ATOM   7718  H HA   . ARG B 1 18 ? -20.096 10.463  4.703   1.00 0.52 ? 18  ARG B HA   4  
ATOM   7719  H HB2  . ARG B 1 18 ? -18.650 11.342  2.201   1.00 0.55 ? 18  ARG B HB2  4  
ATOM   7720  H HB3  . ARG B 1 18 ? -20.394 11.086  2.185   1.00 0.55 ? 18  ARG B HB3  4  
ATOM   7721  H HG2  . ARG B 1 18 ? -19.934 13.432  2.662   1.00 1.27 ? 18  ARG B HG2  4  
ATOM   7722  H HG3  . ARG B 1 18 ? -20.608 12.670  4.102   1.00 1.20 ? 18  ARG B HG3  4  
ATOM   7723  H HD2  . ARG B 1 18 ? -18.518 12.605  5.194   1.00 1.77 ? 18  ARG B HD2  4  
ATOM   7724  H HD3  . ARG B 1 18 ? -17.623 12.837  3.691   1.00 1.64 ? 18  ARG B HD3  4  
ATOM   7725  H HE   . ARG B 1 18 ? -19.116 15.154  3.917   1.00 2.46 ? 18  ARG B HE   4  
ATOM   7726  H HH11 . ARG B 1 18 ? -16.968 13.375  5.940   1.00 2.56 ? 18  ARG B HH11 4  
ATOM   7727  H HH12 . ARG B 1 18 ? -16.375 14.774  6.769   1.00 3.61 ? 18  ARG B HH12 4  
ATOM   7728  H HH21 . ARG B 1 18 ? -18.354 16.993  4.987   1.00 3.98 ? 18  ARG B HH21 4  
ATOM   7729  H HH22 . ARG B 1 18 ? -17.160 16.823  6.230   1.00 4.24 ? 18  ARG B HH22 4  
ATOM   7730  N N    . LYS B 1 19 ? -20.761 8.269   3.705   1.00 0.40 ? 19  LYS B N    4  
ATOM   7731  C CA   . LYS B 1 19 ? -21.096 6.925   3.161   1.00 0.35 ? 19  LYS B CA   4  
ATOM   7732  C C    . LYS B 1 19 ? -21.308 7.057   1.650   1.00 0.31 ? 19  LYS B C    4  
ATOM   7733  O O    . LYS B 1 19 ? -22.040 7.909   1.189   1.00 0.33 ? 19  LYS B O    4  
ATOM   7734  C CB   . LYS B 1 19 ? -22.369 6.414   3.854   1.00 0.38 ? 19  LYS B CB   4  
ATOM   7735  C CG   . LYS B 1 19 ? -22.952 5.205   3.122   1.00 0.40 ? 19  LYS B CG   4  
ATOM   7736  C CD   . LYS B 1 19 ? -24.188 4.728   3.883   1.00 0.62 ? 19  LYS B CD   4  
ATOM   7737  C CE   . LYS B 1 19 ? -24.983 3.764   3.012   1.00 0.97 ? 19  LYS B CE   4  
ATOM   7738  N NZ   . LYS B 1 19 ? -25.754 4.535   1.996   1.00 1.79 ? 19  LYS B NZ   4  
ATOM   7739  H H    . LYS B 1 19 ? -21.358 8.697   4.353   1.00 0.43 ? 19  LYS B H    4  
ATOM   7740  H HA   . LYS B 1 19 ? -20.279 6.244   3.353   1.00 0.35 ? 19  LYS B HA   4  
ATOM   7741  H HB2  . LYS B 1 19 ? -22.130 6.127   4.866   1.00 0.45 ? 19  LYS B HB2  4  
ATOM   7742  H HB3  . LYS B 1 19 ? -23.107 7.195   3.875   1.00 0.41 ? 19  LYS B HB3  4  
ATOM   7743  H HG2  . LYS B 1 19 ? -23.237 5.482   2.118   1.00 0.68 ? 19  LYS B HG2  4  
ATOM   7744  H HG3  . LYS B 1 19 ? -22.221 4.412   3.089   1.00 0.68 ? 19  LYS B HG3  4  
ATOM   7745  H HD2  . LYS B 1 19 ? -23.884 4.229   4.789   1.00 1.50 ? 19  LYS B HD2  4  
ATOM   7746  H HD3  . LYS B 1 19 ? -24.809 5.576   4.132   1.00 1.32 ? 19  LYS B HD3  4  
ATOM   7747  H HE2  . LYS B 1 19 ? -24.306 3.085   2.514   1.00 1.40 ? 19  LYS B HE2  4  
ATOM   7748  H HE3  . LYS B 1 19 ? -25.665 3.206   3.632   1.00 1.44 ? 19  LYS B HE3  4  
ATOM   7749  H HZ1  . LYS B 1 19 ? -25.934 5.495   2.354   1.00 2.18 ? 19  LYS B HZ1  4  
ATOM   7750  H HZ2  . LYS B 1 19 ? -25.207 4.590   1.114   1.00 2.30 ? 19  LYS B HZ2  4  
ATOM   7751  H HZ3  . LYS B 1 19 ? -26.658 4.058   1.809   1.00 2.23 ? 19  LYS B HZ3  4  
ATOM   7752  N N    . LEU B 1 20 ? -20.659 6.230   0.875   1.00 0.27 ? 20  LEU B N    4  
ATOM   7753  C CA   . LEU B 1 20 ? -20.808 6.323   -0.605  1.00 0.27 ? 20  LEU B CA   4  
ATOM   7754  C C    . LEU B 1 20 ? -22.198 5.796   -1.034  1.00 0.27 ? 20  LEU B C    4  
ATOM   7755  O O    . LEU B 1 20 ? -22.474 4.631   -0.823  1.00 0.27 ? 20  LEU B O    4  
ATOM   7756  C CB   . LEU B 1 20 ? -19.743 5.450   -1.274  1.00 0.24 ? 20  LEU B CB   4  
ATOM   7757  C CG   . LEU B 1 20 ? -18.382 5.670   -0.616  1.00 0.23 ? 20  LEU B CG   4  
ATOM   7758  C CD1  . LEU B 1 20 ? -17.310 4.971   -1.452  1.00 0.22 ? 20  LEU B CD1  4  
ATOM   7759  C CD2  . LEU B 1 20 ? -18.066 7.167   -0.541  1.00 0.27 ? 20  LEU B CD2  4  
ATOM   7760  H H    . LEU B 1 20 ? -20.062 5.559   1.266   1.00 0.27 ? 20  LEU B H    4  
ATOM   7761  H HA   . LEU B 1 20 ? -20.662 7.340   -0.907  1.00 0.29 ? 20  LEU B HA   4  
ATOM   7762  H HB2  . LEU B 1 20 ? -20.020 4.409   -1.175  1.00 0.24 ? 20  LEU B HB2  4  
ATOM   7763  H HB3  . LEU B 1 20 ? -19.679 5.703   -2.321  1.00 0.27 ? 20  LEU B HB3  4  
ATOM   7764  H HG   . LEU B 1 20 ? -18.392 5.250   0.380   1.00 0.21 ? 20  LEU B HG   4  
ATOM   7765  H HD11 . LEU B 1 20 ? -17.647 3.980   -1.718  1.00 1.00 ? 20  LEU B HD11 4  
ATOM   7766  H HD12 . LEU B 1 20 ? -17.128 5.542   -2.351  1.00 1.05 ? 20  LEU B HD12 4  
ATOM   7767  H HD13 . LEU B 1 20 ? -16.399 4.901   -0.880  1.00 1.00 ? 20  LEU B HD13 4  
ATOM   7768  H HD21 . LEU B 1 20 ? -18.312 7.634   -1.483  1.00 1.03 ? 20  LEU B HD21 4  
ATOM   7769  H HD22 . LEU B 1 20 ? -18.645 7.617   0.250   1.00 1.05 ? 20  LEU B HD22 4  
ATOM   7770  H HD23 . LEU B 1 20 ? -17.013 7.303   -0.337  1.00 1.05 ? 20  LEU B HD23 4  
ATOM   7771  N N    . PRO B 1 21 ? -23.040 6.621   -1.642  1.00 0.31 ? 21  PRO B N    4  
ATOM   7772  C CA   . PRO B 1 21 ? -24.361 6.142   -2.091  1.00 0.34 ? 21  PRO B CA   4  
ATOM   7773  C C    . PRO B 1 21 ? -24.178 4.961   -3.047  1.00 0.30 ? 21  PRO B C    4  
ATOM   7774  O O    . PRO B 1 21 ? -23.215 4.895   -3.781  1.00 0.29 ? 21  PRO B O    4  
ATOM   7775  C CB   . PRO B 1 21 ? -24.996 7.348   -2.823  1.00 0.39 ? 21  PRO B CB   4  
ATOM   7776  C CG   . PRO B 1 21 ? -24.072 8.573   -2.580  1.00 0.42 ? 21  PRO B CG   4  
ATOM   7777  C CD   . PRO B 1 21 ? -22.777 8.052   -1.923  1.00 0.35 ? 21  PRO B CD   4  
ATOM   7778  H HA   . PRO B 1 21 ? -24.966 5.855   -1.245  1.00 0.36 ? 21  PRO B HA   4  
ATOM   7779  H HB2  . PRO B 1 21 ? -25.069 7.147   -3.887  1.00 0.39 ? 21  PRO B HB2  4  
ATOM   7780  H HB3  . PRO B 1 21 ? -25.978 7.544   -2.430  1.00 0.43 ? 21  PRO B HB3  4  
ATOM   7781  H HG2  . PRO B 1 21 ? -23.845 9.058   -3.523  1.00 0.45 ? 21  PRO B HG2  4  
ATOM   7782  H HG3  . PRO B 1 21 ? -24.558 9.278   -1.918  1.00 0.47 ? 21  PRO B HG3  4  
ATOM   7783  H HD2  . PRO B 1 21 ? -21.943 8.157   -2.609  1.00 0.35 ? 21  PRO B HD2  4  
ATOM   7784  H HD3  . PRO B 1 21 ? -22.580 8.584   -1.003  1.00 0.37 ? 21  PRO B HD3  4  
ATOM   7785  N N    . ARG B 1 22 ? -25.099 4.038   -3.061  1.00 0.31 ? 22  ARG B N    4  
ATOM   7786  C CA   . ARG B 1 22 ? -24.971 2.887   -3.995  1.00 0.30 ? 22  ARG B CA   4  
ATOM   7787  C C    . ARG B 1 22 ? -24.704 3.430   -5.402  1.00 0.31 ? 22  ARG B C    4  
ATOM   7788  O O    . ARG B 1 22 ? -24.006 2.827   -6.193  1.00 0.31 ? 22  ARG B O    4  
ATOM   7789  C CB   . ARG B 1 22 ? -26.267 2.075   -3.993  1.00 0.33 ? 22  ARG B CB   4  
ATOM   7790  C CG   . ARG B 1 22 ? -26.040 0.748   -4.720  1.00 0.69 ? 22  ARG B CG   4  
ATOM   7791  C CD   . ARG B 1 22 ? -27.275 -0.140  -4.559  1.00 1.24 ? 22  ARG B CD   4  
ATOM   7792  N NE   . ARG B 1 22 ? -27.050 -1.437  -5.257  1.00 1.34 ? 22  ARG B NE   4  
ATOM   7793  C CZ   . ARG B 1 22 ? -27.830 -2.454  -5.010  1.00 2.07 ? 22  ARG B CZ   4  
ATOM   7794  N NH1  . ARG B 1 22 ? -28.806 -2.335  -4.152  1.00 2.89 ? 22  ARG B NH1  4  
ATOM   7795  N NH2  . ARG B 1 22 ? -27.634 -3.589  -5.622  1.00 2.44 ? 22  ARG B NH2  4  
ATOM   7796  H H    . ARG B 1 22 ? -25.880 4.112   -2.472  1.00 0.33 ? 22  ARG B H    4  
ATOM   7797  H HA   . ARG B 1 22 ? -24.148 2.260   -3.687  1.00 0.28 ? 22  ARG B HA   4  
ATOM   7798  H HB2  . ARG B 1 22 ? -26.568 1.881   -2.973  1.00 0.51 ? 22  ARG B HB2  4  
ATOM   7799  H HB3  . ARG B 1 22 ? -27.042 2.631   -4.498  1.00 0.49 ? 22  ARG B HB3  4  
ATOM   7800  H HG2  . ARG B 1 22 ? -25.867 0.938   -5.770  1.00 1.24 ? 22  ARG B HG2  4  
ATOM   7801  H HG3  . ARG B 1 22 ? -25.182 0.247   -4.298  1.00 1.29 ? 22  ARG B HG3  4  
ATOM   7802  H HD2  . ARG B 1 22 ? -27.452 -0.322  -3.509  1.00 1.83 ? 22  ARG B HD2  4  
ATOM   7803  H HD3  . ARG B 1 22 ? -28.133 0.357   -4.987  1.00 1.88 ? 22  ARG B HD3  4  
ATOM   7804  H HE   . ARG B 1 22 ? -26.318 -1.526  -5.901  1.00 1.53 ? 22  ARG B HE   4  
ATOM   7805  H HH11 . ARG B 1 22 ? -28.956 -1.464  -3.684  1.00 2.92 ? 22  ARG B HH11 4  
ATOM   7806  H HH12 . ARG B 1 22 ? -29.404 -3.114  -3.963  1.00 3.67 ? 22  ARG B HH12 4  
ATOM   7807  H HH21 . ARG B 1 22 ? -26.886 -3.681  -6.280  1.00 2.35 ? 22  ARG B HH21 4  
ATOM   7808  H HH22 . ARG B 1 22 ? -28.232 -4.369  -5.433  1.00 3.12 ? 22  ARG B HH22 4  
ATOM   7809  N N    . ASN B 1 23 ? -25.257 4.574   -5.710  1.00 0.34 ? 23  ASN B N    4  
ATOM   7810  C CA   . ASN B 1 23 ? -25.042 5.173   -7.058  1.00 0.37 ? 23  ASN B CA   4  
ATOM   7811  C C    . ASN B 1 23 ? -23.612 5.711   -7.161  1.00 0.37 ? 23  ASN B C    4  
ATOM   7812  O O    . ASN B 1 23 ? -23.288 6.470   -8.053  1.00 0.40 ? 23  ASN B O    4  
ATOM   7813  C CB   . ASN B 1 23 ? -26.033 6.320   -7.269  1.00 0.42 ? 23  ASN B CB   4  
ATOM   7814  C CG   . ASN B 1 23 ? -27.462 5.790   -7.138  1.00 1.47 ? 23  ASN B CG   4  
ATOM   7815  O OD1  . ASN B 1 23 ? -28.209 5.779   -8.096  1.00 2.16 ? 23  ASN B OD1  4  
ATOM   7816  N ND2  . ASN B 1 23 ? -27.876 5.347   -5.983  1.00 2.38 ? 23  ASN B ND2  4  
ATOM   7817  H H    . ASN B 1 23 ? -25.812 5.043   -5.048  1.00 0.35 ? 23  ASN B H    4  
ATOM   7818  H HA   . ASN B 1 23 ? -25.197 4.420   -7.816  1.00 0.38 ? 23  ASN B HA   4  
ATOM   7819  H HB2  . ASN B 1 23 ? -25.862 7.085   -6.526  1.00 1.04 ? 23  ASN B HB2  4  
ATOM   7820  H HB3  . ASN B 1 23 ? -25.895 6.738   -8.256  1.00 1.07 ? 23  ASN B HB3  4  
ATOM   7821  H HD21 . ASN B 1 23 ? -27.275 5.356   -5.209  1.00 2.56 ? 23  ASN B HD21 4  
ATOM   7822  H HD22 . ASN B 1 23 ? -28.790 5.005   -5.888  1.00 3.17 ? 23  ASN B HD22 4  
ATOM   7823  N N    . PHE B 1 24 ? -22.755 5.332   -6.248  1.00 0.33 ? 24  PHE B N    4  
ATOM   7824  C CA   . PHE B 1 24 ? -21.341 5.826   -6.278  1.00 0.33 ? 24  PHE B CA   4  
ATOM   7825  C C    . PHE B 1 24 ? -20.405 4.668   -5.920  1.00 0.30 ? 24  PHE B C    4  
ATOM   7826  O O    . PHE B 1 24 ? -19.326 4.865   -5.399  1.00 0.28 ? 24  PHE B O    4  
ATOM   7827  C CB   . PHE B 1 24 ? -21.190 6.962   -5.250  1.00 0.33 ? 24  PHE B CB   4  
ATOM   7828  C CG   . PHE B 1 24 ? -19.998 7.837   -5.584  1.00 0.35 ? 24  PHE B CG   4  
ATOM   7829  C CD1  . PHE B 1 24 ? -19.953 8.534   -6.811  1.00 0.39 ? 24  PHE B CD1  4  
ATOM   7830  C CD2  . PHE B 1 24 ? -18.936 7.971   -4.664  1.00 0.35 ? 24  PHE B CD2  4  
ATOM   7831  C CE1  . PHE B 1 24 ? -18.853 9.357   -7.113  1.00 0.41 ? 24  PHE B CE1  4  
ATOM   7832  C CE2  . PHE B 1 24 ? -17.837 8.795   -4.970  1.00 0.37 ? 24  PHE B CE2  4  
ATOM   7833  C CZ   . PHE B 1 24 ? -17.796 9.489   -6.194  1.00 0.41 ? 24  PHE B CZ   4  
ATOM   7834  H H    . PHE B 1 24 ? -23.045 4.727   -5.534  1.00 0.31 ? 24  PHE B H    4  
ATOM   7835  H HA   . PHE B 1 24 ? -21.096 6.188   -7.268  1.00 0.36 ? 24  PHE B HA   4  
ATOM   7836  H HB2  . PHE B 1 24 ? -22.083 7.565   -5.254  1.00 0.35 ? 24  PHE B HB2  4  
ATOM   7837  H HB3  . PHE B 1 24 ? -21.056 6.536   -4.262  1.00 0.31 ? 24  PHE B HB3  4  
ATOM   7838  H HD1  . PHE B 1 24 ? -20.763 8.440   -7.519  1.00 0.40 ? 24  PHE B HD1  4  
ATOM   7839  H HD2  . PHE B 1 24 ? -18.966 7.440   -3.725  1.00 0.32 ? 24  PHE B HD2  4  
ATOM   7840  H HE1  . PHE B 1 24 ? -18.822 9.890   -8.051  1.00 0.44 ? 24  PHE B HE1  4  
ATOM   7841  H HE2  . PHE B 1 24 ? -17.025 8.900   -4.266  1.00 0.37 ? 24  PHE B HE2  4  
ATOM   7842  H HZ   . PHE B 1 24 ? -16.952 10.121  -6.428  1.00 0.43 ? 24  PHE B HZ   4  
ATOM   7843  N N    . VAL B 1 25 ? -20.816 3.459   -6.201  1.00 0.30 ? 25  VAL B N    4  
ATOM   7844  C CA   . VAL B 1 25 ? -19.964 2.274   -5.886  1.00 0.28 ? 25  VAL B CA   4  
ATOM   7845  C C    . VAL B 1 25 ? -20.249 1.171   -6.908  1.00 0.30 ? 25  VAL B C    4  
ATOM   7846  O O    . VAL B 1 25 ? -21.113 0.340   -6.713  1.00 0.31 ? 25  VAL B O    4  
ATOM   7847  C CB   . VAL B 1 25 ? -20.300 1.757   -4.485  1.00 0.24 ? 25  VAL B CB   4  
ATOM   7848  C CG1  . VAL B 1 25 ? -19.366 0.602   -4.127  1.00 0.22 ? 25  VAL B CG1  4  
ATOM   7849  C CG2  . VAL B 1 25 ? -20.123 2.882   -3.463  1.00 0.23 ? 25  VAL B CG2  4  
ATOM   7850  H H    . VAL B 1 25 ? -21.692 3.329   -6.624  1.00 0.31 ? 25  VAL B H    4  
ATOM   7851  H HA   . VAL B 1 25 ? -18.920 2.549   -5.931  1.00 0.27 ? 25  VAL B HA   4  
ATOM   7852  H HB   . VAL B 1 25 ? -21.324 1.411   -4.466  1.00 0.25 ? 25  VAL B HB   4  
ATOM   7853  H HG11 . VAL B 1 25 ? -18.342 0.942   -4.169  1.00 1.04 ? 25  VAL B HG11 4  
ATOM   7854  H HG12 . VAL B 1 25 ? -19.590 0.257   -3.129  1.00 1.03 ? 25  VAL B HG12 4  
ATOM   7855  H HG13 . VAL B 1 25 ? -19.507 -0.207  -4.827  1.00 1.04 ? 25  VAL B HG13 4  
ATOM   7856  H HG21 . VAL B 1 25 ? -19.162 3.353   -3.608  1.00 1.07 ? 25  VAL B HG21 4  
ATOM   7857  H HG22 . VAL B 1 25 ? -20.907 3.613   -3.591  1.00 1.01 ? 25  VAL B HG22 4  
ATOM   7858  H HG23 . VAL B 1 25 ? -20.174 2.470   -2.467  1.00 1.04 ? 25  VAL B HG23 4  
ATOM   7859  N N    . VAL B 1 26 ? -19.532 1.158   -7.999  1.00 0.33 ? 26  VAL B N    4  
ATOM   7860  C CA   . VAL B 1 26 ? -19.762 0.114   -9.035  1.00 0.36 ? 26  VAL B CA   4  
ATOM   7861  C C    . VAL B 1 26 ? -18.970 -1.143  -8.684  1.00 0.35 ? 26  VAL B C    4  
ATOM   7862  O O    . VAL B 1 26 ? -19.157 -2.189  -9.273  1.00 0.37 ? 26  VAL B O    4  
ATOM   7863  C CB   . VAL B 1 26 ? -19.304 0.646   -10.391 1.00 0.41 ? 26  VAL B CB   4  
ATOM   7864  C CG1  . VAL B 1 26 ? -20.142 1.868   -10.768 1.00 0.78 ? 26  VAL B CG1  4  
ATOM   7865  C CG2  . VAL B 1 26 ? -17.827 1.041   -10.314 1.00 0.61 ? 26  VAL B CG2  4  
ATOM   7866  H H    . VAL B 1 26 ? -18.842 1.838   -8.140  1.00 0.33 ? 26  VAL B H    4  
ATOM   7867  H HA   . VAL B 1 26 ? -20.814 -0.128  -9.080  1.00 0.37 ? 26  VAL B HA   4  
ATOM   7868  H HB   . VAL B 1 26 ? -19.433 -0.121  -11.136 1.00 0.58 ? 26  VAL B HB   4  
ATOM   7869  H HG11 . VAL B 1 26 ? -20.233 2.518   -9.910  1.00 1.32 ? 26  VAL B HG11 4  
ATOM   7870  H HG12 . VAL B 1 26 ? -19.661 2.401   -11.575 1.00 1.36 ? 26  VAL B HG12 4  
ATOM   7871  H HG13 . VAL B 1 26 ? -21.124 1.548   -11.082 1.00 1.31 ? 26  VAL B HG13 4  
ATOM   7872  H HG21 . VAL B 1 26 ? -17.685 1.754   -9.516  1.00 1.34 ? 26  VAL B HG21 4  
ATOM   7873  H HG22 . VAL B 1 26 ? -17.227 0.164   -10.123 1.00 1.17 ? 26  VAL B HG22 4  
ATOM   7874  H HG23 . VAL B 1 26 ? -17.523 1.487   -11.251 1.00 1.18 ? 26  VAL B HG23 4  
ATOM   7875  N N    . ASP B 1 27 ? -18.086 -1.055  -7.730  1.00 0.32 ? 27  ASP B N    4  
ATOM   7876  C CA   . ASP B 1 27 ? -17.292 -2.256  -7.353  1.00 0.31 ? 27  ASP B CA   4  
ATOM   7877  C C    . ASP B 1 27 ? -16.521 -1.968  -6.069  1.00 0.27 ? 27  ASP B C    4  
ATOM   7878  O O    . ASP B 1 27 ? -16.705 -0.943  -5.441  1.00 0.25 ? 27  ASP B O    4  
ATOM   7879  C CB   . ASP B 1 27 ? -16.308 -2.591  -8.476  1.00 0.34 ? 27  ASP B CB   4  
ATOM   7880  C CG   . ASP B 1 27 ? -15.739 -3.995  -8.255  1.00 0.35 ? 27  ASP B CG   4  
ATOM   7881  O OD1  . ASP B 1 27 ? -16.492 -4.946  -8.390  1.00 1.09 ? 27  ASP B OD1  4  
ATOM   7882  O OD2  . ASP B 1 27 ? -14.561 -4.094  -7.954  1.00 1.13 ? 27  ASP B OD2  4  
ATOM   7883  H H    . ASP B 1 27 ? -17.946 -0.202  -7.262  1.00 0.30 ? 27  ASP B H    4  
ATOM   7884  H HA   . ASP B 1 27 ? -17.956 -3.092  -7.192  1.00 0.31 ? 27  ASP B HA   4  
ATOM   7885  H HB2  . ASP B 1 27 ? -16.821 -2.557  -9.426  1.00 0.37 ? 27  ASP B HB2  4  
ATOM   7886  H HB3  . ASP B 1 27 ? -15.499 -1.873  -8.477  1.00 0.34 ? 27  ASP B HB3  4  
ATOM   7887  N N    . TYR B 1 28 ? -15.656 -2.858  -5.670  1.00 0.26 ? 28  TYR B N    4  
ATOM   7888  C CA   . TYR B 1 28 ? -14.878 -2.622  -4.424  1.00 0.23 ? 28  TYR B CA   4  
ATOM   7889  C C    . TYR B 1 28 ? -13.581 -3.422  -4.457  1.00 0.25 ? 28  TYR B C    4  
ATOM   7890  O O    . TYR B 1 28 ? -13.247 -4.062  -5.435  1.00 0.29 ? 28  TYR B O    4  
ATOM   7891  C CB   . TYR B 1 28 ? -15.710 -3.018  -3.198  1.00 0.19 ? 28  TYR B CB   4  
ATOM   7892  C CG   . TYR B 1 28 ? -15.805 -4.527  -3.072  1.00 0.21 ? 28  TYR B CG   4  
ATOM   7893  C CD1  . TYR B 1 28 ? -16.438 -5.285  -4.078  1.00 0.25 ? 28  TYR B CD1  4  
ATOM   7894  C CD2  . TYR B 1 28 ? -15.268 -5.173  -1.939  1.00 0.19 ? 28  TYR B CD2  4  
ATOM   7895  C CE1  . TYR B 1 28 ? -16.533 -6.683  -3.951  1.00 0.27 ? 28  TYR B CE1  4  
ATOM   7896  C CE2  . TYR B 1 28 ? -15.364 -6.570  -1.811  1.00 0.22 ? 28  TYR B CE2  4  
ATOM   7897  C CZ   . TYR B 1 28 ? -15.996 -7.327  -2.818  1.00 0.25 ? 28  TYR B CZ   4  
ATOM   7898  O OH   . TYR B 1 28 ? -16.091 -8.698  -2.694  1.00 0.28 ? 28  TYR B OH   4  
ATOM   7899  H H    . TYR B 1 28 ? -15.519 -3.679  -6.189  1.00 0.28 ? 28  TYR B H    4  
ATOM   7900  H HA   . TYR B 1 28 ? -14.634 -1.573  -4.356  1.00 0.23 ? 28  TYR B HA   4  
ATOM   7901  H HB2  . TYR B 1 28 ? -15.247 -2.611  -2.311  1.00 0.17 ? 28  TYR B HB2  4  
ATOM   7902  H HB3  . TYR B 1 28 ? -16.699 -2.607  -3.297  1.00 0.19 ? 28  TYR B HB3  4  
ATOM   7903  H HD1  . TYR B 1 28 ? -16.850 -4.795  -4.946  1.00 0.27 ? 28  TYR B HD1  4  
ATOM   7904  H HD2  . TYR B 1 28 ? -14.782 -4.596  -1.169  1.00 0.17 ? 28  TYR B HD2  4  
ATOM   7905  H HE1  . TYR B 1 28 ? -17.020 -7.261  -4.723  1.00 0.30 ? 28  TYR B HE1  4  
ATOM   7906  H HE2  . TYR B 1 28 ? -14.953 -7.061  -0.940  1.00 0.23 ? 28  TYR B HE2  4  
ATOM   7907  H HH   . TYR B 1 28 ? -15.224 -9.073  -2.872  1.00 0.98 ? 28  TYR B HH   4  
ATOM   7908  N N    . TYR B 1 29 ? -12.842 -3.364  -3.393  1.00 0.23 ? 29  TYR B N    4  
ATOM   7909  C CA   . TYR B 1 29 ? -11.549 -4.087  -3.329  1.00 0.25 ? 29  TYR B CA   4  
ATOM   7910  C C    . TYR B 1 29 ? -11.145 -4.225  -1.856  1.00 0.22 ? 29  TYR B C    4  
ATOM   7911  O O    . TYR B 1 29 ? -11.259 -3.293  -1.091  1.00 0.23 ? 29  TYR B O    4  
ATOM   7912  C CB   . TYR B 1 29 ? -10.507 -3.273  -4.113  1.00 0.29 ? 29  TYR B CB   4  
ATOM   7913  C CG   . TYR B 1 29 ? -9.106  -3.675  -3.722  1.00 0.31 ? 29  TYR B CG   4  
ATOM   7914  C CD1  . TYR B 1 29 ? -8.613  -4.939  -4.088  1.00 0.36 ? 29  TYR B CD1  4  
ATOM   7915  C CD2  . TYR B 1 29 ? -8.296  -2.785  -2.989  1.00 0.35 ? 29  TYR B CD2  4  
ATOM   7916  C CE1  . TYR B 1 29 ? -7.307  -5.318  -3.722  1.00 0.39 ? 29  TYR B CE1  4  
ATOM   7917  C CE2  . TYR B 1 29 ? -6.990  -3.162  -2.623  1.00 0.38 ? 29  TYR B CE2  4  
ATOM   7918  C CZ   . TYR B 1 29 ? -6.495  -4.430  -2.989  1.00 0.36 ? 29  TYR B CZ   4  
ATOM   7919  O OH   . TYR B 1 29 ? -5.216  -4.801  -2.630  1.00 0.39 ? 29  TYR B OH   4  
ATOM   7920  H H    . TYR B 1 29 ? -13.139 -2.833  -2.629  1.00 0.20 ? 29  TYR B H    4  
ATOM   7921  H HA   . TYR B 1 29 ? -11.656 -5.067  -3.771  1.00 0.28 ? 29  TYR B HA   4  
ATOM   7922  H HB2  . TYR B 1 29 ? -10.644 -3.448  -5.171  1.00 0.32 ? 29  TYR B HB2  4  
ATOM   7923  H HB3  . TYR B 1 29 ? -10.652 -2.221  -3.907  1.00 0.27 ? 29  TYR B HB3  4  
ATOM   7924  H HD1  . TYR B 1 29 ? -9.238  -5.616  -4.652  1.00 0.42 ? 29  TYR B HD1  4  
ATOM   7925  H HD2  . TYR B 1 29 ? -8.678  -1.812  -2.712  1.00 0.40 ? 29  TYR B HD2  4  
ATOM   7926  H HE1  . TYR B 1 29 ? -6.929  -6.289  -4.004  1.00 0.46 ? 29  TYR B HE1  4  
ATOM   7927  H HE2  . TYR B 1 29 ? -6.369  -2.481  -2.061  1.00 0.44 ? 29  TYR B HE2  4  
ATOM   7928  H HH   . TYR B 1 29 ? -4.894  -4.168  -1.983  1.00 0.97 ? 29  TYR B HH   4  
ATOM   7929  N N    . GLU B 1 30 ? -10.681 -5.376  -1.446  1.00 0.22 ? 30  GLU B N    4  
ATOM   7930  C CA   . GLU B 1 30 ? -10.277 -5.554  -0.016  1.00 0.20 ? 30  GLU B CA   4  
ATOM   7931  C C    . GLU B 1 30 ? -8.773  -5.305  0.125   1.00 0.21 ? 30  GLU B C    4  
ATOM   7932  O O    . GLU B 1 30 ? -8.023  -5.413  -0.824  1.00 0.24 ? 30  GLU B O    4  
ATOM   7933  C CB   . GLU B 1 30 ? -10.606 -6.978  0.434   1.00 0.22 ? 30  GLU B CB   4  
ATOM   7934  C CG   . GLU B 1 30 ? -12.113 -7.109  0.663   1.00 0.25 ? 30  GLU B CG   4  
ATOM   7935  C CD   . GLU B 1 30 ? -12.448 -8.553  1.041   1.00 0.69 ? 30  GLU B CD   4  
ATOM   7936  O OE1  . GLU B 1 30 ? -11.731 -9.440  0.608   1.00 1.35 ? 30  GLU B OE1  4  
ATOM   7937  O OE2  . GLU B 1 30 ? -13.417 -8.747  1.758   1.00 1.43 ? 30  GLU B OE2  4  
ATOM   7938  H H    . GLU B 1 30 ? -10.598 -6.123  -2.075  1.00 0.25 ? 30  GLU B H    4  
ATOM   7939  H HA   . GLU B 1 30 ? -10.815 -4.850  0.608   1.00 0.18 ? 30  GLU B HA   4  
ATOM   7940  H HB2  . GLU B 1 30 ? -10.298 -7.671  -0.328  1.00 0.26 ? 30  GLU B HB2  4  
ATOM   7941  H HB3  . GLU B 1 30 ? -10.085 -7.196  1.354   1.00 0.25 ? 30  GLU B HB3  4  
ATOM   7942  H HG2  . GLU B 1 30 ? -12.415 -6.447  1.463   1.00 0.59 ? 30  GLU B HG2  4  
ATOM   7943  H HG3  . GLU B 1 30 ? -12.640 -6.845  -0.242  1.00 0.45 ? 30  GLU B HG3  4  
ATOM   7944  N N    . THR B 1 31 ? -8.332  -4.961  1.304   1.00 0.19 ? 31  THR B N    4  
ATOM   7945  C CA   . THR B 1 31 ? -6.878  -4.691  1.518   1.00 0.21 ? 31  THR B CA   4  
ATOM   7946  C C    . THR B 1 31 ? -6.086  -5.997  1.515   1.00 0.25 ? 31  THR B C    4  
ATOM   7947  O O    . THR B 1 31 ? -6.572  -7.036  1.112   1.00 0.27 ? 31  THR B O    4  
ATOM   7948  C CB   . THR B 1 31 ? -6.694  -4.004  2.870   1.00 0.20 ? 31  THR B CB   4  
ATOM   7949  O OG1  . THR B 1 31 ? -7.401  -4.736  3.856   1.00 0.21 ? 31  THR B OG1  4  
ATOM   7950  C CG2  . THR B 1 31 ? -7.230  -2.575  2.788   1.00 0.20 ? 31  THR B CG2  4  
ATOM   7951  H H    . THR B 1 31 ? -8.962  -4.872  2.052   1.00 0.18 ? 31  THR B H    4  
ATOM   7952  H HA   . THR B 1 31 ? -6.512  -4.044  0.735   1.00 0.22 ? 31  THR B HA   4  
ATOM   7953  H HB   . THR B 1 31 ? -5.648  -3.978  3.132   1.00 0.22 ? 31  THR B HB   4  
ATOM   7954  H HG1  . THR B 1 31 ? -7.868  -5.450  3.417   1.00 0.73 ? 31  THR B HG1  4  
ATOM   7955  H HG21 . THR B 1 31 ? -8.251  -2.594  2.433   1.00 1.04 ? 31  THR B HG21 4  
ATOM   7956  H HG22 . THR B 1 31 ? -7.196  -2.120  3.765   1.00 1.00 ? 31  THR B HG22 4  
ATOM   7957  H HG23 . THR B 1 31 ? -6.622  -2.002  2.104   1.00 1.04 ? 31  THR B HG23 4  
ATOM   7958  N N    . SER B 1 32 ? -4.863  -5.945  1.970   1.00 0.27 ? 32  SER B N    4  
ATOM   7959  C CA   . SER B 1 32 ? -4.015  -7.168  2.012   1.00 0.31 ? 32  SER B CA   4  
ATOM   7960  C C    . SER B 1 32 ? -4.267  -7.918  3.319   1.00 0.33 ? 32  SER B C    4  
ATOM   7961  O O    . SER B 1 32 ? -5.371  -7.961  3.825   1.00 0.33 ? 32  SER B O    4  
ATOM   7962  C CB   . SER B 1 32 ? -2.544  -6.761  1.942   1.00 0.33 ? 32  SER B CB   4  
ATOM   7963  O OG   . SER B 1 32 ? -1.752  -7.911  1.676   1.00 1.27 ? 32  SER B OG   4  
ATOM   7964  H H    . SER B 1 32 ? -4.501  -5.093  2.291   1.00 0.26 ? 32  SER B H    4  
ATOM   7965  H HA   . SER B 1 32 ? -4.249  -7.808  1.178   1.00 0.34 ? 32  SER B HA   4  
ATOM   7966  H HB2  . SER B 1 32 ? -2.404  -6.043  1.152   1.00 0.94 ? 32  SER B HB2  4  
ATOM   7967  H HB3  . SER B 1 32 ? -2.251  -6.319  2.884   1.00 0.85 ? 32  SER B HB3  4  
ATOM   7968  H HG   . SER B 1 32 ? -1.249  -8.115  2.469   1.00 1.72 ? 32  SER B HG   4  
ATOM   7969  N N    . SER B 1 33 ? -3.243  -8.510  3.865   1.00 0.36 ? 33  SER B N    4  
ATOM   7970  C CA   . SER B 1 33 ? -3.390  -9.267  5.145   1.00 0.40 ? 33  SER B CA   4  
ATOM   7971  C C    . SER B 1 33 ? -2.148  -9.033  5.999   1.00 0.40 ? 33  SER B C    4  
ATOM   7972  O O    . SER B 1 33 ? -2.217  -8.937  7.209   1.00 0.42 ? 33  SER B O    4  
ATOM   7973  C CB   . SER B 1 33 ? -3.503  -10.756 4.835   1.00 0.46 ? 33  SER B CB   4  
ATOM   7974  O OG   . SER B 1 33 ? -2.205  -11.289 4.616   1.00 0.48 ? 33  SER B OG   4  
ATOM   7975  H H    . SER B 1 33 ? -2.368  -8.456  3.429   1.00 0.37 ? 33  SER B H    4  
ATOM   7976  H HA   . SER B 1 33 ? -4.270  -8.936  5.680   1.00 0.39 ? 33  SER B HA   4  
ATOM   7977  H HB2  . SER B 1 33 ? -3.966  -11.268 5.662   1.00 0.48 ? 33  SER B HB2  4  
ATOM   7978  H HB3  . SER B 1 33 ? -4.106  -10.884 3.950   1.00 0.46 ? 33  SER B HB3  4  
ATOM   7979  H HG   . SER B 1 33 ? -2.246  -12.238 4.753   1.00 1.00 ? 33  SER B HG   4  
ATOM   7980  N N    . LEU B 1 34 ? -1.014  -8.948  5.361   1.00 0.39 ? 34  LEU B N    4  
ATOM   7981  C CA   . LEU B 1 34 ? 0.271   -8.722  6.090   1.00 0.39 ? 34  LEU B CA   4  
ATOM   7982  C C    . LEU B 1 34 ? 0.067   -7.721  7.227   1.00 0.37 ? 34  LEU B C    4  
ATOM   7983  O O    . LEU B 1 34 ? 0.342   -8.002  8.377   1.00 0.40 ? 34  LEU B O    4  
ATOM   7984  C CB   . LEU B 1 34 ? 1.315   -8.165  5.119   1.00 0.36 ? 34  LEU B CB   4  
ATOM   7985  C CG   . LEU B 1 34 ? 1.243   -8.908  3.783   1.00 0.39 ? 34  LEU B CG   4  
ATOM   7986  C CD1  . LEU B 1 34 ? 2.401   -8.460  2.887   1.00 0.40 ? 34  LEU B CD1  4  
ATOM   7987  C CD2  . LEU B 1 34 ? 1.333   -10.417 4.030   1.00 0.45 ? 34  LEU B CD2  4  
ATOM   7988  H H    . LEU B 1 34 ? -1.007  -9.039  4.389   1.00 0.39 ? 34  LEU B H    4  
ATOM   7989  H HA   . LEU B 1 34 ? 0.622   -9.657  6.492   1.00 0.43 ? 34  LEU B HA   4  
ATOM   7990  H HB2  . LEU B 1 34 ? 1.130   -7.113  4.951   1.00 0.34 ? 34  LEU B HB2  4  
ATOM   7991  H HB3  . LEU B 1 34 ? 2.296   -8.290  5.542   1.00 0.37 ? 34  LEU B HB3  4  
ATOM   7992  H HG   . LEU B 1 34 ? 0.310   -8.676  3.294   1.00 0.39 ? 34  LEU B HG   4  
ATOM   7993  H HD11 . LEU B 1 34 ? 2.537   -7.390  2.977   1.00 1.12 ? 34  LEU B HD11 4  
ATOM   7994  H HD12 . LEU B 1 34 ? 3.307   -8.964  3.189   1.00 1.04 ? 34  LEU B HD12 4  
ATOM   7995  H HD13 . LEU B 1 34 ? 2.177   -8.707  1.861   1.00 1.09 ? 34  LEU B HD13 4  
ATOM   7996  H HD21 . LEU B 1 34 ? 2.131   -10.620 4.729   1.00 1.05 ? 34  LEU B HD21 4  
ATOM   7997  H HD22 . LEU B 1 34 ? 0.399   -10.772 4.436   1.00 1.14 ? 34  LEU B HD22 4  
ATOM   7998  H HD23 . LEU B 1 34 ? 1.535   -10.923 3.097   1.00 1.13 ? 34  LEU B HD23 4  
ATOM   7999  N N    . CYS B 1 35 ? -0.408  -6.552  6.910   1.00 0.33 ? 35  CYS B N    4  
ATOM   8000  C CA   . CYS B 1 35 ? -0.624  -5.528  7.967   1.00 0.34 ? 35  CYS B CA   4  
ATOM   8001  C C    . CYS B 1 35 ? -1.797  -5.960  8.855   1.00 0.39 ? 35  CYS B C    4  
ATOM   8002  O O    . CYS B 1 35 ? -2.855  -6.306  8.378   1.00 0.39 ? 35  CYS B O    4  
ATOM   8003  C CB   . CYS B 1 35 ? -0.923  -4.173  7.315   1.00 0.32 ? 35  CYS B CB   4  
ATOM   8004  S SG   . CYS B 1 35 ? -1.992  -4.408  5.874   1.00 0.40 ? 35  CYS B SG   4  
ATOM   8005  H H    . CYS B 1 35 ? -0.617  -6.347  5.975   1.00 0.31 ? 35  CYS B H    4  
ATOM   8006  H HA   . CYS B 1 35 ? 0.270   -5.447  8.569   1.00 0.36 ? 35  CYS B HA   4  
ATOM   8007  H HB2  . CYS B 1 35 ? -1.418  -3.531  8.026   1.00 0.45 ? 35  CYS B HB2  4  
ATOM   8008  H HB3  . CYS B 1 35 ? 0.003   -3.714  7.004   1.00 0.35 ? 35  CYS B HB3  4  
ATOM   8009  N N    . SER B 1 36 ? -1.600  -5.969  10.144  1.00 0.44 ? 36  SER B N    4  
ATOM   8010  C CA   . SER B 1 36 ? -2.686  -6.394  11.077  1.00 0.51 ? 36  SER B CA   4  
ATOM   8011  C C    . SER B 1 36 ? -3.867  -5.409  11.054  1.00 0.51 ? 36  SER B C    4  
ATOM   8012  O O    . SER B 1 36 ? -4.531  -5.226  12.054  1.00 0.58 ? 36  SER B O    4  
ATOM   8013  C CB   . SER B 1 36 ? -2.124  -6.470  12.495  1.00 0.59 ? 36  SER B CB   4  
ATOM   8014  O OG   . SER B 1 36 ? -1.239  -7.579  12.592  1.00 1.41 ? 36  SER B OG   4  
ATOM   8015  H H    . SER B 1 36 ? -0.727  -5.705  10.503  1.00 0.45 ? 36  SER B H    4  
ATOM   8016  H HA   . SER B 1 36 ? -3.037  -7.373  10.786  1.00 0.53 ? 36  SER B HA   4  
ATOM   8017  H HB2  . SER B 1 36 ? -1.584  -5.566  12.720  1.00 1.10 ? 36  SER B HB2  4  
ATOM   8018  H HB3  . SER B 1 36 ? -2.939  -6.584  13.198  1.00 1.26 ? 36  SER B HB3  4  
ATOM   8019  H HG   . SER B 1 36 ? -0.947  -7.647  13.503  1.00 1.84 ? 36  SER B HG   4  
ATOM   8020  N N    . GLN B 1 37 ? -4.150  -4.768  9.946   1.00 0.45 ? 37  GLN B N    4  
ATOM   8021  C CA   . GLN B 1 37 ? -5.302  -3.809  9.934   1.00 0.47 ? 37  GLN B CA   4  
ATOM   8022  C C    . GLN B 1 37 ? -5.872  -3.652  8.515   1.00 0.36 ? 37  GLN B C    4  
ATOM   8023  O O    . GLN B 1 37 ? -5.784  -2.585  7.943   1.00 0.35 ? 37  GLN B O    4  
ATOM   8024  C CB   . GLN B 1 37 ? -4.825  -2.445  10.442  1.00 0.55 ? 37  GLN B CB   4  
ATOM   8025  C CG   . GLN B 1 37 ? -3.495  -2.083  9.775   1.00 0.78 ? 37  GLN B CG   4  
ATOM   8026  C CD   . GLN B 1 37 ? -3.073  -0.679  10.208  1.00 0.79 ? 37  GLN B CD   4  
ATOM   8027  O OE1  . GLN B 1 37 ? -3.907  0.176   10.437  1.00 1.24 ? 37  GLN B OE1  4  
ATOM   8028  N NE2  . GLN B 1 37 ? -1.804  -0.401  10.330  1.00 1.48 ? 37  GLN B NE2  4  
ATOM   8029  H H    . GLN B 1 37 ? -3.619  -4.912  9.136   1.00 0.41 ? 37  GLN B H    4  
ATOM   8030  H HA   . GLN B 1 37 ? -6.085  -4.173  10.587  1.00 0.54 ? 37  GLN B HA   4  
ATOM   8031  H HB2  . GLN B 1 37 ? -5.564  -1.693  10.204  1.00 0.86 ? 37  GLN B HB2  4  
ATOM   8032  H HB3  . GLN B 1 37 ? -4.688  -2.488  11.512  1.00 1.06 ? 37  GLN B HB3  4  
ATOM   8033  H HG2  . GLN B 1 37 ? -2.738  -2.795  10.072  1.00 1.28 ? 37  GLN B HG2  4  
ATOM   8034  H HG3  . GLN B 1 37 ? -3.610  -2.107  8.702   1.00 1.14 ? 37  GLN B HG3  4  
ATOM   8035  H HE21 . GLN B 1 37 ? -1.132  -1.089  10.146  1.00 2.20 ? 37  GLN B HE21 4  
ATOM   8036  H HE22 . GLN B 1 37 ? -1.524  0.497   10.608  1.00 1.54 ? 37  GLN B HE22 4  
ATOM   8037  N N    . PRO B 1 38 ? -6.461  -4.705  7.991   1.00 0.34 ? 38  PRO B N    4  
ATOM   8038  C CA   . PRO B 1 38 ? -7.065  -4.661  6.645   1.00 0.26 ? 38  PRO B CA   4  
ATOM   8039  C C    . PRO B 1 38 ? -8.327  -3.784  6.685   1.00 0.25 ? 38  PRO B C    4  
ATOM   8040  O O    . PRO B 1 38 ? -8.725  -3.292  7.721   1.00 0.27 ? 38  PRO B O    4  
ATOM   8041  C CB   . PRO B 1 38 ? -7.420  -6.132  6.326   1.00 0.33 ? 38  PRO B CB   4  
ATOM   8042  C CG   . PRO B 1 38 ? -7.208  -6.955  7.631   1.00 0.43 ? 38  PRO B CG   4  
ATOM   8043  C CD   . PRO B 1 38 ? -6.565  -6.013  8.675   1.00 0.43 ? 38  PRO B CD   4  
ATOM   8044  H HA   . PRO B 1 38 ? -6.361  -4.275  5.915   1.00 0.23 ? 38  PRO B HA   4  
ATOM   8045  H HB2  . PRO B 1 38 ? -8.451  -6.212  5.998   1.00 0.32 ? 38  PRO B HB2  4  
ATOM   8046  H HB3  . PRO B 1 38 ? -6.765  -6.508  5.552   1.00 0.34 ? 38  PRO B HB3  4  
ATOM   8047  H HG2  . PRO B 1 38 ? -8.162  -7.318  7.996   1.00 0.50 ? 38  PRO B HG2  4  
ATOM   8048  H HG3  . PRO B 1 38 ? -6.550  -7.793  7.440   1.00 0.48 ? 38  PRO B HG3  4  
ATOM   8049  H HD2  . PRO B 1 38 ? -7.196  -5.933  9.551   1.00 0.50 ? 38  PRO B HD2  4  
ATOM   8050  H HD3  . PRO B 1 38 ? -5.584  -6.368  8.951   1.00 0.45 ? 38  PRO B HD3  4  
ATOM   8051  N N    . ALA B 1 39 ? -8.952  -3.601  5.562   1.00 0.23 ? 39  ALA B N    4  
ATOM   8052  C CA   . ALA B 1 39 ? -10.186 -2.780  5.500   1.00 0.22 ? 39  ALA B CA   4  
ATOM   8053  C C    . ALA B 1 39 ? -10.835 -3.013  4.140   1.00 0.19 ? 39  ALA B C    4  
ATOM   8054  O O    . ALA B 1 39 ? -10.236 -3.597  3.258   1.00 0.22 ? 39  ALA B O    4  
ATOM   8055  C CB   . ALA B 1 39 ? -9.830  -1.299  5.648   1.00 0.23 ? 39  ALA B CB   4  
ATOM   8056  H H    . ALA B 1 39 ? -8.615  -4.015  4.748   1.00 0.23 ? 39  ALA B H    4  
ATOM   8057  H HA   . ALA B 1 39 ? -10.862 -3.077  6.285   1.00 0.24 ? 39  ALA B HA   4  
ATOM   8058  H HB1  . ALA B 1 39 ? -9.266  -1.153  6.557   1.00 1.03 ? 39  ALA B HB1  4  
ATOM   8059  H HB2  . ALA B 1 39 ? -9.238  -0.984  4.803   1.00 0.99 ? 39  ALA B HB2  4  
ATOM   8060  H HB3  . ALA B 1 39 ? -10.737 -0.714  5.691   1.00 1.03 ? 39  ALA B HB3  4  
ATOM   8061  N N    . VAL B 1 40 ? -12.040 -2.551  3.944   1.00 0.15 ? 40  VAL B N    4  
ATOM   8062  C CA   . VAL B 1 40 ? -12.702 -2.739  2.618   1.00 0.13 ? 40  VAL B CA   4  
ATOM   8063  C C    . VAL B 1 40 ? -12.505 -1.456  1.819   1.00 0.13 ? 40  VAL B C    4  
ATOM   8064  O O    . VAL B 1 40 ? -12.520 -0.369  2.364   1.00 0.18 ? 40  VAL B O    4  
ATOM   8065  C CB   . VAL B 1 40 ? -14.199 -3.014  2.815   1.00 0.12 ? 40  VAL B CB   4  
ATOM   8066  C CG1  . VAL B 1 40 ? -14.948 -2.802  1.494   1.00 0.12 ? 40  VAL B CG1  4  
ATOM   8067  C CG2  . VAL B 1 40 ? -14.387 -4.463  3.265   1.00 0.16 ? 40  VAL B CG2  4  
ATOM   8068  H H    . VAL B 1 40 ? -12.505 -2.066  4.662   1.00 0.14 ? 40  VAL B H    4  
ATOM   8069  H HA   . VAL B 1 40 ? -12.247 -3.571  2.084   1.00 0.16 ? 40  VAL B HA   4  
ATOM   8070  H HB   . VAL B 1 40 ? -14.595 -2.347  3.566   1.00 0.11 ? 40  VAL B HB   4  
ATOM   8071  H HG11 . VAL B 1 40 ? -14.385 -3.248  0.689   1.00 1.02 ? 40  VAL B HG11 4  
ATOM   8072  H HG12 . VAL B 1 40 ? -15.924 -3.262  1.550   1.00 1.00 ? 40  VAL B HG12 4  
ATOM   8073  H HG13 . VAL B 1 40 ? -15.059 -1.743  1.310   1.00 1.04 ? 40  VAL B HG13 4  
ATOM   8074  H HG21 . VAL B 1 40 ? -13.762 -4.656  4.123   1.00 1.06 ? 40  VAL B HG21 4  
ATOM   8075  H HG22 . VAL B 1 40 ? -15.421 -4.628  3.524   1.00 1.01 ? 40  VAL B HG22 4  
ATOM   8076  H HG23 . VAL B 1 40 ? -14.108 -5.125  2.458   1.00 0.99 ? 40  VAL B HG23 4  
ATOM   8077  N N    . VAL B 1 41 ? -12.308 -1.578  0.533   1.00 0.15 ? 41  VAL B N    4  
ATOM   8078  C CA   . VAL B 1 41 ? -12.091 -0.369  -0.324  1.00 0.16 ? 41  VAL B CA   4  
ATOM   8079  C C    . VAL B 1 41 ? -13.181 -0.298  -1.396  1.00 0.16 ? 41  VAL B C    4  
ATOM   8080  O O    . VAL B 1 41 ? -13.315 -1.178  -2.215  1.00 0.18 ? 41  VAL B O    4  
ATOM   8081  C CB   . VAL B 1 41 ? -10.712 -0.460  -0.987  1.00 0.21 ? 41  VAL B CB   4  
ATOM   8082  C CG1  . VAL B 1 41 ? -10.286 0.925   -1.474  1.00 0.25 ? 41  VAL B CG1  4  
ATOM   8083  C CG2  . VAL B 1 41 ? -9.690  -0.968  0.034   1.00 0.23 ? 41  VAL B CG2  4  
ATOM   8084  H H    . VAL B 1 41 ? -12.295 -2.470  0.130   1.00 0.20 ? 41  VAL B H    4  
ATOM   8085  H HA   . VAL B 1 41 ? -12.134 0.517   0.280   1.00 0.15 ? 41  VAL B HA   4  
ATOM   8086  H HB   . VAL B 1 41 ? -10.755 -1.137  -1.826  1.00 0.22 ? 41  VAL B HB   4  
ATOM   8087  H HG11 . VAL B 1 41 ? -10.270 1.610   -0.640  1.00 1.08 ? 41  VAL B HG11 4  
ATOM   8088  H HG12 . VAL B 1 41 ? -9.300  0.863   -1.906  1.00 1.04 ? 41  VAL B HG12 4  
ATOM   8089  H HG13 . VAL B 1 41 ? -10.988 1.276   -2.215  1.00 0.99 ? 41  VAL B HG13 4  
ATOM   8090  H HG21 . VAL B 1 41 ? -9.700  -0.324  0.903   1.00 1.03 ? 41  VAL B HG21 4  
ATOM   8091  H HG22 . VAL B 1 41 ? -9.942  -1.974  0.330   1.00 1.04 ? 41  VAL B HG22 4  
ATOM   8092  H HG23 . VAL B 1 41 ? -8.705  -0.959  -0.408  1.00 1.06 ? 41  VAL B HG23 4  
ATOM   8093  N N    . PHE B 1 42 ? -13.970 0.744   -1.392  1.00 0.15 ? 42  PHE B N    4  
ATOM   8094  C CA   . PHE B 1 42 ? -15.060 0.855   -2.409  1.00 0.17 ? 42  PHE B CA   4  
ATOM   8095  C C    . PHE B 1 42 ? -14.554 1.587   -3.653  1.00 0.21 ? 42  PHE B C    4  
ATOM   8096  O O    . PHE B 1 42 ? -13.895 2.604   -3.570  1.00 0.23 ? 42  PHE B O    4  
ATOM   8097  C CB   . PHE B 1 42 ? -16.236 1.643   -1.820  1.00 0.16 ? 42  PHE B CB   4  
ATOM   8098  C CG   . PHE B 1 42 ? -17.008 0.779   -0.845  1.00 0.14 ? 42  PHE B CG   4  
ATOM   8099  C CD1  . PHE B 1 42 ? -17.662 -0.387  -1.294  1.00 0.14 ? 42  PHE B CD1  4  
ATOM   8100  C CD2  . PHE B 1 42 ? -17.085 1.147   0.513   1.00 0.13 ? 42  PHE B CD2  4  
ATOM   8101  C CE1  . PHE B 1 42 ? -18.386 -1.183  -0.386  1.00 0.14 ? 42  PHE B CE1  4  
ATOM   8102  C CE2  . PHE B 1 42 ? -17.811 0.353   1.418   1.00 0.14 ? 42  PHE B CE2  4  
ATOM   8103  C CZ   . PHE B 1 42 ? -18.461 -0.813  0.970   1.00 0.14 ? 42  PHE B CZ   4  
ATOM   8104  H H    . PHE B 1 42 ? -13.854 1.445   -0.718  1.00 0.15 ? 42  PHE B H    4  
ATOM   8105  H HA   . PHE B 1 42 ? -15.396 -0.131  -2.689  1.00 0.17 ? 42  PHE B HA   4  
ATOM   8106  H HB2  . PHE B 1 42 ? -15.860 2.518   -1.311  1.00 0.16 ? 42  PHE B HB2  4  
ATOM   8107  H HB3  . PHE B 1 42 ? -16.897 1.952   -2.618  1.00 0.18 ? 42  PHE B HB3  4  
ATOM   8108  H HD1  . PHE B 1 42 ? -17.608 -0.673  -2.333  1.00 0.16 ? 42  PHE B HD1  4  
ATOM   8109  H HD2  . PHE B 1 42 ? -16.586 2.040   0.861   1.00 0.14 ? 42  PHE B HD2  4  
ATOM   8110  H HE1  . PHE B 1 42 ? -18.885 -2.077  -0.730  1.00 0.16 ? 42  PHE B HE1  4  
ATOM   8111  H HE2  . PHE B 1 42 ? -17.869 0.638   2.456   1.00 0.16 ? 42  PHE B HE2  4  
ATOM   8112  H HZ   . PHE B 1 42 ? -19.020 -1.422  1.665   1.00 0.16 ? 42  PHE B HZ   4  
ATOM   8113  N N    . GLN B 1 43 ? -14.894 1.085   -4.811  1.00 0.24 ? 43  GLN B N    4  
ATOM   8114  C CA   . GLN B 1 43 ? -14.482 1.745   -6.084  1.00 0.28 ? 43  GLN B CA   4  
ATOM   8115  C C    . GLN B 1 43 ? -15.669 2.588   -6.560  1.00 0.30 ? 43  GLN B C    4  
ATOM   8116  O O    . GLN B 1 43 ? -16.759 2.070   -6.733  1.00 0.30 ? 43  GLN B O    4  
ATOM   8117  C CB   . GLN B 1 43 ? -14.144 0.669   -7.116  1.00 0.32 ? 43  GLN B CB   4  
ATOM   8118  C CG   . GLN B 1 43 ? -12.931 -0.132  -6.640  1.00 0.32 ? 43  GLN B CG   4  
ATOM   8119  C CD   . GLN B 1 43 ? -12.806 -1.413  -7.469  1.00 0.58 ? 43  GLN B CD   4  
ATOM   8120  O OE1  . GLN B 1 43 ? -12.402 -2.441  -6.963  1.00 1.29 ? 43  GLN B OE1  4  
ATOM   8121  N NE2  . GLN B 1 43 ? -13.136 -1.392  -8.731  1.00 1.31 ? 43  GLN B NE2  4  
ATOM   8122  H H    . GLN B 1 43 ? -15.447 0.277   -4.844  1.00 0.23 ? 43  GLN B H    4  
ATOM   8123  H HA   . GLN B 1 43 ? -13.626 2.378   -5.913  1.00 0.29 ? 43  GLN B HA   4  
ATOM   8124  H HB2  . GLN B 1 43 ? -14.989 0.010   -7.232  1.00 0.32 ? 43  GLN B HB2  4  
ATOM   8125  H HB3  . GLN B 1 43 ? -13.915 1.130   -8.060  1.00 0.36 ? 43  GLN B HB3  4  
ATOM   8126  H HG2  . GLN B 1 43 ? -12.039 0.463   -6.760  1.00 0.36 ? 43  GLN B HG2  4  
ATOM   8127  H HG3  . GLN B 1 43 ? -13.053 -0.390  -5.600  1.00 0.40 ? 43  GLN B HG3  4  
ATOM   8128  H HE21 . GLN B 1 43 ? -13.461 -0.563  -9.139  1.00 2.01 ? 43  GLN B HE21 4  
ATOM   8129  H HE22 . GLN B 1 43 ? -13.059 -2.207  -9.270  1.00 1.45 ? 43  GLN B HE22 4  
ATOM   8130  N N    . THR B 1 44 ? -15.497 3.887   -6.729  1.00 0.32 ? 44  THR B N    4  
ATOM   8131  C CA   . THR B 1 44 ? -16.669 4.740   -7.135  1.00 0.34 ? 44  THR B CA   4  
ATOM   8132  C C    . THR B 1 44 ? -16.678 5.027   -8.635  1.00 0.39 ? 44  THR B C    4  
ATOM   8133  O O    . THR B 1 44 ? -16.100 4.312   -9.429  1.00 0.41 ? 44  THR B O    4  
ATOM   8134  C CB   . THR B 1 44 ? -16.605 6.070   -6.386  1.00 0.34 ? 44  THR B CB   4  
ATOM   8135  O OG1  . THR B 1 44 ? -15.708 6.940   -7.057  1.00 0.38 ? 44  THR B OG1  4  
ATOM   8136  C CG2  . THR B 1 44 ? -16.108 5.824   -4.961  1.00 0.29 ? 44  THR B CG2  4  
ATOM   8137  H H    . THR B 1 44 ? -14.611 4.305   -6.557  1.00 0.32 ? 44  THR B H    4  
ATOM   8138  H HA   . THR B 1 44 ? -17.591 4.242   -6.870  1.00 0.33 ? 44  THR B HA   4  
ATOM   8139  H HB   . THR B 1 44 ? -17.587 6.517   -6.351  1.00 0.35 ? 44  THR B HB   4  
ATOM   8140  H HG1  . THR B 1 44 ? -15.019 6.405   -7.456  1.00 0.77 ? 44  THR B HG1  4  
ATOM   8141  H HG21 . THR B 1 44 ? -16.602 4.954   -4.551  1.00 1.07 ? 44  THR B HG21 4  
ATOM   8142  H HG22 . THR B 1 44 ? -15.043 5.656   -4.981  1.00 1.03 ? 44  THR B HG22 4  
ATOM   8143  H HG23 . THR B 1 44 ? -16.326 6.683   -4.348  1.00 1.00 ? 44  THR B HG23 4  
ATOM   8144  N N    . LYS B 1 45 ? -17.361 6.082   -9.013  1.00 0.43 ? 45  LYS B N    4  
ATOM   8145  C CA   . LYS B 1 45 ? -17.469 6.468   -10.453 1.00 0.48 ? 45  LYS B CA   4  
ATOM   8146  C C    . LYS B 1 45 ? -16.729 7.788   -10.697 1.00 0.51 ? 45  LYS B C    4  
ATOM   8147  O O    . LYS B 1 45 ? -16.355 8.093   -11.812 1.00 0.56 ? 45  LYS B O    4  
ATOM   8148  C CB   . LYS B 1 45 ? -18.950 6.662   -10.810 1.00 0.50 ? 45  LYS B CB   4  
ATOM   8149  C CG   . LYS B 1 45 ? -19.785 5.517   -10.234 1.00 0.46 ? 45  LYS B CG   4  
ATOM   8150  C CD   . LYS B 1 45 ? -21.259 5.741   -10.587 1.00 0.49 ? 45  LYS B CD   4  
ATOM   8151  C CE   . LYS B 1 45 ? -22.084 4.519   -10.174 1.00 0.54 ? 45  LYS B CE   4  
ATOM   8152  N NZ   . LYS B 1 45 ? -23.523 4.898   -10.090 1.00 1.55 ? 45  LYS B NZ   4  
ATOM   8153  H H    . LYS B 1 45 ? -17.822 6.623   -8.338  1.00 0.44 ? 45  LYS B H    4  
ATOM   8154  H HA   . LYS B 1 45 ? -17.047 5.695   -11.080 1.00 0.49 ? 45  LYS B HA   4  
ATOM   8155  H HB2  . LYS B 1 45 ? -19.300 7.599   -10.399 1.00 0.51 ? 45  LYS B HB2  4  
ATOM   8156  H HB3  . LYS B 1 45 ? -19.061 6.679   -11.881 1.00 0.57 ? 45  LYS B HB3  4  
ATOM   8157  H HG2  . LYS B 1 45 ? -19.449 4.582   -10.657 1.00 0.50 ? 45  LYS B HG2  4  
ATOM   8158  H HG3  . LYS B 1 45 ? -19.675 5.491   -9.161  1.00 0.42 ? 45  LYS B HG3  4  
ATOM   8159  H HD2  . LYS B 1 45 ? -21.624 6.613   -10.064 1.00 0.51 ? 45  LYS B HD2  4  
ATOM   8160  H HD3  . LYS B 1 45 ? -21.355 5.894   -11.651 1.00 0.63 ? 45  LYS B HD3  4  
ATOM   8161  H HE2  . LYS B 1 45 ? -21.962 3.738   -10.909 1.00 0.95 ? 45  LYS B HE2  4  
ATOM   8162  H HE3  . LYS B 1 45 ? -21.749 4.162   -9.210  1.00 1.20 ? 45  LYS B HE3  4  
ATOM   8163  H HZ1  . LYS B 1 45 ? -23.612 5.933   -10.140 1.00 2.09 ? 45  LYS B HZ1  4  
ATOM   8164  H HZ2  . LYS B 1 45 ? -24.042 4.465   -10.881 1.00 2.04 ? 45  LYS B HZ2  4  
ATOM   8165  H HZ3  . LYS B 1 45 ? -23.919 4.561   -9.190  1.00 2.16 ? 45  LYS B HZ3  4  
ATOM   8166  N N    . ARG B 1 46 ? -16.529 8.581   -9.667  1.00 0.50 ? 46  ARG B N    4  
ATOM   8167  C CA   . ARG B 1 46 ? -15.826 9.897   -9.841  1.00 0.54 ? 46  ARG B CA   4  
ATOM   8168  C C    . ARG B 1 46 ? -14.664 9.966   -8.844  1.00 0.49 ? 46  ARG B C    4  
ATOM   8169  O O    . ARG B 1 46 ? -14.487 10.930  -8.130  1.00 0.48 ? 46  ARG B O    4  
ATOM   8170  C CB   . ARG B 1 46 ? -16.833 11.038  -9.580  1.00 0.59 ? 46  ARG B CB   4  
ATOM   8171  C CG   . ARG B 1 46 ? -16.396 12.348  -10.275 1.00 0.72 ? 46  ARG B CG   4  
ATOM   8172  C CD   . ARG B 1 46 ? -15.278 13.054  -9.497  1.00 0.92 ? 46  ARG B CD   4  
ATOM   8173  N NE   . ARG B 1 46 ? -15.223 14.484  -9.911  1.00 1.48 ? 46  ARG B NE   4  
ATOM   8174  C CZ   . ARG B 1 46 ? -14.565 15.348  -9.189  1.00 2.13 ? 46  ARG B CZ   4  
ATOM   8175  N NH1  . ARG B 1 46 ? -13.955 14.960  -8.102  1.00 2.62 ? 46  ARG B NH1  4  
ATOM   8176  N NH2  . ARG B 1 46 ? -14.517 16.601  -9.553  1.00 2.82 ? 46  ARG B NH2  4  
ATOM   8177  H H    . ARG B 1 46 ? -16.850 8.316   -8.779  1.00 0.48 ? 46  ARG B H    4  
ATOM   8178  H HA   . ARG B 1 46 ? -15.433 9.979   -10.845 1.00 0.59 ? 46  ARG B HA   4  
ATOM   8179  H HB2  . ARG B 1 46 ? -17.797 10.745  -9.967  1.00 0.68 ? 46  ARG B HB2  4  
ATOM   8180  H HB3  . ARG B 1 46 ? -16.918 11.205  -8.517  1.00 0.53 ? 46  ARG B HB3  4  
ATOM   8181  H HG2  . ARG B 1 46 ? -16.050 12.131  -11.274 1.00 0.90 ? 46  ARG B HG2  4  
ATOM   8182  H HG3  . ARG B 1 46 ? -17.248 13.009  -10.337 1.00 1.21 ? 46  ARG B HG3  4  
ATOM   8183  H HD2  . ARG B 1 46 ? -15.475 12.999  -8.437  1.00 1.48 ? 46  ARG B HD2  4  
ATOM   8184  H HD3  . ARG B 1 46 ? -14.331 12.584  -9.719  1.00 1.01 ? 46  ARG B HD3  4  
ATOM   8185  H HE   . ARG B 1 46 ? -15.683 14.775  -10.727 1.00 1.94 ? 46  ARG B HE   4  
ATOM   8186  H HH11 . ARG B 1 46 ? -13.992 14.002  -7.823  1.00 2.46 ? 46  ARG B HH11 4  
ATOM   8187  H HH12 . ARG B 1 46 ? -13.450 15.623  -7.549  1.00 3.45 ? 46  ARG B HH12 4  
ATOM   8188  H HH21 . ARG B 1 46 ? -14.985 16.898  -10.385 1.00 2.97 ? 46  ARG B HH21 4  
ATOM   8189  H HH22 . ARG B 1 46 ? -14.012 17.263  -8.999  1.00 3.45 ? 46  ARG B HH22 4  
ATOM   8190  N N    . SER B 1 47 ? -13.864 8.941   -8.799  1.00 0.46 ? 47  SER B N    4  
ATOM   8191  C CA   . SER B 1 47 ? -12.701 8.925   -7.881  1.00 0.42 ? 47  SER B CA   4  
ATOM   8192  C C    . SER B 1 47 ? -11.834 7.729   -8.253  1.00 0.42 ? 47  SER B C    4  
ATOM   8193  O O    . SER B 1 47 ? -11.382 7.601   -9.374  1.00 0.46 ? 47  SER B O    4  
ATOM   8194  C CB   . SER B 1 47 ? -13.166 8.820   -6.421  1.00 0.38 ? 47  SER B CB   4  
ATOM   8195  O OG   . SER B 1 47 ? -13.649 7.510   -6.167  1.00 1.07 ? 47  SER B OG   4  
ATOM   8196  H H    . SER B 1 47 ? -14.022 8.171   -9.382  1.00 0.47 ? 47  SER B H    4  
ATOM   8197  H HA   . SER B 1 47 ? -12.133 9.827   -8.012  1.00 0.44 ? 47  SER B HA   4  
ATOM   8198  H HB2  . SER B 1 47 ? -12.336 9.024   -5.762  1.00 0.76 ? 47  SER B HB2  4  
ATOM   8199  H HB3  . SER B 1 47 ? -13.949 9.546   -6.240  1.00 0.86 ? 47  SER B HB3  4  
ATOM   8200  H HG   . SER B 1 47 ? -13.353 7.249   -5.292  1.00 1.44 ? 47  SER B HG   4  
ATOM   8201  N N    . LYS B 1 48 ? -11.620 6.842   -7.339  1.00 0.38 ? 48  LYS B N    4  
ATOM   8202  C CA   . LYS B 1 48 ? -10.809 5.638   -7.640  1.00 0.40 ? 48  LYS B CA   4  
ATOM   8203  C C    . LYS B 1 48 ? -11.100 4.596   -6.563  1.00 0.35 ? 48  LYS B C    4  
ATOM   8204  O O    . LYS B 1 48 ? -12.035 3.834   -6.676  1.00 0.34 ? 48  LYS B O    4  
ATOM   8205  C CB   . LYS B 1 48 ? -9.302  5.978   -7.703  1.00 0.44 ? 48  LYS B CB   4  
ATOM   8206  C CG   . LYS B 1 48 ? -8.941  7.142   -6.762  1.00 1.11 ? 48  LYS B CG   4  
ATOM   8207  C CD   . LYS B 1 48 ? -7.491  7.577   -7.027  1.00 1.38 ? 48  LYS B CD   4  
ATOM   8208  C CE   . LYS B 1 48 ? -6.540  6.382   -6.891  1.00 2.13 ? 48  LYS B CE   4  
ATOM   8209  N NZ   . LYS B 1 48 ? -5.161  6.876   -6.618  1.00 2.73 ? 48  LYS B NZ   4  
ATOM   8210  H H    . LYS B 1 48 ? -12.021 6.952   -6.456  1.00 0.36 ? 48  LYS B H    4  
ATOM   8211  H HA   . LYS B 1 48 ? -11.125 5.240   -8.596  1.00 0.43 ? 48  LYS B HA   4  
ATOM   8212  H HB2  . LYS B 1 48 ? -8.731  5.109   -7.427  1.00 0.92 ? 48  LYS B HB2  4  
ATOM   8213  H HB3  . LYS B 1 48 ? -9.047  6.256   -8.716  1.00 0.85 ? 48  LYS B HB3  4  
ATOM   8214  H HG2  . LYS B 1 48 ? -9.598  7.977   -6.946  1.00 1.64 ? 48  LYS B HG2  4  
ATOM   8215  H HG3  . LYS B 1 48 ? -9.035  6.828   -5.736  1.00 1.69 ? 48  LYS B HG3  4  
ATOM   8216  H HD2  . LYS B 1 48 ? -7.416  7.981   -8.026  1.00 1.70 ? 48  LYS B HD2  4  
ATOM   8217  H HD3  . LYS B 1 48 ? -7.208  8.336   -6.314  1.00 1.63 ? 48  LYS B HD3  4  
ATOM   8218  H HE2  . LYS B 1 48 ? -6.863  5.750   -6.076  1.00 2.60 ? 48  LYS B HE2  4  
ATOM   8219  H HE3  . LYS B 1 48 ? -6.542  5.813   -7.810  1.00 2.56 ? 48  LYS B HE3  4  
ATOM   8220  H HZ1  . LYS B 1 48 ? -5.161  7.915   -6.610  1.00 3.07 ? 48  LYS B HZ1  4  
ATOM   8221  H HZ2  . LYS B 1 48 ? -4.843  6.524   -5.693  1.00 3.23 ? 48  LYS B HZ2  4  
ATOM   8222  H HZ3  . LYS B 1 48 ? -4.518  6.534   -7.361  1.00 3.01 ? 48  LYS B HZ3  4  
ATOM   8223  N N    . GLN B 1 49 ? -10.318 4.577   -5.509  1.00 0.33 ? 49  GLN B N    4  
ATOM   8224  C CA   . GLN B 1 49 ? -10.546 3.602   -4.395  1.00 0.30 ? 49  GLN B CA   4  
ATOM   8225  C C    . GLN B 1 49 ? -10.808 4.395   -3.099  1.00 0.25 ? 49  GLN B C    4  
ATOM   8226  O O    . GLN B 1 49 ? -10.263 5.465   -2.887  1.00 0.26 ? 49  GLN B O    4  
ATOM   8227  C CB   . GLN B 1 49 ? -9.301  2.688   -4.227  1.00 0.35 ? 49  GLN B CB   4  
ATOM   8228  C CG   . GLN B 1 49 ? -8.431  2.715   -5.487  1.00 0.82 ? 49  GLN B CG   4  
ATOM   8229  C CD   . GLN B 1 49 ? -9.232  2.185   -6.678  1.00 0.89 ? 49  GLN B CD   4  
ATOM   8230  O OE1  . GLN B 1 49 ? -9.439  2.884   -7.648  1.00 1.53 ? 49  GLN B OE1  4  
ATOM   8231  N NE2  . GLN B 1 49 ? -9.693  0.964   -6.644  1.00 1.52 ? 49  GLN B NE2  4  
ATOM   8232  H H    . GLN B 1 49 ? -9.584  5.216   -5.444  1.00 0.36 ? 49  GLN B H    4  
ATOM   8233  H HA   . GLN B 1 49 ? -11.414 2.991   -4.611  1.00 0.32 ? 49  GLN B HA   4  
ATOM   8234  H HB2  . GLN B 1 49 ? -8.708  3.019   -3.388  1.00 0.76 ? 49  GLN B HB2  4  
ATOM   8235  H HB3  . GLN B 1 49 ? -9.623  1.672   -4.052  1.00 0.86 ? 49  GLN B HB3  4  
ATOM   8236  H HG2  . GLN B 1 49 ? -8.106  3.724   -5.683  1.00 1.46 ? 49  GLN B HG2  4  
ATOM   8237  H HG3  . GLN B 1 49 ? -7.565  2.086   -5.336  1.00 1.32 ? 49  GLN B HG3  4  
ATOM   8238  H HE21 . GLN B 1 49 ? -9.523  0.399   -5.862  1.00 2.12 ? 49  GLN B HE21 4  
ATOM   8239  H HE22 . GLN B 1 49 ? -10.206 0.614   -7.400  1.00 1.80 ? 49  GLN B HE22 4  
ATOM   8240  N N    . VAL B 1 50 ? -11.649 3.880   -2.234  1.00 0.23 ? 50  VAL B N    4  
ATOM   8241  C CA   . VAL B 1 50 ? -11.958 4.593   -0.954  1.00 0.19 ? 50  VAL B CA   4  
ATOM   8242  C C    . VAL B 1 50 ? -12.002 3.585   0.185   1.00 0.16 ? 50  VAL B C    4  
ATOM   8243  O O    . VAL B 1 50 ? -12.781 2.660   0.167   1.00 0.15 ? 50  VAL B O    4  
ATOM   8244  C CB   . VAL B 1 50 ? -13.317 5.286   -1.068  1.00 0.22 ? 50  VAL B CB   4  
ATOM   8245  C CG1  . VAL B 1 50 ? -13.509 6.228   0.121   1.00 0.24 ? 50  VAL B CG1  4  
ATOM   8246  C CG2  . VAL B 1 50 ? -13.367 6.076   -2.379  1.00 0.31 ? 50  VAL B CG2  4  
ATOM   8247  H H    . VAL B 1 50 ? -12.080 3.022   -2.429  1.00 0.26 ? 50  VAL B H    4  
ATOM   8248  H HA   . VAL B 1 50 ? -11.196 5.331   -0.745  1.00 0.20 ? 50  VAL B HA   4  
ATOM   8249  H HB   . VAL B 1 50 ? -14.103 4.544   -1.065  1.00 0.24 ? 50  VAL B HB   4  
ATOM   8250  H HG11 . VAL B 1 50 ? -12.671 6.905   0.182   1.00 1.03 ? 50  VAL B HG11 4  
ATOM   8251  H HG12 . VAL B 1 50 ? -14.421 6.793   -0.007  1.00 1.07 ? 50  VAL B HG12 4  
ATOM   8252  H HG13 . VAL B 1 50 ? -13.570 5.650   1.031   1.00 1.04 ? 50  VAL B HG13 4  
ATOM   8253  H HG21 . VAL B 1 50 ? -12.412 6.548   -2.553  1.00 1.02 ? 50  VAL B HG21 4  
ATOM   8254  H HG22 . VAL B 1 50 ? -13.583 5.400   -3.190  1.00 1.09 ? 50  VAL B HG22 4  
ATOM   8255  H HG23 . VAL B 1 50 ? -14.139 6.829   -2.322  1.00 1.10 ? 50  VAL B HG23 4  
ATOM   8256  N N    . CYS B 1 51 ? -11.175 3.762   1.176   1.00 0.16 ? 51  CYS B N    4  
ATOM   8257  C CA   . CYS B 1 51 ? -11.158 2.808   2.315   1.00 0.15 ? 51  CYS B CA   4  
ATOM   8258  C C    . CYS B 1 51 ? -12.416 2.998   3.160   1.00 0.14 ? 51  CYS B C    4  
ATOM   8259  O O    . CYS B 1 51 ? -12.968 4.076   3.240   1.00 0.16 ? 51  CYS B O    4  
ATOM   8260  C CB   . CYS B 1 51 ? -9.922  3.076   3.170   1.00 0.17 ? 51  CYS B CB   4  
ATOM   8261  S SG   . CYS B 1 51 ? -8.433  2.733   2.200   1.00 0.21 ? 51  CYS B SG   4  
ATOM   8262  H H    . CYS B 1 51 ? -10.559 4.523   1.167   1.00 0.19 ? 51  CYS B H    4  
ATOM   8263  H HA   . CYS B 1 51 ? -11.123 1.795   1.942   1.00 0.15 ? 51  CYS B HA   4  
ATOM   8264  H HB2  . CYS B 1 51 ? -9.917  4.110   3.483   1.00 0.19 ? 51  CYS B HB2  4  
ATOM   8265  H HB3  . CYS B 1 51 ? -9.940  2.438   4.038   1.00 0.18 ? 51  CYS B HB3  4  
ATOM   8266  N N    . ALA B 1 52 ? -12.880 1.945   3.784   1.00 0.12 ? 52  ALA B N    4  
ATOM   8267  C CA   . ALA B 1 52 ? -14.113 2.042   4.620   1.00 0.13 ? 52  ALA B CA   4  
ATOM   8268  C C    . ALA B 1 52 ? -13.955 1.163   5.862   1.00 0.15 ? 52  ALA B C    4  
ATOM   8269  O O    . ALA B 1 52 ? -13.503 0.035   5.786   1.00 0.15 ? 52  ALA B O    4  
ATOM   8270  C CB   . ALA B 1 52 ? -15.313 1.550   3.807   1.00 0.11 ? 52  ALA B CB   4  
ATOM   8271  H H    . ALA B 1 52 ? -12.419 1.085   3.693   1.00 0.13 ? 52  ALA B H    4  
ATOM   8272  H HA   . ALA B 1 52 ? -14.278 3.069   4.920   1.00 0.14 ? 52  ALA B HA   4  
ATOM   8273  H HB1  . ALA B 1 52 ? -15.306 2.020   2.834   1.00 1.01 ? 52  ALA B HB1  4  
ATOM   8274  H HB2  . ALA B 1 52 ? -15.251 0.477   3.688   1.00 1.04 ? 52  ALA B HB2  4  
ATOM   8275  H HB3  . ALA B 1 52 ? -16.227 1.803   4.323   1.00 1.02 ? 52  ALA B HB3  4  
ATOM   8276  N N    . ASP B 1 53 ? -14.324 1.674   7.007   1.00 0.18 ? 53  ASP B N    4  
ATOM   8277  C CA   . ASP B 1 53 ? -14.197 0.877   8.260   1.00 0.22 ? 53  ASP B CA   4  
ATOM   8278  C C    . ASP B 1 53 ? -15.206 -0.298  8.224   1.00 0.21 ? 53  ASP B C    4  
ATOM   8279  O O    . ASP B 1 53 ? -16.395 -0.050  8.187   1.00 0.22 ? 53  ASP B O    4  
ATOM   8280  C CB   . ASP B 1 53 ? -14.530 1.778   9.451   1.00 0.27 ? 53  ASP B CB   4  
ATOM   8281  C CG   . ASP B 1 53 ? -14.114 1.085   10.751  1.00 1.35 ? 53  ASP B CG   4  
ATOM   8282  O OD1  . ASP B 1 53 ? -13.264 0.213   10.687  1.00 2.17 ? 53  ASP B OD1  4  
ATOM   8283  O OD2  . ASP B 1 53 ? -14.654 1.437   11.786  1.00 2.10 ? 53  ASP B OD2  4  
ATOM   8284  H H    . ASP B 1 53 ? -14.684 2.586   7.040   1.00 0.19 ? 53  ASP B H    4  
ATOM   8285  H HA   . ASP B 1 53 ? -13.187 0.531   8.352   1.00 0.22 ? 53  ASP B HA   4  
ATOM   8286  H HB2  . ASP B 1 53 ? -13.997 2.714   9.355   1.00 1.05 ? 53  ASP B HB2  4  
ATOM   8287  H HB3  . ASP B 1 53 ? -15.592 1.971   9.472   1.00 1.03 ? 53  ASP B HB3  4  
ATOM   8288  N N    . PRO B 1 54 ? -14.744 -1.545  8.236   1.00 0.22 ? 54  PRO B N    4  
ATOM   8289  C CA   . PRO B 1 54 ? -15.678 -2.693  8.203   1.00 0.24 ? 54  PRO B CA   4  
ATOM   8290  C C    . PRO B 1 54 ? -16.597 -2.670  9.434   1.00 0.28 ? 54  PRO B C    4  
ATOM   8291  O O    . PRO B 1 54 ? -17.511 -3.461  9.552   1.00 0.30 ? 54  PRO B O    4  
ATOM   8292  C CB   . PRO B 1 54 ? -14.774 -3.949  8.214   1.00 0.27 ? 54  PRO B CB   4  
ATOM   8293  C CG   . PRO B 1 54 ? -13.296 -3.466  8.259   1.00 0.27 ? 54  PRO B CG   4  
ATOM   8294  C CD   . PRO B 1 54 ? -13.310 -1.921  8.278   1.00 0.24 ? 54  PRO B CD   4  
ATOM   8295  H HA   . PRO B 1 54 ? -16.266 -2.668  7.297   1.00 0.21 ? 54  PRO B HA   4  
ATOM   8296  H HB2  . PRO B 1 54 ? -14.990 -4.556  9.086   1.00 0.30 ? 54  PRO B HB2  4  
ATOM   8297  H HB3  . PRO B 1 54 ? -14.940 -4.530  7.316   1.00 0.26 ? 54  PRO B HB3  4  
ATOM   8298  H HG2  . PRO B 1 54 ? -12.810 -3.846  9.153   1.00 0.31 ? 54  PRO B HG2  4  
ATOM   8299  H HG3  . PRO B 1 54 ? -12.765 -3.817  7.385   1.00 0.27 ? 54  PRO B HG3  4  
ATOM   8300  H HD2  . PRO B 1 54 ? -12.849 -1.557  9.187   1.00 0.26 ? 54  PRO B HD2  4  
ATOM   8301  H HD3  . PRO B 1 54 ? -12.797 -1.528  7.410   1.00 0.21 ? 54  PRO B HD3  4  
ATOM   8302  N N    . SER B 1 55 ? -16.349 -1.783  10.355  1.00 0.31 ? 55  SER B N    4  
ATOM   8303  C CA   . SER B 1 55 ? -17.194 -1.727  11.582  1.00 0.36 ? 55  SER B CA   4  
ATOM   8304  C C    . SER B 1 55 ? -18.536 -1.057  11.273  1.00 0.36 ? 55  SER B C    4  
ATOM   8305  O O    . SER B 1 55 ? -19.497 -1.219  11.996  1.00 0.40 ? 55  SER B O    4  
ATOM   8306  C CB   . SER B 1 55 ? -16.464 -0.926  12.662  1.00 0.40 ? 55  SER B CB   4  
ATOM   8307  O OG   . SER B 1 55 ? -17.083 -1.163  13.920  1.00 1.42 ? 55  SER B OG   4  
ATOM   8308  H H    . SER B 1 55 ? -15.597 -1.168  10.247  1.00 0.30 ? 55  SER B H    4  
ATOM   8309  H HA   . SER B 1 55 ? -17.370 -2.731  11.941  1.00 0.39 ? 55  SER B HA   4  
ATOM   8310  H HB2  . SER B 1 55 ? -15.435 -1.238  12.709  1.00 0.99 ? 55  SER B HB2  4  
ATOM   8311  H HB3  . SER B 1 55 ? -16.509 0.127   12.419  1.00 1.11 ? 55  SER B HB3  4  
ATOM   8312  H HG   . SER B 1 55 ? -16.390 -1.336  14.562  1.00 1.89 ? 55  SER B HG   4  
ATOM   8313  N N    . GLU B 1 56 ? -18.615 -0.309  10.206  1.00 0.33 ? 56  GLU B N    4  
ATOM   8314  C CA   . GLU B 1 56 ? -19.906 0.360   9.864   1.00 0.33 ? 56  GLU B CA   4  
ATOM   8315  C C    . GLU B 1 56 ? -20.823 -0.640  9.151   1.00 0.33 ? 56  GLU B C    4  
ATOM   8316  O O    . GLU B 1 56 ? -20.492 -1.184  8.116   1.00 0.29 ? 56  GLU B O    4  
ATOM   8317  C CB   . GLU B 1 56 ? -19.632 1.563   8.957   1.00 0.31 ? 56  GLU B CB   4  
ATOM   8318  C CG   . GLU B 1 56 ? -19.168 2.755   9.800   1.00 0.35 ? 56  GLU B CG   4  
ATOM   8319  C CD   . GLU B 1 56 ? -18.563 3.821   8.887   1.00 1.30 ? 56  GLU B CD   4  
ATOM   8320  O OE1  . GLU B 1 56 ? -18.565 3.614   7.684   1.00 2.01 ? 56  GLU B OE1  4  
ATOM   8321  O OE2  . GLU B 1 56 ? -18.106 4.828   9.404   1.00 2.08 ? 56  GLU B OE2  4  
ATOM   8322  H H    . GLU B 1 56 ? -17.833 -0.189  9.629   1.00 0.30 ? 56  GLU B H    4  
ATOM   8323  H HA   . GLU B 1 56 ? -20.387 0.695   10.773  1.00 0.37 ? 56  GLU B HA   4  
ATOM   8324  H HB2  . GLU B 1 56 ? -18.862 1.303   8.253   1.00 0.28 ? 56  GLU B HB2  4  
ATOM   8325  H HB3  . GLU B 1 56 ? -20.534 1.830   8.428   1.00 0.31 ? 56  GLU B HB3  4  
ATOM   8326  H HG2  . GLU B 1 56 ? -20.013 3.171   10.330  1.00 0.87 ? 56  GLU B HG2  4  
ATOM   8327  H HG3  . GLU B 1 56 ? -18.424 2.426   10.510  1.00 1.00 ? 56  GLU B HG3  4  
ATOM   8328  N N    . SER B 1 57 ? -21.966 -0.894  9.720   1.00 0.37 ? 57  SER B N    4  
ATOM   8329  C CA   . SER B 1 57 ? -22.925 -1.867  9.123   1.00 0.38 ? 57  SER B CA   4  
ATOM   8330  C C    . SER B 1 57 ? -23.169 -1.586  7.636   1.00 0.35 ? 57  SER B C    4  
ATOM   8331  O O    . SER B 1 57 ? -23.257 -2.498  6.838   1.00 0.34 ? 57  SER B O    4  
ATOM   8332  C CB   . SER B 1 57 ? -24.254 -1.784  9.873   1.00 0.44 ? 57  SER B CB   4  
ATOM   8333  O OG   . SER B 1 57 ? -24.068 -2.235  11.209  1.00 1.37 ? 57  SER B OG   4  
ATOM   8334  H H    . SER B 1 57 ? -22.193 -0.448  10.559  1.00 0.41 ? 57  SER B H    4  
ATOM   8335  H HA   . SER B 1 57 ? -22.526 -2.862  9.229   1.00 0.38 ? 57  SER B HA   4  
ATOM   8336  H HB2  . SER B 1 57 ? -24.598 -0.764  9.889   1.00 1.21 ? 57  SER B HB2  4  
ATOM   8337  H HB3  . SER B 1 57 ? -24.988 -2.402  9.372   1.00 1.06 ? 57  SER B HB3  4  
ATOM   8338  H HG   . SER B 1 57 ? -23.478 -2.991  11.186  1.00 1.80 ? 57  SER B HG   4  
ATOM   8339  N N    . TRP B 1 58 ? -23.310 -0.347  7.249   1.00 0.34 ? 58  TRP B N    4  
ATOM   8340  C CA   . TRP B 1 58 ? -23.582 -0.062  5.811   1.00 0.32 ? 58  TRP B CA   4  
ATOM   8341  C C    . TRP B 1 58 ? -22.439 -0.598  4.950   1.00 0.27 ? 58  TRP B C    4  
ATOM   8342  O O    . TRP B 1 58 ? -22.625 -0.939  3.801   1.00 0.27 ? 58  TRP B O    4  
ATOM   8343  C CB   . TRP B 1 58 ? -23.793 1.444   5.588   1.00 0.34 ? 58  TRP B CB   4  
ATOM   8344  C CG   . TRP B 1 58 ? -22.495 2.188   5.563   1.00 0.31 ? 58  TRP B CG   4  
ATOM   8345  C CD1  . TRP B 1 58 ? -22.012 2.930   6.585   1.00 0.32 ? 58  TRP B CD1  4  
ATOM   8346  C CD2  . TRP B 1 58 ? -21.531 2.309   4.476   1.00 0.27 ? 58  TRP B CD2  4  
ATOM   8347  N NE1  . TRP B 1 58 ? -20.811 3.496   6.200   1.00 0.29 ? 58  TRP B NE1  4  
ATOM   8348  C CE2  . TRP B 1 58 ? -20.466 3.142   4.914   1.00 0.26 ? 58  TRP B CE2  4  
ATOM   8349  C CE3  . TRP B 1 58 ? -21.469 1.781   3.165   1.00 0.27 ? 58  TRP B CE3  4  
ATOM   8350  C CZ2  . TRP B 1 58 ? -19.379 3.442   4.083   1.00 0.25 ? 58  TRP B CZ2  4  
ATOM   8351  C CZ3  . TRP B 1 58 ? -20.376 2.081   2.324   1.00 0.27 ? 58  TRP B CZ3  4  
ATOM   8352  C CH2  . TRP B 1 58 ? -19.332 2.910   2.784   1.00 0.26 ? 58  TRP B CH2  4  
ATOM   8353  H H    . TRP B 1 58 ? -23.252 0.383   7.897   1.00 0.36 ? 58  TRP B H    4  
ATOM   8354  H HA   . TRP B 1 58 ? -24.488 -0.582  5.529   1.00 0.35 ? 58  TRP B HA   4  
ATOM   8355  H HB2  . TRP B 1 58 ? -24.299 1.595   4.647   1.00 0.35 ? 58  TRP B HB2  4  
ATOM   8356  H HB3  . TRP B 1 58 ? -24.410 1.835   6.384   1.00 0.38 ? 58  TRP B HB3  4  
ATOM   8357  H HD1  . TRP B 1 58 ? -22.488 3.061   7.546   1.00 0.36 ? 58  TRP B HD1  4  
ATOM   8358  H HE1  . TRP B 1 58 ? -20.258 4.079   6.756   1.00 0.30 ? 58  TRP B HE1  4  
ATOM   8359  H HE3  . TRP B 1 58 ? -22.265 1.147   2.803   1.00 0.29 ? 58  TRP B HE3  4  
ATOM   8360  H HZ2  . TRP B 1 58 ? -18.581 4.077   4.439   1.00 0.25 ? 58  TRP B HZ2  4  
ATOM   8361  H HZ3  . TRP B 1 58 ? -20.338 1.674   1.325   1.00 0.29 ? 58  TRP B HZ3  4  
ATOM   8362  H HH2  . TRP B 1 58 ? -18.496 3.138   2.138   1.00 0.27 ? 58  TRP B HH2  4  
ATOM   8363  N N    . VAL B 1 59 ? -21.264 -0.699  5.500   1.00 0.24 ? 59  VAL B N    4  
ATOM   8364  C CA   . VAL B 1 59 ? -20.128 -1.237  4.706   1.00 0.20 ? 59  VAL B CA   4  
ATOM   8365  C C    . VAL B 1 59 ? -20.347 -2.730  4.485   1.00 0.22 ? 59  VAL B C    4  
ATOM   8366  O O    . VAL B 1 59 ? -20.228 -3.230  3.386   1.00 0.21 ? 59  VAL B O    4  
ATOM   8367  C CB   . VAL B 1 59 ? -18.824 -1.008  5.468   1.00 0.19 ? 59  VAL B CB   4  
ATOM   8368  C CG1  . VAL B 1 59 ? -17.649 -1.597  4.681   1.00 0.18 ? 59  VAL B CG1  4  
ATOM   8369  C CG2  . VAL B 1 59 ? -18.626 0.495   5.652   1.00 0.19 ? 59  VAL B CG2  4  
ATOM   8370  H H    . VAL B 1 59 ? -21.132 -0.437  6.434   1.00 0.26 ? 59  VAL B H    4  
ATOM   8371  H HA   . VAL B 1 59 ? -20.084 -0.735  3.753   1.00 0.20 ? 59  VAL B HA   4  
ATOM   8372  H HB   . VAL B 1 59 ? -18.881 -1.488  6.435   1.00 0.21 ? 59  VAL B HB   4  
ATOM   8373  H HG11 . VAL B 1 59 ? -17.759 -1.362  3.634   1.00 1.01 ? 59  VAL B HG11 4  
ATOM   8374  H HG12 . VAL B 1 59 ? -16.723 -1.180  5.049   1.00 1.03 ? 59  VAL B HG12 4  
ATOM   8375  H HG13 . VAL B 1 59 ? -17.634 -2.670  4.808   1.00 0.98 ? 59  VAL B HG13 4  
ATOM   8376  H HG21 . VAL B 1 59 ? -19.523 0.924   6.077   1.00 1.04 ? 59  VAL B HG21 4  
ATOM   8377  H HG22 . VAL B 1 59 ? -17.790 0.671   6.309   1.00 1.05 ? 59  VAL B HG22 4  
ATOM   8378  H HG23 . VAL B 1 59 ? -18.433 0.951   4.695   1.00 1.00 ? 59  VAL B HG23 4  
ATOM   8379  N N    . GLN B 1 60 ? -20.676 -3.442  5.523   1.00 0.25 ? 60  GLN B N    4  
ATOM   8380  C CA   . GLN B 1 60 ? -20.915 -4.905  5.370   1.00 0.28 ? 60  GLN B CA   4  
ATOM   8381  C C    . GLN B 1 60 ? -22.126 -5.133  4.459   1.00 0.30 ? 60  GLN B C    4  
ATOM   8382  O O    . GLN B 1 60 ? -22.155 -6.055  3.667   1.00 0.31 ? 60  GLN B O    4  
ATOM   8383  C CB   . GLN B 1 60 ? -21.183 -5.526  6.742   1.00 0.33 ? 60  GLN B CB   4  
ATOM   8384  C CG   . GLN B 1 60 ? -19.971 -5.302  7.650   1.00 1.25 ? 60  GLN B CG   4  
ATOM   8385  C CD   . GLN B 1 60 ? -20.147 -6.100  8.943   1.00 1.65 ? 60  GLN B CD   4  
ATOM   8386  O OE1  . GLN B 1 60 ? -19.179 -6.478  9.572   1.00 2.33 ? 60  GLN B OE1  4  
ATOM   8387  N NE2  . GLN B 1 60 ? -21.351 -6.373  9.369   1.00 2.14 ? 60  GLN B NE2  4  
ATOM   8388  H H    . GLN B 1 60 ? -20.775 -3.012  6.402   1.00 0.27 ? 60  GLN B H    4  
ATOM   8389  H HA   . GLN B 1 60 ? -20.045 -5.367  4.930   1.00 0.28 ? 60  GLN B HA   4  
ATOM   8390  H HB2  . GLN B 1 60 ? -22.055 -5.061  7.183   1.00 0.91 ? 60  GLN B HB2  4  
ATOM   8391  H HB3  . GLN B 1 60 ? -21.358 -6.585  6.632   1.00 0.88 ? 60  GLN B HB3  4  
ATOM   8392  H HG2  . GLN B 1 60 ? -19.077 -5.632  7.141   1.00 1.90 ? 60  GLN B HG2  4  
ATOM   8393  H HG3  . GLN B 1 60 ? -19.886 -4.253  7.885   1.00 1.91 ? 60  GLN B HG3  4  
ATOM   8394  H HE21 . GLN B 1 60 ? -22.131 -6.068  8.860   1.00 2.43 ? 60  GLN B HE21 4  
ATOM   8395  H HE22 . GLN B 1 60 ? -21.473 -6.883  10.196  1.00 2.66 ? 60  GLN B HE22 4  
ATOM   8396  N N    . GLU B 1 61 ? -23.127 -4.303  4.569   1.00 0.31 ? 61  GLU B N    4  
ATOM   8397  C CA   . GLU B 1 61 ? -24.340 -4.469  3.717   1.00 0.33 ? 61  GLU B CA   4  
ATOM   8398  C C    . GLU B 1 61 ? -23.983 -4.249  2.245   1.00 0.31 ? 61  GLU B C    4  
ATOM   8399  O O    . GLU B 1 61 ? -24.351 -5.025  1.385   1.00 0.32 ? 61  GLU B O    4  
ATOM   8400  C CB   . GLU B 1 61 ? -25.403 -3.452  4.140   1.00 0.35 ? 61  GLU B CB   4  
ATOM   8401  C CG   . GLU B 1 61 ? -26.713 -3.749  3.410   1.00 0.40 ? 61  GLU B CG   4  
ATOM   8402  C CD   . GLU B 1 61 ? -27.805 -2.804  3.915   1.00 1.29 ? 61  GLU B CD   4  
ATOM   8403  O OE1  . GLU B 1 61 ? -28.384 -3.097  4.948   1.00 2.03 ? 61  GLU B OE1  4  
ATOM   8404  O OE2  . GLU B 1 61 ? -28.044 -1.803  3.259   1.00 1.99 ? 61  GLU B OE2  4  
ATOM   8405  H H    . GLU B 1 61 ? -23.081 -3.570  5.217   1.00 0.31 ? 61  GLU B H    4  
ATOM   8406  H HA   . GLU B 1 61 ? -24.731 -5.465  3.843   1.00 0.36 ? 61  GLU B HA   4  
ATOM   8407  H HB2  . GLU B 1 61 ? -25.560 -3.519  5.207   1.00 0.37 ? 61  GLU B HB2  4  
ATOM   8408  H HB3  . GLU B 1 61 ? -25.069 -2.457  3.887   1.00 0.33 ? 61  GLU B HB3  4  
ATOM   8409  H HG2  . GLU B 1 61 ? -26.574 -3.606  2.348   1.00 0.84 ? 61  GLU B HG2  4  
ATOM   8410  H HG3  . GLU B 1 61 ? -27.009 -4.770  3.600   1.00 0.95 ? 61  GLU B HG3  4  
ATOM   8411  N N    . TYR B 1 62 ? -23.278 -3.194  1.947   1.00 0.28 ? 62  TYR B N    4  
ATOM   8412  C CA   . TYR B 1 62 ? -22.904 -2.920  0.530   1.00 0.28 ? 62  TYR B CA   4  
ATOM   8413  C C    . TYR B 1 62 ? -22.033 -4.062  -0.002  1.00 0.28 ? 62  TYR B C    4  
ATOM   8414  O O    . TYR B 1 62 ? -22.113 -4.427  -1.158  1.00 0.30 ? 62  TYR B O    4  
ATOM   8415  C CB   . TYR B 1 62 ? -22.130 -1.592  0.445   1.00 0.25 ? 62  TYR B CB   4  
ATOM   8416  C CG   . TYR B 1 62 ? -23.091 -0.415  0.408   1.00 0.27 ? 62  TYR B CG   4  
ATOM   8417  C CD1  . TYR B 1 62 ? -24.132 -0.304  1.355   1.00 0.29 ? 62  TYR B CD1  4  
ATOM   8418  C CD2  . TYR B 1 62 ? -22.942 0.577   -0.585  1.00 0.27 ? 62  TYR B CD2  4  
ATOM   8419  C CE1  . TYR B 1 62 ? -25.015 0.791   1.307   1.00 0.32 ? 62  TYR B CE1  4  
ATOM   8420  C CE2  . TYR B 1 62 ? -23.826 1.670   -0.630  1.00 0.29 ? 62  TYR B CE2  4  
ATOM   8421  C CZ   . TYR B 1 62 ? -24.862 1.777   0.315   1.00 0.31 ? 62  TYR B CZ   4  
ATOM   8422  O OH   . TYR B 1 62 ? -25.731 2.847   0.268   1.00 0.34 ? 62  TYR B OH   4  
ATOM   8423  H H    . TYR B 1 62 ? -22.997 -2.581  2.656   1.00 0.28 ? 62  TYR B H    4  
ATOM   8424  H HA   . TYR B 1 62 ? -23.802 -2.852  -0.069  1.00 0.30 ? 62  TYR B HA   4  
ATOM   8425  H HB2  . TYR B 1 62 ? -21.490 -1.500  1.310   1.00 0.24 ? 62  TYR B HB2  4  
ATOM   8426  H HB3  . TYR B 1 62 ? -21.522 -1.585  -0.449  1.00 0.25 ? 62  TYR B HB3  4  
ATOM   8427  H HD1  . TYR B 1 62 ? -24.253 -1.056  2.117   1.00 0.30 ? 62  TYR B HD1  4  
ATOM   8428  H HD2  . TYR B 1 62 ? -22.147 0.497   -1.311  1.00 0.27 ? 62  TYR B HD2  4  
ATOM   8429  H HE1  . TYR B 1 62 ? -25.810 0.874   2.033   1.00 0.35 ? 62  TYR B HE1  4  
ATOM   8430  H HE2  . TYR B 1 62 ? -23.710 2.428   -1.391  1.00 0.30 ? 62  TYR B HE2  4  
ATOM   8431  H HH   . TYR B 1 62 ? -26.327 2.779   1.017   1.00 0.89 ? 62  TYR B HH   4  
ATOM   8432  N N    . VAL B 1 63 ? -21.213 -4.636  0.830   1.00 0.27 ? 63  VAL B N    4  
ATOM   8433  C CA   . VAL B 1 63 ? -20.357 -5.757  0.368   1.00 0.28 ? 63  VAL B CA   4  
ATOM   8434  C C    . VAL B 1 63 ? -21.261 -6.923  -0.001  1.00 0.32 ? 63  VAL B C    4  
ATOM   8435  O O    . VAL B 1 63 ? -21.051 -7.607  -0.982  1.00 0.34 ? 63  VAL B O    4  
ATOM   8436  C CB   . VAL B 1 63 ? -19.407 -6.169  1.495   1.00 0.28 ? 63  VAL B CB   4  
ATOM   8437  C CG1  . VAL B 1 63 ? -18.696 -7.474  1.128   1.00 0.32 ? 63  VAL B CG1  4  
ATOM   8438  C CG2  . VAL B 1 63 ? -18.367 -5.065  1.709   1.00 0.25 ? 63  VAL B CG2  4  
ATOM   8439  H H    . VAL B 1 63 ? -21.171 -4.342  1.760   1.00 0.26 ? 63  VAL B H    4  
ATOM   8440  H HA   . VAL B 1 63 ? -19.787 -5.448  -0.496  1.00 0.28 ? 63  VAL B HA   4  
ATOM   8441  H HB   . VAL B 1 63 ? -19.974 -6.312  2.403   1.00 0.30 ? 63  VAL B HB   4  
ATOM   8442  H HG11 . VAL B 1 63 ? -18.330 -7.411  0.113   1.00 1.07 ? 63  VAL B HG11 4  
ATOM   8443  H HG12 . VAL B 1 63 ? -17.866 -7.632  1.801   1.00 1.05 ? 63  VAL B HG12 4  
ATOM   8444  H HG13 . VAL B 1 63 ? -19.389 -8.297  1.210   1.00 1.08 ? 63  VAL B HG13 4  
ATOM   8445  H HG21 . VAL B 1 63 ? -18.855 -4.102  1.697   1.00 1.00 ? 63  VAL B HG21 4  
ATOM   8446  H HG22 . VAL B 1 63 ? -17.882 -5.210  2.662   1.00 1.05 ? 63  VAL B HG22 4  
ATOM   8447  H HG23 . VAL B 1 63 ? -17.631 -5.106  0.921   1.00 1.03 ? 63  VAL B HG23 4  
ATOM   8448  N N    . TYR B 1 64 ? -22.274 -7.147  0.782   1.00 0.34 ? 64  TYR B N    4  
ATOM   8449  C CA   . TYR B 1 64 ? -23.206 -8.262  0.489   1.00 0.38 ? 64  TYR B CA   4  
ATOM   8450  C C    . TYR B 1 64 ? -23.903 -7.996  -0.843  1.00 0.39 ? 64  TYR B C    4  
ATOM   8451  O O    . TYR B 1 64 ? -24.049 -8.871  -1.671  1.00 0.41 ? 64  TYR B O    4  
ATOM   8452  C CB   . TYR B 1 64 ? -24.251 -8.353  1.604   1.00 0.41 ? 64  TYR B CB   4  
ATOM   8453  C CG   . TYR B 1 64 ? -24.932 -9.701  1.557   1.00 0.46 ? 64  TYR B CG   4  
ATOM   8454  C CD1  . TYR B 1 64 ? -24.255 -10.850 2.011   1.00 0.48 ? 64  TYR B CD1  4  
ATOM   8455  C CD2  . TYR B 1 64 ? -26.247 -9.811  1.060   1.00 0.49 ? 64  TYR B CD2  4  
ATOM   8456  C CE1  . TYR B 1 64 ? -24.890 -12.106 1.967   1.00 0.52 ? 64  TYR B CE1  4  
ATOM   8457  C CE2  . TYR B 1 64 ? -26.881 -11.068 1.017   1.00 0.54 ? 64  TYR B CE2  4  
ATOM   8458  C CZ   . TYR B 1 64 ? -26.203 -12.214 1.470   1.00 0.55 ? 64  TYR B CZ   4  
ATOM   8459  O OH   . TYR B 1 64 ? -26.825 -13.445 1.427   1.00 0.60 ? 64  TYR B OH   4  
ATOM   8460  H H    . TYR B 1 64 ? -22.423 -6.576  1.563   1.00 0.33 ? 64  TYR B H    4  
ATOM   8461  H HA   . TYR B 1 64 ? -22.649 -9.180  0.434   1.00 0.40 ? 64  TYR B HA   4  
ATOM   8462  H HB2  . TYR B 1 64 ? -23.764 -8.227  2.557   1.00 0.41 ? 64  TYR B HB2  4  
ATOM   8463  H HB3  . TYR B 1 64 ? -24.987 -7.573  1.475   1.00 0.40 ? 64  TYR B HB3  4  
ATOM   8464  H HD1  . TYR B 1 64 ? -23.248 -10.767 2.392   1.00 0.47 ? 64  TYR B HD1  4  
ATOM   8465  H HD2  . TYR B 1 64 ? -26.767 -8.931  0.712   1.00 0.49 ? 64  TYR B HD2  4  
ATOM   8466  H HE1  . TYR B 1 64 ? -24.369 -12.987 2.314   1.00 0.55 ? 64  TYR B HE1  4  
ATOM   8467  H HE2  . TYR B 1 64 ? -27.888 -11.151 0.636   1.00 0.56 ? 64  TYR B HE2  4  
ATOM   8468  H HH   . TYR B 1 64 ? -27.767 -13.298 1.318   1.00 1.08 ? 64  TYR B HH   4  
ATOM   8469  N N    . ASP B 1 65 ? -24.335 -6.787  -1.043  1.00 0.36 ? 65  ASP B N    4  
ATOM   8470  C CA   . ASP B 1 65 ? -25.034 -6.437  -2.312  1.00 0.37 ? 65  ASP B CA   4  
ATOM   8471  C C    . ASP B 1 65 ? -24.083 -6.639  -3.496  1.00 0.37 ? 65  ASP B C    4  
ATOM   8472  O O    . ASP B 1 65 ? -24.487 -7.040  -4.570  1.00 0.40 ? 65  ASP B O    4  
ATOM   8473  C CB   . ASP B 1 65 ? -25.476 -4.972  -2.251  1.00 0.35 ? 65  ASP B CB   4  
ATOM   8474  C CG   . ASP B 1 65 ? -26.742 -4.848  -1.400  1.00 0.39 ? 65  ASP B CG   4  
ATOM   8475  O OD1  . ASP B 1 65 ? -27.764 -5.368  -1.815  1.00 1.15 ? 65  ASP B OD1  4  
ATOM   8476  O OD2  . ASP B 1 65 ? -26.667 -4.235  -0.347  1.00 1.11 ? 65  ASP B OD2  4  
ATOM   8477  H H    . ASP B 1 65 ? -24.202 -6.104  -0.352  1.00 0.34 ? 65  ASP B H    4  
ATOM   8478  H HA   . ASP B 1 65 ? -25.899 -7.073  -2.435  1.00 0.41 ? 65  ASP B HA   4  
ATOM   8479  H HB2  . ASP B 1 65 ? -24.688 -4.378  -1.811  1.00 0.32 ? 65  ASP B HB2  4  
ATOM   8480  H HB3  . ASP B 1 65 ? -25.679 -4.615  -3.248  1.00 0.36 ? 65  ASP B HB3  4  
ATOM   8481  N N    . LEU B 1 66 ? -22.827 -6.360  -3.307  1.00 0.33 ? 66  LEU B N    4  
ATOM   8482  C CA   . LEU B 1 66 ? -21.845 -6.529  -4.414  1.00 0.34 ? 66  LEU B CA   4  
ATOM   8483  C C    . LEU B 1 66 ? -21.601 -8.021  -4.661  1.00 0.39 ? 66  LEU B C    4  
ATOM   8484  O O    . LEU B 1 66 ? -21.304 -8.438  -5.762  1.00 0.42 ? 66  LEU B O    4  
ATOM   8485  C CB   . LEU B 1 66 ? -20.533 -5.841  -4.017  1.00 0.31 ? 66  LEU B CB   4  
ATOM   8486  C CG   . LEU B 1 66 ? -20.632 -4.321  -4.266  1.00 0.28 ? 66  LEU B CG   4  
ATOM   8487  C CD1  . LEU B 1 66 ? -19.598 -3.589  -3.409  1.00 0.24 ? 66  LEU B CD1  4  
ATOM   8488  C CD2  . LEU B 1 66 ? -20.353 -4.001  -5.744  1.00 0.30 ? 66  LEU B CD2  4  
ATOM   8489  H H    . LEU B 1 66 ? -22.527 -6.035  -2.434  1.00 0.31 ? 66  LEU B H    4  
ATOM   8490  H HA   . LEU B 1 66 ? -22.238 -6.079  -5.312  1.00 0.35 ? 66  LEU B HA   4  
ATOM   8491  H HB2  . LEU B 1 66 ? -20.350 -6.021  -2.966  1.00 0.29 ? 66  LEU B HB2  4  
ATOM   8492  H HB3  . LEU B 1 66 ? -19.723 -6.253  -4.592  1.00 0.33 ? 66  LEU B HB3  4  
ATOM   8493  H HG   . LEU B 1 66 ? -21.623 -3.975  -4.003  1.00 0.27 ? 66  LEU B HG   4  
ATOM   8494  H HD11 . LEU B 1 66 ? -19.760 -3.827  -2.367  1.00 1.02 ? 66  LEU B HD11 4  
ATOM   8495  H HD12 . LEU B 1 66 ? -18.607 -3.899  -3.698  1.00 1.06 ? 66  LEU B HD12 4  
ATOM   8496  H HD13 . LEU B 1 66 ? -19.699 -2.523  -3.555  1.00 1.04 ? 66  LEU B HD13 4  
ATOM   8497  H HD21 . LEU B 1 66 ? -19.451 -4.503  -6.063  1.00 1.07 ? 66  LEU B HD21 4  
ATOM   8498  H HD22 . LEU B 1 66 ? -21.181 -4.328  -6.353  1.00 1.05 ? 66  LEU B HD22 4  
ATOM   8499  H HD23 . LEU B 1 66 ? -20.225 -2.935  -5.861  1.00 1.06 ? 66  LEU B HD23 4  
ATOM   8500  N N    . GLU B 1 67 ? -21.730 -8.824  -3.645  1.00 0.40 ? 67  GLU B N    4  
ATOM   8501  C CA   . GLU B 1 67 ? -21.513 -10.289 -3.821  1.00 0.45 ? 67  GLU B CA   4  
ATOM   8502  C C    . GLU B 1 67 ? -22.684 -10.876 -4.606  1.00 0.50 ? 67  GLU B C    4  
ATOM   8503  O O    . GLU B 1 67 ? -22.547 -11.854 -5.313  1.00 0.55 ? 67  GLU B O    4  
ATOM   8504  C CB   . GLU B 1 67 ? -21.440 -10.958 -2.447  1.00 0.46 ? 67  GLU B CB   4  
ATOM   8505  C CG   . GLU B 1 67 ? -20.162 -10.518 -1.724  1.00 0.44 ? 67  GLU B CG   4  
ATOM   8506  C CD   . GLU B 1 67 ? -18.969 -11.335 -2.231  1.00 1.13 ? 67  GLU B CD   4  
ATOM   8507  O OE1  . GLU B 1 67 ? -18.711 -12.384 -1.663  1.00 1.88 ? 67  GLU B OE1  4  
ATOM   8508  O OE2  . GLU B 1 67 ? -18.336 -10.896 -3.176  1.00 1.81 ? 67  GLU B OE2  4  
ATOM   8509  H H    . GLU B 1 67 ? -21.971 -8.464  -2.769  1.00 0.38 ? 67  GLU B H    4  
ATOM   8510  H HA   . GLU B 1 67 ? -20.592 -10.459 -4.359  1.00 0.46 ? 67  GLU B HA   4  
ATOM   8511  H HB2  . GLU B 1 67 ? -22.302 -10.667 -1.863  1.00 0.45 ? 67  GLU B HB2  4  
ATOM   8512  H HB3  . GLU B 1 67 ? -21.437 -12.031 -2.568  1.00 0.50 ? 67  GLU B HB3  4  
ATOM   8513  H HG2  . GLU B 1 67 ? -19.985 -9.469  -1.911  1.00 0.93 ? 67  GLU B HG2  4  
ATOM   8514  H HG3  . GLU B 1 67 ? -20.282 -10.678 -0.664  1.00 0.85 ? 67  GLU B HG3  4  
ATOM   8515  N N    . LEU B 1 68 ? -23.837 -10.279 -4.487  1.00 0.49 ? 68  LEU B N    4  
ATOM   8516  C CA   . LEU B 1 68 ? -25.023 -10.795 -5.228  1.00 0.54 ? 68  LEU B CA   4  
ATOM   8517  C C    . LEU B 1 68 ? -24.925 -10.381 -6.697  1.00 0.56 ? 68  LEU B C    4  
ATOM   8518  O O    . LEU B 1 68 ? -24.472 -11.133 -7.536  1.00 0.62 ? 68  LEU B O    4  
ATOM   8519  C CB   . LEU B 1 68 ? -26.299 -10.214 -4.627  1.00 0.55 ? 68  LEU B CB   4  
ATOM   8520  C CG   . LEU B 1 68 ? -26.448 -10.676 -3.174  1.00 0.55 ? 68  LEU B CG   4  
ATOM   8521  C CD1  . LEU B 1 68 ? -27.678 -10.003 -2.576  1.00 0.56 ? 68  LEU B CD1  4  
ATOM   8522  C CD2  . LEU B 1 68 ? -26.613 -12.208 -3.109  1.00 0.61 ? 68  LEU B CD2  4  
ATOM   8523  H H    . LEU B 1 68 ? -23.919 -9.491  -3.910  1.00 0.46 ? 68  LEU B H    4  
ATOM   8524  H HA   . LEU B 1 68 ? -25.055 -11.866 -5.160  1.00 0.58 ? 68  LEU B HA   4  
ATOM   8525  H HB2  . LEU B 1 68 ? -26.250 -9.135  -4.657  1.00 0.51 ? 68  LEU B HB2  4  
ATOM   8526  H HB3  . LEU B 1 68 ? -27.151 -10.551 -5.198  1.00 0.59 ? 68  LEU B HB3  4  
ATOM   8527  H HG   . LEU B 1 68 ? -25.573 -10.380 -2.614  1.00 0.52 ? 68  LEU B HG   4  
ATOM   8528  H HD11 . LEU B 1 68 ? -27.591 -8.934  -2.689  1.00 1.15 ? 68  LEU B HD11 4  
ATOM   8529  H HD12 . LEU B 1 68 ? -28.561 -10.351 -3.092  1.00 1.21 ? 68  LEU B HD12 4  
ATOM   8530  H HD13 . LEU B 1 68 ? -27.749 -10.253 -1.530  1.00 1.13 ? 68  LEU B HD13 4  
ATOM   8531  H HD21 . LEU B 1 68 ? -27.155 -12.556 -3.977  1.00 1.17 ? 68  LEU B HD21 4  
ATOM   8532  H HD22 . LEU B 1 68 ? -25.640 -12.675 -3.082  1.00 1.22 ? 68  LEU B HD22 4  
ATOM   8533  H HD23 . LEU B 1 68 ? -27.159 -12.480 -2.216  1.00 1.15 ? 68  LEU B HD23 4  
ATOM   8534  N N    . ASN B 1 69 ? -25.346 -9.186  -7.015  1.00 0.61 ? 69  ASN B N    4  
ATOM   8535  C CA   . ASN B 1 69 ? -25.280 -8.715  -8.429  1.00 0.64 ? 69  ASN B CA   4  
ATOM   8536  C C    . ASN B 1 69 ? -23.927 -8.048  -8.683  1.00 0.70 ? 69  ASN B C    4  
ATOM   8537  O O    . ASN B 1 69 ? -23.486 -7.304  -7.823  1.00 1.15 ? 69  ASN B O    4  
ATOM   8538  C CB   . ASN B 1 69 ? -26.400 -7.704  -8.680  1.00 0.82 ? 69  ASN B CB   4  
ATOM   8539  C CG   . ASN B 1 69 ? -26.208 -6.491  -7.768  1.00 1.67 ? 69  ASN B CG   4  
ATOM   8540  O OD1  . ASN B 1 69 ? -26.562 -6.527  -6.605  1.00 2.45 ? 69  ASN B OD1  4  
ATOM   8541  N ND2  . ASN B 1 69 ? -25.659 -5.409  -8.247  1.00 2.41 ? 69  ASN B ND2  4  
ATOM   8542  O OXT  . ASN B 1 69 ? -23.354 -8.294  -9.731  1.00 1.44 ? 69  ASN B OXT  4  
ATOM   8543  H H    . ASN B 1 69 ? -25.707 -8.598  -6.323  1.00 0.69 ? 69  ASN B H    4  
ATOM   8544  H HA   . ASN B 1 69 ? -25.399 -9.555  -9.098  1.00 0.62 ? 69  ASN B HA   4  
ATOM   8545  H HB2  . ASN B 1 69 ? -26.374 -7.386  -9.713  1.00 1.42 ? 69  ASN B HB2  4  
ATOM   8546  H HB3  . ASN B 1 69 ? -27.354 -8.162  -8.469  1.00 1.27 ? 69  ASN B HB3  4  
ATOM   8547  H HD21 . ASN B 1 69 ? -25.373 -5.379  -9.185  1.00 2.52 ? 69  ASN B HD21 4  
ATOM   8548  H HD22 . ASN B 1 69 ? -25.531 -4.627  -7.672  1.00 3.22 ? 69  ASN B HD22 4  
HETATM 8549  O O    . HOH C 2 .  ? 6.763   1.572   6.084   1.00 0.36 ? 201 HOH A O    4  
HETATM 8550  H H1   . HOH C 2 .  ? 5.938   1.183   6.377   1.00 0.78 ? 201 HOH A H1   4  
HETATM 8551  H H2   . HOH C 2 .  ? 6.736   2.469   6.418   1.00 0.36 ? 201 HOH A H2   4  
HETATM 8552  O O    . HOH C 2 .  ? 4.298   5.619   6.677   1.00 0.70 ? 202 HOH A O    4  
HETATM 8553  H H1   . HOH C 2 .  ? 3.991   4.719   6.781   1.00 1.01 ? 202 HOH A H1   4  
HETATM 8554  H H2   . HOH C 2 .  ? 3.650   6.029   6.105   1.00 1.21 ? 202 HOH A H2   4  
HETATM 8555  O O    . HOH D 2 .  ? -6.466  -1.329  5.959   1.00 0.35 ? 301 HOH B O    4  
HETATM 8556  H H1   . HOH D 2 .  ? -5.862  -1.941  5.540   1.00 0.68 ? 301 HOH B H1   4  
HETATM 8557  H H2   . HOH D 2 .  ? -7.084  -1.888  6.432   1.00 0.31 ? 301 HOH B H2   4  
HETATM 8558  O O    . HOH D 2 .  ? -4.422  -5.468  6.743   1.00 1.65 ? 302 HOH B O    4  
HETATM 8559  H H1   . HOH D 2 .  ? -3.781  -4.895  7.164   1.00 1.48 ? 302 HOH B H1   4  
HETATM 8560  H H2   . HOH D 2 .  ? -4.225  -6.340  7.084   1.00 2.04 ? 302 HOH B H2   4  
ATOM   8561  N N    . ALA A 1 1  ? -7.946  14.854  -13.704 1.00 0.00 ? 1   ALA A N    5  
ATOM   8562  C CA   . ALA A 1 1  ? -8.001  16.010  -12.769 1.00 0.00 ? 1   ALA A CA   5  
ATOM   8563  C C    . ALA A 1 1  ? -8.690  15.602  -11.448 1.00 0.00 ? 1   ALA A C    5  
ATOM   8564  O O    . ALA A 1 1  ? -8.189  15.922  -10.389 1.00 0.00 ? 1   ALA A O    5  
ATOM   8565  C CB   . ALA A 1 1  ? -8.746  17.186  -13.444 1.00 0.00 ? 1   ALA A CB   5  
ATOM   8566  H H1   . ALA A 1 1  ? -8.018  13.968  -13.164 1.00 0.00 ? 1   ALA A H1   5  
ATOM   8567  H H2   . ALA A 1 1  ? -8.736  14.915  -14.377 1.00 0.00 ? 1   ALA A H2   5  
ATOM   8568  H H3   . ALA A 1 1  ? -7.047  14.871  -14.225 1.00 0.00 ? 1   ALA A H3   5  
ATOM   8569  H HA   . ALA A 1 1  ? -6.989  16.314  -12.545 1.00 0.00 ? 1   ALA A HA   5  
ATOM   8570  H HB1  . ALA A 1 1  ? -9.034  16.897  -14.442 1.00 0.00 ? 1   ALA A HB1  5  
ATOM   8571  H HB2  . ALA A 1 1  ? -9.634  17.443  -12.879 1.00 0.00 ? 1   ALA A HB2  5  
ATOM   8572  H HB3  . ALA A 1 1  ? -8.096  18.051  -13.499 1.00 0.00 ? 1   ALA A HB3  5  
ATOM   8573  N N    . PRO A 1 2  ? -9.818  14.924  -11.530 1.00 0.00 ? 2   PRO A N    5  
ATOM   8574  C CA   . PRO A 1 2  ? -10.547 14.508  -10.317 1.00 0.00 ? 2   PRO A CA   5  
ATOM   8575  C C    . PRO A 1 2  ? -9.724  13.466  -9.546  1.00 0.00 ? 2   PRO A C    5  
ATOM   8576  O O    . PRO A 1 2  ? -9.511  12.363  -10.008 1.00 0.00 ? 2   PRO A O    5  
ATOM   8577  C CB   . PRO A 1 2  ? -11.879 13.913  -10.835 1.00 0.00 ? 2   PRO A CB   5  
ATOM   8578  C CG   . PRO A 1 2  ? -11.850 13.990  -12.390 1.00 0.00 ? 2   PRO A CG   5  
ATOM   8579  C CD   . PRO A 1 2  ? -10.458 14.521  -12.802 1.00 0.00 ? 2   PRO A CD   5  
ATOM   8580  H HA   . PRO A 1 2  ? -10.742 15.365  -9.689  1.00 0.00 ? 2   PRO A HA   5  
ATOM   8581  H HB2  . PRO A 1 2  ? -11.981 12.881  -10.515 1.00 0.00 ? 2   PRO A HB2  5  
ATOM   8582  H HB3  . PRO A 1 2  ? -12.713 14.491  -10.459 1.00 0.00 ? 2   PRO A HB3  5  
ATOM   8583  H HG2  . PRO A 1 2  ? -12.015 13.005  -12.812 1.00 0.00 ? 2   PRO A HG2  5  
ATOM   8584  H HG3  . PRO A 1 2  ? -12.617 14.667  -12.742 1.00 0.00 ? 2   PRO A HG3  5  
ATOM   8585  H HD2  . PRO A 1 2  ? -9.893  13.730  -13.276 1.00 0.00 ? 2   PRO A HD2  5  
ATOM   8586  H HD3  . PRO A 1 2  ? -10.552 15.367  -13.462 1.00 0.00 ? 2   PRO A HD3  5  
ATOM   8587  N N    . MET A 1 3  ? -9.261  13.810  -8.375  1.00 0.00 ? 3   MET A N    5  
ATOM   8588  C CA   . MET A 1 3  ? -8.456  12.842  -7.578  1.00 0.00 ? 3   MET A CA   5  
ATOM   8589  C C    . MET A 1 3  ? -9.394  11.843  -6.896  1.00 0.00 ? 3   MET A C    5  
ATOM   8590  O O    . MET A 1 3  ? -10.529 12.153  -6.590  1.00 0.00 ? 3   MET A O    5  
ATOM   8591  C CB   . MET A 1 3  ? -7.655  13.597  -6.516  1.00 0.00 ? 3   MET A CB   5  
ATOM   8592  C CG   . MET A 1 3  ? -8.573  14.579  -5.785  1.00 0.00 ? 3   MET A CG   5  
ATOM   8593  S SD   . MET A 1 3  ? -7.742  15.191  -4.298  1.00 0.00 ? 3   MET A SD   5  
ATOM   8594  C CE   . MET A 1 3  ? -6.440  16.130  -5.134  1.00 0.00 ? 3   MET A CE   5  
ATOM   8595  H H    . MET A 1 3  ? -9.444  14.704  -8.019  1.00 0.00 ? 3   MET A H    5  
ATOM   8596  H HA   . MET A 1 3  ? -7.779  12.311  -8.231  1.00 0.00 ? 3   MET A HA   5  
ATOM   8597  H HB2  . MET A 1 3  ? -7.243  12.892  -5.807  1.00 0.00 ? 3   MET A HB2  5  
ATOM   8598  H HB3  . MET A 1 3  ? -6.852  14.142  -6.990  1.00 0.00 ? 3   MET A HB3  5  
ATOM   8599  H HG2  . MET A 1 3  ? -8.803  15.409  -6.437  1.00 0.00 ? 3   MET A HG2  5  
ATOM   8600  H HG3  . MET A 1 3  ? -9.487  14.076  -5.506  1.00 0.00 ? 3   MET A HG3  5  
ATOM   8601  H HE1  . MET A 1 3  ? -6.851  16.632  -5.995  1.00 0.00 ? 3   MET A HE1  5  
ATOM   8602  H HE2  . MET A 1 3  ? -6.032  16.864  -4.453  1.00 0.00 ? 3   MET A HE2  5  
ATOM   8603  H HE3  . MET A 1 3  ? -5.658  15.454  -5.454  1.00 0.00 ? 3   MET A HE3  5  
ATOM   8604  N N    . GLY A 1 4  ? -8.932  10.648  -6.655  1.00 0.00 ? 4   GLY A N    5  
ATOM   8605  C CA   . GLY A 1 4  ? -9.801  9.634   -5.994  1.00 0.00 ? 4   GLY A CA   5  
ATOM   8606  C C    . GLY A 1 4  ? -10.289 10.179  -4.650  1.00 0.00 ? 4   GLY A C    5  
ATOM   8607  O O    . GLY A 1 4  ? -9.961  11.283  -4.263  1.00 0.00 ? 4   GLY A O    5  
ATOM   8608  H H    . GLY A 1 4  ? -8.014  10.415  -6.909  1.00 0.00 ? 4   GLY A H    5  
ATOM   8609  H HA2  . GLY A 1 4  ? -10.650 9.424   -6.630  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   8610  H HA3  . GLY A 1 4  ? -9.241  8.728   -5.830  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   8611  N N    . SER A 1 5  ? -11.079 9.417   -3.934  1.00 0.00 ? 5   SER A N    5  
ATOM   8612  C CA   . SER A 1 5  ? -11.591 9.900   -2.616  1.00 0.00 ? 5   SER A CA   5  
ATOM   8613  C C    . SER A 1 5  ? -10.591 9.540   -1.504  1.00 0.00 ? 5   SER A C    5  
ATOM   8614  O O    . SER A 1 5  ? -10.022 10.405  -0.868  1.00 0.00 ? 5   SER A O    5  
ATOM   8615  C CB   . SER A 1 5  ? -12.967 9.266   -2.345  1.00 0.00 ? 5   SER A CB   5  
ATOM   8616  O OG   . SER A 1 5  ? -13.904 10.297  -2.061  1.00 0.00 ? 5   SER A OG   5  
ATOM   8617  H H    . SER A 1 5  ? -11.336 8.532   -4.266  1.00 0.00 ? 5   SER A H    5  
ATOM   8618  H HA   . SER A 1 5  ? -11.703 10.971  -2.653  1.00 0.00 ? 5   SER A HA   5  
ATOM   8619  H HB2  . SER A 1 5  ? -13.293 8.730   -3.220  1.00 0.00 ? 5   SER A HB2  5  
ATOM   8620  H HB3  . SER A 1 5  ? -12.909 8.581   -1.509  1.00 0.00 ? 5   SER A HB3  5  
ATOM   8621  H HG   . SER A 1 5  ? -13.643 11.079  -2.553  1.00 0.00 ? 5   SER A HG   5  
ATOM   8622  N N    . ASP A 1 6  ? -10.373 8.273   -1.266  1.00 0.00 ? 6   ASP A N    5  
ATOM   8623  C CA   . ASP A 1 6  ? -9.408  7.865   -0.196  1.00 0.00 ? 6   ASP A CA   5  
ATOM   8624  C C    . ASP A 1 6  ? -8.890  6.445   -0.479  1.00 0.00 ? 6   ASP A C    5  
ATOM   8625  O O    . ASP A 1 6  ? -9.213  5.524   0.243   1.00 0.00 ? 6   ASP A O    5  
ATOM   8626  C CB   . ASP A 1 6  ? -10.111 7.882   1.171   1.00 0.00 ? 6   ASP A CB   5  
ATOM   8627  C CG   . ASP A 1 6  ? -9.062  7.912   2.287   1.00 0.00 ? 6   ASP A CG   5  
ATOM   8628  O OD1  . ASP A 1 6  ? -8.175  8.745   2.216   1.00 0.00 ? 6   ASP A OD1  5  
ATOM   8629  O OD2  . ASP A 1 6  ? -9.165  7.101   3.192   1.00 0.00 ? 6   ASP A OD2  5  
ATOM   8630  H H    . ASP A 1 6  ? -10.840 7.590   -1.793  1.00 0.00 ? 6   ASP A H    5  
ATOM   8631  H HA   . ASP A 1 6  ? -8.578  8.555   -0.180  1.00 0.00 ? 6   ASP A HA   5  
ATOM   8632  H HB2  . ASP A 1 6  ? -10.737 8.758   1.245   1.00 0.00 ? 6   ASP A HB2  5  
ATOM   8633  H HB3  . ASP A 1 6  ? -10.720 6.996   1.280   1.00 0.00 ? 6   ASP A HB3  5  
ATOM   8634  N N    . PRO A 1 7  ? -8.103  6.297   -1.524  1.00 0.00 ? 7   PRO A N    5  
ATOM   8635  C CA   . PRO A 1 7  ? -7.554  4.978   -1.890  1.00 0.00 ? 7   PRO A CA   5  
ATOM   8636  C C    . PRO A 1 7  ? -6.602  4.483   -0.778  1.00 0.00 ? 7   PRO A C    5  
ATOM   8637  O O    . PRO A 1 7  ? -6.241  5.245   0.097   1.00 0.00 ? 7   PRO A O    5  
ATOM   8638  C CB   . PRO A 1 7  ? -6.797  5.219   -3.220  1.00 0.00 ? 7   PRO A CB   5  
ATOM   8639  C CG   . PRO A 1 7  ? -6.896  6.739   -3.548  1.00 0.00 ? 7   PRO A CG   5  
ATOM   8640  C CD   . PRO A 1 7  ? -7.706  7.409   -2.415  1.00 0.00 ? 7   PRO A CD   5  
ATOM   8641  H HA   . PRO A 1 7  ? -8.360  4.280   -2.039  1.00 0.00 ? 7   PRO A HA   5  
ATOM   8642  H HB2  . PRO A 1 7  ? -5.757  4.927   -3.120  1.00 0.00 ? 7   PRO A HB2  5  
ATOM   8643  H HB3  . PRO A 1 7  ? -7.256  4.647   -4.014  1.00 0.00 ? 7   PRO A HB3  5  
ATOM   8644  H HG2  . PRO A 1 7  ? -5.902  7.170   -3.600  1.00 0.00 ? 7   PRO A HG2  5  
ATOM   8645  H HG3  . PRO A 1 7  ? -7.403  6.882   -4.493  1.00 0.00 ? 7   PRO A HG3  5  
ATOM   8646  H HD2  . PRO A 1 7  ? -7.088  8.119   -1.881  1.00 0.00 ? 7   PRO A HD2  5  
ATOM   8647  H HD3  . PRO A 1 7  ? -8.584  7.898   -2.811  1.00 0.00 ? 7   PRO A HD3  5  
ATOM   8648  N N    . PRO A 1 8  ? -6.216  3.222   -0.843  1.00 0.00 ? 8   PRO A N    5  
ATOM   8649  C CA   . PRO A 1 8  ? -5.301  2.640   0.162   1.00 0.00 ? 8   PRO A CA   5  
ATOM   8650  C C    . PRO A 1 8  ? -3.947  3.367   0.122   1.00 0.00 ? 8   PRO A C    5  
ATOM   8651  O O    . PRO A 1 8  ? -3.842  4.481   -0.353  1.00 0.00 ? 8   PRO A O    5  
ATOM   8652  C CB   . PRO A 1 8  ? -5.152  1.155   -0.251  1.00 0.00 ? 8   PRO A CB   5  
ATOM   8653  C CG   . PRO A 1 8  ? -5.890  0.974   -1.610  1.00 0.00 ? 8   PRO A CG   5  
ATOM   8654  C CD   . PRO A 1 8  ? -6.650  2.286   -1.903  1.00 0.00 ? 8   PRO A CD   5  
ATOM   8655  H HA   . PRO A 1 8  ? -5.734  2.711   1.147   1.00 0.00 ? 8   PRO A HA   5  
ATOM   8656  H HB2  . PRO A 1 8  ? -4.105  0.893   -0.359  1.00 0.00 ? 8   PRO A HB2  5  
ATOM   8657  H HB3  . PRO A 1 8  ? -5.608  0.517   0.494   1.00 0.00 ? 8   PRO A HB3  5  
ATOM   8658  H HG2  . PRO A 1 8  ? -5.169  0.778   -2.396  1.00 0.00 ? 8   PRO A HG2  5  
ATOM   8659  H HG3  . PRO A 1 8  ? -6.590  0.150   -1.546  1.00 0.00 ? 8   PRO A HG3  5  
ATOM   8660  H HD2  . PRO A 1 8  ? -6.387  2.670   -2.880  1.00 0.00 ? 8   PRO A HD2  5  
ATOM   8661  H HD3  . PRO A 1 8  ? -7.715  2.121   -1.837  1.00 0.00 ? 8   PRO A HD3  5  
ATOM   8662  N N    . THR A 1 9  ? -2.910  2.740   0.616   1.00 0.00 ? 9   THR A N    5  
ATOM   8663  C CA   . THR A 1 9  ? -1.565  3.387   0.605   1.00 0.00 ? 9   THR A CA   5  
ATOM   8664  C C    . THR A 1 9  ? -0.478  2.315   0.628   1.00 0.00 ? 9   THR A C    5  
ATOM   8665  O O    . THR A 1 9  ? -0.488  1.418   1.448   1.00 0.00 ? 9   THR A O    5  
ATOM   8666  C CB   . THR A 1 9  ? -1.415  4.280   1.836   1.00 0.00 ? 9   THR A CB   5  
ATOM   8667  O OG1  . THR A 1 9  ? -2.571  5.096   1.970   1.00 0.00 ? 9   THR A OG1  5  
ATOM   8668  C CG2  . THR A 1 9  ? -0.176  5.165   1.680   1.00 0.00 ? 9   THR A CG2  5  
ATOM   8669  H H    . THR A 1 9  ? -3.016  1.841   0.994   1.00 0.00 ? 9   THR A H    5  
ATOM   8670  H HA   . THR A 1 9  ? -1.455  3.984   -0.290  1.00 0.00 ? 9   THR A HA   5  
ATOM   8671  H HB   . THR A 1 9  ? -1.304  3.663   2.714   1.00 0.00 ? 9   THR A HB   5  
ATOM   8672  H HG1  . THR A 1 9  ? -2.952  5.217   1.098   1.00 0.00 ? 9   THR A HG1  5  
ATOM   8673  H HG21 . THR A 1 9  ? 0.693   4.543   1.520   1.00 0.00 ? 9   THR A HG21 5  
ATOM   8674  H HG22 . THR A 1 9  ? -0.308  5.824   0.835   1.00 0.00 ? 9   THR A HG22 5  
ATOM   8675  H HG23 . THR A 1 9  ? -0.039  5.753   2.576   1.00 0.00 ? 9   THR A HG23 5  
ATOM   8676  N N    . ALA A 1 10 ? 0.460   2.405   -0.272  1.00 0.00 ? 10  ALA A N    5  
ATOM   8677  C CA   . ALA A 1 10 ? 1.556   1.399   -0.315  1.00 0.00 ? 10  ALA A CA   5  
ATOM   8678  C C    . ALA A 1 10 ? 2.457   1.566   0.909   1.00 0.00 ? 10  ALA A C    5  
ATOM   8679  O O    . ALA A 1 10 ? 3.511   2.166   0.835   1.00 0.00 ? 10  ALA A O    5  
ATOM   8680  C CB   . ALA A 1 10 ? 2.378   1.614   -1.584  1.00 0.00 ? 10  ALA A CB   5  
ATOM   8681  H H    . ALA A 1 10 ? 0.445   3.138   -0.921  1.00 0.00 ? 10  ALA A H    5  
ATOM   8682  H HA   . ALA A 1 10 ? 1.136   0.404   -0.321  1.00 0.00 ? 10  ALA A HA   5  
ATOM   8683  H HB1  . ALA A 1 10 ? 2.592   2.667   -1.698  1.00 0.00 ? 10  ALA A HB1  5  
ATOM   8684  H HB2  . ALA A 1 10 ? 3.305   1.065   -1.509  1.00 0.00 ? 10  ALA A HB2  5  
ATOM   8685  H HB3  . ALA A 1 10 ? 1.819   1.265   -2.439  1.00 0.00 ? 10  ALA A HB3  5  
ATOM   8686  N N    . CYS A 1 11 ? 2.054   1.029   2.033   1.00 0.00 ? 11  CYS A N    5  
ATOM   8687  C CA   . CYS A 1 11 ? 2.884   1.136   3.275   1.00 0.00 ? 11  CYS A CA   5  
ATOM   8688  C C    . CYS A 1 11 ? 3.476   -0.240  3.588   1.00 0.00 ? 11  CYS A C    5  
ATOM   8689  O O    . CYS A 1 11 ? 2.803   -1.247  3.508   1.00 0.00 ? 11  CYS A O    5  
ATOM   8690  C CB   . CYS A 1 11 ? 2.000   1.590   4.440   1.00 0.00 ? 11  CYS A CB   5  
ATOM   8691  S SG   . CYS A 1 11 ? 1.180   3.147   4.007   1.00 0.00 ? 11  CYS A SG   5  
ATOM   8692  H H    . CYS A 1 11 ? 1.203   0.544   2.060   1.00 0.00 ? 11  CYS A H    5  
ATOM   8693  H HA   . CYS A 1 11 ? 3.686   1.848   3.133   1.00 0.00 ? 11  CYS A HA   5  
ATOM   8694  H HB2  . CYS A 1 11 ? 1.255   0.834   4.642   1.00 0.00 ? 11  CYS A HB2  5  
ATOM   8695  H HB3  . CYS A 1 11 ? 2.611   1.737   5.319   1.00 0.00 ? 11  CYS A HB3  5  
ATOM   8696  N N    . CYS A 1 12 ? 4.733   -0.293  3.933   1.00 0.00 ? 12  CYS A N    5  
ATOM   8697  C CA   . CYS A 1 12 ? 5.364   -1.608  4.238   1.00 0.00 ? 12  CYS A CA   5  
ATOM   8698  C C    . CYS A 1 12 ? 4.846   -2.126  5.581   1.00 0.00 ? 12  CYS A C    5  
ATOM   8699  O O    . CYS A 1 12 ? 4.626   -1.369  6.506   1.00 0.00 ? 12  CYS A O    5  
ATOM   8700  C CB   . CYS A 1 12 ? 6.885   -1.445  4.306   1.00 0.00 ? 12  CYS A CB   5  
ATOM   8701  S SG   . CYS A 1 12 ? 7.519   -0.983  2.674   1.00 0.00 ? 12  CYS A SG   5  
ATOM   8702  H H    . CYS A 1 12 ? 5.265   0.529   3.983   1.00 0.00 ? 12  CYS A H    5  
ATOM   8703  H HA   . CYS A 1 12 ? 5.113   -2.314  3.462   1.00 0.00 ? 12  CYS A HA   5  
ATOM   8704  H HB2  . CYS A 1 12 ? 7.133   -0.674  5.020   1.00 0.00 ? 12  CYS A HB2  5  
ATOM   8705  H HB3  . CYS A 1 12 ? 7.334   -2.378  4.615   1.00 0.00 ? 12  CYS A HB3  5  
ATOM   8706  N N    . PHE A 1 13 ? 4.654   -3.415  5.693   1.00 0.00 ? 13  PHE A N    5  
ATOM   8707  C CA   . PHE A 1 13 ? 4.154   -4.006  6.973   1.00 0.00 ? 13  PHE A CA   5  
ATOM   8708  C C    . PHE A 1 13 ? 5.330   -4.653  7.708   1.00 0.00 ? 13  PHE A C    5  
ATOM   8709  O O    . PHE A 1 13 ? 5.279   -4.897  8.897   1.00 0.00 ? 13  PHE A O    5  
ATOM   8710  C CB   . PHE A 1 13 ? 3.104   -5.076  6.659   1.00 0.00 ? 13  PHE A CB   5  
ATOM   8711  C CG   . PHE A 1 13 ? 3.759   -6.218  5.920   1.00 0.00 ? 13  PHE A CG   5  
ATOM   8712  C CD1  . PHE A 1 13 ? 4.042   -6.098  4.547   1.00 0.00 ? 13  PHE A CD1  5  
ATOM   8713  C CD2  . PHE A 1 13 ? 4.093   -7.401  6.608   1.00 0.00 ? 13  PHE A CD2  5  
ATOM   8714  C CE1  . PHE A 1 13 ? 4.658   -7.161  3.860   1.00 0.00 ? 13  PHE A CE1  5  
ATOM   8715  C CE2  . PHE A 1 13 ? 4.710   -8.463  5.922   1.00 0.00 ? 13  PHE A CE2  5  
ATOM   8716  C CZ   . PHE A 1 13 ? 4.993   -8.344  4.547   1.00 0.00 ? 13  PHE A CZ   5  
ATOM   8717  H H    . PHE A 1 13 ? 4.843   -4.001  4.930   1.00 0.00 ? 13  PHE A H    5  
ATOM   8718  H HA   . PHE A 1 13 ? 3.714   -3.240  7.593   1.00 0.00 ? 13  PHE A HA   5  
ATOM   8719  H HB2  . PHE A 1 13 ? 2.675   -5.440  7.581   1.00 0.00 ? 13  PHE A HB2  5  
ATOM   8720  H HB3  . PHE A 1 13 ? 2.326   -4.649  6.044   1.00 0.00 ? 13  PHE A HB3  5  
ATOM   8721  H HD1  . PHE A 1 13 ? 3.786   -5.190  4.021   1.00 0.00 ? 13  PHE A HD1  5  
ATOM   8722  H HD2  . PHE A 1 13 ? 3.875   -7.493  7.663   1.00 0.00 ? 13  PHE A HD2  5  
ATOM   8723  H HE1  . PHE A 1 13 ? 4.875   -7.068  2.807   1.00 0.00 ? 13  PHE A HE1  5  
ATOM   8724  H HE2  . PHE A 1 13 ? 4.966   -9.370  6.450   1.00 0.00 ? 13  PHE A HE2  5  
ATOM   8725  H HZ   . PHE A 1 13 ? 5.467   -9.159  4.021   1.00 0.00 ? 13  PHE A HZ   5  
ATOM   8726  N N    . SER A 1 14 ? 6.388   -4.931  6.997   1.00 0.00 ? 14  SER A N    5  
ATOM   8727  C CA   . SER A 1 14 ? 7.578   -5.562  7.629   1.00 0.00 ? 14  SER A CA   5  
ATOM   8728  C C    . SER A 1 14 ? 8.812   -5.237  6.787   1.00 0.00 ? 14  SER A C    5  
ATOM   8729  O O    . SER A 1 14 ? 8.878   -4.210  6.141   1.00 0.00 ? 14  SER A O    5  
ATOM   8730  C CB   . SER A 1 14 ? 7.384   -7.078  7.688   1.00 0.00 ? 14  SER A CB   5  
ATOM   8731  O OG   . SER A 1 14 ? 7.278   -7.589  6.366   1.00 0.00 ? 14  SER A OG   5  
ATOM   8732  H H    . SER A 1 14 ? 6.398   -4.723  6.039   1.00 0.00 ? 14  SER A H    5  
ATOM   8733  H HA   . SER A 1 14 ? 7.709   -5.173  8.628   1.00 0.00 ? 14  SER A HA   5  
ATOM   8734  H HB2  . SER A 1 14 ? 8.229   -7.531  8.177   1.00 0.00 ? 14  SER A HB2  5  
ATOM   8735  H HB3  . SER A 1 14 ? 6.483   -7.302  8.245   1.00 0.00 ? 14  SER A HB3  5  
ATOM   8736  H HG   . SER A 1 14 ? 8.157   -7.846  6.076   1.00 0.00 ? 14  SER A HG   5  
ATOM   8737  N N    . TYR A 1 15 ? 9.795   -6.098  6.788   1.00 0.00 ? 15  TYR A N    5  
ATOM   8738  C CA   . TYR A 1 15 ? 11.023  -5.825  5.983   1.00 0.00 ? 15  TYR A CA   5  
ATOM   8739  C C    . TYR A 1 15 ? 11.707  -7.144  5.627   1.00 0.00 ? 15  TYR A C    5  
ATOM   8740  O O    . TYR A 1 15 ? 11.454  -8.170  6.227   1.00 0.00 ? 15  TYR A O    5  
ATOM   8741  C CB   . TYR A 1 15 ? 11.988  -4.954  6.799   1.00 0.00 ? 15  TYR A CB   5  
ATOM   8742  C CG   . TYR A 1 15 ? 11.211  -3.897  7.547   1.00 0.00 ? 15  TYR A CG   5  
ATOM   8743  C CD1  . TYR A 1 15 ? 10.723  -4.167  8.841   1.00 0.00 ? 15  TYR A CD1  5  
ATOM   8744  C CD2  . TYR A 1 15 ? 10.973  -2.644  6.953   1.00 0.00 ? 15  TYR A CD2  5  
ATOM   8745  C CE1  . TYR A 1 15 ? 9.999   -3.183  9.539   1.00 0.00 ? 15  TYR A CE1  5  
ATOM   8746  C CE2  . TYR A 1 15 ? 10.248  -1.660  7.652   1.00 0.00 ? 15  TYR A CE2  5  
ATOM   8747  C CZ   . TYR A 1 15 ? 9.761   -1.929  8.945   1.00 0.00 ? 15  TYR A CZ   5  
ATOM   8748  O OH   . TYR A 1 15 ? 9.051   -0.964  9.630   1.00 0.00 ? 15  TYR A OH   5  
ATOM   8749  H H    . TYR A 1 15 ? 9.727   -6.920  7.315   1.00 0.00 ? 15  TYR A H    5  
ATOM   8750  H HA   . TYR A 1 15 ? 10.754  -5.309  5.071   1.00 0.00 ? 15  TYR A HA   5  
ATOM   8751  H HB2  . TYR A 1 15 ? 12.524  -5.570  7.507   1.00 0.00 ? 15  TYR A HB2  5  
ATOM   8752  H HB3  . TYR A 1 15 ? 12.690  -4.478  6.134   1.00 0.00 ? 15  TYR A HB3  5  
ATOM   8753  H HD1  . TYR A 1 15 ? 10.906  -5.129  9.296   1.00 0.00 ? 15  TYR A HD1  5  
ATOM   8754  H HD2  . TYR A 1 15 ? 11.346  -2.437  5.960   1.00 0.00 ? 15  TYR A HD2  5  
ATOM   8755  H HE1  . TYR A 1 15 ? 9.626   -3.389  10.531  1.00 0.00 ? 15  TYR A HE1  5  
ATOM   8756  H HE2  . TYR A 1 15 ? 10.065  -0.699  7.196   1.00 0.00 ? 15  TYR A HE2  5  
ATOM   8757  H HH   . TYR A 1 15 ? 9.302   -1.013  10.556  1.00 0.00 ? 15  TYR A HH   5  
ATOM   8758  N N    . THR A 1 16 ? 12.574  -7.120  4.655   1.00 0.00 ? 16  THR A N    5  
ATOM   8759  C CA   . THR A 1 16 ? 13.278  -8.372  4.262   1.00 0.00 ? 16  THR A CA   5  
ATOM   8760  C C    . THR A 1 16 ? 14.063  -8.904  5.463   1.00 0.00 ? 16  THR A C    5  
ATOM   8761  O O    . THR A 1 16 ? 13.864  -8.477  6.583   1.00 0.00 ? 16  THR A O    5  
ATOM   8762  C CB   . THR A 1 16 ? 14.227  -8.083  3.093   1.00 0.00 ? 16  THR A CB   5  
ATOM   8763  O OG1  . THR A 1 16 ? 15.030  -9.225  2.834   1.00 0.00 ? 16  THR A OG1  5  
ATOM   8764  C CG2  . THR A 1 16 ? 15.125  -6.893  3.434   1.00 0.00 ? 16  THR A CG2  5  
ATOM   8765  H H    . THR A 1 16 ? 12.769  -6.276  4.188   1.00 0.00 ? 16  THR A H    5  
ATOM   8766  H HA   . THR A 1 16 ? 12.551  -9.112  3.959   1.00 0.00 ? 16  THR A HA   5  
ATOM   8767  H HB   . THR A 1 16 ? 13.649  -7.848  2.215   1.00 0.00 ? 16  THR A HB   5  
ATOM   8768  H HG1  . THR A 1 16 ? 14.984  -9.413  1.893   1.00 0.00 ? 16  THR A HG1  5  
ATOM   8769  H HG21 . THR A 1 16 ? 15.678  -7.106  4.335   1.00 0.00 ? 16  THR A HG21 5  
ATOM   8770  H HG22 . THR A 1 16 ? 15.817  -6.721  2.620   1.00 0.00 ? 16  THR A HG22 5  
ATOM   8771  H HG23 . THR A 1 16 ? 14.518  -6.013  3.581   1.00 0.00 ? 16  THR A HG23 5  
ATOM   8772  N N    . ALA A 1 17 ? 14.955  -9.831  5.239   1.00 0.00 ? 17  ALA A N    5  
ATOM   8773  C CA   . ALA A 1 17 ? 15.763  -10.397 6.360   1.00 0.00 ? 17  ALA A CA   5  
ATOM   8774  C C    . ALA A 1 17 ? 17.195  -10.597 5.871   1.00 0.00 ? 17  ALA A C    5  
ATOM   8775  O O    . ALA A 1 17 ? 17.998  -11.256 6.501   1.00 0.00 ? 17  ALA A O    5  
ATOM   8776  C CB   . ALA A 1 17 ? 15.171  -11.743 6.784   1.00 0.00 ? 17  ALA A CB   5  
ATOM   8777  H H    . ALA A 1 17 ? 15.097  -10.159 4.329   1.00 0.00 ? 17  ALA A H    5  
ATOM   8778  H HA   . ALA A 1 17 ? 15.762  -9.718  7.202   1.00 0.00 ? 17  ALA A HA   5  
ATOM   8779  H HB1  . ALA A 1 17 ? 14.936  -12.324 5.905   1.00 0.00 ? 17  ALA A HB1  5  
ATOM   8780  H HB2  . ALA A 1 17 ? 15.888  -12.277 7.388   1.00 0.00 ? 17  ALA A HB2  5  
ATOM   8781  H HB3  . ALA A 1 17 ? 14.271  -11.575 7.357   1.00 0.00 ? 17  ALA A HB3  5  
ATOM   8782  N N    . ARG A 1 18 ? 17.516  -10.018 4.744   1.00 0.00 ? 18  ARG A N    5  
ATOM   8783  C CA   . ARG A 1 18 ? 18.894  -10.143 4.184   1.00 0.00 ? 18  ARG A CA   5  
ATOM   8784  C C    . ARG A 1 18 ? 19.320  -8.790  3.616   1.00 0.00 ? 18  ARG A C    5  
ATOM   8785  O O    . ARG A 1 18 ? 18.663  -8.230  2.761   1.00 0.00 ? 18  ARG A O    5  
ATOM   8786  C CB   . ARG A 1 18 ? 18.906  -11.187 3.057   1.00 0.00 ? 18  ARG A CB   5  
ATOM   8787  C CG   . ARG A 1 18 ? 18.580  -12.594 3.613   1.00 0.00 ? 18  ARG A CG   5  
ATOM   8788  C CD   . ARG A 1 18 ? 17.086  -12.904 3.441   1.00 0.00 ? 18  ARG A CD   5  
ATOM   8789  N NE   . ARG A 1 18 ? 16.765  -14.188 4.128   1.00 0.00 ? 18  ARG A NE   5  
ATOM   8790  C CZ   . ARG A 1 18 ? 15.522  -14.513 4.355   1.00 0.00 ? 18  ARG A CZ   5  
ATOM   8791  N NH1  . ARG A 1 18 ? 14.558  -13.719 3.976   1.00 0.00 ? 18  ARG A NH1  5  
ATOM   8792  N NH2  . ARG A 1 18 ? 15.242  -15.635 4.962   1.00 0.00 ? 18  ARG A NH2  5  
ATOM   8793  H H    . ARG A 1 18 ? 16.846  -9.489  4.264   1.00 0.00 ? 18  ARG A H    5  
ATOM   8794  H HA   . ARG A 1 18 ? 19.586  -10.441 4.960   1.00 0.00 ? 18  ARG A HA   5  
ATOM   8795  H HB2  . ARG A 1 18 ? 18.177  -10.909 2.307   1.00 0.00 ? 18  ARG A HB2  5  
ATOM   8796  H HB3  . ARG A 1 18 ? 19.887  -11.201 2.604   1.00 0.00 ? 18  ARG A HB3  5  
ATOM   8797  H HG2  . ARG A 1 18 ? 19.155  -13.335 3.076   1.00 0.00 ? 18  ARG A HG2  5  
ATOM   8798  H HG3  . ARG A 1 18 ? 18.834  -12.644 4.663   1.00 0.00 ? 18  ARG A HG3  5  
ATOM   8799  H HD2  . ARG A 1 18 ? 16.499  -12.109 3.872   1.00 0.00 ? 18  ARG A HD2  5  
ATOM   8800  H HD3  . ARG A 1 18 ? 16.856  -12.990 2.389   1.00 0.00 ? 18  ARG A HD3  5  
ATOM   8801  H HE   . ARG A 1 18 ? 17.488  -14.786 4.410   1.00 0.00 ? 18  ARG A HE   5  
ATOM   8802  H HH11 . ARG A 1 18 ? 14.773  -12.860 3.511   1.00 0.00 ? 18  ARG A HH11 5  
ATOM   8803  H HH12 . ARG A 1 18 ? 13.607  -13.969 4.151   1.00 0.00 ? 18  ARG A HH12 5  
ATOM   8804  H HH21 . ARG A 1 18 ? 15.981  -16.245 5.250   1.00 0.00 ? 18  ARG A HH21 5  
ATOM   8805  H HH22 . ARG A 1 18 ? 14.290  -15.885 5.136   1.00 0.00 ? 18  ARG A HH22 5  
ATOM   8806  N N    . LYS A 1 19 ? 20.415  -8.259  4.082   1.00 0.00 ? 19  LYS A N    5  
ATOM   8807  C CA   . LYS A 1 19 ? 20.881  -6.943  3.567   1.00 0.00 ? 19  LYS A CA   5  
ATOM   8808  C C    . LYS A 1 19 ? 21.198  -7.083  2.073   1.00 0.00 ? 19  LYS A C    5  
ATOM   8809  O O    . LYS A 1 19 ? 21.946  -7.948  1.665   1.00 0.00 ? 19  LYS A O    5  
ATOM   8810  C CB   . LYS A 1 19 ? 22.130  -6.522  4.355   1.00 0.00 ? 19  LYS A CB   5  
ATOM   8811  C CG   . LYS A 1 19 ? 22.861  -5.385  3.653   1.00 0.00 ? 19  LYS A CG   5  
ATOM   8812  C CD   . LYS A 1 19 ? 23.947  -4.871  4.591   1.00 0.00 ? 19  LYS A CD   5  
ATOM   8813  C CE   . LYS A 1 19 ? 24.835  -3.887  3.851   1.00 0.00 ? 19  LYS A CE   5  
ATOM   8814  N NZ   . LYS A 1 19 ? 23.986  -2.894  3.141   1.00 0.00 ? 19  LYS A NZ   5  
ATOM   8815  H H    . LYS A 1 19 ? 20.931  -8.728  4.771   1.00 0.00 ? 19  LYS A H    5  
ATOM   8816  H HA   . LYS A 1 19 ? 20.104  -6.206  3.703   1.00 0.00 ? 19  LYS A HA   5  
ATOM   8817  H HB2  . LYS A 1 19 ? 21.835  -6.189  5.339   1.00 0.00 ? 19  LYS A HB2  5  
ATOM   8818  H HB3  . LYS A 1 19 ? 22.798  -7.365  4.448   1.00 0.00 ? 19  LYS A HB3  5  
ATOM   8819  H HG2  . LYS A 1 19 ? 23.311  -5.745  2.739   1.00 0.00 ? 19  LYS A HG2  5  
ATOM   8820  H HG3  . LYS A 1 19 ? 22.169  -4.587  3.431   1.00 0.00 ? 19  LYS A HG3  5  
ATOM   8821  H HD2  . LYS A 1 19 ? 23.490  -4.382  5.435   1.00 0.00 ? 19  LYS A HD2  5  
ATOM   8822  H HD3  . LYS A 1 19 ? 24.543  -5.700  4.935   1.00 0.00 ? 19  LYS A HD3  5  
ATOM   8823  H HE2  . LYS A 1 19 ? 25.472  -3.382  4.559   1.00 0.00 ? 19  LYS A HE2  5  
ATOM   8824  H HE3  . LYS A 1 19 ? 25.439  -4.422  3.137   1.00 0.00 ? 19  LYS A HE3  5  
ATOM   8825  H HZ1  . LYS A 1 19 ? 23.006  -2.981  3.473   1.00 0.00 ? 19  LYS A HZ1  5  
ATOM   8826  H HZ2  . LYS A 1 19 ? 24.336  -1.935  3.336   1.00 0.00 ? 19  LYS A HZ2  5  
ATOM   8827  H HZ3  . LYS A 1 19 ? 24.024  -3.074  2.119   1.00 0.00 ? 19  LYS A HZ3  5  
ATOM   8828  N N    . LEU A 1 20 ? 20.616  -6.247  1.255   1.00 0.00 ? 20  LEU A N    5  
ATOM   8829  C CA   . LEU A 1 20 ? 20.862  -6.341  -0.214  1.00 0.00 ? 20  LEU A CA   5  
ATOM   8830  C C    . LEU A 1 20 ? 22.279  -5.823  -0.556  1.00 0.00 ? 20  LEU A C    5  
ATOM   8831  O O    . LEU A 1 20 ? 22.547  -4.658  -0.335  1.00 0.00 ? 20  LEU A O    5  
ATOM   8832  C CB   . LEU A 1 20 ? 19.847  -5.461  -0.951  1.00 0.00 ? 20  LEU A CB   5  
ATOM   8833  C CG   . LEU A 1 20 ? 18.444  -5.673  -0.384  1.00 0.00 ? 20  LEU A CG   5  
ATOM   8834  C CD1  . LEU A 1 20 ? 17.434  -4.960  -1.282  1.00 0.00 ? 20  LEU A CD1  5  
ATOM   8835  C CD2  . LEU A 1 20 ? 18.113  -7.168  -0.341  1.00 0.00 ? 20  LEU A CD2  5  
ATOM   8836  H H    . LEU A 1 20 ? 20.005  -5.566  1.604   1.00 0.00 ? 20  LEU A H    5  
ATOM   8837  H HA   . LEU A 1 20 ? 20.729  -7.357  -0.526  1.00 0.00 ? 20  LEU A HA   5  
ATOM   8838  H HB2  . LEU A 1 20 ? 20.122  -4.422  -0.835  1.00 0.00 ? 20  LEU A HB2  5  
ATOM   8839  H HB3  . LEU A 1 20 ? 19.850  -5.715  -2.000  1.00 0.00 ? 20  LEU A HB3  5  
ATOM   8840  H HG   . LEU A 1 20 ? 18.394  -5.261  0.615   1.00 0.00 ? 20  LEU A HG   5  
ATOM   8841  H HD11 . LEU A 1 20 ? 17.789  -3.964  -1.504  1.00 0.00 ? 20  LEU A HD11 5  
ATOM   8842  H HD12 . LEU A 1 20 ? 17.319  -5.515  -2.200  1.00 0.00 ? 20  LEU A HD12 5  
ATOM   8843  H HD13 . LEU A 1 20 ? 16.484  -4.900  -0.776  1.00 0.00 ? 20  LEU A HD13 5  
ATOM   8844  H HD21 . LEU A 1 20 ? 18.420  -7.630  -1.267  1.00 0.00 ? 20  LEU A HD21 5  
ATOM   8845  H HD22 . LEU A 1 20 ? 18.633  -7.629  0.483   1.00 0.00 ? 20  LEU A HD22 5  
ATOM   8846  H HD23 . LEU A 1 20 ? 17.047  -7.298  -0.211  1.00 0.00 ? 20  LEU A HD23 5  
ATOM   8847  N N    . PRO A 1 21 ? 23.153  -6.655  -1.106  1.00 0.00 ? 21  PRO A N    5  
ATOM   8848  C CA   . PRO A 1 21 ? 24.502  -6.186  -1.476  1.00 0.00 ? 21  PRO A CA   5  
ATOM   8849  C C    . PRO A 1 21 ? 24.388  -5.014  -2.454  1.00 0.00 ? 21  PRO A C    5  
ATOM   8850  O O    . PRO A 1 21 ? 23.470  -4.948  -3.245  1.00 0.00 ? 21  PRO A O    5  
ATOM   8851  C CB   . PRO A 1 21 ? 25.178  -7.400  -2.153  1.00 0.00 ? 21  PRO A CB   5  
ATOM   8852  C CG   . PRO A 1 21 ? 24.235  -8.620  -1.959  1.00 0.00 ? 21  PRO A CG   5  
ATOM   8853  C CD   . PRO A 1 21 ? 22.901  -8.088  -1.395  1.00 0.00 ? 21  PRO A CD   5  
ATOM   8854  H HA   . PRO A 1 21 ? 25.054  -5.892  -0.595  1.00 0.00 ? 21  PRO A HA   5  
ATOM   8855  H HB2  . PRO A 1 21 ? 25.321  -7.211  -3.212  1.00 0.00 ? 21  PRO A HB2  5  
ATOM   8856  H HB3  . PRO A 1 21 ? 26.132  -7.597  -1.695  1.00 0.00 ? 21  PRO A HB3  5  
ATOM   8857  H HG2  . PRO A 1 21 ? 24.067  -9.114  -2.910  1.00 0.00 ? 21  PRO A HG2  5  
ATOM   8858  H HG3  . PRO A 1 21 ? 24.673  -9.320  -1.259  1.00 0.00 ? 21  PRO A HG3  5  
ATOM   8859  H HD2  . PRO A 1 21 ? 22.115  -8.192  -2.133  1.00 0.00 ? 21  PRO A HD2  5  
ATOM   8860  H HD3  . PRO A 1 21 ? 22.640  -8.611  -0.486  1.00 0.00 ? 21  PRO A HD3  5  
ATOM   8861  N N    . ARG A 1 22 ? 25.318  -4.101  -2.425  1.00 0.00 ? 22  ARG A N    5  
ATOM   8862  C CA   . ARG A 1 22 ? 25.259  -2.960  -3.379  1.00 0.00 ? 22  ARG A CA   5  
ATOM   8863  C C    . ARG A 1 22 ? 25.072  -3.515  -4.792  1.00 0.00 ? 22  ARG A C    5  
ATOM   8864  O O    . ARG A 1 22 ? 24.442  -2.907  -5.635  1.00 0.00 ? 22  ARG A O    5  
ATOM   8865  C CB   . ARG A 1 22 ? 26.563  -2.162  -3.305  1.00 0.00 ? 22  ARG A CB   5  
ATOM   8866  C CG   . ARG A 1 22 ? 26.374  -0.805  -3.984  1.00 0.00 ? 22  ARG A CG   5  
ATOM   8867  C CD   . ARG A 1 22 ? 27.636  0.038   -3.800  1.00 0.00 ? 22  ARG A CD   5  
ATOM   8868  N NE   . ARG A 1 22 ? 27.512  1.298   -4.585  1.00 0.00 ? 22  ARG A NE   5  
ATOM   8869  C CZ   . ARG A 1 22 ? 28.322  2.294   -4.353  1.00 0.00 ? 22  ARG A CZ   5  
ATOM   8870  N NH1  . ARG A 1 22 ? 29.243  2.186   -3.434  1.00 0.00 ? 22  ARG A NH1  5  
ATOM   8871  N NH2  . ARG A 1 22 ? 28.212  3.398   -5.040  1.00 0.00 ? 22  ARG A NH2  5  
ATOM   8872  H H    . ARG A 1 22 ? 26.061  -4.176  -1.791  1.00 0.00 ? 22  ARG A H    5  
ATOM   8873  H HA   . ARG A 1 22 ? 24.426  -2.320  -3.130  1.00 0.00 ? 22  ARG A HA   5  
ATOM   8874  H HB2  . ARG A 1 22 ? 26.834  -2.013  -2.270  1.00 0.00 ? 22  ARG A HB2  5  
ATOM   8875  H HB3  . ARG A 1 22 ? 27.348  -2.708  -3.808  1.00 0.00 ? 22  ARG A HB3  5  
ATOM   8876  H HG2  . ARG A 1 22 ? 26.189  -0.953  -5.039  1.00 0.00 ? 22  ARG A HG2  5  
ATOM   8877  H HG3  . ARG A 1 22 ? 25.533  -0.293  -3.539  1.00 0.00 ? 22  ARG A HG3  5  
ATOM   8878  H HD2  . ARG A 1 22 ? 27.759  0.276   -2.754  1.00 0.00 ? 22  ARG A HD2  5  
ATOM   8879  H HD3  . ARG A 1 22 ? 28.494  -0.520  -4.146  1.00 0.00 ? 22  ARG A HD3  5  
ATOM   8880  H HE   . ARG A 1 22 ? 26.821  1.378   -5.276  1.00 0.00 ? 22  ARG A HE   5  
ATOM   8881  H HH11 . ARG A 1 22 ? 29.327  1.339   -2.908  1.00 0.00 ? 22  ARG A HH11 5  
ATOM   8882  H HH12 . ARG A 1 22 ? 29.864  2.949   -3.257  1.00 0.00 ? 22  ARG A HH12 5  
ATOM   8883  H HH21 . ARG A 1 22 ? 27.507  3.481   -5.745  1.00 0.00 ? 22  ARG A HH21 5  
ATOM   8884  H HH22 . ARG A 1 22 ? 28.833  4.161   -4.863  1.00 0.00 ? 22  ARG A HH22 5  
ATOM   8885  N N    . ASN A 1 23 ? 25.616  -4.674  -5.051  1.00 0.00 ? 23  ASN A N    5  
ATOM   8886  C CA   . ASN A 1 23 ? 25.477  -5.286  -6.403  1.00 0.00 ? 23  ASN A CA   5  
ATOM   8887  C C    . ASN A 1 23 ? 24.044  -5.785  -6.602  1.00 0.00 ? 23  ASN A C    5  
ATOM   8888  O O    . ASN A 1 23 ? 23.762  -6.532  -7.518  1.00 0.00 ? 23  ASN A O    5  
ATOM   8889  C CB   . ASN A 1 23 ? 26.447  -6.463  -6.531  1.00 0.00 ? 23  ASN A CB   5  
ATOM   8890  C CG   . ASN A 1 23 ? 27.846  -6.023  -6.095  1.00 0.00 ? 23  ASN A CG   5  
ATOM   8891  O OD1  . ASN A 1 23 ? 28.428  -5.138  -6.689  1.00 0.00 ? 23  ASN A OD1  5  
ATOM   8892  N ND2  . ASN A 1 23 ? 28.413  -6.609  -5.077  1.00 0.00 ? 23  ASN A ND2  5  
ATOM   8893  H H    . ASN A 1 23 ? 26.116  -5.147  -4.349  1.00 0.00 ? 23  ASN A H    5  
ATOM   8894  H HA   . ASN A 1 23 ? 25.709  -4.549  -7.157  1.00 0.00 ? 23  ASN A HA   5  
ATOM   8895  H HB2  . ASN A 1 23 ? 26.111  -7.275  -5.902  1.00 0.00 ? 23  ASN A HB2  5  
ATOM   8896  H HB3  . ASN A 1 23 ? 26.479  -6.794  -7.559  1.00 0.00 ? 23  ASN A HB3  5  
ATOM   8897  H HD21 . ASN A 1 23 ? 27.943  -7.323  -4.598  1.00 0.00 ? 23  ASN A HD21 5  
ATOM   8898  H HD22 . ASN A 1 23 ? 29.309  -6.334  -4.790  1.00 0.00 ? 23  ASN A HD22 5  
ATOM   8899  N N    . PHE A 1 24 ? 23.137  -5.390  -5.744  1.00 0.00 ? 24  PHE A N    5  
ATOM   8900  C CA   . PHE A 1 24 ? 21.717  -5.852  -5.876  1.00 0.00 ? 24  PHE A CA   5  
ATOM   8901  C C    . PHE A 1 24 ? 20.772  -4.684  -5.569  1.00 0.00 ? 24  PHE A C    5  
ATOM   8902  O O    . PHE A 1 24 ? 19.665  -4.875  -5.106  1.00 0.00 ? 24  PHE A O    5  
ATOM   8903  C CB   . PHE A 1 24 ? 21.474  -6.996  -4.875  1.00 0.00 ? 24  PHE A CB   5  
ATOM   8904  C CG   . PHE A 1 24 ? 20.279  -7.833  -5.290  1.00 0.00 ? 24  PHE A CG   5  
ATOM   8905  C CD1  . PHE A 1 24 ? 20.280  -8.508  -6.529  1.00 0.00 ? 24  PHE A CD1  5  
ATOM   8906  C CD2  . PHE A 1 24 ? 19.166  -7.950  -4.429  1.00 0.00 ? 24  PHE A CD2  5  
ATOM   8907  C CE1  . PHE A 1 24 ? 19.172  -9.293  -6.905  1.00 0.00 ? 24  PHE A CE1  5  
ATOM   8908  C CE2  . PHE A 1 24 ? 18.061  -8.735  -4.808  1.00 0.00 ? 24  PHE A CE2  5  
ATOM   8909  C CZ   . PHE A 1 24 ? 18.065  -9.406  -6.045  1.00 0.00 ? 24  PHE A CZ   5  
ATOM   8910  H H    . PHE A 1 24 ? 23.391  -4.797  -5.009  1.00 0.00 ? 24  PHE A H    5  
ATOM   8911  H HA   . PHE A 1 24 ? 21.533  -6.198  -6.881  1.00 0.00 ? 24  PHE A HA   5  
ATOM   8912  H HB2  . PHE A 1 24 ? 22.349  -7.625  -4.838  1.00 0.00 ? 24  PHE A HB2  5  
ATOM   8913  H HB3  . PHE A 1 24 ? 21.297  -6.580  -3.891  1.00 0.00 ? 24  PHE A HB3  5  
ATOM   8914  H HD1  . PHE A 1 24 ? 21.127  -8.427  -7.193  1.00 0.00 ? 24  PHE A HD1  5  
ATOM   8915  H HD2  . PHE A 1 24 ? 19.162  -7.436  -3.480  1.00 0.00 ? 24  PHE A HD2  5  
ATOM   8916  H HE1  . PHE A 1 24 ? 19.174  -9.808  -7.854  1.00 0.00 ? 24  PHE A HE1  5  
ATOM   8917  H HE2  . PHE A 1 24 ? 17.211  -8.826  -4.149  1.00 0.00 ? 24  PHE A HE2  5  
ATOM   8918  H HZ   . PHE A 1 24 ? 17.216  -10.009 -6.334  1.00 0.00 ? 24  PHE A HZ   5  
ATOM   8919  N N    . VAL A 1 25 ? 21.203  -3.477  -5.830  1.00 0.00 ? 25  VAL A N    5  
ATOM   8920  C CA   . VAL A 1 25 ? 20.338  -2.288  -5.562  1.00 0.00 ? 25  VAL A CA   5  
ATOM   8921  C C    . VAL A 1 25 ? 20.677  -1.189  -6.572  1.00 0.00 ? 25  VAL A C    5  
ATOM   8922  O O    . VAL A 1 25 ? 21.553  -0.378  -6.350  1.00 0.00 ? 25  VAL A O    5  
ATOM   8923  C CB   . VAL A 1 25 ? 20.598  -1.773  -4.143  1.00 0.00 ? 25  VAL A CB   5  
ATOM   8924  C CG1  . VAL A 1 25 ? 19.647  -0.617  -3.833  1.00 0.00 ? 25  VAL A CG1  5  
ATOM   8925  C CG2  . VAL A 1 25 ? 20.360  -2.899  -3.134  1.00 0.00 ? 25  VAL A CG2  5  
ATOM   8926  H H    . VAL A 1 25 ? 22.099  -3.352  -6.206  1.00 0.00 ? 25  VAL A H    5  
ATOM   8927  H HA   . VAL A 1 25 ? 19.297  -2.561  -5.664  1.00 0.00 ? 25  VAL A HA   5  
ATOM   8928  H HB   . VAL A 1 25 ? 21.619  -1.428  -4.067  1.00 0.00 ? 25  VAL A HB   5  
ATOM   8929  H HG11 . VAL A 1 25 ? 19.798  0.180   -4.546  1.00 0.00 ? 25  VAL A HG11 5  
ATOM   8930  H HG12 . VAL A 1 25 ? 18.625  -0.964  -3.894  1.00 0.00 ? 25  VAL A HG12 5  
ATOM   8931  H HG13 . VAL A 1 25 ? 19.844  -0.251  -2.837  1.00 0.00 ? 25  VAL A HG13 5  
ATOM   8932  H HG21 . VAL A 1 25 ? 19.406  -3.365  -3.332  1.00 0.00 ? 25  VAL A HG21 5  
ATOM   8933  H HG22 . VAL A 1 25 ? 21.147  -3.633  -3.220  1.00 0.00 ? 25  VAL A HG22 5  
ATOM   8934  H HG23 . VAL A 1 25 ? 20.359  -2.489  -2.136  1.00 0.00 ? 25  VAL A HG23 5  
ATOM   8935  N N    . VAL A 1 26 ? 19.993  -1.160  -7.684  1.00 0.00 ? 26  VAL A N    5  
ATOM   8936  C CA   . VAL A 1 26 ? 20.275  -0.122  -8.714  1.00 0.00 ? 26  VAL A CA   5  
ATOM   8937  C C    . VAL A 1 26 ? 19.493  1.149   -8.395  1.00 0.00 ? 26  VAL A C    5  
ATOM   8938  O O    . VAL A 1 26 ? 19.731  2.194   -8.969  1.00 0.00 ? 26  VAL A O    5  
ATOM   8939  C CB   . VAL A 1 26 ? 19.850  -0.645  -10.086 1.00 0.00 ? 26  VAL A CB   5  
ATOM   8940  C CG1  . VAL A 1 26 ? 20.727  -1.835  -10.470 1.00 0.00 ? 26  VAL A CG1  5  
ATOM   8941  C CG2  . VAL A 1 26 ? 18.385  -1.089  -10.038 1.00 0.00 ? 26  VAL A CG2  5  
ATOM   8942  H H    . VAL A 1 26 ? 19.293  -1.826  -7.845  1.00 0.00 ? 26  VAL A H    5  
ATOM   8943  H HA   . VAL A 1 26 ? 21.332  0.102   -8.725  1.00 0.00 ? 26  VAL A HA   5  
ATOM   8944  H HB   . VAL A 1 26 ? 19.966  0.136   -10.817 1.00 0.00 ? 26  VAL A HB   5  
ATOM   8945  H HG11 . VAL A 1 26 ? 20.799  -2.513  -9.631  1.00 0.00 ? 26  VAL A HG11 5  
ATOM   8946  H HG12 . VAL A 1 26 ? 20.288  -2.349  -11.312 1.00 0.00 ? 26  VAL A HG12 5  
ATOM   8947  H HG13 . VAL A 1 26 ? 21.713  -1.485  -10.735 1.00 0.00 ? 26  VAL A HG13 5  
ATOM   8948  H HG21 . VAL A 1 26 ? 17.764  -0.255  -9.743  1.00 0.00 ? 26  VAL A HG21 5  
ATOM   8949  H HG22 . VAL A 1 26 ? 18.082  -1.434  -11.015 1.00 0.00 ? 26  VAL A HG22 5  
ATOM   8950  H HG23 . VAL A 1 26 ? 18.274  -1.891  -9.323  1.00 0.00 ? 26  VAL A HG23 5  
ATOM   8951  N N    . ASP A 1 27 ? 18.561  1.075   -7.489  1.00 0.00 ? 27  ASP A N    5  
ATOM   8952  C CA   . ASP A 1 27 ? 17.772  2.289   -7.148  1.00 0.00 ? 27  ASP A CA   5  
ATOM   8953  C C    . ASP A 1 27 ? 16.933  2.012   -5.908  1.00 0.00 ? 27  ASP A C    5  
ATOM   8954  O O    . ASP A 1 27 ? 17.064  0.984   -5.275  1.00 0.00 ? 27  ASP A O    5  
ATOM   8955  C CB   . ASP A 1 27 ? 16.850  2.642   -8.320  1.00 0.00 ? 27  ASP A CB   5  
ATOM   8956  C CG   . ASP A 1 27 ? 16.293  4.053   -8.125  1.00 0.00 ? 27  ASP A CG   5  
ATOM   8957  O OD1  . ASP A 1 27 ? 17.083  4.953   -7.886  1.00 0.00 ? 27  ASP A OD1  5  
ATOM   8958  O OD2  . ASP A 1 27 ? 15.087  4.210   -8.216  1.00 0.00 ? 27  ASP A OD2  5  
ATOM   8959  H H    . ASP A 1 27 ? 18.377  0.223   -7.035  1.00 0.00 ? 27  ASP A H    5  
ATOM   8960  H HA   . ASP A 1 27 ? 18.443  3.114   -6.953  1.00 0.00 ? 27  ASP A HA   5  
ATOM   8961  H HB2  . ASP A 1 27 ? 17.410  2.599   -9.242  1.00 0.00 ? 27  ASP A HB2  5  
ATOM   8962  H HB3  . ASP A 1 27 ? 16.033  1.937   -8.362  1.00 0.00 ? 27  ASP A HB3  5  
ATOM   8963  N N    . TYR A 1 28 ? 16.068  2.920   -5.552  1.00 0.00 ? 28  TYR A N    5  
ATOM   8964  C CA   . TYR A 1 28 ? 15.222  2.697   -4.350  1.00 0.00 ? 28  TYR A CA   5  
ATOM   8965  C C    . TYR A 1 28 ? 13.951  3.533   -4.442  1.00 0.00 ? 28  TYR A C    5  
ATOM   8966  O O    . TYR A 1 28 ? 13.687  4.192   -5.429  1.00 0.00 ? 28  TYR A O    5  
ATOM   8967  C CB   . TYR A 1 28 ? 16.003  3.063   -3.081  1.00 0.00 ? 28  TYR A CB   5  
ATOM   8968  C CG   . TYR A 1 28 ? 16.129  4.570   -2.941  1.00 0.00 ? 28  TYR A CG   5  
ATOM   8969  C CD1  . TYR A 1 28 ? 16.829  5.317   -3.908  1.00 0.00 ? 28  TYR A CD1  5  
ATOM   8970  C CD2  . TYR A 1 28 ? 15.552  5.223   -1.832  1.00 0.00 ? 28  TYR A CD2  5  
ATOM   8971  C CE1  . TYR A 1 28 ? 16.951  6.712   -3.768  1.00 0.00 ? 28  TYR A CE1  5  
ATOM   8972  C CE2  . TYR A 1 28 ? 15.675  6.616   -1.690  1.00 0.00 ? 28  TYR A CE2  5  
ATOM   8973  C CZ   . TYR A 1 28 ? 16.374  7.363   -2.659  1.00 0.00 ? 28  TYR A CZ   5  
ATOM   8974  O OH   . TYR A 1 28 ? 16.496  8.730   -2.521  1.00 0.00 ? 28  TYR A OH   5  
ATOM   8975  H H    . TYR A 1 28 ? 15.974  3.742   -6.075  1.00 0.00 ? 28  TYR A H    5  
ATOM   8976  H HA   . TYR A 1 28 ? 14.947  1.654   -4.301  1.00 0.00 ? 28  TYR A HA   5  
ATOM   8977  H HB2  . TYR A 1 28 ? 15.486  2.663   -2.220  1.00 0.00 ? 28  TYR A HB2  5  
ATOM   8978  H HB3  . TYR A 1 28 ? 16.985  2.628   -3.133  1.00 0.00 ? 28  TYR A HB3  5  
ATOM   8979  H HD1  . TYR A 1 28 ? 17.270  4.822   -4.760  1.00 0.00 ? 28  TYR A HD1  5  
ATOM   8980  H HD2  . TYR A 1 28 ? 15.016  4.653   -1.090  1.00 0.00 ? 28  TYR A HD2  5  
ATOM   8981  H HE1  . TYR A 1 28 ? 17.490  7.282   -4.511  1.00 0.00 ? 28  TYR A HE1  5  
ATOM   8982  H HE2  . TYR A 1 28 ? 15.233  7.111   -0.837  1.00 0.00 ? 28  TYR A HE2  5  
ATOM   8983  H HH   . TYR A 1 28 ? 17.329  8.996   -2.916  1.00 0.00 ? 28  TYR A HH   5  
ATOM   8984  N N    . TYR A 1 29 ? 13.160  3.487   -3.417  1.00 0.00 ? 29  TYR A N    5  
ATOM   8985  C CA   . TYR A 1 29 ? 11.885  4.247   -3.410  1.00 0.00 ? 29  TYR A CA   5  
ATOM   8986  C C    . TYR A 1 29 ? 11.413  4.368   -1.956  1.00 0.00 ? 29  TYR A C    5  
ATOM   8987  O O    . TYR A 1 29 ? 11.558  3.451   -1.181  1.00 0.00 ? 29  TYR A O    5  
ATOM   8988  C CB   . TYR A 1 29 ? 10.866  3.473   -4.262  1.00 0.00 ? 29  TYR A CB   5  
ATOM   8989  C CG   . TYR A 1 29 ? 9.455   3.897   -3.926  1.00 0.00 ? 29  TYR A CG   5  
ATOM   8990  C CD1  . TYR A 1 29 ? 9.105   5.257   -3.980  1.00 0.00 ? 29  TYR A CD1  5  
ATOM   8991  C CD2  . TYR A 1 29 ? 8.495   2.934   -3.558  1.00 0.00 ? 29  TYR A CD2  5  
ATOM   8992  C CE1  . TYR A 1 29 ? 7.793   5.659   -3.665  1.00 0.00 ? 29  TYR A CE1  5  
ATOM   8993  C CE2  . TYR A 1 29 ? 7.182   3.335   -3.244  1.00 0.00 ? 29  TYR A CE2  5  
ATOM   8994  C CZ   . TYR A 1 29 ? 6.831   4.698   -3.297  1.00 0.00 ? 29  TYR A CZ   5  
ATOM   8995  O OH   . TYR A 1 29 ? 5.545   5.092   -2.988  1.00 0.00 ? 29  TYR A OH   5  
ATOM   8996  H H    . TYR A 1 29 ? 13.404  2.941   -2.645  1.00 0.00 ? 29  TYR A H    5  
ATOM   8997  H HA   . TYR A 1 29 ? 12.043  5.231   -3.827  1.00 0.00 ? 29  TYR A HA   5  
ATOM   8998  H HB2  . TYR A 1 29 ? 11.055  3.669   -5.306  1.00 0.00 ? 29  TYR A HB2  5  
ATOM   8999  H HB3  . TYR A 1 29 ? 10.978  2.415   -4.074  1.00 0.00 ? 29  TYR A HB3  5  
ATOM   9000  H HD1  . TYR A 1 29 ? 9.845   5.991   -4.265  1.00 0.00 ? 29  TYR A HD1  5  
ATOM   9001  H HD2  . TYR A 1 29 ? 8.767   1.887   -3.520  1.00 0.00 ? 29  TYR A HD2  5  
ATOM   9002  H HE1  . TYR A 1 29 ? 7.524   6.704   -3.707  1.00 0.00 ? 29  TYR A HE1  5  
ATOM   9003  H HE2  . TYR A 1 29 ? 6.446   2.597   -2.960  1.00 0.00 ? 29  TYR A HE2  5  
ATOM   9004  H HH   . TYR A 1 29 ? 5.543   5.417   -2.084  1.00 0.00 ? 29  TYR A HH   5  
ATOM   9005  N N    . GLU A 1 30 ? 10.853  5.485   -1.573  1.00 0.00 ? 30  GLU A N    5  
ATOM   9006  C CA   . GLU A 1 30 ? 10.378  5.637   -0.160  1.00 0.00 ? 30  GLU A CA   5  
ATOM   9007  C C    . GLU A 1 30 ? 8.874   5.357   -0.096  1.00 0.00 ? 30  GLU A C    5  
ATOM   9008  O O    . GLU A 1 30 ? 8.167   5.486   -1.076  1.00 0.00 ? 30  GLU A O    5  
ATOM   9009  C CB   . GLU A 1 30 ? 10.652  7.061   0.321   1.00 0.00 ? 30  GLU A CB   5  
ATOM   9010  C CG   . GLU A 1 30 ? 12.161  7.317   0.335   1.00 0.00 ? 30  GLU A CG   5  
ATOM   9011  C CD   . GLU A 1 30 ? 12.662  7.494   -1.100  1.00 0.00 ? 30  GLU A CD   5  
ATOM   9012  O OE1  . GLU A 1 30 ? 12.645  8.617   -1.577  1.00 0.00 ? 30  GLU A OE1  5  
ATOM   9013  O OE2  . GLU A 1 30 ? 13.053  6.505   -1.697  1.00 0.00 ? 30  GLU A OE2  5  
ATOM   9014  H H    . GLU A 1 30 ? 10.742  6.222   -2.209  1.00 0.00 ? 30  GLU A H    5  
ATOM   9015  H HA   . GLU A 1 30 ? 10.901  4.939   0.484   1.00 0.00 ? 30  GLU A HA   5  
ATOM   9016  H HB2  . GLU A 1 30 ? 10.176  7.758   -0.343  1.00 0.00 ? 30  GLU A HB2  5  
ATOM   9017  H HB3  . GLU A 1 30 ? 10.260  7.186   1.319   1.00 0.00 ? 30  GLU A HB3  5  
ATOM   9018  H HG2  . GLU A 1 30 ? 12.370  8.211   0.903   1.00 0.00 ? 30  GLU A HG2  5  
ATOM   9019  H HG3  . GLU A 1 30 ? 12.665  6.476   0.788   1.00 0.00 ? 30  GLU A HG3  5  
ATOM   9020  N N    . THR A 1 31 ? 8.384   4.965   1.046   1.00 0.00 ? 31  THR A N    5  
ATOM   9021  C CA   . THR A 1 31 ? 6.925   4.664   1.176   1.00 0.00 ? 31  THR A CA   5  
ATOM   9022  C C    . THR A 1 31 ? 6.115   5.961   1.159   1.00 0.00 ? 31  THR A C    5  
ATOM   9023  O O    . THR A 1 31 ? 6.609   7.015   0.812   1.00 0.00 ? 31  THR A O    5  
ATOM   9024  C CB   . THR A 1 31 ? 6.681   3.939   2.501   1.00 0.00 ? 31  THR A CB   5  
ATOM   9025  O OG1  . THR A 1 31 ? 7.392   4.605   3.525   1.00 0.00 ? 31  THR A OG1  5  
ATOM   9026  C CG2  . THR A 1 31 ? 7.164   2.491   2.386   1.00 0.00 ? 31  THR A CG2  5  
ATOM   9027  H H    . THR A 1 31 ? 8.976   4.860   1.821   1.00 0.00 ? 31  THR A H    5  
ATOM   9028  H HA   . THR A 1 31 ? 6.614   4.034   0.358   1.00 0.00 ? 31  THR A HA   5  
ATOM   9029  H HB   . THR A 1 31 ? 5.629   3.947   2.741   1.00 0.00 ? 31  THR A HB   5  
ATOM   9030  H HG1  . THR A 1 31 ? 6.988   5.467   3.655   1.00 0.00 ? 31  THR A HG1  5  
ATOM   9031  H HG21 . THR A 1 31 ? 8.127   2.468   1.899   1.00 0.00 ? 31  THR A HG21 5  
ATOM   9032  H HG22 . THR A 1 31 ? 7.248   2.060   3.371   1.00 0.00 ? 31  THR A HG22 5  
ATOM   9033  H HG23 . THR A 1 31 ? 6.453   1.921   1.803   1.00 0.00 ? 31  THR A HG23 5  
ATOM   9034  N N    . SER A 1 32 ? 4.868   5.882   1.535   1.00 0.00 ? 32  SER A N    5  
ATOM   9035  C CA   . SER A 1 32 ? 4.004   7.093   1.551   1.00 0.00 ? 32  SER A CA   5  
ATOM   9036  C C    . SER A 1 32 ? 4.217   7.858   2.856   1.00 0.00 ? 32  SER A C    5  
ATOM   9037  O O    . SER A 1 32 ? 5.293   7.864   3.421   1.00 0.00 ? 32  SER A O    5  
ATOM   9038  C CB   . SER A 1 32 ? 2.540   6.664   1.451   1.00 0.00 ? 32  SER A CB   5  
ATOM   9039  O OG   . SER A 1 32 ? 2.366   5.849   0.299   1.00 0.00 ? 32  SER A OG   5  
ATOM   9040  H H    . SER A 1 32 ? 4.498   5.016   1.810   1.00 0.00 ? 32  SER A H    5  
ATOM   9041  H HA   . SER A 1 32 ? 4.248   7.728   0.716   1.00 0.00 ? 32  SER A HA   5  
ATOM   9042  H HB2  . SER A 1 32 ? 2.268   6.099   2.328   1.00 0.00 ? 32  SER A HB2  5  
ATOM   9043  H HB3  . SER A 1 32 ? 1.912   7.542   1.382   1.00 0.00 ? 32  SER A HB3  5  
ATOM   9044  H HG   . SER A 1 32 ? 3.183   5.366   0.152   1.00 0.00 ? 32  SER A HG   5  
ATOM   9045  N N    . SER A 1 33 ? 3.192   8.506   3.337   1.00 0.00 ? 33  SER A N    5  
ATOM   9046  C CA   . SER A 1 33 ? 3.305   9.284   4.609   1.00 0.00 ? 33  SER A CA   5  
ATOM   9047  C C    . SER A 1 33 ? 2.030   9.084   5.420   1.00 0.00 ? 33  SER A C    5  
ATOM   9048  O O    . SER A 1 33 ? 2.052   9.017   6.633   1.00 0.00 ? 33  SER A O    5  
ATOM   9049  C CB   . SER A 1 33 ? 3.453   10.764  4.275   1.00 0.00 ? 33  SER A CB   5  
ATOM   9050  O OG   . SER A 1 33 ? 2.171   11.313  4.003   1.00 0.00 ? 33  SER A OG   5  
ATOM   9051  H H    . SER A 1 33 ? 2.340   8.483   2.858   1.00 0.00 ? 33  SER A H    5  
ATOM   9052  H HA   . SER A 1 33 ? 4.159   8.949   5.181   1.00 0.00 ? 33  SER A HA   5  
ATOM   9053  H HB2  . SER A 1 33 ? 3.895   11.285  5.108   1.00 0.00 ? 33  SER A HB2  5  
ATOM   9054  H HB3  . SER A 1 33 ? 4.087   10.866  3.409   1.00 0.00 ? 33  SER A HB3  5  
ATOM   9055  H HG   . SER A 1 33 ? 2.116   12.170  4.433   1.00 0.00 ? 33  SER A HG   5  
ATOM   9056  N N    . LEU A 1 34 ? 0.917   8.993   4.742   1.00 0.00 ? 34  LEU A N    5  
ATOM   9057  C CA   . LEU A 1 34 ? -0.394  8.800   5.429   1.00 0.00 ? 34  LEU A CA   5  
ATOM   9058  C C    . LEU A 1 34 ? -0.243  7.818   6.592   1.00 0.00 ? 34  LEU A C    5  
ATOM   9059  O O    . LEU A 1 34 ? -0.557  8.125   7.725   1.00 0.00 ? 34  LEU A O    5  
ATOM   9060  C CB   . LEU A 1 34 ? -1.411  8.234   4.433   1.00 0.00 ? 34  LEU A CB   5  
ATOM   9061  C CG   . LEU A 1 34 ? -1.285  8.949   3.086   1.00 0.00 ? 34  LEU A CG   5  
ATOM   9062  C CD1  . LEU A 1 34 ? -2.425  8.503   2.169   1.00 0.00 ? 34  LEU A CD1  5  
ATOM   9063  C CD2  . LEU A 1 34 ? -1.360  10.464  3.299   1.00 0.00 ? 34  LEU A CD2  5  
ATOM   9064  H H    . LEU A 1 34 ? 0.948   9.061   3.768   1.00 0.00 ? 34  LEU A H    5  
ATOM   9065  H HA   . LEU A 1 34 ? -0.748  9.746   5.799   1.00 0.00 ? 34  LEU A HA   5  
ATOM   9066  H HB2  . LEU A 1 34 ? -1.232  7.177   4.293   1.00 0.00 ? 34  LEU A HB2  5  
ATOM   9067  H HB3  . LEU A 1 34 ? -2.404  8.380   4.819   1.00 0.00 ? 34  LEU A HB3  5  
ATOM   9068  H HG   . LEU A 1 34 ? -0.342  8.694   2.630   1.00 0.00 ? 34  LEU A HG   5  
ATOM   9069  H HD11 . LEU A 1 34 ? -2.563  7.434   2.255   1.00 0.00 ? 34  LEU A HD11 5  
ATOM   9070  H HD12 . LEU A 1 34 ? -3.337  9.007   2.454   1.00 0.00 ? 34  LEU A HD12 5  
ATOM   9071  H HD13 . LEU A 1 34 ? -2.182  8.751   1.147   1.00 0.00 ? 34  LEU A HD13 5  
ATOM   9072  H HD21 . LEU A 1 34 ? -2.177  10.695  3.966   1.00 0.00 ? 34  LEU A HD21 5  
ATOM   9073  H HD22 . LEU A 1 34 ? -0.434  10.813  3.731   1.00 0.00 ? 34  LEU A HD22 5  
ATOM   9074  H HD23 . LEU A 1 34 ? -1.521  10.954  2.350   1.00 0.00 ? 34  LEU A HD23 5  
ATOM   9075  N N    . CYS A 1 35 ? 0.235   6.640   6.315   1.00 0.00 ? 35  CYS A N    5  
ATOM   9076  C CA   . CYS A 1 35 ? 0.406   5.634   7.398   1.00 0.00 ? 35  CYS A CA   5  
ATOM   9077  C C    . CYS A 1 35 ? 1.544   6.076   8.323   1.00 0.00 ? 35  CYS A C    5  
ATOM   9078  O O    . CYS A 1 35 ? 2.618   6.423   7.882   1.00 0.00 ? 35  CYS A O    5  
ATOM   9079  C CB   . CYS A 1 35 ? 0.724   4.266   6.782   1.00 0.00 ? 35  CYS A CB   5  
ATOM   9080  S SG   . CYS A 1 35 ? 1.851   4.470   5.379   1.00 0.00 ? 35  CYS A SG   5  
ATOM   9081  H H    . CYS A 1 35 ? 0.477   6.418   5.392   1.00 0.00 ? 35  CYS A H    5  
ATOM   9082  H HA   . CYS A 1 35 ? -0.510  5.566   7.966   1.00 0.00 ? 35  CYS A HA   5  
ATOM   9083  H HB2  . CYS A 1 35 ? 1.187   3.636   7.524   1.00 0.00 ? 35  CYS A HB2  5  
ATOM   9084  H HB3  . CYS A 1 35 ? -0.192  3.805   6.441   1.00 0.00 ? 35  CYS A HB3  5  
ATOM   9085  N N    . SER A 1 36 ? 1.301   6.091   9.604   1.00 0.00 ? 36  SER A N    5  
ATOM   9086  C CA   . SER A 1 36 ? 2.353   6.523   10.570  1.00 0.00 ? 36  SER A CA   5  
ATOM   9087  C C    . SER A 1 36 ? 3.528   5.532   10.597  1.00 0.00 ? 36  SER A C    5  
ATOM   9088  O O    . SER A 1 36 ? 4.146   5.342   11.624  1.00 0.00 ? 36  SER A O    5  
ATOM   9089  C CB   . SER A 1 36 ? 1.742   6.612   11.968  1.00 0.00 ? 36  SER A CB   5  
ATOM   9090  O OG   . SER A 1 36 ? 0.579   7.429   11.922  1.00 0.00 ? 36  SER A OG   5  
ATOM   9091  H H    . SER A 1 36 ? 0.417   5.825   9.934   1.00 0.00 ? 36  SER A H    5  
ATOM   9092  H HA   . SER A 1 36 ? 2.718   7.498   10.283  1.00 0.00 ? 36  SER A HA   5  
ATOM   9093  H HB2  . SER A 1 36 ? 1.470   5.627   12.309  1.00 0.00 ? 36  SER A HB2  5  
ATOM   9094  H HB3  . SER A 1 36 ? 2.466   7.039   12.650  1.00 0.00 ? 36  SER A HB3  5  
ATOM   9095  H HG   . SER A 1 36 ? 0.082   7.192   11.134  1.00 0.00 ? 36  SER A HG   5  
ATOM   9096  N N    . GLN A 1 37 ? 3.852   4.891   9.499   1.00 0.00 ? 37  GLN A N    5  
ATOM   9097  C CA   . GLN A 1 37 ? 4.994   3.923   9.531   1.00 0.00 ? 37  GLN A CA   5  
ATOM   9098  C C    . GLN A 1 37 ? 5.628   3.773   8.140   1.00 0.00 ? 37  GLN A C    5  
ATOM   9099  O O    . GLN A 1 37 ? 5.573   2.706   7.562   1.00 0.00 ? 37  GLN A O    5  
ATOM   9100  C CB   . GLN A 1 37 ? 4.482   2.558   10.003  1.00 0.00 ? 37  GLN A CB   5  
ATOM   9101  C CG   . GLN A 1 37 ? 3.184   2.212   9.267   1.00 0.00 ? 37  GLN A CG   5  
ATOM   9102  C CD   . GLN A 1 37 ? 2.703   0.828   9.705   1.00 0.00 ? 37  GLN A CD   5  
ATOM   9103  O OE1  . GLN A 1 37 ? 1.779   0.284   9.134   1.00 0.00 ? 37  GLN A OE1  5  
ATOM   9104  N NE2  . GLN A 1 37 ? 3.296   0.230   10.702  1.00 0.00 ? 37  GLN A NE2  5  
ATOM   9105  H H    . GLN A 1 37 ? 3.353   5.038   8.669   1.00 0.00 ? 37  GLN A H    5  
ATOM   9106  H HA   . GLN A 1 37 ? 5.748   4.272   10.224  1.00 0.00 ? 37  GLN A HA   5  
ATOM   9107  H HB2  . GLN A 1 37 ? 5.226   1.803   9.796   1.00 0.00 ? 37  GLN A HB2  5  
ATOM   9108  H HB3  . GLN A 1 37 ? 4.291   2.594   11.064  1.00 0.00 ? 37  GLN A HB3  5  
ATOM   9109  H HG2  . GLN A 1 37 ? 2.428   2.948   9.504   1.00 0.00 ? 37  GLN A HG2  5  
ATOM   9110  H HG3  . GLN A 1 37 ? 3.362   2.209   8.203   1.00 0.00 ? 37  GLN A HG3  5  
ATOM   9111  H HE21 . GLN A 1 37 ? 4.042   0.668   11.163  1.00 0.00 ? 37  GLN A HE21 5  
ATOM   9112  H HE22 . GLN A 1 37 ? 2.996   -0.657  10.991  1.00 0.00 ? 37  GLN A HE22 5  
ATOM   9113  N N    . PRO A 1 38 ? 6.237   4.830   7.645   1.00 0.00 ? 38  PRO A N    5  
ATOM   9114  C CA   . PRO A 1 38 ? 6.905   4.788   6.330   1.00 0.00 ? 38  PRO A CA   5  
ATOM   9115  C C    . PRO A 1 38 ? 8.136   3.873   6.422   1.00 0.00 ? 38  PRO A C    5  
ATOM   9116  O O    . PRO A 1 38 ? 8.422   3.295   7.451   1.00 0.00 ? 38  PRO A O    5  
ATOM   9117  C CB   . PRO A 1 38 ? 7.316   6.253   6.049   1.00 0.00 ? 38  PRO A CB   5  
ATOM   9118  C CG   . PRO A 1 38 ? 7.022   7.075   7.339   1.00 0.00 ? 38  PRO A CG   5  
ATOM   9119  C CD   . PRO A 1 38 ? 6.304   6.136   8.336   1.00 0.00 ? 38  PRO A CD   5  
ATOM   9120  H HA   . PRO A 1 38 ? 6.228   4.431   5.560   1.00 0.00 ? 38  PRO A HA   5  
ATOM   9121  H HB2  . PRO A 1 38 ? 8.371   6.310   5.802   1.00 0.00 ? 38  PRO A HB2  5  
ATOM   9122  H HB3  . PRO A 1 38 ? 6.732   6.648   5.228   1.00 0.00 ? 38  PRO A HB3  5  
ATOM   9123  H HG2  . PRO A 1 38 ? 7.952   7.432   7.767   1.00 0.00 ? 38  PRO A HG2  5  
ATOM   9124  H HG3  . PRO A 1 38 ? 6.384   7.918   7.106   1.00 0.00 ? 38  PRO A HG3  5  
ATOM   9125  H HD2  . PRO A 1 38 ? 6.874   6.051   9.252   1.00 0.00 ? 38  PRO A HD2  5  
ATOM   9126  H HD3  . PRO A 1 38 ? 5.310   6.497   8.546   1.00 0.00 ? 38  PRO A HD3  5  
ATOM   9127  N N    . ALA A 1 39 ? 8.861   3.752   5.351   1.00 0.00 ? 39  ALA A N    5  
ATOM   9128  C CA   . ALA A 1 39 ? 10.073  2.899   5.342   1.00 0.00 ? 39  ALA A CA   5  
ATOM   9129  C C    . ALA A 1 39 ? 10.793  3.128   4.018   1.00 0.00 ? 39  ALA A C    5  
ATOM   9130  O O    . ALA A 1 39 ? 10.251  3.740   3.118   1.00 0.00 ? 39  ALA A O    5  
ATOM   9131  C CB   . ALA A 1 39 ? 9.671   1.428   5.459   1.00 0.00 ? 39  ALA A CB   5  
ATOM   9132  H H    . ALA A 1 39 ? 8.614   4.235   4.546   1.00 0.00 ? 39  ALA A H    5  
ATOM   9133  H HA   . ALA A 1 39 ? 10.719  3.171   6.162   1.00 0.00 ? 39  ALA A HA   5  
ATOM   9134  H HB1  . ALA A 1 39 ? 9.114   1.279   6.373   1.00 0.00 ? 39  ALA A HB1  5  
ATOM   9135  H HB2  . ALA A 1 39 ? 9.055   1.154   4.616   1.00 0.00 ? 39  ALA A HB2  5  
ATOM   9136  H HB3  . ALA A 1 39 ? 10.557  0.812   5.474   1.00 0.00 ? 39  ALA A HB3  5  
ATOM   9137  N N    . VAL A 1 40 ? 11.989  2.629   3.867   1.00 0.00 ? 40  VAL A N    5  
ATOM   9138  C CA   . VAL A 1 40 ? 12.710  2.808   2.571   1.00 0.00 ? 40  VAL A CA   5  
ATOM   9139  C C    . VAL A 1 40 ? 12.508  1.535   1.753   1.00 0.00 ? 40  VAL A C    5  
ATOM   9140  O O    . VAL A 1 40 ? 12.441  0.446   2.289   1.00 0.00 ? 40  VAL A O    5  
ATOM   9141  C CB   . VAL A 1 40 ? 14.205  3.043   2.828   1.00 0.00 ? 40  VAL A CB   5  
ATOM   9142  C CG1  . VAL A 1 40 ? 14.995  2.822   1.533   1.00 0.00 ? 40  VAL A CG1  5  
ATOM   9143  C CG2  . VAL A 1 40 ? 14.412  4.484   3.295   1.00 0.00 ? 40  VAL A CG2  5  
ATOM   9144  H H    . VAL A 1 40 ? 12.405  2.117   4.596   1.00 0.00 ? 40  VAL A H    5  
ATOM   9145  H HA   . VAL A 1 40 ? 12.298  3.656   2.024   1.00 0.00 ? 40  VAL A HA   5  
ATOM   9146  H HB   . VAL A 1 40 ? 14.554  2.360   3.588   1.00 0.00 ? 40  VAL A HB   5  
ATOM   9147  H HG11 . VAL A 1 40 ? 14.475  3.294   0.714   1.00 0.00 ? 40  VAL A HG11 5  
ATOM   9148  H HG12 . VAL A 1 40 ? 15.981  3.251   1.631   1.00 0.00 ? 40  VAL A HG12 5  
ATOM   9149  H HG13 . VAL A 1 40 ? 15.080  1.763   1.341   1.00 0.00 ? 40  VAL A HG13 5  
ATOM   9150  H HG21 . VAL A 1 40 ? 13.730  4.702   4.103   1.00 0.00 ? 40  VAL A HG21 5  
ATOM   9151  H HG22 . VAL A 1 40 ? 15.429  4.609   3.636   1.00 0.00 ? 40  VAL A HG22 5  
ATOM   9152  H HG23 . VAL A 1 40 ? 14.223  5.158   2.471   1.00 0.00 ? 40  VAL A HG23 5  
ATOM   9153  N N    . VAL A 1 41 ? 12.391  1.673   0.462   1.00 0.00 ? 41  VAL A N    5  
ATOM   9154  C CA   . VAL A 1 41 ? 12.168  0.486   -0.424  1.00 0.00 ? 41  VAL A CA   5  
ATOM   9155  C C    . VAL A 1 41 ? 13.307  0.387   -1.440  1.00 0.00 ? 41  VAL A C    5  
ATOM   9156  O O    . VAL A 1 41 ? 13.495  1.256   -2.260  1.00 0.00 ? 41  VAL A O    5  
ATOM   9157  C CB   . VAL A 1 41 ? 10.829  0.666   -1.144  1.00 0.00 ? 41  VAL A CB   5  
ATOM   9158  C CG1  . VAL A 1 41 ? 10.338  -0.671  -1.694  1.00 0.00 ? 41  VAL A CG1  5  
ATOM   9159  C CG2  . VAL A 1 41 ? 9.798   1.206   -0.149  1.00 0.00 ? 41  VAL A CG2  5  
ATOM   9160  H H    . VAL A 1 41 ? 12.439  2.569   0.070   1.00 0.00 ? 41  VAL A H    5  
ATOM   9161  H HA   . VAL A 1 41 ? 12.137  -0.414  0.166   1.00 0.00 ? 41  VAL A HA   5  
ATOM   9162  H HB   . VAL A 1 41 ? 10.946  1.363   -1.959  1.00 0.00 ? 41  VAL A HB   5  
ATOM   9163  H HG11 . VAL A 1 41 ? 10.324  -1.406  -0.902  1.00 0.00 ? 41  VAL A HG11 5  
ATOM   9164  H HG12 . VAL A 1 41 ? 9.342   -0.543  -2.085  1.00 0.00 ? 41  VAL A HG12 5  
ATOM   9165  H HG13 . VAL A 1 41 ? 10.997  -1.001  -2.483  1.00 0.00 ? 41  VAL A HG13 5  
ATOM   9166  H HG21 . VAL A 1 41 ? 9.784   0.577   0.729   1.00 0.00 ? 41  VAL A HG21 5  
ATOM   9167  H HG22 . VAL A 1 41 ? 10.063  2.213   0.136   1.00 0.00 ? 41  VAL A HG22 5  
ATOM   9168  H HG23 . VAL A 1 41 ? 8.821   1.206   -0.607  1.00 0.00 ? 41  VAL A HG23 5  
ATOM   9169  N N    . PHE A 1 42 ? 14.084  -0.664  -1.386  1.00 0.00 ? 42  PHE A N    5  
ATOM   9170  C CA   . PHE A 1 42 ? 15.222  -0.799  -2.344  1.00 0.00 ? 42  PHE A CA   5  
ATOM   9171  C C    . PHE A 1 42 ? 14.769  -1.523  -3.615  1.00 0.00 ? 42  PHE A C    5  
ATOM   9172  O O    . PHE A 1 42 ? 14.103  -2.537  -3.568  1.00 0.00 ? 42  PHE A O    5  
ATOM   9173  C CB   . PHE A 1 42 ? 16.350  -1.610  -1.694  1.00 0.00 ? 42  PHE A CB   5  
ATOM   9174  C CG   . PHE A 1 42 ? 17.092  -0.758  -0.687  1.00 0.00 ? 42  PHE A CG   5  
ATOM   9175  C CD1  . PHE A 1 42 ? 17.800  0.384   -1.113  1.00 0.00 ? 42  PHE A CD1  5  
ATOM   9176  C CD2  . PHE A 1 42 ? 17.085  -1.111  0.676   1.00 0.00 ? 42  PHE A CD2  5  
ATOM   9177  C CE1  . PHE A 1 42 ? 18.497  1.170   -0.177  1.00 0.00 ? 42  PHE A CE1  5  
ATOM   9178  C CE2  . PHE A 1 42 ? 17.784  -0.326  1.611   1.00 0.00 ? 42  PHE A CE2  5  
ATOM   9179  C CZ   . PHE A 1 42 ? 18.490  0.816   1.184   1.00 0.00 ? 42  PHE A CZ   5  
ATOM   9180  H H    . PHE A 1 42 ? 13.926  -1.357  -0.710  1.00 0.00 ? 42  PHE A H    5  
ATOM   9181  H HA   . PHE A 1 42 ? 15.592  0.179   -2.606  1.00 0.00 ? 42  PHE A HA   5  
ATOM   9182  H HB2  . PHE A 1 42 ? 15.930  -2.473  -1.200  1.00 0.00 ? 42  PHE A HB2  5  
ATOM   9183  H HB3  . PHE A 1 42 ? 17.043  -1.940  -2.456  1.00 0.00 ? 42  PHE A HB3  5  
ATOM   9184  H HD1  . PHE A 1 42 ? 17.808  0.658   -2.157  1.00 0.00 ? 42  PHE A HD1  5  
ATOM   9185  H HD2  . PHE A 1 42 ? 16.542  -1.985  1.006   1.00 0.00 ? 42  PHE A HD2  5  
ATOM   9186  H HE1  . PHE A 1 42 ? 19.039  2.045   -0.504  1.00 0.00 ? 42  PHE A HE1  5  
ATOM   9187  H HE2  . PHE A 1 42 ? 17.778  -0.599  2.654   1.00 0.00 ? 42  PHE A HE2  5  
ATOM   9188  H HZ   . PHE A 1 42 ? 19.027  1.418   1.902   1.00 0.00 ? 42  PHE A HZ   5  
ATOM   9189  N N    . GLN A 1 43 ? 15.165  -1.014  -4.753  1.00 0.00 ? 43  GLN A N    5  
ATOM   9190  C CA   . GLN A 1 43 ? 14.812  -1.666  -6.047  1.00 0.00 ? 43  GLN A CA   5  
ATOM   9191  C C    . GLN A 1 43 ? 16.017  -2.515  -6.461  1.00 0.00 ? 43  GLN A C    5  
ATOM   9192  O O    . GLN A 1 43 ? 17.120  -2.008  -6.573  1.00 0.00 ? 43  GLN A O    5  
ATOM   9193  C CB   . GLN A 1 43 ? 14.539  -0.580  -7.089  1.00 0.00 ? 43  GLN A CB   5  
ATOM   9194  C CG   . GLN A 1 43 ? 13.324  0.247   -6.658  1.00 0.00 ? 43  GLN A CG   5  
ATOM   9195  C CD   . GLN A 1 43 ? 13.275  1.544   -7.468  1.00 0.00 ? 43  GLN A CD   5  
ATOM   9196  O OE1  . GLN A 1 43 ? 12.874  2.574   -6.964  1.00 0.00 ? 43  GLN A OE1  5  
ATOM   9197  N NE2  . GLN A 1 43 ? 13.671  1.538   -8.713  1.00 0.00 ? 43  GLN A NE2  5  
ATOM   9198  H H    . GLN A 1 43 ? 15.724  -0.209  -4.755  1.00 0.00 ? 43  GLN A H    5  
ATOM   9199  H HA   . GLN A 1 43 ? 13.943  -2.292  -5.925  1.00 0.00 ? 43  GLN A HA   5  
ATOM   9200  H HB2  . GLN A 1 43 ? 15.402  0.062   -7.169  1.00 0.00 ? 43  GLN A HB2  5  
ATOM   9201  H HB3  . GLN A 1 43 ? 14.339  -1.032  -8.042  1.00 0.00 ? 43  GLN A HB3  5  
ATOM   9202  H HG2  . GLN A 1 43 ? 12.422  -0.321  -6.835  1.00 0.00 ? 43  GLN A HG2  5  
ATOM   9203  H HG3  . GLN A 1 43 ? 13.400  0.483   -5.608  1.00 0.00 ? 43  GLN A HG3  5  
ATOM   9204  H HE21 . GLN A 1 43 ? 13.994  0.707   -9.118  1.00 0.00 ? 43  GLN A HE21 5  
ATOM   9205  H HE22 . GLN A 1 43 ? 13.643  2.363   -9.240  1.00 0.00 ? 43  GLN A HE22 5  
ATOM   9206  N N    . THR A 1 44 ? 15.845  -3.812  -6.634  1.00 0.00 ? 44  THR A N    5  
ATOM   9207  C CA   . THR A 1 44 ? 17.033  -4.678  -6.970  1.00 0.00 ? 44  THR A CA   5  
ATOM   9208  C C    . THR A 1 44 ? 17.125  -4.983  -8.465  1.00 0.00 ? 44  THR A C    5  
ATOM   9209  O O    . THR A 1 44 ? 16.546  -4.313  -9.298  1.00 0.00 ? 44  THR A O    5  
ATOM   9210  C CB   . THR A 1 44 ? 16.923  -6.000  -6.213  1.00 0.00 ? 44  THR A CB   5  
ATOM   9211  O OG1  . THR A 1 44 ? 16.063  -6.873  -6.925  1.00 0.00 ? 44  THR A OG1  5  
ATOM   9212  C CG2  . THR A 1 44 ? 16.351  -5.741  -4.817  1.00 0.00 ? 44  THR A CG2  5  
ATOM   9213  H H    . THR A 1 44 ? 14.949  -4.220  -6.502  1.00 0.00 ? 44  THR A H    5  
ATOM   9214  H HA   . THR A 1 44 ? 17.942  -4.181  -6.662  1.00 0.00 ? 44  THR A HA   5  
ATOM   9215  H HB   . THR A 1 44 ? 17.901  -6.447  -6.122  1.00 0.00 ? 44  THR A HB   5  
ATOM   9216  H HG1  . THR A 1 44 ? 16.371  -6.917  -7.833  1.00 0.00 ? 44  THR A HG1  5  
ATOM   9217  H HG21 . THR A 1 44 ? 16.819  -4.866  -4.391  1.00 0.00 ? 44  THR A HG21 5  
ATOM   9218  H HG22 . THR A 1 44 ? 15.286  -5.581  -4.890  1.00 0.00 ? 44  THR A HG22 5  
ATOM   9219  H HG23 . THR A 1 44 ? 16.543  -6.594  -4.185  1.00 0.00 ? 44  THR A HG23 5  
ATOM   9220  N N    . LYS A 1 45 ? 17.882  -6.005  -8.795  1.00 0.00 ? 45  LYS A N    5  
ATOM   9221  C CA   . LYS A 1 45 ? 18.077  -6.405  -10.222 1.00 0.00 ? 45  LYS A CA   5  
ATOM   9222  C C    . LYS A 1 45 ? 17.304  -7.695  -10.516 1.00 0.00 ? 45  LYS A C    5  
ATOM   9223  O O    . LYS A 1 45 ? 16.993  -7.989  -11.654 1.00 0.00 ? 45  LYS A O    5  
ATOM   9224  C CB   . LYS A 1 45 ? 19.562  -6.674  -10.467 1.00 0.00 ? 45  LYS A CB   5  
ATOM   9225  C CG   . LYS A 1 45 ? 20.397  -5.517  -9.921  1.00 0.00 ? 45  LYS A CG   5  
ATOM   9226  C CD   . LYS A 1 45 ? 21.884  -5.826  -10.122 1.00 0.00 ? 45  LYS A CD   5  
ATOM   9227  C CE   . LYS A 1 45 ? 22.690  -4.534  -10.023 1.00 0.00 ? 45  LYS A CE   5  
ATOM   9228  N NZ   . LYS A 1 45 ? 22.501  -3.930  -8.673  1.00 0.00 ? 45  LYS A NZ   5  
ATOM   9229  H H    . LYS A 1 45 ? 18.339  -6.510  -8.091  1.00 0.00 ? 45  LYS A H    5  
ATOM   9230  H HA   . LYS A 1 45 ? 17.746  -5.616  -10.880 1.00 0.00 ? 45  LYS A HA   5  
ATOM   9231  H HB2  . LYS A 1 45 ? 19.848  -7.590  -9.968  1.00 0.00 ? 45  LYS A HB2  5  
ATOM   9232  H HB3  . LYS A 1 45 ? 19.739  -6.774  -11.527 1.00 0.00 ? 45  LYS A HB3  5  
ATOM   9233  H HG2  . LYS A 1 45 ? 20.137  -4.610  -10.448 1.00 0.00 ? 45  LYS A HG2  5  
ATOM   9234  H HG3  . LYS A 1 45 ? 20.198  -5.392  -8.868  1.00 0.00 ? 45  LYS A HG3  5  
ATOM   9235  H HD2  . LYS A 1 45 ? 22.214  -6.516  -9.359  1.00 0.00 ? 45  LYS A HD2  5  
ATOM   9236  H HD3  . LYS A 1 45 ? 22.036  -6.266  -11.097 1.00 0.00 ? 45  LYS A HD3  5  
ATOM   9237  H HE2  . LYS A 1 45 ? 23.734  -4.750  -10.177 1.00 0.00 ? 45  LYS A HE2  5  
ATOM   9238  H HE3  . LYS A 1 45 ? 22.349  -3.842  -10.778 1.00 0.00 ? 45  LYS A HE3  5  
ATOM   9239  H HZ1  . LYS A 1 45 ? 21.507  -4.039  -8.381  1.00 0.00 ? 45  LYS A HZ1  5  
ATOM   9240  H HZ2  . LYS A 1 45 ? 23.118  -4.410  -7.988  1.00 0.00 ? 45  LYS A HZ2  5  
ATOM   9241  H HZ3  . LYS A 1 45 ? 22.744  -2.920  -8.708  1.00 0.00 ? 45  LYS A HZ3  5  
ATOM   9242  N N    . ARG A 1 46 ? 17.009  -8.477  -9.502  1.00 0.00 ? 46  ARG A N    5  
ATOM   9243  C CA   . ARG A 1 46 ? 16.275  -9.768  -9.718  1.00 0.00 ? 46  ARG A CA   5  
ATOM   9244  C C    . ARG A 1 46 ? 15.089  -9.828  -8.754  1.00 0.00 ? 46  ARG A C    5  
ATOM   9245  O O    . ARG A 1 46 ? 14.905  -10.775 -8.022  1.00 0.00 ? 46  ARG A O    5  
ATOM   9246  C CB   . ARG A 1 46 ? 17.238  -10.944 -9.456  1.00 0.00 ? 46  ARG A CB   5  
ATOM   9247  C CG   . ARG A 1 46 ? 16.758  -12.232 -10.166 1.00 0.00 ? 46  ARG A CG   5  
ATOM   9248  C CD   . ARG A 1 46 ? 15.629  -12.919 -9.383  1.00 0.00 ? 46  ARG A CD   5  
ATOM   9249  N NE   . ARG A 1 46 ? 15.548  -14.347 -9.795  1.00 0.00 ? 46  ARG A NE   5  
ATOM   9250  C CZ   . ARG A 1 46 ? 14.888  -15.200 -9.060  1.00 0.00 ? 46  ARG A CZ   5  
ATOM   9251  N NH1  . ARG A 1 46 ? 14.300  -14.801 -7.965  1.00 0.00 ? 46  ARG A NH1  5  
ATOM   9252  N NH2  . ARG A 1 46 ? 14.815  -16.453 -9.420  1.00 0.00 ? 46  ARG A NH2  5  
ATOM   9253  H H    . ARG A 1 46 ? 17.283  -8.222  -8.596  1.00 0.00 ? 46  ARG A H    5  
ATOM   9254  H HA   . ARG A 1 46 ? 15.906  -9.817  -10.733 1.00 0.00 ? 46  ARG A HA   5  
ATOM   9255  H HB2  . ARG A 1 46 ? 18.217  -10.683 -9.831  1.00 0.00 ? 46  ARG A HB2  5  
ATOM   9256  H HB3  . ARG A 1 46 ? 17.306  -11.123 -8.394  1.00 0.00 ? 46  ARG A HB3  5  
ATOM   9257  H HG2  . ARG A 1 46 ? 16.405  -11.992 -11.157 1.00 0.00 ? 46  ARG A HG2  5  
ATOM   9258  H HG3  . ARG A 1 46 ? 17.591  -12.914 -10.248 1.00 0.00 ? 46  ARG A HG3  5  
ATOM   9259  H HD2  . ARG A 1 46 ? 15.829  -12.867 -8.323  1.00 0.00 ? 46  ARG A HD2  5  
ATOM   9260  H HD3  . ARG A 1 46 ? 14.689  -12.434 -9.602  1.00 0.00 ? 46  ARG A HD3  5  
ATOM   9261  H HE   . ARG A 1 46 ? 15.990  -14.647 -10.617 1.00 0.00 ? 46  ARG A HE   5  
ATOM   9262  H HH11 . ARG A 1 46 ? 14.357  -13.841 -7.689  1.00 0.00 ? 46  ARG A HH11 5  
ATOM   9263  H HH12 . ARG A 1 46 ? 13.794  -15.454 -7.402  1.00 0.00 ? 46  ARG A HH12 5  
ATOM   9264  H HH21 . ARG A 1 46 ? 15.265  -16.759 -10.259 1.00 0.00 ? 46  ARG A HH21 5  
ATOM   9265  H HH22 . ARG A 1 46 ? 14.309  -17.106 -8.857  1.00 0.00 ? 46  ARG A HH22 5  
ATOM   9266  N N    . SER A 1 47 ? 14.280  -8.814  -8.756  1.00 0.00 ? 47  SER A N    5  
ATOM   9267  C CA   . SER A 1 47 ? 13.099  -8.795  -7.869  1.00 0.00 ? 47  SER A CA   5  
ATOM   9268  C C    . SER A 1 47 ? 12.225  -7.621  -8.290  1.00 0.00 ? 47  SER A C    5  
ATOM   9269  O O    . SER A 1 47 ? 11.806  -7.525  -9.425  1.00 0.00 ? 47  SER A O    5  
ATOM   9270  C CB   . SER A 1 47 ? 13.532  -8.653  -6.402  1.00 0.00 ? 47  SER A CB   5  
ATOM   9271  O OG   . SER A 1 47 ? 13.951  -7.320  -6.152  1.00 0.00 ? 47  SER A OG   5  
ATOM   9272  H H    . SER A 1 47 ? 14.446  -8.056  -9.351  1.00 0.00 ? 47  SER A H    5  
ATOM   9273  H HA   . SER A 1 47 ? 12.546  -9.710  -7.993  1.00 0.00 ? 47  SER A HA   5  
ATOM   9274  H HB2  . SER A 1 47 ? 12.704  -8.888  -5.755  1.00 0.00 ? 47  SER A HB2  5  
ATOM   9275  H HB3  . SER A 1 47 ? 14.344  -9.340  -6.200  1.00 0.00 ? 47  SER A HB3  5  
ATOM   9276  H HG   . SER A 1 47 ? 14.624  -7.344  -5.468  1.00 0.00 ? 47  SER A HG   5  
ATOM   9277  N N    . LYS A 1 48 ? 11.970  -6.724  -7.400  1.00 0.00 ? 48  LYS A N    5  
ATOM   9278  C CA   . LYS A 1 48 ? 11.146  -5.538  -7.736  1.00 0.00 ? 48  LYS A CA   5  
ATOM   9279  C C    . LYS A 1 48 ? 11.425  -4.480  -6.669  1.00 0.00 ? 48  LYS A C    5  
ATOM   9280  O O    . LYS A 1 48 ? 12.311  -3.660  -6.806  1.00 0.00 ? 48  LYS A O    5  
ATOM   9281  C CB   . LYS A 1 48 ? 9.643   -5.934  -7.752  1.00 0.00 ? 48  LYS A CB   5  
ATOM   9282  C CG   . LYS A 1 48 ? 9.096   -5.948  -9.191  1.00 0.00 ? 48  LYS A CG   5  
ATOM   9283  C CD   . LYS A 1 48 ? 8.778   -4.519  -9.638  1.00 0.00 ? 48  LYS A CD   5  
ATOM   9284  C CE   . LYS A 1 48 ? 8.240   -4.539  -11.070 1.00 0.00 ? 48  LYS A CE   5  
ATOM   9285  N NZ   . LYS A 1 48 ? 9.361   -4.792  -12.018 1.00 0.00 ? 48  LYS A NZ   5  
ATOM   9286  H H    . LYS A 1 48 ? 12.345  -6.816  -6.505  1.00 0.00 ? 48  LYS A H    5  
ATOM   9287  H HA   . LYS A 1 48 ? 11.448  -5.155  -8.701  1.00 0.00 ? 48  LYS A HA   5  
ATOM   9288  H HB2  . LYS A 1 48 ? 9.537   -6.921  -7.328  1.00 0.00 ? 48  LYS A HB2  5  
ATOM   9289  H HB3  . LYS A 1 48 ? 9.063   -5.235  -7.165  1.00 0.00 ? 48  LYS A HB3  5  
ATOM   9290  H HG2  . LYS A 1 48 ? 9.830   -6.378  -9.855  1.00 0.00 ? 48  LYS A HG2  5  
ATOM   9291  H HG3  . LYS A 1 48 ? 8.194   -6.542  -9.224  1.00 0.00 ? 48  LYS A HG3  5  
ATOM   9292  H HD2  . LYS A 1 48 ? 8.033   -4.093  -8.980  1.00 0.00 ? 48  LYS A HD2  5  
ATOM   9293  H HD3  . LYS A 1 48 ? 9.675   -3.921  -9.602  1.00 0.00 ? 48  LYS A HD3  5  
ATOM   9294  H HE2  . LYS A 1 48 ? 7.503   -5.324  -11.167 1.00 0.00 ? 48  LYS A HE2  5  
ATOM   9295  H HE3  . LYS A 1 48 ? 7.784   -3.587  -11.298 1.00 0.00 ? 48  LYS A HE3  5  
ATOM   9296  H HZ1  . LYS A 1 48 ? 10.255  -4.858  -11.487 1.00 0.00 ? 48  LYS A HZ1  5  
ATOM   9297  H HZ2  . LYS A 1 48 ? 9.193   -5.684  -12.526 1.00 0.00 ? 48  LYS A HZ2  5  
ATOM   9298  H HZ3  . LYS A 1 48 ? 9.421   -4.013  -12.702 1.00 0.00 ? 48  LYS A HZ3  5  
ATOM   9299  N N    . GLN A 1 49 ? 10.675  -4.522  -5.600  1.00 0.00 ? 49  GLN A N    5  
ATOM   9300  C CA   . GLN A 1 49 ? 10.853  -3.551  -4.484  1.00 0.00 ? 49  GLN A CA   5  
ATOM   9301  C C    . GLN A 1 49 ? 11.022  -4.335  -3.175  1.00 0.00 ? 49  GLN A C    5  
ATOM   9302  O O    . GLN A 1 49 ? 10.433  -5.383  -2.986  1.00 0.00 ? 49  GLN A O    5  
ATOM   9303  C CB   . GLN A 1 49 ? 9.596   -2.661  -4.412  1.00 0.00 ? 49  GLN A CB   5  
ATOM   9304  C CG   . GLN A 1 49 ? 9.815   -1.363  -5.200  1.00 0.00 ? 49  GLN A CG   5  
ATOM   9305  C CD   . GLN A 1 49 ? 8.574   -0.476  -5.079  1.00 0.00 ? 49  GLN A CD   5  
ATOM   9306  O OE1  . GLN A 1 49 ? 7.708   -0.733  -4.266  1.00 0.00 ? 49  GLN A OE1  5  
ATOM   9307  N NE2  . GLN A 1 49 ? 8.452   0.564   -5.856  1.00 0.00 ? 49  GLN A NE2  5  
ATOM   9308  H H    . GLN A 1 49 ? 9.982   -5.211  -5.527  1.00 0.00 ? 49  GLN A H    5  
ATOM   9309  H HA   . GLN A 1 49 ? 11.733  -2.940  -4.651  1.00 0.00 ? 49  GLN A HA   5  
ATOM   9310  H HB2  . GLN A 1 49 ? 8.762   -3.196  -4.840  1.00 0.00 ? 49  GLN A HB2  5  
ATOM   9311  H HB3  . GLN A 1 49 ? 9.372   -2.421  -3.386  1.00 0.00 ? 49  GLN A HB3  5  
ATOM   9312  H HG2  . GLN A 1 49 ? 10.673  -0.841  -4.803  1.00 0.00 ? 49  GLN A HG2  5  
ATOM   9313  H HG3  . GLN A 1 49 ? 9.986   -1.598  -6.240  1.00 0.00 ? 49  GLN A HG3  5  
ATOM   9314  H HE21 . GLN A 1 49 ? 9.150   0.770   -6.511  1.00 0.00 ? 49  GLN A HE21 5  
ATOM   9315  H HE22 . GLN A 1 49 ? 7.660   1.138   -5.786  1.00 0.00 ? 49  GLN A HE22 5  
ATOM   9316  N N    . VAL A 1 50 ? 11.823  -3.832  -2.271  1.00 0.00 ? 50  VAL A N    5  
ATOM   9317  C CA   . VAL A 1 50 ? 12.036  -4.534  -0.967  1.00 0.00 ? 50  VAL A CA   5  
ATOM   9318  C C    . VAL A 1 50 ? 12.033  -3.508  0.159   1.00 0.00 ? 50  VAL A C    5  
ATOM   9319  O O    . VAL A 1 50 ? 12.820  -2.587  0.166   1.00 0.00 ? 50  VAL A O    5  
ATOM   9320  C CB   . VAL A 1 50 ? 13.385  -5.258  -0.988  1.00 0.00 ? 50  VAL A CB   5  
ATOM   9321  C CG1  . VAL A 1 50 ? 13.479  -6.187  0.225   1.00 0.00 ? 50  VAL A CG1  5  
ATOM   9322  C CG2  . VAL A 1 50 ? 13.505  -6.072  -2.280  1.00 0.00 ? 50  VAL A CG2  5  
ATOM   9323  H H    . VAL A 1 50 ? 12.284  -2.985  -2.447  1.00 0.00 ? 50  VAL A H    5  
ATOM   9324  H HA   . VAL A 1 50 ? 11.244  -5.251  -0.796  1.00 0.00 ? 50  VAL A HA   5  
ATOM   9325  H HB   . VAL A 1 50 ? 14.185  -4.532  -0.942  1.00 0.00 ? 50  VAL A HB   5  
ATOM   9326  H HG11 . VAL A 1 50 ? 12.629  -6.850  0.236   1.00 0.00 ? 50  VAL A HG11 5  
ATOM   9327  H HG12 . VAL A 1 50 ? 14.389  -6.767  0.167   1.00 0.00 ? 50  VAL A HG12 5  
ATOM   9328  H HG13 . VAL A 1 50 ? 13.488  -5.597  1.129   1.00 0.00 ? 50  VAL A HG13 5  
ATOM   9329  H HG21 . VAL A 1 50 ? 12.556  -6.539  -2.503  1.00 0.00 ? 50  VAL A HG21 5  
ATOM   9330  H HG22 . VAL A 1 50 ? 13.779  -5.414  -3.090  1.00 0.00 ? 50  VAL A HG22 5  
ATOM   9331  H HG23 . VAL A 1 50 ? 14.263  -6.832  -2.163  1.00 0.00 ? 50  VAL A HG23 5  
ATOM   9332  N N    . CYS A 1 51 ? 11.158  -3.662  1.111   1.00 0.00 ? 51  CYS A N    5  
ATOM   9333  C CA   . CYS A 1 51 ? 11.102  -2.688  2.232   1.00 0.00 ? 51  CYS A CA   5  
ATOM   9334  C C    . CYS A 1 51 ? 12.315  -2.893  3.136   1.00 0.00 ? 51  CYS A C    5  
ATOM   9335  O O    . CYS A 1 51 ? 12.847  -3.980  3.240   1.00 0.00 ? 51  CYS A O    5  
ATOM   9336  C CB   . CYS A 1 51 ? 9.823   -2.916  3.039   1.00 0.00 ? 51  CYS A CB   5  
ATOM   9337  S SG   . CYS A 1 51 ? 8.380   -2.672  1.973   1.00 0.00 ? 51  CYS A SG   5  
ATOM   9338  H H    . CYS A 1 51 ? 10.534  -4.415  1.087   1.00 0.00 ? 51  CYS A H    5  
ATOM   9339  H HA   . CYS A 1 51 ? 11.108  -1.681  1.841   1.00 0.00 ? 51  CYS A HA   5  
ATOM   9340  H HB2  . CYS A 1 51 ? 9.817   -3.923  3.426   1.00 0.00 ? 51  CYS A HB2  5  
ATOM   9341  H HB3  . CYS A 1 51 ? 9.788   -2.217  3.857   1.00 0.00 ? 51  CYS A HB3  5  
ATOM   9342  N N    . ALA A 1 52 ? 12.765  -1.849  3.783   1.00 0.00 ? 52  ALA A N    5  
ATOM   9343  C CA   . ALA A 1 52 ? 13.957  -1.972  4.676   1.00 0.00 ? 52  ALA A CA   5  
ATOM   9344  C C    . ALA A 1 52 ? 13.766  -1.087  5.910   1.00 0.00 ? 52  ALA A C    5  
ATOM   9345  O O    . ALA A 1 52 ? 13.321  0.041   5.816   1.00 0.00 ? 52  ALA A O    5  
ATOM   9346  C CB   . ALA A 1 52 ? 15.205  -1.517  3.918   1.00 0.00 ? 52  ALA A CB   5  
ATOM   9347  H H    . ALA A 1 52 ? 12.323  -0.980  3.673   1.00 0.00 ? 52  ALA A H    5  
ATOM   9348  H HA   . ALA A 1 52 ? 14.082  -3.003  4.987   1.00 0.00 ? 52  ALA A HA   5  
ATOM   9349  H HB1  . ALA A 1 52 ? 15.030  -0.540  3.491   1.00 0.00 ? 52  ALA A HB1  5  
ATOM   9350  H HB2  . ALA A 1 52 ? 16.042  -1.466  4.599   1.00 0.00 ? 52  ALA A HB2  5  
ATOM   9351  H HB3  . ALA A 1 52 ? 15.425  -2.221  3.129   1.00 0.00 ? 52  ALA A HB3  5  
ATOM   9352  N N    . ASP A 1 53 ? 14.098  -1.597  7.066   1.00 0.00 ? 53  ASP A N    5  
ATOM   9353  C CA   . ASP A 1 53 ? 13.938  -0.797  8.315   1.00 0.00 ? 53  ASP A CA   5  
ATOM   9354  C C    . ASP A 1 53 ? 14.951  0.376   8.312   1.00 0.00 ? 53  ASP A C    5  
ATOM   9355  O O    . ASP A 1 53 ? 16.139  0.124   8.319   1.00 0.00 ? 53  ASP A O    5  
ATOM   9356  C CB   . ASP A 1 53 ? 14.234  -1.696  9.520   1.00 0.00 ? 53  ASP A CB   5  
ATOM   9357  C CG   . ASP A 1 53 ? 13.519  -3.036  9.349   1.00 0.00 ? 53  ASP A CG   5  
ATOM   9358  O OD1  . ASP A 1 53 ? 13.706  -3.659  8.316   1.00 0.00 ? 53  ASP A OD1  5  
ATOM   9359  O OD2  . ASP A 1 53 ? 12.799  -3.421  10.256  1.00 0.00 ? 53  ASP A OD2  5  
ATOM   9360  H H    . ASP A 1 53 ? 14.451  -2.510  7.112   1.00 0.00 ? 53  ASP A H    5  
ATOM   9361  H HA   . ASP A 1 53 ? 12.927  -0.447  8.380   1.00 0.00 ? 53  ASP A HA   5  
ATOM   9362  H HB2  . ASP A 1 53 ? 15.300  -1.864  9.592   1.00 0.00 ? 53  ASP A HB2  5  
ATOM   9363  H HB3  . ASP A 1 53 ? 13.885  -1.217  10.422  1.00 0.00 ? 53  ASP A HB3  5  
ATOM   9364  N N    . PRO A 1 54 ? 14.495  1.624   8.305   1.00 0.00 ? 54  PRO A N    5  
ATOM   9365  C CA   . PRO A 1 54 ? 15.434  2.766   8.308   1.00 0.00 ? 54  PRO A CA   5  
ATOM   9366  C C    . PRO A 1 54 ? 16.298  2.740   9.579   1.00 0.00 ? 54  PRO A C    5  
ATOM   9367  O O    . PRO A 1 54 ? 17.209  3.528   9.737   1.00 0.00 ? 54  PRO A O    5  
ATOM   9368  C CB   . PRO A 1 54 ? 14.539  4.026   8.275   1.00 0.00 ? 54  PRO A CB   5  
ATOM   9369  C CG   . PRO A 1 54 ? 13.057  3.552   8.260   1.00 0.00 ? 54  PRO A CG   5  
ATOM   9370  C CD   . PRO A 1 54 ? 13.062  2.007   8.292   1.00 0.00 ? 54  PRO A CD   5  
ATOM   9371  H HA   . PRO A 1 54 ? 16.062  2.733   7.430   1.00 0.00 ? 54  PRO A HA   5  
ATOM   9372  H HB2  . PRO A 1 54 ? 14.722  4.637   9.152   1.00 0.00 ? 54  PRO A HB2  5  
ATOM   9373  H HB3  . PRO A 1 54 ? 14.746  4.602   7.384   1.00 0.00 ? 54  PRO A HB3  5  
ATOM   9374  H HG2  . PRO A 1 54 ? 12.536  3.942   9.129   1.00 0.00 ? 54  PRO A HG2  5  
ATOM   9375  H HG3  . PRO A 1 54 ? 12.567  3.899   7.361   1.00 0.00 ? 54  PRO A HG3  5  
ATOM   9376  H HD2  . PRO A 1 54 ? 12.565  1.652   9.187   1.00 0.00 ? 54  PRO A HD2  5  
ATOM   9377  H HD3  . PRO A 1 54 ? 12.579  1.611   7.409   1.00 0.00 ? 54  PRO A HD3  5  
ATOM   9378  N N    . SER A 1 55 ? 16.006  1.856   10.487  1.00 0.00 ? 55  SER A N    5  
ATOM   9379  C CA   . SER A 1 55 ? 16.794  1.795   11.752  1.00 0.00 ? 55  SER A CA   5  
ATOM   9380  C C    . SER A 1 55 ? 18.144  1.119   11.499  1.00 0.00 ? 55  SER A C    5  
ATOM   9381  O O    . SER A 1 55 ? 19.075  1.274   12.265  1.00 0.00 ? 55  SER A O    5  
ATOM   9382  C CB   . SER A 1 55 ? 16.015  0.997   12.798  1.00 0.00 ? 55  SER A CB   5  
ATOM   9383  O OG   . SER A 1 55 ? 15.949  -0.365  12.395  1.00 0.00 ? 55  SER A OG   5  
ATOM   9384  H H    . SER A 1 55 ? 15.256  1.243   10.346  1.00 0.00 ? 55  SER A H    5  
ATOM   9385  H HA   . SER A 1 55 ? 16.960  2.797   12.119  1.00 0.00 ? 55  SER A HA   5  
ATOM   9386  H HB2  . SER A 1 55 ? 16.517  1.060   13.749  1.00 0.00 ? 55  SER A HB2  5  
ATOM   9387  H HB3  . SER A 1 55 ? 15.018  1.405   12.892  1.00 0.00 ? 55  SER A HB3  5  
ATOM   9388  H HG   . SER A 1 55 ? 15.268  -0.795  12.916  1.00 0.00 ? 55  SER A HG   5  
ATOM   9389  N N    . GLU A 1 56 ? 18.266  0.374   10.434  1.00 0.00 ? 56  GLU A N    5  
ATOM   9390  C CA   . GLU A 1 56 ? 19.566  -0.301  10.146  1.00 0.00 ? 56  GLU A CA   5  
ATOM   9391  C C    . GLU A 1 56 ? 20.517  0.699   9.476   1.00 0.00 ? 56  GLU A C    5  
ATOM   9392  O O    . GLU A 1 56 ? 20.236  1.243   8.427   1.00 0.00 ? 56  GLU A O    5  
ATOM   9393  C CB   . GLU A 1 56 ? 19.328  -1.498  9.222   1.00 0.00 ? 56  GLU A CB   5  
ATOM   9394  C CG   . GLU A 1 56 ? 18.819  -2.691  10.038  1.00 0.00 ? 56  GLU A CG   5  
ATOM   9395  C CD   . GLU A 1 56 ? 19.968  -3.272  10.864  1.00 0.00 ? 56  GLU A CD   5  
ATOM   9396  O OE1  . GLU A 1 56 ? 21.079  -2.789  10.720  1.00 0.00 ? 56  GLU A OE1  5  
ATOM   9397  O OE2  . GLU A 1 56 ? 19.717  -4.190  11.627  1.00 0.00 ? 56  GLU A OE2  5  
ATOM   9398  H H    . GLU A 1 56 ? 17.508  0.261   9.823   1.00 0.00 ? 56  GLU A H    5  
ATOM   9399  H HA   . GLU A 1 56 ? 20.007  -0.641  11.073  1.00 0.00 ? 56  GLU A HA   5  
ATOM   9400  H HB2  . GLU A 1 56 ? 18.590  -1.232  8.486   1.00 0.00 ? 56  GLU A HB2  5  
ATOM   9401  H HB3  . GLU A 1 56 ? 20.251  -1.767  8.732   1.00 0.00 ? 56  GLU A HB3  5  
ATOM   9402  H HG2  . GLU A 1 56 ? 18.029  -2.364  10.699  1.00 0.00 ? 56  GLU A HG2  5  
ATOM   9403  H HG3  . GLU A 1 56 ? 18.439  -3.448  9.370   1.00 0.00 ? 56  GLU A HG3  5  
ATOM   9404  N N    . SER A 1 57 ? 21.633  0.951   10.098  1.00 0.00 ? 57  SER A N    5  
ATOM   9405  C CA   . SER A 1 57 ? 22.619  1.924   9.546   1.00 0.00 ? 57  SER A CA   5  
ATOM   9406  C C    . SER A 1 57 ? 22.934  1.640   8.073   1.00 0.00 ? 57  SER A C    5  
ATOM   9407  O O    . SER A 1 57 ? 23.067  2.552   7.281   1.00 0.00 ? 57  SER A O    5  
ATOM   9408  C CB   . SER A 1 57 ? 23.912  1.840   10.359  1.00 0.00 ? 57  SER A CB   5  
ATOM   9409  O OG   . SER A 1 57 ? 23.656  2.261   11.692  1.00 0.00 ? 57  SER A OG   5  
ATOM   9410  H H    . SER A 1 57 ? 21.820  0.505   10.947  1.00 0.00 ? 57  SER A H    5  
ATOM   9411  H HA   . SER A 1 57 ? 22.217  2.919   9.633   1.00 0.00 ? 57  SER A HA   5  
ATOM   9412  H HB2  . SER A 1 57 ? 24.267  0.824   10.370  1.00 0.00 ? 57  SER A HB2  5  
ATOM   9413  H HB3  . SER A 1 57 ? 24.661  2.477   9.907   1.00 0.00 ? 57  SER A HB3  5  
ATOM   9414  H HG   . SER A 1 57 ? 22.710  2.395   11.785  1.00 0.00 ? 57  SER A HG   5  
ATOM   9415  N N    . TRP A 1 58 ? 23.085  0.400   7.694   1.00 0.00 ? 58  TRP A N    5  
ATOM   9416  C CA   . TRP A 1 58 ? 23.423  0.113   6.270   1.00 0.00 ? 58  TRP A CA   5  
ATOM   9417  C C    . TRP A 1 58 ? 22.323  0.648   5.357   1.00 0.00 ? 58  TRP A C    5  
ATOM   9418  O O    . TRP A 1 58 ? 22.565  0.994   4.219   1.00 0.00 ? 58  TRP A O    5  
ATOM   9419  C CB   . TRP A 1 58 ? 23.644  -1.394  6.061   1.00 0.00 ? 58  TRP A CB   5  
ATOM   9420  C CG   . TRP A 1 58 ? 22.356  -2.141  6.004   1.00 0.00 ? 58  TRP A CG   5  
ATOM   9421  C CD1  . TRP A 1 58 ? 21.854  -2.890  7.010   1.00 0.00 ? 58  TRP A CD1  5  
ATOM   9422  C CD2  . TRP A 1 58 ? 21.423  -2.268  4.892   1.00 0.00 ? 58  TRP A CD2  5  
ATOM   9423  N NE1  . TRP A 1 58 ? 20.673  -3.468  6.590   1.00 0.00 ? 58  TRP A NE1  5  
ATOM   9424  C CE2  . TRP A 1 58 ? 20.356  -3.112  5.298   1.00 0.00 ? 58  TRP A CE2  5  
ATOM   9425  C CE3  . TRP A 1 58 ? 21.391  -1.735  3.583   1.00 0.00 ? 58  TRP A CE3  5  
ATOM   9426  C CZ2  . TRP A 1 58 ? 19.294  -3.421  4.437   1.00 0.00 ? 58  TRP A CZ2  5  
ATOM   9427  C CZ3  . TRP A 1 58 ? 20.325  -2.043  2.712   1.00 0.00 ? 58  TRP A CZ3  5  
ATOM   9428  C CH2  . TRP A 1 58 ? 19.278  -2.884  3.140   1.00 0.00 ? 58  TRP A CH2  5  
ATOM   9429  H H    . TRP A 1 58 ? 22.989  -0.329  8.339   1.00 0.00 ? 58  TRP A H    5  
ATOM   9430  H HA   . TRP A 1 58 ? 24.342  0.631   6.031   1.00 0.00 ? 58  TRP A HA   5  
ATOM   9431  H HB2  . TRP A 1 58 ? 24.171  -1.550  5.135   1.00 0.00 ? 58  TRP A HB2  5  
ATOM   9432  H HB3  . TRP A 1 58 ? 24.241  -1.778  6.875   1.00 0.00 ? 58  TRP A HB3  5  
ATOM   9433  H HD1  . TRP A 1 58 ? 22.307  -3.021  7.982   1.00 0.00 ? 58  TRP A HD1  5  
ATOM   9434  H HE1  . TRP A 1 58 ? 20.117  -4.058  7.128   1.00 0.00 ? 58  TRP A HE1  5  
ATOM   9435  H HE3  . TRP A 1 58 ? 22.189  -1.093  3.245   1.00 0.00 ? 58  TRP A HE3  5  
ATOM   9436  H HZ2  . TRP A 1 58 ? 18.494  -4.066  4.769   1.00 0.00 ? 58  TRP A HZ2  5  
ATOM   9437  H HZ3  . TRP A 1 58 ? 20.314  -1.634  1.716   1.00 0.00 ? 58  TRP A HZ3  5  
ATOM   9438  H HH2  . TRP A 1 58 ? 18.465  -3.117  2.470   1.00 0.00 ? 58  TRP A HH2  5  
ATOM   9439  N N    . VAL A 1 59 ? 21.123  0.745   5.848   1.00 0.00 ? 59  VAL A N    5  
ATOM   9440  C CA   . VAL A 1 59 ? 20.025  1.283   5.002   1.00 0.00 ? 59  VAL A CA   5  
ATOM   9441  C C    . VAL A 1 59 ? 20.253  2.776   4.791   1.00 0.00 ? 59  VAL A C    5  
ATOM   9442  O O    . VAL A 1 59 ? 20.166  3.280   3.690   1.00 0.00 ? 59  VAL A O    5  
ATOM   9443  C CB   . VAL A 1 59 ? 18.687  1.054   5.704   1.00 0.00 ? 59  VAL A CB   5  
ATOM   9444  C CG1  . VAL A 1 59 ? 17.550  1.648   4.867   1.00 0.00 ? 59  VAL A CG1  5  
ATOM   9445  C CG2  . VAL A 1 59 ? 18.478  -0.450  5.870   1.00 0.00 ? 59  VAL A CG2  5  
ATOM   9446  H H    . VAL A 1 59 ? 20.946  0.480   6.775   1.00 0.00 ? 59  VAL A H    5  
ATOM   9447  H HA   . VAL A 1 59 ? 20.025  0.780   4.049   1.00 0.00 ? 59  VAL A HA   5  
ATOM   9448  H HB   . VAL A 1 59 ? 18.701  1.528   6.674   1.00 0.00 ? 59  VAL A HB   5  
ATOM   9449  H HG11 . VAL A 1 59 ? 17.704  1.412   3.826   1.00 0.00 ? 59  VAL A HG11 5  
ATOM   9450  H HG12 . VAL A 1 59 ? 16.607  1.234   5.194   1.00 0.00 ? 59  VAL A HG12 5  
ATOM   9451  H HG13 . VAL A 1 59 ? 17.533  2.721   4.993   1.00 0.00 ? 59  VAL A HG13 5  
ATOM   9452  H HG21 . VAL A 1 59 ? 19.352  -0.882  6.339   1.00 0.00 ? 59  VAL A HG21 5  
ATOM   9453  H HG22 . VAL A 1 59 ? 17.610  -0.627  6.485   1.00 0.00 ? 59  VAL A HG22 5  
ATOM   9454  H HG23 . VAL A 1 59 ? 18.333  -0.902  4.903   1.00 0.00 ? 59  VAL A HG23 5  
ATOM   9455  N N    . GLN A 1 60 ? 20.557  3.485   5.839   1.00 0.00 ? 60  GLN A N    5  
ATOM   9456  C CA   . GLN A 1 60 ? 20.804  4.949   5.698   1.00 0.00 ? 60  GLN A CA   5  
ATOM   9457  C C    . GLN A 1 60 ? 22.040  5.174   4.819   1.00 0.00 ? 60  GLN A C    5  
ATOM   9458  O O    . GLN A 1 60 ? 22.093  6.097   4.031   1.00 0.00 ? 60  GLN A O    5  
ATOM   9459  C CB   . GLN A 1 60 ? 21.041  5.562   7.079   1.00 0.00 ? 60  GLN A CB   5  
ATOM   9460  C CG   . GLN A 1 60 ? 21.029  7.088   6.969   1.00 0.00 ? 60  GLN A CG   5  
ATOM   9461  C CD   . GLN A 1 60 ? 21.370  7.701   8.328   1.00 0.00 ? 60  GLN A CD   5  
ATOM   9462  O OE1  . GLN A 1 60 ? 20.600  7.603   9.263   1.00 0.00 ? 60  GLN A OE1  5  
ATOM   9463  N NE2  . GLN A 1 60 ? 22.501  8.333   8.479   1.00 0.00 ? 60  GLN A NE2  5  
ATOM   9464  H H    . GLN A 1 60 ? 20.630  3.053   6.719   1.00 0.00 ? 60  GLN A H    5  
ATOM   9465  H HA   . GLN A 1 60 ? 19.948  5.415   5.237   1.00 0.00 ? 60  GLN A HA   5  
ATOM   9466  H HB2  . GLN A 1 60 ? 20.259  5.243   7.753   1.00 0.00 ? 60  GLN A HB2  5  
ATOM   9467  H HB3  . GLN A 1 60 ? 21.998  5.238   7.459   1.00 0.00 ? 60  GLN A HB3  5  
ATOM   9468  H HG2  . GLN A 1 60 ? 21.759  7.402   6.238   1.00 0.00 ? 60  GLN A HG2  5  
ATOM   9469  H HG3  . GLN A 1 60 ? 20.048  7.420   6.664   1.00 0.00 ? 60  GLN A HG3  5  
ATOM   9470  H HE21 . GLN A 1 60 ? 23.123  8.413   7.726   1.00 0.00 ? 60  GLN A HE21 5  
ATOM   9471  H HE22 . GLN A 1 60 ? 22.730  8.729   9.347   1.00 0.00 ? 60  GLN A HE22 5  
ATOM   9472  N N    . GLU A 1 61 ? 23.034  4.341   4.956   1.00 0.00 ? 61  GLU A N    5  
ATOM   9473  C CA   . GLU A 1 61 ? 24.271  4.504   4.138   1.00 0.00 ? 61  GLU A CA   5  
ATOM   9474  C C    . GLU A 1 61 ? 23.947  4.288   2.657   1.00 0.00 ? 61  GLU A C    5  
ATOM   9475  O O    . GLU A 1 61 ? 24.341  5.060   1.806   1.00 0.00 ? 61  GLU A O    5  
ATOM   9476  C CB   . GLU A 1 61 ? 25.315  3.473   4.591   1.00 0.00 ? 61  GLU A CB   5  
ATOM   9477  C CG   . GLU A 1 61 ? 26.554  3.527   3.685   1.00 0.00 ? 61  GLU A CG   5  
ATOM   9478  C CD   . GLU A 1 61 ? 27.097  4.957   3.628   1.00 0.00 ? 61  GLU A CD   5  
ATOM   9479  O OE1  . GLU A 1 61 ? 27.123  5.601   4.663   1.00 0.00 ? 61  GLU A OE1  5  
ATOM   9480  O OE2  . GLU A 1 61 ? 27.479  5.381   2.550   1.00 0.00 ? 61  GLU A OE2  5  
ATOM   9481  H H    . GLU A 1 61 ? 22.968  3.607   5.602   1.00 0.00 ? 61  GLU A H    5  
ATOM   9482  H HA   . GLU A 1 61 ? 24.660  5.498   4.279   1.00 0.00 ? 61  GLU A HA   5  
ATOM   9483  H HB2  . GLU A 1 61 ? 25.608  3.683   5.609   1.00 0.00 ? 61  GLU A HB2  5  
ATOM   9484  H HB3  . GLU A 1 61 ? 24.883  2.483   4.541   1.00 0.00 ? 61  GLU A HB3  5  
ATOM   9485  H HG2  . GLU A 1 61 ? 27.316  2.873   4.085   1.00 0.00 ? 61  GLU A HG2  5  
ATOM   9486  H HG3  . GLU A 1 61 ? 26.293  3.202   2.690   1.00 0.00 ? 61  GLU A HG3  5  
ATOM   9487  N N    . TYR A 1 62 ? 23.243  3.239   2.347   1.00 0.00 ? 62  TYR A N    5  
ATOM   9488  C CA   . TYR A 1 62 ? 22.900  2.957   0.924   1.00 0.00 ? 62  TYR A CA   5  
ATOM   9489  C C    . TYR A 1 62 ? 22.037  4.095   0.370   1.00 0.00 ? 62  TYR A C    5  
ATOM   9490  O O    . TYR A 1 62 ? 22.154  4.468   -0.780  1.00 0.00 ? 62  TYR A O    5  
ATOM   9491  C CB   . TYR A 1 62 ? 22.133  1.625   0.836   1.00 0.00 ? 62  TYR A CB   5  
ATOM   9492  C CG   . TYR A 1 62 ? 23.103  0.455   0.839   1.00 0.00 ? 62  TYR A CG   5  
ATOM   9493  C CD1  . TYR A 1 62 ? 24.124  0.367   1.811   1.00 0.00 ? 62  TYR A CD1  5  
ATOM   9494  C CD2  . TYR A 1 62 ? 22.981  -0.554  -0.138  1.00 0.00 ? 62  TYR A CD2  5  
ATOM   9495  C CE1  . TYR A 1 62 ? 25.014  -0.723  1.801   1.00 0.00 ? 62  TYR A CE1  5  
ATOM   9496  C CE2  . TYR A 1 62 ? 23.872  -1.644  -0.144  1.00 0.00 ? 62  TYR A CE2  5  
ATOM   9497  C CZ   . TYR A 1 62 ? 24.888  -1.728  0.824   1.00 0.00 ? 62  TYR A CZ   5  
ATOM   9498  O OH   . TYR A 1 62 ? 25.763  -2.795  0.816   1.00 0.00 ? 62  TYR A OH   5  
ATOM   9499  H H    . TYR A 1 62 ? 22.944  2.629   3.052   1.00 0.00 ? 62  TYR A H    5  
ATOM   9500  H HA   . TYR A 1 62 ? 23.809  2.890   0.344   1.00 0.00 ? 62  TYR A HA   5  
ATOM   9501  H HB2  . TYR A 1 62 ? 21.472  1.541   1.685   1.00 0.00 ? 62  TYR A HB2  5  
ATOM   9502  H HB3  . TYR A 1 62 ? 21.549  1.606   -0.074  1.00 0.00 ? 62  TYR A HB3  5  
ATOM   9503  H HD1  . TYR A 1 62 ? 24.226  1.130   2.563   1.00 0.00 ? 62  TYR A HD1  5  
ATOM   9504  H HD2  . TYR A 1 62 ? 22.201  -0.493  -0.883  1.00 0.00 ? 62  TYR A HD2  5  
ATOM   9505  H HE1  . TYR A 1 62 ? 25.794  -0.789  2.545   1.00 0.00 ? 62  TYR A HE1  5  
ATOM   9506  H HE2  . TYR A 1 62 ? 23.775  -2.415  -0.892  1.00 0.00 ? 62  TYR A HE2  5  
ATOM   9507  H HH   . TYR A 1 62 ? 25.275  -3.580  1.074   1.00 0.00 ? 62  TYR A HH   5  
ATOM   9508  N N    . VAL A 1 63 ? 21.183  4.656   1.178   1.00 0.00 ? 63  VAL A N    5  
ATOM   9509  C CA   . VAL A 1 63 ? 20.335  5.772   0.694   1.00 0.00 ? 63  VAL A CA   5  
ATOM   9510  C C    . VAL A 1 63 ? 21.241  6.955   0.385   1.00 0.00 ? 63  VAL A C    5  
ATOM   9511  O O    . VAL A 1 63 ? 21.086  7.634   -0.609  1.00 0.00 ? 63  VAL A O    5  
ATOM   9512  C CB   . VAL A 1 63 ? 19.330  6.156   1.783   1.00 0.00 ? 63  VAL A CB   5  
ATOM   9513  C CG1  . VAL A 1 63 ? 18.611  7.451   1.394   1.00 0.00 ? 63  VAL A CG1  5  
ATOM   9514  C CG2  . VAL A 1 63 ? 18.302  5.033   1.941   1.00 0.00 ? 63  VAL A CG2  5  
ATOM   9515  H H    . VAL A 1 63 ? 21.113  4.355   2.104   1.00 0.00 ? 63  VAL A H    5  
ATOM   9516  H HA   . VAL A 1 63 ? 19.809  5.472   -0.200  1.00 0.00 ? 63  VAL A HA   5  
ATOM   9517  H HB   . VAL A 1 63 ? 19.852  6.303   2.716   1.00 0.00 ? 63  VAL A HB   5  
ATOM   9518  H HG11 . VAL A 1 63 ? 18.293  7.392   0.364   1.00 0.00 ? 63  VAL A HG11 5  
ATOM   9519  H HG12 . VAL A 1 63 ? 17.749  7.589   2.030   1.00 0.00 ? 63  VAL A HG12 5  
ATOM   9520  H HG13 . VAL A 1 63 ? 19.284  8.286   1.515   1.00 0.00 ? 63  VAL A HG13 5  
ATOM   9521  H HG21 . VAL A 1 63 ? 18.809  4.079   1.950   1.00 0.00 ? 63  VAL A HG21 5  
ATOM   9522  H HG22 . VAL A 1 63 ? 17.767  5.164   2.870   1.00 0.00 ? 63  VAL A HG22 5  
ATOM   9523  H HG23 . VAL A 1 63 ? 17.606  5.062   1.116   1.00 0.00 ? 63  VAL A HG23 5  
ATOM   9524  N N    . TYR A 1 64 ? 22.192  7.197   1.237   1.00 0.00 ? 64  TYR A N    5  
ATOM   9525  C CA   . TYR A 1 64 ? 23.121  8.329   1.009   1.00 0.00 ? 64  TYR A CA   5  
ATOM   9526  C C    . TYR A 1 64 ? 23.929  8.068   -0.261  1.00 0.00 ? 64  TYR A C    5  
ATOM   9527  O O    . TYR A 1 64 ? 24.114  8.939   -1.087  1.00 0.00 ? 64  TYR A O    5  
ATOM   9528  C CB   . TYR A 1 64 ? 24.071  8.451   2.206   1.00 0.00 ? 64  TYR A CB   5  
ATOM   9529  C CG   . TYR A 1 64 ? 24.706  9.824   2.219   1.00 0.00 ? 64  TYR A CG   5  
ATOM   9530  C CD1  . TYR A 1 64 ? 23.934  10.952  2.559   1.00 0.00 ? 64  TYR A CD1  5  
ATOM   9531  C CD2  . TYR A 1 64 ? 26.068  9.976   1.893   1.00 0.00 ? 64  TYR A CD2  5  
ATOM   9532  C CE1  . TYR A 1 64 ? 24.522  12.231  2.572   1.00 0.00 ? 64  TYR A CE1  5  
ATOM   9533  C CE2  . TYR A 1 64 ? 26.657  11.255  1.907   1.00 0.00 ? 64  TYR A CE2  5  
ATOM   9534  C CZ   . TYR A 1 64 ? 25.884  12.382  2.246   1.00 0.00 ? 64  TYR A CZ   5  
ATOM   9535  O OH   . TYR A 1 64 ? 26.461  13.636  2.259   1.00 0.00 ? 64  TYR A OH   5  
ATOM   9536  H H    . TYR A 1 64 ? 22.296  6.630   2.028   1.00 0.00 ? 64  TYR A H    5  
ATOM   9537  H HA   . TYR A 1 64 ? 22.553  9.234   0.900   1.00 0.00 ? 64  TYR A HA   5  
ATOM   9538  H HB2  . TYR A 1 64 ? 23.514  8.301   3.116   1.00 0.00 ? 64  TYR A HB2  5  
ATOM   9539  H HB3  . TYR A 1 64 ? 24.843  7.697   2.134   1.00 0.00 ? 64  TYR A HB3  5  
ATOM   9540  H HD1  . TYR A 1 64 ? 22.890  10.835  2.809   1.00 0.00 ? 64  TYR A HD1  5  
ATOM   9541  H HD2  . TYR A 1 64 ? 26.661  9.112   1.633   1.00 0.00 ? 64  TYR A HD2  5  
ATOM   9542  H HE1  . TYR A 1 64 ? 23.929  13.095  2.832   1.00 0.00 ? 64  TYR A HE1  5  
ATOM   9543  H HE2  . TYR A 1 64 ? 27.701  11.373  1.657   1.00 0.00 ? 64  TYR A HE2  5  
ATOM   9544  H HH   . TYR A 1 64 ? 27.298  13.572  2.723   1.00 0.00 ? 64  TYR A HH   5  
ATOM   9545  N N    . ASP A 1 65 ? 24.412  6.871   -0.413  1.00 0.00 ? 65  ASP A N    5  
ATOM   9546  C CA   . ASP A 1 65 ? 25.218  6.531   -1.619  1.00 0.00 ? 65  ASP A CA   5  
ATOM   9547  C C    . ASP A 1 65 ? 24.360  6.703   -2.876  1.00 0.00 ? 65  ASP A C    5  
ATOM   9548  O O    . ASP A 1 65 ? 24.839  7.101   -3.919  1.00 0.00 ? 65  ASP A O    5  
ATOM   9549  C CB   . ASP A 1 65 ? 25.688  5.077   -1.511  1.00 0.00 ? 65  ASP A CB   5  
ATOM   9550  C CG   . ASP A 1 65 ? 26.887  4.988   -0.563  1.00 0.00 ? 65  ASP A CG   5  
ATOM   9551  O OD1  . ASP A 1 65 ? 27.862  5.678   -0.808  1.00 0.00 ? 65  ASP A OD1  5  
ATOM   9552  O OD2  . ASP A 1 65 ? 26.807  4.233   0.391   1.00 0.00 ? 65  ASP A OD2  5  
ATOM   9553  H H    . ASP A 1 65 ? 24.245  6.190   0.274   1.00 0.00 ? 65  ASP A H    5  
ATOM   9554  H HA   . ASP A 1 65 ? 26.074  7.186   -1.678  1.00 0.00 ? 65  ASP A HA   5  
ATOM   9555  H HB2  . ASP A 1 65 ? 24.881  4.468   -1.129  1.00 0.00 ? 65  ASP A HB2  5  
ATOM   9556  H HB3  . ASP A 1 65 ? 25.975  4.717   -2.485  1.00 0.00 ? 65  ASP A HB3  5  
ATOM   9557  N N    . LEU A 1 66 ? 23.097  6.403   -2.781  1.00 0.00 ? 66  LEU A N    5  
ATOM   9558  C CA   . LEU A 1 66 ? 22.202  6.544   -3.963  1.00 0.00 ? 66  LEU A CA   5  
ATOM   9559  C C    . LEU A 1 66 ? 21.963  8.030   -4.245  1.00 0.00 ? 66  LEU A C    5  
ATOM   9560  O O    . LEU A 1 66 ? 21.751  8.432   -5.372  1.00 0.00 ? 66  LEU A O    5  
ATOM   9561  C CB   . LEU A 1 66 ? 20.870  5.845   -3.656  1.00 0.00 ? 66  LEU A CB   5  
ATOM   9562  C CG   . LEU A 1 66 ? 21.004  4.323   -3.874  1.00 0.00 ? 66  LEU A CG   5  
ATOM   9563  C CD1  . LEU A 1 66 ? 19.919  3.588   -3.084  1.00 0.00 ? 66  LEU A CD1  5  
ATOM   9564  C CD2  . LEU A 1 66 ? 20.835  3.980   -5.364  1.00 0.00 ? 66  LEU A CD2  5  
ATOM   9565  H H    . LEU A 1 66 ? 22.736  6.082   -1.931  1.00 0.00 ? 66  LEU A H    5  
ATOM   9566  H HA   . LEU A 1 66 ? 22.666  6.088   -4.821  1.00 0.00 ? 66  LEU A HA   5  
ATOM   9567  H HB2  . LEU A 1 66 ? 20.604  6.039   -2.625  1.00 0.00 ? 66  LEU A HB2  5  
ATOM   9568  H HB3  . LEU A 1 66 ? 20.102  6.241   -4.297  1.00 0.00 ? 66  LEU A HB3  5  
ATOM   9569  H HG   . LEU A 1 66 ? 21.977  3.994   -3.536  1.00 0.00 ? 66  LEU A HG   5  
ATOM   9570  H HD11 . LEU A 1 66 ? 19.993  3.852   -2.039  1.00 0.00 ? 66  LEU A HD11 5  
ATOM   9571  H HD12 . LEU A 1 66 ? 18.948  3.870   -3.458  1.00 0.00 ? 66  LEU A HD12 5  
ATOM   9572  H HD13 . LEU A 1 66 ? 20.051  2.522   -3.196  1.00 0.00 ? 66  LEU A HD13 5  
ATOM   9573  H HD21 . LEU A 1 66 ? 19.946  4.456   -5.749  1.00 0.00 ? 66  LEU A HD21 5  
ATOM   9574  H HD22 . LEU A 1 66 ? 21.695  4.319   -5.919  1.00 0.00 ? 66  LEU A HD22 5  
ATOM   9575  H HD23 . LEU A 1 66 ? 20.740  2.910   -5.475  1.00 0.00 ? 66  LEU A HD23 5  
ATOM   9576  N N    . GLU A 1 67 ? 22.001  8.846   -3.232  1.00 0.00 ? 67  GLU A N    5  
ATOM   9577  C CA   . GLU A 1 67 ? 21.784  10.306  -3.438  1.00 0.00 ? 67  GLU A CA   5  
ATOM   9578  C C    . GLU A 1 67 ? 23.016  10.904  -4.115  1.00 0.00 ? 67  GLU A C    5  
ATOM   9579  O O    . GLU A 1 67 ? 22.928  11.862  -4.858  1.00 0.00 ? 67  GLU A O    5  
ATOM   9580  C CB   . GLU A 1 67 ? 21.576  10.984  -2.083  1.00 0.00 ? 67  GLU A CB   5  
ATOM   9581  C CG   . GLU A 1 67 ? 20.242  10.534  -1.480  1.00 0.00 ? 67  GLU A CG   5  
ATOM   9582  C CD   . GLU A 1 67 ? 19.092  11.317  -2.119  1.00 0.00 ? 67  GLU A CD   5  
ATOM   9583  O OE1  . GLU A 1 67 ? 18.801  12.401  -1.640  1.00 0.00 ? 67  GLU A OE1  5  
ATOM   9584  O OE2  . GLU A 1 67 ? 18.523  10.820  -3.076  1.00 0.00 ? 67  GLU A OE2  5  
ATOM   9585  H H    . GLU A 1 67 ? 22.174  8.496   -2.334  1.00 0.00 ? 67  GLU A H    5  
ATOM   9586  H HA   . GLU A 1 67 ? 20.916  10.461  -4.060  1.00 0.00 ? 67  GLU A HA   5  
ATOM   9587  H HB2  . GLU A 1 67 ? 22.383  10.707  -1.418  1.00 0.00 ? 67  GLU A HB2  5  
ATOM   9588  H HB3  . GLU A 1 67 ? 21.572  12.055  -2.212  1.00 0.00 ? 67  GLU A HB3  5  
ATOM   9589  H HG2  . GLU A 1 67 ? 20.102  9.478   -1.662  1.00 0.00 ? 67  GLU A HG2  5  
ATOM   9590  H HG3  . GLU A 1 67 ? 20.252  10.717  -0.418  1.00 0.00 ? 67  GLU A HG3  5  
ATOM   9591  N N    . LEU A 1 68 ? 24.165  10.343  -3.865  1.00 0.00 ? 68  LEU A N    5  
ATOM   9592  C CA   . LEU A 1 68 ? 25.408  10.874  -4.496  1.00 0.00 ? 68  LEU A CA   5  
ATOM   9593  C C    . LEU A 1 68 ? 25.471  10.424  -5.957  1.00 0.00 ? 68  LEU A C    5  
ATOM   9594  O O    . LEU A 1 68 ? 24.974  11.091  -6.842  1.00 0.00 ? 68  LEU A O    5  
ATOM   9595  C CB   . LEU A 1 68 ? 26.631  10.346  -3.750  1.00 0.00 ? 68  LEU A CB   5  
ATOM   9596  C CG   . LEU A 1 68 ? 26.612  10.834  -2.298  1.00 0.00 ? 68  LEU A CG   5  
ATOM   9597  C CD1  . LEU A 1 68 ? 27.814  10.239  -1.572  1.00 0.00 ? 68  LEU A CD1  5  
ATOM   9598  C CD2  . LEU A 1 68 ? 26.685  12.374  -2.242  1.00 0.00 ? 68  LEU A CD2  5  
ATOM   9599  H H    . LEU A 1 68 ? 24.209  9.572   -3.262  1.00 0.00 ? 68  LEU A H    5  
ATOM   9600  H HA   . LEU A 1 68 ? 25.403  11.949  -4.452  1.00 0.00 ? 68  LEU A HA   5  
ATOM   9601  H HB2  . LEU A 1 68 ? 26.621  9.266   -3.765  1.00 0.00 ? 68  LEU A HB2  5  
ATOM   9602  H HB3  . LEU A 1 68 ? 27.528  10.704  -4.234  1.00 0.00 ? 68  LEU A HB3  5  
ATOM   9603  H HG   . LEU A 1 68 ? 25.704  10.496  -1.820  1.00 0.00 ? 68  LEU A HG   5  
ATOM   9604  H HD11 . LEU A 1 68 ? 27.768  9.164   -1.627  1.00 0.00 ? 68  LEU A HD11 5  
ATOM   9605  H HD12 . LEU A 1 68 ? 28.721  10.588  -2.043  1.00 0.00 ? 68  LEU A HD12 5  
ATOM   9606  H HD13 . LEU A 1 68 ? 27.798  10.551  -0.540  1.00 0.00 ? 68  LEU A HD13 5  
ATOM   9607  H HD21 . LEU A 1 68 ? 27.291  12.742  -3.058  1.00 0.00 ? 68  LEU A HD21 5  
ATOM   9608  H HD22 . LEU A 1 68 ? 25.689  12.784  -2.321  1.00 0.00 ? 68  LEU A HD22 5  
ATOM   9609  H HD23 . LEU A 1 68 ? 27.123  12.686  -1.303  1.00 0.00 ? 68  LEU A HD23 5  
ATOM   9610  N N    . ASN A 1 69 ? 26.080  9.298   -6.217  1.00 0.00 ? 69  ASN A N    5  
ATOM   9611  C CA   . ASN A 1 69 ? 26.178  8.803   -7.622  1.00 0.00 ? 69  ASN A CA   5  
ATOM   9612  C C    . ASN A 1 69 ? 24.956  7.941   -7.944  1.00 0.00 ? 69  ASN A C    5  
ATOM   9613  O O    . ASN A 1 69 ? 23.899  8.508   -8.171  1.00 0.00 ? 69  ASN A O    5  
ATOM   9614  C CB   . ASN A 1 69 ? 27.447  7.962   -7.776  1.00 0.00 ? 69  ASN A CB   5  
ATOM   9615  C CG   . ASN A 1 69 ? 27.516  7.397   -9.196  1.00 0.00 ? 69  ASN A CG   5  
ATOM   9616  O OD1  . ASN A 1 69 ? 27.362  6.210   -9.398  1.00 0.00 ? 69  ASN A OD1  5  
ATOM   9617  N ND2  . ASN A 1 69 ? 27.744  8.206   -10.195 1.00 0.00 ? 69  ASN A ND2  5  
ATOM   9618  O OXT  . ASN A 1 69 ? 25.097  6.729   -7.959  1.00 0.00 ? 69  ASN A OXT  5  
ATOM   9619  H H    . ASN A 1 69 ? 26.475  8.777   -5.489  1.00 0.00 ? 69  ASN A H    5  
ATOM   9620  H HA   . ASN A 1 69 ? 26.218  9.641   -8.302  1.00 0.00 ? 69  ASN A HA   5  
ATOM   9621  H HB2  . ASN A 1 69 ? 28.313  8.581   -7.590  1.00 0.00 ? 69  ASN A HB2  5  
ATOM   9622  H HB3  . ASN A 1 69 ? 27.428  7.147   -7.068  1.00 0.00 ? 69  ASN A HB3  5  
ATOM   9623  H HD21 . ASN A 1 69 ? 27.868  9.163   -10.033 1.00 0.00 ? 69  ASN A HD21 5  
ATOM   9624  H HD22 . ASN A 1 69 ? 27.790  7.854   -11.109 1.00 0.00 ? 69  ASN A HD22 5  
ATOM   9625  N N    . ALA B 1 1  ? 7.877   -14.988 -13.473 1.00 0.00 ? 1   ALA B N    5  
ATOM   9626  C CA   . ALA B 1 1  ? 7.929   -16.131 -12.521 1.00 0.00 ? 1   ALA B CA   5  
ATOM   9627  C C    . ALA B 1 1  ? 8.615   -15.705 -11.204 1.00 0.00 ? 1   ALA B C    5  
ATOM   9628  O O    . ALA B 1 1  ? 8.112   -16.009 -10.141 1.00 0.00 ? 1   ALA B O    5  
ATOM   9629  C CB   . ALA B 1 1  ? 8.677   -17.316 -13.177 1.00 0.00 ? 1   ALA B CB   5  
ATOM   9630  H H1   . ALA B 1 1  ? 7.948   -14.095 -12.943 1.00 0.00 ? 1   ALA B H1   5  
ATOM   9631  H H2   . ALA B 1 1  ? 8.668   -15.060 -14.142 1.00 0.00 ? 1   ALA B H2   5  
ATOM   9632  H H3   . ALA B 1 1  ? 6.980   -15.013 -13.996 1.00 0.00 ? 1   ALA B H3   5  
ATOM   9633  H HA   . ALA B 1 1  ? 6.917   -16.431 -12.295 1.00 0.00 ? 1   ALA B HA   5  
ATOM   9634  H HB1  . ALA B 1 1  ? 8.968   -17.041 -14.179 1.00 0.00 ? 1   ALA B HB1  5  
ATOM   9635  H HB2  . ALA B 1 1  ? 9.562   -17.565 -12.606 1.00 0.00 ? 1   ALA B HB2  5  
ATOM   9636  H HB3  . ALA B 1 1  ? 8.027   -18.181 -13.221 1.00 0.00 ? 1   ALA B HB3  5  
ATOM   9637  N N    . PRO B 1 2  ? 9.744   -15.027 -11.293 1.00 0.00 ? 2   PRO B N    5  
ATOM   9638  C CA   . PRO B 1 2  ? 10.469  -14.595 -10.083 1.00 0.00 ? 2   PRO B CA   5  
ATOM   9639  C C    . PRO B 1 2  ? 9.643   -13.542 -9.329  1.00 0.00 ? 2   PRO B C    5  
ATOM   9640  O O    . PRO B 1 2  ? 9.433   -12.445 -9.808  1.00 0.00 ? 2   PRO B O    5  
ATOM   9641  C CB   . PRO B 1 2  ? 11.803  -14.007 -10.605 1.00 0.00 ? 2   PRO B CB   5  
ATOM   9642  C CG   . PRO B 1 2  ? 11.777  -14.106 -12.159 1.00 0.00 ? 2   PRO B CG   5  
ATOM   9643  C CD   . PRO B 1 2  ? 10.387  -14.642 -12.568 1.00 0.00 ? 2   PRO B CD   5  
ATOM   9644  H HA   . PRO B 1 2  ? 10.663  -15.444 -9.443  1.00 0.00 ? 2   PRO B HA   5  
ATOM   9645  H HB2  . PRO B 1 2  ? 11.904  -12.970 -10.301 1.00 0.00 ? 2   PRO B HB2  5  
ATOM   9646  H HB3  . PRO B 1 2  ? 12.636  -14.579 -10.220 1.00 0.00 ? 2   PRO B HB3  5  
ATOM   9647  H HG2  . PRO B 1 2  ? 11.944  -13.127 -12.594 1.00 0.00 ? 2   PRO B HG2  5  
ATOM   9648  H HG3  . PRO B 1 2  ? 12.546  -14.788 -12.500 1.00 0.00 ? 2   PRO B HG3  5  
ATOM   9649  H HD2  . PRO B 1 2  ? 9.823   -13.858 -13.055 1.00 0.00 ? 2   PRO B HD2  5  
ATOM   9650  H HD3  . PRO B 1 2  ? 10.483  -15.498 -13.216 1.00 0.00 ? 2   PRO B HD3  5  
ATOM   9651  N N    . MET B 1 3  ? 9.178   -13.869 -8.154  1.00 0.00 ? 3   MET B N    5  
ATOM   9652  C CA   . MET B 1 3  ? 8.372   -12.889 -7.373  1.00 0.00 ? 3   MET B CA   5  
ATOM   9653  C C    . MET B 1 3  ? 9.306   -11.882 -6.703  1.00 0.00 ? 3   MET B C    5  
ATOM   9654  O O    . MET B 1 3  ? 10.441  -12.187 -6.389  1.00 0.00 ? 3   MET B O    5  
ATOM   9655  C CB   . MET B 1 3  ? 7.566   -13.630 -6.303  1.00 0.00 ? 3   MET B CB   5  
ATOM   9656  C CG   . MET B 1 3  ? 8.482   -14.601 -5.556  1.00 0.00 ? 3   MET B CG   5  
ATOM   9657  S SD   . MET B 1 3  ? 7.648   -15.193 -4.063  1.00 0.00 ? 3   MET B SD   5  
ATOM   9658  C CE   . MET B 1 3  ? 6.348   -16.144 -4.890  1.00 0.00 ? 3   MET B CE   5  
ATOM   9659  H H    . MET B 1 3  ? 9.360   -14.759 -7.785  1.00 0.00 ? 3   MET B H    5  
ATOM   9660  H HA   . MET B 1 3  ? 7.696   -12.369 -8.036  1.00 0.00 ? 3   MET B HA   5  
ATOM   9661  H HB2  . MET B 1 3  ? 7.152   -12.915 -5.606  1.00 0.00 ? 3   MET B HB2  5  
ATOM   9662  H HB3  . MET B 1 3  ? 6.766   -14.182 -6.772  1.00 0.00 ? 3   MET B HB3  5  
ATOM   9663  H HG2  . MET B 1 3  ? 8.714   -15.441 -6.196  1.00 0.00 ? 3   MET B HG2  5  
ATOM   9664  H HG3  . MET B 1 3  ? 9.396   -14.095 -5.281  1.00 0.00 ? 3   MET B HG3  5  
ATOM   9665  H HE1  . MET B 1 3  ? 6.761   -16.658 -5.742  1.00 0.00 ? 3   MET B HE1  5  
ATOM   9666  H HE2  . MET B 1 3  ? 5.938   -16.868 -4.199  1.00 0.00 ? 3   MET B HE2  5  
ATOM   9667  H HE3  . MET B 1 3  ? 5.567   -15.472 -5.220  1.00 0.00 ? 3   MET B HE3  5  
ATOM   9668  N N    . GLY B 1 4  ? 8.843   -10.682 -6.480  1.00 0.00 ? 4   GLY B N    5  
ATOM   9669  C CA   . GLY B 1 4  ? 9.712   -9.660  -5.831  1.00 0.00 ? 4   GLY B CA   5  
ATOM   9670  C C    . GLY B 1 4  ? 10.197  -10.186 -4.479  1.00 0.00 ? 4   GLY B C    5  
ATOM   9671  O O    . GLY B 1 4  ? 9.866   -11.284 -4.077  1.00 0.00 ? 4   GLY B O    5  
ATOM   9672  H H    . GLY B 1 4  ? 7.926   -10.454 -6.741  1.00 0.00 ? 4   GLY B H    5  
ATOM   9673  H HA2  . GLY B 1 4  ? 10.562  -9.459  -6.467  1.00 0.00 ? 4   GLY B HA2  5  
ATOM   9674  H HA3  . GLY B 1 4  ? 9.151   -8.752  -5.682  1.00 0.00 ? 4   GLY B HA3  5  
ATOM   9675  N N    . SER B 1 5  ? 10.982  -9.415  -3.771  1.00 0.00 ? 5   SER B N    5  
ATOM   9676  C CA   . SER B 1 5  ? 11.492  -9.879  -2.445  1.00 0.00 ? 5   SER B CA   5  
ATOM   9677  C C    . SER B 1 5  ? 10.489  -9.503  -1.341  1.00 0.00 ? 5   SER B C    5  
ATOM   9678  O O    . SER B 1 5  ? 9.918   -10.359 -0.694  1.00 0.00 ? 5   SER B O    5  
ATOM   9679  C CB   . SER B 1 5  ? 12.867  -9.241  -2.179  1.00 0.00 ? 5   SER B CB   5  
ATOM   9680  O OG   . SER B 1 5  ? 13.803  -10.269 -1.878  1.00 0.00 ? 5   SER B OG   5  
ATOM   9681  H H    . SER B 1 5  ? 11.241  -8.534  -4.114  1.00 0.00 ? 5   SER B H    5  
ATOM   9682  H HA   . SER B 1 5  ? 11.604  -10.951 -2.466  1.00 0.00 ? 5   SER B HA   5  
ATOM   9683  H HB2  . SER B 1 5  ? 13.196  -8.718  -3.060  1.00 0.00 ? 5   SER B HB2  5  
ATOM   9684  H HB3  . SER B 1 5  ? 12.807  -8.544  -1.353  1.00 0.00 ? 5   SER B HB3  5  
ATOM   9685  H HG   . SER B 1 5  ? 13.543  -11.057 -2.359  1.00 0.00 ? 5   SER B HG   5  
ATOM   9686  N N    . ASP B 1 6  ? 10.270  -8.232  -1.121  1.00 0.00 ? 6   ASP B N    5  
ATOM   9687  C CA   . ASP B 1 6  ? 9.302   -7.810  -0.060  1.00 0.00 ? 6   ASP B CA   5  
ATOM   9688  C C    . ASP B 1 6  ? 8.785   -6.395  -0.364  1.00 0.00 ? 6   ASP B C    5  
ATOM   9689  O O    . ASP B 1 6  ? 9.106   -5.463  0.346   1.00 0.00 ? 6   ASP B O    5  
ATOM   9690  C CB   . ASP B 1 6  ? 10.001  -7.807  1.309   1.00 0.00 ? 6   ASP B CB   5  
ATOM   9691  C CG   . ASP B 1 6  ? 8.950   -7.822  2.423   1.00 0.00 ? 6   ASP B CG   5  
ATOM   9692  O OD1  . ASP B 1 6  ? 8.061   -8.657  2.361   1.00 0.00 ? 6   ASP B OD1  5  
ATOM   9693  O OD2  . ASP B 1 6  ? 9.050   -6.998  3.316   1.00 0.00 ? 6   ASP B OD2  5  
ATOM   9694  H H    . ASP B 1 6  ? 10.738  -7.557  -1.656  1.00 0.00 ? 6   ASP B H    5  
ATOM   9695  H HA   . ASP B 1 6  ? 8.472   -8.499  -0.037  1.00 0.00 ? 6   ASP B HA   5  
ATOM   9696  H HB2  . ASP B 1 6  ? 10.627  -8.683  1.398   1.00 0.00 ? 6   ASP B HB2  5  
ATOM   9697  H HB3  . ASP B 1 6  ? 10.610  -6.920  1.408   1.00 0.00 ? 6   ASP B HB3  5  
ATOM   9698  N N    . PRO B 1 7  ? 8.001   -6.261  -1.414  1.00 0.00 ? 7   PRO B N    5  
ATOM   9699  C CA   . PRO B 1 7  ? 7.452   -4.947  -1.799  1.00 0.00 ? 7   PRO B CA   5  
ATOM   9700  C C    . PRO B 1 7  ? 6.498   -4.435  -0.697  1.00 0.00 ? 7   PRO B C    5  
ATOM   9701  O O    . PRO B 1 7  ? 6.134   -5.186  0.187   1.00 0.00 ? 7   PRO B O    5  
ATOM   9702  C CB   . PRO B 1 7  ? 6.700   -5.207  -3.128  1.00 0.00 ? 7   PRO B CB   5  
ATOM   9703  C CG   . PRO B 1 7  ? 6.799   -6.731  -3.434  1.00 0.00 ? 7   PRO B CG   5  
ATOM   9704  C CD   . PRO B 1 7  ? 7.607   -7.385  -2.290  1.00 0.00 ? 7   PRO B CD   5  
ATOM   9705  H HA   . PRO B 1 7  ? 8.259   -4.251  -1.956  1.00 0.00 ? 7   PRO B HA   5  
ATOM   9706  H HB2  . PRO B 1 7  ? 5.659   -4.914  -3.035  1.00 0.00 ? 7   PRO B HB2  5  
ATOM   9707  H HB3  . PRO B 1 7  ? 7.160   -4.646  -3.930  1.00 0.00 ? 7   PRO B HB3  5  
ATOM   9708  H HG2  . PRO B 1 7  ? 5.806   -7.163  -3.484  1.00 0.00 ? 7   PRO B HG2  5  
ATOM   9709  H HG3  . PRO B 1 7  ? 7.308   -6.888  -4.376  1.00 0.00 ? 7   PRO B HG3  5  
ATOM   9710  H HD2  . PRO B 1 7  ? 6.986   -8.088  -1.748  1.00 0.00 ? 7   PRO B HD2  5  
ATOM   9711  H HD3  . PRO B 1 7  ? 8.485   -7.880  -2.677  1.00 0.00 ? 7   PRO B HD3  5  
ATOM   9712  N N    . PRO B 1 8  ? 6.112   -3.177  -0.781  1.00 0.00 ? 8   PRO B N    5  
ATOM   9713  C CA   . PRO B 1 8  ? 5.193   -2.581  0.213   1.00 0.00 ? 8   PRO B CA   5  
ATOM   9714  C C    . PRO B 1 8  ? 3.839   -3.308  0.179   1.00 0.00 ? 8   PRO B C    5  
ATOM   9715  O O    . PRO B 1 8  ? 3.737   -4.428  -0.281  1.00 0.00 ? 8   PRO B O    5  
ATOM   9716  C CB   . PRO B 1 8  ? 5.046   -1.101  -0.222  1.00 0.00 ? 8   PRO B CB   5  
ATOM   9717  C CG   . PRO B 1 8  ? 5.787   -0.940  -1.580  1.00 0.00 ? 8   PRO B CG   5  
ATOM   9718  C CD   . PRO B 1 8  ? 6.550   -2.255  -1.852  1.00 0.00 ? 8   PRO B CD   5  
ATOM   9719  H HA   . PRO B 1 8  ? 5.625   -2.638  1.201   1.00 0.00 ? 8   PRO B HA   5  
ATOM   9720  H HB2  . PRO B 1 8  ? 4.000   -0.841  -0.335  1.00 0.00 ? 8   PRO B HB2  5  
ATOM   9721  H HB3  . PRO B 1 8  ? 5.500   -0.453  0.517   1.00 0.00 ? 8   PRO B HB3  5  
ATOM   9722  H HG2  . PRO B 1 8  ? 5.070   -0.755  -2.371  1.00 0.00 ? 8   PRO B HG2  5  
ATOM   9723  H HG3  . PRO B 1 8  ? 6.487   -0.115  -1.527  1.00 0.00 ? 8   PRO B HG3  5  
ATOM   9724  H HD2  . PRO B 1 8  ? 6.288   -2.653  -2.825  1.00 0.00 ? 8   PRO B HD2  5  
ATOM   9725  H HD3  . PRO B 1 8  ? 7.613   -2.090  -1.787  1.00 0.00 ? 8   PRO B HD3  5  
ATOM   9726  N N    . THR B 1 9  ? 2.801   -2.674  0.662   1.00 0.00 ? 9   THR B N    5  
ATOM   9727  C CA   . THR B 1 9  ? 1.457   -3.322  0.656   1.00 0.00 ? 9   THR B CA   5  
ATOM   9728  C C    . THR B 1 9  ? 0.371   -2.249  0.660   1.00 0.00 ? 9   THR B C    5  
ATOM   9729  O O    . THR B 1 9  ? 0.377   -1.341  1.469   1.00 0.00 ? 9   THR B O    5  
ATOM   9730  C CB   . THR B 1 9  ? 1.304   -4.197  1.900   1.00 0.00 ? 9   THR B CB   5  
ATOM   9731  O OG1  . THR B 1 9  ? 2.460   -5.010  2.049   1.00 0.00 ? 9   THR B OG1  5  
ATOM   9732  C CG2  . THR B 1 9  ? 0.065   -5.084  1.753   1.00 0.00 ? 9   THR B CG2  5  
ATOM   9733  H H    . THR B 1 9  ? 2.907   -1.770  1.028   1.00 0.00 ? 9   THR B H    5  
ATOM   9734  H HA   . THR B 1 9  ? 1.349   -3.931  -0.230  1.00 0.00 ? 9   THR B HA   5  
ATOM   9735  H HB   . THR B 1 9  ? 1.190   -3.568  2.768   1.00 0.00 ? 9   THR B HB   5  
ATOM   9736  H HG1  . THR B 1 9  ? 2.843   -5.144  1.179   1.00 0.00 ? 9   THR B HG1  5  
ATOM   9737  H HG21 . THR B 1 9  ? -0.803  -4.464  1.582   1.00 0.00 ? 9   THR B HG21 5  
ATOM   9738  H HG22 . THR B 1 9  ? 0.199   -5.754  0.916   1.00 0.00 ? 9   THR B HG22 5  
ATOM   9739  H HG23 . THR B 1 9  ? -0.075  -5.659  2.656   1.00 0.00 ? 9   THR B HG23 5  
ATOM   9740  N N    . ALA B 1 10 ? -0.565  -2.350  -0.240  1.00 0.00 ? 10  ALA B N    5  
ATOM   9741  C CA   . ALA B 1 10 ? -1.661  -1.347  -0.300  1.00 0.00 ? 10  ALA B CA   5  
ATOM   9742  C C    . ALA B 1 10 ? -2.566  -1.496  0.923   1.00 0.00 ? 10  ALA B C    5  
ATOM   9743  O O    . ALA B 1 10 ? -3.620  -2.097  0.855   1.00 0.00 ? 10  ALA B O    5  
ATOM   9744  C CB   . ALA B 1 10 ? -2.480  -1.579  -1.568  1.00 0.00 ? 10  ALA B CB   5  
ATOM   9745  H H    . ALA B 1 10 ? -0.548  -3.094  -0.878  1.00 0.00 ? 10  ALA B H    5  
ATOM   9746  H HA   . ALA B 1 10 ? -1.241  -0.351  -0.318  1.00 0.00 ? 10  ALA B HA   5  
ATOM   9747  H HB1  . ALA B 1 10 ? -2.694  -2.634  -1.669  1.00 0.00 ? 10  ALA B HB1  5  
ATOM   9748  H HB2  . ALA B 1 10 ? -3.407  -1.029  -1.505  1.00 0.00 ? 10  ALA B HB2  5  
ATOM   9749  H HB3  . ALA B 1 10 ? -1.918  -1.243  -2.426  1.00 0.00 ? 10  ALA B HB3  5  
ATOM   9750  N N    . CYS B 1 11 ? -2.166  -0.943  2.041   1.00 0.00 ? 11  CYS B N    5  
ATOM   9751  C CA   . CYS B 1 11 ? -2.999  -1.033  3.282   1.00 0.00 ? 11  CYS B CA   5  
ATOM   9752  C C    . CYS B 1 11 ? -3.592  0.346   3.574   1.00 0.00 ? 11  CYS B C    5  
ATOM   9753  O O    . CYS B 1 11 ? -2.918  1.353   3.482   1.00 0.00 ? 11  CYS B O    5  
ATOM   9754  C CB   . CYS B 1 11 ? -2.118  -1.471  4.456   1.00 0.00 ? 11  CYS B CB   5  
ATOM   9755  S SG   . CYS B 1 11 ? -1.298  -3.034  4.047   1.00 0.00 ? 11  CYS B SG   5  
ATOM   9756  H H    . CYS B 1 11 ? -1.315  -0.458  2.063   1.00 0.00 ? 11  CYS B H    5  
ATOM   9757  H HA   . CYS B 1 11 ? -3.800  -1.748  3.147   1.00 0.00 ? 11  CYS B HA   5  
ATOM   9758  H HB2  . CYS B 1 11 ? -1.373  -0.713  4.649   1.00 0.00 ? 11  CYS B HB2  5  
ATOM   9759  H HB3  . CYS B 1 11 ? -2.731  -1.605  5.335   1.00 0.00 ? 11  CYS B HB3  5  
ATOM   9760  N N    . CYS B 1 12 ? -4.850  0.404   3.914   1.00 0.00 ? 12  CYS B N    5  
ATOM   9761  C CA   . CYS B 1 12 ? -5.482  1.724   4.201   1.00 0.00 ? 12  CYS B CA   5  
ATOM   9762  C C    . CYS B 1 12 ? -4.967  2.260   5.537   1.00 0.00 ? 12  CYS B C    5  
ATOM   9763  O O    . CYS B 1 12 ? -4.750  1.517   6.474   1.00 0.00 ? 12  CYS B O    5  
ATOM   9764  C CB   . CYS B 1 12 ? -7.003  1.562   4.266   1.00 0.00 ? 12  CYS B CB   5  
ATOM   9765  S SG   . CYS B 1 12 ? -7.633  1.077   2.639   1.00 0.00 ? 12  CYS B SG   5  
ATOM   9766  H H    . CYS B 1 12 ? -5.381  -0.417  3.975   1.00 0.00 ? 12  CYS B H    5  
ATOM   9767  H HA   . CYS B 1 12 ? -5.229  2.419   3.414   1.00 0.00 ? 12  CYS B HA   5  
ATOM   9768  H HB2  . CYS B 1 12 ? -7.254  0.801   4.990   1.00 0.00 ? 12  CYS B HB2  5  
ATOM   9769  H HB3  . CYS B 1 12 ? -7.453  2.499   4.561   1.00 0.00 ? 12  CYS B HB3  5  
ATOM   9770  N N    . PHE B 1 13 ? -4.776  3.551   5.631   1.00 0.00 ? 13  PHE B N    5  
ATOM   9771  C CA   . PHE B 1 13 ? -4.280  4.161   6.903   1.00 0.00 ? 13  PHE B CA   5  
ATOM   9772  C C    . PHE B 1 13 ? -5.457  4.818   7.625   1.00 0.00 ? 13  PHE B C    5  
ATOM   9773  O O    . PHE B 1 13 ? -5.410  5.078   8.811   1.00 0.00 ? 13  PHE B O    5  
ATOM   9774  C CB   . PHE B 1 13 ? -3.228  5.225   6.578   1.00 0.00 ? 13  PHE B CB   5  
ATOM   9775  C CG   . PHE B 1 13 ? -3.882  6.358   5.821   1.00 0.00 ? 13  PHE B CG   5  
ATOM   9776  C CD1  . PHE B 1 13 ? -4.161  6.218   4.449   1.00 0.00 ? 13  PHE B CD1  5  
ATOM   9777  C CD2  . PHE B 1 13 ? -4.217  7.550   6.492   1.00 0.00 ? 13  PHE B CD2  5  
ATOM   9778  C CE1  . PHE B 1 13 ? -4.775  7.271   3.746   1.00 0.00 ? 13  PHE B CE1  5  
ATOM   9779  C CE2  . PHE B 1 13 ? -4.833  8.602   5.789   1.00 0.00 ? 13  PHE B CE2  5  
ATOM   9780  C CZ   . PHE B 1 13 ? -5.112  8.464   4.415   1.00 0.00 ? 13  PHE B CZ   5  
ATOM   9781  H H    . PHE B 1 13 ? -4.963  4.126   4.859   1.00 0.00 ? 13  PHE B H    5  
ATOM   9782  H HA   . PHE B 1 13 ? -3.841  3.403   7.535   1.00 0.00 ? 13  PHE B HA   5  
ATOM   9783  H HB2  . PHE B 1 13 ? -2.803  5.602   7.496   1.00 0.00 ? 13  PHE B HB2  5  
ATOM   9784  H HB3  . PHE B 1 13 ? -2.450  4.790   5.971   1.00 0.00 ? 13  PHE B HB3  5  
ATOM   9785  H HD1  . PHE B 1 13 ? -3.903  5.303   3.936   1.00 0.00 ? 13  PHE B HD1  5  
ATOM   9786  H HD2  . PHE B 1 13 ? -4.003  7.656   7.545   1.00 0.00 ? 13  PHE B HD2  5  
ATOM   9787  H HE1  . PHE B 1 13 ? -4.988  7.163   2.693   1.00 0.00 ? 13  PHE B HE1  5  
ATOM   9788  H HE2  . PHE B 1 13 ? -5.090  9.517   6.302   1.00 0.00 ? 13  PHE B HE2  5  
ATOM   9789  H HZ   . PHE B 1 13 ? -5.583  9.271   3.875   1.00 0.00 ? 13  PHE B HZ   5  
ATOM   9790  N N    . SER B 1 14 ? -6.513  5.085   6.908   1.00 0.00 ? 14  SER B N    5  
ATOM   9791  C CA   . SER B 1 14 ? -7.706  5.725   7.527   1.00 0.00 ? 14  SER B CA   5  
ATOM   9792  C C    . SER B 1 14 ? -8.937  5.389   6.688   1.00 0.00 ? 14  SER B C    5  
ATOM   9793  O O    . SER B 1 14 ? -9.002  4.354   6.056   1.00 0.00 ? 14  SER B O    5  
ATOM   9794  C CB   . SER B 1 14 ? -7.512  7.242   7.566   1.00 0.00 ? 14  SER B CB   5  
ATOM   9795  O OG   . SER B 1 14 ? -7.402  7.735   6.237   1.00 0.00 ? 14  SER B OG   5  
ATOM   9796  H H    . SER B 1 14 ? -6.521  4.864   5.953   1.00 0.00 ? 14  SER B H    5  
ATOM   9797  H HA   . SER B 1 14 ? -7.839  5.350   8.533   1.00 0.00 ? 14  SER B HA   5  
ATOM   9798  H HB2  . SER B 1 14 ? -8.357  7.703   8.047   1.00 0.00 ? 14  SER B HB2  5  
ATOM   9799  H HB3  . SER B 1 14 ? -6.613  7.474   8.123   1.00 0.00 ? 14  SER B HB3  5  
ATOM   9800  H HG   . SER B 1 14 ? -8.280  7.987   5.942   1.00 0.00 ? 14  SER B HG   5  
ATOM   9801  N N    . TYR B 1 15 ? -9.920  6.249   6.673   1.00 0.00 ? 15  TYR B N    5  
ATOM   9802  C CA   . TYR B 1 15 ? -11.146 5.965   5.870   1.00 0.00 ? 15  TYR B CA   5  
ATOM   9803  C C    . TYR B 1 15 ? -11.828 7.278   5.492   1.00 0.00 ? 15  TYR B C    5  
ATOM   9804  O O    . TYR B 1 15 ? -11.578 8.313   6.078   1.00 0.00 ? 15  TYR B O    5  
ATOM   9805  C CB   . TYR B 1 15 ? -12.112 5.106   6.695   1.00 0.00 ? 15  TYR B CB   5  
ATOM   9806  C CG   . TYR B 1 15 ? -11.339 4.060   7.460   1.00 0.00 ? 15  TYR B CG   5  
ATOM   9807  C CD1  . TYR B 1 15 ? -10.855 4.347   8.750   1.00 0.00 ? 15  TYR B CD1  5  
ATOM   9808  C CD2  . TYR B 1 15 ? -11.098 2.798   6.884   1.00 0.00 ? 15  TYR B CD2  5  
ATOM   9809  C CE1  . TYR B 1 15 ? -10.132 3.373   9.466   1.00 0.00 ? 15  TYR B CE1  5  
ATOM   9810  C CE2  . TYR B 1 15 ? -10.376 1.824   7.598   1.00 0.00 ? 15  TYR B CE2  5  
ATOM   9811  C CZ   . TYR B 1 15 ? -9.892  2.112   8.889   1.00 0.00 ? 15  TYR B CZ   5  
ATOM   9812  O OH   . TYR B 1 15 ? -9.184  1.156   9.590   1.00 0.00 ? 15  TYR B OH   5  
ATOM   9813  H H    . TYR B 1 15 ? -9.853  7.080   7.190   1.00 0.00 ? 15  TYR B H    5  
ATOM   9814  H HA   . TYR B 1 15 ? -10.874 5.437   4.965   1.00 0.00 ? 15  TYR B HA   5  
ATOM   9815  H HB2  . TYR B 1 15 ? -12.651 5.732   7.393   1.00 0.00 ? 15  TYR B HB2  5  
ATOM   9816  H HB3  . TYR B 1 15 ? -12.813 4.620   6.034   1.00 0.00 ? 15  TYR B HB3  5  
ATOM   9817  H HD1  . TYR B 1 15 ? -11.038 5.315   9.193   1.00 0.00 ? 15  TYR B HD1  5  
ATOM   9818  H HD2  . TYR B 1 15 ? -11.469 2.577   5.893   1.00 0.00 ? 15  TYR B HD2  5  
ATOM   9819  H HE1  . TYR B 1 15 ? -9.761  3.594   10.456  1.00 0.00 ? 15  TYR B HE1  5  
ATOM   9820  H HE2  . TYR B 1 15 ? -10.192 0.856   7.157   1.00 0.00 ? 15  TYR B HE2  5  
ATOM   9821  H HH   . TYR B 1 15 ? -9.436  1.218   10.514  1.00 0.00 ? 15  TYR B HH   5  
ATOM   9822  N N    . THR B 1 16 ? -12.693 7.242   4.518   1.00 0.00 ? 16  THR B N    5  
ATOM   9823  C CA   . THR B 1 16 ? -13.396 8.488   4.106   1.00 0.00 ? 16  THR B CA   5  
ATOM   9824  C C    . THR B 1 16 ? -14.184 9.037   5.298   1.00 0.00 ? 16  THR B C    5  
ATOM   9825  O O    . THR B 1 16 ? -13.987 8.627   6.424   1.00 0.00 ? 16  THR B O    5  
ATOM   9826  C CB   . THR B 1 16 ? -14.342 8.182   2.939   1.00 0.00 ? 16  THR B CB   5  
ATOM   9827  O OG1  . THR B 1 16 ? -15.144 9.321   2.661   1.00 0.00 ? 16  THR B OG1  5  
ATOM   9828  C CG2  . THR B 1 16 ? -15.241 6.997   3.293   1.00 0.00 ? 16  THR B CG2  5  
ATOM   9829  H H    . THR B 1 16 ? -12.887 6.391   4.064   1.00 0.00 ? 16  THR B H    5  
ATOM   9830  H HA   . THR B 1 16 ? -12.668 9.223   3.795   1.00 0.00 ? 16  THR B HA   5  
ATOM   9831  H HB   . THR B 1 16 ? -13.761 7.935   2.065   1.00 0.00 ? 16  THR B HB   5  
ATOM   9832  H HG1  . THR B 1 16 ? -15.095 9.495   1.719   1.00 0.00 ? 16  THR B HG1  5  
ATOM   9833  H HG21 . THR B 1 16 ? -15.797 7.222   4.191   1.00 0.00 ? 16  THR B HG21 5  
ATOM   9834  H HG22 . THR B 1 16 ? -15.930 6.813   2.481   1.00 0.00 ? 16  THR B HG22 5  
ATOM   9835  H HG23 . THR B 1 16 ? -14.634 6.120   3.455   1.00 0.00 ? 16  THR B HG23 5  
ATOM   9836  N N    . ALA B 1 17 ? -15.076 9.960   5.059   1.00 0.00 ? 17  ALA B N    5  
ATOM   9837  C CA   . ALA B 1 17 ? -15.887 10.543  6.169   1.00 0.00 ? 17  ALA B CA   5  
ATOM   9838  C C    . ALA B 1 17 ? -17.317 10.735  5.673   1.00 0.00 ? 17  ALA B C    5  
ATOM   9839  O O    . ALA B 1 17 ? -18.121 11.402  6.292   1.00 0.00 ? 17  ALA B O    5  
ATOM   9840  C CB   . ALA B 1 17 ? -15.296 11.894  6.575   1.00 0.00 ? 17  ALA B CB   5  
ATOM   9841  H H    . ALA B 1 17 ? -15.215 10.275  4.142   1.00 0.00 ? 17  ALA B H    5  
ATOM   9842  H HA   . ALA B 1 17 ? -15.888 9.875   7.021   1.00 0.00 ? 17  ALA B HA   5  
ATOM   9843  H HB1  . ALA B 1 17 ? -15.058 12.463  5.690   1.00 0.00 ? 17  ALA B HB1  5  
ATOM   9844  H HB2  . ALA B 1 17 ? -16.015 12.437  7.170   1.00 0.00 ? 17  ALA B HB2  5  
ATOM   9845  H HB3  . ALA B 1 17 ? -14.397 11.734  7.153   1.00 0.00 ? 17  ALA B HB3  5  
ATOM   9846  N N    . ARG B 1 18 ? -17.636 10.140  4.553   1.00 0.00 ? 18  ARG B N    5  
ATOM   9847  C CA   . ARG B 1 18 ? -19.012 10.258  3.988   1.00 0.00 ? 18  ARG B CA   5  
ATOM   9848  C C    . ARG B 1 18 ? -19.436 8.896   3.438   1.00 0.00 ? 18  ARG B C    5  
ATOM   9849  O O    . ARG B 1 18 ? -18.776 8.325   2.593   1.00 0.00 ? 18  ARG B O    5  
ATOM   9850  C CB   . ARG B 1 18 ? -19.020 11.285  2.846   1.00 0.00 ? 18  ARG B CB   5  
ATOM   9851  C CG   . ARG B 1 18 ? -18.696 12.701  3.384   1.00 0.00 ? 18  ARG B CG   5  
ATOM   9852  C CD   . ARG B 1 18 ? -17.202 13.008  3.211   1.00 0.00 ? 18  ARG B CD   5  
ATOM   9853  N NE   . ARG B 1 18 ? -16.882 14.301  3.880   1.00 0.00 ? 18  ARG B NE   5  
ATOM   9854  C CZ   . ARG B 1 18 ? -15.640 14.630  4.107   1.00 0.00 ? 18  ARG B CZ   5  
ATOM   9855  N NH1  . ARG B 1 18 ? -14.675 13.830  3.741   1.00 0.00 ? 18  ARG B NH1  5  
ATOM   9856  N NH2  . ARG B 1 18 ? -15.362 15.759  4.697   1.00 0.00 ? 18  ARG B NH2  5  
ATOM   9857  H H    . ARG B 1 18 ? -16.964 9.605   4.082   1.00 0.00 ? 18  ARG B H    5  
ATOM   9858  H HA   . ARG B 1 18 ? -19.705 10.566  4.758   1.00 0.00 ? 18  ARG B HA   5  
ATOM   9859  H HB2  . ARG B 1 18 ? -18.290 10.996  2.103   1.00 0.00 ? 18  ARG B HB2  5  
ATOM   9860  H HB3  . ARG B 1 18 ? -20.000 11.293  2.390   1.00 0.00 ? 18  ARG B HB3  5  
ATOM   9861  H HG2  . ARG B 1 18 ? -19.270 13.434  2.834   1.00 0.00 ? 18  ARG B HG2  5  
ATOM   9862  H HG3  . ARG B 1 18 ? -18.953 12.766  4.432   1.00 0.00 ? 18  ARG B HG3  5  
ATOM   9863  H HD2  . ARG B 1 18 ? -16.616 12.219  3.655   1.00 0.00 ? 18  ARG B HD2  5  
ATOM   9864  H HD3  . ARG B 1 18 ? -16.969 13.079  2.158   1.00 0.00 ? 18  ARG B HD3  5  
ATOM   9865  H HE   . ARG B 1 18 ? -17.606 14.903  4.153   1.00 0.00 ? 18  ARG B HE   5  
ATOM   9866  H HH11 . ARG B 1 18 ? -14.889 12.965  3.287   1.00 0.00 ? 18  ARG B HH11 5  
ATOM   9867  H HH12 . ARG B 1 18 ? -13.724 14.083  3.915   1.00 0.00 ? 18  ARG B HH12 5  
ATOM   9868  H HH21 . ARG B 1 18 ? -16.101 16.374  4.976   1.00 0.00 ? 18  ARG B HH21 5  
ATOM   9869  H HH22 . ARG B 1 18 ? -14.409 16.012  4.871   1.00 0.00 ? 18  ARG B HH22 5  
ATOM   9870  N N    . LYS B 1 19 ? -20.532 8.373   3.908   1.00 0.00 ? 19  LYS B N    5  
ATOM   9871  C CA   . LYS B 1 19 ? -20.998 7.049   3.411   1.00 0.00 ? 19  LYS B CA   5  
ATOM   9872  C C    . LYS B 1 19 ? -21.310 7.167   1.913   1.00 0.00 ? 19  LYS B C    5  
ATOM   9873  O O    . LYS B 1 19 ? -22.056 8.027   1.491   1.00 0.00 ? 19  LYS B O    5  
ATOM   9874  C CB   . LYS B 1 19 ? -22.248 6.640   4.201   1.00 0.00 ? 19  LYS B CB   5  
ATOM   9875  C CG   . LYS B 1 19 ? -22.978 5.492   3.513   1.00 0.00 ? 19  LYS B CG   5  
ATOM   9876  C CD   . LYS B 1 19 ? -24.066 4.991   4.455   1.00 0.00 ? 19  LYS B CD   5  
ATOM   9877  C CE   . LYS B 1 19 ? -24.952 3.997   3.726   1.00 0.00 ? 19  LYS B CE   5  
ATOM   9878  N NZ   . LYS B 1 19 ? -24.101 2.994   3.033   1.00 0.00 ? 19  LYS B NZ   5  
ATOM   9879  H H    . LYS B 1 19 ? -21.051 8.850   4.589   1.00 0.00 ? 19  LYS B H    5  
ATOM   9880  H HA   . LYS B 1 19 ? -20.219 6.314   3.559   1.00 0.00 ? 19  LYS B HA   5  
ATOM   9881  H HB2  . LYS B 1 19 ? -21.956 6.321   5.191   1.00 0.00 ? 19  LYS B HB2  5  
ATOM   9882  H HB3  . LYS B 1 19 ? -22.915 7.483   4.281   1.00 0.00 ? 19  LYS B HB3  5  
ATOM   9883  H HG2  . LYS B 1 19 ? -23.426 5.840   2.592   1.00 0.00 ? 19  LYS B HG2  5  
ATOM   9884  H HG3  . LYS B 1 19 ? -22.285 4.691   3.304   1.00 0.00 ? 19  LYS B HG3  5  
ATOM   9885  H HD2  . LYS B 1 19 ? -23.611 4.515   5.307   1.00 0.00 ? 19  LYS B HD2  5  
ATOM   9886  H HD3  . LYS B 1 19 ? -24.663 5.826   4.785   1.00 0.00 ? 19  LYS B HD3  5  
ATOM   9887  H HE2  . LYS B 1 19 ? -25.591 3.502   4.440   1.00 0.00 ? 19  LYS B HE2  5  
ATOM   9888  H HE3  . LYS B 1 19 ? -25.553 4.522   3.003   1.00 0.00 ? 19  LYS B HE3  5  
ATOM   9889  H HZ1  . LYS B 1 19 ? -23.121 3.086   3.366   1.00 0.00 ? 19  LYS B HZ1  5  
ATOM   9890  H HZ2  . LYS B 1 19 ? -24.452 2.037   3.240   1.00 0.00 ? 19  LYS B HZ2  5  
ATOM   9891  H HZ3  . LYS B 1 19 ? -24.136 3.159   2.007   1.00 0.00 ? 19  LYS B HZ3  5  
ATOM   9892  N N    . LEU B 1 20 ? -20.726 6.321   1.109   1.00 0.00 ? 20  LEU B N    5  
ATOM   9893  C CA   . LEU B 1 20 ? -20.967 6.394   -0.362  1.00 0.00 ? 20  LEU B CA   5  
ATOM   9894  C C    . LEU B 1 20 ? -22.384 5.871   -0.700  1.00 0.00 ? 20  LEU B C    5  
ATOM   9895  O O    . LEU B 1 20 ? -22.652 4.709   -0.464  1.00 0.00 ? 20  LEU B O    5  
ATOM   9896  C CB   . LEU B 1 20 ? -19.951 5.504   -1.083  1.00 0.00 ? 20  LEU B CB   5  
ATOM   9897  C CG   . LEU B 1 20 ? -18.548 5.724   -0.514  1.00 0.00 ? 20  LEU B CG   5  
ATOM   9898  C CD1  . LEU B 1 20 ? -17.536 4.998   -1.400  1.00 0.00 ? 20  LEU B CD1  5  
ATOM   9899  C CD2  . LEU B 1 20 ? -18.218 7.219   -0.494  1.00 0.00 ? 20  LEU B CD2  5  
ATOM   9900  H H    . LEU B 1 20 ? -20.115 5.644   1.470   1.00 0.00 ? 20  LEU B H    5  
ATOM   9901  H HA   . LEU B 1 20 ? -20.833 7.405   -0.687  1.00 0.00 ? 20  LEU B HA   5  
ATOM   9902  H HB2  . LEU B 1 20 ? -20.226 4.466   -0.953  1.00 0.00 ? 20  LEU B HB2  5  
ATOM   9903  H HB3  . LEU B 1 20 ? -19.950 5.744   -2.136  1.00 0.00 ? 20  LEU B HB3  5  
ATOM   9904  H HG   . LEU B 1 20 ? -18.502 5.326   0.488   1.00 0.00 ? 20  LEU B HG   5  
ATOM   9905  H HD11 . LEU B 1 20 ? -17.891 3.999   -1.610  1.00 0.00 ? 20  LEU B HD11 5  
ATOM   9906  H HD12 . LEU B 1 20 ? -17.419 5.540   -2.327  1.00 0.00 ? 20  LEU B HD12 5  
ATOM   9907  H HD13 . LEU B 1 20 ? -16.588 4.945   -0.891  1.00 0.00 ? 20  LEU B HD13 5  
ATOM   9908  H HD21 . LEU B 1 20 ? -18.523 7.668   -1.426  1.00 0.00 ? 20  LEU B HD21 5  
ATOM   9909  H HD22 . LEU B 1 20 ? -18.741 7.692   0.324   1.00 0.00 ? 20  LEU B HD22 5  
ATOM   9910  H HD23 . LEU B 1 20 ? -17.153 7.351   -0.362  1.00 0.00 ? 20  LEU B HD23 5  
ATOM   9911  N N    . PRO B 1 21 ? -23.256 6.695   -1.264  1.00 0.00 ? 21  PRO B N    5  
ATOM   9912  C CA   . PRO B 1 21 ? -24.605 6.221   -1.630  1.00 0.00 ? 21  PRO B CA   5  
ATOM   9913  C C    . PRO B 1 21 ? -24.487 5.035   -2.593  1.00 0.00 ? 21  PRO B C    5  
ATOM   9914  O O    . PRO B 1 21 ? -23.566 4.958   -3.379  1.00 0.00 ? 21  PRO B O    5  
ATOM   9915  C CB   . PRO B 1 21 ? -25.279 7.426   -2.327  1.00 0.00 ? 21  PRO B CB   5  
ATOM   9916  C CG   . PRO B 1 21 ? -24.336 8.649   -2.148  1.00 0.00 ? 21  PRO B CG   5  
ATOM   9917  C CD   . PRO B 1 21 ? -23.004 8.124   -1.573  1.00 0.00 ? 21  PRO B CD   5  
ATOM   9918  H HA   . PRO B 1 21 ? -25.158 5.939   -0.749  1.00 0.00 ? 21  PRO B HA   5  
ATOM   9919  H HB2  . PRO B 1 21 ? -25.418 7.221   -3.384  1.00 0.00 ? 21  PRO B HB2  5  
ATOM   9920  H HB3  . PRO B 1 21 ? -26.233 7.628   -1.874  1.00 0.00 ? 21  PRO B HB3  5  
ATOM   9921  H HG2  . PRO B 1 21 ? -24.166 9.129   -3.105  1.00 0.00 ? 21  PRO B HG2  5  
ATOM   9922  H HG3  . PRO B 1 21 ? -24.775 9.357   -1.459  1.00 0.00 ? 21  PRO B HG3  5  
ATOM   9923  H HD2  . PRO B 1 21 ? -22.216 8.218   -2.310  1.00 0.00 ? 21  PRO B HD2  5  
ATOM   9924  H HD3  . PRO B 1 21 ? -22.745 8.660   -0.671  1.00 0.00 ? 21  PRO B HD3  5  
ATOM   9925  N N    . ARG B 1 22 ? -25.417 4.123   -2.553  1.00 0.00 ? 22  ARG B N    5  
ATOM   9926  C CA   . ARG B 1 22 ? -25.355 2.968   -3.490  1.00 0.00 ? 22  ARG B CA   5  
ATOM   9927  C C    . ARG B 1 22 ? -25.164 3.504   -4.912  1.00 0.00 ? 22  ARG B C    5  
ATOM   9928  O O    . ARG B 1 22 ? -24.532 2.884   -5.744  1.00 0.00 ? 22  ARG B O    5  
ATOM   9929  C CB   . ARG B 1 22 ? -26.660 2.172   -3.410  1.00 0.00 ? 22  ARG B CB   5  
ATOM   9930  C CG   . ARG B 1 22 ? -26.469 0.805   -4.070  1.00 0.00 ? 22  ARG B CG   5  
ATOM   9931  C CD   . ARG B 1 22 ? -27.732 -0.034  -3.876  1.00 0.00 ? 22  ARG B CD   5  
ATOM   9932  N NE   . ARG B 1 22 ? -27.605 -1.306  -4.644  1.00 0.00 ? 22  ARG B NE   5  
ATOM   9933  C CZ   . ARG B 1 22 ? -28.416 -2.299  -4.400  1.00 0.00 ? 22  ARG B CZ   5  
ATOM   9934  N NH1  . ARG B 1 22 ? -29.339 -2.178  -3.485  1.00 0.00 ? 22  ARG B NH1  5  
ATOM   9935  N NH2  . ARG B 1 22 ? -28.304 -3.412  -5.071  1.00 0.00 ? 22  ARG B NH2  5  
ATOM   9936  H H    . ARG B 1 22 ? -26.162 4.206   -1.923  1.00 0.00 ? 22  ARG B H    5  
ATOM   9937  H HA   . ARG B 1 22 ? -24.523 2.332   -3.230  1.00 0.00 ? 22  ARG B HA   5  
ATOM   9938  H HB2  . ARG B 1 22 ? -26.934 2.036   -2.374  1.00 0.00 ? 22  ARG B HB2  5  
ATOM   9939  H HB3  . ARG B 1 22 ? -27.444 2.710   -3.922  1.00 0.00 ? 22  ARG B HB3  5  
ATOM   9940  H HG2  . ARG B 1 22 ? -26.281 0.938   -5.126  1.00 0.00 ? 22  ARG B HG2  5  
ATOM   9941  H HG3  . ARG B 1 22 ? -25.629 0.299   -3.615  1.00 0.00 ? 22  ARG B HG3  5  
ATOM   9942  H HD2  . ARG B 1 22 ? -27.858 -0.259  -2.828  1.00 0.00 ? 22  ARG B HD2  5  
ATOM   9943  H HD3  . ARG B 1 22 ? -28.589 0.518   -4.232  1.00 0.00 ? 22  ARG B HD3  5  
ATOM   9944  H HE   . ARG B 1 22 ? -26.913 -1.396  -5.331  1.00 0.00 ? 22  ARG B HE   5  
ATOM   9945  H HH11 . ARG B 1 22 ? -29.425 -1.324  -2.971  1.00 0.00 ? 22  ARG B HH11 5  
ATOM   9946  H HH12 . ARG B 1 22 ? -29.961 -2.939  -3.299  1.00 0.00 ? 22  ARG B HH12 5  
ATOM   9947  H HH21 . ARG B 1 22 ? -27.598 -3.505  -5.772  1.00 0.00 ? 22  ARG B HH21 5  
ATOM   9948  H HH22 . ARG B 1 22 ? -28.927 -4.173  -4.884  1.00 0.00 ? 22  ARG B HH22 5  
ATOM   9949  N N    . ASN B 1 23 ? -25.709 4.660   -5.188  1.00 0.00 ? 23  ASN B N    5  
ATOM   9950  C CA   . ASN B 1 23 ? -25.566 5.253   -6.549  1.00 0.00 ? 23  ASN B CA   5  
ATOM   9951  C C    . ASN B 1 23 ? -24.132 5.749   -6.750  1.00 0.00 ? 23  ASN B C    5  
ATOM   9952  O O    . ASN B 1 23 ? -23.847 6.482   -7.676  1.00 0.00 ? 23  ASN B O    5  
ATOM   9953  C CB   . ASN B 1 23 ? -26.535 6.427   -6.695  1.00 0.00 ? 23  ASN B CB   5  
ATOM   9954  C CG   . ASN B 1 23 ? -27.935 5.993   -6.258  1.00 0.00 ? 23  ASN B CG   5  
ATOM   9955  O OD1  . ASN B 1 23 ? -28.516 5.099   -6.840  1.00 0.00 ? 23  ASN B OD1  5  
ATOM   9956  N ND2  . ASN B 1 23 ? -28.504 6.593   -5.249  1.00 0.00 ? 23  ASN B ND2  5  
ATOM   9957  H H    . ASN B 1 23 ? -26.210 5.142   -4.494  1.00 0.00 ? 23  ASN B H    5  
ATOM   9958  H HA   . ASN B 1 23 ? -25.795 4.503   -7.292  1.00 0.00 ? 23  ASN B HA   5  
ATOM   9959  H HB2  . ASN B 1 23 ? -26.202 7.248   -6.077  1.00 0.00 ? 23  ASN B HB2  5  
ATOM   9960  H HB3  . ASN B 1 23 ? -26.565 6.743   -7.728  1.00 0.00 ? 23  ASN B HB3  5  
ATOM   9961  H HD21 . ASN B 1 23 ? -28.036 7.314   -4.779  1.00 0.00 ? 23  ASN B HD21 5  
ATOM   9962  H HD22 . ASN B 1 23 ? -29.402 6.322   -4.961  1.00 0.00 ? 23  ASN B HD22 5  
ATOM   9963  N N    . PHE B 1 24 ? -23.227 5.364   -5.884  1.00 0.00 ? 24  PHE B N    5  
ATOM   9964  C CA   . PHE B 1 24 ? -21.806 5.825   -6.017  1.00 0.00 ? 24  PHE B CA   5  
ATOM   9965  C C    . PHE B 1 24 ? -20.863 4.662   -5.693  1.00 0.00 ? 24  PHE B C    5  
ATOM   9966  O O    . PHE B 1 24 ? -19.757 4.859   -5.230  1.00 0.00 ? 24  PHE B O    5  
ATOM   9967  C CB   . PHE B 1 24 ? -21.567 6.983   -5.033  1.00 0.00 ? 24  PHE B CB   5  
ATOM   9968  C CG   . PHE B 1 24 ? -20.370 7.814   -5.457  1.00 0.00 ? 24  PHE B CG   5  
ATOM   9969  C CD1  . PHE B 1 24 ? -20.367 8.471   -6.706  1.00 0.00 ? 24  PHE B CD1  5  
ATOM   9970  C CD2  . PHE B 1 24 ? -19.261 7.943   -4.594  1.00 0.00 ? 24  PHE B CD2  5  
ATOM   9971  C CE1  . PHE B 1 24 ? -19.260 9.251   -7.089  1.00 0.00 ? 24  PHE B CE1  5  
ATOM   9972  C CE2  . PHE B 1 24 ? -18.154 8.723   -4.982  1.00 0.00 ? 24  PHE B CE2  5  
ATOM   9973  C CZ   . PHE B 1 24 ? -18.154 9.376   -6.227  1.00 0.00 ? 24  PHE B CZ   5  
ATOM   9974  H H    . PHE B 1 24 ? -23.484 4.782   -5.140  1.00 0.00 ? 24  PHE B H    5  
ATOM   9975  H HA   . PHE B 1 24 ? -21.620 6.157   -7.028  1.00 0.00 ? 24  PHE B HA   5  
ATOM   9976  H HB2  . PHE B 1 24 ? -22.441 7.612   -5.007  1.00 0.00 ? 24  PHE B HB2  5  
ATOM   9977  H HB3  . PHE B 1 24 ? -21.392 6.581   -4.043  1.00 0.00 ? 24  PHE B HB3  5  
ATOM   9978  H HD1  . PHE B 1 24 ? -21.214 8.381   -7.369  1.00 0.00 ? 24  PHE B HD1  5  
ATOM   9979  H HD2  . PHE B 1 24 ? -19.258 7.443   -3.638  1.00 0.00 ? 24  PHE B HD2  5  
ATOM   9980  H HE1  . PHE B 1 24 ? -19.258 9.753   -8.045  1.00 0.00 ? 24  PHE B HE1  5  
ATOM   9981  H HE2  . PHE B 1 24 ? -17.305 8.823   -4.320  1.00 0.00 ? 24  PHE B HE2  5  
ATOM   9982  H HZ   . PHE B 1 24 ? -17.305 9.974   -6.522  1.00 0.00 ? 24  PHE B HZ   5  
ATOM   9983  N N    . VAL B 1 25 ? -21.293 3.452   -5.937  1.00 0.00 ? 25  VAL B N    5  
ATOM   9984  C CA   . VAL B 1 25 ? -20.429 2.266   -5.651  1.00 0.00 ? 25  VAL B CA   5  
ATOM   9985  C C    . VAL B 1 25 ? -20.765 1.153   -6.646  1.00 0.00 ? 25  VAL B C    5  
ATOM   9986  O O    . VAL B 1 25 ? -21.643 0.345   -6.415  1.00 0.00 ? 25  VAL B O    5  
ATOM   9987  C CB   . VAL B 1 25 ? -20.692 1.771   -4.225  1.00 0.00 ? 25  VAL B CB   5  
ATOM   9988  C CG1  . VAL B 1 25 ? -19.741 0.619   -3.896  1.00 0.00 ? 25  VAL B CG1  5  
ATOM   9989  C CG2  . VAL B 1 25 ? -20.458 2.911   -3.232  1.00 0.00 ? 25  VAL B CG2  5  
ATOM   9990  H H    . VAL B 1 25 ? -22.187 3.321   -6.315  1.00 0.00 ? 25  VAL B H    5  
ATOM   9991  H HA   . VAL B 1 25 ? -19.388 2.537   -5.753  1.00 0.00 ? 25  VAL B HA   5  
ATOM   9992  H HB   . VAL B 1 25 ? -21.714 1.428   -4.148  1.00 0.00 ? 25  VAL B HB   5  
ATOM   9993  H HG11 . VAL B 1 25 ? -19.892 -0.187  -4.598  1.00 0.00 ? 25  VAL B HG11 5  
ATOM   9994  H HG12 . VAL B 1 25 ? -18.721 0.966   -3.958  1.00 0.00 ? 25  VAL B HG12 5  
ATOM   9995  H HG13 . VAL B 1 25 ? -19.942 0.267   -2.896  1.00 0.00 ? 25  VAL B HG13 5  
ATOM   9996  H HG21 . VAL B 1 25 ? -19.504 3.374   -3.434  1.00 0.00 ? 25  VAL B HG21 5  
ATOM   9997  H HG22 . VAL B 1 25 ? -21.244 3.644   -3.330  1.00 0.00 ? 25  VAL B HG22 5  
ATOM   9998  H HG23 . VAL B 1 25 ? -20.459 2.515   -2.228  1.00 0.00 ? 25  VAL B HG23 5  
ATOM   9999  N N    . VAL B 1 26 ? -20.078 1.109   -7.756  1.00 0.00 ? 26  VAL B N    5  
ATOM   10000 C CA   . VAL B 1 26 ? -20.357 0.056   -8.771  1.00 0.00 ? 26  VAL B CA   5  
ATOM   10001 C C    . VAL B 1 26 ? -19.576 -1.211  -8.432  1.00 0.00 ? 26  VAL B C    5  
ATOM   10002 O O    . VAL B 1 26 ? -19.812 -2.263  -8.992  1.00 0.00 ? 26  VAL B O    5  
ATOM   10003 C CB   . VAL B 1 26 ? -19.928 0.560   -10.149 1.00 0.00 ? 26  VAL B CB   5  
ATOM   10004 C CG1  . VAL B 1 26 ? -20.804 1.744   -10.552 1.00 0.00 ? 26  VAL B CG1  5  
ATOM   10005 C CG2  . VAL B 1 26 ? -18.463 1.004   -10.104 1.00 0.00 ? 26  VAL B CG2  5  
ATOM   10006 H H    . VAL B 1 26 ? -19.378 1.772   -7.925  1.00 0.00 ? 26  VAL B H    5  
ATOM   10007 H HA   . VAL B 1 26 ? -21.414 -0.168  -8.783  1.00 0.00 ? 26  VAL B HA   5  
ATOM   10008 H HB   . VAL B 1 26 ? -20.043 -0.233  -10.869 1.00 0.00 ? 26  VAL B HB   5  
ATOM   10009 H HG11 . VAL B 1 26 ? -20.879 2.433   -9.724  1.00 0.00 ? 26  VAL B HG11 5  
ATOM   10010 H HG12 . VAL B 1 26 ? -20.363 2.247   -11.400 1.00 0.00 ? 26  VAL B HG12 5  
ATOM   10011 H HG13 . VAL B 1 26 ? -21.790 1.390   -10.816 1.00 0.00 ? 26  VAL B HG13 5  
ATOM   10012 H HG21 . VAL B 1 26 ? -17.844 0.175   -9.795  1.00 0.00 ? 26  VAL B HG21 5  
ATOM   10013 H HG22 . VAL B 1 26 ? -18.157 1.335   -11.084 1.00 0.00 ? 26  VAL B HG22 5  
ATOM   10014 H HG23 . VAL B 1 26 ? -18.354 1.816   -9.400  1.00 0.00 ? 26  VAL B HG23 5  
ATOM   10015 N N    . ASP B 1 27 ? -18.647 -1.125  -7.524  1.00 0.00 ? 27  ASP B N    5  
ATOM   10016 C CA   . ASP B 1 27 ? -17.859 -2.334  -7.165  1.00 0.00 ? 27  ASP B CA   5  
ATOM   10017 C C    . ASP B 1 27 ? -17.023 -2.039  -5.927  1.00 0.00 ? 27  ASP B C    5  
ATOM   10018 O O    . ASP B 1 27 ? -17.156 -1.002  -5.309  1.00 0.00 ? 27  ASP B O    5  
ATOM   10019 C CB   . ASP B 1 27 ? -16.934 -2.703  -8.329  1.00 0.00 ? 27  ASP B CB   5  
ATOM   10020 C CG   . ASP B 1 27 ? -16.377 -4.111  -8.112  1.00 0.00 ? 27  ASP B CG   5  
ATOM   10021 O OD1  . ASP B 1 27 ? -17.166 -5.007  -7.863  1.00 0.00 ? 27  ASP B OD1  5  
ATOM   10022 O OD2  . ASP B 1 27 ? -15.170 -4.270  -8.199  1.00 0.00 ? 27  ASP B OD2  5  
ATOM   10023 H H    . ASP B 1 27 ? -18.463 -0.265  -7.082  1.00 0.00 ? 27  ASP B H    5  
ATOM   10024 H HA   . ASP B 1 27 ? -18.529 -3.155  -6.961  1.00 0.00 ? 27  ASP B HA   5  
ATOM   10025 H HB2  . ASP B 1 27 ? -17.491 -2.673  -9.255  1.00 0.00 ? 27  ASP B HB2  5  
ATOM   10026 H HB3  . ASP B 1 27 ? -16.115 -1.997  -8.378  1.00 0.00 ? 27  ASP B HB3  5  
ATOM   10027 N N    . TYR B 1 28 ? -16.159 -2.941  -5.556  1.00 0.00 ? 28  TYR B N    5  
ATOM   10028 C CA   . TYR B 1 28 ? -15.317 -2.702  -4.354  1.00 0.00 ? 28  TYR B CA   5  
ATOM   10029 C C    . TYR B 1 28 ? -14.045 -3.539  -4.432  1.00 0.00 ? 28  TYR B C    5  
ATOM   10030 O O    . TYR B 1 28 ? -13.778 -4.211  -5.408  1.00 0.00 ? 28  TYR B O    5  
ATOM   10031 C CB   . TYR B 1 28 ? -16.101 -3.050  -3.082  1.00 0.00 ? 28  TYR B CB   5  
ATOM   10032 C CG   . TYR B 1 28 ? -16.226 -4.554  -2.921  1.00 0.00 ? 28  TYR B CG   5  
ATOM   10033 C CD1  . TYR B 1 28 ? -16.924 -5.314  -3.880  1.00 0.00 ? 28  TYR B CD1  5  
ATOM   10034 C CD2  . TYR B 1 28 ? -15.654 -5.191  -1.801  1.00 0.00 ? 28  TYR B CD2  5  
ATOM   10035 C CE1  . TYR B 1 28 ? -17.047 -6.707  -3.720  1.00 0.00 ? 28  TYR B CE1  5  
ATOM   10036 C CE2  . TYR B 1 28 ? -15.776 -6.582  -1.641  1.00 0.00 ? 28  TYR B CE2  5  
ATOM   10037 C CZ   . TYR B 1 28 ? -16.473 -7.343  -2.600  1.00 0.00 ? 28  TYR B CZ   5  
ATOM   10038 O OH   . TYR B 1 28 ? -16.596 -8.708  -2.444  1.00 0.00 ? 28  TYR B OH   5  
ATOM   10039 H H    . TYR B 1 28 ? -16.063 -3.771  -6.067  1.00 0.00 ? 28  TYR B H    5  
ATOM   10040 H HA   . TYR B 1 28 ? -15.041 -1.658  -4.319  1.00 0.00 ? 28  TYR B HA   5  
ATOM   10041 H HB2  . TYR B 1 28 ? -15.586 -2.637  -2.226  1.00 0.00 ? 28  TYR B HB2  5  
ATOM   10042 H HB3  . TYR B 1 28 ? -17.083 -2.615  -3.144  1.00 0.00 ? 28  TYR B HB3  5  
ATOM   10043 H HD1  . TYR B 1 28 ? -17.364 -4.832  -4.739  1.00 0.00 ? 28  TYR B HD1  5  
ATOM   10044 H HD2  . TYR B 1 28 ? -15.119 -4.612  -1.066  1.00 0.00 ? 28  TYR B HD2  5  
ATOM   10045 H HE1  . TYR B 1 28 ? -17.584 -7.288  -4.457  1.00 0.00 ? 28  TYR B HE1  5  
ATOM   10046 H HE2  . TYR B 1 28 ? -15.337 -7.066  -0.779  1.00 0.00 ? 28  TYR B HE2  5  
ATOM   10047 H HH   . TYR B 1 28 ? -17.428 -8.979  -2.839  1.00 0.00 ? 28  TYR B HH   5  
ATOM   10048 N N    . TYR B 1 29 ? -13.256 -3.479  -3.405  1.00 0.00 ? 29  TYR B N    5  
ATOM   10049 C CA   . TYR B 1 29 ? -11.983 -4.238  -3.383  1.00 0.00 ? 29  TYR B CA   5  
ATOM   10050 C C    . TYR B 1 29 ? -11.514 -4.339  -1.926  1.00 0.00 ? 29  TYR B C    5  
ATOM   10051 O O    . TYR B 1 29 ? -11.662 -3.410  -1.165  1.00 0.00 ? 29  TYR B O    5  
ATOM   10052 C CB   . TYR B 1 29 ? -10.960 -3.475  -4.244  1.00 0.00 ? 29  TYR B CB   5  
ATOM   10053 C CG   . TYR B 1 29 ? -9.550  -3.896  -3.898  1.00 0.00 ? 29  TYR B CG   5  
ATOM   10054 C CD1  . TYR B 1 29 ? -9.200  -5.256  -3.933  1.00 0.00 ? 29  TYR B CD1  5  
ATOM   10055 C CD2  . TYR B 1 29 ? -8.591  -2.928  -3.541  1.00 0.00 ? 29  TYR B CD2  5  
ATOM   10056 C CE1  . TYR B 1 29 ? -7.889  -5.653  -3.608  1.00 0.00 ? 29  TYR B CE1  5  
ATOM   10057 C CE2  . TYR B 1 29 ? -7.279  -3.324  -3.217  1.00 0.00 ? 29  TYR B CE2  5  
ATOM   10058 C CZ   . TYR B 1 29 ? -6.928  -4.688  -3.250  1.00 0.00 ? 29  TYR B CZ   5  
ATOM   10059 O OH   . TYR B 1 29 ? -5.643  -5.077  -2.932  1.00 0.00 ? 29  TYR B OH   5  
ATOM   10060 H H    . TYR B 1 29 ? -13.502 -2.921  -2.642  1.00 0.00 ? 29  TYR B H    5  
ATOM   10061 H HA   . TYR B 1 29 ? -12.138 -5.227  -3.788  1.00 0.00 ? 29  TYR B HA   5  
ATOM   10062 H HB2  . TYR B 1 29 ? -11.148 -3.687  -5.286  1.00 0.00 ? 29  TYR B HB2  5  
ATOM   10063 H HB3  . TYR B 1 29 ? -11.073 -2.415  -4.071  1.00 0.00 ? 29  TYR B HB3  5  
ATOM   10064 H HD1  . TYR B 1 29 ? -9.939  -5.994  -4.209  1.00 0.00 ? 29  TYR B HD1  5  
ATOM   10065 H HD2  . TYR B 1 29 ? -8.863  -1.880  -3.518  1.00 0.00 ? 29  TYR B HD2  5  
ATOM   10066 H HE1  . TYR B 1 29 ? -7.621  -6.699  -3.634  1.00 0.00 ? 29  TYR B HE1  5  
ATOM   10067 H HE2  . TYR B 1 29 ? -6.544  -2.582  -2.942  1.00 0.00 ? 29  TYR B HE2  5  
ATOM   10068 H HH   . TYR B 1 29 ? -5.644  -5.388  -2.024  1.00 0.00 ? 29  TYR B HH   5  
ATOM   10069 N N    . GLU B 1 30 ? -10.955 -5.450  -1.526  1.00 0.00 ? 30  GLU B N    5  
ATOM   10070 C CA   . GLU B 1 30 ? -10.485 -5.583  -0.110  1.00 0.00 ? 30  GLU B CA   5  
ATOM   10071 C C    . GLU B 1 30 ? -8.980  -5.302  -0.046  1.00 0.00 ? 30  GLU B C    5  
ATOM   10072 O O    . GLU B 1 30 ? -8.270  -5.446  -1.022  1.00 0.00 ? 30  GLU B O    5  
ATOM   10073 C CB   . GLU B 1 30 ? -10.760 -6.999  0.391   1.00 0.00 ? 30  GLU B CB   5  
ATOM   10074 C CG   . GLU B 1 30 ? -12.268 -7.254  0.403   1.00 0.00 ? 30  GLU B CG   5  
ATOM   10075 C CD   . GLU B 1 30 ? -12.765 -7.452  -1.030  1.00 0.00 ? 30  GLU B CD   5  
ATOM   10076 O OE1  . GLU B 1 30 ? -12.747 -8.582  -1.491  1.00 0.00 ? 30  GLU B OE1  5  
ATOM   10077 O OE2  . GLU B 1 30 ? -13.154 -6.471  -1.642  1.00 0.00 ? 30  GLU B OE2  5  
ATOM   10078 H H    . GLU B 1 30 ? -10.842 -6.196  -2.152  1.00 0.00 ? 30  GLU B H    5  
ATOM   10079 H HA   . GLU B 1 30 ? -11.009 -4.876  0.522   1.00 0.00 ? 30  GLU B HA   5  
ATOM   10080 H HB2  . GLU B 1 30 ? -10.281 -7.706  -0.262  1.00 0.00 ? 30  GLU B HB2  5  
ATOM   10081 H HB3  . GLU B 1 30 ? -10.370 -7.111  1.392   1.00 0.00 ? 30  GLU B HB3  5  
ATOM   10082 H HG2  . GLU B 1 30 ? -12.479 -8.140  0.984   1.00 0.00 ? 30  GLU B HG2  5  
ATOM   10083 H HG3  . GLU B 1 30 ? -12.774 -6.407  0.843   1.00 0.00 ? 30  GLU B HG3  5  
ATOM   10084 N N    . THR B 1 31 ? -8.492  -4.894  1.093   1.00 0.00 ? 31  THR B N    5  
ATOM   10085 C CA   . THR B 1 31 ? -7.035  -4.591  1.222   1.00 0.00 ? 31  THR B CA   5  
ATOM   10086 C C    . THR B 1 31 ? -6.225  -5.888  1.225   1.00 0.00 ? 31  THR B C    5  
ATOM   10087 O O    . THR B 1 31 ? -6.717  -6.947  0.892   1.00 0.00 ? 31  THR B O    5  
ATOM   10088 C CB   . THR B 1 31 ? -6.794  -3.846  2.537   1.00 0.00 ? 31  THR B CB   5  
ATOM   10089 O OG1  . THR B 1 31 ? -7.508  -4.499  3.568   1.00 0.00 ? 31  THR B OG1  5  
ATOM   10090 C CG2  . THR B 1 31 ? -7.277  -2.401  2.401   1.00 0.00 ? 31  THR B CG2  5  
ATOM   10091 H H    . THR B 1 31 ? -9.088  -4.777  1.864   1.00 0.00 ? 31  THR B H    5  
ATOM   10092 H HA   . THR B 1 31 ? -6.720  -3.972  0.395   1.00 0.00 ? 31  THR B HA   5  
ATOM   10093 H HB   . THR B 1 31 ? -5.743  -3.850  2.780   1.00 0.00 ? 31  THR B HB   5  
ATOM   10094 H HG1  . THR B 1 31 ? -7.104  -5.358  3.712   1.00 0.00 ? 31  THR B HG1  5  
ATOM   10095 H HG21 . THR B 1 31 ? -8.239  -2.386  1.909   1.00 0.00 ? 31  THR B HG21 5  
ATOM   10096 H HG22 . THR B 1 31 ? -7.365  -1.956  3.379   1.00 0.00 ? 31  THR B HG22 5  
ATOM   10097 H HG23 . THR B 1 31 ? -6.565  -1.838  1.813   1.00 0.00 ? 31  THR B HG23 5  
ATOM   10098 N N    . SER B 1 32 ? -4.978  -5.803  1.604   1.00 0.00 ? 32  SER B N    5  
ATOM   10099 C CA   . SER B 1 32 ? -4.114  -7.013  1.639   1.00 0.00 ? 32  SER B CA   5  
ATOM   10100 C C    . SER B 1 32 ? -4.331  -7.760  2.955   1.00 0.00 ? 32  SER B C    5  
ATOM   10101 O O    . SER B 1 32 ? -5.409  -7.758  3.516   1.00 0.00 ? 32  SER B O    5  
ATOM   10102 C CB   . SER B 1 32 ? -2.650  -6.586  1.537   1.00 0.00 ? 32  SER B CB   5  
ATOM   10103 O OG   . SER B 1 32 ? -2.474  -5.788  0.375   1.00 0.00 ? 32  SER B OG   5  
ATOM   10104 H H    . SER B 1 32 ? -4.609  -4.934  1.868   1.00 0.00 ? 32  SER B H    5  
ATOM   10105 H HA   . SER B 1 32 ? -4.356  -7.660  0.812   1.00 0.00 ? 32  SER B HA   5  
ATOM   10106 H HB2  . SER B 1 32 ? -2.381  -6.009  2.407   1.00 0.00 ? 32  SER B HB2  5  
ATOM   10107 H HB3  . SER B 1 32 ? -2.022  -7.465  1.483   1.00 0.00 ? 32  SER B HB3  5  
ATOM   10108 H HG   . SER B 1 32 ? -3.290  -5.307  0.218   1.00 0.00 ? 32  SER B HG   5  
ATOM   10109 N N    . SER B 1 33 ? -3.308  -8.402  3.447   1.00 0.00 ? 33  SER B N    5  
ATOM   10110 C CA   . SER B 1 33 ? -3.424  -9.161  4.730   1.00 0.00 ? 33  SER B CA   5  
ATOM   10111 C C    . SER B 1 33 ? -2.151  -8.950  5.541   1.00 0.00 ? 33  SER B C    5  
ATOM   10112 O O    . SER B 1 33 ? -2.177  -8.867  6.753   1.00 0.00 ? 33  SER B O    5  
ATOM   10113 C CB   . SER B 1 33 ? -3.572  -10.646 4.417   1.00 0.00 ? 33  SER B CB   5  
ATOM   10114 O OG   . SER B 1 33 ? -2.288  -11.199 4.154   1.00 0.00 ? 33  SER B OG   5  
ATOM   10115 H H    . SER B 1 33 ? -2.454  -8.384  2.969   1.00 0.00 ? 33  SER B H    5  
ATOM   10116 H HA   . SER B 1 33 ? -4.280  -8.818  5.295   1.00 0.00 ? 33  SER B HA   5  
ATOM   10117 H HB2  . SER B 1 33 ? -4.016  -11.155 5.256   1.00 0.00 ? 33  SER B HB2  5  
ATOM   10118 H HB3  . SER B 1 33 ? -4.202  -10.760 3.550   1.00 0.00 ? 33  SER B HB3  5  
ATOM   10119 H HG   . SER B 1 33 ? -2.235  -12.049 4.598   1.00 0.00 ? 33  SER B HG   5  
ATOM   10120 N N    . LEU B 1 34 ? -1.037  -8.869  4.865   1.00 0.00 ? 34  LEU B N    5  
ATOM   10121 C CA   . LEU B 1 34 ? 0.273   -8.665  5.553   1.00 0.00 ? 34  LEU B CA   5  
ATOM   10122 C C    . LEU B 1 34 ? 0.119   -7.668  6.702   1.00 0.00 ? 34  LEU B C    5  
ATOM   10123 O O    . LEU B 1 34 ? 0.429   -7.957  7.839   1.00 0.00 ? 34  LEU B O    5  
ATOM   10124 C CB   . LEU B 1 34 ? 1.293   -8.115  4.551   1.00 0.00 ? 34  LEU B CB   5  
ATOM   10125 C CG   . LEU B 1 34 ? 1.170   -8.848  3.215   1.00 0.00 ? 34  LEU B CG   5  
ATOM   10126 C CD1  . LEU B 1 34 ? 2.313   -8.414  2.294   1.00 0.00 ? 34  LEU B CD1  5  
ATOM   10127 C CD2  . LEU B 1 34 ? 1.244   -10.360 3.450   1.00 0.00 ? 34  LEU B CD2  5  
ATOM   10128 H H    . LEU B 1 34 ? -1.065  -8.950  3.892   1.00 0.00 ? 34  LEU B H    5  
ATOM   10129 H HA   . LEU B 1 34 ? 0.625   -9.607  5.937   1.00 0.00 ? 34  LEU B HA   5  
ATOM   10130 H HB2  . LEU B 1 34 ? 1.114   -7.060  4.396   1.00 0.00 ? 34  LEU B HB2  5  
ATOM   10131 H HB3  . LEU B 1 34 ? 2.284   -8.254  4.943   1.00 0.00 ? 34  LEU B HB3  5  
ATOM   10132 H HG   . LEU B 1 34 ? 0.229   -8.598  2.753   1.00 0.00 ? 34  LEU B HG   5  
ATOM   10133 H HD11 . LEU B 1 34 ? 2.450   -7.344  2.366   1.00 0.00 ? 34  LEU B HD11 5  
ATOM   10134 H HD12 . LEU B 1 34 ? 3.224   -8.915  2.589   1.00 0.00 ? 34  LEU B HD12 5  
ATOM   10135 H HD13 . LEU B 1 34 ? 2.072   -8.676  1.276   1.00 0.00 ? 34  LEU B HD13 5  
ATOM   10136 H HD21 . LEU B 1 34 ? 2.060   -10.580 4.122   1.00 0.00 ? 34  LEU B HD21 5  
ATOM   10137 H HD22 . LEU B 1 34 ? 0.317   -10.704 3.884   1.00 0.00 ? 34  LEU B HD22 5  
ATOM   10138 H HD23 . LEU B 1 34 ? 1.408   -10.863 2.507   1.00 0.00 ? 34  LEU B HD23 5  
ATOM   10139 N N    . CYS B 1 35 ? -0.358  -6.494  6.406   1.00 0.00 ? 35  CYS B N    5  
ATOM   10140 C CA   . CYS B 1 35 ? -0.532  -5.472  7.474   1.00 0.00 ? 35  CYS B CA   5  
ATOM   10141 C C    . CYS B 1 35 ? -1.673  -5.902  8.403   1.00 0.00 ? 35  CYS B C    5  
ATOM   10142 O O    . CYS B 1 35 ? -2.746  -6.255  7.964   1.00 0.00 ? 35  CYS B O    5  
ATOM   10143 C CB   . CYS B 1 35 ? -0.849  -4.113  6.838   1.00 0.00 ? 35  CYS B CB   5  
ATOM   10144 S SG   . CYS B 1 35 ? -1.973  -4.337  5.437   1.00 0.00 ? 35  CYS B SG   5  
ATOM   10145 H H    . CYS B 1 35 ? -0.600  -6.284  5.479   1.00 0.00 ? 35  CYS B H    5  
ATOM   10146 H HA   . CYS B 1 35 ? 0.382   -5.397  8.044   1.00 0.00 ? 35  CYS B HA   5  
ATOM   10147 H HB2  . CYS B 1 35 ? -1.315  -3.472  7.570   1.00 0.00 ? 35  CYS B HB2  5  
ATOM   10148 H HB3  . CYS B 1 35 ? 0.067   -3.657  6.494   1.00 0.00 ? 35  CYS B HB3  5  
ATOM   10149 N N    . SER B 1 36 ? -1.433  -5.898  9.684   1.00 0.00 ? 36  SER B N    5  
ATOM   10150 C CA   . SER B 1 36 ? -2.488  -6.317  10.654  1.00 0.00 ? 36  SER B CA   5  
ATOM   10151 C C    . SER B 1 36 ? -3.663  -5.326  10.663  1.00 0.00 ? 36  SER B C    5  
ATOM   10152 O O    . SER B 1 36 ? -4.285  -5.121  11.687  1.00 0.00 ? 36  SER B O    5  
ATOM   10153 C CB   . SER B 1 36 ? -1.881  -6.387  12.056  1.00 0.00 ? 36  SER B CB   5  
ATOM   10154 O OG   . SER B 1 36 ? -0.718  -7.203  12.022  1.00 0.00 ? 36  SER B OG   5  
ATOM   10155 H H    . SER B 1 36 ? -0.551  -5.628  10.013  1.00 0.00 ? 36  SER B H    5  
ATOM   10156 H HA   . SER B 1 36 ? -2.853  -7.296  10.379  1.00 0.00 ? 36  SER B HA   5  
ATOM   10157 H HB2  . SER B 1 36 ? -1.610  -5.397  12.382  1.00 0.00 ? 36  SER B HB2  5  
ATOM   10158 H HB3  . SER B 1 36 ? -2.607  -6.805  12.741  1.00 0.00 ? 36  SER B HB3  5  
ATOM   10159 H HG   . SER B 1 36 ? -0.219  -6.978  11.233  1.00 0.00 ? 36  SER B HG   5  
ATOM   10160 N N    . GLN B 1 37 ? -3.984  -4.701  9.557   1.00 0.00 ? 37  GLN B N    5  
ATOM   10161 C CA   . GLN B 1 37 ? -5.126  -3.732  9.572   1.00 0.00 ? 37  GLN B CA   5  
ATOM   10162 C C    . GLN B 1 37 ? -5.757  -3.601  8.176   1.00 0.00 ? 37  GLN B C    5  
ATOM   10163 O O    . GLN B 1 37 ? -5.701  -2.543  7.583   1.00 0.00 ? 37  GLN B O    5  
ATOM   10164 C CB   . GLN B 1 37 ? -4.616  -2.360  10.025  1.00 0.00 ? 37  GLN B CB   5  
ATOM   10165 C CG   . GLN B 1 37 ? -3.316  -2.025  9.288   1.00 0.00 ? 37  GLN B CG   5  
ATOM   10166 C CD   . GLN B 1 37 ? -2.836  -0.635  9.707   1.00 0.00 ? 37  GLN B CD   5  
ATOM   10167 O OE1  . GLN B 1 37 ? -1.911  -0.099  9.132   1.00 0.00 ? 37  GLN B OE1  5  
ATOM   10168 N NE2  . GLN B 1 37 ? -3.433  -0.022  10.694  1.00 0.00 ? 37  GLN B NE2  5  
ATOM   10169 H H    . GLN B 1 37 ? -3.484  -4.860  8.730   1.00 0.00 ? 37  GLN B H    5  
ATOM   10170 H HA   . GLN B 1 37 ? -5.882  -4.071  10.267  1.00 0.00 ? 37  GLN B HA   5  
ATOM   10171 H HB2  . GLN B 1 37 ? -5.359  -1.608  9.805   1.00 0.00 ? 37  GLN B HB2  5  
ATOM   10172 H HB3  . GLN B 1 37 ? -4.428  -2.381  11.088  1.00 0.00 ? 37  GLN B HB3  5  
ATOM   10173 H HG2  . GLN B 1 37 ? -2.561  -2.757  9.537   1.00 0.00 ? 37  GLN B HG2  5  
ATOM   10174 H HG3  . GLN B 1 37 ? -3.492  -2.037  8.223   1.00 0.00 ? 37  GLN B HG3  5  
ATOM   10175 H HE21 . GLN B 1 37 ? -4.179  -0.454  11.159  1.00 0.00 ? 37  GLN B HE21 5  
ATOM   10176 H HE22 . GLN B 1 37 ? -3.132  0.868   10.971  1.00 0.00 ? 37  GLN B HE22 5  
ATOM   10177 N N    . PRO B 1 38 ? -6.364  -4.665  7.694   1.00 0.00 ? 38  PRO B N    5  
ATOM   10178 C CA   . PRO B 1 38 ? -7.028  -4.642  6.377   1.00 0.00 ? 38  PRO B CA   5  
ATOM   10179 C C    . PRO B 1 38 ? -8.261  -3.727  6.453   1.00 0.00 ? 38  PRO B C    5  
ATOM   10180 O O    . PRO B 1 38 ? -8.549  -3.133  7.473   1.00 0.00 ? 38  PRO B O    5  
ATOM   10181 C CB   . PRO B 1 38 ? -7.439  -6.111  6.115   1.00 0.00 ? 38  PRO B CB   5  
ATOM   10182 C CG   . PRO B 1 38 ? -7.148  -6.914  7.418   1.00 0.00 ? 38  PRO B CG   5  
ATOM   10183 C CD   . PRO B 1 38 ? -6.434  -5.961  8.403   1.00 0.00 ? 38  PRO B CD   5  
ATOM   10184 H HA   . PRO B 1 38 ? -6.349  -4.296  5.604   1.00 0.00 ? 38  PRO B HA   5  
ATOM   10185 H HB2  . PRO B 1 38 ? -8.493  -6.172  5.867   1.00 0.00 ? 38  PRO B HB2  5  
ATOM   10186 H HB3  . PRO B 1 38 ? -6.852  -6.517  5.303   1.00 0.00 ? 38  PRO B HB3  5  
ATOM   10187 H HG2  . PRO B 1 38 ? -8.080  -7.265  7.848   1.00 0.00 ? 38  PRO B HG2  5  
ATOM   10188 H HG3  . PRO B 1 38 ? -6.510  -7.759  7.198   1.00 0.00 ? 38  PRO B HG3  5  
ATOM   10189 H HD2  . PRO B 1 38 ? -7.007  -5.864  9.317   1.00 0.00 ? 38  PRO B HD2  5  
ATOM   10190 H HD3  . PRO B 1 38 ? -5.439  -6.319  8.620   1.00 0.00 ? 38  PRO B HD3  5  
ATOM   10191 N N    . ALA B 1 39 ? -8.983  -3.621  5.379   1.00 0.00 ? 39  ALA B N    5  
ATOM   10192 C CA   . ALA B 1 39 ? -10.195 -2.768  5.354   1.00 0.00 ? 39  ALA B CA   5  
ATOM   10193 C C    . ALA B 1 39 ? -10.910 -3.015  4.030   1.00 0.00 ? 39  ALA B C    5  
ATOM   10194 O O    . ALA B 1 39 ? -10.366 -3.639  3.141   1.00 0.00 ? 39  ALA B O    5  
ATOM   10195 C CB   . ALA B 1 39 ? -9.793  -1.295  5.453   1.00 0.00 ? 39  ALA B CB   5  
ATOM   10196 H H    . ALA B 1 39 ? -8.733  -4.115  4.581   1.00 0.00 ? 39  ALA B H    5  
ATOM   10197 H HA   . ALA B 1 39 ? -10.842 -3.028  6.176   1.00 0.00 ? 39  ALA B HA   5  
ATOM   10198 H HB1  . ALA B 1 39 ? -9.238  -1.133  6.365   1.00 0.00 ? 39  ALA B HB1  5  
ATOM   10199 H HB2  . ALA B 1 39 ? -9.175  -1.032  4.606   1.00 0.00 ? 39  ALA B HB2  5  
ATOM   10200 H HB3  . ALA B 1 39 ? -10.680 -0.679  5.455   1.00 0.00 ? 39  ALA B HB3  5  
ATOM   10201 N N    . VAL B 1 40 ? -12.106 -2.517  3.870   1.00 0.00 ? 40  VAL B N    5  
ATOM   10202 C CA   . VAL B 1 40 ? -12.823 -2.715  2.574   1.00 0.00 ? 40  VAL B CA   5  
ATOM   10203 C C    . VAL B 1 40 ? -12.619 -1.454  1.740   1.00 0.00 ? 40  VAL B C    5  
ATOM   10204 O O    . VAL B 1 40 ? -12.554 -0.357  2.261   1.00 0.00 ? 40  VAL B O    5  
ATOM   10205 C CB   . VAL B 1 40 ? -14.319 -2.947  2.830   1.00 0.00 ? 40  VAL B CB   5  
ATOM   10206 C CG1  . VAL B 1 40 ? -15.105 -2.743  1.531   1.00 0.00 ? 40  VAL B CG1  5  
ATOM   10207 C CG2  . VAL B 1 40 ? -14.528 -4.381  3.317   1.00 0.00 ? 40  VAL B CG2  5  
ATOM   10208 H H    . VAL B 1 40 ? -12.524 -1.996  4.590   1.00 0.00 ? 40  VAL B H    5  
ATOM   10209 H HA   . VAL B 1 40 ? -12.410 -3.570  2.041   1.00 0.00 ? 40  VAL B HA   5  
ATOM   10210 H HB   . VAL B 1 40 ? -14.670 -2.252  3.579   1.00 0.00 ? 40  VAL B HB   5  
ATOM   10211 H HG11 . VAL B 1 40 ? -14.584 -3.227  0.719   1.00 0.00 ? 40  VAL B HG11 5  
ATOM   10212 H HG12 . VAL B 1 40 ? -16.091 -3.171  1.632   1.00 0.00 ? 40  VAL B HG12 5  
ATOM   10213 H HG13 . VAL B 1 40 ? -15.189 -1.687  1.324   1.00 0.00 ? 40  VAL B HG13 5  
ATOM   10214 H HG21 . VAL B 1 40 ? -13.849 -4.588  4.129   1.00 0.00 ? 40  VAL B HG21 5  
ATOM   10215 H HG22 . VAL B 1 40 ? -15.546 -4.500  3.657   1.00 0.00 ? 40  VAL B HG22 5  
ATOM   10216 H HG23 . VAL B 1 40 ? -14.336 -5.067  2.504   1.00 0.00 ? 40  VAL B HG23 5  
ATOM   10217 N N    . VAL B 1 41 ? -12.498 -1.609  0.451   1.00 0.00 ? 41  VAL B N    5  
ATOM   10218 C CA   . VAL B 1 41 ? -12.273 -0.436  -0.451  1.00 0.00 ? 41  VAL B CA   5  
ATOM   10219 C C    . VAL B 1 41 ? -13.410 -0.350  -1.471  1.00 0.00 ? 41  VAL B C    5  
ATOM   10220 O O    . VAL B 1 41 ? -13.595 -1.232  -2.281  1.00 0.00 ? 41  VAL B O    5  
ATOM   10221 C CB   . VAL B 1 41 ? -10.932 -0.625  -1.166  1.00 0.00 ? 41  VAL B CB   5  
ATOM   10222 C CG1  . VAL B 1 41 ? -10.440 0.704   -1.733  1.00 0.00 ? 41  VAL B CG1  5  
ATOM   10223 C CG2  . VAL B 1 41 ? -9.904  -1.151  -0.160  1.00 0.00 ? 41  VAL B CG2  5  
ATOM   10224 H H    . VAL B 1 41 ? -12.545 -2.511  0.072   1.00 0.00 ? 41  VAL B H    5  
ATOM   10225 H HA   . VAL B 1 41 ? -12.244 0.473   0.126   1.00 0.00 ? 41  VAL B HA   5  
ATOM   10226 H HB   . VAL B 1 41 ? -11.046 -1.334  -1.971  1.00 0.00 ? 41  VAL B HB   5  
ATOM   10227 H HG11 . VAL B 1 41 ? -10.428 1.450   -0.952  1.00 0.00 ? 41  VAL B HG11 5  
ATOM   10228 H HG12 . VAL B 1 41 ? -9.442  0.571   -2.118  1.00 0.00 ? 41  VAL B HG12 5  
ATOM   10229 H HG13 . VAL B 1 41 ? -11.097 1.022   -2.528  1.00 0.00 ? 41  VAL B HG13 5  
ATOM   10230 H HG21 . VAL B 1 41 ? -9.893  -0.509  0.709   1.00 0.00 ? 41  VAL B HG21 5  
ATOM   10231 H HG22 . VAL B 1 41 ? -10.170 -2.153  0.138   1.00 0.00 ? 41  VAL B HG22 5  
ATOM   10232 H HG23 . VAL B 1 41 ? -8.925  -1.157  -0.615  1.00 0.00 ? 41  VAL B HG23 5  
ATOM   10233 N N    . PHE B 1 42 ? -14.185 0.702   -1.435  1.00 0.00 ? 42  PHE B N    5  
ATOM   10234 C CA   . PHE B 1 42 ? -15.321 0.823   -2.398  1.00 0.00 ? 42  PHE B CA   5  
ATOM   10235 C C    . PHE B 1 42 ? -14.865 1.528   -3.677  1.00 0.00 ? 42  PHE B C    5  
ATOM   10236 O O    . PHE B 1 42 ? -14.201 2.544   -3.643  1.00 0.00 ? 42  PHE B O    5  
ATOM   10237 C CB   . PHE B 1 42 ? -16.451 1.642   -1.762  1.00 0.00 ? 42  PHE B CB   5  
ATOM   10238 C CG   . PHE B 1 42 ? -17.195 0.804   -0.745  1.00 0.00 ? 42  PHE B CG   5  
ATOM   10239 C CD1  . PHE B 1 42 ? -17.903 -0.343  -1.157  1.00 0.00 ? 42  PHE B CD1  5  
ATOM   10240 C CD2  . PHE B 1 42 ? -17.192 1.177   0.614   1.00 0.00 ? 42  PHE B CD2  5  
ATOM   10241 C CE1  . PHE B 1 42 ? -18.603 -1.116  -0.213  1.00 0.00 ? 42  PHE B CE1  5  
ATOM   10242 C CE2  . PHE B 1 42 ? -17.894 0.405   1.556   1.00 0.00 ? 42  PHE B CE2  5  
ATOM   10243 C CZ   . PHE B 1 42 ? -18.599 -0.743  1.144   1.00 0.00 ? 42  PHE B CZ   5  
ATOM   10244 H H    . PHE B 1 42 ? -14.030 1.403   -0.769  1.00 0.00 ? 42  PHE B H    5  
ATOM   10245 H HA   . PHE B 1 42 ? -15.692 -0.159  -2.647  1.00 0.00 ? 42  PHE B HA   5  
ATOM   10246 H HB2  . PHE B 1 42 ? -16.033 2.512   -1.279  1.00 0.00 ? 42  PHE B HB2  5  
ATOM   10247 H HB3  . PHE B 1 42 ? -17.142 1.961   -2.532  1.00 0.00 ? 42  PHE B HB3  5  
ATOM   10248 H HD1  . PHE B 1 42 ? -17.909 -0.631  -2.197  1.00 0.00 ? 42  PHE B HD1  5  
ATOM   10249 H HD2  . PHE B 1 42 ? -16.652 2.056   0.931   1.00 0.00 ? 42  PHE B HD2  5  
ATOM   10250 H HE1  . PHE B 1 42 ? -19.144 -1.996  -0.528  1.00 0.00 ? 42  PHE B HE1  5  
ATOM   10251 H HE2  . PHE B 1 42 ? -17.892 0.693   2.595   1.00 0.00 ? 42  PHE B HE2  5  
ATOM   10252 H HZ   . PHE B 1 42 ? -19.139 -1.334  1.867   1.00 0.00 ? 42  PHE B HZ   5  
ATOM   10253 N N    . GLN B 1 43 ? -15.258 1.004   -4.809  1.00 0.00 ? 43  GLN B N    5  
ATOM   10254 C CA   . GLN B 1 43 ? -14.901 1.637   -6.111  1.00 0.00 ? 43  GLN B CA   5  
ATOM   10255 C C    . GLN B 1 43 ? -16.105 2.481   -6.540  1.00 0.00 ? 43  GLN B C    5  
ATOM   10256 O O    . GLN B 1 43 ? -17.207 1.972   -6.648  1.00 0.00 ? 43  GLN B O    5  
ATOM   10257 C CB   . GLN B 1 43 ? -14.625 0.537   -7.137  1.00 0.00 ? 43  GLN B CB   5  
ATOM   10258 C CG   . GLN B 1 43 ? -13.412 -0.284  -6.692  1.00 0.00 ? 43  GLN B CG   5  
ATOM   10259 C CD   . GLN B 1 43 ? -13.361 -1.593  -7.483  1.00 0.00 ? 43  GLN B CD   5  
ATOM   10260 O OE1  . GLN B 1 43 ? -12.961 -2.615  -6.964  1.00 0.00 ? 43  GLN B OE1  5  
ATOM   10261 N NE2  . GLN B 1 43 ? -13.752 -1.604  -8.728  1.00 0.00 ? 43  GLN B NE2  5  
ATOM   10262 H H    . GLN B 1 43 ? -15.817 0.198   -4.801  1.00 0.00 ? 43  GLN B H    5  
ATOM   10263 H HA   . GLN B 1 43 ? -14.033 2.266   -5.996  1.00 0.00 ? 43  GLN B HA   5  
ATOM   10264 H HB2  . GLN B 1 43 ? -15.488 -0.106  -7.210  1.00 0.00 ? 43  GLN B HB2  5  
ATOM   10265 H HB3  . GLN B 1 43 ? -14.423 0.976   -8.096  1.00 0.00 ? 43  GLN B HB3  5  
ATOM   10266 H HG2  . GLN B 1 43 ? -12.509 0.281   -6.874  1.00 0.00 ? 43  GLN B HG2  5  
ATOM   10267 H HG3  . GLN B 1 43 ? -13.491 -0.506  -5.639  1.00 0.00 ? 43  GLN B HG3  5  
ATOM   10268 H HE21 . GLN B 1 43 ? -14.075 -0.778  -9.147  1.00 0.00 ? 43  GLN B HE21 5  
ATOM   10269 H HE22 . GLN B 1 43 ? -13.725 -2.437  -9.244  1.00 0.00 ? 43  GLN B HE22 5  
ATOM   10270 N N    . THR B 1 44 ? -15.932 3.775   -6.732  1.00 0.00 ? 44  THR B N    5  
ATOM   10271 C CA   . THR B 1 44 ? -17.119 4.636   -7.083  1.00 0.00 ? 44  THR B CA   5  
ATOM   10272 C C    . THR B 1 44 ? -17.208 4.920   -8.583  1.00 0.00 ? 44  THR B C    5  
ATOM   10273 O O    . THR B 1 44 ? -16.626 4.238   -9.404  1.00 0.00 ? 44  THR B O    5  
ATOM   10274 C CB   . THR B 1 44 ? -17.012 5.969   -6.345  1.00 0.00 ? 44  THR B CB   5  
ATOM   10275 O OG1  . THR B 1 44 ? -16.151 6.832   -7.066  1.00 0.00 ? 44  THR B OG1  5  
ATOM   10276 C CG2  . THR B 1 44 ? -16.444 5.730   -4.943  1.00 0.00 ? 44  THR B CG2  5  
ATOM   10277 H H    . THR B 1 44 ? -15.038 4.185   -6.604  1.00 0.00 ? 44  THR B H    5  
ATOM   10278 H HA   . THR B 1 44 ? -18.030 4.144   -6.770  1.00 0.00 ? 44  THR B HA   5  
ATOM   10279 H HB   . THR B 1 44 ? -17.990 6.418   -6.262  1.00 0.00 ? 44  THR B HB   5  
ATOM   10280 H HG1  . THR B 1 44 ? -16.455 6.862   -7.976  1.00 0.00 ? 44  THR B HG1  5  
ATOM   10281 H HG21 . THR B 1 44 ? -16.912 4.859   -4.506  1.00 0.00 ? 44  THR B HG21 5  
ATOM   10282 H HG22 . THR B 1 44 ? -15.378 5.567   -5.011  1.00 0.00 ? 44  THR B HG22 5  
ATOM   10283 H HG23 . THR B 1 44 ? -16.637 6.591   -4.324  1.00 0.00 ? 44  THR B HG23 5  
ATOM   10284 N N    . LYS B 1 45 ? -17.964 5.937   -8.930  1.00 0.00 ? 45  LYS B N    5  
ATOM   10285 C CA   . LYS B 1 45 ? -18.154 6.317   -10.361 1.00 0.00 ? 45  LYS B CA   5  
ATOM   10286 C C    . LYS B 1 45 ? -17.381 7.603   -10.673 1.00 0.00 ? 45  LYS B C    5  
ATOM   10287 O O    . LYS B 1 45 ? -17.066 7.880   -11.813 1.00 0.00 ? 45  LYS B O    5  
ATOM   10288 C CB   . LYS B 1 45 ? -19.639 6.583   -10.614 1.00 0.00 ? 45  LYS B CB   5  
ATOM   10289 C CG   . LYS B 1 45 ? -20.475 5.434   -10.055 1.00 0.00 ? 45  LYS B CG   5  
ATOM   10290 C CD   . LYS B 1 45 ? -21.962 5.739   -10.264 1.00 0.00 ? 45  LYS B CD   5  
ATOM   10291 C CE   . LYS B 1 45 ? -22.769 4.448   -10.149 1.00 0.00 ? 45  LYS B CE   5  
ATOM   10292 N NZ   . LYS B 1 45 ? -22.583 3.864   -8.790  1.00 0.00 ? 45  LYS B NZ   5  
ATOM   10293 H H    . LYS B 1 45 ? -18.422 6.451   -8.233  1.00 0.00 ? 45  LYS B H    5  
ATOM   10294 H HA   . LYS B 1 45 ? -17.822 5.518   -11.009 1.00 0.00 ? 45  LYS B HA   5  
ATOM   10295 H HB2  . LYS B 1 45 ? -19.926 7.505   -10.130 1.00 0.00 ? 45  LYS B HB2  5  
ATOM   10296 H HB3  . LYS B 1 45 ? -19.813 6.667   -11.677 1.00 0.00 ? 45  LYS B HB3  5  
ATOM   10297 H HG2  . LYS B 1 45 ? -20.215 4.519   -10.568 1.00 0.00 ? 45  LYS B HG2  5  
ATOM   10298 H HG3  . LYS B 1 45 ? -20.279 5.324   -9.000  1.00 0.00 ? 45  LYS B HG3  5  
ATOM   10299 H HD2  . LYS B 1 45 ? -22.294 6.441   -9.513  1.00 0.00 ? 45  LYS B HD2  5  
ATOM   10300 H HD3  . LYS B 1 45 ? -22.112 6.165   -11.246 1.00 0.00 ? 45  LYS B HD3  5  
ATOM   10301 H HE2  . LYS B 1 45 ? -23.812 4.663   -10.309 1.00 0.00 ? 45  LYS B HE2  5  
ATOM   10302 H HE3  . LYS B 1 45 ? -22.426 3.747   -10.893 1.00 0.00 ? 45  LYS B HE3  5  
ATOM   10303 H HZ1  . LYS B 1 45 ? -21.591 3.977   -8.498  1.00 0.00 ? 45  LYS B HZ1  5  
ATOM   10304 H HZ2  . LYS B 1 45 ? -23.202 4.353   -8.115  1.00 0.00 ? 45  LYS B HZ2  5  
ATOM   10305 H HZ3  . LYS B 1 45 ? -22.826 2.854   -8.812  1.00 0.00 ? 45  LYS B HZ3  5  
ATOM   10306 N N    . ARG B 1 46 ? -17.089 8.399   -9.668  1.00 0.00 ? 46  ARG B N    5  
ATOM   10307 C CA   . ARG B 1 46 ? -16.354 9.686   -9.901  1.00 0.00 ? 46  ARG B CA   5  
ATOM   10308 C C    . ARG B 1 46 ? -15.171 9.760   -8.934  1.00 0.00 ? 46  ARG B C    5  
ATOM   10309 O O    . ARG B 1 46 ? -14.988 10.718  -8.214  1.00 0.00 ? 46  ARG B O    5  
ATOM   10310 C CB   . ARG B 1 46 ? -17.317 10.867  -9.658  1.00 0.00 ? 46  ARG B CB   5  
ATOM   10311 C CG   . ARG B 1 46 ? -16.836 12.144  -10.385 1.00 0.00 ? 46  ARG B CG   5  
ATOM   10312 C CD   . ARG B 1 46 ? -15.709 12.842  -9.608  1.00 0.00 ? 46  ARG B CD   5  
ATOM   10313 N NE   . ARG B 1 46 ? -15.627 14.264  -10.040 1.00 0.00 ? 46  ARG B NE   5  
ATOM   10314 C CZ   . ARG B 1 46 ? -14.969 15.128  -9.315  1.00 0.00 ? 46  ARG B CZ   5  
ATOM   10315 N NH1  . ARG B 1 46 ? -14.385 14.744  -8.213  1.00 0.00 ? 46  ARG B NH1  5  
ATOM   10316 N NH2  . ARG B 1 46 ? -14.896 16.374  -9.693  1.00 0.00 ? 46  ARG B NH2  5  
ATOM   10317 H H    . ARG B 1 46 ? -17.365 8.157   -8.760  1.00 0.00 ? 46  ARG B H    5  
ATOM   10318 H HA   . ARG B 1 46 ? -15.982 9.721   -10.914 1.00 0.00 ? 46  ARG B HA   5  
ATOM   10319 H HB2  . ARG B 1 46 ? -18.296 10.600  -10.031 1.00 0.00 ? 46  ARG B HB2  5  
ATOM   10320 H HB3  . ARG B 1 46 ? -17.389 11.060  -8.599  1.00 0.00 ? 46  ARG B HB3  5  
ATOM   10321 H HG2  . ARG B 1 46 ? -16.481 11.890  -11.372 1.00 0.00 ? 46  ARG B HG2  5  
ATOM   10322 H HG3  . ARG B 1 46 ? -17.668 12.826  -10.478 1.00 0.00 ? 46  ARG B HG3  5  
ATOM   10323 H HD2  . ARG B 1 46 ? -15.911 12.805  -8.548  1.00 0.00 ? 46  ARG B HD2  5  
ATOM   10324 H HD3  . ARG B 1 46 ? -14.768 12.355  -9.818  1.00 0.00 ? 46  ARG B HD3  5  
ATOM   10325 H HE   . ARG B 1 46 ? -16.067 14.552  -10.866 1.00 0.00 ? 46  ARG B HE   5  
ATOM   10326 H HH11 . ARG B 1 46 ? -14.441 13.789  -7.924  1.00 0.00 ? 46  ARG B HH11 5  
ATOM   10327 H HH12 . ARG B 1 46 ? -13.880 15.406  -7.658  1.00 0.00 ? 46  ARG B HH12 5  
ATOM   10328 H HH21 . ARG B 1 46 ? -15.343 16.669  -10.537 1.00 0.00 ? 46  ARG B HH21 5  
ATOM   10329 H HH22 . ARG B 1 46 ? -14.391 17.037  -9.138  1.00 0.00 ? 46  ARG B HH22 5  
ATOM   10330 N N    . SER B 1 47 ? -14.362 8.745   -8.920  1.00 0.00 ? 47  SER B N    5  
ATOM   10331 C CA   . SER B 1 47 ? -13.183 8.740   -8.029  1.00 0.00 ? 47  SER B CA   5  
ATOM   10332 C C    . SER B 1 47 ? -12.308 7.560   -8.432  1.00 0.00 ? 47  SER B C    5  
ATOM   10333 O O    . SER B 1 47 ? -11.886 7.448   -9.564  1.00 0.00 ? 47  SER B O    5  
ATOM   10334 C CB   . SER B 1 47 ? -13.620 8.619   -6.561  1.00 0.00 ? 47  SER B CB   5  
ATOM   10335 O OG   . SER B 1 47 ? -14.039 7.290   -6.293  1.00 0.00 ? 47  SER B OG   5  
ATOM   10336 H H    . SER B 1 47 ? -14.526 7.980   -9.504  1.00 0.00 ? 47  SER B H    5  
ATOM   10337 H HA   . SER B 1 47 ? -12.630 9.653   -8.165  1.00 0.00 ? 47  SER B HA   5  
ATOM   10338 H HB2  . SER B 1 47 ? -12.794 8.863   -5.915  1.00 0.00 ? 47  SER B HB2  5  
ATOM   10339 H HB3  . SER B 1 47 ? -14.433 9.308   -6.372  1.00 0.00 ? 47  SER B HB3  5  
ATOM   10340 H HG   . SER B 1 47 ? -14.715 7.323   -5.612  1.00 0.00 ? 47  SER B HG   5  
ATOM   10341 N N    . LYS B 1 48 ? -12.056 6.676   -7.527  1.00 0.00 ? 48  LYS B N    5  
ATOM   10342 C CA   . LYS B 1 48 ? -11.231 5.485   -7.844  1.00 0.00 ? 48  LYS B CA   5  
ATOM   10343 C C    . LYS B 1 48 ? -11.512 4.443   -6.764  1.00 0.00 ? 48  LYS B C    5  
ATOM   10344 O O    . LYS B 1 48 ? -12.398 3.620   -6.891  1.00 0.00 ? 48  LYS B O    5  
ATOM   10345 C CB   . LYS B 1 48 ? -9.729  5.882   -7.862  1.00 0.00 ? 48  LYS B CB   5  
ATOM   10346 C CG   . LYS B 1 48 ? -9.177  5.875   -9.300  1.00 0.00 ? 48  LYS B CG   5  
ATOM   10347 C CD   . LYS B 1 48 ? -8.857  4.439   -9.726  1.00 0.00 ? 48  LYS B CD   5  
ATOM   10348 C CE   . LYS B 1 48 ? -8.315  4.440   -11.157 1.00 0.00 ? 48  LYS B CE   5  
ATOM   10349 N NZ   . LYS B 1 48 ? -9.434  4.680   -12.110 1.00 0.00 ? 48  LYS B NZ   5  
ATOM   10350 H H    . LYS B 1 48 ? -12.432 6.781   -6.635  1.00 0.00 ? 48  LYS B H    5  
ATOM   10351 H HA   . LYS B 1 48 ? -11.529 5.089   -8.805  1.00 0.00 ? 48  LYS B HA   5  
ATOM   10352 H HB2  . LYS B 1 48 ? -9.622  6.874   -7.452  1.00 0.00 ? 48  LYS B HB2  5  
ATOM   10353 H HB3  . LYS B 1 48 ? -9.149  5.190   -7.263  1.00 0.00 ? 48  LYS B HB3  5  
ATOM   10354 H HG2  . LYS B 1 48 ? -9.909  6.294   -9.971  1.00 0.00 ? 48  LYS B HG2  5  
ATOM   10355 H HG3  . LYS B 1 48 ? -8.275  6.467   -9.338  1.00 0.00 ? 48  LYS B HG3  5  
ATOM   10356 H HD2  . LYS B 1 48 ? -8.115  4.023   -9.059  1.00 0.00 ? 48  LYS B HD2  5  
ATOM   10357 H HD3  . LYS B 1 48 ? -9.755  3.842   -9.684  1.00 0.00 ? 48  LYS B HD3  5  
ATOM   10358 H HE2  . LYS B 1 48 ? -7.578  5.223   -11.262 1.00 0.00 ? 48  LYS B HE2  5  
ATOM   10359 H HE3  . LYS B 1 48 ? -7.859  3.485   -11.369 1.00 0.00 ? 48  LYS B HE3  5  
ATOM   10360 H HZ1  . LYS B 1 48 ? -10.329 4.753   -11.583 1.00 0.00 ? 48  LYS B HZ1  5  
ATOM   10361 H HZ2  . LYS B 1 48 ? -9.265  5.564   -12.631 1.00 0.00 ? 48  LYS B HZ2  5  
ATOM   10362 H HZ3  . LYS B 1 48 ? -9.492  3.890   -12.783 1.00 0.00 ? 48  LYS B HZ3  5  
ATOM   10363 N N    . GLN B 1 49 ? -10.765 4.500   -5.693  1.00 0.00 ? 49  GLN B N    5  
ATOM   10364 C CA   . GLN B 1 49 ? -10.947 3.543   -4.564  1.00 0.00 ? 49  GLN B CA   5  
ATOM   10365 C C    . GLN B 1 49 ? -11.120 4.346   -3.267  1.00 0.00 ? 49  GLN B C    5  
ATOM   10366 O O    . GLN B 1 49 ? -10.532 5.397   -3.091  1.00 0.00 ? 49  GLN B O    5  
ATOM   10367 C CB   . GLN B 1 49 ? -9.689  2.655   -4.476  1.00 0.00 ? 49  GLN B CB   5  
ATOM   10368 C CG   . GLN B 1 49 ? -9.907  1.347   -5.247  1.00 0.00 ? 49  GLN B CG   5  
ATOM   10369 C CD   . GLN B 1 49 ? -8.667  0.462   -5.109  1.00 0.00 ? 49  GLN B CD   5  
ATOM   10370 O OE1  . GLN B 1 49 ? -7.802  0.730   -4.299  1.00 0.00 ? 49  GLN B OE1  5  
ATOM   10371 N NE2  . GLN B 1 49 ? -8.542  -0.590  -5.872  1.00 0.00 ? 49  GLN B NE2  5  
ATOM   10372 H H    . GLN B 1 49 ? -10.073 5.190   -5.628  1.00 0.00 ? 49  GLN B H    5  
ATOM   10373 H HA   . GLN B 1 49 ? -11.826 2.932   -4.724  1.00 0.00 ? 49  GLN B HA   5  
ATOM   10374 H HB2  . GLN B 1 49 ? -8.854  3.185   -4.909  1.00 0.00 ? 49  GLN B HB2  5  
ATOM   10375 H HB3  . GLN B 1 49 ? -9.468  2.430   -3.446  1.00 0.00 ? 49  GLN B HB3  5  
ATOM   10376 H HG2  . GLN B 1 49 ? -10.766 0.830   -4.844  1.00 0.00 ? 49  GLN B HG2  5  
ATOM   10377 H HG3  . GLN B 1 49 ? -10.075 1.566   -6.291  1.00 0.00 ? 49  GLN B HG3  5  
ATOM   10378 H HE21 . GLN B 1 49 ? -9.239  -0.806  -6.526  1.00 0.00 ? 49  GLN B HE21 5  
ATOM   10379 H HE22 . GLN B 1 49 ? -7.751  -1.162  -5.791  1.00 0.00 ? 49  GLN B HE22 5  
ATOM   10380 N N    . VAL B 1 50 ? -11.923 3.856   -2.357  1.00 0.00 ? 50  VAL B N    5  
ATOM   10381 C CA   . VAL B 1 50 ? -12.140 4.577   -1.065  1.00 0.00 ? 50  VAL B CA   5  
ATOM   10382 C C    . VAL B 1 50 ? -12.139 3.566   0.076   1.00 0.00 ? 50  VAL B C    5  
ATOM   10383 O O    . VAL B 1 50 ? -12.926 2.646   0.094   1.00 0.00 ? 50  VAL B O    5  
ATOM   10384 C CB   . VAL B 1 50 ? -13.488 5.299   -1.099  1.00 0.00 ? 50  VAL B CB   5  
ATOM   10385 C CG1  . VAL B 1 50 ? -13.586 6.245   0.100   1.00 0.00 ? 50  VAL B CG1  5  
ATOM   10386 C CG2  . VAL B 1 50 ? -13.604 6.095   -2.404  1.00 0.00 ? 50  VAL B CG2  5  
ATOM   10387 H H    . VAL B 1 50 ? -12.383 3.008   -2.523  1.00 0.00 ? 50  VAL B H    5  
ATOM   10388 H HA   . VAL B 1 50 ? -11.348 5.296   -0.902  1.00 0.00 ? 50  VAL B HA   5  
ATOM   10389 H HB   . VAL B 1 50 ? -14.289 4.575   -1.046  1.00 0.00 ? 50  VAL B HB   5  
ATOM   10390 H HG11 . VAL B 1 50 ? -12.736 6.909   0.105   1.00 0.00 ? 50  VAL B HG11 5  
ATOM   10391 H HG12 . VAL B 1 50 ? -14.495 6.825   0.031   1.00 0.00 ? 50  VAL B HG12 5  
ATOM   10392 H HG13 . VAL B 1 50 ? -13.598 5.668   1.013   1.00 0.00 ? 50  VAL B HG13 5  
ATOM   10393 H HG21 . VAL B 1 50 ? -12.655 6.559   -2.631  1.00 0.00 ? 50  VAL B HG21 5  
ATOM   10394 H HG22 . VAL B 1 50 ? -13.877 5.427   -3.205  1.00 0.00 ? 50  VAL B HG22 5  
ATOM   10395 H HG23 . VAL B 1 50 ? -14.362 6.857   -2.299  1.00 0.00 ? 50  VAL B HG23 5  
ATOM   10396 N N    . CYS B 1 51 ? -11.266 3.734   1.028   1.00 0.00 ? 51  CYS B N    5  
ATOM   10397 C CA   . CYS B 1 51 ? -11.215 2.775   2.164   1.00 0.00 ? 51  CYS B CA   5  
ATOM   10398 C C    . CYS B 1 51 ? -12.430 2.993   3.061   1.00 0.00 ? 51  CYS B C    5  
ATOM   10399 O O    . CYS B 1 51 ? -12.962 4.082   3.148   1.00 0.00 ? 51  CYS B O    5  
ATOM   10400 C CB   . CYS B 1 51 ? -9.938  3.015   2.969   1.00 0.00 ? 51  CYS B CB   5  
ATOM   10401 S SG   . CYS B 1 51 ? -8.491  2.756   1.911   1.00 0.00 ? 51  CYS B SG   5  
ATOM   10402 H H    . CYS B 1 51 ? -10.643 4.487   0.996   1.00 0.00 ? 51  CYS B H    5  
ATOM   10403 H HA   . CYS B 1 51 ? -11.219 1.763   1.786   1.00 0.00 ? 51  CYS B HA   5  
ATOM   10404 H HB2  . CYS B 1 51 ? -9.934  4.029   3.343   1.00 0.00 ? 51  CYS B HB2  5  
ATOM   10405 H HB3  . CYS B 1 51 ? -9.904  2.328   3.798   1.00 0.00 ? 51  CYS B HB3  5  
ATOM   10406 N N    . ALA B 1 52 ? -12.882 1.959   3.720   1.00 0.00 ? 52  ALA B N    5  
ATOM   10407 C CA   . ALA B 1 52 ? -14.077 2.095   4.609   1.00 0.00 ? 52  ALA B CA   5  
ATOM   10408 C C    . ALA B 1 52 ? -13.889 1.227   5.855   1.00 0.00 ? 52  ALA B C    5  
ATOM   10409 O O    . ALA B 1 52 ? -13.444 0.097   5.778   1.00 0.00 ? 52  ALA B O    5  
ATOM   10410 C CB   . ALA B 1 52 ? -15.322 1.628   3.854   1.00 0.00 ? 52  ALA B CB   5  
ATOM   10411 H H    . ALA B 1 52 ? -12.440 1.089   3.624   1.00 0.00 ? 52  ALA B H    5  
ATOM   10412 H HA   . ALA B 1 52 ? -14.202 3.130   4.905   1.00 0.00 ? 52  ALA B HA   5  
ATOM   10413 H HB1  . ALA B 1 52 ? -15.146 0.646   3.441   1.00 0.00 ? 52  ALA B HB1  5  
ATOM   10414 H HB2  . ALA B 1 52 ? -16.162 1.588   4.533   1.00 0.00 ? 52  ALA B HB2  5  
ATOM   10415 H HB3  . ALA B 1 52 ? -15.539 2.321   3.054   1.00 0.00 ? 52  ALA B HB3  5  
ATOM   10416 N N    . ASP B 1 53 ? -14.223 1.752   7.003   1.00 0.00 ? 53  ASP B N    5  
ATOM   10417 C CA   . ASP B 1 53 ? -14.068 0.971   8.264   1.00 0.00 ? 53  ASP B CA   5  
ATOM   10418 C C    . ASP B 1 53 ? -15.080 -0.202  8.274   1.00 0.00 ? 53  ASP B C    5  
ATOM   10419 O O    . ASP B 1 53 ? -16.269 0.050   8.274   1.00 0.00 ? 53  ASP B O    5  
ATOM   10420 C CB   . ASP B 1 53 ? -14.367 1.886   9.455   1.00 0.00 ? 53  ASP B CB   5  
ATOM   10421 C CG   . ASP B 1 53 ? -13.651 3.225   9.268   1.00 0.00 ? 53  ASP B CG   5  
ATOM   10422 O OD1  . ASP B 1 53 ? -13.835 3.831   8.225   1.00 0.00 ? 53  ASP B OD1  5  
ATOM   10423 O OD2  . ASP B 1 53 ? -12.933 3.621   10.171  1.00 0.00 ? 53  ASP B OD2  5  
ATOM   10424 H H    . ASP B 1 53 ? -14.577 2.666   7.036   1.00 0.00 ? 53  ASP B H    5  
ATOM   10425 H HA   . ASP B 1 53 ? -13.057 0.622   8.336   1.00 0.00 ? 53  ASP B HA   5  
ATOM   10426 H HB2  . ASP B 1 53 ? -15.433 2.055   9.521   1.00 0.00 ? 53  ASP B HB2  5  
ATOM   10427 H HB3  . ASP B 1 53 ? -14.019 1.420   10.365  1.00 0.00 ? 53  ASP B HB3  5  
ATOM   10428 N N    . PRO B 1 54 ? -14.624 -1.450  8.287   1.00 0.00 ? 54  PRO B N    5  
ATOM   10429 C CA   . PRO B 1 54 ? -15.564 -2.593  8.302   1.00 0.00 ? 54  PRO B CA   5  
ATOM   10430 C C    . PRO B 1 54 ? -16.430 -2.549  9.571   1.00 0.00 ? 54  PRO B C    5  
ATOM   10431 O O    . PRO B 1 54 ? -17.343 -3.334  9.738   1.00 0.00 ? 54  PRO B O    5  
ATOM   10432 C CB   . PRO B 1 54 ? -14.668 -3.853  8.290   1.00 0.00 ? 54  PRO B CB   5  
ATOM   10433 C CG   . PRO B 1 54 ? -13.186 -3.379  8.272   1.00 0.00 ? 54  PRO B CG   5  
ATOM   10434 C CD   . PRO B 1 54 ? -13.190 -1.833  8.282   1.00 0.00 ? 54  PRO B CD   5  
ATOM   10435 H HA   . PRO B 1 54 ? -16.189 -2.572  7.423   1.00 0.00 ? 54  PRO B HA   5  
ATOM   10436 H HB2  . PRO B 1 54 ? -14.853 -4.451  9.175   1.00 0.00 ? 54  PRO B HB2  5  
ATOM   10437 H HB3  . PRO B 1 54 ? -14.873 -4.442  7.405   1.00 0.00 ? 54  PRO B HB3  5  
ATOM   10438 H HG2  . PRO B 1 54 ? -12.666 -3.756  9.148   1.00 0.00 ? 54  PRO B HG2  5  
ATOM   10439 H HG3  . PRO B 1 54 ? -12.694 -3.738  7.380   1.00 0.00 ? 54  PRO B HG3  5  
ATOM   10440 H HD2  . PRO B 1 54 ? -12.697 -1.466  9.174   1.00 0.00 ? 54  PRO B HD2  5  
ATOM   10441 H HD3  . PRO B 1 54 ? -12.705 -1.449  7.395   1.00 0.00 ? 54  PRO B HD3  5  
ATOM   10442 N N    . SER B 1 55 ? -16.140 -1.652  10.468  1.00 0.00 ? 55  SER B N    5  
ATOM   10443 C CA   . SER B 1 55 ? -16.933 -1.573  11.729  1.00 0.00 ? 55  SER B CA   5  
ATOM   10444 C C    . SER B 1 55 ? -18.283 -0.901  11.463  1.00 0.00 ? 55  SER B C    5  
ATOM   10445 O O    . SER B 1 55 ? -19.216 -1.044  12.227  1.00 0.00 ? 55  SER B O    5  
ATOM   10446 C CB   . SER B 1 55 ? -16.157 -0.759  12.766  1.00 0.00 ? 55  SER B CB   5  
ATOM   10447 O OG   . SER B 1 55 ? -16.089 0.596   12.344  1.00 0.00 ? 55  SER B OG   5  
ATOM   10448 H H    . SER B 1 55 ? -15.391 -1.040  10.320  1.00 0.00 ? 55  SER B H    5  
ATOM   10449 H HA   . SER B 1 55 ? -17.099 -2.570  12.110  1.00 0.00 ? 55  SER B HA   5  
ATOM   10450 H HB2  . SER B 1 55 ? -16.661 -0.811  13.717  1.00 0.00 ? 55  SER B HB2  5  
ATOM   10451 H HB3  . SER B 1 55 ? -15.159 -1.167  12.868  1.00 0.00 ? 55  SER B HB3  5  
ATOM   10452 H HG   . SER B 1 55 ? -15.409 1.033   12.861  1.00 0.00 ? 55  SER B HG   5  
ATOM   10453 N N    . GLU B 1 56 ? -18.402 -0.171  10.387  1.00 0.00 ? 56  GLU B N    5  
ATOM   10454 C CA   . GLU B 1 56 ? -19.701 0.500   10.086  1.00 0.00 ? 56  GLU B CA   5  
ATOM   10455 C C    . GLU B 1 56 ? -20.650 -0.509  9.427   1.00 0.00 ? 56  GLU B C    5  
ATOM   10456 O O    . GLU B 1 56 ? -20.366 -1.068  8.387   1.00 0.00 ? 56  GLU B O    5  
ATOM   10457 C CB   . GLU B 1 56 ? -19.459 1.684   9.147   1.00 0.00 ? 56  GLU B CB   5  
ATOM   10458 C CG   . GLU B 1 56 ? -18.953 2.887   9.947   1.00 0.00 ? 56  GLU B CG   5  
ATOM   10459 C CD   . GLU B 1 56 ? -20.104 3.481   10.762  1.00 0.00 ? 56  GLU B CD   5  
ATOM   10460 O OE1  . GLU B 1 56 ? -21.215 2.997   10.620  1.00 0.00 ? 56  GLU B OE1  5  
ATOM   10461 O OE2  . GLU B 1 56 ? -19.855 4.410   11.512  1.00 0.00 ? 56  GLU B OE2  5  
ATOM   10462 H H    . GLU B 1 56 ? -17.642 -0.066  9.777   1.00 0.00 ? 56  GLU B H    5  
ATOM   10463 H HA   . GLU B 1 56 ? -20.144 0.854   11.007  1.00 0.00 ? 56  GLU B HA   5  
ATOM   10464 H HB2  . GLU B 1 56 ? -18.720 1.408   8.415   1.00 0.00 ? 56  GLU B HB2  5  
ATOM   10465 H HB3  . GLU B 1 56 ? -20.381 1.947   8.650   1.00 0.00 ? 56  GLU B HB3  5  
ATOM   10466 H HG2  . GLU B 1 56 ? -18.165 2.570   10.614  1.00 0.00 ? 56  GLU B HG2  5  
ATOM   10467 H HG3  . GLU B 1 56 ? -18.571 3.637   9.269   1.00 0.00 ? 56  GLU B HG3  5  
ATOM   10468 N N    . SER B 1 57 ? -21.767 -0.753  10.050  1.00 0.00 ? 57  SER B N    5  
ATOM   10469 C CA   . SER B 1 57 ? -22.752 -1.732  9.509   1.00 0.00 ? 57  SER B CA   5  
ATOM   10470 C C    . SER B 1 57 ? -23.062 -1.470  8.032   1.00 0.00 ? 57  SER B C    5  
ATOM   10471 O O    . SER B 1 57 ? -23.193 -2.392  7.252   1.00 0.00 ? 57  SER B O    5  
ATOM   10472 C CB   . SER B 1 57 ? -24.046 -1.638  10.317  1.00 0.00 ? 57  SER B CB   5  
ATOM   10473 O OG   . SER B 1 57 ? -23.795 -2.040  11.657  1.00 0.00 ? 57  SER B OG   5  
ATOM   10474 H H    . SER B 1 57 ? -21.957 -0.295  10.892  1.00 0.00 ? 57  SER B H    5  
ATOM   10475 H HA   . SER B 1 57 ? -22.350 -2.726  9.611   1.00 0.00 ? 57  SER B HA   5  
ATOM   10476 H HB2  . SER B 1 57 ? -24.402 -0.622  10.312  1.00 0.00 ? 57  SER B HB2  5  
ATOM   10477 H HB3  . SER B 1 57 ? -24.794 -2.281  9.871   1.00 0.00 ? 57  SER B HB3  5  
ATOM   10478 H HG   . SER B 1 57 ? -22.849 -2.173  11.754  1.00 0.00 ? 57  SER B HG   5  
ATOM   10479 N N    . TRP B 1 58 ? -23.212 -0.235  7.634   1.00 0.00 ? 58  TRP B N    5  
ATOM   10480 C CA   . TRP B 1 58 ? -23.548 0.032   6.205   1.00 0.00 ? 58  TRP B CA   5  
ATOM   10481 C C    . TRP B 1 58 ? -22.444 -0.516  5.303   1.00 0.00 ? 58  TRP B C    5  
ATOM   10482 O O    . TRP B 1 58 ? -22.683 -0.879  4.170   1.00 0.00 ? 58  TRP B O    5  
ATOM   10483 C CB   . TRP B 1 58 ? -23.767 1.535   5.975   1.00 0.00 ? 58  TRP B CB   5  
ATOM   10484 C CG   . TRP B 1 58 ? -22.478 2.282   5.911   1.00 0.00 ? 58  TRP B CG   5  
ATOM   10485 C CD1  . TRP B 1 58 ? -21.980 3.045   6.907   1.00 0.00 ? 58  TRP B CD1  5  
ATOM   10486 C CD2  . TRP B 1 58 ? -21.542 2.393   4.800   1.00 0.00 ? 58  TRP B CD2  5  
ATOM   10487 N NE1  . TRP B 1 58 ? -20.797 3.617   6.483   1.00 0.00 ? 58  TRP B NE1  5  
ATOM   10488 C CE2  . TRP B 1 58 ? -20.476 3.243   5.197   1.00 0.00 ? 58  TRP B CE2  5  
ATOM   10489 C CE3  . TRP B 1 58 ? -21.507 1.842   3.498   1.00 0.00 ? 58  TRP B CE3  5  
ATOM   10490 C CZ2  . TRP B 1 58 ? -19.412 3.539   4.334   1.00 0.00 ? 58  TRP B CZ2  5  
ATOM   10491 C CZ3  . TRP B 1 58 ? -20.439 2.138   2.627   1.00 0.00 ? 58  TRP B CZ3  5  
ATOM   10492 C CH2  . TRP B 1 58 ? -19.393 2.984   3.045   1.00 0.00 ? 58  TRP B CH2  5  
ATOM   10493 H H    . TRP B 1 58 ? -23.119 0.503   8.269   1.00 0.00 ? 58  TRP B H    5  
ATOM   10494 H HA   . TRP B 1 58 ? -24.466 -0.490  5.972   1.00 0.00 ? 58  TRP B HA   5  
ATOM   10495 H HB2  . TRP B 1 58 ? -24.292 1.679   5.046   1.00 0.00 ? 58  TRP B HB2  5  
ATOM   10496 H HB3  . TRP B 1 58 ? -24.366 1.931   6.782   1.00 0.00 ? 58  TRP B HB3  5  
ATOM   10497 H HD1  . TRP B 1 58 ? -22.435 3.189   7.876   1.00 0.00 ? 58  TRP B HD1  5  
ATOM   10498 H HE1  . TRP B 1 58 ? -20.243 4.215   7.013   1.00 0.00 ? 58  TRP B HE1  5  
ATOM   10499 H HE3  . TRP B 1 58 ? -22.304 1.195   3.167   1.00 0.00 ? 58  TRP B HE3  5  
ATOM   10500 H HZ2  . TRP B 1 58 ? -18.613 4.189   4.660   1.00 0.00 ? 58  TRP B HZ2  5  
ATOM   10501 H HZ3  . TRP B 1 58 ? -20.425 1.715   1.636   1.00 0.00 ? 58  TRP B HZ3  5  
ATOM   10502 H HH2  . TRP B 1 58 ? -18.577 3.208   2.374   1.00 0.00 ? 58  TRP B HH2  5  
ATOM   10503 N N    . VAL B 1 59 ? -21.245 -0.606  5.799   1.00 0.00 ? 59  VAL B N    5  
ATOM   10504 C CA   . VAL B 1 59 ? -20.144 -1.156  4.964   1.00 0.00 ? 59  VAL B CA   5  
ATOM   10505 C C    . VAL B 1 59 ? -20.373 -2.651  4.773   1.00 0.00 ? 59  VAL B C    5  
ATOM   10506 O O    . VAL B 1 59 ? -20.282 -3.171  3.679   1.00 0.00 ? 59  VAL B O    5  
ATOM   10507 C CB   . VAL B 1 59 ? -18.808 -0.917  5.665   1.00 0.00 ? 59  VAL B CB   5  
ATOM   10508 C CG1  . VAL B 1 59 ? -17.669 -1.523  4.841   1.00 0.00 ? 59  VAL B CG1  5  
ATOM   10509 C CG2  . VAL B 1 59 ? -18.601 0.589   5.811   1.00 0.00 ? 59  VAL B CG2  5  
ATOM   10510 H H    . VAL B 1 59 ? -21.071 -0.327  6.722   1.00 0.00 ? 59  VAL B H    5  
ATOM   10511 H HA   . VAL B 1 59 ? -20.141 -0.666  4.002   1.00 0.00 ? 59  VAL B HA   5  
ATOM   10512 H HB   . VAL B 1 59 ? -18.825 -1.378  6.642   1.00 0.00 ? 59  VAL B HB   5  
ATOM   10513 H HG11 . VAL B 1 59 ? -17.820 -1.302  3.796   1.00 0.00 ? 59  VAL B HG11 5  
ATOM   10514 H HG12 . VAL B 1 59 ? -16.727 -1.105  5.164   1.00 0.00 ? 59  VAL B HG12 5  
ATOM   10515 H HG13 . VAL B 1 59 ? -17.654 -2.593  4.981   1.00 0.00 ? 59  VAL B HG13 5  
ATOM   10516 H HG21 . VAL B 1 59 ? -19.475 1.027   6.271   1.00 0.00 ? 59  VAL B HG21 5  
ATOM   10517 H HG22 . VAL B 1 59 ? -17.734 0.775   6.426   1.00 0.00 ? 59  VAL B HG22 5  
ATOM   10518 H HG23 . VAL B 1 59 ? -18.453 1.027   4.838   1.00 0.00 ? 59  VAL B HG23 5  
ATOM   10519 N N    . GLN B 1 60 ? -20.679 -3.347  5.830   1.00 0.00 ? 60  GLN B N    5  
ATOM   10520 C CA   . GLN B 1 60 ? -20.927 -4.812  5.709   1.00 0.00 ? 60  GLN B CA   5  
ATOM   10521 C C    . GLN B 1 60 ? -22.159 -5.050  4.830   1.00 0.00 ? 60  GLN B C    5  
ATOM   10522 O O    . GLN B 1 60 ? -22.211 -5.983  4.054   1.00 0.00 ? 60  GLN B O    5  
ATOM   10523 C CB   . GLN B 1 60 ? -21.167 -5.406  7.097   1.00 0.00 ? 60  GLN B CB   5  
ATOM   10524 C CG   . GLN B 1 60 ? -21.154 -6.932  7.010   1.00 0.00 ? 60  GLN B CG   5  
ATOM   10525 C CD   . GLN B 1 60 ? -21.499 -7.526  8.377   1.00 0.00 ? 60  GLN B CD   5  
ATOM   10526 O OE1  . GLN B 1 60 ? -20.732 -7.415  9.311   1.00 0.00 ? 60  GLN B OE1  5  
ATOM   10527 N NE2  . GLN B 1 60 ? -22.631 -8.157  8.532   1.00 0.00 ? 60  GLN B NE2  5  
ATOM   10528 H H    . GLN B 1 60 ? -20.755 -2.902  6.704   1.00 0.00 ? 60  GLN B H    5  
ATOM   10529 H HA   . GLN B 1 60 ? -20.068 -5.285  5.257   1.00 0.00 ? 60  GLN B HA   5  
ATOM   10530 H HB2  . GLN B 1 60 ? -20.387 -5.077  7.769   1.00 0.00 ? 60  GLN B HB2  5  
ATOM   10531 H HB3  . GLN B 1 60 ? -22.125 -5.077  7.469   1.00 0.00 ? 60  GLN B HB3  5  
ATOM   10532 H HG2  . GLN B 1 60 ? -21.882 -7.257  6.280   1.00 0.00 ? 60  GLN B HG2  5  
ATOM   10533 H HG3  . GLN B 1 60 ? -20.173 -7.268  6.711   1.00 0.00 ? 60  GLN B HG3  5  
ATOM   10534 H HE21 . GLN B 1 60 ? -23.250 -8.247  7.778   1.00 0.00 ? 60  GLN B HE21 5  
ATOM   10535 H HE22 . GLN B 1 60 ? -22.862 -8.540  9.405   1.00 0.00 ? 60  GLN B HE22 5  
ATOM   10536 N N    . GLU B 1 61 ? -23.154 -4.214  4.952   1.00 0.00 ? 61  GLU B N    5  
ATOM   10537 C CA   . GLU B 1 61 ? -24.389 -4.389  4.132   1.00 0.00 ? 61  GLU B CA   5  
ATOM   10538 C C    . GLU B 1 61 ? -24.061 -4.194  2.650   1.00 0.00 ? 61  GLU B C    5  
ATOM   10539 O O    . GLU B 1 61 ? -24.453 -4.977  1.809   1.00 0.00 ? 61  GLU B O    5  
ATOM   10540 C CB   . GLU B 1 61 ? -25.434 -3.351  4.568   1.00 0.00 ? 61  GLU B CB   5  
ATOM   10541 C CG   . GLU B 1 61 ? -26.671 -3.418  3.661   1.00 0.00 ? 61  GLU B CG   5  
ATOM   10542 C CD   . GLU B 1 61 ? -27.214 -4.849  3.622   1.00 0.00 ? 61  GLU B CD   5  
ATOM   10543 O OE1  . GLU B 1 61 ? -27.242 -5.480  4.666   1.00 0.00 ? 61  GLU B OE1  5  
ATOM   10544 O OE2  . GLU B 1 61 ? -27.591 -5.288  2.549   1.00 0.00 ? 61  GLU B OE2  5  
ATOM   10545 H H    . GLU B 1 61 ? -23.090 -3.471  5.587   1.00 0.00 ? 61  GLU B H    5  
ATOM   10546 H HA   . GLU B 1 61 ? -24.779 -5.381  4.286   1.00 0.00 ? 61  GLU B HA   5  
ATOM   10547 H HB2  . GLU B 1 61 ? -25.729 -3.548  5.588   1.00 0.00 ? 61  GLU B HB2  5  
ATOM   10548 H HB3  . GLU B 1 61 ? -25.002 -2.363  4.506   1.00 0.00 ? 61  GLU B HB3  5  
ATOM   10549 H HG2  . GLU B 1 61 ? -27.433 -2.758  4.049   1.00 0.00 ? 61  GLU B HG2  5  
ATOM   10550 H HG3  . GLU B 1 61 ? -26.406 -3.108  2.661   1.00 0.00 ? 61  GLU B HG3  5  
ATOM   10551 N N    . TYR B 1 62 ? -23.355 -3.149  2.327   1.00 0.00 ? 62  TYR B N    5  
ATOM   10552 C CA   . TYR B 1 62 ? -23.008 -2.888  0.902   1.00 0.00 ? 62  TYR B CA   5  
ATOM   10553 C C    . TYR B 1 62 ? -22.144 -4.032  0.365   1.00 0.00 ? 62  TYR B C    5  
ATOM   10554 O O    . TYR B 1 62 ? -22.258 -4.423  -0.779  1.00 0.00 ? 62  TYR B O    5  
ATOM   10555 C CB   . TYR B 1 62 ? -22.242 -1.557  0.796   1.00 0.00 ? 62  TYR B CB   5  
ATOM   10556 C CG   . TYR B 1 62 ? -23.211 -0.386  0.780   1.00 0.00 ? 62  TYR B CG   5  
ATOM   10557 C CD1  . TYR B 1 62 ? -24.235 -0.285  1.749   1.00 0.00 ? 62  TYR B CD1  5  
ATOM   10558 C CD2  . TYR B 1 62 ? -23.086 0.609   -0.211  1.00 0.00 ? 62  TYR B CD2  5  
ATOM   10559 C CE1  . TYR B 1 62 ? -25.125 0.805   1.721   1.00 0.00 ? 62  TYR B CE1  5  
ATOM   10560 C CE2  . TYR B 1 62 ? -23.978 1.697   -0.235  1.00 0.00 ? 62  TYR B CE2  5  
ATOM   10561 C CZ   . TYR B 1 62 ? -24.997 1.795   0.730   1.00 0.00 ? 62  TYR B CZ   5  
ATOM   10562 O OH   . TYR B 1 62 ? -25.872 2.862   0.704   1.00 0.00 ? 62  TYR B OH   5  
ATOM   10563 H H    . TYR B 1 62 ? -23.059 -2.528  3.024   1.00 0.00 ? 62  TYR B H    5  
ATOM   10564 H HA   . TYR B 1 62 ? -23.917 -2.828  0.318   1.00 0.00 ? 62  TYR B HA   5  
ATOM   10565 H HB2  . TYR B 1 62 ? -21.582 -1.460  1.646   1.00 0.00 ? 62  TYR B HB2  5  
ATOM   10566 H HB3  . TYR B 1 62 ? -21.656 -1.550  -0.112  1.00 0.00 ? 62  TYR B HB3  5  
ATOM   10567 H HD1  . TYR B 1 62 ? -24.339 -1.037  2.510   1.00 0.00 ? 62  TYR B HD1  5  
ATOM   10568 H HD2  . TYR B 1 62 ? -22.305 0.537   -0.952  1.00 0.00 ? 62  TYR B HD2  5  
ATOM   10569 H HE1  . TYR B 1 62 ? -25.907 0.881   2.462   1.00 0.00 ? 62  TYR B HE1  5  
ATOM   10570 H HE2  . TYR B 1 62 ? -23.879 2.459   -0.992  1.00 0.00 ? 62  TYR B HE2  5  
ATOM   10571 H HH   . TYR B 1 62 ? -25.384 3.651   0.953   1.00 0.00 ? 62  TYR B HH   5  
ATOM   10572 N N    . VAL B 1 63 ? -21.293 -4.582  1.184   1.00 0.00 ? 63  VAL B N    5  
ATOM   10573 C CA   . VAL B 1 63 ? -20.443 -5.706  0.718   1.00 0.00 ? 63  VAL B CA   5  
ATOM   10574 C C    . VAL B 1 63 ? -21.347 -6.893  0.423   1.00 0.00 ? 63  VAL B C    5  
ATOM   10575 O O    . VAL B 1 63 ? -21.190 -7.585  -0.561  1.00 0.00 ? 63  VAL B O    5  
ATOM   10576 C CB   . VAL B 1 63 ? -19.441 -6.074  1.814   1.00 0.00 ? 63  VAL B CB   5  
ATOM   10577 C CG1  . VAL B 1 63 ? -18.721 -7.375  1.446   1.00 0.00 ? 63  VAL B CG1  5  
ATOM   10578 C CG2  . VAL B 1 63 ? -18.414 -4.949  1.961   1.00 0.00 ? 63  VAL B CG2  5  
ATOM   10579 H H    . VAL B 1 63 ? -21.225 -4.269  2.105   1.00 0.00 ? 63  VAL B H    5  
ATOM   10580 H HA   . VAL B 1 63 ? -19.915 -5.418  -0.179  1.00 0.00 ? 63  VAL B HA   5  
ATOM   10581 H HB   . VAL B 1 63 ? -19.966 -6.207  2.749   1.00 0.00 ? 63  VAL B HB   5  
ATOM   10582 H HG11 . VAL B 1 63 ? -18.400 -7.328  0.417   1.00 0.00 ? 63  VAL B HG11 5  
ATOM   10583 H HG12 . VAL B 1 63 ? -17.861 -7.504  2.087   1.00 0.00 ? 63  VAL B HG12 5  
ATOM   10584 H HG13 . VAL B 1 63 ? -19.395 -8.208  1.577   1.00 0.00 ? 63  VAL B HG13 5  
ATOM   10585 H HG21 . VAL B 1 63 ? -18.921 -3.994  1.953   1.00 0.00 ? 63  VAL B HG21 5  
ATOM   10586 H HG22 . VAL B 1 63 ? -17.882 -5.066  2.892   1.00 0.00 ? 63  VAL B HG22 5  
ATOM   10587 H HG23 . VAL B 1 63 ? -17.716 -4.990  1.138   1.00 0.00 ? 63  VAL B HG23 5  
ATOM   10588 N N    . TYR B 1 64 ? -22.302 -7.124  1.276   1.00 0.00 ? 64  TYR B N    5  
ATOM   10589 C CA   . TYR B 1 64 ? -23.231 -8.257  1.061   1.00 0.00 ? 64  TYR B CA   5  
ATOM   10590 C C    . TYR B 1 64 ? -24.035 -8.015  -0.214  1.00 0.00 ? 64  TYR B C    5  
ATOM   10591 O O    . TYR B 1 64 ? -24.218 -8.897  -1.028  1.00 0.00 ? 64  TYR B O    5  
ATOM   10592 C CB   . TYR B 1 64 ? -24.184 -8.362  2.256   1.00 0.00 ? 64  TYR B CB   5  
ATOM   10593 C CG   . TYR B 1 64 ? -24.818 -9.736  2.288   1.00 0.00 ? 64  TYR B CG   5  
ATOM   10594 C CD1  . TYR B 1 64 ? -24.047 -10.858 2.646   1.00 0.00 ? 64  TYR B CD1  5  
ATOM   10595 C CD2  . TYR B 1 64 ? -26.180 -9.892  1.960   1.00 0.00 ? 64  TYR B CD2  5  
ATOM   10596 C CE1  . TYR B 1 64 ? -24.636 -12.137 2.675   1.00 0.00 ? 64  TYR B CE1  5  
ATOM   10597 C CE2  . TYR B 1 64 ? -26.768 -11.171 1.990   1.00 0.00 ? 64  TYR B CE2  5  
ATOM   10598 C CZ   . TYR B 1 64 ? -25.997 -12.293 2.348   1.00 0.00 ? 64  TYR B CZ   5  
ATOM   10599 O OH   . TYR B 1 64 ? -26.573 -13.547 2.376   1.00 0.00 ? 64  TYR B OH   5  
ATOM   10600 H H    . TYR B 1 64 ? -22.407 -6.545  2.059   1.00 0.00 ? 64  TYR B H    5  
ATOM   10601 H HA   . TYR B 1 64 ? -22.662 -9.164  0.967   1.00 0.00 ? 64  TYR B HA   5  
ATOM   10602 H HB2  . TYR B 1 64 ? -23.630 -8.200  3.167   1.00 0.00 ? 64  TYR B HB2  5  
ATOM   10603 H HB3  . TYR B 1 64 ? -24.956 -7.610  2.172   1.00 0.00 ? 64  TYR B HB3  5  
ATOM   10604 H HD1  . TYR B 1 64 ? -23.003 -10.738 2.897   1.00 0.00 ? 64  TYR B HD1  5  
ATOM   10605 H HD2  . TYR B 1 64 ? -26.772 -9.032  1.686   1.00 0.00 ? 64  TYR B HD2  5  
ATOM   10606 H HE1  . TYR B 1 64 ? -24.044 -12.997 2.949   1.00 0.00 ? 64  TYR B HE1  5  
ATOM   10607 H HE2  . TYR B 1 64 ? -27.811 -11.292 1.739   1.00 0.00 ? 64  TYR B HE2  5  
ATOM   10608 H HH   . TYR B 1 64 ? -27.412 -13.476 2.839   1.00 0.00 ? 64  TYR B HH   5  
ATOM   10609 N N    . ASP B 1 65 ? -24.517 -6.820  -0.384  1.00 0.00 ? 65  ASP B N    5  
ATOM   10610 C CA   . ASP B 1 65 ? -25.320 -6.497  -1.598  1.00 0.00 ? 65  ASP B CA   5  
ATOM   10611 C C    . ASP B 1 65 ? -24.458 -6.686  -2.849  1.00 0.00 ? 65  ASP B C    5  
ATOM   10612 O O    . ASP B 1 65 ? -24.935 -7.099  -3.887  1.00 0.00 ? 65  ASP B O    5  
ATOM   10613 C CB   . ASP B 1 65 ? -25.790 -5.040  -1.513  1.00 0.00 ? 65  ASP B CB   5  
ATOM   10614 C CG   . ASP B 1 65 ? -26.990 -4.939  -0.568  1.00 0.00 ? 65  ASP B CG   5  
ATOM   10615 O OD1  . ASP B 1 65 ? -27.966 -5.633  -0.805  1.00 0.00 ? 65  ASP B OD1  5  
ATOM   10616 O OD2  . ASP B 1 65 ? -26.914 -4.170  0.376   1.00 0.00 ? 65  ASP B OD2  5  
ATOM   10617 H H    . ASP B 1 65 ? -24.352 -6.130  0.293   1.00 0.00 ? 65  ASP B H    5  
ATOM   10618 H HA   . ASP B 1 65 ? -26.175 -7.153  -1.649  1.00 0.00 ? 65  ASP B HA   5  
ATOM   10619 H HB2  . ASP B 1 65 ? -24.984 -4.427  -1.136  1.00 0.00 ? 65  ASP B HB2  5  
ATOM   10620 H HB3  . ASP B 1 65 ? -26.074 -4.696  -2.491  1.00 0.00 ? 65  ASP B HB3  5  
ATOM   10621 N N    . LEU B 1 66 ? -23.196 -6.385  -2.756  1.00 0.00 ? 66  LEU B N    5  
ATOM   10622 C CA   . LEU B 1 66 ? -22.297 -6.543  -3.932  1.00 0.00 ? 66  LEU B CA   5  
ATOM   10623 C C    . LEU B 1 66 ? -22.058 -8.033  -4.194  1.00 0.00 ? 66  LEU B C    5  
ATOM   10624 O O    . LEU B 1 66 ? -21.843 -8.451  -5.314  1.00 0.00 ? 66  LEU B O    5  
ATOM   10625 C CB   . LEU B 1 66 ? -20.966 -5.840  -3.632  1.00 0.00 ? 66  LEU B CB   5  
ATOM   10626 C CG   . LEU B 1 66 ? -21.099 -4.321  -3.872  1.00 0.00 ? 66  LEU B CG   5  
ATOM   10627 C CD1  . LEU B 1 66 ? -20.017 -3.575  -3.089  1.00 0.00 ? 66  LEU B CD1  5  
ATOM   10628 C CD2  . LEU B 1 66 ? -20.926 -3.998  -5.366  1.00 0.00 ? 66  LEU B CD2  5  
ATOM   10629 H H    . LEU B 1 66 ? -22.837 -6.052  -1.909  1.00 0.00 ? 66  LEU B H    5  
ATOM   10630 H HA   . LEU B 1 66 ? -22.759 -6.099  -4.798  1.00 0.00 ? 66  LEU B HA   5  
ATOM   10631 H HB2  . LEU B 1 66 ? -20.703 -6.019  -2.598  1.00 0.00 ? 66  LEU B HB2  5  
ATOM   10632 H HB3  . LEU B 1 66 ? -20.196 -6.244  -4.266  1.00 0.00 ? 66  LEU B HB3  5  
ATOM   10633 H HG   . LEU B 1 66 ? -22.073 -3.987  -3.542  1.00 0.00 ? 66  LEU B HG   5  
ATOM   10634 H HD11 . LEU B 1 66 ? -20.094 -3.824  -2.040  1.00 0.00 ? 66  LEU B HD11 5  
ATOM   10635 H HD12 . LEU B 1 66 ? -19.045 -3.862  -3.456  1.00 0.00 ? 66  LEU B HD12 5  
ATOM   10636 H HD13 . LEU B 1 66 ? -20.149 -2.511  -3.217  1.00 0.00 ? 66  LEU B HD13 5  
ATOM   10637 H HD21 . LEU B 1 66 ? -20.036 -4.480  -5.742  1.00 0.00 ? 66  LEU B HD21 5  
ATOM   10638 H HD22 . LEU B 1 66 ? -21.785 -4.346  -5.918  1.00 0.00 ? 66  LEU B HD22 5  
ATOM   10639 H HD23 . LEU B 1 66 ? -20.832 -2.930  -5.491  1.00 0.00 ? 66  LEU B HD23 5  
ATOM   10640 N N    . GLU B 1 67 ? -22.099 -8.834  -3.169  1.00 0.00 ? 67  GLU B N    5  
ATOM   10641 C CA   . GLU B 1 67 ? -21.881 -10.297 -3.354  1.00 0.00 ? 67  GLU B CA   5  
ATOM   10642 C C    . GLU B 1 67 ? -23.111 -10.905 -4.026  1.00 0.00 ? 67  GLU B C    5  
ATOM   10643 O O    . GLU B 1 67 ? -23.021 -11.873 -4.756  1.00 0.00 ? 67  GLU B O    5  
ATOM   10644 C CB   . GLU B 1 67 ? -21.677 -10.955 -1.989  1.00 0.00 ? 67  GLU B CB   5  
ATOM   10645 C CG   . GLU B 1 67 ? -20.344 -10.497 -1.388  1.00 0.00 ? 67  GLU B CG   5  
ATOM   10646 C CD   . GLU B 1 67 ? -19.193 -11.290 -2.013  1.00 0.00 ? 67  GLU B CD   5  
ATOM   10647 O OE1  . GLU B 1 67 ? -18.903 -12.366 -1.517  1.00 0.00 ? 67  GLU B OE1  5  
ATOM   10648 O OE2  . GLU B 1 67 ? -18.621 -10.805 -2.976  1.00 0.00 ? 67  GLU B OE2  5  
ATOM   10649 H H    . GLU B 1 67 ? -22.274 -8.472  -2.276  1.00 0.00 ? 67  GLU B H    5  
ATOM   10650 H HA   . GLU B 1 67 ? -21.010 -10.461 -3.971  1.00 0.00 ? 67  GLU B HA   5  
ATOM   10651 H HB2  . GLU B 1 67 ? -22.484 -10.669 -1.329  1.00 0.00 ? 67  GLU B HB2  5  
ATOM   10652 H HB3  . GLU B 1 67 ? -21.673 -12.029 -2.102  1.00 0.00 ? 67  GLU B HB3  5  
ATOM   10653 H HG2  . GLU B 1 67 ? -20.204 -9.444  -1.584  1.00 0.00 ? 67  GLU B HG2  5  
ATOM   10654 H HG3  . GLU B 1 67 ? -20.358 -10.665 -0.323  1.00 0.00 ? 67  GLU B HG3  5  
ATOM   10655 N N    . LEU B 1 68 ? -24.261 -10.340 -3.787  1.00 0.00 ? 68  LEU B N    5  
ATOM   10656 C CA   . LEU B 1 68 ? -25.502 -10.881 -4.413  1.00 0.00 ? 68  LEU B CA   5  
ATOM   10657 C C    . LEU B 1 68 ? -25.561 -10.451 -5.880  1.00 0.00 ? 68  LEU B C    5  
ATOM   10658 O O    . LEU B 1 68 ? -25.062 -11.129 -6.755  1.00 0.00 ? 68  LEU B O    5  
ATOM   10659 C CB   . LEU B 1 68 ? -26.727 -10.342 -3.678  1.00 0.00 ? 68  LEU B CB   5  
ATOM   10660 C CG   . LEU B 1 68 ? -26.712 -10.809 -2.219  1.00 0.00 ? 68  LEU B CG   5  
ATOM   10661 C CD1  . LEU B 1 68 ? -27.916 -10.205 -1.506  1.00 0.00 ? 68  LEU B CD1  5  
ATOM   10662 C CD2  . LEU B 1 68 ? -26.786 -12.348 -2.142  1.00 0.00 ? 68  LEU B CD2  5  
ATOM   10663 H H    . LEU B 1 68 ? -24.306 -9.560  -3.195  1.00 0.00 ? 68  LEU B H    5  
ATOM   10664 H HA   . LEU B 1 68 ? -25.497 -11.954 -4.355  1.00 0.00 ? 68  LEU B HA   5  
ATOM   10665 H HB2  . LEU B 1 68 ? -26.717 -9.262  -3.709  1.00 0.00 ? 68  LEU B HB2  5  
ATOM   10666 H HB3  . LEU B 1 68 ? -27.622 -10.706 -4.160  1.00 0.00 ? 68  LEU B HB3  5  
ATOM   10667 H HG   . LEU B 1 68 ? -25.805 -10.464 -1.744  1.00 0.00 ? 68  LEU B HG   5  
ATOM   10668 H HD11 . LEU B 1 68 ? -27.869 -9.129  -1.576  1.00 0.00 ? 68  LEU B HD11 5  
ATOM   10669 H HD12 . LEU B 1 68 ? -28.822 -10.560 -1.973  1.00 0.00 ? 68  LEU B HD12 5  
ATOM   10670 H HD13 . LEU B 1 68 ? -27.902 -10.502 -0.470  1.00 0.00 ? 68  LEU B HD13 5  
ATOM   10671 H HD21 . LEU B 1 68 ? -27.388 -12.728 -2.954  1.00 0.00 ? 68  LEU B HD21 5  
ATOM   10672 H HD22 . LEU B 1 68 ? -25.789 -12.760 -2.212  1.00 0.00 ? 68  LEU B HD22 5  
ATOM   10673 H HD23 . LEU B 1 68 ? -27.225 -12.647 -1.200  1.00 0.00 ? 68  LEU B HD23 5  
ATOM   10674 N N    . ASN B 1 69 ? -26.169 -9.328  -6.159  1.00 0.00 ? 69  ASN B N    5  
ATOM   10675 C CA   . ASN B 1 69 ? -26.263 -8.853  -7.570  1.00 0.00 ? 69  ASN B CA   5  
ATOM   10676 C C    . ASN B 1 69 ? -25.040 -7.996  -7.901  1.00 0.00 ? 69  ASN B C    5  
ATOM   10677 O O    . ASN B 1 69 ? -23.983 -8.566  -8.117  1.00 0.00 ? 69  ASN B O    5  
ATOM   10678 C CB   . ASN B 1 69 ? -27.532 -8.015  -7.740  1.00 0.00 ? 69  ASN B CB   5  
ATOM   10679 C CG   . ASN B 1 69 ? -27.597 -7.470  -9.168  1.00 0.00 ? 69  ASN B CG   5  
ATOM   10680 O OD1  . ASN B 1 69 ? -27.442 -6.285  -9.387  1.00 0.00 ? 69  ASN B OD1  5  
ATOM   10681 N ND2  . ASN B 1 69 ? -27.822 -8.291  -10.156 1.00 0.00 ? 69  ASN B ND2  5  
ATOM   10682 O OXT  . ASN B 1 69 ? -25.181 -6.785  -7.934  1.00 0.00 ? 69  ASN B OXT  5  
ATOM   10683 H H    . ASN B 1 69 ? -26.565 -8.797  -5.440  1.00 0.00 ? 69  ASN B H    5  
ATOM   10684 H HA   . ASN B 1 69 ? -26.301 -9.700  -8.238  1.00 0.00 ? 69  ASN B HA   5  
ATOM   10685 H HB2  . ASN B 1 69 ? -28.398 -8.630  -7.548  1.00 0.00 ? 69  ASN B HB2  5  
ATOM   10686 H HB3  . ASN B 1 69 ? -27.515 -7.190  -7.043  1.00 0.00 ? 69  ASN B HB3  5  
ATOM   10687 H HD21 . ASN B 1 69 ? -27.947 -9.248  -9.981  1.00 0.00 ? 69  ASN B HD21 5  
ATOM   10688 H HD22 . ASN B 1 69 ? -27.865 -7.953  -11.075 1.00 0.00 ? 69  ASN B HD22 5  
HETATM 10689 O O    . HOH C 2 .  ? 6.162   1.522   5.496   1.00 0.00 ? 201 HOH A O    5  
HETATM 10690 H H1   . HOH C 2 .  ? 5.515   2.177   5.233   1.00 0.00 ? 201 HOH A H1   5  
HETATM 10691 H H2   . HOH C 2 .  ? 6.793   2.008   6.030   1.00 0.00 ? 201 HOH A H2   5  
HETATM 10692 O O    . HOH C 2 .  ? 4.239   5.581   6.311   1.00 0.00 ? 202 HOH A O    5  
HETATM 10693 H H1   . HOH C 2 .  ? 3.493   6.133   6.079   1.00 0.00 ? 202 HOH A H1   5  
HETATM 10694 H H2   . HOH C 2 .  ? 4.999   6.039   5.951   1.00 0.00 ? 202 HOH A H2   5  
HETATM 10695 O O    . HOH D 2 .  ? -6.284  -1.388  5.498   1.00 0.00 ? 301 HOH B O    5  
HETATM 10696 H H1   . HOH D 2 .  ? -5.490  -1.341  6.030   1.00 0.00 ? 301 HOH B H1   5  
HETATM 10697 H H2   . HOH D 2 .  ? -6.910  -1.869  6.043   1.00 0.00 ? 301 HOH B H2   5  
HETATM 10698 O O    . HOH D 2 .  ? -4.364  -5.435  6.377   1.00 0.00 ? 302 HOH B O    5  
HETATM 10699 H H1   . HOH D 2 .  ? -3.519  -5.857  6.217   1.00 0.00 ? 302 HOH B H1   5  
HETATM 10700 H H2   . HOH D 2 .  ? -4.140  -4.593  6.773   1.00 0.00 ? 302 HOH B H2   5  
ATOM   10701 N N    . ALA A 1 1  ? -15.336 20.006  -8.758  1.00 0.00 ? 1   ALA A N    6  
ATOM   10702 C CA   . ALA A 1 1  ? -14.108 19.259  -9.153  1.00 0.00 ? 1   ALA A CA   6  
ATOM   10703 C C    . ALA A 1 1  ? -13.589 18.448  -7.956  1.00 0.00 ? 1   ALA A C    6  
ATOM   10704 O O    . ALA A 1 1  ? -12.534 18.747  -7.431  1.00 0.00 ? 1   ALA A O    6  
ATOM   10705 C CB   . ALA A 1 1  ? -13.031 20.254  -9.592  1.00 0.00 ? 1   ALA A CB   6  
ATOM   10706 H H1   . ALA A 1 1  ? -15.470 19.930  -7.729  1.00 0.00 ? 1   ALA A H1   6  
ATOM   10707 H H2   . ALA A 1 1  ? -15.233 21.007  -9.022  1.00 0.00 ? 1   ALA A H2   6  
ATOM   10708 H H3   . ALA A 1 1  ? -16.159 19.604  -9.247  1.00 0.00 ? 1   ALA A H3   6  
ATOM   10709 H HA   . ALA A 1 1  ? -14.335 18.596  -9.972  1.00 0.00 ? 1   ALA A HA   6  
ATOM   10710 H HB1  . ALA A 1 1  ? -13.453 20.949  -10.304 1.00 0.00 ? 1   ALA A HB1  6  
ATOM   10711 H HB2  . ALA A 1 1  ? -12.670 20.797  -8.731  1.00 0.00 ? 1   ALA A HB2  6  
ATOM   10712 H HB3  . ALA A 1 1  ? -12.212 19.720  -10.051 1.00 0.00 ? 1   ALA A HB3  6  
ATOM   10713 N N    . PRO A 1 2  ? -14.338 17.445  -7.549  1.00 0.00 ? 2   PRO A N    6  
ATOM   10714 C CA   . PRO A 1 2  ? -13.940 16.601  -6.406  1.00 0.00 ? 2   PRO A CA   6  
ATOM   10715 C C    . PRO A 1 2  ? -12.616 15.888  -6.724  1.00 0.00 ? 2   PRO A C    6  
ATOM   10716 O O    . PRO A 1 2  ? -12.459 15.287  -7.767  1.00 0.00 ? 2   PRO A O    6  
ATOM   10717 C CB   . PRO A 1 2  ? -15.101 15.593  -6.227  1.00 0.00 ? 2   PRO A CB   6  
ATOM   10718 C CG   . PRO A 1 2  ? -16.163 15.902  -7.324  1.00 0.00 ? 2   PRO A CG   6  
ATOM   10719 C CD   . PRO A 1 2  ? -15.625 17.073  -8.179  1.00 0.00 ? 2   PRO A CD   6  
ATOM   10720 H HA   . PRO A 1 2  ? -13.831 17.205  -5.518  1.00 0.00 ? 2   PRO A HA   6  
ATOM   10721 H HB2  . PRO A 1 2  ? -14.739 14.576  -6.336  1.00 0.00 ? 2   PRO A HB2  6  
ATOM   10722 H HB3  . PRO A 1 2  ? -15.547 15.713  -5.248  1.00 0.00 ? 2   PRO A HB3  6  
ATOM   10723 H HG2  . PRO A 1 2  ? -16.316 15.027  -7.946  1.00 0.00 ? 2   PRO A HG2  6  
ATOM   10724 H HG3  . PRO A 1 2  ? -17.100 16.188  -6.865  1.00 0.00 ? 2   PRO A HG3  6  
ATOM   10725 H HD2  . PRO A 1 2  ? -15.465 16.749  -9.199  1.00 0.00 ? 2   PRO A HD2  6  
ATOM   10726 H HD3  . PRO A 1 2  ? -16.306 17.909  -8.152  1.00 0.00 ? 2   PRO A HD3  6  
ATOM   10727 N N    . MET A 1 3  ? -11.667 15.953  -5.829  1.00 0.00 ? 3   MET A N    6  
ATOM   10728 C CA   . MET A 1 3  ? -10.361 15.282  -6.080  1.00 0.00 ? 3   MET A CA   6  
ATOM   10729 C C    . MET A 1 3  ? -10.497 13.784  -5.803  1.00 0.00 ? 3   MET A C    6  
ATOM   10730 O O    . MET A 1 3  ? -11.588 13.251  -5.737  1.00 0.00 ? 3   MET A O    6  
ATOM   10731 C CB   . MET A 1 3  ? -9.297  15.877  -5.155  1.00 0.00 ? 3   MET A CB   6  
ATOM   10732 C CG   . MET A 1 3  ? -9.061  17.342  -5.527  1.00 0.00 ? 3   MET A CG   6  
ATOM   10733 S SD   . MET A 1 3  ? -7.723  18.014  -4.511  1.00 0.00 ? 3   MET A SD   6  
ATOM   10734 C CE   . MET A 1 3  ? -7.867  19.733  -5.056  1.00 0.00 ? 3   MET A CE   6  
ATOM   10735 H H    . MET A 1 3  ? -11.815 16.442  -4.994  1.00 0.00 ? 3   MET A H    6  
ATOM   10736 H HA   . MET A 1 3  ? -10.071 15.433  -7.108  1.00 0.00 ? 3   MET A HA   6  
ATOM   10737 H HB2  . MET A 1 3  ? -9.634  15.814  -4.132  1.00 0.00 ? 3   MET A HB2  6  
ATOM   10738 H HB3  . MET A 1 3  ? -8.374  15.327  -5.267  1.00 0.00 ? 3   MET A HB3  6  
ATOM   10739 H HG2  . MET A 1 3  ? -8.791  17.411  -6.570  1.00 0.00 ? 3   MET A HG2  6  
ATOM   10740 H HG3  . MET A 1 3  ? -9.965  17.908  -5.351  1.00 0.00 ? 3   MET A HG3  6  
ATOM   10741 H HE1  . MET A 1 3  ? -7.831  19.775  -6.133  1.00 0.00 ? 3   MET A HE1  6  
ATOM   10742 H HE2  . MET A 1 3  ? -8.808  20.141  -4.714  1.00 0.00 ? 3   MET A HE2  6  
ATOM   10743 H HE3  . MET A 1 3  ? -7.048  20.310  -4.648  1.00 0.00 ? 3   MET A HE3  6  
ATOM   10744 N N    . GLY A 1 4  ? -9.399  13.097  -5.642  1.00 0.00 ? 4   GLY A N    6  
ATOM   10745 C CA   . GLY A 1 4  ? -9.471  11.634  -5.370  1.00 0.00 ? 4   GLY A CA   6  
ATOM   10746 C C    . GLY A 1 4  ? -10.288 11.386  -4.108  1.00 0.00 ? 4   GLY A C    6  
ATOM   10747 O O    . GLY A 1 4  ? -10.545 12.282  -3.330  1.00 0.00 ? 4   GLY A O    6  
ATOM   10748 H H    . GLY A 1 4  ? -8.528  13.543  -5.699  1.00 0.00 ? 4   GLY A H    6  
ATOM   10749 H HA2  . GLY A 1 4  ? -9.945  11.134  -6.204  1.00 0.00 ? 4   GLY A HA2  6  
ATOM   10750 H HA3  . GLY A 1 4  ? -8.477  11.239  -5.232  1.00 0.00 ? 4   GLY A HA3  6  
ATOM   10751 N N    . SER A 1 5  ? -10.703 10.169  -3.908  1.00 0.00 ? 5   SER A N    6  
ATOM   10752 C CA   . SER A 1 5  ? -11.514 9.834   -2.708  1.00 0.00 ? 5   SER A CA   6  
ATOM   10753 C C    . SER A 1 5  ? -10.584 9.457   -1.543  1.00 0.00 ? 5   SER A C    6  
ATOM   10754 O O    . SER A 1 5  ? -10.066 10.315  -0.855  1.00 0.00 ? 5   SER A O    6  
ATOM   10755 C CB   . SER A 1 5  ? -12.423 8.664   -3.064  1.00 0.00 ? 5   SER A CB   6  
ATOM   10756 O OG   . SER A 1 5  ? -11.711 7.780   -3.921  1.00 0.00 ? 5   SER A OG   6  
ATOM   10757 H H    . SER A 1 5  ? -10.484 9.469   -4.557  1.00 0.00 ? 5   SER A H    6  
ATOM   10758 H HA   . SER A 1 5  ? -12.120 10.684  -2.429  1.00 0.00 ? 5   SER A HA   6  
ATOM   10759 H HB2  . SER A 1 5  ? -12.717 8.146   -2.171  1.00 0.00 ? 5   SER A HB2  6  
ATOM   10760 H HB3  . SER A 1 5  ? -13.307 9.034   -3.569  1.00 0.00 ? 5   SER A HB3  6  
ATOM   10761 H HG   . SER A 1 5  ? -11.013 7.368   -3.407  1.00 0.00 ? 5   SER A HG   6  
ATOM   10762 N N    . ASP A 1 6  ? -10.358 8.184   -1.316  1.00 0.00 ? 6   ASP A N    6  
ATOM   10763 C CA   . ASP A 1 6  ? -9.451  7.776   -0.194  1.00 0.00 ? 6   ASP A CA   6  
ATOM   10764 C C    . ASP A 1 6  ? -8.910  6.360   -0.448  1.00 0.00 ? 6   ASP A C    6  
ATOM   10765 O O    . ASP A 1 6  ? -9.252  5.440   0.269   1.00 0.00 ? 6   ASP A O    6  
ATOM   10766 C CB   . ASP A 1 6  ? -10.228 7.791   1.135   1.00 0.00 ? 6   ASP A CB   6  
ATOM   10767 C CG   . ASP A 1 6  ? -9.242  7.855   2.306   1.00 0.00 ? 6   ASP A CG   6  
ATOM   10768 O OD1  . ASP A 1 6  ? -8.732  8.932   2.567   1.00 0.00 ? 6   ASP A OD1  6  
ATOM   10769 O OD2  . ASP A 1 6  ? -9.016  6.825   2.921   1.00 0.00 ? 6   ASP A OD2  6  
ATOM   10770 H H    . ASP A 1 6  ? -10.776 7.497   -1.883  1.00 0.00 ? 6   ASP A H    6  
ATOM   10771 H HA   . ASP A 1 6  ? -8.626  8.471   -0.133  1.00 0.00 ? 6   ASP A HA   6  
ATOM   10772 H HB2  . ASP A 1 6  ? -10.875 8.655   1.167   1.00 0.00 ? 6   ASP A HB2  6  
ATOM   10773 H HB3  . ASP A 1 6  ? -10.823 6.893   1.222   1.00 0.00 ? 6   ASP A HB3  6  
ATOM   10774 N N    . PRO A 1 7  ? -8.079  6.212   -1.459  1.00 0.00 ? 7   PRO A N    6  
ATOM   10775 C CA   . PRO A 1 7  ? -7.503  4.895   -1.790  1.00 0.00 ? 7   PRO A CA   6  
ATOM   10776 C C    . PRO A 1 7  ? -6.574  4.432   -0.647  1.00 0.00 ? 7   PRO A C    6  
ATOM   10777 O O    . PRO A 1 7  ? -6.228  5.219   0.212   1.00 0.00 ? 7   PRO A O    6  
ATOM   10778 C CB   . PRO A 1 7  ? -6.712  5.127   -3.101  1.00 0.00 ? 7   PRO A CB   6  
ATOM   10779 C CG   . PRO A 1 7  ? -6.785  6.650   -3.428  1.00 0.00 ? 7   PRO A CG   6  
ATOM   10780 C CD   . PRO A 1 7  ? -7.657  7.320   -2.343  1.00 0.00 ? 7   PRO A CD   6  
ATOM   10781 H HA   . PRO A 1 7  ? -8.294  4.183   -1.952  1.00 0.00 ? 7   PRO A HA   6  
ATOM   10782 H HB2  . PRO A 1 7  ? -5.678  4.822   -2.977  1.00 0.00 ? 7   PRO A HB2  6  
ATOM   10783 H HB3  . PRO A 1 7  ? -7.160  4.563   -3.907  1.00 0.00 ? 7   PRO A HB3  6  
ATOM   10784 H HG2  . PRO A 1 7  ? -5.788  7.076   -3.420  1.00 0.00 ? 7   PRO A HG2  6  
ATOM   10785 H HG3  . PRO A 1 7  ? -7.234  6.799   -4.401  1.00 0.00 ? 7   PRO A HG3  6  
ATOM   10786 H HD2  . PRO A 1 7  ? -7.076  8.045   -1.788  1.00 0.00 ? 7   PRO A HD2  6  
ATOM   10787 H HD3  . PRO A 1 7  ? -8.521  7.791   -2.787  1.00 0.00 ? 7   PRO A HD3  6  
ATOM   10788 N N    . PRO A 1 8  ? -6.188  3.171   -0.668  1.00 0.00 ? 8   PRO A N    6  
ATOM   10789 C CA   . PRO A 1 8  ? -5.292  2.617   0.369   1.00 0.00 ? 8   PRO A CA   6  
ATOM   10790 C C    . PRO A 1 8  ? -3.943  3.355   0.342   1.00 0.00 ? 8   PRO A C    6  
ATOM   10791 O O    . PRO A 1 8  ? -3.838  4.457   -0.156  1.00 0.00 ? 8   PRO A O    6  
ATOM   10792 C CB   . PRO A 1 8  ? -5.123  1.125   -0.010  1.00 0.00 ? 8   PRO A CB   6  
ATOM   10793 C CG   . PRO A 1 8  ? -5.825  0.913   -1.382  1.00 0.00 ? 8   PRO A CG   6  
ATOM   10794 C CD   . PRO A 1 8  ? -6.606  2.206   -1.707  1.00 0.00 ? 8   PRO A CD   6  
ATOM   10795 H HA   . PRO A 1 8  ? -5.747  2.705   1.344   1.00 0.00 ? 8   PRO A HA   6  
ATOM   10796 H HB2  . PRO A 1 8  ? -4.072  0.870   -0.085  1.00 0.00 ? 8   PRO A HB2  6  
ATOM   10797 H HB3  . PRO A 1 8  ? -5.594  0.499   0.736   1.00 0.00 ? 8   PRO A HB3  6  
ATOM   10798 H HG2  . PRO A 1 8  ? -5.082  0.725   -2.150  1.00 0.00 ? 8   PRO A HG2  6  
ATOM   10799 H HG3  . PRO A 1 8  ? -6.508  0.076   -1.327  1.00 0.00 ? 8   PRO A HG3  6  
ATOM   10800 H HD2  . PRO A 1 8  ? -6.347  2.572   -2.693  1.00 0.00 ? 8   PRO A HD2  6  
ATOM   10801 H HD3  . PRO A 1 8  ? -7.668  2.024   -1.639  1.00 0.00 ? 8   PRO A HD3  6  
ATOM   10802 N N    . THR A 1 9  ? -2.914  2.747   0.872   1.00 0.00 ? 9   THR A N    6  
ATOM   10803 C CA   . THR A 1 9  ? -1.573  3.403   0.876   1.00 0.00 ? 9   THR A CA   6  
ATOM   10804 C C    . THR A 1 9  ? -0.482  2.335   0.902   1.00 0.00 ? 9   THR A C    6  
ATOM   10805 O O    . THR A 1 9  ? -0.478  1.452   1.736   1.00 0.00 ? 9   THR A O    6  
ATOM   10806 C CB   . THR A 1 9  ? -1.439  4.288   2.115   1.00 0.00 ? 9   THR A CB   6  
ATOM   10807 O OG1  . THR A 1 9  ? -2.595  5.105   2.238   1.00 0.00 ? 9   THR A OG1  6  
ATOM   10808 C CG2  . THR A 1 9  ? -0.195  5.170   1.982   1.00 0.00 ? 9   THR A CG2  6  
ATOM   10809 H H    . THR A 1 9  ? -3.023  1.856   1.266   1.00 0.00 ? 9   THR A H    6  
ATOM   10810 H HA   . THR A 1 9  ? -1.458  4.006   -0.014  1.00 0.00 ? 9   THR A HA   6  
ATOM   10811 H HB   . THR A 1 9  ? -1.342  3.665   2.989   1.00 0.00 ? 9   THR A HB   6  
ATOM   10812 H HG1  . THR A 1 9  ? -2.545  5.564   3.080   1.00 0.00 ? 9   THR A HG1  6  
ATOM   10813 H HG21 . THR A 1 9  ? 0.669   4.550   1.795   1.00 0.00 ? 9   THR A HG21 6  
ATOM   10814 H HG22 . THR A 1 9  ? -0.327  5.858   1.159   1.00 0.00 ? 9   THR A HG22 6  
ATOM   10815 H HG23 . THR A 1 9  ? -0.049  5.727   2.896   1.00 0.00 ? 9   THR A HG23 6  
ATOM   10816 N N    . ALA A 1 10 ? 0.445   2.414   -0.010  1.00 0.00 ? 10  ALA A N    6  
ATOM   10817 C CA   . ALA A 1 10 ? 1.543   1.413   -0.051  1.00 0.00 ? 10  ALA A CA   6  
ATOM   10818 C C    . ALA A 1 10 ? 2.454   1.599   1.164   1.00 0.00 ? 10  ALA A C    6  
ATOM   10819 O O    . ALA A 1 10 ? 3.494   2.222   1.078   1.00 0.00 ? 10  ALA A O    6  
ATOM   10820 C CB   . ALA A 1 10 ? 2.352   1.616   -1.330  1.00 0.00 ? 10  ALA A CB   6  
ATOM   10821 H H    . ALA A 1 10 ? 0.418   3.138   -0.670  1.00 0.00 ? 10  ALA A H    6  
ATOM   10822 H HA   . ALA A 1 10 ? 1.127   0.416   -0.039  1.00 0.00 ? 10  ALA A HA   6  
ATOM   10823 H HB1  . ALA A 1 10 ? 1.678   1.730   -2.166  1.00 0.00 ? 10  ALA A HB1  6  
ATOM   10824 H HB2  . ALA A 1 10 ? 2.959   2.504   -1.233  1.00 0.00 ? 10  ALA A HB2  6  
ATOM   10825 H HB3  . ALA A 1 10 ? 2.988   0.760   -1.494  1.00 0.00 ? 10  ALA A HB3  6  
ATOM   10826 N N    . CYS A 1 11 ? 2.074   1.053   2.292   1.00 0.00 ? 11  CYS A N    6  
ATOM   10827 C CA   . CYS A 1 11 ? 2.913   1.179   3.526   1.00 0.00 ? 11  CYS A CA   6  
ATOM   10828 C C    . CYS A 1 11 ? 3.539   -0.181  3.836   1.00 0.00 ? 11  CYS A C    6  
ATOM   10829 O O    . CYS A 1 11 ? 2.885   -1.204  3.767   1.00 0.00 ? 11  CYS A O    6  
ATOM   10830 C CB   . CYS A 1 11 ? 2.031   1.616   4.699   1.00 0.00 ? 11  CYS A CB   6  
ATOM   10831 S SG   . CYS A 1 11 ? 1.178   3.156   4.274   1.00 0.00 ? 11  CYS A SG   6  
ATOM   10832 H H    . CYS A 1 11 ? 1.234   0.551   2.328   1.00 0.00 ? 11  CYS A H    6  
ATOM   10833 H HA   . CYS A 1 11 ? 3.698   1.909   3.375   1.00 0.00 ? 11  CYS A HA   6  
ATOM   10834 H HB2  . CYS A 1 11 ? 1.301   0.847   4.907   1.00 0.00 ? 11  CYS A HB2  6  
ATOM   10835 H HB3  . CYS A 1 11 ? 2.646   1.774   5.572   1.00 0.00 ? 11  CYS A HB3  6  
ATOM   10836 N N    . CYS A 1 12 ? 4.801   -0.206  4.163   1.00 0.00 ? 12  CYS A N    6  
ATOM   10837 C CA   . CYS A 1 12 ? 5.464   -1.506  4.465   1.00 0.00 ? 12  CYS A CA   6  
ATOM   10838 C C    . CYS A 1 12 ? 4.960   -2.041  5.806   1.00 0.00 ? 12  CYS A C    6  
ATOM   10839 O O    . CYS A 1 12 ? 4.775   -1.302  6.753   1.00 0.00 ? 12  CYS A O    6  
ATOM   10840 C CB   . CYS A 1 12 ? 6.980   -1.304  4.536   1.00 0.00 ? 12  CYS A CB   6  
ATOM   10841 S SG   . CYS A 1 12 ? 7.595   -0.768  2.921   1.00 0.00 ? 12  CYS A SG   6  
ATOM   10842 H H    . CYS A 1 12 ? 5.313   0.628   4.205   1.00 0.00 ? 12  CYS A H    6  
ATOM   10843 H HA   . CYS A 1 12 ? 5.233   -2.216  3.685   1.00 0.00 ? 12  CYS A HA   6  
ATOM   10844 H HB2  . CYS A 1 12 ? 7.209   -0.551  5.276   1.00 0.00 ? 12  CYS A HB2  6  
ATOM   10845 H HB3  . CYS A 1 12 ? 7.455   -2.233  4.812   1.00 0.00 ? 12  CYS A HB3  6  
ATOM   10846 N N    . PHE A 1 13 ? 4.745   -3.329  5.895   1.00 0.00 ? 13  PHE A N    6  
ATOM   10847 C CA   . PHE A 1 13 ? 4.261   -3.939  7.172   1.00 0.00 ? 13  PHE A CA   6  
ATOM   10848 C C    . PHE A 1 13 ? 5.444   -4.619  7.864   1.00 0.00 ? 13  PHE A C    6  
ATOM   10849 O O    . PHE A 1 13 ? 5.420   -4.892  9.048   1.00 0.00 ? 13  PHE A O    6  
ATOM   10850 C CB   . PHE A 1 13 ? 3.181   -4.981  6.858   1.00 0.00 ? 13  PHE A CB   6  
ATOM   10851 C CG   . PHE A 1 13 ? 3.807   -6.155  6.143   1.00 0.00 ? 13  PHE A CG   6  
ATOM   10852 C CD1  . PHE A 1 13 ? 4.101   -6.067  4.770   1.00 0.00 ? 13  PHE A CD1  6  
ATOM   10853 C CD2  . PHE A 1 13 ? 4.107   -7.333  6.854   1.00 0.00 ? 13  PHE A CD2  6  
ATOM   10854 C CE1  . PHE A 1 13 ? 4.692   -7.157  4.107   1.00 0.00 ? 13  PHE A CE1  6  
ATOM   10855 C CE2  . PHE A 1 13 ? 4.700   -8.423  6.191   1.00 0.00 ? 13  PHE A CE2  6  
ATOM   10856 C CZ   . PHE A 1 13 ? 4.993   -8.335  4.817   1.00 0.00 ? 13  PHE A CZ   6  
ATOM   10857 H H    . PHE A 1 13 ? 4.909   -3.902  5.117   1.00 0.00 ? 13  PHE A H    6  
ATOM   10858 H HA   . PHE A 1 13 ? 3.850   -3.176  7.818   1.00 0.00 ? 13  PHE A HA   6  
ATOM   10859 H HB2  . PHE A 1 13 ? 2.729   -5.318  7.779   1.00 0.00 ? 13  PHE A HB2  6  
ATOM   10860 H HB3  . PHE A 1 13 ? 2.425   -4.538  6.227   1.00 0.00 ? 13  PHE A HB3  6  
ATOM   10861 H HD1  . PHE A 1 13 ? 3.870   -5.162  4.225   1.00 0.00 ? 13  PHE A HD1  6  
ATOM   10862 H HD2  . PHE A 1 13 ? 3.881   -7.400  7.909   1.00 0.00 ? 13  PHE A HD2  6  
ATOM   10863 H HE1  . PHE A 1 13 ? 4.916   -7.089  3.052   1.00 0.00 ? 13  PHE A HE1  6  
ATOM   10864 H HE2  . PHE A 1 13 ? 4.930   -9.327  6.736   1.00 0.00 ? 13  PHE A HE2  6  
ATOM   10865 H HZ   . PHE A 1 13 ? 5.448   -9.172  4.307   1.00 0.00 ? 13  PHE A HZ   6  
ATOM   10866 N N    . SER A 1 14 ? 6.479   -4.895  7.120   1.00 0.00 ? 14  SER A N    6  
ATOM   10867 C CA   . SER A 1 14 ? 7.678   -5.557  7.700   1.00 0.00 ? 14  SER A CA   6  
ATOM   10868 C C    . SER A 1 14 ? 8.894   -5.221  6.835   1.00 0.00 ? 14  SER A C    6  
ATOM   10869 O O    . SER A 1 14 ? 8.935   -4.192  6.189   1.00 0.00 ? 14  SER A O    6  
ATOM   10870 C CB   . SER A 1 14 ? 7.468   -7.072  7.719   1.00 0.00 ? 14  SER A CB   6  
ATOM   10871 O OG   . SER A 1 14 ? 7.466   -7.562  6.385   1.00 0.00 ? 14  SER A OG   6  
ATOM   10872 H H    . SER A 1 14 ? 6.467   -4.663  6.168   1.00 0.00 ? 14  SER A H    6  
ATOM   10873 H HA   . SER A 1 14 ? 7.841   -5.201  8.708   1.00 0.00 ? 14  SER A HA   6  
ATOM   10874 H HB2  . SER A 1 14 ? 8.268   -7.542  8.268   1.00 0.00 ? 14  SER A HB2  6  
ATOM   10875 H HB3  . SER A 1 14 ? 6.525   -7.297  8.199   1.00 0.00 ? 14  SER A HB3  6  
ATOM   10876 H HG   . SER A 1 14 ? 6.817   -8.268  6.330   1.00 0.00 ? 14  SER A HG   6  
ATOM   10877 N N    . TYR A 1 15 ? 9.886   -6.069  6.815   1.00 0.00 ? 15  TYR A N    6  
ATOM   10878 C CA   . TYR A 1 15 ? 11.096  -5.777  5.987   1.00 0.00 ? 15  TYR A CA   6  
ATOM   10879 C C    . TYR A 1 15 ? 11.801  -7.083  5.625   1.00 0.00 ? 15  TYR A C    6  
ATOM   10880 O O    . TYR A 1 15 ? 11.603  -8.104  6.253   1.00 0.00 ? 15  TYR A O    6  
ATOM   10881 C CB   . TYR A 1 15 ? 12.059  -4.891  6.786   1.00 0.00 ? 15  TYR A CB   6  
ATOM   10882 C CG   . TYR A 1 15 ? 11.285  -3.817  7.513   1.00 0.00 ? 15  TYR A CG   6  
ATOM   10883 C CD1  . TYR A 1 15 ? 10.933  -2.628  6.847   1.00 0.00 ? 15  TYR A CD1  6  
ATOM   10884 C CD2  . TYR A 1 15 ? 10.917  -4.007  8.859   1.00 0.00 ? 15  TYR A CD2  6  
ATOM   10885 C CE1  . TYR A 1 15 ? 10.211  -1.629  7.528   1.00 0.00 ? 15  TYR A CE1  6  
ATOM   10886 C CE2  . TYR A 1 15 ? 10.195  -3.007  9.539   1.00 0.00 ? 15  TYR A CE2  6  
ATOM   10887 C CZ   . TYR A 1 15 ? 9.843   -1.818  8.873   1.00 0.00 ? 15  TYR A CZ   6  
ATOM   10888 O OH   . TYR A 1 15 ? 9.136   -0.839  9.540   1.00 0.00 ? 15  TYR A OH   6  
ATOM   10889 H H    . TYR A 1 15 ? 9.839   -6.893  7.343   1.00 0.00 ? 15  TYR A H    6  
ATOM   10890 H HA   . TYR A 1 15 ? 10.803  -5.270  5.077   1.00 0.00 ? 15  TYR A HA   6  
ATOM   10891 H HB2  . TYR A 1 15 ? 12.594  -5.493  7.506   1.00 0.00 ? 15  TYR A HB2  6  
ATOM   10892 H HB3  . TYR A 1 15 ? 12.761  -4.431  6.112   1.00 0.00 ? 15  TYR A HB3  6  
ATOM   10893 H HD1  . TYR A 1 15 ? 11.216  -2.483  5.816   1.00 0.00 ? 15  TYR A HD1  6  
ATOM   10894 H HD2  . TYR A 1 15 ? 11.188  -4.920  9.369   1.00 0.00 ? 15  TYR A HD2  6  
ATOM   10895 H HE1  . TYR A 1 15 ? 9.940   -0.717  7.017   1.00 0.00 ? 15  TYR A HE1  6  
ATOM   10896 H HE2  . TYR A 1 15 ? 9.913   -3.153  10.571  1.00 0.00 ? 15  TYR A HE2  6  
ATOM   10897 H HH   . TYR A 1 15 ? 9.150   -1.048  10.476  1.00 0.00 ? 15  TYR A HH   6  
ATOM   10898 N N    . THR A 1 16 ? 12.635  -7.054  4.622   1.00 0.00 ? 16  THR A N    6  
ATOM   10899 C CA   . THR A 1 16 ? 13.362  -8.295  4.235   1.00 0.00 ? 16  THR A CA   6  
ATOM   10900 C C    . THR A 1 16 ? 14.196  -8.763  5.430   1.00 0.00 ? 16  THR A C    6  
ATOM   10901 O O    . THR A 1 16 ? 13.960  -8.361  6.552   1.00 0.00 ? 16  THR A O    6  
ATOM   10902 C CB   . THR A 1 16 ? 14.260  -8.014  3.021   1.00 0.00 ? 16  THR A CB   6  
ATOM   10903 O OG1  . THR A 1 16 ? 15.059  -9.154  2.744   1.00 0.00 ? 16  THR A OG1  6  
ATOM   10904 C CG2  . THR A 1 16 ? 15.162  -6.812  3.301   1.00 0.00 ? 16  THR A CG2  6  
ATOM   10905 H H    . THR A 1 16 ? 12.794  -6.214  4.135   1.00 0.00 ? 16  THR A H    6  
ATOM   10906 H HA   . THR A 1 16 ? 12.645  -9.063  3.982   1.00 0.00 ? 16  THR A HA   6  
ATOM   10907 H HB   . THR A 1 16 ? 13.641  -7.797  2.164   1.00 0.00 ? 16  THR A HB   6  
ATOM   10908 H HG1  . THR A 1 16 ? 15.963  -8.951  2.993   1.00 0.00 ? 16  THR A HG1  6  
ATOM   10909 H HG21 . THR A 1 16 ? 14.554  -5.944  3.506   1.00 0.00 ? 16  THR A HG21 6  
ATOM   10910 H HG22 . THR A 1 16 ? 15.789  -7.024  4.154   1.00 0.00 ? 16  THR A HG22 6  
ATOM   10911 H HG23 . THR A 1 16 ? 15.783  -6.621  2.436   1.00 0.00 ? 16  THR A HG23 6  
ATOM   10912 N N    . ALA A 1 17 ? 15.168  -9.607  5.211   1.00 0.00 ? 17  ALA A N    6  
ATOM   10913 C CA   . ALA A 1 17 ? 16.010  -10.096 6.345   1.00 0.00 ? 17  ALA A CA   6  
ATOM   10914 C C    . ALA A 1 17 ? 17.448  -10.268 5.860   1.00 0.00 ? 17  ALA A C    6  
ATOM   10915 O O    . ALA A 1 17 ? 18.267  -10.883 6.513   1.00 0.00 ? 17  ALA A O    6  
ATOM   10916 C CB   . ALA A 1 17 ? 15.470  -11.442 6.833   1.00 0.00 ? 17  ALA A CB   6  
ATOM   10917 H H    . ALA A 1 17 ? 15.344  -9.925  4.304   1.00 0.00 ? 17  ALA A H    6  
ATOM   10918 H HA   . ALA A 1 17 ? 15.990  -9.382  7.157   1.00 0.00 ? 17  ALA A HA   6  
ATOM   10919 H HB1  . ALA A 1 17 ? 15.354  -12.109 5.991   1.00 0.00 ? 17  ALA A HB1  6  
ATOM   10920 H HB2  . ALA A 1 17 ? 16.161  -11.872 7.541   1.00 0.00 ? 17  ALA A HB2  6  
ATOM   10921 H HB3  . ALA A 1 17 ? 14.512  -11.293 7.309   1.00 0.00 ? 17  ALA A HB3  6  
ATOM   10922 N N    . ARG A 1 18 ? 17.757  -9.723  4.713   1.00 0.00 ? 18  ARG A N    6  
ATOM   10923 C CA   . ARG A 1 18 ? 19.140  -9.839  4.163   1.00 0.00 ? 18  ARG A CA   6  
ATOM   10924 C C    . ARG A 1 18 ? 19.531  -8.512  3.512   1.00 0.00 ? 18  ARG A C    6  
ATOM   10925 O O    . ARG A 1 18 ? 18.815  -7.983  2.684   1.00 0.00 ? 18  ARG A O    6  
ATOM   10926 C CB   . ARG A 1 18 ? 19.178  -10.942 3.099   1.00 0.00 ? 18  ARG A CB   6  
ATOM   10927 C CG   . ARG A 1 18 ? 18.924  -12.315 3.741   1.00 0.00 ? 18  ARG A CG   6  
ATOM   10928 C CD   . ARG A 1 18 ? 20.092  -12.710 4.656   1.00 0.00 ? 18  ARG A CD   6  
ATOM   10929 N NE   . ARG A 1 18 ? 20.148  -14.196 4.765   1.00 0.00 ? 18  ARG A NE   6  
ATOM   10930 C CZ   . ARG A 1 18 ? 21.216  -14.776 5.240   1.00 0.00 ? 18  ARG A CZ   6  
ATOM   10931 N NH1  . ARG A 1 18 ? 22.236  -14.056 5.617   1.00 0.00 ? 18  ARG A NH1  6  
ATOM   10932 N NH2  . ARG A 1 18 ? 21.263  -16.077 5.338   1.00 0.00 ? 18  ARG A NH2  6  
ATOM   10933 H H    . ARG A 1 18 ? 17.075  -9.232  4.210   1.00 0.00 ? 18  ARG A H    6  
ATOM   10934 H HA   . ARG A 1 18 ? 19.839  -10.071 4.954   1.00 0.00 ? 18  ARG A HA   6  
ATOM   10935 H HB2  . ARG A 1 18 ? 18.414  -10.748 2.360   1.00 0.00 ? 18  ARG A HB2  6  
ATOM   10936 H HB3  . ARG A 1 18 ? 20.143  -10.943 2.619   1.00 0.00 ? 18  ARG A HB3  6  
ATOM   10937 H HG2  . ARG A 1 18 ? 18.013  -12.278 4.317   1.00 0.00 ? 18  ARG A HG2  6  
ATOM   10938 H HG3  . ARG A 1 18 ? 18.819  -13.056 2.961   1.00 0.00 ? 18  ARG A HG3  6  
ATOM   10939 H HD2  . ARG A 1 18 ? 21.023  -12.347 4.245   1.00 0.00 ? 18  ARG A HD2  6  
ATOM   10940 H HD3  . ARG A 1 18 ? 19.943  -12.288 5.638   1.00 0.00 ? 18  ARG A HD3  6  
ATOM   10941 H HE   . ARG A 1 18 ? 19.382  -14.736 4.480   1.00 0.00 ? 18  ARG A HE   6  
ATOM   10942 H HH11 . ARG A 1 18 ? 22.200  -13.060 5.543   1.00 0.00 ? 18  ARG A HH11 6  
ATOM   10943 H HH12 . ARG A 1 18 ? 23.054  -14.500 5.982   1.00 0.00 ? 18  ARG A HH12 6  
ATOM   10944 H HH21 . ARG A 1 18 ? 20.480  -16.629 5.047   1.00 0.00 ? 18  ARG A HH21 6  
ATOM   10945 H HH22 . ARG A 1 18 ? 22.081  -16.521 5.701   1.00 0.00 ? 18  ARG A HH22 6  
ATOM   10946 N N    . LYS A 1 19 ? 20.665  -7.971  3.866   1.00 0.00 ? 19  LYS A N    6  
ATOM   10947 C CA   . LYS A 1 19 ? 21.093  -6.685  3.250   1.00 0.00 ? 19  LYS A CA   6  
ATOM   10948 C C    . LYS A 1 19 ? 21.278  -6.913  1.749   1.00 0.00 ? 19  LYS A C    6  
ATOM   10949 O O    . LYS A 1 19 ? 21.971  -7.818  1.329   1.00 0.00 ? 19  LYS A O    6  
ATOM   10950 C CB   . LYS A 1 19 ? 22.415  -6.228  3.898   1.00 0.00 ? 19  LYS A CB   6  
ATOM   10951 C CG   . LYS A 1 19 ? 22.985  -4.985  3.187   1.00 0.00 ? 19  LYS A CG   6  
ATOM   10952 C CD   . LYS A 1 19 ? 24.441  -4.761  3.612   1.00 0.00 ? 19  LYS A CD   6  
ATOM   10953 C CE   . LYS A 1 19 ? 24.562  -4.801  5.139   1.00 0.00 ? 19  LYS A CE   6  
ATOM   10954 N NZ   . LYS A 1 19 ? 24.588  -6.218  5.598   1.00 0.00 ? 19  LYS A NZ   6  
ATOM   10955 H H    . LYS A 1 19 ? 21.234  -8.413  4.530   1.00 0.00 ? 19  LYS A H    6  
ATOM   10956 H HA   . LYS A 1 19 ? 20.331  -5.936  3.412   1.00 0.00 ? 19  LYS A HA   6  
ATOM   10957 H HB2  . LYS A 1 19 ? 22.232  -5.987  4.935   1.00 0.00 ? 19  LYS A HB2  6  
ATOM   10958 H HB3  . LYS A 1 19 ? 23.131  -7.028  3.848   1.00 0.00 ? 19  LYS A HB3  6  
ATOM   10959 H HG2  . LYS A 1 19 ? 22.954  -5.119  2.118   1.00 0.00 ? 19  LYS A HG2  6  
ATOM   10960 H HG3  . LYS A 1 19 ? 22.402  -4.122  3.454   1.00 0.00 ? 19  LYS A HG3  6  
ATOM   10961 H HD2  . LYS A 1 19 ? 25.062  -5.534  3.184   1.00 0.00 ? 19  LYS A HD2  6  
ATOM   10962 H HD3  . LYS A 1 19 ? 24.773  -3.797  3.254   1.00 0.00 ? 19  LYS A HD3  6  
ATOM   10963 H HE2  . LYS A 1 19 ? 25.475  -4.309  5.438   1.00 0.00 ? 19  LYS A HE2  6  
ATOM   10964 H HE3  . LYS A 1 19 ? 23.720  -4.294  5.582   1.00 0.00 ? 19  LYS A HE3  6  
ATOM   10965 H HZ1  . LYS A 1 19 ? 24.757  -6.843  4.784   1.00 0.00 ? 19  LYS A HZ1  6  
ATOM   10966 H HZ2  . LYS A 1 19 ? 25.349  -6.343  6.295   1.00 0.00 ? 19  LYS A HZ2  6  
ATOM   10967 H HZ3  . LYS A 1 19 ? 23.677  -6.458  6.037   1.00 0.00 ? 19  LYS A HZ3  6  
ATOM   10968 N N    . LEU A 1 20 ? 20.661  -6.099  0.938   1.00 0.00 ? 20  LEU A N    6  
ATOM   10969 C CA   . LEU A 1 20 ? 20.801  -6.272  -0.534  1.00 0.00 ? 20  LEU A CA   6  
ATOM   10970 C C    . LEU A 1 20 ? 22.210  -5.813  -0.970  1.00 0.00 ? 20  LEU A C    6  
ATOM   10971 O O    . LEU A 1 20 ? 22.552  -4.670  -0.741  1.00 0.00 ? 20  LEU A O    6  
ATOM   10972 C CB   . LEU A 1 20 ? 19.771  -5.390  -1.246  1.00 0.00 ? 20  LEU A CB   6  
ATOM   10973 C CG   . LEU A 1 20 ? 18.389  -5.562  -0.612  1.00 0.00 ? 20  LEU A CG   6  
ATOM   10974 C CD1  . LEU A 1 20 ? 17.351  -4.861  -1.489  1.00 0.00 ? 20  LEU A CD1  6  
ATOM   10975 C CD2  . LEU A 1 20 ? 18.038  -7.050  -0.507  1.00 0.00 ? 20  LEU A CD2  6  
ATOM   10976 H H    . LEU A 1 20 ? 20.106  -5.376  1.296   1.00 0.00 ? 20  LEU A H    6  
ATOM   10977 H HA   . LEU A 1 20 ? 20.622  -7.298  -0.786  1.00 0.00 ? 20  LEU A HA   6  
ATOM   10978 H HB2  . LEU A 1 20 ? 20.070  -4.356  -1.164  1.00 0.00 ? 20  LEU A HB2  6  
ATOM   10979 H HB3  . LEU A 1 20 ? 19.723  -5.665  -2.287  1.00 0.00 ? 20  LEU A HB3  6  
ATOM   10980 H HG   . LEU A 1 20 ? 18.388  -5.117  0.373   1.00 0.00 ? 20  LEU A HG   6  
ATOM   10981 H HD11 . LEU A 1 20 ? 17.713  -3.880  -1.762  1.00 0.00 ? 20  LEU A HD11 6  
ATOM   10982 H HD12 . LEU A 1 20 ? 17.186  -5.444  -2.383  1.00 0.00 ? 20  LEU A HD12 6  
ATOM   10983 H HD13 . LEU A 1 20 ? 16.426  -4.766  -0.945  1.00 0.00 ? 20  LEU A HD13 6  
ATOM   10984 H HD21 . LEU A 1 20 ? 18.318  -7.552  -1.420  1.00 0.00 ? 20  LEU A HD21 6  
ATOM   10985 H HD22 . LEU A 1 20 ? 18.572  -7.487  0.324   1.00 0.00 ? 20  LEU A HD22 6  
ATOM   10986 H HD23 . LEU A 1 20 ? 16.975  -7.160  -0.347  1.00 0.00 ? 20  LEU A HD23 6  
ATOM   10987 N N    . PRO A 1 21 ? 23.002  -6.672  -1.596  1.00 0.00 ? 21  PRO A N    6  
ATOM   10988 C CA   . PRO A 1 21 ? 24.345  -6.258  -2.042  1.00 0.00 ? 21  PRO A CA   6  
ATOM   10989 C C    . PRO A 1 21 ? 24.231  -5.019  -2.933  1.00 0.00 ? 21  PRO A C    6  
ATOM   10990 O O    . PRO A 1 21 ? 23.290  -4.878  -3.686  1.00 0.00 ? 21  PRO A O    6  
ATOM   10991 C CB   . PRO A 1 21 ? 24.893  -7.464  -2.839  1.00 0.00 ? 21  PRO A CB   6  
ATOM   10992 C CG   . PRO A 1 21 ? 23.904  -8.645  -2.626  1.00 0.00 ? 21  PRO A CG   6  
ATOM   10993 C CD   . PRO A 1 21 ? 22.659  -8.080  -1.907  1.00 0.00 ? 21  PRO A CD   6  
ATOM   10994 H HA   . PRO A 1 21 ? 24.978  -6.054  -1.192  1.00 0.00 ? 21  PRO A HA   6  
ATOM   10995 H HB2  . PRO A 1 21 ? 24.953  -7.220  -3.895  1.00 0.00 ? 21  PRO A HB2  6  
ATOM   10996 H HB3  . PRO A 1 21 ? 25.871  -7.733  -2.479  1.00 0.00 ? 21  PRO A HB3  6  
ATOM   10997 H HG2  . PRO A 1 21 ? 23.622  -9.069  -3.582  1.00 0.00 ? 21  PRO A HG2  6  
ATOM   10998 H HG3  . PRO A 1 21 ? 24.364  -9.406  -2.011  1.00 0.00 ? 21  PRO A HG3  6  
ATOM   10999 H HD2  . PRO A 1 21 ? 21.798  -8.124  -2.563  1.00 0.00 ? 21  PRO A HD2  6  
ATOM   11000 H HD3  . PRO A 1 21 ? 22.469  -8.628  -0.995  1.00 0.00 ? 21  PRO A HD3  6  
ATOM   11001 N N    . ARG A 1 22 ? 25.183  -4.133  -2.871  1.00 0.00 ? 22  ARG A N    6  
ATOM   11002 C CA   . ARG A 1 22 ? 25.122  -2.926  -3.739  1.00 0.00 ? 22  ARG A CA   6  
ATOM   11003 C C    . ARG A 1 22 ? 24.861  -3.383  -5.177  1.00 0.00 ? 22  ARG A C    6  
ATOM   11004 O O    . ARG A 1 22 ? 24.184  -2.726  -5.941  1.00 0.00 ? 22  ARG A O    6  
ATOM   11005 C CB   . ARG A 1 22 ? 26.458  -2.168  -3.660  1.00 0.00 ? 22  ARG A CB   6  
ATOM   11006 C CG   . ARG A 1 22 ? 26.354  -0.782  -4.348  1.00 0.00 ? 22  ARG A CG   6  
ATOM   11007 C CD   . ARG A 1 22 ? 26.819  -0.865  -5.809  1.00 0.00 ? 22  ARG A CD   6  
ATOM   11008 N NE   . ARG A 1 22 ? 26.853  0.505   -6.393  1.00 0.00 ? 22  ARG A NE   6  
ATOM   11009 C CZ   . ARG A 1 22 ? 27.493  0.724   -7.509  1.00 0.00 ? 22  ARG A CZ   6  
ATOM   11010 N NH1  . ARG A 1 22 ? 28.103  -0.258  -8.113  1.00 0.00 ? 22  ARG A NH1  6  
ATOM   11011 N NH2  . ARG A 1 22 ? 27.523  1.924   -8.019  1.00 0.00 ? 22  ARG A NH2  6  
ATOM   11012 H H    . ARG A 1 22 ? 25.944  -4.268  -2.268  1.00 0.00 ? 22  ARG A H    6  
ATOM   11013 H HA   . ARG A 1 22 ? 24.315  -2.288  -3.410  1.00 0.00 ? 22  ARG A HA   6  
ATOM   11014 H HB2  . ARG A 1 22 ? 26.717  -2.032  -2.618  1.00 0.00 ? 22  ARG A HB2  6  
ATOM   11015 H HB3  . ARG A 1 22 ? 27.228  -2.757  -4.139  1.00 0.00 ? 22  ARG A HB3  6  
ATOM   11016 H HG2  . ARG A 1 22 ? 25.332  -0.432  -4.321  1.00 0.00 ? 22  ARG A HG2  6  
ATOM   11017 H HG3  . ARG A 1 22 ? 26.980  -0.076  -3.821  1.00 0.00 ? 22  ARG A HG3  6  
ATOM   11018 H HD2  . ARG A 1 22 ? 27.809  -1.296  -5.851  1.00 0.00 ? 22  ARG A HD2  6  
ATOM   11019 H HD3  . ARG A 1 22 ? 26.135  -1.477  -6.376  1.00 0.00 ? 22  ARG A HD3  6  
ATOM   11020 H HE   . ARG A 1 22 ? 26.395  1.244   -5.939  1.00 0.00 ? 22  ARG A HE   6  
ATOM   11021 H HH11 . ARG A 1 22 ? 28.081  -1.178  -7.723  1.00 0.00 ? 22  ARG A HH11 6  
ATOM   11022 H HH12 . ARG A 1 22 ? 28.594  -0.090  -8.969  1.00 0.00 ? 22  ARG A HH12 6  
ATOM   11023 H HH21 . ARG A 1 22 ? 27.056  2.677   -7.556  1.00 0.00 ? 22  ARG A HH21 6  
ATOM   11024 H HH22 . ARG A 1 22 ? 28.014  2.092   -8.875  1.00 0.00 ? 22  ARG A HH22 6  
ATOM   11025 N N    . ASN A 1 23 ? 25.396  -4.520  -5.539  1.00 0.00 ? 23  ASN A N    6  
ATOM   11026 C CA   . ASN A 1 23 ? 25.186  -5.045  -6.918  1.00 0.00 ? 23  ASN A CA   6  
ATOM   11027 C C    . ASN A 1 23 ? 23.753  -5.560  -7.055  1.00 0.00 ? 23  ASN A C    6  
ATOM   11028 O O    . ASN A 1 23 ? 23.437  -6.305  -7.962  1.00 0.00 ? 23  ASN A O    6  
ATOM   11029 C CB   . ASN A 1 23 ? 26.167  -6.189  -7.183  1.00 0.00 ? 23  ASN A CB   6  
ATOM   11030 C CG   . ASN A 1 23 ? 27.579  -5.748  -6.795  1.00 0.00 ? 23  ASN A CG   6  
ATOM   11031 O OD1  . ASN A 1 23 ? 28.518  -6.511  -6.904  1.00 0.00 ? 23  ASN A OD1  6  
ATOM   11032 N ND2  . ASN A 1 23 ? 27.769  -4.540  -6.344  1.00 0.00 ? 23  ASN A ND2  6  
ATOM   11033 H H    . ASN A 1 23 ? 25.932  -5.035  -4.896  1.00 0.00 ? 23  ASN A H    6  
ATOM   11034 H HA   . ASN A 1 23 ? 25.354  -4.253  -7.634  1.00 0.00 ? 23  ASN A HA   6  
ATOM   11035 H HB2  . ASN A 1 23 ? 25.883  -7.049  -6.594  1.00 0.00 ? 23  ASN A HB2  6  
ATOM   11036 H HB3  . ASN A 1 23 ? 26.147  -6.446  -8.231  1.00 0.00 ? 23  ASN A HB3  6  
ATOM   11037 H HD21 . ASN A 1 23 ? 27.011  -3.926  -6.256  1.00 0.00 ? 23  ASN A HD21 6  
ATOM   11038 H HD22 . ASN A 1 23 ? 28.669  -4.245  -6.092  1.00 0.00 ? 23  ASN A HD22 6  
ATOM   11039 N N    . PHE A 1 24 ? 22.882  -5.177  -6.156  1.00 0.00 ? 24  PHE A N    6  
ATOM   11040 C CA   . PHE A 1 24 ? 21.464  -5.654  -6.222  1.00 0.00 ? 24  PHE A CA   6  
ATOM   11041 C C    . PHE A 1 24 ? 20.533  -4.496  -5.850  1.00 0.00 ? 24  PHE A C    6  
ATOM   11042 O O    . PHE A 1 24 ? 19.443  -4.694  -5.351  1.00 0.00 ? 24  PHE A O    6  
ATOM   11043 C CB   . PHE A 1 24 ? 21.285  -6.817  -5.230  1.00 0.00 ? 24  PHE A CB   6  
ATOM   11044 C CG   . PHE A 1 24 ? 20.094  -7.671  -5.618  1.00 0.00 ? 24  PHE A CG   6  
ATOM   11045 C CD1  . PHE A 1 24 ? 20.076  -8.332  -6.863  1.00 0.00 ? 24  PHE A CD1  6  
ATOM   11046 C CD2  . PHE A 1 24 ? 19.007  -7.816  -4.731  1.00 0.00 ? 24  PHE A CD2  6  
ATOM   11047 C CE1  . PHE A 1 24 ? 18.976  -9.133  -7.221  1.00 0.00 ? 24  PHE A CE1  6  
ATOM   11048 C CE2  . PHE A 1 24 ? 17.906  -8.617  -5.092  1.00 0.00 ? 24  PHE A CE2  6  
ATOM   11049 C CZ   . PHE A 1 24 ? 17.892  -9.276  -6.335  1.00 0.00 ? 24  PHE A CZ   6  
ATOM   11050 H H    . PHE A 1 24 ? 23.164  -4.584  -5.430  1.00 0.00 ? 24  PHE A H    6  
ATOM   11051 H HA   . PHE A 1 24 ? 21.233  -5.984  -7.226  1.00 0.00 ? 24  PHE A HA   6  
ATOM   11052 H HB2  . PHE A 1 24 ? 22.175  -7.428  -5.236  1.00 0.00 ? 24  PHE A HB2  6  
ATOM   11053 H HB3  . PHE A 1 24 ? 21.134  -6.421  -4.235  1.00 0.00 ? 24  PHE A HB3  6  
ATOM   11054 H HD1  . PHE A 1 24 ? 20.908  -8.229  -7.546  1.00 0.00 ? 24  PHE A HD1  6  
ATOM   11055 H HD2  . PHE A 1 24 ? 19.018  -7.312  -3.778  1.00 0.00 ? 24  PHE A HD2  6  
ATOM   11056 H HE1  . PHE A 1 24 ? 18.965  -9.639  -8.175  1.00 0.00 ? 24  PHE A HE1  6  
ATOM   11057 H HE2  . PHE A 1 24 ? 17.075  -8.729  -4.412  1.00 0.00 ? 24  PHE A HE2  6  
ATOM   11058 H HZ   . PHE A 1 24 ? 17.047  -9.890  -6.610  1.00 0.00 ? 24  PHE A HZ   6  
ATOM   11059 N N    . VAL A 1 25 ? 20.960  -3.285  -6.098  1.00 0.00 ? 25  VAL A N    6  
ATOM   11060 C CA   . VAL A 1 25 ? 20.118  -2.096  -5.773  1.00 0.00 ? 25  VAL A CA   6  
ATOM   11061 C C    . VAL A 1 25 ? 20.433  -0.984  -6.774  1.00 0.00 ? 25  VAL A C    6  
ATOM   11062 O O    . VAL A 1 25 ? 21.294  -0.157  -6.548  1.00 0.00 ? 25  VAL A O    6  
ATOM   11063 C CB   . VAL A 1 25 ? 20.439  -1.608  -4.359  1.00 0.00 ? 25  VAL A CB   6  
ATOM   11064 C CG1  . VAL A 1 25 ? 19.495  -0.463  -3.984  1.00 0.00 ? 25  VAL A CG1  6  
ATOM   11065 C CG2  . VAL A 1 25 ? 20.254  -2.754  -3.363  1.00 0.00 ? 25  VAL A CG2  6  
ATOM   11066 H H    . VAL A 1 25 ? 21.842  -3.157  -6.505  1.00 0.00 ? 25  VAL A H    6  
ATOM   11067 H HA   . VAL A 1 25 ? 19.071  -2.356  -5.839  1.00 0.00 ? 25  VAL A HA   6  
ATOM   11068 H HB   . VAL A 1 25 ? 21.460  -1.258  -4.323  1.00 0.00 ? 25  VAL A HB   6  
ATOM   11069 H HG11 . VAL A 1 25 ? 19.615  0.348   -4.687  1.00 0.00 ? 25  VAL A HG11 6  
ATOM   11070 H HG12 . VAL A 1 25 ? 18.474  -0.814  -4.009  1.00 0.00 ? 25  VAL A HG12 6  
ATOM   11071 H HG13 . VAL A 1 25 ? 19.732  -0.114  -2.989  1.00 0.00 ? 25  VAL A HG13 6  
ATOM   11072 H HG21 . VAL A 1 25 ? 19.295  -3.221  -3.525  1.00 0.00 ? 25  VAL A HG21 6  
ATOM   11073 H HG22 . VAL A 1 25 ? 21.039  -3.482  -3.502  1.00 0.00 ? 25  VAL A HG22 6  
ATOM   11074 H HG23 . VAL A 1 25 ? 20.300  -2.364  -2.357  1.00 0.00 ? 25  VAL A HG23 6  
ATOM   11075 N N    . VAL A 1 26 ? 19.748  -0.961  -7.886  1.00 0.00 ? 26  VAL A N    6  
ATOM   11076 C CA   . VAL A 1 26 ? 20.013  0.090   -8.907  1.00 0.00 ? 26  VAL A CA   6  
ATOM   11077 C C    . VAL A 1 26 ? 19.242  1.357   -8.553  1.00 0.00 ? 26  VAL A C    6  
ATOM   11078 O O    . VAL A 1 26 ? 19.464  2.408   -9.121  1.00 0.00 ? 26  VAL A O    6  
ATOM   11079 C CB   . VAL A 1 26 ? 19.557  -0.416  -10.274 1.00 0.00 ? 26  VAL A CB   6  
ATOM   11080 C CG1  . VAL A 1 26 ? 20.506  -1.514  -10.753 1.00 0.00 ? 26  VAL A CG1  6  
ATOM   11081 C CG2  . VAL A 1 26 ? 18.139  -0.982  -10.161 1.00 0.00 ? 26  VAL A CG2  6  
ATOM   11082 H H    . VAL A 1 26 ? 19.061  -1.639  -8.053  1.00 0.00 ? 26  VAL A H    6  
ATOM   11083 H HA   . VAL A 1 26 ? 21.070  0.310   -8.938  1.00 0.00 ? 26  VAL A HA   6  
ATOM   11084 H HB   . VAL A 1 26 ? 19.565  0.400   -10.978 1.00 0.00 ? 26  VAL A HB   6  
ATOM   11085 H HG11 . VAL A 1 26 ? 20.690  -2.205  -9.944  1.00 0.00 ? 26  VAL A HG11 6  
ATOM   11086 H HG12 . VAL A 1 26 ? 20.058  -2.041  -11.583 1.00 0.00 ? 26  VAL A HG12 6  
ATOM   11087 H HG13 . VAL A 1 26 ? 21.439  -1.071  -11.068 1.00 0.00 ? 26  VAL A HG13 6  
ATOM   11088 H HG21 . VAL A 1 26 ? 17.515  -0.285  -9.622  1.00 0.00 ? 26  VAL A HG21 6  
ATOM   11089 H HG22 . VAL A 1 26 ? 17.733  -1.138  -11.149 1.00 0.00 ? 26  VAL A HG22 6  
ATOM   11090 H HG23 . VAL A 1 26 ? 18.168  -1.922  -9.632  1.00 0.00 ? 26  VAL A HG23 6  
ATOM   11091 N N    . ASP A 1 27 ? 18.338  1.272   -7.620  1.00 0.00 ? 27  ASP A N    6  
ATOM   11092 C CA   . ASP A 1 27 ? 17.560  2.480   -7.242  1.00 0.00 ? 27  ASP A CA   6  
ATOM   11093 C C    . ASP A 1 27 ? 16.756  2.185   -5.983  1.00 0.00 ? 27  ASP A C    6  
ATOM   11094 O O    . ASP A 1 27 ? 16.901  1.146   -5.370  1.00 0.00 ? 27  ASP A O    6  
ATOM   11095 C CB   . ASP A 1 27 ? 16.606  2.849   -8.380  1.00 0.00 ? 27  ASP A CB   6  
ATOM   11096 C CG   . ASP A 1 27 ? 16.055  4.258   -8.151  1.00 0.00 ? 27  ASP A CG   6  
ATOM   11097 O OD1  . ASP A 1 27 ? 16.831  5.122   -7.777  1.00 0.00 ? 27  ASP A OD1  6  
ATOM   11098 O OD2  . ASP A 1 27 ? 14.867  4.447   -8.353  1.00 0.00 ? 27  ASP A OD2  6  
ATOM   11099 H H    . ASP A 1 27 ? 18.167  0.414   -7.171  1.00 0.00 ? 27  ASP A H    6  
ATOM   11100 H HA   . ASP A 1 27 ? 18.236  3.303   -7.054  1.00 0.00 ? 27  ASP A HA   6  
ATOM   11101 H HB2  . ASP A 1 27 ? 17.138  2.818   -9.320  1.00 0.00 ? 27  ASP A HB2  6  
ATOM   11102 H HB3  . ASP A 1 27 ? 15.787  2.143   -8.408  1.00 0.00 ? 27  ASP A HB3  6  
ATOM   11103 N N    . TYR A 1 28 ? 15.904  3.089   -5.590  1.00 0.00 ? 28  TYR A N    6  
ATOM   11104 C CA   . TYR A 1 28 ? 15.090  2.852   -4.370  1.00 0.00 ? 28  TYR A CA   6  
ATOM   11105 C C    . TYR A 1 28 ? 13.818  3.691   -4.428  1.00 0.00 ? 28  TYR A C    6  
ATOM   11106 O O    . TYR A 1 28 ? 13.532  4.356   -5.403  1.00 0.00 ? 28  TYR A O    6  
ATOM   11107 C CB   . TYR A 1 28 ? 15.900  3.205   -3.117  1.00 0.00 ? 28  TYR A CB   6  
ATOM   11108 C CG   . TYR A 1 28 ? 16.027  4.709   -2.962  1.00 0.00 ? 28  TYR A CG   6  
ATOM   11109 C CD1  . TYR A 1 28 ? 16.707  5.467   -3.936  1.00 0.00 ? 28  TYR A CD1  6  
ATOM   11110 C CD2  . TYR A 1 28 ? 15.473  5.349   -1.835  1.00 0.00 ? 28  TYR A CD2  6  
ATOM   11111 C CE1  . TYR A 1 28 ? 16.832  6.860   -3.784  1.00 0.00 ? 28  TYR A CE1  6  
ATOM   11112 C CE2  . TYR A 1 28 ? 15.598  6.741   -1.681  1.00 0.00 ? 28  TYR A CE2  6  
ATOM   11113 C CZ   . TYR A 1 28 ? 16.277  7.498   -2.655  1.00 0.00 ? 28  TYR A CZ   6  
ATOM   11114 O OH   . TYR A 1 28 ? 16.401  8.865   -2.506  1.00 0.00 ? 28  TYR A OH   6  
ATOM   11115 H H    . TYR A 1 28 ? 15.799  3.920   -6.099  1.00 0.00 ? 28  TYR A H    6  
ATOM   11116 H HA   . TYR A 1 28 ? 14.814  1.807   -4.326  1.00 0.00 ? 28  TYR A HA   6  
ATOM   11117 H HB2  . TYR A 1 28 ? 15.405  2.795   -2.249  1.00 0.00 ? 28  TYR A HB2  6  
ATOM   11118 H HB3  . TYR A 1 28 ? 16.882  2.772   -3.199  1.00 0.00 ? 28  TYR A HB3  6  
ATOM   11119 H HD1  . TYR A 1 28 ? 17.131  4.981   -4.801  1.00 0.00 ? 28  TYR A HD1  6  
ATOM   11120 H HD2  . TYR A 1 28 ? 14.952  4.772   -1.089  1.00 0.00 ? 28  TYR A HD2  6  
ATOM   11121 H HE1  . TYR A 1 28 ? 17.356  7.438   -4.531  1.00 0.00 ? 28  TYR A HE1  6  
ATOM   11122 H HE2  . TYR A 1 28 ? 15.172  7.228   -0.813  1.00 0.00 ? 28  TYR A HE2  6  
ATOM   11123 H HH   . TYR A 1 28 ? 17.335  9.073   -2.439  1.00 0.00 ? 28  TYR A HH   6  
ATOM   11124 N N    . TYR A 1 29 ? 13.053  3.643   -3.386  1.00 0.00 ? 29  TYR A N    6  
ATOM   11125 C CA   . TYR A 1 29 ? 11.783  4.406   -3.343  1.00 0.00 ? 29  TYR A CA   6  
ATOM   11126 C C    . TYR A 1 29 ? 11.344  4.515   -1.880  1.00 0.00 ? 29  TYR A C    6  
ATOM   11127 O O    . TYR A 1 29 ? 11.532  3.602   -1.110  1.00 0.00 ? 29  TYR A O    6  
ATOM   11128 C CB   . TYR A 1 29 ? 10.739  3.645   -4.180  1.00 0.00 ? 29  TYR A CB   6  
ATOM   11129 C CG   . TYR A 1 29 ? 9.339   4.070   -3.804  1.00 0.00 ? 29  TYR A CG   6  
ATOM   11130 C CD1  . TYR A 1 29 ? 8.888   5.360   -4.131  1.00 0.00 ? 29  TYR A CD1  6  
ATOM   11131 C CD2  . TYR A 1 29 ? 8.489   3.175   -3.126  1.00 0.00 ? 29  TYR A CD2  6  
ATOM   11132 C CE1  . TYR A 1 29 ? 7.584   5.760   -3.780  1.00 0.00 ? 29  TYR A CE1  6  
ATOM   11133 C CE2  . TYR A 1 29 ? 7.185   3.573   -2.774  1.00 0.00 ? 29  TYR A CE2  6  
ATOM   11134 C CZ   . TYR A 1 29 ? 6.732   4.866   -3.101  1.00 0.00 ? 29  TYR A CZ   6  
ATOM   11135 O OH   . TYR A 1 29 ? 5.454   5.258   -2.756  1.00 0.00 ? 29  TYR A OH   6  
ATOM   11136 H H    . TYR A 1 29 ? 13.314  3.092   -2.621  1.00 0.00 ? 29  TYR A H    6  
ATOM   11137 H HA   . TYR A 1 29 ? 11.935  5.393   -3.755  1.00 0.00 ? 29  TYR A HA   6  
ATOM   11138 H HB2  . TYR A 1 29 ? 10.904  3.856   -5.226  1.00 0.00 ? 29  TYR A HB2  6  
ATOM   11139 H HB3  . TYR A 1 29 ? 10.852  2.585   -4.009  1.00 0.00 ? 29  TYR A HB3  6  
ATOM   11140 H HD1  . TYR A 1 29 ? 9.543   6.043   -4.654  1.00 0.00 ? 29  TYR A HD1  6  
ATOM   11141 H HD2  . TYR A 1 29 ? 8.838   2.181   -2.879  1.00 0.00 ? 29  TYR A HD2  6  
ATOM   11142 H HE1  . TYR A 1 29 ? 7.236   6.751   -4.030  1.00 0.00 ? 29  TYR A HE1  6  
ATOM   11143 H HE2  . TYR A 1 29 ? 6.532   2.886   -2.254  1.00 0.00 ? 29  TYR A HE2  6  
ATOM   11144 H HH   . TYR A 1 29 ? 5.210   6.000   -3.314  1.00 0.00 ? 29  TYR A HH   6  
ATOM   11145 N N    . GLU A 1 30 ? 10.766  5.617   -1.483  1.00 0.00 ? 30  GLU A N    6  
ATOM   11146 C CA   . GLU A 1 30 ? 10.321  5.759   -0.060  1.00 0.00 ? 30  GLU A CA   6  
ATOM   11147 C C    . GLU A 1 30 ? 8.821   5.461   0.028   1.00 0.00 ? 30  GLU A C    6  
ATOM   11148 O O    . GLU A 1 30 ? 8.097   5.582   -0.940  1.00 0.00 ? 30  GLU A O    6  
ATOM   11149 C CB   . GLU A 1 30 ? 10.590  7.184   0.422   1.00 0.00 ? 30  GLU A CB   6  
ATOM   11150 C CG   . GLU A 1 30 ? 12.093  7.463   0.381   1.00 0.00 ? 30  GLU A CG   6  
ATOM   11151 C CD   . GLU A 1 30 ? 12.538  7.657   -1.070  1.00 0.00 ? 30  GLU A CD   6  
ATOM   11152 O OE1  . GLU A 1 30 ? 12.444  8.773   -1.554  1.00 0.00 ? 30  GLU A OE1  6  
ATOM   11153 O OE2  . GLU A 1 30 ? 12.963  6.685   -1.673  1.00 0.00 ? 30  GLU A OE2  6  
ATOM   11154 H H    . GLU A 1 30 ? 10.620  6.350   -2.118  1.00 0.00 ? 30  GLU A H    6  
ATOM   11155 H HA   . GLU A 1 30 ? 10.863  5.063   0.570   1.00 0.00 ? 30  GLU A HA   6  
ATOM   11156 H HB2  . GLU A 1 30 ? 10.078  7.879   -0.219  1.00 0.00 ? 30  GLU A HB2  6  
ATOM   11157 H HB3  . GLU A 1 30 ? 10.233  7.296   1.435   1.00 0.00 ? 30  GLU A HB3  6  
ATOM   11158 H HG2  . GLU A 1 30 ? 12.308  8.359   0.947   1.00 0.00 ? 30  GLU A HG2  6  
ATOM   11159 H HG3  . GLU A 1 30 ? 12.627  6.629   0.810   1.00 0.00 ? 30  GLU A HG3  6  
ATOM   11160 N N    . THR A 1 31 ? 8.353   5.064   1.178   1.00 0.00 ? 31  THR A N    6  
ATOM   11161 C CA   . THR A 1 31 ? 6.901   4.745   1.329   1.00 0.00 ? 31  THR A CA   6  
ATOM   11162 C C    . THR A 1 31 ? 6.075   6.031   1.323   1.00 0.00 ? 31  THR A C    6  
ATOM   11163 O O    . THR A 1 31 ? 6.551   7.092   0.974   1.00 0.00 ? 31  THR A O    6  
ATOM   11164 C CB   . THR A 1 31 ? 6.684   4.017   2.656   1.00 0.00 ? 31  THR A CB   6  
ATOM   11165 O OG1  . THR A 1 31 ? 7.389   4.702   3.672   1.00 0.00 ? 31  THR A OG1  6  
ATOM   11166 C CG2  . THR A 1 31 ? 7.198   2.581   2.540   1.00 0.00 ? 31  THR A CG2  6  
ATOM   11167 H H    . THR A 1 31 ? 8.959   4.965   1.944   1.00 0.00 ? 31  THR A H    6  
ATOM   11168 H HA   . THR A 1 31 ? 6.584   4.110   0.515   1.00 0.00 ? 31  THR A HA   6  
ATOM   11169 H HB   . THR A 1 31 ? 5.634   4.002   2.905   1.00 0.00 ? 31  THR A HB   6  
ATOM   11170 H HG1  . THR A 1 31 ? 8.270   4.896   3.343   1.00 0.00 ? 31  THR A HG1  6  
ATOM   11171 H HG21 . THR A 1 31 ? 8.157   2.580   2.041   1.00 0.00 ? 31  THR A HG21 6  
ATOM   11172 H HG22 . THR A 1 31 ? 7.305   2.155   3.524   1.00 0.00 ? 31  THR A HG22 6  
ATOM   11173 H HG23 . THR A 1 31 ? 6.496   1.993   1.966   1.00 0.00 ? 31  THR A HG23 6  
ATOM   11174 N N    . SER A 1 32 ? 4.833   5.935   1.714   1.00 0.00 ? 32  SER A N    6  
ATOM   11175 C CA   . SER A 1 32 ? 3.956   7.136   1.742   1.00 0.00 ? 32  SER A CA   6  
ATOM   11176 C C    . SER A 1 32 ? 4.185   7.907   3.042   1.00 0.00 ? 32  SER A C    6  
ATOM   11177 O O    . SER A 1 32 ? 5.271   7.926   3.586   1.00 0.00 ? 32  SER A O    6  
ATOM   11178 C CB   . SER A 1 32 ? 2.495   6.693   1.669   1.00 0.00 ? 32  SER A CB   6  
ATOM   11179 O OG   . SER A 1 32 ? 2.312   5.869   0.525   1.00 0.00 ? 32  SER A OG   6  
ATOM   11180 H H    . SER A 1 32 ? 4.476   5.065   1.991   1.00 0.00 ? 32  SER A H    6  
ATOM   11181 H HA   . SER A 1 32 ? 4.180   7.773   0.902   1.00 0.00 ? 32  SER A HA   6  
ATOM   11182 H HB2  . SER A 1 32 ? 2.241   6.133   2.554   1.00 0.00 ? 32  SER A HB2  6  
ATOM   11183 H HB3  . SER A 1 32 ? 1.859   7.565   1.602   1.00 0.00 ? 32  SER A HB3  6  
ATOM   11184 H HG   . SER A 1 32 ? 3.179   5.626   0.193   1.00 0.00 ? 32  SER A HG   6  
ATOM   11185 N N    . SER A 1 33 ? 3.161   8.543   3.541   1.00 0.00 ? 33  SER A N    6  
ATOM   11186 C CA   . SER A 1 33 ? 3.288   9.324   4.809   1.00 0.00 ? 33  SER A CA   6  
ATOM   11187 C C    . SER A 1 33 ? 2.027   9.118   5.639   1.00 0.00 ? 33  SER A C    6  
ATOM   11188 O O    . SER A 1 33 ? 2.066   9.053   6.852   1.00 0.00 ? 33  SER A O    6  
ATOM   11189 C CB   . SER A 1 33 ? 3.423   10.804  4.472   1.00 0.00 ? 33  SER A CB   6  
ATOM   11190 O OG   . SER A 1 33 ? 2.135   11.346  4.216   1.00 0.00 ? 33  SER A OG   6  
ATOM   11191 H H    . SER A 1 33 ? 2.300   8.509   3.076   1.00 0.00 ? 33  SER A H    6  
ATOM   11192 H HA   . SER A 1 33 ? 4.153   8.994   5.369   1.00 0.00 ? 33  SER A HA   6  
ATOM   11193 H HB2  . SER A 1 33 ? 3.875   11.329  5.298   1.00 0.00 ? 33  SER A HB2  6  
ATOM   11194 H HB3  . SER A 1 33 ? 4.044   10.908  3.596   1.00 0.00 ? 33  SER A HB3  6  
ATOM   11195 H HG   . SER A 1 33 ? 2.036   12.141  4.747   1.00 0.00 ? 33  SER A HG   6  
ATOM   11196 N N    . LEU A 1 34 ? 0.905   9.022   4.977   1.00 0.00 ? 34  LEU A N    6  
ATOM   11197 C CA   . LEU A 1 34 ? -0.395  8.822   5.682   1.00 0.00 ? 34  LEU A CA   6  
ATOM   11198 C C    . LEU A 1 34 ? -0.223  7.846   6.848   1.00 0.00 ? 34  LEU A C    6  
ATOM   11199 O O    . LEU A 1 34 ? -0.521  8.158   7.983   1.00 0.00 ? 34  LEU A O    6  
ATOM   11200 C CB   . LEU A 1 34 ? -1.421  8.246   4.702   1.00 0.00 ? 34  LEU A CB   6  
ATOM   11201 C CG   . LEU A 1 34 ? -1.318  8.957   3.352   1.00 0.00 ? 34  LEU A CG   6  
ATOM   11202 C CD1  . LEU A 1 34 ? -2.471  8.504   2.451   1.00 0.00 ? 34  LEU A CD1  6  
ATOM   11203 C CD2  . LEU A 1 34 ? -1.393  10.473  3.561   1.00 0.00 ? 34  LEU A CD2  6  
ATOM   11204 H H    . LEU A 1 34 ? 0.921   9.088   4.003   1.00 0.00 ? 34  LEU A H    6  
ATOM   11205 H HA   . LEU A 1 34 ? -0.750  9.767   6.053   1.00 0.00 ? 34  LEU A HA   6  
ATOM   11206 H HB2  . LEU A 1 34 ? -1.235  7.190   4.562   1.00 0.00 ? 34  LEU A HB2  6  
ATOM   11207 H HB3  . LEU A 1 34 ? -2.409  8.384   5.101   1.00 0.00 ? 34  LEU A HB3  6  
ATOM   11208 H HG   . LEU A 1 34 ? -0.381  8.702   2.882   1.00 0.00 ? 34  LEU A HG   6  
ATOM   11209 H HD11 . LEU A 1 34 ? -2.621  7.439   2.562   1.00 0.00 ? 34  LEU A HD11 6  
ATOM   11210 H HD12 . LEU A 1 34 ? -3.375  9.025   2.729   1.00 0.00 ? 34  LEU A HD12 6  
ATOM   11211 H HD13 . LEU A 1 34 ? -2.230  8.725   1.423   1.00 0.00 ? 34  LEU A HD13 6  
ATOM   11212 H HD21 . LEU A 1 34 ? -2.197  10.704  4.245   1.00 0.00 ? 34  LEU A HD21 6  
ATOM   11213 H HD22 . LEU A 1 34 ? -0.459  10.826  3.972   1.00 0.00 ? 34  LEU A HD22 6  
ATOM   11214 H HD23 . LEU A 1 34 ? -1.576  10.960  2.614   1.00 0.00 ? 34  LEU A HD23 6  
ATOM   11215 N N    . CYS A 1 35 ? 0.253   6.668   6.569   1.00 0.00 ? 35  CYS A N    6  
ATOM   11216 C CA   . CYS A 1 35 ? 0.441   5.671   7.655   1.00 0.00 ? 35  CYS A CA   6  
ATOM   11217 C C    . CYS A 1 35 ? 1.592   6.123   8.560   1.00 0.00 ? 35  CYS A C    6  
ATOM   11218 O O    . CYS A 1 35 ? 2.656   6.477   8.101   1.00 0.00 ? 35  CYS A O    6  
ATOM   11219 C CB   . CYS A 1 35 ? 0.755   4.299   7.044   1.00 0.00 ? 35  CYS A CB   6  
ATOM   11220 S SG   . CYS A 1 35 ? 1.860   4.498   5.623   1.00 0.00 ? 35  CYS A SG   6  
ATOM   11221 H H    . CYS A 1 35 ? 0.482   6.441   5.643   1.00 0.00 ? 35  CYS A H    6  
ATOM   11222 H HA   . CYS A 1 35 ? -0.467  5.604   8.237   1.00 0.00 ? 35  CYS A HA   6  
ATOM   11223 H HB2  . CYS A 1 35 ? 1.232   3.675   7.783   1.00 0.00 ? 35  CYS A HB2  6  
ATOM   11224 H HB3  . CYS A 1 35 ? -0.164  3.833   6.720   1.00 0.00 ? 35  CYS A HB3  6  
ATOM   11225 N N    . SER A 1 36 ? 1.371   6.140   9.845   1.00 0.00 ? 36  SER A N    6  
ATOM   11226 C CA   . SER A 1 36 ? 2.434   6.586   10.793  1.00 0.00 ? 36  SER A CA   6  
ATOM   11227 C C    . SER A 1 36 ? 3.622   5.612   10.800  1.00 0.00 ? 36  SER A C    6  
ATOM   11228 O O    . SER A 1 36 ? 4.265   5.435   11.816  1.00 0.00 ? 36  SER A O    6  
ATOM   11229 C CB   . SER A 1 36 ? 1.846   6.669   12.201  1.00 0.00 ? 36  SER A CB   6  
ATOM   11230 O OG   . SER A 1 36 ? 1.209   5.437   12.517  1.00 0.00 ? 36  SER A OG   6  
ATOM   11231 H H    . SER A 1 36 ? 0.494   5.870   10.190  1.00 0.00 ? 36  SER A H    6  
ATOM   11232 H HA   . SER A 1 36 ? 2.781   7.565   10.500  1.00 0.00 ? 36  SER A HA   6  
ATOM   11233 H HB2  . SER A 1 36 ? 2.633   6.854   12.913  1.00 0.00 ? 36  SER A HB2  6  
ATOM   11234 H HB3  . SER A 1 36 ? 1.128   7.478   12.243  1.00 0.00 ? 36  SER A HB3  6  
ATOM   11235 H HG   . SER A 1 36 ? 1.006   5.441   13.456  1.00 0.00 ? 36  SER A HG   6  
ATOM   11236 N N    . GLN A 1 37 ? 3.936   4.969   9.700   1.00 0.00 ? 37  GLN A N    6  
ATOM   11237 C CA   . GLN A 1 37 ? 5.094   4.020   9.717   1.00 0.00 ? 37  GLN A CA   6  
ATOM   11238 C C    . GLN A 1 37 ? 5.710   3.872   8.316   1.00 0.00 ? 37  GLN A C    6  
ATOM   11239 O O    . GLN A 1 37 ? 5.667   2.800   7.748   1.00 0.00 ? 37  GLN A O    6  
ATOM   11240 C CB   . GLN A 1 37 ? 4.612   2.649   10.201  1.00 0.00 ? 37  GLN A CB   6  
ATOM   11241 C CG   . GLN A 1 37 ? 3.314   2.275   9.480   1.00 0.00 ? 37  GLN A CG   6  
ATOM   11242 C CD   . GLN A 1 37 ? 2.933   0.836   9.829   1.00 0.00 ? 37  GLN A CD   6  
ATOM   11243 O OE1  . GLN A 1 37 ? 2.283   0.592   10.826  1.00 0.00 ? 37  GLN A OE1  6  
ATOM   11244 N NE2  . GLN A 1 37 ? 3.314   -0.135  9.045   1.00 0.00 ? 37  GLN A NE2  6  
ATOM   11245 H H    . GLN A 1 37 ? 3.421   5.106   8.879   1.00 0.00 ? 37  GLN A H    6  
ATOM   11246 H HA   . GLN A 1 37 ? 5.853   4.384   10.396  1.00 0.00 ? 37  GLN A HA   6  
ATOM   11247 H HB2  . GLN A 1 37 ? 5.367   1.906   9.993   1.00 0.00 ? 37  GLN A HB2  6  
ATOM   11248 H HB3  . GLN A 1 37 ? 4.430   2.689   11.265  1.00 0.00 ? 37  GLN A HB3  6  
ATOM   11249 H HG2  . GLN A 1 37 ? 2.524   2.943   9.791   1.00 0.00 ? 37  GLN A HG2  6  
ATOM   11250 H HG3  . GLN A 1 37 ? 3.457   2.358   8.413   1.00 0.00 ? 37  GLN A HG3  6  
ATOM   11251 H HE21 . GLN A 1 37 ? 3.839   0.061   8.241   1.00 0.00 ? 37  GLN A HE21 6  
ATOM   11252 H HE22 . GLN A 1 37 ? 3.075   -1.061  9.260   1.00 0.00 ? 37  GLN A HE22 6  
ATOM   11253 N N    . PRO A 1 38 ? 6.287   4.937   7.802   1.00 0.00 ? 38  PRO A N    6  
ATOM   11254 C CA   . PRO A 1 38 ? 6.935   4.898   6.476   1.00 0.00 ? 38  PRO A CA   6  
ATOM   11255 C C    . PRO A 1 38 ? 8.191   4.016   6.554   1.00 0.00 ? 38  PRO A C    6  
ATOM   11256 O O    . PRO A 1 38 ? 8.505   3.451   7.583   1.00 0.00 ? 38  PRO A O    6  
ATOM   11257 C CB   . PRO A 1 38 ? 7.305   6.370   6.175   1.00 0.00 ? 38  PRO A CB   6  
ATOM   11258 C CG   . PRO A 1 38 ? 7.024   7.193   7.466   1.00 0.00 ? 38  PRO A CG   6  
ATOM   11259 C CD   . PRO A 1 38 ? 6.339   6.250   8.481   1.00 0.00 ? 38  PRO A CD   6  
ATOM   11260 H HA   . PRO A 1 38 ? 6.254   4.519   5.721   1.00 0.00 ? 38  PRO A HA   6  
ATOM   11261 H HB2  . PRO A 1 38 ? 8.352   6.450   5.903   1.00 0.00 ? 38  PRO A HB2  6  
ATOM   11262 H HB3  . PRO A 1 38 ? 6.693   6.746   5.367   1.00 0.00 ? 38  PRO A HB3  6  
ATOM   11263 H HG2  . PRO A 1 38 ? 7.956   7.566   7.876   1.00 0.00 ? 38  PRO A HG2  6  
ATOM   11264 H HG3  . PRO A 1 38 ? 6.370   8.026   7.241   1.00 0.00 ? 38  PRO A HG3  6  
ATOM   11265 H HD2  . PRO A 1 38 ? 6.923   6.183   9.390   1.00 0.00 ? 38  PRO A HD2  6  
ATOM   11266 H HD3  . PRO A 1 38 ? 5.339   6.593   8.701   1.00 0.00 ? 38  PRO A HD3  6  
ATOM   11267 N N    . ALA A 1 39 ? 8.903   3.905   5.473   1.00 0.00 ? 39  ALA A N    6  
ATOM   11268 C CA   . ALA A 1 39 ? 10.137  3.080   5.455   1.00 0.00 ? 39  ALA A CA   6  
ATOM   11269 C C    . ALA A 1 39 ? 10.835  3.312   4.120   1.00 0.00 ? 39  ALA A C    6  
ATOM   11270 O O    . ALA A 1 39 ? 10.292  3.945   3.237   1.00 0.00 ? 39  ALA A O    6  
ATOM   11271 C CB   . ALA A 1 39 ? 9.773   1.600   5.588   1.00 0.00 ? 39  ALA A CB   6  
ATOM   11272 H H    . ALA A 1 39 ? 8.633   4.375   4.667   1.00 0.00 ? 39  ALA A H    6  
ATOM   11273 H HA   . ALA A 1 39 ? 10.787  3.374   6.265   1.00 0.00 ? 39  ALA A HA   6  
ATOM   11274 H HB1  . ALA A 1 39 ? 9.213   1.447   6.499   1.00 0.00 ? 39  ALA A HB1  6  
ATOM   11275 H HB2  . ALA A 1 39 ? 9.172   1.298   4.743   1.00 0.00 ? 39  ALA A HB2  6  
ATOM   11276 H HB3  . ALA A 1 39 ? 10.676  1.008   5.617   1.00 0.00 ? 39  ALA A HB3  6  
ATOM   11277 N N    . VAL A 1 40 ? 12.016  2.785   3.944   1.00 0.00 ? 40  VAL A N    6  
ATOM   11278 C CA   . VAL A 1 40 ? 12.722  2.959   2.640   1.00 0.00 ? 40  VAL A CA   6  
ATOM   11279 C C    . VAL A 1 40 ? 12.497  1.689   1.822   1.00 0.00 ? 40  VAL A C    6  
ATOM   11280 O O    . VAL A 1 40 ? 12.432  0.600   2.356   1.00 0.00 ? 40  VAL A O    6  
ATOM   11281 C CB   . VAL A 1 40 ? 14.222  3.177   2.878   1.00 0.00 ? 40  VAL A CB   6  
ATOM   11282 C CG1  . VAL A 1 40 ? 14.990  2.966   1.569   1.00 0.00 ? 40  VAL A CG1  6  
ATOM   11283 C CG2  . VAL A 1 40 ? 14.449  4.609   3.363   1.00 0.00 ? 40  VAL A CG2  6  
ATOM   11284 H H    . VAL A 1 40 ? 12.430  2.257   4.660   1.00 0.00 ? 40  VAL A H    6  
ATOM   11285 H HA   . VAL A 1 40 ? 12.312  3.812   2.100   1.00 0.00 ? 40  VAL A HA   6  
ATOM   11286 H HB   . VAL A 1 40 ? 14.575  2.480   3.623   1.00 0.00 ? 40  VAL A HB   6  
ATOM   11287 H HG11 . VAL A 1 40 ? 14.463  3.453   0.764   1.00 0.00 ? 40  VAL A HG11 6  
ATOM   11288 H HG12 . VAL A 1 40 ? 15.981  3.386   1.658   1.00 0.00 ? 40  VAL A HG12 6  
ATOM   11289 H HG13 . VAL A 1 40 ? 15.063  1.910   1.363   1.00 0.00 ? 40  VAL A HG13 6  
ATOM   11290 H HG21 . VAL A 1 40 ? 13.884  4.777   4.265   1.00 0.00 ? 40  VAL A HG21 6  
ATOM   11291 H HG22 . VAL A 1 40 ? 15.500  4.759   3.559   1.00 0.00 ? 40  VAL A HG22 6  
ATOM   11292 H HG23 . VAL A 1 40 ? 14.124  5.301   2.599   1.00 0.00 ? 40  VAL A HG23 6  
ATOM   11293 N N    . VAL A 1 41 ? 12.358  1.832   0.534   1.00 0.00 ? 41  VAL A N    6  
ATOM   11294 C CA   . VAL A 1 41 ? 12.112  0.650   -0.353  1.00 0.00 ? 41  VAL A CA   6  
ATOM   11295 C C    . VAL A 1 41 ? 13.231  0.549   -1.395  1.00 0.00 ? 41  VAL A C    6  
ATOM   11296 O O    . VAL A 1 41 ? 13.413  1.430   -2.205  1.00 0.00 ? 41  VAL A O    6  
ATOM   11297 C CB   . VAL A 1 41 ? 10.756  0.838   -1.045  1.00 0.00 ? 41  VAL A CB   6  
ATOM   11298 C CG1  . VAL A 1 41 ? 10.233  -0.499  -1.563  1.00 0.00 ? 41  VAL A CG1  6  
ATOM   11299 C CG2  . VAL A 1 41 ? 9.752   1.405   -0.037  1.00 0.00 ? 41  VAL A CG2  6  
ATOM   11300 H H    . VAL A 1 41 ? 12.406  2.728   0.145   1.00 0.00 ? 41  VAL A H    6  
ATOM   11301 H HA   . VAL A 1 41 ? 12.090  -0.253  0.235   1.00 0.00 ? 41  VAL A HA   6  
ATOM   11302 H HB   . VAL A 1 41 ? 10.862  1.522   -1.872  1.00 0.00 ? 41  VAL A HB   6  
ATOM   11303 H HG11 . VAL A 1 41 ? 10.230  -1.224  -0.763  1.00 0.00 ? 41  VAL A HG11 6  
ATOM   11304 H HG12 . VAL A 1 41 ? 9.226   -0.362  -1.927  1.00 0.00 ? 41  VAL A HG12 6  
ATOM   11305 H HG13 . VAL A 1 41 ? 10.865  -0.847  -2.366  1.00 0.00 ? 41  VAL A HG13 6  
ATOM   11306 H HG21 . VAL A 1 41 ? 9.733   0.778   0.842   1.00 0.00 ? 41  VAL A HG21 6  
ATOM   11307 H HG22 . VAL A 1 41 ? 10.043  2.407   0.243   1.00 0.00 ? 41  VAL A HG22 6  
ATOM   11308 H HG23 . VAL A 1 41 ? 8.769   1.429   -0.482  1.00 0.00 ? 41  VAL A HG23 6  
ATOM   11309 N N    . PHE A 1 42 ? 13.996  -0.512  -1.377  1.00 0.00 ? 42  PHE A N    6  
ATOM   11310 C CA   . PHE A 1 42 ? 15.111  -0.645  -2.365  1.00 0.00 ? 42  PHE A CA   6  
ATOM   11311 C C    . PHE A 1 42 ? 14.624  -1.349  -3.634  1.00 0.00 ? 42  PHE A C    6  
ATOM   11312 O O    . PHE A 1 42 ? 13.923  -2.340  -3.584  1.00 0.00 ? 42  PHE A O    6  
ATOM   11313 C CB   . PHE A 1 42 ? 16.249  -1.472  -1.750  1.00 0.00 ? 42  PHE A CB   6  
ATOM   11314 C CG   . PHE A 1 42 ? 17.004  -0.642  -0.736  1.00 0.00 ? 42  PHE A CG   6  
ATOM   11315 C CD1  . PHE A 1 42 ? 17.719  0.500   -1.151  1.00 0.00 ? 42  PHE A CD1  6  
ATOM   11316 C CD2  . PHE A 1 42 ? 17.002  -1.015  0.623   1.00 0.00 ? 42  PHE A CD2  6  
ATOM   11317 C CE1  . PHE A 1 42 ? 18.428  1.267   -0.207  1.00 0.00 ? 42  PHE A CE1  6  
ATOM   11318 C CE2  . PHE A 1 42 ? 17.713  -0.248  1.564   1.00 0.00 ? 42  PHE A CE2  6  
ATOM   11319 C CZ   . PHE A 1 42 ? 18.426  0.894   1.149   1.00 0.00 ? 42  PHE A CZ   6  
ATOM   11320 H H    . PHE A 1 42 ? 13.844  -1.214  -0.711  1.00 0.00 ? 42  PHE A H    6  
ATOM   11321 H HA   . PHE A 1 42 ? 15.485  0.335   -2.624  1.00 0.00 ? 42  PHE A HA   6  
ATOM   11322 H HB2  . PHE A 1 42 ? 15.835  -2.345  -1.270  1.00 0.00 ? 42  PHE A HB2  6  
ATOM   11323 H HB3  . PHE A 1 42 ? 16.929  -1.783  -2.530  1.00 0.00 ? 42  PHE A HB3  6  
ATOM   11324 H HD1  . PHE A 1 42 ? 17.723  0.787   -2.192  1.00 0.00 ? 42  PHE A HD1  6  
ATOM   11325 H HD2  . PHE A 1 42 ? 16.454  -1.889  0.943   1.00 0.00 ? 42  PHE A HD2  6  
ATOM   11326 H HE1  . PHE A 1 42 ? 18.975  2.142   -0.526  1.00 0.00 ? 42  PHE A HE1  6  
ATOM   11327 H HE2  . PHE A 1 42 ? 17.711  -0.536  2.604   1.00 0.00 ? 42  PHE A HE2  6  
ATOM   11328 H HZ   . PHE A 1 42 ? 18.972  1.482   1.871   1.00 0.00 ? 42  PHE A HZ   6  
ATOM   11329 N N    . GLN A 1 43 ? 15.027  -0.853  -4.776  1.00 0.00 ? 43  GLN A N    6  
ATOM   11330 C CA   . GLN A 1 43 ? 14.636  -1.486  -6.070  1.00 0.00 ? 43  GLN A CA   6  
ATOM   11331 C C    . GLN A 1 43 ? 15.826  -2.330  -6.541  1.00 0.00 ? 43  GLN A C    6  
ATOM   11332 O O    . GLN A 1 43 ? 16.924  -1.819  -6.691  1.00 0.00 ? 43  GLN A O    6  
ATOM   11333 C CB   . GLN A 1 43 ? 14.326  -0.386  -7.088  1.00 0.00 ? 43  GLN A CB   6  
ATOM   11334 C CG   . GLN A 1 43 ? 13.083  0.386   -6.640  1.00 0.00 ? 43  GLN A CG   6  
ATOM   11335 C CD   . GLN A 1 43 ? 12.902  1.619   -7.527  1.00 0.00 ? 43  GLN A CD   6  
ATOM   11336 O OE1  . GLN A 1 43 ? 13.469  2.661   -7.263  1.00 0.00 ? 43  GLN A OE1  6  
ATOM   11337 N NE2  . GLN A 1 43 ? 12.129  1.546   -8.575  1.00 0.00 ? 43  GLN A NE2  6  
ATOM   11338 H H    . GLN A 1 43 ? 15.612  -0.066  -4.781  1.00 0.00 ? 43  GLN A H    6  
ATOM   11339 H HA   . GLN A 1 43 ? 13.772  -2.117  -5.931  1.00 0.00 ? 43  GLN A HA   6  
ATOM   11340 H HB2  . GLN A 1 43 ? 15.167  0.287   -7.152  1.00 0.00 ? 43  GLN A HB2  6  
ATOM   11341 H HB3  . GLN A 1 43 ? 14.142  -0.824  -8.052  1.00 0.00 ? 43  GLN A HB3  6  
ATOM   11342 H HG2  . GLN A 1 43 ? 12.214  -0.250  -6.724  1.00 0.00 ? 43  GLN A HG2  6  
ATOM   11343 H HG3  . GLN A 1 43 ? 13.203  0.698   -5.613  1.00 0.00 ? 43  GLN A HG3  6  
ATOM   11344 H HE21 . GLN A 1 43 ? 11.670  0.705   -8.788  1.00 0.00 ? 43  GLN A HE21 6  
ATOM   11345 H HE22 . GLN A 1 43 ? 12.004  2.330   -9.149  1.00 0.00 ? 43  GLN A HE22 6  
ATOM   11346 N N    . THR A 1 44 ? 15.647  -3.624  -6.726  1.00 0.00 ? 44  THR A N    6  
ATOM   11347 C CA   . THR A 1 44 ? 16.818  -4.483  -7.127  1.00 0.00 ? 44  THR A CA   6  
ATOM   11348 C C    . THR A 1 44 ? 16.851  -4.739  -8.633  1.00 0.00 ? 44  THR A C    6  
ATOM   11349 O O    . THR A 1 44 ? 16.229  -4.050  -9.417  1.00 0.00 ? 44  THR A O    6  
ATOM   11350 C CB   . THR A 1 44 ? 16.725  -5.828  -6.412  1.00 0.00 ? 44  THR A CB   6  
ATOM   11351 O OG1  . THR A 1 44 ? 15.837  -6.673  -7.126  1.00 0.00 ? 44  THR A OG1  6  
ATOM   11352 C CG2  . THR A 1 44 ? 16.200  -5.618  -4.989  1.00 0.00 ? 44  THR A CG2  6  
ATOM   11353 H H    . THR A 1 44 ? 14.757  -4.034  -6.569  1.00 0.00 ? 44  THR A H    6  
ATOM   11354 H HA   . THR A 1 44 ? 17.740  -4.000  -6.834  1.00 0.00 ? 44  THR A HA   6  
ATOM   11355 H HB   . THR A 1 44 ? 17.702  -6.285  -6.369  1.00 0.00 ? 44  THR A HB   6  
ATOM   11356 H HG1  . THR A 1 44 ? 15.262  -6.118  -7.656  1.00 0.00 ? 44  THR A HG1  6  
ATOM   11357 H HG21 . THR A 1 44 ? 16.672  -4.749  -4.553  1.00 0.00 ? 44  THR A HG21 6  
ATOM   11358 H HG22 . THR A 1 44 ? 15.130  -5.470  -5.020  1.00 0.00 ? 44  THR A HG22 6  
ATOM   11359 H HG23 . THR A 1 44 ? 16.426  -6.486  -4.389  1.00 0.00 ? 44  THR A HG23 6  
ATOM   11360 N N    . LYS A 1 45 ? 17.601  -5.741  -9.029  1.00 0.00 ? 45  LYS A N    6  
ATOM   11361 C CA   . LYS A 1 45 ? 17.731  -6.094  -10.475 1.00 0.00 ? 45  LYS A CA   6  
ATOM   11362 C C    . LYS A 1 45 ? 16.962  -7.389  -10.764 1.00 0.00 ? 45  LYS A C    6  
ATOM   11363 O O    . LYS A 1 45 ? 16.632  -7.678  -11.897 1.00 0.00 ? 45  LYS A O    6  
ATOM   11364 C CB   . LYS A 1 45 ? 19.212  -6.320  -10.814 1.00 0.00 ? 45  LYS A CB   6  
ATOM   11365 C CG   . LYS A 1 45 ? 20.076  -5.220  -10.192 1.00 0.00 ? 45  LYS A CG   6  
ATOM   11366 C CD   . LYS A 1 45 ? 21.551  -5.515  -10.487 1.00 0.00 ? 45  LYS A CD   6  
ATOM   11367 C CE   . LYS A 1 45 ? 22.417  -4.325  -10.065 1.00 0.00 ? 45  LYS A CE   6  
ATOM   11368 N NZ   . LYS A 1 45 ? 23.829  -4.775  -9.899  1.00 0.00 ? 45  LYS A NZ   6  
ATOM   11369 H H    . LYS A 1 45 ? 18.091  -6.266  -8.362  1.00 0.00 ? 45  LYS A H    6  
ATOM   11370 H HA   . LYS A 1 45 ? 17.339  -5.295  -11.089 1.00 0.00 ? 45  LYS A HA   6  
ATOM   11371 H HB2  . LYS A 1 45 ? 19.528  -7.279  -10.427 1.00 0.00 ? 45  LYS A HB2  6  
ATOM   11372 H HB3  . LYS A 1 45 ? 19.339  -6.308  -11.885 1.00 0.00 ? 45  LYS A HB3  6  
ATOM   11373 H HG2  . LYS A 1 45 ? 19.805  -4.266  -10.617 1.00 0.00 ? 45  LYS A HG2  6  
ATOM   11374 H HG3  . LYS A 1 45 ? 19.924  -5.198  -9.123  1.00 0.00 ? 45  LYS A HG3  6  
ATOM   11375 H HD2  . LYS A 1 45 ? 21.857  -6.394  -9.938  1.00 0.00 ? 45  LYS A HD2  6  
ATOM   11376 H HD3  . LYS A 1 45 ? 21.677  -5.691  -11.544 1.00 0.00 ? 45  LYS A HD3  6  
ATOM   11377 H HE2  . LYS A 1 45 ? 22.372  -3.560  -10.825 1.00 0.00 ? 45  LYS A HE2  6  
ATOM   11378 H HE3  . LYS A 1 45 ? 22.056  -3.924  -9.128  1.00 0.00 ? 45  LYS A HE3  6  
ATOM   11379 H HZ1  . LYS A 1 45 ? 23.847  -5.790  -9.678  1.00 0.00 ? 45  LYS A HZ1  6  
ATOM   11380 H HZ2  . LYS A 1 45 ? 24.353  -4.602  -10.782 1.00 0.00 ? 45  LYS A HZ2  6  
ATOM   11381 H HZ3  . LYS A 1 45 ? 24.273  -4.244  -9.123  1.00 0.00 ? 45  LYS A HZ3  6  
ATOM   11382 N N    . ARG A 1 46 ? 16.684  -8.178  -9.749  1.00 0.00 ? 46  ARG A N    6  
ATOM   11383 C CA   . ARG A 1 46 ? 15.949  -9.468  -9.967  1.00 0.00 ? 46  ARG A CA   6  
ATOM   11384 C C    . ARG A 1 46 ? 14.813  -9.568  -8.944  1.00 0.00 ? 46  ARG A C    6  
ATOM   11385 O O    . ARG A 1 46 ? 14.671  -10.543 -8.239  1.00 0.00 ? 46  ARG A O    6  
ATOM   11386 C CB   . ARG A 1 46 ? 16.930  -10.648 -9.795  1.00 0.00 ? 46  ARG A CB   6  
ATOM   11387 C CG   . ARG A 1 46 ? 16.419  -11.915 -10.522 1.00 0.00 ? 46  ARG A CG   6  
ATOM   11388 C CD   . ARG A 1 46 ? 15.358  -12.653 -9.689  1.00 0.00 ? 46  ARG A CD   6  
ATOM   11389 N NE   . ARG A 1 46 ? 15.342  -14.102 -10.073 1.00 0.00 ? 46  ARG A NE   6  
ATOM   11390 C CZ   . ARG A 1 46 ? 15.218  -14.477 -11.320 1.00 0.00 ? 46  ARG A CZ   6  
ATOM   11391 N NH1  . ARG A 1 46 ? 14.902  -13.614 -12.245 1.00 0.00 ? 46  ARG A NH1  6  
ATOM   11392 N NH2  . ARG A 1 46 ? 15.351  -15.738 -11.631 1.00 0.00 ? 46  ARG A NH2  6  
ATOM   11393 H H    . ARG A 1 46 ? 16.969  -7.928  -8.846  1.00 0.00 ? 46  ARG A H    6  
ATOM   11394 H HA   . ARG A 1 46 ? 15.526  -9.486  -10.962 1.00 0.00 ? 46  ARG A HA   6  
ATOM   11395 H HB2  . ARG A 1 46 ? 17.887  -10.367 -10.211 1.00 0.00 ? 46  ARG A HB2  6  
ATOM   11396 H HB3  . ARG A 1 46 ? 17.055  -10.859 -8.744  1.00 0.00 ? 46  ARG A HB3  6  
ATOM   11397 H HG2  . ARG A 1 46 ? 16.000  -11.635 -11.472 1.00 0.00 ? 46  ARG A HG2  6  
ATOM   11398 H HG3  . ARG A 1 46 ? 17.254  -12.578 -10.692 1.00 0.00 ? 46  ARG A HG3  6  
ATOM   11399 H HD2  . ARG A 1 46 ? 15.609  -12.603 -8.647  1.00 0.00 ? 46  ARG A HD2  6  
ATOM   11400 H HD3  . ARG A 1 46 ? 14.387  -12.192 -9.849  1.00 0.00 ? 46  ARG A HD3  6  
ATOM   11401 H HE   . ARG A 1 46 ? 15.481  -14.781 -9.381  1.00 0.00 ? 46  ARG A HE   6  
ATOM   11402 H HH11 . ARG A 1 46 ? 14.745  -12.659 -12.006 1.00 0.00 ? 46  ARG A HH11 6  
ATOM   11403 H HH12 . ARG A 1 46 ? 14.816  -13.911 -13.196 1.00 0.00 ? 46  ARG A HH12 6  
ATOM   11404 H HH21 . ARG A 1 46 ? 15.546  -16.411 -10.918 1.00 0.00 ? 46  ARG A HH21 6  
ATOM   11405 H HH22 . ARG A 1 46 ? 15.257  -16.030 -12.583 1.00 0.00 ? 46  ARG A HH22 6  
ATOM   11406 N N    . SER A 1 47 ? 13.999  -8.558  -8.868  1.00 0.00 ? 47  SER A N    6  
ATOM   11407 C CA   . SER A 1 47 ? 12.863  -8.579  -7.920  1.00 0.00 ? 47  SER A CA   6  
ATOM   11408 C C    . SER A 1 47 ? 11.948  -7.412  -8.270  1.00 0.00 ? 47  SER A C    6  
ATOM   11409 O O    . SER A 1 47 ? 11.470  -7.297  -9.380  1.00 0.00 ? 47  SER A O    6  
ATOM   11410 C CB   . SER A 1 47 ? 13.366  -8.458  -6.475  1.00 0.00 ? 47  SER A CB   6  
ATOM   11411 O OG   . SER A 1 47 ? 13.777  -7.125  -6.217  1.00 0.00 ? 47  SER A OG   6  
ATOM   11412 H H    . SER A 1 47 ? 14.127  -7.780  -9.445  1.00 0.00 ? 47  SER A H    6  
ATOM   11413 H HA   . SER A 1 47 ? 12.321  -9.499  -8.034  1.00 0.00 ? 47  SER A HA   6  
ATOM   11414 H HB2  . SER A 1 47 ? 12.571  -8.719  -5.794  1.00 0.00 ? 47  SER A HB2  6  
ATOM   11415 H HB3  . SER A 1 47 ? 14.195  -9.138  -6.325  1.00 0.00 ? 47  SER A HB3  6  
ATOM   11416 H HG   . SER A 1 47 ? 13.128  -6.721  -5.636  1.00 0.00 ? 47  SER A HG   6  
ATOM   11417 N N    . LYS A 1 48 ? 11.721  -6.542  -7.345  1.00 0.00 ? 48  LYS A N    6  
ATOM   11418 C CA   . LYS A 1 48 ? 10.859  -5.367  -7.610  1.00 0.00 ? 48  LYS A CA   6  
ATOM   11419 C C    . LYS A 1 48 ? 11.189  -4.311  -6.569  1.00 0.00 ? 48  LYS A C    6  
ATOM   11420 O O    . LYS A 1 48 ? 12.126  -3.549  -6.706  1.00 0.00 ? 48  LYS A O    6  
ATOM   11421 C CB   . LYS A 1 48 ? 9.380   -5.758  -7.484  1.00 0.00 ? 48  LYS A CB   6  
ATOM   11422 C CG   . LYS A 1 48 ? 8.965   -6.650  -8.660  1.00 0.00 ? 48  LYS A CG   6  
ATOM   11423 C CD   . LYS A 1 48 ? 7.437   -6.688  -8.760  1.00 0.00 ? 48  LYS A CD   6  
ATOM   11424 C CE   . LYS A 1 48 ? 7.025   -7.509  -9.984  1.00 0.00 ? 48  LYS A CE   6  
ATOM   11425 N NZ   . LYS A 1 48 ? 5.585   -7.270  -10.280 1.00 0.00 ? 48  LYS A NZ   6  
ATOM   11426 H H    . LYS A 1 48 ? 12.142  -6.648  -6.472  1.00 0.00 ? 48  LYS A H    6  
ATOM   11427 H HA   . LYS A 1 48 ? 11.058  -4.979  -8.599  1.00 0.00 ? 48  LYS A HA   6  
ATOM   11428 H HB2  . LYS A 1 48 ? 9.231   -6.292  -6.558  1.00 0.00 ? 48  LYS A HB2  6  
ATOM   11429 H HB3  . LYS A 1 48 ? 8.775   -4.863  -7.483  1.00 0.00 ? 48  LYS A HB3  6  
ATOM   11430 H HG2  . LYS A 1 48 ? 9.375   -6.256  -9.578  1.00 0.00 ? 48  LYS A HG2  6  
ATOM   11431 H HG3  . LYS A 1 48 ? 9.334   -7.651  -8.498  1.00 0.00 ? 48  LYS A HG3  6  
ATOM   11432 H HD2  . LYS A 1 48 ? 7.029   -7.141  -7.867  1.00 0.00 ? 48  LYS A HD2  6  
ATOM   11433 H HD3  . LYS A 1 48 ? 7.058   -5.682  -8.858  1.00 0.00 ? 48  LYS A HD3  6  
ATOM   11434 H HE2  . LYS A 1 48 ? 7.622   -7.211  -10.833 1.00 0.00 ? 48  LYS A HE2  6  
ATOM   11435 H HE3  . LYS A 1 48 ? 7.183   -8.558  -9.783  1.00 0.00 ? 48  LYS A HE3  6  
ATOM   11436 H HZ1  . LYS A 1 48 ? 5.053   -7.206  -9.389  1.00 0.00 ? 48  LYS