data_1HUW
# 
_entry.id   1HUW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HUW         
WWPDB D_1000174038 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HUW 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-22 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ultsch, M.H.'     1 
'Somers, W.S.'     2 
'Kossiakoff, A.A.' 3 
'De Vos, A.M.'     4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The crystal structure of affinity-matured human growth hormone at 2 A resolution.' J.Mol.Biol.       236 286 299 1994 
JMOBAK UK 0022-2836 0070 ? 8107110 10.1006/jmbi.1994.1135 
1       'Affinity Maturation of Human Growth Hormone by Monovalent Phage Display'           'To be Published' ?   ?   ?   ?    ? ? 
?         0353 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ultsch, M.H.'     1 
primary 'Somers, W.'       2 
primary 'Kossiakoff, A.A.' 3 
primary 'de Vos, A.M.'     4 
1       'Lowman, H.B.'     5 
1       'Wells, J.A.'      6 
# 
_cell.entry_id           1HUW 
_cell.length_a           80.450 
_cell.length_b           59.340 
_cell.length_c           50.870 
_cell.angle_alpha        90.00 
_cell.angle_beta         128.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1HUW 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HUMAN GROWTH HORMONE' 21986.627 1  ? ? ? ? 
2 water   nat water                  18.015    77 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FPTIPLSRLADNAWLRADRLNQLAFDTYQEFEEAYIPKEQIHSFWWNPQTSLCPSESIPTPSNKEETQQKSNLELLRISL
LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY
GLLYCFNKDMSKVSTYLRTVQCRSVEGSCGF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FPTIPLSRLADNAWLRADRLNQLAFDTYQEFEEAYIPKEQIHSFWWNPQTSLCPSESIPTPSNKEETQQKSNLELLRISL
LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY
GLLYCFNKDMSKVSTYLRTVQCRSVEGSCGF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   PRO n 
1 3   THR n 
1 4   ILE n 
1 5   PRO n 
1 6   LEU n 
1 7   SER n 
1 8   ARG n 
1 9   LEU n 
1 10  ALA n 
1 11  ASP n 
1 12  ASN n 
1 13  ALA n 
1 14  TRP n 
1 15  LEU n 
1 16  ARG n 
1 17  ALA n 
1 18  ASP n 
1 19  ARG n 
1 20  LEU n 
1 21  ASN n 
1 22  GLN n 
1 23  LEU n 
1 24  ALA n 
1 25  PHE n 
1 26  ASP n 
1 27  THR n 
1 28  TYR n 
1 29  GLN n 
1 30  GLU n 
1 31  PHE n 
1 32  GLU n 
1 33  GLU n 
1 34  ALA n 
1 35  TYR n 
1 36  ILE n 
1 37  PRO n 
1 38  LYS n 
1 39  GLU n 
1 40  GLN n 
1 41  ILE n 
1 42  HIS n 
1 43  SER n 
1 44  PHE n 
1 45  TRP n 
1 46  TRP n 
1 47  ASN n 
1 48  PRO n 
1 49  GLN n 
1 50  THR n 
1 51  SER n 
1 52  LEU n 
1 53  CYS n 
1 54  PRO n 
1 55  SER n 
1 56  GLU n 
1 57  SER n 
1 58  ILE n 
1 59  PRO n 
1 60  THR n 
1 61  PRO n 
1 62  SER n 
1 63  ASN n 
1 64  LYS n 
1 65  GLU n 
1 66  GLU n 
1 67  THR n 
1 68  GLN n 
1 69  GLN n 
1 70  LYS n 
1 71  SER n 
1 72  ASN n 
1 73  LEU n 
1 74  GLU n 
1 75  LEU n 
1 76  LEU n 
1 77  ARG n 
1 78  ILE n 
1 79  SER n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  ILE n 
1 84  GLN n 
1 85  SER n 
1 86  TRP n 
1 87  LEU n 
1 88  GLU n 
1 89  PRO n 
1 90  VAL n 
1 91  GLN n 
1 92  PHE n 
1 93  LEU n 
1 94  ARG n 
1 95  SER n 
1 96  VAL n 
1 97  PHE n 
1 98  ALA n 
1 99  ASN n 
1 100 SER n 
1 101 LEU n 
1 102 VAL n 
1 103 TYR n 
1 104 GLY n 
1 105 ALA n 
1 106 SER n 
1 107 ASP n 
1 108 SER n 
1 109 ASN n 
1 110 VAL n 
1 111 TYR n 
1 112 ASP n 
1 113 LEU n 
1 114 LEU n 
1 115 LYS n 
1 116 ASP n 
1 117 LEU n 
1 118 GLU n 
1 119 GLU n 
1 120 GLY n 
1 121 ILE n 
1 122 GLN n 
1 123 THR n 
1 124 LEU n 
1 125 MET n 
1 126 GLY n 
1 127 ARG n 
1 128 LEU n 
1 129 GLU n 
1 130 ASP n 
1 131 GLY n 
1 132 SER n 
1 133 PRO n 
1 134 ARG n 
1 135 THR n 
1 136 GLY n 
1 137 GLN n 
1 138 ILE n 
1 139 PHE n 
1 140 LYS n 
1 141 GLN n 
1 142 THR n 
1 143 TYR n 
1 144 SER n 
1 145 LYS n 
1 146 PHE n 
1 147 ASP n 
1 148 THR n 
1 149 ASN n 
1 150 SER n 
1 151 HIS n 
1 152 ASN n 
1 153 ASP n 
1 154 ASP n 
1 155 ALA n 
1 156 LEU n 
1 157 LEU n 
1 158 LYS n 
1 159 ASN n 
1 160 TYR n 
1 161 GLY n 
1 162 LEU n 
1 163 LEU n 
1 164 TYR n 
1 165 CYS n 
1 166 PHE n 
1 167 ASN n 
1 168 LYS n 
1 169 ASP n 
1 170 MET n 
1 171 SER n 
1 172 LYS n 
1 173 VAL n 
1 174 SER n 
1 175 THR n 
1 176 TYR n 
1 177 LEU n 
1 178 ARG n 
1 179 THR n 
1 180 VAL n 
1 181 GLN n 
1 182 CYS n 
1 183 ARG n 
1 184 SER n 
1 185 VAL n 
1 186 GLU n 
1 187 GLY n 
1 188 SER n 
1 189 CYS n 
1 190 GLY n 
1 191 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SOMA_HUMAN 
_struct_ref.pdbx_db_accession          P01241 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1HUW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 191 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01241 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  217 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       191 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1HUW ALA A 10  ? UNP P01241 PHE 36  ENGINEERED 10  1  
1 1HUW TRP A 14  ? UNP P01241 MET 40  ENGINEERED 14  2  
1 1HUW ASP A 18  ? UNP P01241 HIS 44  ENGINEERED 18  3  
1 1HUW ASN A 21  ? UNP P01241 HIS 47  ENGINEERED 21  4  
1 1HUW ILE A 41  ? UNP P01241 LYS 67  ENGINEERED 41  5  
1 1HUW HIS A 42  ? UNP P01241 TYR 68  ENGINEERED 42  6  
1 1HUW TRP A 45  ? UNP P01241 LEU 71  ENGINEERED 45  7  
1 1HUW TRP A 46  ? UNP P01241 GLN 72  ENGINEERED 46  8  
1 1HUW PRO A 54  ? UNP P01241 PHE 80  ENGINEERED 54  9  
1 1HUW LYS A 64  ? UNP P01241 ARG 90  ENGINEERED 64  10 
1 1HUW ASN A 167 ? UNP P01241 ARG 193 ENGINEERED 167 11 
1 1HUW SER A 171 ? UNP P01241 ASP 197 ENGINEERED 171 12 
1 1HUW SER A 174 ? UNP P01241 GLU 200 ENGINEERED 174 13 
1 1HUW TYR A 176 ? UNP P01241 PHE 202 ENGINEERED 176 14 
1 1HUW THR A 179 ? UNP P01241 ILE 205 ENGINEERED 179 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1HUW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1HUW 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1361 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               1438 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.63  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1HUW 
_struct.title                     'THE CRYSTAL STRUCTURE OF AFFINITY-MATURED HUMAN GROWTH HORMONE AT 2 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           
;HUMAN GROWTH HORMONE MUTANT WITH PHE 10 REPLACED BY ALA, MET 14 REPLACED BY TRP, HIS 18 REPLACED BY ASP, HIS 21 REPLACED BY ASN, LYS 41 REPLACED BY ILE, TYR 42 REPLACED BY HIS, LEU 45 REPLACED BY TRP, GLN 46 REPLACED BY TRP, PHE 54 REPLACED BY PRO, ARG 64 REPLACED BY LYS, ARG 167 REPLACED ASN, ASP 171 REPLACED BY SER, GLU 174 REPLACED BY SER, PHE 176 REPLACED BY TYR, ILE 179 REPLACED BY THR (F10A, M14W,H18D,H21N,K41I,Y42H,L45W,Q46W,F54P,R64K,R167N,D171S, E174S,F176Y,I179T)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HUW 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            HORMONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A LEU A 6   ? TYR A 35  ? LEU A 6   TYR A 35  1 ? 30 
HELX_P HELX_P2 B LYS A 38  ? TRP A 46  ? LYS A 38  TRP A 46  1 ? 9  
HELX_P HELX_P3 C LYS A 64  ? GLN A 69  ? LYS A 64  GLN A 69  1 ? 6  
HELX_P HELX_P4 D ASN A 72  ? PHE A 92  ? ASN A 72  PHE A 92  1 ? 21 
HELX_P HELX_P5 E ARG A 94  ? SER A 100 ? ARG A 94  SER A 100 1 ? 7  
HELX_P HELX_P6 F TYR A 111 ? LEU A 128 ? TYR A 111 LEU A 128 1 ? 18 
HELX_P HELX_P7 G ALA A 155 ? SER A 184 ? ALA A 155 SER A 184 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 53  SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 53  A CYS 165 1_555 ? ? ? ? ? ? ? 1.997 ? 
disulf2 disulf ? ? A CYS 182 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 182 A CYS 189 1_555 ? ? ? ? ? ? ? 2.016 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1HUW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HUW 
_atom_sites.fract_transf_matrix[1][1]   0.012430 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009782 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016852 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025015 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PHE A 1 1   ? -15.309 -7.827  -48.542 1.00 33.37  ? 1   PHE A N   1 
ATOM   2    C CA  . PHE A 1 1   ? -15.460 -9.231  -48.169 1.00 36.67  ? 1   PHE A CA  1 
ATOM   3    C C   . PHE A 1 1   ? -15.661 -9.465  -46.667 1.00 38.01  ? 1   PHE A C   1 
ATOM   4    O O   . PHE A 1 1   ? -14.993 -8.820  -45.844 1.00 38.40  ? 1   PHE A O   1 
ATOM   5    C CB  . PHE A 1 1   ? -14.235 -10.073 -48.617 1.00 32.77  ? 1   PHE A CB  1 
ATOM   6    C CG  . PHE A 1 1   ? -14.075 -10.165 -50.128 1.00 32.71  ? 1   PHE A CG  1 
ATOM   7    C CD1 . PHE A 1 1   ? -15.147 -10.519 -50.926 1.00 30.88  ? 1   PHE A CD1 1 
ATOM   8    C CD2 . PHE A 1 1   ? -12.870 -9.826  -50.701 1.00 32.69  ? 1   PHE A CD2 1 
ATOM   9    C CE1 . PHE A 1 1   ? -15.013 -10.523 -52.294 1.00 34.78  ? 1   PHE A CE1 1 
ATOM   10   C CE2 . PHE A 1 1   ? -12.745 -9.832  -52.072 1.00 33.27  ? 1   PHE A CE2 1 
ATOM   11   C CZ  . PHE A 1 1   ? -13.810 -10.176 -52.869 1.00 33.19  ? 1   PHE A CZ  1 
ATOM   12   N N   . PRO A 1 2   ? -16.574 -10.383 -46.268 1.00 38.94  ? 2   PRO A N   1 
ATOM   13   C CA  . PRO A 1 2   ? -16.856 -10.717 -44.881 1.00 39.11  ? 2   PRO A CA  1 
ATOM   14   C C   . PRO A 1 2   ? -15.661 -11.265 -44.135 1.00 38.69  ? 2   PRO A C   1 
ATOM   15   O O   . PRO A 1 2   ? -15.009 -12.233 -44.490 1.00 40.06  ? 2   PRO A O   1 
ATOM   16   C CB  . PRO A 1 2   ? -18.000 -11.670 -44.989 1.00 38.09  ? 2   PRO A CB  1 
ATOM   17   C CG  . PRO A 1 2   ? -17.815 -12.319 -46.325 1.00 38.93  ? 2   PRO A CG  1 
ATOM   18   C CD  . PRO A 1 2   ? -17.523 -11.074 -47.130 1.00 39.54  ? 2   PRO A CD  1 
ATOM   19   N N   . THR A 1 3   ? -15.390 -10.590 -43.047 1.00 40.39  ? 3   THR A N   1 
ATOM   20   C CA  . THR A 1 3   ? -14.239 -10.919 -42.247 1.00 44.89  ? 3   THR A CA  1 
ATOM   21   C C   . THR A 1 3   ? -14.478 -11.713 -40.932 1.00 41.76  ? 3   THR A C   1 
ATOM   22   O O   . THR A 1 3   ? -13.573 -11.824 -40.099 1.00 46.76  ? 3   THR A O   1 
ATOM   23   C CB  . THR A 1 3   ? -13.555 -9.520  -42.122 1.00 50.97  ? 3   THR A CB  1 
ATOM   24   O OG1 . THR A 1 3   ? -12.410 -9.711  -41.299 1.00 60.62  ? 3   THR A OG1 1 
ATOM   25   C CG2 . THR A 1 3   ? -14.475 -8.423  -41.571 1.00 56.60  ? 3   THR A CG2 1 
ATOM   26   N N   . ILE A 1 4   ? -15.654 -12.296 -40.639 1.00 34.05  ? 4   ILE A N   1 
ATOM   27   C CA  . ILE A 1 4   ? -15.785 -13.180 -39.482 1.00 27.32  ? 4   ILE A CA  1 
ATOM   28   C C   . ILE A 1 4   ? -16.099 -14.544 -40.061 1.00 21.01  ? 4   ILE A C   1 
ATOM   29   O O   . ILE A 1 4   ? -16.972 -14.678 -40.905 1.00 22.47  ? 4   ILE A O   1 
ATOM   30   C CB  . ILE A 1 4   ? -16.913 -12.704 -38.507 1.00 28.35  ? 4   ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 4   ? -16.389 -11.468 -37.821 1.00 27.27  ? 4   ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 4   ? -17.200 -13.675 -37.350 1.00 25.69  ? 4   ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 4   ? -17.594 -10.634 -37.416 1.00 28.19  ? 4   ILE A CD1 1 
ATOM   34   N N   . PRO A 1 5   ? -15.395 -15.613 -39.686 1.00 21.17  ? 5   PRO A N   1 
ATOM   35   C CA  . PRO A 1 5   ? -15.607 -16.941 -40.243 1.00 19.91  ? 5   PRO A CA  1 
ATOM   36   C C   . PRO A 1 5   ? -16.953 -17.465 -39.850 1.00 19.50  ? 5   PRO A C   1 
ATOM   37   O O   . PRO A 1 5   ? -17.475 -17.144 -38.775 1.00 18.01  ? 5   PRO A O   1 
ATOM   38   C CB  . PRO A 1 5   ? -14.452 -17.753 -39.708 1.00 19.46  ? 5   PRO A CB  1 
ATOM   39   C CG  . PRO A 1 5   ? -14.085 -17.077 -38.419 1.00 23.47  ? 5   PRO A CG  1 
ATOM   40   C CD  . PRO A 1 5   ? -14.296 -15.610 -38.712 1.00 18.05  ? 5   PRO A CD  1 
ATOM   41   N N   . LEU A 1 6   ? -17.507 -18.220 -40.782 1.00 19.02  ? 6   LEU A N   1 
ATOM   42   C CA  . LEU A 1 6   ? -18.793 -18.862 -40.560 1.00 20.93  ? 6   LEU A CA  1 
ATOM   43   C C   . LEU A 1 6   ? -18.885 -19.613 -39.224 1.00 17.99  ? 6   LEU A C   1 
ATOM   44   O O   . LEU A 1 6   ? -19.890 -19.437 -38.560 1.00 15.65  ? 6   LEU A O   1 
ATOM   45   C CB  . LEU A 1 6   ? -19.077 -19.838 -41.702 1.00 22.48  ? 6   LEU A CB  1 
ATOM   46   C CG  . LEU A 1 6   ? -20.490 -20.355 -41.857 1.00 25.95  ? 6   LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 6   ? -21.280 -19.445 -42.782 1.00 29.34  ? 6   LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 6   ? -20.455 -21.731 -42.474 1.00 33.09  ? 6   LEU A CD2 1 
ATOM   49   N N   . SER A 1 7   ? -17.891 -20.360 -38.738 1.00 15.43  ? 7   SER A N   1 
ATOM   50   C CA  . SER A 1 7   ? -18.031 -21.097 -37.505 1.00 17.88  ? 7   SER A CA  1 
ATOM   51   C C   . SER A 1 7   ? -18.196 -20.250 -36.251 1.00 19.01  ? 7   SER A C   1 
ATOM   52   O O   . SER A 1 7   ? -18.849 -20.657 -35.275 1.00 16.23  ? 7   SER A O   1 
ATOM   53   C CB  . SER A 1 7   ? -16.840 -22.006 -37.301 1.00 13.30  ? 7   SER A CB  1 
ATOM   54   O OG  . SER A 1 7   ? -15.661 -21.248 -37.260 1.00 22.09  ? 7   SER A OG  1 
ATOM   55   N N   . ARG A 1 8   ? -17.564 -19.065 -36.282 1.00 19.49  ? 8   ARG A N   1 
ATOM   56   C CA  . ARG A 1 8   ? -17.691 -18.122 -35.188 1.00 18.57  ? 8   ARG A CA  1 
ATOM   57   C C   . ARG A 1 8   ? -19.081 -17.523 -35.197 1.00 15.92  ? 8   ARG A C   1 
ATOM   58   O O   . ARG A 1 8   ? -19.646 -17.338 -34.140 1.00 15.96  ? 8   ARG A O   1 
ATOM   59   C CB  . ARG A 1 8   ? -16.675 -16.986 -35.294 1.00 19.02  ? 8   ARG A CB  1 
ATOM   60   C CG  . ARG A 1 8   ? -16.779 -15.913 -34.169 1.00 18.13  ? 8   ARG A CG  1 
ATOM   61   C CD  . ARG A 1 8   ? -16.673 -16.508 -32.751 1.00 17.06  ? 8   ARG A CD  1 
ATOM   62   N NE  . ARG A 1 8   ? -15.426 -17.213 -32.644 1.00 22.61  ? 8   ARG A NE  1 
ATOM   63   C CZ  . ARG A 1 8   ? -15.137 -18.102 -31.706 1.00 25.39  ? 8   ARG A CZ  1 
ATOM   64   N NH1 . ARG A 1 8   ? -16.029 -18.411 -30.791 1.00 25.40  ? 8   ARG A NH1 1 
ATOM   65   N NH2 . ARG A 1 8   ? -13.908 -18.631 -31.671 1.00 30.03  ? 8   ARG A NH2 1 
ATOM   66   N N   . LEU A 1 9   ? -19.607 -17.179 -36.368 1.00 17.43  ? 9   LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? -20.937 -16.681 -36.488 1.00 17.83  ? 9   LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? -21.926 -17.743 -35.979 1.00 18.68  ? 9   LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? -22.909 -17.370 -35.344 1.00 17.16  ? 9   LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? -21.274 -16.359 -37.953 1.00 17.56  ? 9   LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? -20.695 -15.226 -38.777 1.00 20.42  ? 9   LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? -21.376 -15.247 -40.118 1.00 16.76  ? 9   LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? -20.998 -13.870 -38.155 1.00 19.90  ? 9   LEU A CD2 1 
ATOM   74   N N   . ALA A 1 10  ? -21.769 -19.048 -36.272 1.00 15.66  ? 10  ALA A N   1 
ATOM   75   C CA  . ALA A 1 10  ? -22.703 -20.073 -35.795 1.00 16.58  ? 10  ALA A CA  1 
ATOM   76   C C   . ALA A 1 10  ? -22.571 -20.265 -34.278 1.00 14.03  ? 10  ALA A C   1 
ATOM   77   O O   . ALA A 1 10  ? -23.530 -20.521 -33.576 1.00 15.42  ? 10  ALA A O   1 
ATOM   78   C CB  . ALA A 1 10  ? -22.416 -21.426 -36.447 1.00 16.09  ? 10  ALA A CB  1 
ATOM   79   N N   . ASP A 1 11  ? -21.376 -20.118 -33.744 1.00 12.78  ? 11  ASP A N   1 
ATOM   80   C CA  . ASP A 1 11  ? -21.117 -20.238 -32.339 1.00 14.22  ? 11  ASP A CA  1 
ATOM   81   C C   . ASP A 1 11  ? -21.743 -19.143 -31.543 1.00 13.86  ? 11  ASP A C   1 
ATOM   82   O O   . ASP A 1 11  ? -22.321 -19.398 -30.512 1.00 14.57  ? 11  ASP A O   1 
ATOM   83   C CB  . ASP A 1 11  ? -19.685 -20.168 -32.109 1.00 20.90  ? 11  ASP A CB  1 
ATOM   84   C CG  . ASP A 1 11  ? -19.311 -21.280 -31.196 1.00 37.56  ? 11  ASP A CG  1 
ATOM   85   O OD1 . ASP A 1 11  ? -19.687 -21.230 -30.004 1.00 43.44  ? 11  ASP A OD1 1 
ATOM   86   O OD2 . ASP A 1 11  ? -18.660 -22.193 -31.730 1.00 42.73  ? 11  ASP A OD2 1 
ATOM   87   N N   . ASN A 1 12  ? -21.579 -17.922 -32.038 1.00 14.43  ? 12  ASN A N   1 
ATOM   88   C CA  . ASN A 1 12  ? -22.085 -16.747 -31.391 1.00 15.71  ? 12  ASN A CA  1 
ATOM   89   C C   . ASN A 1 12  ? -23.579 -16.679 -31.402 1.00 14.17  ? 12  ASN A C   1 
ATOM   90   O O   . ASN A 1 12  ? -24.120 -16.184 -30.414 1.00 13.76  ? 12  ASN A O   1 
ATOM   91   C CB  . ASN A 1 12  ? -21.545 -15.508 -32.048 1.00 12.17  ? 12  ASN A CB  1 
ATOM   92   C CG  . ASN A 1 12  ? -20.163 -15.193 -31.569 1.00 14.65  ? 12  ASN A CG  1 
ATOM   93   O OD1 . ASN A 1 12  ? -19.645 -15.816 -30.648 1.00 15.52  ? 12  ASN A OD1 1 
ATOM   94   N ND2 . ASN A 1 12  ? -19.507 -14.181 -32.128 1.00 16.47  ? 12  ASN A ND2 1 
ATOM   95   N N   . ALA A 1 13  ? -24.165 -17.166 -32.505 1.00 12.87  ? 13  ALA A N   1 
ATOM   96   C CA  . ALA A 1 13  ? -25.600 -17.248 -32.664 1.00 13.73  ? 13  ALA A CA  1 
ATOM   97   C C   . ALA A 1 13  ? -26.120 -18.283 -31.691 1.00 16.78  ? 13  ALA A C   1 
ATOM   98   O O   . ALA A 1 13  ? -27.095 -17.983 -31.014 1.00 18.46  ? 13  ALA A O   1 
ATOM   99   C CB  . ALA A 1 13  ? -26.014 -17.694 -34.053 1.00 13.89  ? 13  ALA A CB  1 
ATOM   100  N N   . TRP A 1 14  ? -25.526 -19.477 -31.563 1.00 15.07  ? 14  TRP A N   1 
ATOM   101  C CA  . TRP A 1 14  ? -25.894 -20.429 -30.521 1.00 14.43  ? 14  TRP A CA  1 
ATOM   102  C C   . TRP A 1 14  ? -25.655 -19.856 -29.113 1.00 13.31  ? 14  TRP A C   1 
ATOM   103  O O   . TRP A 1 14  ? -26.511 -20.076 -28.264 1.00 16.37  ? 14  TRP A O   1 
ATOM   104  C CB  . TRP A 1 14  ? -25.089 -21.748 -30.603 1.00 12.97  ? 14  TRP A CB  1 
ATOM   105  C CG  . TRP A 1 14  ? -25.619 -22.659 -29.497 1.00 16.59  ? 14  TRP A CG  1 
ATOM   106  C CD1 . TRP A 1 14  ? -26.901 -23.176 -29.552 1.00 14.76  ? 14  TRP A CD1 1 
ATOM   107  C CD2 . TRP A 1 14  ? -24.989 -22.967 -28.315 1.00 14.42  ? 14  TRP A CD2 1 
ATOM   108  N NE1 . TRP A 1 14  ? -27.070 -23.785 -28.398 1.00 15.64  ? 14  TRP A NE1 1 
ATOM   109  C CE2 . TRP A 1 14  ? -25.972 -23.689 -27.648 1.00 15.92  ? 14  TRP A CE2 1 
ATOM   110  C CE3 . TRP A 1 14  ? -23.778 -22.729 -27.729 1.00 18.82  ? 14  TRP A CE3 1 
ATOM   111  C CZ2 . TRP A 1 14  ? -25.767 -24.190 -26.391 1.00 18.22  ? 14  TRP A CZ2 1 
ATOM   112  C CZ3 . TRP A 1 14  ? -23.557 -23.227 -26.453 1.00 23.71  ? 14  TRP A CZ3 1 
ATOM   113  C CH2 . TRP A 1 14  ? -24.539 -23.946 -25.798 1.00 22.05  ? 14  TRP A CH2 1 
ATOM   114  N N   . LEU A 1 15  ? -24.575 -19.169 -28.748 1.00 9.75   ? 15  LEU A N   1 
ATOM   115  C CA  . LEU A 1 15  ? -24.422 -18.657 -27.399 1.00 14.11  ? 15  LEU A CA  1 
ATOM   116  C C   . LEU A 1 15  ? -25.513 -17.664 -26.953 1.00 14.35  ? 15  LEU A C   1 
ATOM   117  O O   . LEU A 1 15  ? -25.925 -17.631 -25.796 1.00 11.21  ? 15  LEU A O   1 
ATOM   118  C CB  . LEU A 1 15  ? -23.054 -17.979 -27.241 1.00 14.72  ? 15  LEU A CB  1 
ATOM   119  C CG  . LEU A 1 15  ? -21.804 -18.861 -27.123 1.00 18.60  ? 15  LEU A CG  1 
ATOM   120  C CD1 . LEU A 1 15  ? -20.522 -18.040 -27.202 1.00 19.78  ? 15  LEU A CD1 1 
ATOM   121  C CD2 . LEU A 1 15  ? -21.845 -19.569 -25.806 1.00 19.25  ? 15  LEU A CD2 1 
ATOM   122  N N   . ARG A 1 16  ? -25.984 -16.858 -27.896 1.00 12.89  ? 16  ARG A N   1 
ATOM   123  C CA  . ARG A 1 16  ? -26.995 -15.883 -27.626 1.00 12.41  ? 16  ARG A CA  1 
ATOM   124  C C   . ARG A 1 16  ? -28.291 -16.589 -27.345 1.00 12.67  ? 16  ARG A C   1 
ATOM   125  O O   . ARG A 1 16  ? -28.989 -16.179 -26.449 1.00 12.27  ? 16  ARG A O   1 
ATOM   126  C CB  . ARG A 1 16  ? -27.164 -14.988 -28.817 1.00 13.66  ? 16  ARG A CB  1 
ATOM   127  C CG  . ARG A 1 16  ? -26.076 -13.961 -28.897 1.00 15.17  ? 16  ARG A CG  1 
ATOM   128  C CD  . ARG A 1 16  ? -26.401 -13.213 -30.171 1.00 21.29  ? 16  ARG A CD  1 
ATOM   129  N NE  . ARG A 1 16  ? -25.383 -12.203 -30.265 1.00 33.18  ? 16  ARG A NE  1 
ATOM   130  C CZ  . ARG A 1 16  ? -24.582 -12.075 -31.318 1.00 39.40  ? 16  ARG A CZ  1 
ATOM   131  N NH1 . ARG A 1 16  ? -24.667 -12.865 -32.398 1.00 41.48  ? 16  ARG A NH1 1 
ATOM   132  N NH2 . ARG A 1 16  ? -23.640 -11.137 -31.237 1.00 46.02  ? 16  ARG A NH2 1 
ATOM   133  N N   . ALA A 1 17  ? -28.610 -17.614 -28.144 1.00 10.88  ? 17  ALA A N   1 
ATOM   134  C CA  . ALA A 1 17  ? -29.817 -18.394 -27.963 1.00 13.18  ? 17  ALA A CA  1 
ATOM   135  C C   . ALA A 1 17  ? -29.793 -19.176 -26.674 1.00 14.22  ? 17  ALA A C   1 
ATOM   136  O O   . ALA A 1 17  ? -30.806 -19.260 -26.013 1.00 16.33  ? 17  ALA A O   1 
ATOM   137  C CB  . ALA A 1 17  ? -30.028 -19.421 -29.093 1.00 9.06   ? 17  ALA A CB  1 
ATOM   138  N N   . ASP A 1 18  ? -28.678 -19.768 -26.282 1.00 15.01  ? 18  ASP A N   1 
ATOM   139  C CA  . ASP A 1 18  ? -28.535 -20.502 -25.023 1.00 18.65  ? 18  ASP A CA  1 
ATOM   140  C C   . ASP A 1 18  ? -28.767 -19.623 -23.779 1.00 19.81  ? 18  ASP A C   1 
ATOM   141  O O   . ASP A 1 18  ? -29.327 -20.082 -22.782 1.00 18.04  ? 18  ASP A O   1 
ATOM   142  C CB  . ASP A 1 18  ? -27.129 -21.087 -25.011 1.00 16.30  ? 18  ASP A CB  1 
ATOM   143  C CG  . ASP A 1 18  ? -26.766 -21.846 -23.765 1.00 21.93  ? 18  ASP A CG  1 
ATOM   144  O OD1 . ASP A 1 18  ? -27.400 -22.860 -23.546 1.00 19.79  ? 18  ASP A OD1 1 
ATOM   145  O OD2 . ASP A 1 18  ? -25.857 -21.448 -23.033 1.00 26.50  ? 18  ASP A OD2 1 
ATOM   146  N N   . ARG A 1 19  ? -28.262 -18.378 -23.820 1.00 20.14  ? 19  ARG A N   1 
ATOM   147  C CA  . ARG A 1 19  ? -28.438 -17.382 -22.768 1.00 22.45  ? 19  ARG A CA  1 
ATOM   148  C C   . ARG A 1 19  ? -29.905 -17.004 -22.636 1.00 16.58  ? 19  ARG A C   1 
ATOM   149  O O   . ARG A 1 19  ? -30.408 -16.914 -21.541 1.00 18.47  ? 19  ARG A O   1 
ATOM   150  C CB  . ARG A 1 19  ? -27.664 -16.116 -23.079 1.00 29.76  ? 19  ARG A CB  1 
ATOM   151  C CG  . ARG A 1 19  ? -27.766 -15.053 -21.996 1.00 45.66  ? 19  ARG A CG  1 
ATOM   152  C CD  . ARG A 1 19  ? -27.350 -13.693 -22.534 1.00 60.95  ? 19  ARG A CD  1 
ATOM   153  N NE  . ARG A 1 19  ? -27.339 -12.692 -21.471 1.00 73.16  ? 19  ARG A NE  1 
ATOM   154  C CZ  . ARG A 1 19  ? -26.864 -11.445 -21.652 1.00 78.35  ? 19  ARG A CZ  1 
ATOM   155  N NH1 . ARG A 1 19  ? -26.359 -11.030 -22.826 1.00 80.28  ? 19  ARG A NH1 1 
ATOM   156  N NH2 . ARG A 1 19  ? -26.917 -10.583 -20.631 1.00 81.46  ? 19  ARG A NH2 1 
ATOM   157  N N   . LEU A 1 20  ? -30.588 -16.762 -23.739 1.00 12.13  ? 20  LEU A N   1 
ATOM   158  C CA  . LEU A 1 20  ? -31.970 -16.441 -23.743 1.00 11.35  ? 20  LEU A CA  1 
ATOM   159  C C   . LEU A 1 20  ? -32.712 -17.653 -23.237 1.00 12.58  ? 20  LEU A C   1 
ATOM   160  O O   . LEU A 1 20  ? -33.600 -17.471 -22.435 1.00 13.36  ? 20  LEU A O   1 
ATOM   161  C CB  . LEU A 1 20  ? -32.353 -16.079 -25.159 1.00 13.17  ? 20  LEU A CB  1 
ATOM   162  C CG  . LEU A 1 20  ? -32.232 -14.617 -25.551 1.00 18.23  ? 20  LEU A CG  1 
ATOM   163  C CD1 . LEU A 1 20  ? -32.424 -14.461 -27.053 1.00 15.40  ? 20  LEU A CD1 1 
ATOM   164  C CD2 . LEU A 1 20  ? -33.274 -13.810 -24.773 1.00 19.42  ? 20  LEU A CD2 1 
ATOM   165  N N   . ASN A 1 21  ? -32.368 -18.884 -23.620 1.00 11.08  ? 21  ASN A N   1 
ATOM   166  C CA  . ASN A 1 21  ? -33.027 -20.058 -23.088 1.00 13.89  ? 21  ASN A CA  1 
ATOM   167  C C   . ASN A 1 21  ? -32.783 -20.221 -21.587 1.00 13.67  ? 21  ASN A C   1 
ATOM   168  O O   . ASN A 1 21  ? -33.707 -20.579 -20.878 1.00 12.81  ? 21  ASN A O   1 
ATOM   169  C CB  . ASN A 1 21  ? -32.537 -21.280 -23.837 1.00 16.86  ? 21  ASN A CB  1 
ATOM   170  C CG  . ASN A 1 21  ? -33.303 -22.552 -23.468 1.00 23.97  ? 21  ASN A CG  1 
ATOM   171  O OD1 . ASN A 1 21  ? -32.685 -23.588 -23.307 1.00 27.17  ? 21  ASN A OD1 1 
ATOM   172  N ND2 . ASN A 1 21  ? -34.617 -22.566 -23.271 1.00 29.53  ? 21  ASN A ND2 1 
ATOM   173  N N   . GLN A 1 22  ? -31.606 -19.950 -21.023 1.00 12.92  ? 22  GLN A N   1 
ATOM   174  C CA  . GLN A 1 22  ? -31.408 -20.020 -19.582 1.00 16.31  ? 22  GLN A CA  1 
ATOM   175  C C   . GLN A 1 22  ? -32.298 -18.994 -18.891 1.00 16.93  ? 22  GLN A C   1 
ATOM   176  O O   . GLN A 1 22  ? -32.978 -19.307 -17.923 1.00 16.61  ? 22  GLN A O   1 
ATOM   177  C CB  . GLN A 1 22  ? -29.924 -19.741 -19.196 1.00 16.41  ? 22  GLN A CB  1 
ATOM   178  C CG  . GLN A 1 22  ? -29.552 -19.510 -17.683 1.00 22.50  ? 22  GLN A CG  1 
ATOM   179  C CD  . GLN A 1 22  ? -29.717 -18.106 -17.049 1.00 27.42  ? 22  GLN A CD  1 
ATOM   180  O OE1 . GLN A 1 22  ? -30.372 -17.852 -16.015 1.00 23.64  ? 22  GLN A OE1 1 
ATOM   181  N NE2 . GLN A 1 22  ? -29.084 -17.117 -17.667 1.00 31.15  ? 22  GLN A NE2 1 
ATOM   182  N N   . LEU A 1 23  ? -32.336 -17.768 -19.425 1.00 16.76  ? 23  LEU A N   1 
ATOM   183  C CA  . LEU A 1 23  ? -33.094 -16.688 -18.841 1.00 15.90  ? 23  LEU A CA  1 
ATOM   184  C C   . LEU A 1 23  ? -34.541 -17.065 -18.897 1.00 12.94  ? 23  LEU A C   1 
ATOM   185  O O   . LEU A 1 23  ? -35.195 -16.983 -17.886 1.00 11.57  ? 23  LEU A O   1 
ATOM   186  C CB  . LEU A 1 23  ? -32.846 -15.407 -19.616 1.00 18.88  ? 23  LEU A CB  1 
ATOM   187  C CG  . LEU A 1 23  ? -32.983 -14.079 -18.885 1.00 29.30  ? 23  LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 23  ? -32.127 -14.094 -17.603 1.00 25.69  ? 23  LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 23  ? -32.524 -12.944 -19.820 1.00 33.37  ? 23  LEU A CD2 1 
ATOM   190  N N   . ALA A 1 24  ? -35.026 -17.586 -20.009 1.00 9.84   ? 24  ALA A N   1 
ATOM   191  C CA  . ALA A 1 24  ? -36.421 -17.943 -20.129 1.00 12.40  ? 24  ALA A CA  1 
ATOM   192  C C   . ALA A 1 24  ? -36.786 -19.069 -19.164 1.00 14.90  ? 24  ALA A C   1 
ATOM   193  O O   . ALA A 1 24  ? -37.829 -19.000 -18.537 1.00 13.27  ? 24  ALA A O   1 
ATOM   194  C CB  . ALA A 1 24  ? -36.709 -18.386 -21.557 1.00 7.69   ? 24  ALA A CB  1 
ATOM   195  N N   . PHE A 1 25  ? -35.913 -20.057 -18.947 1.00 15.53  ? 25  PHE A N   1 
ATOM   196  C CA  . PHE A 1 25  ? -36.186 -21.216 -18.114 1.00 14.61  ? 25  PHE A CA  1 
ATOM   197  C C   . PHE A 1 25  ? -36.201 -20.908 -16.619 1.00 14.80  ? 25  PHE A C   1 
ATOM   198  O O   . PHE A 1 25  ? -37.078 -21.321 -15.852 1.00 16.14  ? 25  PHE A O   1 
ATOM   199  C CB  . PHE A 1 25  ? -35.132 -22.310 -18.413 1.00 15.66  ? 25  PHE A CB  1 
ATOM   200  C CG  . PHE A 1 25  ? -35.400 -23.561 -17.583 1.00 17.57  ? 25  PHE A CG  1 
ATOM   201  C CD1 . PHE A 1 25  ? -36.489 -24.362 -17.860 1.00 24.00  ? 25  PHE A CD1 1 
ATOM   202  C CD2 . PHE A 1 25  ? -34.601 -23.850 -16.508 1.00 21.10  ? 25  PHE A CD2 1 
ATOM   203  C CE1 . PHE A 1 25  ? -36.791 -25.447 -17.061 1.00 30.01  ? 25  PHE A CE1 1 
ATOM   204  C CE2 . PHE A 1 25  ? -34.897 -24.936 -15.701 1.00 26.44  ? 25  PHE A CE2 1 
ATOM   205  C CZ  . PHE A 1 25  ? -35.990 -25.733 -15.976 1.00 30.07  ? 25  PHE A CZ  1 
ATOM   206  N N   . ASP A 1 26  ? -35.169 -20.222 -16.185 1.00 14.01  ? 26  ASP A N   1 
ATOM   207  C CA  . ASP A 1 26  ? -35.059 -19.850 -14.802 1.00 12.40  ? 26  ASP A CA  1 
ATOM   208  C C   . ASP A 1 26  ? -36.099 -18.848 -14.359 1.00 10.84  ? 26  ASP A C   1 
ATOM   209  O O   . ASP A 1 26  ? -36.573 -18.980 -13.238 1.00 12.68  ? 26  ASP A O   1 
ATOM   210  C CB  . ASP A 1 26  ? -33.667 -19.313 -14.560 1.00 14.62  ? 26  ASP A CB  1 
ATOM   211  C CG  . ASP A 1 26  ? -32.562 -20.371 -14.581 1.00 17.22  ? 26  ASP A CG  1 
ATOM   212  O OD1 . ASP A 1 26  ? -32.856 -21.562 -14.549 1.00 21.60  ? 26  ASP A OD1 1 
ATOM   213  O OD2 . ASP A 1 26  ? -31.394 -20.013 -14.593 1.00 15.60  ? 26  ASP A OD2 1 
ATOM   214  N N   . THR A 1 27  ? -36.533 -17.895 -15.174 1.00 12.48  ? 27  THR A N   1 
ATOM   215  C CA  . THR A 1 27  ? -37.549 -16.948 -14.705 1.00 13.60  ? 27  THR A CA  1 
ATOM   216  C C   . THR A 1 27  ? -38.886 -17.630 -14.756 1.00 12.07  ? 27  THR A C   1 
ATOM   217  O O   . THR A 1 27  ? -39.715 -17.304 -13.932 1.00 11.83  ? 27  THR A O   1 
ATOM   218  C CB  . THR A 1 27  ? -37.647 -15.622 -15.533 1.00 14.42  ? 27  THR A CB  1 
ATOM   219  O OG1 . THR A 1 27  ? -37.930 -15.874 -16.902 1.00 22.27  ? 27  THR A OG1 1 
ATOM   220  C CG2 . THR A 1 27  ? -36.315 -14.896 -15.428 1.00 11.02  ? 27  THR A CG2 1 
ATOM   221  N N   . TYR A 1 28  ? -39.096 -18.566 -15.685 1.00 11.49  ? 28  TYR A N   1 
ATOM   222  C CA  . TYR A 1 28  ? -40.279 -19.414 -15.709 1.00 12.56  ? 28  TYR A CA  1 
ATOM   223  C C   . TYR A 1 28  ? -40.355 -20.290 -14.427 1.00 14.62  ? 28  TYR A C   1 
ATOM   224  O O   . TYR A 1 28  ? -41.430 -20.377 -13.820 1.00 15.57  ? 28  TYR A O   1 
ATOM   225  C CB  . TYR A 1 28  ? -40.202 -20.288 -16.954 1.00 16.36  ? 28  TYR A CB  1 
ATOM   226  C CG  . TYR A 1 28  ? -41.313 -21.300 -17.108 1.00 18.34  ? 28  TYR A CG  1 
ATOM   227  C CD1 . TYR A 1 28  ? -42.592 -20.842 -17.323 1.00 19.47  ? 28  TYR A CD1 1 
ATOM   228  C CD2 . TYR A 1 28  ? -41.033 -22.639 -16.981 1.00 21.69  ? 28  TYR A CD2 1 
ATOM   229  C CE1 . TYR A 1 28  ? -43.628 -21.722 -17.403 1.00 24.96  ? 28  TYR A CE1 1 
ATOM   230  C CE2 . TYR A 1 28  ? -42.083 -23.526 -17.053 1.00 26.88  ? 28  TYR A CE2 1 
ATOM   231  C CZ  . TYR A 1 28  ? -43.357 -23.050 -17.266 1.00 24.82  ? 28  TYR A CZ  1 
ATOM   232  O OH  . TYR A 1 28  ? -44.418 -23.917 -17.348 1.00 36.86  ? 28  TYR A OH  1 
ATOM   233  N N   . GLN A 1 29  ? -39.275 -20.944 -13.952 1.00 14.47  ? 29  GLN A N   1 
ATOM   234  C CA  . GLN A 1 29  ? -39.351 -21.714 -12.717 1.00 17.48  ? 29  GLN A CA  1 
ATOM   235  C C   . GLN A 1 29  ? -39.522 -20.870 -11.443 1.00 18.21  ? 29  GLN A C   1 
ATOM   236  O O   . GLN A 1 29  ? -40.238 -21.265 -10.520 1.00 16.43  ? 29  GLN A O   1 
ATOM   237  C CB  A GLN A 1 29  ? -38.103 -22.532 -12.470 0.50 18.02  ? 29  GLN A CB  1 
ATOM   238  C CB  B GLN A 1 29  ? -38.107 -22.574 -12.625 0.50 17.08  ? 29  GLN A CB  1 
ATOM   239  C CG  A GLN A 1 29  ? -37.912 -23.861 -13.168 0.50 24.07  ? 29  GLN A CG  1 
ATOM   240  C CG  B GLN A 1 29  ? -38.022 -23.588 -13.773 0.50 20.73  ? 29  GLN A CG  1 
ATOM   241  C CD  A GLN A 1 29  ? -36.923 -24.690 -12.357 0.50 24.26  ? 29  GLN A CD  1 
ATOM   242  C CD  B GLN A 1 29  ? -39.047 -24.711 -13.762 0.50 22.06  ? 29  GLN A CD  1 
ATOM   243  O OE1 A GLN A 1 29  ? -35.707 -24.576 -12.463 0.50 22.86  ? 29  GLN A OE1 1 
ATOM   244  O OE1 B GLN A 1 29  ? -39.056 -25.562 -12.878 0.50 23.49  ? 29  GLN A OE1 1 
ATOM   245  N NE2 A GLN A 1 29  ? -37.435 -25.517 -11.453 0.50 32.23  ? 29  GLN A NE2 1 
ATOM   246  N NE2 B GLN A 1 29  ? -39.929 -24.755 -14.748 0.50 22.17  ? 29  GLN A NE2 1 
ATOM   247  N N   . GLU A 1 30  ? -38.862 -19.699 -11.348 1.00 14.01  ? 30  GLU A N   1 
ATOM   248  C CA  . GLU A 1 30  ? -38.963 -18.852 -10.180 1.00 12.28  ? 30  GLU A CA  1 
ATOM   249  C C   . GLU A 1 30  ? -40.390 -18.327 -10.070 1.00 12.32  ? 30  GLU A C   1 
ATOM   250  O O   . GLU A 1 30  ? -40.938 -18.324 -8.977  1.00 14.38  ? 30  GLU A O   1 
ATOM   251  C CB  . GLU A 1 30  ? -37.967 -17.755 -10.354 1.00 12.92  ? 30  GLU A CB  1 
ATOM   252  C CG  . GLU A 1 30  ? -38.205 -16.613 -9.391  1.00 12.73  ? 30  GLU A CG  1 
ATOM   253  C CD  . GLU A 1 30  ? -37.439 -15.370 -9.777  1.00 12.71  ? 30  GLU A CD  1 
ATOM   254  O OE1 . GLU A 1 30  ? -37.449 -14.972 -10.936 1.00 13.75  ? 30  GLU A OE1 1 
ATOM   255  O OE2 . GLU A 1 30  ? -36.796 -14.828 -8.899  1.00 13.05  ? 30  GLU A OE2 1 
ATOM   256  N N   . PHE A 1 31  ? -41.010 -17.923 -11.192 1.00 10.71  ? 31  PHE A N   1 
ATOM   257  C CA  . PHE A 1 31  ? -42.379 -17.437 -11.266 1.00 13.13  ? 31  PHE A CA  1 
ATOM   258  C C   . PHE A 1 31  ? -43.396 -18.512 -10.851 1.00 18.14  ? 31  PHE A C   1 
ATOM   259  O O   . PHE A 1 31  ? -44.315 -18.295 -10.060 1.00 17.12  ? 31  PHE A O   1 
ATOM   260  C CB  . PHE A 1 31  ? -42.696 -16.975 -12.707 1.00 9.36   ? 31  PHE A CB  1 
ATOM   261  C CG  . PHE A 1 31  ? -43.951 -16.140 -12.900 1.00 14.05  ? 31  PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 31  ? -43.905 -14.759 -12.690 1.00 18.30  ? 31  PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 31  ? -45.136 -16.735 -13.282 1.00 16.47  ? 31  PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 31  ? -45.037 -13.976 -12.857 1.00 17.27  ? 31  PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 31  ? -46.264 -15.942 -13.448 1.00 20.02  ? 31  PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 31  ? -46.221 -14.578 -13.238 1.00 19.59  ? 31  PHE A CZ  1 
ATOM   267  N N   . GLU A 1 32  ? -43.248 -19.696 -11.452 1.00 17.26  ? 32  GLU A N   1 
ATOM   268  C CA  . GLU A 1 32  ? -44.097 -20.803 -11.161 1.00 17.22  ? 32  GLU A CA  1 
ATOM   269  C C   . GLU A 1 32  ? -43.974 -21.118 -9.679  1.00 17.73  ? 32  GLU A C   1 
ATOM   270  O O   . GLU A 1 32  ? -44.980 -21.189 -9.004  1.00 21.49  ? 32  GLU A O   1 
ATOM   271  C CB  . GLU A 1 32  ? -43.645 -21.956 -12.013 1.00 18.13  ? 32  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 32  ? -44.534 -23.144 -11.818 1.00 19.20  ? 32  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 32  ? -44.044 -24.387 -12.545 1.00 18.91  ? 32  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 32  ? -43.213 -25.075 -11.986 1.00 21.54  ? 32  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 32  ? -44.514 -24.680 -13.637 1.00 21.57  ? 32  GLU A OE2 1 
ATOM   276  N N   . GLU A 1 33  ? -42.784 -21.195 -9.115  1.00 20.28  ? 33  GLU A N   1 
ATOM   277  C CA  . GLU A 1 33  ? -42.618 -21.576 -7.735  1.00 24.82  ? 33  GLU A CA  1 
ATOM   278  C C   . GLU A 1 33  ? -43.074 -20.463 -6.809  1.00 25.65  ? 33  GLU A C   1 
ATOM   279  O O   . GLU A 1 33  ? -43.714 -20.748 -5.809  1.00 28.34  ? 33  GLU A O   1 
ATOM   280  C CB  . GLU A 1 33  ? -41.181 -21.896 -7.508  1.00 29.59  ? 33  GLU A CB  1 
ATOM   281  C CG  . GLU A 1 33  ? -40.904 -22.601 -6.184  1.00 48.31  ? 33  GLU A CG  1 
ATOM   282  C CD  . GLU A 1 33  ? -39.448 -22.514 -5.705  1.00 54.14  ? 33  GLU A CD  1 
ATOM   283  O OE1 . GLU A 1 33  ? -38.534 -22.705 -6.511  1.00 58.86  ? 33  GLU A OE1 1 
ATOM   284  O OE2 . GLU A 1 33  ? -39.231 -22.254 -4.516  1.00 58.50  ? 33  GLU A OE2 1 
ATOM   285  N N   . ALA A 1 34  ? -42.870 -19.194 -7.131  1.00 23.51  ? 34  ALA A N   1 
ATOM   286  C CA  . ALA A 1 34  ? -43.288 -18.106 -6.277  1.00 19.87  ? 34  ALA A CA  1 
ATOM   287  C C   . ALA A 1 34  ? -44.774 -17.887 -6.281  1.00 18.48  ? 34  ALA A C   1 
ATOM   288  O O   . ALA A 1 34  ? -45.347 -17.674 -5.229  1.00 22.98  ? 34  ALA A O   1 
ATOM   289  C CB  . ALA A 1 34  ? -42.683 -16.777 -6.705  1.00 15.98  ? 34  ALA A CB  1 
ATOM   290  N N   . TYR A 1 35  ? -45.418 -17.981 -7.433  1.00 17.39  ? 35  TYR A N   1 
ATOM   291  C CA  . TYR A 1 35  ? -46.787 -17.542 -7.588  1.00 18.25  ? 35  TYR A CA  1 
ATOM   292  C C   . TYR A 1 35  ? -47.859 -18.521 -8.018  1.00 21.73  ? 35  TYR A C   1 
ATOM   293  O O   . TYR A 1 35  ? -49.007 -18.162 -7.761  1.00 24.24  ? 35  TYR A O   1 
ATOM   294  C CB  . TYR A 1 35  ? -46.889 -16.390 -8.596  1.00 18.42  ? 35  TYR A CB  1 
ATOM   295  C CG  . TYR A 1 35  ? -45.893 -15.292 -8.352  1.00 19.97  ? 35  TYR A CG  1 
ATOM   296  C CD1 . TYR A 1 35  ? -45.920 -14.640 -7.148  1.00 22.17  ? 35  TYR A CD1 1 
ATOM   297  C CD2 . TYR A 1 35  ? -44.941 -15.000 -9.294  1.00 17.84  ? 35  TYR A CD2 1 
ATOM   298  C CE1 . TYR A 1 35  ? -44.976 -13.689 -6.863  1.00 22.15  ? 35  TYR A CE1 1 
ATOM   299  C CE2 . TYR A 1 35  ? -43.995 -14.048 -9.018  1.00 22.69  ? 35  TYR A CE2 1 
ATOM   300  C CZ  . TYR A 1 35  ? -44.020 -13.401 -7.798  1.00 23.75  ? 35  TYR A CZ  1 
ATOM   301  O OH  . TYR A 1 35  ? -43.061 -12.459 -7.461  1.00 27.45  ? 35  TYR A OH  1 
ATOM   302  N N   . ILE A 1 36  ? -47.589 -19.668 -8.700  1.00 21.04  ? 36  ILE A N   1 
ATOM   303  C CA  . ILE A 1 36  ? -48.643 -20.541 -9.242  1.00 19.95  ? 36  ILE A CA  1 
ATOM   304  C C   . ILE A 1 36  ? -48.911 -21.640 -8.248  1.00 18.96  ? 36  ILE A C   1 
ATOM   305  O O   . ILE A 1 36  ? -47.988 -22.309 -7.812  1.00 21.14  ? 36  ILE A O   1 
ATOM   306  C CB  . ILE A 1 36  ? -48.207 -21.136 -10.598 1.00 18.54  ? 36  ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 36  ? -47.807 -19.950 -11.470 1.00 17.45  ? 36  ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 36  ? -49.316 -21.942 -11.300 1.00 17.53  ? 36  ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 36  ? -48.863 -18.866 -11.802 1.00 19.86  ? 36  ILE A CD1 1 
ATOM   310  N N   . PRO A 1 37  ? -50.134 -21.825 -7.758  1.00 21.75  ? 37  PRO A N   1 
ATOM   311  C CA  . PRO A 1 37  ? -50.404 -22.872 -6.794  1.00 21.17  ? 37  PRO A CA  1 
ATOM   312  C C   . PRO A 1 37  ? -50.342 -24.186 -7.563  1.00 20.63  ? 37  PRO A C   1 
ATOM   313  O O   . PRO A 1 37  ? -50.690 -24.217 -8.744  1.00 24.54  ? 37  PRO A O   1 
ATOM   314  C CB  . PRO A 1 37  ? -51.748 -22.439 -6.253  1.00 19.10  ? 37  PRO A CB  1 
ATOM   315  C CG  . PRO A 1 37  ? -52.436 -21.742 -7.385  1.00 23.27  ? 37  PRO A CG  1 
ATOM   316  C CD  . PRO A 1 37  ? -51.297 -20.998 -8.053  1.00 19.70  ? 37  PRO A CD  1 
ATOM   317  N N   . LYS A 1 38  ? -49.835 -25.227 -6.895  1.00 23.53  ? 38  LYS A N   1 
ATOM   318  C CA  . LYS A 1 38  ? -49.631 -26.579 -7.401  1.00 28.20  ? 38  LYS A CA  1 
ATOM   319  C C   . LYS A 1 38  ? -50.783 -27.160 -8.222  1.00 29.90  ? 38  LYS A C   1 
ATOM   320  O O   . LYS A 1 38  ? -50.647 -27.857 -9.221  1.00 29.59  ? 38  LYS A O   1 
ATOM   321  C CB  . LYS A 1 38  ? -49.361 -27.451 -6.221  1.00 33.85  ? 38  LYS A CB  1 
ATOM   322  C CG  . LYS A 1 38  ? -48.799 -28.764 -6.729  1.00 46.68  ? 38  LYS A CG  1 
ATOM   323  C CD  . LYS A 1 38  ? -48.813 -29.883 -5.698  1.00 52.64  ? 38  LYS A CD  1 
ATOM   324  C CE  . LYS A 1 38  ? -47.874 -31.001 -6.137  1.00 54.54  ? 38  LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 38  ? -47.872 -32.007 -5.098  1.00 62.22  ? 38  LYS A NZ  1 
ATOM   326  N N   . GLU A 1 39  ? -51.956 -26.779 -7.763  1.00 30.36  ? 39  GLU A N   1 
ATOM   327  C CA  . GLU A 1 39  ? -53.215 -27.108 -8.372  1.00 29.97  ? 39  GLU A CA  1 
ATOM   328  C C   . GLU A 1 39  ? -53.178 -26.637 -9.814  1.00 28.42  ? 39  GLU A C   1 
ATOM   329  O O   . GLU A 1 39  ? -53.458 -27.408 -10.728 1.00 28.49  ? 39  GLU A O   1 
ATOM   330  C CB  A GLU A 1 39  ? -54.410 -26.395 -7.748  0.50 32.20  ? 39  GLU A CB  1 
ATOM   331  C CB  B GLU A 1 39  ? -54.283 -26.409 -7.510  0.50 32.58  ? 39  GLU A CB  1 
ATOM   332  C CG  A GLU A 1 39  ? -54.800 -26.752 -6.321  0.50 34.70  ? 39  GLU A CG  1 
ATOM   333  C CG  B GLU A 1 39  ? -54.429 -26.758 -5.988  0.50 33.99  ? 39  GLU A CG  1 
ATOM   334  C CD  A GLU A 1 39  ? -55.828 -25.826 -5.680  0.50 32.90  ? 39  GLU A CD  1 
ATOM   335  C CD  B GLU A 1 39  ? -53.294 -26.513 -4.971  0.50 33.01  ? 39  GLU A CD  1 
ATOM   336  O OE1 A GLU A 1 39  ? -56.824 -25.467 -6.302  0.50 31.95  ? 39  GLU A OE1 1 
ATOM   337  O OE1 B GLU A 1 39  ? -53.115 -25.380 -4.522  0.50 32.07  ? 39  GLU A OE1 1 
ATOM   338  O OE2 A GLU A 1 39  ? -55.615 -25.457 -4.532  0.50 38.69  ? 39  GLU A OE2 1 
ATOM   339  O OE2 B GLU A 1 39  ? -52.611 -27.470 -4.591  0.50 34.75  ? 39  GLU A OE2 1 
ATOM   340  N N   . GLN A 1 40  ? -52.787 -25.379 -10.030 1.00 27.22  ? 40  GLN A N   1 
ATOM   341  C CA  . GLN A 1 40  ? -52.784 -24.819 -11.373 1.00 27.66  ? 40  GLN A CA  1 
ATOM   342  C C   . GLN A 1 40  ? -51.623 -25.238 -12.277 1.00 26.99  ? 40  GLN A C   1 
ATOM   343  O O   . GLN A 1 40  ? -51.742 -25.130 -13.498 1.00 25.92  ? 40  GLN A O   1 
ATOM   344  C CB  . GLN A 1 40  ? -52.823 -23.318 -11.270 1.00 29.60  ? 40  GLN A CB  1 
ATOM   345  C CG  . GLN A 1 40  ? -54.080 -22.933 -10.528 1.00 39.75  ? 40  GLN A CG  1 
ATOM   346  C CD  . GLN A 1 40  ? -54.582 -21.514 -10.731 1.00 45.02  ? 40  GLN A CD  1 
ATOM   347  O OE1 . GLN A 1 40  ? -55.684 -21.310 -11.247 1.00 49.30  ? 40  GLN A OE1 1 
ATOM   348  N NE2 . GLN A 1 40  ? -53.825 -20.495 -10.335 1.00 46.56  ? 40  GLN A NE2 1 
ATOM   349  N N   . ILE A 1 41  ? -50.529 -25.731 -11.674 1.00 22.91  ? 41  ILE A N   1 
ATOM   350  C CA  . ILE A 1 41  ? -49.360 -26.233 -12.366 1.00 21.97  ? 41  ILE A CA  1 
ATOM   351  C C   . ILE A 1 41  ? -49.720 -27.523 -13.085 1.00 25.74  ? 41  ILE A C   1 
ATOM   352  O O   . ILE A 1 41  ? -49.394 -27.648 -14.267 1.00 26.32  ? 41  ILE A O   1 
ATOM   353  C CB  . ILE A 1 41  ? -48.202 -26.520 -11.383 1.00 20.78  ? 41  ILE A CB  1 
ATOM   354  C CG1 . ILE A 1 41  ? -47.802 -25.240 -10.669 1.00 19.00  ? 41  ILE A CG1 1 
ATOM   355  C CG2 . ILE A 1 41  ? -47.002 -27.104 -12.148 1.00 20.03  ? 41  ILE A CG2 1 
ATOM   356  C CD1 . ILE A 1 41  ? -46.659 -25.402 -9.669  1.00 15.62  ? 41  ILE A CD1 1 
ATOM   357  N N   . HIS A 1 42  ? -50.414 -28.471 -12.431 1.00 24.42  ? 42  HIS A N   1 
ATOM   358  C CA  . HIS A 1 42  ? -50.770 -29.733 -13.078 1.00 25.30  ? 42  HIS A CA  1 
ATOM   359  C C   . HIS A 1 42  ? -51.809 -29.591 -14.156 1.00 24.94  ? 42  HIS A C   1 
ATOM   360  O O   . HIS A 1 42  ? -51.787 -30.259 -15.176 1.00 26.14  ? 42  HIS A O   1 
ATOM   361  C CB  . HIS A 1 42  ? -51.297 -30.698 -12.076 1.00 27.71  ? 42  HIS A CB  1 
ATOM   362  C CG  . HIS A 1 42  ? -50.238 -31.066 -11.081 1.00 28.78  ? 42  HIS A CG  1 
ATOM   363  N ND1 . HIS A 1 42  ? -50.317 -30.954 -9.764  1.00 32.32  ? 42  HIS A ND1 1 
ATOM   364  C CD2 . HIS A 1 42  ? -49.016 -31.584 -11.413 1.00 34.22  ? 42  HIS A CD2 1 
ATOM   365  C CE1 . HIS A 1 42  ? -49.178 -31.390 -9.290  1.00 34.91  ? 42  HIS A CE1 1 
ATOM   366  N NE2 . HIS A 1 42  ? -48.401 -31.766 -10.275 1.00 36.42  ? 42  HIS A NE2 1 
ATOM   367  N N   . SER A 1 43  ? -52.723 -28.664 -13.931 1.00 24.88  ? 43  SER A N   1 
ATOM   368  C CA  . SER A 1 43  ? -53.759 -28.371 -14.878 1.00 26.40  ? 43  SER A CA  1 
ATOM   369  C C   . SER A 1 43  ? -53.230 -27.864 -16.220 1.00 27.73  ? 43  SER A C   1 
ATOM   370  O O   . SER A 1 43  ? -53.609 -28.356 -17.293 1.00 28.99  ? 43  SER A O   1 
ATOM   371  C CB  . SER A 1 43  ? -54.661 -27.376 -14.177 1.00 27.41  ? 43  SER A CB  1 
ATOM   372  O OG  . SER A 1 43  ? -55.630 -26.789 -15.026 1.00 38.65  ? 43  SER A OG  1 
ATOM   373  N N   . PHE A 1 44  ? -52.327 -26.870 -16.130 1.00 30.08  ? 44  PHE A N   1 
ATOM   374  C CA  . PHE A 1 44  ? -51.743 -26.243 -17.314 1.00 29.19  ? 44  PHE A CA  1 
ATOM   375  C C   . PHE A 1 44  ? -50.829 -27.251 -17.999 1.00 24.73  ? 44  PHE A C   1 
ATOM   376  O O   . PHE A 1 44  ? -50.803 -27.278 -19.225 1.00 24.23  ? 44  PHE A O   1 
ATOM   377  C CB  . PHE A 1 44  ? -50.974 -24.942 -16.894 1.00 33.39  ? 44  PHE A CB  1 
ATOM   378  C CG  . PHE A 1 44  ? -50.178 -24.247 -18.025 1.00 39.21  ? 44  PHE A CG  1 
ATOM   379  C CD1 . PHE A 1 44  ? -48.884 -24.681 -18.361 1.00 37.87  ? 44  PHE A CD1 1 
ATOM   380  C CD2 . PHE A 1 44  ? -50.764 -23.224 -18.754 1.00 35.57  ? 44  PHE A CD2 1 
ATOM   381  C CE1 . PHE A 1 44  ? -48.221 -24.104 -19.407 1.00 35.38  ? 44  PHE A CE1 1 
ATOM   382  C CE2 . PHE A 1 44  ? -50.058 -22.664 -19.805 1.00 32.86  ? 44  PHE A CE2 1 
ATOM   383  C CZ  . PHE A 1 44  ? -48.812 -23.096 -20.131 1.00 31.31  ? 44  PHE A CZ  1 
ATOM   384  N N   . TRP A 1 45  ? -50.106 -28.087 -17.240 1.00 22.78  ? 45  TRP A N   1 
ATOM   385  C CA  . TRP A 1 45  ? -49.263 -29.113 -17.809 1.00 22.99  ? 45  TRP A CA  1 
ATOM   386  C C   . TRP A 1 45  ? -50.046 -29.987 -18.793 1.00 23.07  ? 45  TRP A C   1 
ATOM   387  O O   . TRP A 1 45  ? -49.616 -30.227 -19.926 1.00 22.61  ? 45  TRP A O   1 
ATOM   388  C CB  . TRP A 1 45  ? -48.702 -29.951 -16.661 1.00 24.76  ? 45  TRP A CB  1 
ATOM   389  C CG  . TRP A 1 45  ? -47.822 -31.077 -17.169 1.00 31.91  ? 45  TRP A CG  1 
ATOM   390  C CD1 . TRP A 1 45  ? -48.276 -32.365 -17.252 1.00 35.95  ? 45  TRP A CD1 1 
ATOM   391  C CD2 . TRP A 1 45  ? -46.543 -30.948 -17.634 1.00 39.53  ? 45  TRP A CD2 1 
ATOM   392  N NE1 . TRP A 1 45  ? -47.297 -33.042 -17.777 1.00 34.27  ? 45  TRP A NE1 1 
ATOM   393  C CE2 . TRP A 1 45  ? -46.250 -32.245 -18.014 1.00 38.42  ? 45  TRP A CE2 1 
ATOM   394  C CE3 . TRP A 1 45  ? -45.608 -29.940 -17.782 1.00 47.61  ? 45  TRP A CE3 1 
ATOM   395  C CZ2 . TRP A 1 45  ? -45.021 -32.567 -18.546 1.00 44.20  ? 45  TRP A CZ2 1 
ATOM   396  C CZ3 . TRP A 1 45  ? -44.371 -30.263 -18.316 1.00 48.83  ? 45  TRP A CZ3 1 
ATOM   397  C CH2 . TRP A 1 45  ? -44.084 -31.565 -18.692 1.00 46.65  ? 45  TRP A CH2 1 
ATOM   398  N N   . TRP A 1 46  ? -51.259 -30.381 -18.378 1.00 19.88  ? 46  TRP A N   1 
ATOM   399  C CA  . TRP A 1 46  ? -52.031 -31.291 -19.184 1.00 24.29  ? 46  TRP A CA  1 
ATOM   400  C C   . TRP A 1 46  ? -52.811 -30.575 -20.250 1.00 30.94  ? 46  TRP A C   1 
ATOM   401  O O   . TRP A 1 46  ? -53.230 -31.218 -21.207 1.00 34.59  ? 46  TRP A O   1 
ATOM   402  C CB  . TRP A 1 46  ? -52.945 -32.137 -18.260 1.00 18.96  ? 46  TRP A CB  1 
ATOM   403  C CG  . TRP A 1 46  ? -52.121 -33.202 -17.510 1.00 14.56  ? 46  TRP A CG  1 
ATOM   404  C CD1 . TRP A 1 46  ? -51.540 -32.961 -16.291 1.00 11.11  ? 46  TRP A CD1 1 
ATOM   405  C CD2 . TRP A 1 46  ? -51.810 -34.457 -17.982 1.00 14.58  ? 46  TRP A CD2 1 
ATOM   406  N NE1 . TRP A 1 46  ? -50.851 -34.042 -16.003 1.00 12.76  ? 46  TRP A NE1 1 
ATOM   407  C CE2 . TRP A 1 46  ? -50.992 -34.956 -16.989 1.00 15.18  ? 46  TRP A CE2 1 
ATOM   408  C CE3 . TRP A 1 46  ? -52.113 -35.217 -19.103 1.00 16.62  ? 46  TRP A CE3 1 
ATOM   409  C CZ2 . TRP A 1 46  ? -50.459 -36.228 -17.099 1.00 16.96  ? 46  TRP A CZ2 1 
ATOM   410  C CZ3 . TRP A 1 46  ? -51.579 -36.498 -19.203 1.00 20.20  ? 46  TRP A CZ3 1 
ATOM   411  C CH2 . TRP A 1 46  ? -50.761 -36.996 -18.207 1.00 16.88  ? 46  TRP A CH2 1 
ATOM   412  N N   . ASN A 1 47  ? -52.999 -29.251 -20.135 1.00 38.22  ? 47  ASN A N   1 
ATOM   413  C CA  . ASN A 1 47  ? -53.620 -28.440 -21.175 1.00 45.36  ? 47  ASN A CA  1 
ATOM   414  C C   . ASN A 1 47  ? -52.914 -27.091 -21.288 1.00 47.23  ? 47  ASN A C   1 
ATOM   415  O O   . ASN A 1 47  ? -53.360 -26.101 -20.690 1.00 44.63  ? 47  ASN A O   1 
ATOM   416  C CB  . ASN A 1 47  ? -55.086 -28.180 -20.884 1.00 53.77  ? 47  ASN A CB  1 
ATOM   417  C CG  . ASN A 1 47  ? -55.870 -29.470 -20.922 1.00 65.24  ? 47  ASN A CG  1 
ATOM   418  O OD1 . ASN A 1 47  ? -56.054 -30.086 -21.981 1.00 71.40  ? 47  ASN A OD1 1 
ATOM   419  N ND2 . ASN A 1 47  ? -56.288 -29.899 -19.722 1.00 70.33  ? 47  ASN A ND2 1 
ATOM   420  N N   . PRO A 1 48  ? -51.776 -27.015 -22.017 1.00 50.15  ? 48  PRO A N   1 
ATOM   421  C CA  . PRO A 1 48  ? -51.067 -25.760 -22.296 1.00 54.36  ? 48  PRO A CA  1 
ATOM   422  C C   . PRO A 1 48  ? -51.825 -24.651 -23.063 1.00 57.03  ? 48  PRO A C   1 
ATOM   423  O O   . PRO A 1 48  ? -52.591 -24.952 -23.986 1.00 59.25  ? 48  PRO A O   1 
ATOM   424  C CB  . PRO A 1 48  ? -49.797 -26.263 -22.991 1.00 52.65  ? 48  PRO A CB  1 
ATOM   425  C CG  . PRO A 1 48  ? -50.162 -27.579 -23.616 1.00 49.69  ? 48  PRO A CG  1 
ATOM   426  C CD  . PRO A 1 48  ? -51.002 -28.167 -22.502 1.00 48.94  ? 48  PRO A CD  1 
ATOM   427  N N   . GLN A 1 49  ? -51.658 -23.364 -22.685 1.00 61.00  ? 49  GLN A N   1 
ATOM   428  C CA  . GLN A 1 49  ? -52.332 -22.251 -23.360 1.00 64.61  ? 49  GLN A CA  1 
ATOM   429  C C   . GLN A 1 49  ? -51.431 -21.638 -24.414 1.00 62.76  ? 49  GLN A C   1 
ATOM   430  O O   . GLN A 1 49  ? -50.847 -20.561 -24.334 1.00 59.79  ? 49  GLN A O   1 
ATOM   431  C CB  . GLN A 1 49  ? -52.796 -21.190 -22.313 1.00 72.25  ? 49  GLN A CB  1 
ATOM   432  C CG  . GLN A 1 49  ? -51.814 -20.417 -21.394 1.00 84.07  ? 49  GLN A CG  1 
ATOM   433  C CD  . GLN A 1 49  ? -52.356 -19.872 -20.044 1.00 88.62  ? 49  GLN A CD  1 
ATOM   434  O OE1 . GLN A 1 49  ? -52.322 -20.537 -19.000 1.00 91.30  ? 49  GLN A OE1 1 
ATOM   435  N NE2 . GLN A 1 49  ? -52.840 -18.630 -19.968 1.00 93.17  ? 49  GLN A NE2 1 
ATOM   436  N N   . THR A 1 50  ? -51.403 -22.479 -25.444 1.00 62.79  ? 50  THR A N   1 
ATOM   437  C CA  . THR A 1 50  ? -50.626 -22.279 -26.655 1.00 66.79  ? 50  THR A CA  1 
ATOM   438  C C   . THR A 1 50  ? -51.222 -21.202 -27.572 1.00 67.94  ? 50  THR A C   1 
ATOM   439  O O   . THR A 1 50  ? -50.625 -20.773 -28.572 1.00 68.37  ? 50  THR A O   1 
ATOM   440  C CB  . THR A 1 50  ? -50.521 -23.639 -27.379 1.00 67.06  ? 50  THR A CB  1 
ATOM   441  O OG1 . THR A 1 50  ? -50.080 -24.572 -26.398 1.00 72.16  ? 50  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 50  ? -49.524 -23.643 -28.541 1.00 68.80  ? 50  THR A CG2 1 
ATOM   443  N N   . SER A 1 51  ? -52.434 -20.757 -27.208 1.00 68.10  ? 51  SER A N   1 
ATOM   444  C CA  . SER A 1 51  ? -53.096 -19.632 -27.848 1.00 66.87  ? 51  SER A CA  1 
ATOM   445  C C   . SER A 1 51  ? -52.276 -18.385 -27.578 1.00 63.41  ? 51  SER A C   1 
ATOM   446  O O   . SER A 1 51  ? -52.157 -17.527 -28.451 1.00 63.83  ? 51  SER A O   1 
ATOM   447  C CB  . SER A 1 51  ? -54.499 -19.445 -27.275 1.00 69.92  ? 51  SER A CB  1 
ATOM   448  O OG  . SER A 1 51  ? -55.308 -20.588 -27.518 1.00 75.22  ? 51  SER A OG  1 
ATOM   449  N N   . LEU A 1 52  ? -51.701 -18.352 -26.356 1.00 60.66  ? 52  LEU A N   1 
ATOM   450  C CA  . LEU A 1 52  ? -50.807 -17.295 -25.912 1.00 56.99  ? 52  LEU A CA  1 
ATOM   451  C C   . LEU A 1 52  ? -49.536 -17.287 -26.738 1.00 53.58  ? 52  LEU A C   1 
ATOM   452  O O   . LEU A 1 52  ? -48.972 -16.210 -26.907 1.00 56.32  ? 52  LEU A O   1 
ATOM   453  C CB  . LEU A 1 52  ? -50.370 -17.435 -24.431 1.00 55.31  ? 52  LEU A CB  1 
ATOM   454  C CG  . LEU A 1 52  ? -51.367 -17.362 -23.279 1.00 55.00  ? 52  LEU A CG  1 
ATOM   455  C CD1 . LEU A 1 52  ? -50.711 -16.694 -22.097 1.00 54.53  ? 52  LEU A CD1 1 
ATOM   456  C CD2 . LEU A 1 52  ? -52.521 -16.453 -23.599 1.00 57.58  ? 52  LEU A CD2 1 
ATOM   457  N N   . CYS A 1 53  ? -49.090 -18.438 -27.279 1.00 47.75  ? 53  CYS A N   1 
ATOM   458  C CA  . CYS A 1 53  ? -47.879 -18.500 -28.077 1.00 39.98  ? 53  CYS A CA  1 
ATOM   459  C C   . CYS A 1 53  ? -48.001 -17.755 -29.402 1.00 38.20  ? 53  CYS A C   1 
ATOM   460  O O   . CYS A 1 53  ? -48.874 -18.070 -30.201 1.00 35.57  ? 53  CYS A O   1 
ATOM   461  C CB  . CYS A 1 53  ? -47.515 -19.956 -28.323 1.00 37.09  ? 53  CYS A CB  1 
ATOM   462  S SG  . CYS A 1 53  ? -47.202 -20.903 -26.792 1.00 33.71  ? 53  CYS A SG  1 
ATOM   463  N N   . PRO A 1 54  ? -47.154 -16.730 -29.649 1.00 38.21  ? 54  PRO A N   1 
ATOM   464  C CA  . PRO A 1 54  ? -47.099 -15.938 -30.886 1.00 37.36  ? 54  PRO A CA  1 
ATOM   465  C C   . PRO A 1 54  ? -46.703 -16.734 -32.125 1.00 36.01  ? 54  PRO A C   1 
ATOM   466  O O   . PRO A 1 54  ? -47.034 -16.394 -33.259 1.00 38.57  ? 54  PRO A O   1 
ATOM   467  C CB  . PRO A 1 54  ? -46.101 -14.842 -30.613 1.00 37.03  ? 54  PRO A CB  1 
ATOM   468  C CG  . PRO A 1 54  ? -45.818 -14.906 -29.126 1.00 38.10  ? 54  PRO A CG  1 
ATOM   469  C CD  . PRO A 1 54  ? -46.039 -16.353 -28.777 1.00 35.77  ? 54  PRO A CD  1 
ATOM   470  N N   . SER A 1 55  ? -45.993 -17.823 -31.848 1.00 36.43  ? 55  SER A N   1 
ATOM   471  C CA  . SER A 1 55  ? -45.400 -18.712 -32.821 1.00 40.00  ? 55  SER A CA  1 
ATOM   472  C C   . SER A 1 55  ? -46.211 -19.930 -33.227 1.00 42.20  ? 55  SER A C   1 
ATOM   473  O O   . SER A 1 55  ? -45.680 -20.746 -33.985 1.00 40.73  ? 55  SER A O   1 
ATOM   474  C CB  . SER A 1 55  ? -44.086 -19.198 -32.265 1.00 41.01  ? 55  SER A CB  1 
ATOM   475  O OG  . SER A 1 55  ? -44.340 -20.129 -31.204 1.00 39.06  ? 55  SER A OG  1 
ATOM   476  N N   . GLU A 1 56  ? -47.418 -20.100 -32.668 1.00 46.21  ? 56  GLU A N   1 
ATOM   477  C CA  . GLU A 1 56  ? -48.312 -21.235 -32.911 1.00 53.74  ? 56  GLU A CA  1 
ATOM   478  C C   . GLU A 1 56  ? -48.334 -21.708 -34.383 1.00 54.96  ? 56  GLU A C   1 
ATOM   479  O O   . GLU A 1 56  ? -48.146 -22.892 -34.708 1.00 56.23  ? 56  GLU A O   1 
ATOM   480  C CB  . GLU A 1 56  ? -49.712 -20.785 -32.397 1.00 59.20  ? 56  GLU A CB  1 
ATOM   481  C CG  . GLU A 1 56  ? -50.878 -21.805 -32.294 1.00 68.08  ? 56  GLU A CG  1 
ATOM   482  C CD  . GLU A 1 56  ? -52.260 -21.317 -31.784 1.00 73.34  ? 56  GLU A CD  1 
ATOM   483  O OE1 . GLU A 1 56  ? -52.579 -20.120 -31.859 1.00 75.95  ? 56  GLU A OE1 1 
ATOM   484  O OE2 . GLU A 1 56  ? -53.041 -22.162 -31.317 1.00 75.07  ? 56  GLU A OE2 1 
ATOM   485  N N   . SER A 1 57  ? -48.437 -20.686 -35.254 1.00 55.34  ? 57  SER A N   1 
ATOM   486  C CA  . SER A 1 57  ? -48.492 -20.769 -36.723 1.00 55.16  ? 57  SER A CA  1 
ATOM   487  C C   . SER A 1 57  ? -47.273 -21.248 -37.519 1.00 52.21  ? 57  SER A C   1 
ATOM   488  O O   . SER A 1 57  ? -47.412 -21.741 -38.646 1.00 53.54  ? 57  SER A O   1 
ATOM   489  C CB  . SER A 1 57  ? -48.892 -19.386 -37.266 1.00 58.65  ? 57  SER A CB  1 
ATOM   490  O OG  . SER A 1 57  ? -48.059 -18.327 -36.764 1.00 65.45  ? 57  SER A OG  1 
ATOM   491  N N   . ILE A 1 58  ? -46.067 -21.040 -36.973 1.00 46.07  ? 58  ILE A N   1 
ATOM   492  C CA  . ILE A 1 58  ? -44.848 -21.431 -37.635 1.00 41.33  ? 58  ILE A CA  1 
ATOM   493  C C   . ILE A 1 58  ? -44.640 -22.932 -37.486 1.00 43.10  ? 58  ILE A C   1 
ATOM   494  O O   . ILE A 1 58  ? -44.629 -23.483 -36.389 1.00 43.85  ? 58  ILE A O   1 
ATOM   495  C CB  . ILE A 1 58  ? -43.717 -20.605 -37.032 1.00 37.72  ? 58  ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 58  ? -43.970 -19.165 -37.443 1.00 36.23  ? 58  ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 58  ? -42.341 -21.063 -37.524 1.00 35.37  ? 58  ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 58  ? -43.453 -18.084 -36.490 1.00 37.69  ? 58  ILE A CD1 1 
ATOM   499  N N   . PRO A 1 59  ? -44.535 -23.662 -38.603 1.00 45.46  ? 59  PRO A N   1 
ATOM   500  C CA  . PRO A 1 59  ? -44.257 -25.092 -38.595 1.00 43.71  ? 59  PRO A CA  1 
ATOM   501  C C   . PRO A 1 59  ? -42.804 -25.415 -38.291 1.00 41.06  ? 59  PRO A C   1 
ATOM   502  O O   . PRO A 1 59  ? -41.890 -24.989 -38.998 1.00 40.94  ? 59  PRO A O   1 
ATOM   503  C CB  . PRO A 1 59  ? -44.745 -25.518 -39.969 1.00 45.89  ? 59  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 59  ? -44.427 -24.324 -40.843 1.00 46.79  ? 59  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 59  ? -44.891 -23.190 -39.951 1.00 46.59  ? 59  PRO A CD  1 
ATOM   506  N N   . THR A 1 60  ? -42.625 -26.147 -37.195 1.00 37.38  ? 60  THR A N   1 
ATOM   507  C CA  . THR A 1 60  ? -41.312 -26.574 -36.770 1.00 39.37  ? 60  THR A CA  1 
ATOM   508  C C   . THR A 1 60  ? -41.147 -28.112 -36.747 1.00 40.07  ? 60  THR A C   1 
ATOM   509  O O   . THR A 1 60  ? -42.139 -28.834 -36.667 1.00 42.21  ? 60  THR A O   1 
ATOM   510  C CB  . THR A 1 60  ? -40.994 -25.921 -35.343 1.00 37.62  ? 60  THR A CB  1 
ATOM   511  O OG1 . THR A 1 60  ? -41.822 -26.495 -34.334 1.00 36.49  ? 60  THR A OG1 1 
ATOM   512  C CG2 . THR A 1 60  ? -41.178 -24.410 -35.387 1.00 32.45  ? 60  THR A CG2 1 
ATOM   513  N N   . PRO A 1 61  ? -39.945 -28.702 -36.845 1.00 42.18  ? 61  PRO A N   1 
ATOM   514  C CA  . PRO A 1 61  ? -39.725 -30.116 -36.599 1.00 44.88  ? 61  PRO A CA  1 
ATOM   515  C C   . PRO A 1 61  ? -40.053 -30.568 -35.188 1.00 50.20  ? 61  PRO A C   1 
ATOM   516  O O   . PRO A 1 61  ? -39.605 -30.051 -34.154 1.00 51.30  ? 61  PRO A O   1 
ATOM   517  C CB  . PRO A 1 61  ? -38.284 -30.355 -36.979 1.00 41.56  ? 61  PRO A CB  1 
ATOM   518  C CG  . PRO A 1 61  ? -37.648 -29.005 -36.914 1.00 40.65  ? 61  PRO A CG  1 
ATOM   519  C CD  . PRO A 1 61  ? -38.741 -28.070 -37.369 1.00 40.68  ? 61  PRO A CD  1 
ATOM   520  N N   . SER A 1 62  ? -40.950 -31.556 -35.264 1.00 57.33  ? 62  SER A N   1 
ATOM   521  C CA  . SER A 1 62  ? -41.526 -32.257 -34.117 1.00 62.27  ? 62  SER A CA  1 
ATOM   522  C C   . SER A 1 62  ? -40.589 -33.118 -33.264 1.00 63.01  ? 62  SER A C   1 
ATOM   523  O O   . SER A 1 62  ? -40.740 -33.132 -32.039 1.00 66.97  ? 62  SER A O   1 
ATOM   524  C CB  . SER A 1 62  ? -42.698 -33.118 -34.627 1.00 64.53  ? 62  SER A CB  1 
ATOM   525  O OG  . SER A 1 62  ? -42.400 -33.843 -35.824 1.00 70.34  ? 62  SER A OG  1 
ATOM   526  N N   . ASN A 1 63  ? -39.599 -33.819 -33.836 1.00 60.16  ? 63  ASN A N   1 
ATOM   527  C CA  . ASN A 1 63  ? -38.681 -34.683 -33.087 1.00 55.68  ? 63  ASN A CA  1 
ATOM   528  C C   . ASN A 1 63  ? -37.250 -34.448 -33.537 1.00 53.69  ? 63  ASN A C   1 
ATOM   529  O O   . ASN A 1 63  ? -37.073 -33.791 -34.567 1.00 52.54  ? 63  ASN A O   1 
ATOM   530  C CB  . ASN A 1 63  ? -39.100 -36.138 -33.319 1.00 57.21  ? 63  ASN A CB  1 
ATOM   531  C CG  . ASN A 1 63  ? -39.333 -36.492 -34.777 1.00 59.07  ? 63  ASN A CG  1 
ATOM   532  O OD1 . ASN A 1 63  ? -38.530 -37.218 -35.347 1.00 65.06  ? 63  ASN A OD1 1 
ATOM   533  N ND2 . ASN A 1 63  ? -40.389 -36.028 -35.454 1.00 61.28  ? 63  ASN A ND2 1 
ATOM   534  N N   . LYS A 1 64  ? -36.204 -34.965 -32.863 1.00 52.41  ? 64  LYS A N   1 
ATOM   535  C CA  . LYS A 1 64  ? -34.835 -34.689 -33.321 1.00 54.48  ? 64  LYS A CA  1 
ATOM   536  C C   . LYS A 1 64  ? -34.528 -35.237 -34.694 1.00 51.43  ? 64  LYS A C   1 
ATOM   537  O O   . LYS A 1 64  ? -33.704 -34.652 -35.396 1.00 51.87  ? 64  LYS A O   1 
ATOM   538  C CB  . LYS A 1 64  ? -33.719 -35.268 -32.461 1.00 59.99  ? 64  LYS A CB  1 
ATOM   539  C CG  . LYS A 1 64  ? -33.605 -34.727 -31.040 1.00 74.44  ? 64  LYS A CG  1 
ATOM   540  C CD  . LYS A 1 64  ? -33.416 -33.203 -30.823 1.00 81.15  ? 64  LYS A CD  1 
ATOM   541  C CE  . LYS A 1 64  ? -33.369 -32.887 -29.297 1.00 85.24  ? 64  LYS A CE  1 
ATOM   542  N NZ  . LYS A 1 64  ? -34.598 -33.236 -28.574 1.00 87.30  ? 64  LYS A NZ  1 
ATOM   543  N N   . GLU A 1 65  ? -35.187 -36.326 -35.109 1.00 45.96  ? 65  GLU A N   1 
ATOM   544  C CA  . GLU A 1 65  ? -34.904 -36.860 -36.411 1.00 40.87  ? 65  GLU A CA  1 
ATOM   545  C C   . GLU A 1 65  ? -35.612 -36.054 -37.492 1.00 41.11  ? 65  GLU A C   1 
ATOM   546  O O   . GLU A 1 65  ? -35.105 -36.020 -38.617 1.00 41.79  ? 65  GLU A O   1 
ATOM   547  C CB  . GLU A 1 65  ? -35.277 -38.347 -36.375 1.00 37.46  ? 65  GLU A CB  1 
ATOM   548  C CG  . GLU A 1 65  ? -36.545 -38.780 -37.016 1.00 27.80  ? 65  GLU A CG  1 
ATOM   549  C CD  . GLU A 1 65  ? -36.732 -40.282 -37.109 1.00 28.68  ? 65  GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 65  ? -36.228 -41.069 -36.293 1.00 25.61  ? 65  GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 65  ? -37.417 -40.657 -38.043 1.00 25.69  ? 65  GLU A OE2 1 
ATOM   552  N N   . GLU A 1 66  ? -36.720 -35.345 -37.221 1.00 40.07  ? 66  GLU A N   1 
ATOM   553  C CA  . GLU A 1 66  ? -37.250 -34.440 -38.241 1.00 43.27  ? 66  GLU A CA  1 
ATOM   554  C C   . GLU A 1 66  ? -36.405 -33.152 -38.372 1.00 41.30  ? 66  GLU A C   1 
ATOM   555  O O   . GLU A 1 66  ? -36.349 -32.504 -39.420 1.00 39.08  ? 66  GLU A O   1 
ATOM   556  C CB  . GLU A 1 66  ? -38.664 -34.030 -37.934 1.00 49.93  ? 66  GLU A CB  1 
ATOM   557  C CG  . GLU A 1 66  ? -39.194 -33.597 -39.297 1.00 62.50  ? 66  GLU A CG  1 
ATOM   558  C CD  . GLU A 1 66  ? -40.434 -32.719 -39.328 1.00 71.07  ? 66  GLU A CD  1 
ATOM   559  O OE1 . GLU A 1 66  ? -41.329 -32.887 -38.481 1.00 74.01  ? 66  GLU A OE1 1 
ATOM   560  O OE2 . GLU A 1 66  ? -40.478 -31.867 -40.228 1.00 74.51  ? 66  GLU A OE2 1 
ATOM   561  N N   . THR A 1 67  ? -35.755 -32.805 -37.260 1.00 38.41  ? 67  THR A N   1 
ATOM   562  C CA  . THR A 1 67  ? -34.791 -31.735 -37.172 1.00 40.54  ? 67  THR A CA  1 
ATOM   563  C C   . THR A 1 67  ? -33.556 -32.100 -38.024 1.00 42.76  ? 67  THR A C   1 
ATOM   564  O O   . THR A 1 67  ? -33.157 -31.312 -38.884 1.00 42.28  ? 67  THR A O   1 
ATOM   565  C CB  . THR A 1 67  ? -34.466 -31.551 -35.660 1.00 40.04  ? 67  THR A CB  1 
ATOM   566  O OG1 . THR A 1 67  ? -35.686 -31.150 -35.052 1.00 37.58  ? 67  THR A OG1 1 
ATOM   567  C CG2 . THR A 1 67  ? -33.381 -30.537 -35.362 1.00 40.20  ? 67  THR A CG2 1 
ATOM   568  N N   . GLN A 1 68  ? -32.956 -33.296 -37.877 1.00 45.85  ? 68  GLN A N   1 
ATOM   569  C CA  . GLN A 1 68  ? -31.805 -33.742 -38.680 1.00 49.08  ? 68  GLN A CA  1 
ATOM   570  C C   . GLN A 1 68  ? -32.008 -33.774 -40.199 1.00 47.90  ? 68  GLN A C   1 
ATOM   571  O O   . GLN A 1 68  ? -31.068 -33.599 -40.974 1.00 48.09  ? 68  GLN A O   1 
ATOM   572  C CB  . GLN A 1 68  ? -31.382 -35.132 -38.258 1.00 54.04  ? 68  GLN A CB  1 
ATOM   573  C CG  . GLN A 1 68  ? -30.944 -35.206 -36.795 1.00 67.13  ? 68  GLN A CG  1 
ATOM   574  C CD  . GLN A 1 68  ? -30.647 -36.633 -36.288 1.00 78.50  ? 68  GLN A CD  1 
ATOM   575  O OE1 . GLN A 1 68  ? -31.455 -37.578 -36.349 1.00 81.67  ? 68  GLN A OE1 1 
ATOM   576  N NE2 . GLN A 1 68  ? -29.429 -36.810 -35.752 1.00 84.42  ? 68  GLN A NE2 1 
ATOM   577  N N   . GLN A 1 69  ? -33.247 -33.964 -40.657 1.00 48.76  ? 69  GLN A N   1 
ATOM   578  C CA  . GLN A 1 69  ? -33.598 -33.993 -42.075 1.00 48.77  ? 69  GLN A CA  1 
ATOM   579  C C   . GLN A 1 69  ? -33.572 -32.621 -42.708 1.00 46.15  ? 69  GLN A C   1 
ATOM   580  O O   . GLN A 1 69  ? -33.547 -32.495 -43.929 1.00 47.66  ? 69  GLN A O   1 
ATOM   581  C CB  . GLN A 1 69  ? -35.011 -34.499 -42.328 1.00 54.79  ? 69  GLN A CB  1 
ATOM   582  C CG  . GLN A 1 69  ? -35.533 -35.865 -41.850 1.00 63.68  ? 69  GLN A CG  1 
ATOM   583  C CD  . GLN A 1 69  ? -37.072 -35.891 -41.917 1.00 70.73  ? 69  GLN A CD  1 
ATOM   584  O OE1 . GLN A 1 69  ? -37.726 -34.917 -42.337 1.00 73.27  ? 69  GLN A OE1 1 
ATOM   585  N NE2 . GLN A 1 69  ? -37.714 -36.989 -41.488 1.00 72.53  ? 69  GLN A NE2 1 
ATOM   586  N N   . LYS A 1 70  ? -33.671 -31.585 -41.872 1.00 43.87  ? 70  LYS A N   1 
ATOM   587  C CA  . LYS A 1 70  ? -33.752 -30.203 -42.336 1.00 39.76  ? 70  LYS A CA  1 
ATOM   588  C C   . LYS A 1 70  ? -32.395 -29.671 -42.692 1.00 33.68  ? 70  LYS A C   1 
ATOM   589  O O   . LYS A 1 70  ? -31.441 -29.970 -41.982 1.00 31.86  ? 70  LYS A O   1 
ATOM   590  C CB  . LYS A 1 70  ? -34.334 -29.320 -41.257 1.00 43.69  ? 70  LYS A CB  1 
ATOM   591  C CG  . LYS A 1 70  ? -35.771 -29.599 -40.873 1.00 47.89  ? 70  LYS A CG  1 
ATOM   592  C CD  . LYS A 1 70  ? -36.653 -28.969 -41.917 1.00 53.67  ? 70  LYS A CD  1 
ATOM   593  C CE  . LYS A 1 70  ? -38.099 -29.253 -41.587 1.00 57.73  ? 70  LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 70  ? -38.930 -28.447 -42.459 1.00 62.89  ? 70  LYS A NZ  1 
ATOM   595  N N   . SER A 1 71  ? -32.280 -28.897 -43.770 1.00 30.66  ? 71  SER A N   1 
ATOM   596  C CA  . SER A 1 71  ? -30.985 -28.326 -44.094 1.00 31.71  ? 71  SER A CA  1 
ATOM   597  C C   . SER A 1 71  ? -30.665 -27.197 -43.136 1.00 30.03  ? 71  SER A C   1 
ATOM   598  O O   . SER A 1 71  ? -31.517 -26.784 -42.361 1.00 29.73  ? 71  SER A O   1 
ATOM   599  C CB  . SER A 1 71  ? -30.958 -27.804 -45.541 1.00 28.32  ? 71  SER A CB  1 
ATOM   600  O OG  . SER A 1 71  ? -31.957 -26.872 -45.903 1.00 30.69  ? 71  SER A OG  1 
ATOM   601  N N   . ASN A 1 72  ? -29.401 -26.788 -43.097 1.00 29.30  ? 72  ASN A N   1 
ATOM   602  C CA  . ASN A 1 72  ? -29.013 -25.647 -42.313 1.00 30.08  ? 72  ASN A CA  1 
ATOM   603  C C   . ASN A 1 72  ? -29.773 -24.394 -42.695 1.00 28.84  ? 72  ASN A C   1 
ATOM   604  O O   . ASN A 1 72  ? -30.275 -23.749 -41.788 1.00 29.27  ? 72  ASN A O   1 
ATOM   605  C CB  . ASN A 1 72  ? -27.542 -25.407 -42.468 1.00 31.87  ? 72  ASN A CB  1 
ATOM   606  C CG  . ASN A 1 72  ? -26.734 -26.388 -41.654 1.00 34.93  ? 72  ASN A CG  1 
ATOM   607  O OD1 . ASN A 1 72  ? -27.209 -26.981 -40.698 1.00 36.04  ? 72  ASN A OD1 1 
ATOM   608  N ND2 . ASN A 1 72  ? -25.462 -26.565 -41.967 1.00 40.82  ? 72  ASN A ND2 1 
ATOM   609  N N   . LEU A 1 73  ? -29.993 -24.069 -43.971 1.00 25.66  ? 73  LEU A N   1 
ATOM   610  C CA  . LEU A 1 73  ? -30.708 -22.874 -44.359 1.00 27.08  ? 73  LEU A CA  1 
ATOM   611  C C   . LEU A 1 73  ? -32.167 -22.914 -43.975 1.00 28.43  ? 73  LEU A C   1 
ATOM   612  O O   . LEU A 1 73  ? -32.779 -21.883 -43.711 1.00 29.42  ? 73  LEU A O   1 
ATOM   613  C CB  . LEU A 1 73  ? -30.608 -22.684 -45.850 1.00 26.38  ? 73  LEU A CB  1 
ATOM   614  C CG  . LEU A 1 73  ? -30.772 -21.284 -46.395 1.00 31.05  ? 73  LEU A CG  1 
ATOM   615  C CD1 . LEU A 1 73  ? -29.980 -20.298 -45.552 1.00 22.53  ? 73  LEU A CD1 1 
ATOM   616  C CD2 . LEU A 1 73  ? -30.322 -21.285 -47.852 1.00 30.61  ? 73  LEU A CD2 1 
ATOM   617  N N   . GLU A 1 74  ? -32.716 -24.128 -43.962 1.00 29.14  ? 74  GLU A N   1 
ATOM   618  C CA  . GLU A 1 74  ? -34.090 -24.358 -43.553 1.00 29.55  ? 74  GLU A CA  1 
ATOM   619  C C   . GLU A 1 74  ? -34.244 -24.168 -42.058 1.00 26.45  ? 74  GLU A C   1 
ATOM   620  O O   . GLU A 1 74  ? -35.181 -23.492 -41.653 1.00 28.49  ? 74  GLU A O   1 
ATOM   621  C CB  . GLU A 1 74  ? -34.528 -25.770 -43.898 1.00 36.24  ? 74  GLU A CB  1 
ATOM   622  C CG  . GLU A 1 74  ? -34.920 -25.918 -45.373 1.00 43.88  ? 74  GLU A CG  1 
ATOM   623  C CD  . GLU A 1 74  ? -35.550 -27.269 -45.703 1.00 46.49  ? 74  GLU A CD  1 
ATOM   624  O OE1 . GLU A 1 74  ? -34.931 -28.314 -45.475 1.00 46.85  ? 74  GLU A OE1 1 
ATOM   625  O OE2 . GLU A 1 74  ? -36.682 -27.264 -46.181 1.00 49.81  ? 74  GLU A OE2 1 
ATOM   626  N N   . LEU A 1 75  ? -33.339 -24.743 -41.252 1.00 20.84  ? 75  LEU A N   1 
ATOM   627  C CA  . LEU A 1 75  ? -33.339 -24.561 -39.821 1.00 22.33  ? 75  LEU A CA  1 
ATOM   628  C C   . LEU A 1 75  ? -33.102 -23.103 -39.398 1.00 24.85  ? 75  LEU A C   1 
ATOM   629  O O   . LEU A 1 75  ? -33.645 -22.677 -38.381 1.00 23.35  ? 75  LEU A O   1 
ATOM   630  C CB  . LEU A 1 75  ? -32.279 -25.432 -39.196 1.00 19.17  ? 75  LEU A CB  1 
ATOM   631  C CG  . LEU A 1 75  ? -32.538 -26.936 -39.206 1.00 22.40  ? 75  LEU A CG  1 
ATOM   632  C CD1 . LEU A 1 75  ? -31.350 -27.659 -38.618 1.00 17.89  ? 75  LEU A CD1 1 
ATOM   633  C CD2 . LEU A 1 75  ? -33.836 -27.230 -38.437 1.00 19.82  ? 75  LEU A CD2 1 
ATOM   634  N N   . LEU A 1 76  ? -32.345 -22.319 -40.193 1.00 23.05  ? 76  LEU A N   1 
ATOM   635  C CA  . LEU A 1 76  ? -32.061 -20.900 -39.973 1.00 19.39  ? 76  LEU A CA  1 
ATOM   636  C C   . LEU A 1 76  ? -33.269 -20.076 -40.287 1.00 18.78  ? 76  LEU A C   1 
ATOM   637  O O   . LEU A 1 76  ? -33.586 -19.096 -39.616 1.00 25.48  ? 76  LEU A O   1 
ATOM   638  C CB  . LEU A 1 76  ? -30.907 -20.406 -40.869 1.00 16.98  ? 76  LEU A CB  1 
ATOM   639  C CG  . LEU A 1 76  ? -29.507 -20.817 -40.408 1.00 18.46  ? 76  LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 76  ? -28.492 -20.375 -41.438 1.00 16.76  ? 76  LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 76  ? -29.196 -20.214 -39.035 1.00 19.76  ? 76  LEU A CD2 1 
ATOM   642  N N   . ARG A 1 77  ? -33.956 -20.484 -41.327 1.00 18.19  ? 77  ARG A N   1 
ATOM   643  C CA  . ARG A 1 77  ? -35.150 -19.787 -41.717 1.00 23.54  ? 77  ARG A CA  1 
ATOM   644  C C   . ARG A 1 77  ? -36.256 -19.929 -40.653 1.00 23.97  ? 77  ARG A C   1 
ATOM   645  O O   . ARG A 1 77  ? -36.891 -18.933 -40.289 1.00 21.44  ? 77  ARG A O   1 
ATOM   646  C CB  . ARG A 1 77  ? -35.499 -20.384 -43.032 1.00 29.56  ? 77  ARG A CB  1 
ATOM   647  C CG  . ARG A 1 77  ? -36.393 -19.628 -43.983 1.00 43.81  ? 77  ARG A CG  1 
ATOM   648  C CD  . ARG A 1 77  ? -35.643 -19.551 -45.324 1.00 56.59  ? 77  ARG A CD  1 
ATOM   649  N NE  . ARG A 1 77  ? -35.054 -20.822 -45.766 1.00 65.58  ? 77  ARG A NE  1 
ATOM   650  C CZ  . ARG A 1 77  ? -34.593 -21.014 -47.010 1.00 70.25  ? 77  ARG A CZ  1 
ATOM   651  N NH1 . ARG A 1 77  ? -34.637 -20.044 -47.937 1.00 72.82  ? 77  ARG A NH1 1 
ATOM   652  N NH2 . ARG A 1 77  ? -34.074 -22.207 -47.324 1.00 71.75  ? 77  ARG A NH2 1 
ATOM   653  N N   . ILE A 1 78  ? -36.468 -21.174 -40.158 1.00 26.10  ? 78  ILE A N   1 
ATOM   654  C CA  . ILE A 1 78  ? -37.406 -21.493 -39.070 1.00 25.97  ? 78  ILE A CA  1 
ATOM   655  C C   . ILE A 1 78  ? -37.013 -20.733 -37.764 1.00 24.75  ? 78  ILE A C   1 
ATOM   656  O O   . ILE A 1 78  ? -37.865 -20.106 -37.134 1.00 23.88  ? 78  ILE A O   1 
ATOM   657  C CB  . ILE A 1 78  ? -37.397 -23.049 -38.858 1.00 25.75  ? 78  ILE A CB  1 
ATOM   658  C CG1 . ILE A 1 78  ? -37.957 -23.785 -40.052 1.00 26.03  ? 78  ILE A CG1 1 
ATOM   659  C CG2 . ILE A 1 78  ? -38.261 -23.408 -37.657 1.00 27.04  ? 78  ILE A CG2 1 
ATOM   660  C CD1 . ILE A 1 78  ? -37.536 -25.291 -39.964 1.00 26.31  ? 78  ILE A CD1 1 
ATOM   661  N N   . SER A 1 79  ? -35.744 -20.771 -37.314 1.00 21.84  ? 79  SER A N   1 
ATOM   662  C CA  . SER A 1 79  ? -35.269 -20.013 -36.170 1.00 20.25  ? 79  SER A CA  1 
ATOM   663  C C   . SER A 1 79  ? -35.555 -18.528 -36.374 1.00 19.87  ? 79  SER A C   1 
ATOM   664  O O   . SER A 1 79  ? -36.068 -17.884 -35.458 1.00 21.19  ? 79  SER A O   1 
ATOM   665  C CB  . SER A 1 79  ? -33.762 -20.229 -35.975 1.00 15.60  ? 79  SER A CB  1 
ATOM   666  O OG  . SER A 1 79  ? -33.536 -21.568 -35.566 1.00 21.15  ? 79  SER A OG  1 
ATOM   667  N N   . LEU A 1 80  ? -35.363 -17.957 -37.568 1.00 19.48  ? 80  LEU A N   1 
ATOM   668  C CA  . LEU A 1 80  ? -35.618 -16.530 -37.764 1.00 21.77  ? 80  LEU A CA  1 
ATOM   669  C C   . LEU A 1 80  ? -37.096 -16.141 -37.569 1.00 21.13  ? 80  LEU A C   1 
ATOM   670  O O   . LEU A 1 80  ? -37.456 -15.123 -36.978 1.00 18.25  ? 80  LEU A O   1 
ATOM   671  C CB  . LEU A 1 80  ? -35.147 -16.145 -39.168 1.00 21.20  ? 80  LEU A CB  1 
ATOM   672  C CG  . LEU A 1 80  ? -35.311 -14.687 -39.598 1.00 22.50  ? 80  LEU A CG  1 
ATOM   673  C CD1 . LEU A 1 80  ? -34.403 -13.816 -38.750 1.00 22.08  ? 80  LEU A CD1 1 
ATOM   674  C CD2 . LEU A 1 80  ? -34.940 -14.518 -41.054 1.00 24.43  ? 80  LEU A CD2 1 
ATOM   675  N N   . LEU A 1 81  ? -37.983 -16.985 -38.080 1.00 21.54  ? 81  LEU A N   1 
ATOM   676  C CA  . LEU A 1 81  ? -39.405 -16.745 -37.976 1.00 22.13  ? 81  LEU A CA  1 
ATOM   677  C C   . LEU A 1 81  ? -39.852 -16.860 -36.533 1.00 19.74  ? 81  LEU A C   1 
ATOM   678  O O   . LEU A 1 81  ? -40.726 -16.094 -36.156 1.00 21.55  ? 81  LEU A O   1 
ATOM   679  C CB  . LEU A 1 81  ? -40.164 -17.748 -38.840 1.00 21.41  ? 81  LEU A CB  1 
ATOM   680  C CG  . LEU A 1 81  ? -39.829 -17.800 -40.330 1.00 27.42  ? 81  LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 81  ? -40.575 -18.942 -40.965 1.00 28.09  ? 81  LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 81  ? -40.177 -16.488 -40.994 1.00 26.63  ? 81  LEU A CD2 1 
ATOM   683  N N   . LEU A 1 82  ? -39.263 -17.752 -35.722 1.00 20.50  ? 82  LEU A N   1 
ATOM   684  C CA  . LEU A 1 82  ? -39.607 -17.869 -34.310 1.00 20.04  ? 82  LEU A CA  1 
ATOM   685  C C   . LEU A 1 82  ? -39.072 -16.668 -33.535 1.00 20.80  ? 82  LEU A C   1 
ATOM   686  O O   . LEU A 1 82  ? -39.747 -16.172 -32.649 1.00 23.16  ? 82  LEU A O   1 
ATOM   687  C CB  . LEU A 1 82  ? -39.044 -19.194 -33.715 1.00 20.08  ? 82  LEU A CB  1 
ATOM   688  C CG  . LEU A 1 82  ? -39.585 -20.605 -34.119 1.00 18.39  ? 82  LEU A CG  1 
ATOM   689  C CD1 . LEU A 1 82  ? -38.781 -21.687 -33.413 1.00 15.52  ? 82  LEU A CD1 1 
ATOM   690  C CD2 . LEU A 1 82  ? -41.030 -20.769 -33.703 1.00 18.04  ? 82  LEU A CD2 1 
ATOM   691  N N   . ILE A 1 83  ? -37.893 -16.123 -33.805 1.00 19.22  ? 83  ILE A N   1 
ATOM   692  C CA  . ILE A 1 83  ? -37.430 -14.897 -33.166 1.00 22.63  ? 83  ILE A CA  1 
ATOM   693  C C   . ILE A 1 83  ? -38.263 -13.698 -33.617 1.00 21.92  ? 83  ILE A C   1 
ATOM   694  O O   . ILE A 1 83  ? -38.635 -12.877 -32.793 1.00 21.95  ? 83  ILE A O   1 
ATOM   695  C CB  . ILE A 1 83  ? -35.930 -14.669 -33.505 1.00 23.38  ? 83  ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 83  ? -35.078 -15.763 -32.836 1.00 26.07  ? 83  ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 83  ? -35.468 -13.307 -33.016 1.00 22.85  ? 83  ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 83  ? -35.251 -15.885 -31.293 1.00 28.00  ? 83  ILE A CD1 1 
ATOM   699  N N   . GLN A 1 84  ? -38.621 -13.605 -34.900 1.00 22.07  ? 84  GLN A N   1 
ATOM   700  C CA  . GLN A 1 84  ? -39.386 -12.498 -35.408 1.00 21.09  ? 84  GLN A CA  1 
ATOM   701  C C   . GLN A 1 84  ? -40.783 -12.483 -34.835 1.00 23.37  ? 84  GLN A C   1 
ATOM   702  O O   . GLN A 1 84  ? -41.332 -11.401 -34.654 1.00 25.98  ? 84  GLN A O   1 
ATOM   703  C CB  . GLN A 1 84  ? -39.449 -12.560 -36.937 1.00 20.22  ? 84  GLN A CB  1 
ATOM   704  C CG  . GLN A 1 84  ? -38.142 -12.075 -37.506 1.00 22.46  ? 84  GLN A CG  1 
ATOM   705  C CD  . GLN A 1 84  ? -38.056 -12.001 -39.013 1.00 24.35  ? 84  GLN A CD  1 
ATOM   706  O OE1 . GLN A 1 84  ? -37.231 -11.255 -39.550 1.00 28.65  ? 84  GLN A OE1 1 
ATOM   707  N NE2 . GLN A 1 84  ? -38.843 -12.776 -39.749 1.00 26.47  ? 84  GLN A NE2 1 
ATOM   708  N N   . SER A 1 85  ? -41.397 -13.616 -34.485 1.00 23.06  ? 85  SER A N   1 
ATOM   709  C CA  . SER A 1 85  ? -42.736 -13.590 -33.896 1.00 22.38  ? 85  SER A CA  1 
ATOM   710  C C   . SER A 1 85  ? -42.685 -13.142 -32.429 1.00 20.09  ? 85  SER A C   1 
ATOM   711  O O   . SER A 1 85  ? -43.703 -12.847 -31.827 1.00 22.32  ? 85  SER A O   1 
ATOM   712  C CB  . SER A 1 85  ? -43.348 -14.988 -34.020 1.00 24.98  ? 85  SER A CB  1 
ATOM   713  O OG  . SER A 1 85  ? -42.700 -15.903 -33.156 1.00 27.16  ? 85  SER A OG  1 
ATOM   714  N N   . TRP A 1 86  ? -41.520 -13.077 -31.787 1.00 18.64  ? 86  TRP A N   1 
ATOM   715  C CA  . TRP A 1 86  ? -41.442 -12.589 -30.431 1.00 16.99  ? 86  TRP A CA  1 
ATOM   716  C C   . TRP A 1 86  ? -41.104 -11.121 -30.280 1.00 18.60  ? 86  TRP A C   1 
ATOM   717  O O   . TRP A 1 86  ? -41.185 -10.584 -29.181 1.00 17.23  ? 86  TRP A O   1 
ATOM   718  C CB  . TRP A 1 86  ? -40.411 -13.367 -29.674 1.00 17.82  ? 86  TRP A CB  1 
ATOM   719  C CG  . TRP A 1 86  ? -41.044 -14.580 -29.069 1.00 20.73  ? 86  TRP A CG  1 
ATOM   720  C CD1 . TRP A 1 86  ? -40.939 -15.798 -29.671 1.00 18.13  ? 86  TRP A CD1 1 
ATOM   721  C CD2 . TRP A 1 86  ? -41.799 -14.570 -27.922 1.00 20.86  ? 86  TRP A CD2 1 
ATOM   722  N NE1 . TRP A 1 86  ? -41.644 -16.574 -28.910 1.00 18.79  ? 86  TRP A NE1 1 
ATOM   723  C CE2 . TRP A 1 86  ? -42.180 -15.905 -27.861 1.00 21.82  ? 86  TRP A CE2 1 
ATOM   724  C CE3 . TRP A 1 86  ? -42.212 -13.650 -26.966 1.00 20.04  ? 86  TRP A CE3 1 
ATOM   725  C CZ2 . TRP A 1 86  ? -43.002 -16.353 -26.821 1.00 24.65  ? 86  TRP A CZ2 1 
ATOM   726  C CZ3 . TRP A 1 86  ? -43.027 -14.095 -25.938 1.00 21.53  ? 86  TRP A CZ3 1 
ATOM   727  C CH2 . TRP A 1 86  ? -43.419 -15.429 -25.868 1.00 22.35  ? 86  TRP A CH2 1 
ATOM   728  N N   . LEU A 1 87  ? -40.703 -10.433 -31.352 1.00 20.58  ? 87  LEU A N   1 
ATOM   729  C CA  . LEU A 1 87  ? -40.227 -9.055  -31.243 1.00 22.24  ? 87  LEU A CA  1 
ATOM   730  C C   . LEU A 1 87  ? -41.211 -8.052  -30.629 1.00 20.54  ? 87  LEU A C   1 
ATOM   731  O O   . LEU A 1 87  ? -40.796 -7.210  -29.820 1.00 17.63  ? 87  LEU A O   1 
ATOM   732  C CB  . LEU A 1 87  ? -39.756 -8.589  -32.657 1.00 20.13  ? 87  LEU A CB  1 
ATOM   733  C CG  . LEU A 1 87  ? -38.443 -9.198  -33.098 1.00 16.32  ? 87  LEU A CG  1 
ATOM   734  C CD1 . LEU A 1 87  ? -38.139 -8.655  -34.462 1.00 18.67  ? 87  LEU A CD1 1 
ATOM   735  C CD2 . LEU A 1 87  ? -37.335 -8.907  -32.103 1.00 16.15  ? 87  LEU A CD2 1 
ATOM   736  N N   . GLU A 1 88  ? -42.500 -8.169  -30.993 1.00 21.18  ? 88  GLU A N   1 
ATOM   737  C CA  . GLU A 1 88  ? -43.502 -7.324  -30.375 1.00 24.65  ? 88  GLU A CA  1 
ATOM   738  C C   . GLU A 1 88  ? -44.040 -7.930  -29.070 1.00 22.41  ? 88  GLU A C   1 
ATOM   739  O O   . GLU A 1 88  ? -44.005 -7.213  -28.058 1.00 24.86  ? 88  GLU A O   1 
ATOM   740  C CB  . GLU A 1 88  ? -44.618 -7.056  -31.407 1.00 28.14  ? 88  GLU A CB  1 
ATOM   741  C CG  . GLU A 1 88  ? -44.162 -6.225  -32.631 1.00 39.42  ? 88  GLU A CG  1 
ATOM   742  C CD  . GLU A 1 88  ? -43.408 -4.899  -32.347 1.00 49.79  ? 88  GLU A CD  1 
ATOM   743  O OE1 . GLU A 1 88  ? -44.040 -3.871  -32.044 1.00 51.65  ? 88  GLU A OE1 1 
ATOM   744  O OE2 . GLU A 1 88  ? -42.170 -4.889  -32.451 1.00 51.64  ? 88  GLU A OE2 1 
ATOM   745  N N   . PRO A 1 89  ? -44.447 -9.222  -28.965 1.00 21.79  ? 89  PRO A N   1 
ATOM   746  C CA  . PRO A 1 89  ? -44.795 -9.923  -27.729 1.00 20.25  ? 89  PRO A CA  1 
ATOM   747  C C   . PRO A 1 89  ? -43.927 -9.776  -26.491 1.00 20.08  ? 89  PRO A C   1 
ATOM   748  O O   . PRO A 1 89  ? -44.473 -9.594  -25.415 1.00 21.12  ? 89  PRO A O   1 
ATOM   749  C CB  . PRO A 1 89  ? -44.889 -11.371 -28.134 1.00 20.65  ? 89  PRO A CB  1 
ATOM   750  C CG  . PRO A 1 89  ? -45.436 -11.289 -29.512 1.00 18.24  ? 89  PRO A CG  1 
ATOM   751  C CD  . PRO A 1 89  ? -44.603 -10.179 -30.066 1.00 20.70  ? 89  PRO A CD  1 
ATOM   752  N N   . VAL A 1 90  ? -42.590 -9.801  -26.592 1.00 16.66  ? 90  VAL A N   1 
ATOM   753  C CA  . VAL A 1 90  ? -41.741 -9.818  -25.430 1.00 14.75  ? 90  VAL A CA  1 
ATOM   754  C C   . VAL A 1 90  ? -41.857 -8.603  -24.530 1.00 18.61  ? 90  VAL A C   1 
ATOM   755  O O   . VAL A 1 90  ? -41.499 -8.694  -23.349 1.00 18.47  ? 90  VAL A O   1 
ATOM   756  C CB  . VAL A 1 90  ? -40.287 -10.038 -25.927 1.00 16.10  ? 90  VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 90  ? -39.694 -8.803  -26.599 1.00 14.44  ? 90  VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 90  ? -39.463 -10.456 -24.733 1.00 18.37  ? 90  VAL A CG2 1 
ATOM   759  N N   . GLN A 1 91  ? -42.401 -7.474  -25.040 1.00 21.75  ? 91  GLN A N   1 
ATOM   760  C CA  . GLN A 1 91  ? -42.556 -6.277  -24.205 1.00 24.77  ? 91  GLN A CA  1 
ATOM   761  C C   . GLN A 1 91  ? -43.473 -6.560  -23.010 1.00 23.03  ? 91  GLN A C   1 
ATOM   762  O O   . GLN A 1 91  ? -43.253 -6.038  -21.922 1.00 21.16  ? 91  GLN A O   1 
ATOM   763  C CB  . GLN A 1 91  ? -43.167 -5.059  -24.979 1.00 28.42  ? 91  GLN A CB  1 
ATOM   764  C CG  . GLN A 1 91  ? -42.696 -4.706  -26.382 1.00 33.60  ? 91  GLN A CG  1 
ATOM   765  C CD  . GLN A 1 91  ? -41.225 -4.861  -26.773 1.00 35.34  ? 91  GLN A CD  1 
ATOM   766  O OE1 . GLN A 1 91  ? -40.252 -4.406  -26.161 1.00 31.97  ? 91  GLN A OE1 1 
ATOM   767  N NE2 . GLN A 1 91  ? -41.094 -5.528  -27.913 1.00 37.83  ? 91  GLN A NE2 1 
ATOM   768  N N   . PHE A 1 92  ? -44.444 -7.460  -23.194 1.00 22.79  ? 92  PHE A N   1 
ATOM   769  C CA  . PHE A 1 92  ? -45.352 -7.869  -22.126 1.00 27.82  ? 92  PHE A CA  1 
ATOM   770  C C   . PHE A 1 92  ? -44.684 -8.605  -20.962 1.00 28.01  ? 92  PHE A C   1 
ATOM   771  O O   . PHE A 1 92  ? -45.242 -8.688  -19.854 1.00 27.65  ? 92  PHE A O   1 
ATOM   772  C CB  . PHE A 1 92  ? -46.461 -8.762  -22.696 1.00 31.15  ? 92  PHE A CB  1 
ATOM   773  C CG  . PHE A 1 92  ? -47.177 -8.124  -23.875 1.00 42.13  ? 92  PHE A CG  1 
ATOM   774  C CD1 . PHE A 1 92  ? -47.460 -6.757  -23.882 1.00 46.72  ? 92  PHE A CD1 1 
ATOM   775  C CD2 . PHE A 1 92  ? -47.510 -8.913  -24.967 1.00 46.77  ? 92  PHE A CD2 1 
ATOM   776  C CE1 . PHE A 1 92  ? -48.069 -6.181  -24.981 1.00 47.25  ? 92  PHE A CE1 1 
ATOM   777  C CE2 . PHE A 1 92  ? -48.119 -8.328  -26.061 1.00 50.15  ? 92  PHE A CE2 1 
ATOM   778  C CZ  . PHE A 1 92  ? -48.393 -6.968  -26.063 1.00 49.74  ? 92  PHE A CZ  1 
ATOM   779  N N   . LEU A 1 93  ? -43.463 -9.122  -21.198 1.00 23.98  ? 93  LEU A N   1 
ATOM   780  C CA  . LEU A 1 93  ? -42.786 -9.855  -20.155 1.00 21.17  ? 93  LEU A CA  1 
ATOM   781  C C   . LEU A 1 93  ? -41.863 -8.976  -19.368 1.00 19.18  ? 93  LEU A C   1 
ATOM   782  O O   . LEU A 1 93  ? -41.235 -9.444  -18.435 1.00 18.93  ? 93  LEU A O   1 
ATOM   783  C CB  . LEU A 1 93  ? -42.021 -11.040 -20.776 1.00 19.89  ? 93  LEU A CB  1 
ATOM   784  C CG  . LEU A 1 93  ? -42.858 -12.112 -21.469 1.00 21.05  ? 93  LEU A CG  1 
ATOM   785  C CD1 . LEU A 1 93  ? -41.976 -13.261 -21.891 1.00 24.59  ? 93  LEU A CD1 1 
ATOM   786  C CD2 . LEU A 1 93  ? -43.890 -12.670 -20.514 1.00 21.66  ? 93  LEU A CD2 1 
ATOM   787  N N   . ARG A 1 94  ? -41.788 -7.685  -19.687 1.00 19.88  ? 94  ARG A N   1 
ATOM   788  C CA  . ARG A 1 94  ? -40.965 -6.725  -18.979 1.00 21.12  ? 94  ARG A CA  1 
ATOM   789  C C   . ARG A 1 94  ? -41.107 -6.756  -17.457 1.00 18.56  ? 94  ARG A C   1 
ATOM   790  O O   . ARG A 1 94  ? -40.123 -6.752  -16.721 1.00 17.02  ? 94  ARG A O   1 
ATOM   791  C CB  . ARG A 1 94  ? -41.329 -5.338  -19.524 1.00 30.13  ? 94  ARG A CB  1 
ATOM   792  C CG  . ARG A 1 94  ? -40.345 -4.248  -19.190 1.00 35.39  ? 94  ARG A CG  1 
ATOM   793  C CD  . ARG A 1 94  ? -40.917 -3.329  -18.152 1.00 44.50  ? 94  ARG A CD  1 
ATOM   794  N NE  . ARG A 1 94  ? -39.788 -2.769  -17.432 1.00 57.20  ? 94  ARG A NE  1 
ATOM   795  C CZ  . ARG A 1 94  ? -39.901 -2.250  -16.197 1.00 64.00  ? 94  ARG A CZ  1 
ATOM   796  N NH1 . ARG A 1 94  ? -41.079 -2.201  -15.554 1.00 66.62  ? 94  ARG A NH1 1 
ATOM   797  N NH2 . ARG A 1 94  ? -38.810 -1.764  -15.588 1.00 65.01  ? 94  ARG A NH2 1 
ATOM   798  N N   . SER A 1 95  ? -42.327 -6.792  -16.924 1.00 20.61  ? 95  SER A N   1 
ATOM   799  C CA  . SER A 1 95  ? -42.478 -6.793  -15.467 1.00 25.07  ? 95  SER A CA  1 
ATOM   800  C C   . SER A 1 95  ? -42.028 -8.028  -14.734 1.00 20.11  ? 95  SER A C   1 
ATOM   801  O O   . SER A 1 95  ? -41.592 -7.944  -13.586 1.00 17.84  ? 95  SER A O   1 
ATOM   802  C CB  . SER A 1 95  ? -43.925 -6.523  -15.103 1.00 32.06  ? 95  SER A CB  1 
ATOM   803  O OG  . SER A 1 95  ? -44.187 -5.194  -15.559 1.00 49.26  ? 95  SER A OG  1 
ATOM   804  N N   . VAL A 1 96  ? -42.154 -9.168  -15.430 1.00 18.85  ? 96  VAL A N   1 
ATOM   805  C CA  . VAL A 1 96  ? -41.616 -10.426 -14.920 1.00 18.78  ? 96  VAL A CA  1 
ATOM   806  C C   . VAL A 1 96  ? -40.117 -10.324 -14.667 1.00 17.10  ? 96  VAL A C   1 
ATOM   807  O O   . VAL A 1 96  ? -39.626 -10.604 -13.566 1.00 18.13  ? 96  VAL A O   1 
ATOM   808  C CB  . VAL A 1 96  ? -41.862 -11.566 -15.932 1.00 21.84  ? 96  VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 96  ? -41.218 -12.884 -15.487 1.00 19.57  ? 96  VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 96  ? -43.342 -11.732 -16.063 1.00 22.98  ? 96  VAL A CG2 1 
ATOM   811  N N   . PHE A 1 97  ? -39.385 -9.892  -15.712 1.00 15.65  ? 97  PHE A N   1 
ATOM   812  C CA  . PHE A 1 97  ? -37.933 -9.835  -15.645 1.00 13.14  ? 97  PHE A CA  1 
ATOM   813  C C   . PHE A 1 97  ? -37.524 -8.744  -14.672 1.00 13.81  ? 97  PHE A C   1 
ATOM   814  O O   . PHE A 1 97  ? -36.569 -8.928  -13.917 1.00 13.57  ? 97  PHE A O   1 
ATOM   815  C CB  . PHE A 1 97  ? -37.359 -9.554  -17.053 1.00 15.66  ? 97  PHE A CB  1 
ATOM   816  C CG  . PHE A 1 97  ? -37.622 -10.674 -18.064 1.00 20.01  ? 97  PHE A CG  1 
ATOM   817  C CD1 . PHE A 1 97  ? -36.964 -11.878 -17.973 1.00 23.53  ? 97  PHE A CD1 1 
ATOM   818  C CD2 . PHE A 1 97  ? -38.540 -10.508 -19.078 1.00 21.40  ? 97  PHE A CD2 1 
ATOM   819  C CE1 . PHE A 1 97  ? -37.227 -12.897 -18.877 1.00 21.71  ? 97  PHE A CE1 1 
ATOM   820  C CE2 . PHE A 1 97  ? -38.800 -11.526 -19.973 1.00 24.42  ? 97  PHE A CE2 1 
ATOM   821  C CZ  . PHE A 1 97  ? -38.147 -12.730 -19.881 1.00 21.95  ? 97  PHE A CZ  1 
ATOM   822  N N   . ALA A 1 98  ? -38.258 -7.602  -14.611 1.00 14.27  ? 98  ALA A N   1 
ATOM   823  C CA  . ALA A 1 98  ? -37.920 -6.528  -13.671 1.00 14.29  ? 98  ALA A CA  1 
ATOM   824  C C   . ALA A 1 98  ? -38.088 -7.009  -12.215 1.00 16.17  ? 98  ALA A C   1 
ATOM   825  O O   . ALA A 1 98  ? -37.333 -6.675  -11.293 1.00 19.82  ? 98  ALA A O   1 
ATOM   826  C CB  . ALA A 1 98  ? -38.830 -5.336  -13.932 1.00 12.15  ? 98  ALA A CB  1 
ATOM   827  N N   . ASN A 1 99  ? -39.037 -7.904  -11.969 1.00 18.89  ? 99  ASN A N   1 
ATOM   828  C CA  . ASN A 1 99  ? -39.211 -8.452  -10.632 1.00 20.31  ? 99  ASN A CA  1 
ATOM   829  C C   . ASN A 1 99  ? -38.380 -9.660  -10.235 1.00 21.00  ? 99  ASN A C   1 
ATOM   830  O O   . ASN A 1 99  ? -38.309 -10.065 -9.071  1.00 17.56  ? 99  ASN A O   1 
ATOM   831  C CB  . ASN A 1 99  ? -40.644 -8.773  -10.497 1.00 27.40  ? 99  ASN A CB  1 
ATOM   832  C CG  . ASN A 1 99  ? -41.346 -7.535  -10.007 1.00 35.17  ? 99  ASN A CG  1 
ATOM   833  O OD1 . ASN A 1 99  ? -41.507 -7.379  -8.793  1.00 44.56  ? 99  ASN A OD1 1 
ATOM   834  N ND2 . ASN A 1 99  ? -41.744 -6.639  -10.914 1.00 32.83  ? 99  ASN A ND2 1 
ATOM   835  N N   . SER A 1 100 ? -37.745 -10.269 -11.236 1.00 19.90  ? 100 SER A N   1 
ATOM   836  C CA  . SER A 1 100 ? -37.023 -11.497 -11.010 1.00 17.02  ? 100 SER A CA  1 
ATOM   837  C C   . SER A 1 100 ? -35.785 -11.312 -10.172 1.00 15.25  ? 100 SER A C   1 
ATOM   838  O O   . SER A 1 100 ? -35.140 -10.276 -10.252 1.00 18.02  ? 100 SER A O   1 
ATOM   839  C CB  . SER A 1 100 ? -36.717 -12.062 -12.396 1.00 15.44  ? 100 SER A CB  1 
ATOM   840  O OG  . SER A 1 100 ? -35.931 -13.223 -12.280 1.00 17.52  ? 100 SER A OG  1 
ATOM   841  N N   . LEU A 1 101 ? -35.449 -12.254 -9.289  1.00 12.33  ? 101 LEU A N   1 
ATOM   842  C CA  . LEU A 1 101 ? -34.183 -12.238 -8.577  1.00 12.12  ? 101 LEU A CA  1 
ATOM   843  C C   . LEU A 1 101 ? -33.106 -13.055 -9.299  1.00 11.23  ? 101 LEU A C   1 
ATOM   844  O O   . LEU A 1 101 ? -32.017 -13.182 -8.771  1.00 11.87  ? 101 LEU A O   1 
ATOM   845  C CB  . LEU A 1 101 ? -34.367 -12.811 -7.186  1.00 14.34  ? 101 LEU A CB  1 
ATOM   846  C CG  . LEU A 1 101 ? -35.381 -12.175 -6.253  1.00 18.15  ? 101 LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 101 ? -35.376 -12.852 -4.891  1.00 23.11  ? 101 LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 101 ? -34.989 -10.732 -6.051  1.00 22.01  ? 101 LEU A CD2 1 
ATOM   849  N N   . VAL A 1 102 ? -33.384 -13.660 -10.458 1.00 13.54  ? 102 VAL A N   1 
ATOM   850  C CA  . VAL A 1 102 ? -32.459 -14.491 -11.235 1.00 15.62  ? 102 VAL A CA  1 
ATOM   851  C C   . VAL A 1 102 ? -31.447 -13.542 -11.819 1.00 15.08  ? 102 VAL A C   1 
ATOM   852  O O   . VAL A 1 102 ? -31.790 -12.522 -12.419 1.00 15.62  ? 102 VAL A O   1 
ATOM   853  C CB  . VAL A 1 102 ? -33.168 -15.237 -12.421 1.00 15.72  ? 102 VAL A CB  1 
ATOM   854  C CG1 . VAL A 1 102 ? -32.169 -15.907 -13.405 1.00 11.54  ? 102 VAL A CG1 1 
ATOM   855  C CG2 . VAL A 1 102 ? -34.090 -16.287 -11.798 1.00 10.75  ? 102 VAL A CG2 1 
ATOM   856  N N   . TYR A 1 103 ? -30.191 -13.932 -11.642 1.00 17.68  ? 103 TYR A N   1 
ATOM   857  C CA  . TYR A 1 103 ? -29.071 -13.132 -12.092 1.00 18.62  ? 103 TYR A CA  1 
ATOM   858  C C   . TYR A 1 103 ? -29.254 -12.743 -13.554 1.00 19.26  ? 103 TYR A C   1 
ATOM   859  O O   . TYR A 1 103 ? -29.545 -13.569 -14.419 1.00 22.85  ? 103 TYR A O   1 
ATOM   860  C CB  . TYR A 1 103 ? -27.779 -13.932 -11.889 1.00 17.79  ? 103 TYR A CB  1 
ATOM   861  C CG  . TYR A 1 103 ? -26.607 -13.242 -12.561 1.00 22.48  ? 103 TYR A CG  1 
ATOM   862  C CD1 . TYR A 1 103 ? -26.156 -12.043 -12.049 1.00 24.83  ? 103 TYR A CD1 1 
ATOM   863  C CD2 . TYR A 1 103 ? -26.044 -13.790 -13.705 1.00 26.03  ? 103 TYR A CD2 1 
ATOM   864  C CE1 . TYR A 1 103 ? -25.131 -11.380 -12.688 1.00 27.69  ? 103 TYR A CE1 1 
ATOM   865  C CE2 . TYR A 1 103 ? -25.009 -13.128 -14.348 1.00 31.56  ? 103 TYR A CE2 1 
ATOM   866  C CZ  . TYR A 1 103 ? -24.562 -11.918 -13.829 1.00 31.93  ? 103 TYR A CZ  1 
ATOM   867  O OH  . TYR A 1 103 ? -23.520 -11.229 -14.451 1.00 36.08  ? 103 TYR A OH  1 
ATOM   868  N N   . GLY A 1 104 ? -29.223 -11.417 -13.726 1.00 22.35  ? 104 GLY A N   1 
ATOM   869  C CA  . GLY A 1 104 ? -29.304 -10.785 -15.024 1.00 20.72  ? 104 GLY A CA  1 
ATOM   870  C C   . GLY A 1 104 ? -30.670 -10.591 -15.612 1.00 22.72  ? 104 GLY A C   1 
ATOM   871  O O   . GLY A 1 104 ? -30.760 -10.003 -16.682 1.00 26.14  ? 104 GLY A O   1 
ATOM   872  N N   . ALA A 1 105 ? -31.757 -11.047 -14.999 1.00 20.14  ? 105 ALA A N   1 
ATOM   873  C CA  . ALA A 1 105 ? -33.076 -10.881 -15.571 1.00 20.20  ? 105 ALA A CA  1 
ATOM   874  C C   . ALA A 1 105 ? -33.565 -9.449  -15.484 1.00 19.89  ? 105 ALA A C   1 
ATOM   875  O O   . ALA A 1 105 ? -34.015 -8.882  -16.472 1.00 19.82  ? 105 ALA A O   1 
ATOM   876  C CB  . ALA A 1 105 ? -34.044 -11.790 -14.836 1.00 15.82  ? 105 ALA A CB  1 
ATOM   877  N N   . SER A 1 106 ? -33.430 -8.846  -14.300 1.00 24.40  ? 106 SER A N   1 
ATOM   878  C CA  . SER A 1 106 ? -33.968 -7.513  -14.038 1.00 28.81  ? 106 SER A CA  1 
ATOM   879  C C   . SER A 1 106 ? -33.294 -6.377  -14.794 1.00 29.84  ? 106 SER A C   1 
ATOM   880  O O   . SER A 1 106 ? -33.940 -5.363  -15.078 1.00 31.73  ? 106 SER A O   1 
ATOM   881  C CB  . SER A 1 106 ? -33.930 -7.189  -12.520 1.00 24.85  ? 106 SER A CB  1 
ATOM   882  O OG  . SER A 1 106 ? -32.625 -7.031  -11.966 1.00 30.55  ? 106 SER A OG  1 
ATOM   883  N N   . ASP A 1 107 ? -32.017 -6.490  -15.141 1.00 28.73  ? 107 ASP A N   1 
ATOM   884  C CA  . ASP A 1 107 ? -31.471 -5.414  -15.922 1.00 30.97  ? 107 ASP A CA  1 
ATOM   885  C C   . ASP A 1 107 ? -31.206 -5.793  -17.358 1.00 30.67  ? 107 ASP A C   1 
ATOM   886  O O   . ASP A 1 107 ? -30.407 -5.138  -18.020 1.00 31.61  ? 107 ASP A O   1 
ATOM   887  C CB  . ASP A 1 107 ? -30.218 -4.920  -15.236 1.00 36.23  ? 107 ASP A CB  1 
ATOM   888  C CG  . ASP A 1 107 ? -29.269 -6.002  -14.769 1.00 42.55  ? 107 ASP A CG  1 
ATOM   889  O OD1 . ASP A 1 107 ? -29.176 -7.067  -15.397 1.00 43.20  ? 107 ASP A OD1 1 
ATOM   890  O OD2 . ASP A 1 107 ? -28.621 -5.744  -13.756 1.00 46.02  ? 107 ASP A OD2 1 
ATOM   891  N N   . SER A 1 108 ? -31.853 -6.865  -17.855 1.00 30.04  ? 108 SER A N   1 
ATOM   892  C CA  . SER A 1 108 ? -31.800 -7.243  -19.275 1.00 26.91  ? 108 SER A CA  1 
ATOM   893  C C   . SER A 1 108 ? -32.862 -6.565  -20.134 1.00 25.11  ? 108 SER A C   1 
ATOM   894  O O   . SER A 1 108 ? -34.019 -6.482  -19.730 1.00 26.01  ? 108 SER A O   1 
ATOM   895  C CB  . SER A 1 108 ? -31.991 -8.734  -19.469 1.00 30.11  ? 108 SER A CB  1 
ATOM   896  O OG  . SER A 1 108 ? -30.760 -9.412  -19.324 1.00 30.11  ? 108 SER A OG  1 
ATOM   897  N N   . ASN A 1 109 ? -32.504 -6.040  -21.314 1.00 18.74  ? 109 ASN A N   1 
ATOM   898  C CA  . ASN A 1 109 ? -33.485 -5.507  -22.233 1.00 19.30  ? 109 ASN A CA  1 
ATOM   899  C C   . ASN A 1 109 ? -33.607 -6.705  -23.141 1.00 19.10  ? 109 ASN A C   1 
ATOM   900  O O   . ASN A 1 109 ? -32.767 -6.955  -24.002 1.00 23.60  ? 109 ASN A O   1 
ATOM   901  C CB  . ASN A 1 109 ? -32.948 -4.276  -22.980 1.00 15.21  ? 109 ASN A CB  1 
ATOM   902  C CG  . ASN A 1 109 ? -33.876 -3.724  -24.043 1.00 19.15  ? 109 ASN A CG  1 
ATOM   903  O OD1 . ASN A 1 109 ? -34.564 -4.438  -24.774 1.00 22.88  ? 109 ASN A OD1 1 
ATOM   904  N ND2 . ASN A 1 109 ? -33.961 -2.408  -24.165 1.00 24.42  ? 109 ASN A ND2 1 
ATOM   905  N N   . VAL A 1 110 ? -34.657 -7.483  -22.912 1.00 18.13  ? 110 VAL A N   1 
ATOM   906  C CA  . VAL A 1 110 ? -34.794 -8.717  -23.635 1.00 17.03  ? 110 VAL A CA  1 
ATOM   907  C C   . VAL A 1 110 ? -35.219 -8.405  -25.062 1.00 17.37  ? 110 VAL A C   1 
ATOM   908  O O   . VAL A 1 110 ? -34.942 -9.204  -25.943 1.00 21.35  ? 110 VAL A O   1 
ATOM   909  C CB  . VAL A 1 110 ? -35.783 -9.603  -22.828 1.00 14.91  ? 110 VAL A CB  1 
ATOM   910  C CG1 . VAL A 1 110 ? -35.935 -10.978 -23.452 1.00 14.49  ? 110 VAL A CG1 1 
ATOM   911  C CG2 . VAL A 1 110 ? -35.185 -9.892  -21.452 1.00 13.49  ? 110 VAL A CG2 1 
ATOM   912  N N   . TYR A 1 111 ? -35.793 -7.262  -25.406 1.00 17.40  ? 111 TYR A N   1 
ATOM   913  C CA  . TYR A 1 111 ? -36.103 -6.979  -26.805 1.00 18.88  ? 111 TYR A CA  1 
ATOM   914  C C   . TYR A 1 111 ? -34.834 -6.889  -27.651 1.00 19.08  ? 111 TYR A C   1 
ATOM   915  O O   . TYR A 1 111 ? -34.813 -7.338  -28.796 1.00 18.82  ? 111 TYR A O   1 
ATOM   916  C CB  . TYR A 1 111 ? -36.864 -5.659  -26.904 1.00 19.47  ? 111 TYR A CB  1 
ATOM   917  C CG  . TYR A 1 111 ? -36.997 -5.145  -28.328 1.00 17.28  ? 111 TYR A CG  1 
ATOM   918  C CD1 . TYR A 1 111 ? -37.930 -5.698  -29.166 1.00 16.72  ? 111 TYR A CD1 1 
ATOM   919  C CD2 . TYR A 1 111 ? -36.171 -4.109  -28.754 1.00 17.16  ? 111 TYR A CD2 1 
ATOM   920  C CE1 . TYR A 1 111 ? -38.041 -5.205  -30.452 1.00 17.66  ? 111 TYR A CE1 1 
ATOM   921  C CE2 . TYR A 1 111 ? -36.288 -3.623  -30.035 1.00 16.56  ? 111 TYR A CE2 1 
ATOM   922  C CZ  . TYR A 1 111 ? -37.234 -4.174  -30.875 1.00 19.99  ? 111 TYR A CZ  1 
ATOM   923  O OH  . TYR A 1 111 ? -37.403 -3.665  -32.161 1.00 25.00  ? 111 TYR A OH  1 
ATOM   924  N N   . ASP A 1 112 ? -33.806 -6.260  -27.084 1.00 17.66  ? 112 ASP A N   1 
ATOM   925  C CA  . ASP A 1 112 ? -32.512 -6.099  -27.714 1.00 21.49  ? 112 ASP A CA  1 
ATOM   926  C C   . ASP A 1 112 ? -31.765 -7.405  -27.909 1.00 21.40  ? 112 ASP A C   1 
ATOM   927  O O   . ASP A 1 112 ? -31.064 -7.571  -28.912 1.00 19.95  ? 112 ASP A O   1 
ATOM   928  C CB  . ASP A 1 112 ? -31.586 -5.171  -26.893 1.00 21.93  ? 112 ASP A CB  1 
ATOM   929  C CG  . ASP A 1 112 ? -31.873 -3.671  -26.978 1.00 26.77  ? 112 ASP A CG  1 
ATOM   930  O OD1 . ASP A 1 112 ? -32.663 -3.236  -27.820 1.00 26.15  ? 112 ASP A OD1 1 
ATOM   931  O OD2 . ASP A 1 112 ? -31.280 -2.929  -26.195 1.00 28.90  ? 112 ASP A OD2 1 
ATOM   932  N N   . LEU A 1 113 ? -31.894 -8.302  -26.935 1.00 14.80  ? 113 LEU A N   1 
ATOM   933  C CA  . LEU A 1 113 ? -31.259 -9.598  -27.026 1.00 16.57  ? 113 LEU A CA  1 
ATOM   934  C C   . LEU A 1 113 ? -31.857 -10.354 -28.180 1.00 15.31  ? 113 LEU A C   1 
ATOM   935  O O   . LEU A 1 113 ? -31.137 -11.011 -28.906 1.00 18.28  ? 113 LEU A O   1 
ATOM   936  C CB  . LEU A 1 113 ? -31.458 -10.358 -25.713 1.00 18.53  ? 113 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 113 ? -30.831 -9.739  -24.451 1.00 19.08  ? 113 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 113 ? -31.117 -10.521 -23.154 1.00 19.00  ? 113 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 113 ? -29.352 -9.710  -24.708 1.00 18.86  ? 113 LEU A CD2 1 
ATOM   940  N N   . LEU A 1 114 ? -33.147 -10.237 -28.453 1.00 14.33  ? 114 LEU A N   1 
ATOM   941  C CA  . LEU A 1 114 ? -33.751 -10.887 -29.584 1.00 15.37  ? 114 LEU A CA  1 
ATOM   942  C C   . LEU A 1 114 ? -33.392 -10.201 -30.923 1.00 17.80  ? 114 LEU A C   1 
ATOM   943  O O   . LEU A 1 114 ? -33.243 -10.866 -31.960 1.00 14.17  ? 114 LEU A O   1 
ATOM   944  C CB  . LEU A 1 114 ? -35.279 -10.923 -29.353 1.00 14.17  ? 114 LEU A CB  1 
ATOM   945  C CG  . LEU A 1 114 ? -35.860 -11.821 -28.226 1.00 14.94  ? 114 LEU A CG  1 
ATOM   946  C CD1 . LEU A 1 114 ? -37.279 -11.361 -27.976 1.00 15.53  ? 114 LEU A CD1 1 
ATOM   947  C CD2 . LEU A 1 114 ? -35.866 -13.308 -28.597 1.00 9.66   ? 114 LEU A CD2 1 
ATOM   948  N N   . LYS A 1 115 ? -33.264 -8.868  -30.972 1.00 16.12  ? 115 LYS A N   1 
ATOM   949  C CA  . LYS A 1 115 ? -32.900 -8.193  -32.211 1.00 18.61  ? 115 LYS A CA  1 
ATOM   950  C C   . LYS A 1 115 ? -31.478 -8.531  -32.643 1.00 14.89  ? 115 LYS A C   1 
ATOM   951  O O   . LYS A 1 115 ? -31.202 -8.652  -33.833 1.00 15.25  ? 115 LYS A O   1 
ATOM   952  C CB  . LYS A 1 115 ? -33.017 -6.676  -32.048 1.00 19.21  ? 115 LYS A CB  1 
ATOM   953  C CG  . LYS A 1 115 ? -34.479 -6.239  -32.154 1.00 26.66  ? 115 LYS A CG  1 
ATOM   954  C CD  . LYS A 1 115 ? -35.205 -6.475  -33.492 1.00 28.61  ? 115 LYS A CD  1 
ATOM   955  C CE  . LYS A 1 115 ? -34.782 -5.558  -34.647 1.00 31.18  ? 115 LYS A CE  1 
ATOM   956  N NZ  . LYS A 1 115 ? -35.584 -5.808  -35.843 1.00 33.58  ? 115 LYS A NZ  1 
ATOM   957  N N   . ASP A 1 116 ? -30.602 -8.671  -31.651 1.00 12.48  ? 116 ASP A N   1 
ATOM   958  C CA  . ASP A 1 116 ? -29.260 -9.102  -31.892 1.00 14.62  ? 116 ASP A CA  1 
ATOM   959  C C   . ASP A 1 116 ? -29.226 -10.531 -32.453 1.00 18.33  ? 116 ASP A C   1 
ATOM   960  O O   . ASP A 1 116 ? -28.445 -10.839 -33.364 1.00 17.29  ? 116 ASP A O   1 
ATOM   961  C CB  A ASP A 1 116 ? -28.484 -9.038  -30.615 0.50 17.27  ? 116 ASP A CB  1 
ATOM   962  C CB  B ASP A 1 116 ? -28.535 -8.986  -30.557 0.50 16.43  ? 116 ASP A CB  1 
ATOM   963  C CG  A ASP A 1 116 ? -28.105 -7.623  -30.200 0.50 23.44  ? 116 ASP A CG  1 
ATOM   964  C CG  B ASP A 1 116 ? -27.011 -9.165  -30.478 0.50 21.03  ? 116 ASP A CG  1 
ATOM   965  O OD1 A ASP A 1 116 ? -28.098 -6.725  -31.049 0.50 27.14  ? 116 ASP A OD1 1 
ATOM   966  O OD1 B ASP A 1 116 ? -26.295 -8.721  -31.375 0.50 22.35  ? 116 ASP A OD1 1 
ATOM   967  O OD2 A ASP A 1 116 ? -27.806 -7.431  -29.016 0.50 22.62  ? 116 ASP A OD2 1 
ATOM   968  O OD2 B ASP A 1 116 ? -26.530 -9.715  -29.477 0.50 24.08  ? 116 ASP A OD2 1 
ATOM   969  N N   . LEU A 1 117 ? -30.096 -11.441 -31.967 1.00 19.07  ? 117 LEU A N   1 
ATOM   970  C CA  . LEU A 1 117 ? -30.093 -12.815 -32.457 1.00 17.58  ? 117 LEU A CA  1 
ATOM   971  C C   . LEU A 1 117 ? -30.703 -12.855 -33.849 1.00 17.97  ? 117 LEU A C   1 
ATOM   972  O O   . LEU A 1 117 ? -30.142 -13.490 -34.737 1.00 19.16  ? 117 LEU A O   1 
ATOM   973  C CB  . LEU A 1 117 ? -30.855 -13.685 -31.490 1.00 13.50  ? 117 LEU A CB  1 
ATOM   974  C CG  . LEU A 1 117 ? -30.885 -15.184 -31.760 1.00 14.15  ? 117 LEU A CG  1 
ATOM   975  C CD1 . LEU A 1 117 ? -29.459 -15.729 -31.926 1.00 10.78  ? 117 LEU A CD1 1 
ATOM   976  C CD2 . LEU A 1 117 ? -31.528 -15.881 -30.572 1.00 11.66  ? 117 LEU A CD2 1 
ATOM   977  N N   . GLU A 1 118 ? -31.772 -12.114 -34.118 1.00 15.99  ? 118 GLU A N   1 
ATOM   978  C CA  . GLU A 1 118 ? -32.336 -12.038 -35.452 1.00 17.47  ? 118 GLU A CA  1 
ATOM   979  C C   . GLU A 1 118 ? -31.295 -11.558 -36.479 1.00 18.20  ? 118 GLU A C   1 
ATOM   980  O O   . GLU A 1 118 ? -31.256 -12.077 -37.577 1.00 18.72  ? 118 GLU A O   1 
ATOM   981  C CB  . GLU A 1 118 ? -33.511 -11.082 -35.420 1.00 16.61  ? 118 GLU A CB  1 
ATOM   982  C CG  . GLU A 1 118 ? -34.031 -10.813 -36.809 1.00 18.36  ? 118 GLU A CG  1 
ATOM   983  C CD  . GLU A 1 118 ? -34.903 -9.596  -36.951 1.00 22.76  ? 118 GLU A CD  1 
ATOM   984  O OE1 . GLU A 1 118 ? -34.669 -8.594  -36.273 1.00 28.53  ? 118 GLU A OE1 1 
ATOM   985  O OE2 . GLU A 1 118 ? -35.811 -9.669  -37.768 1.00 26.79  ? 118 GLU A OE2 1 
ATOM   986  N N   . GLU A 1 119 ? -30.456 -10.565 -36.182 1.00 20.94  ? 119 GLU A N   1 
ATOM   987  C CA  . GLU A 1 119 ? -29.442 -10.059 -37.090 1.00 22.08  ? 119 GLU A CA  1 
ATOM   988  C C   . GLU A 1 119 ? -28.385 -11.139 -37.223 1.00 20.17  ? 119 GLU A C   1 
ATOM   989  O O   . GLU A 1 119 ? -27.865 -11.318 -38.322 1.00 19.40  ? 119 GLU A O   1 
ATOM   990  C CB  . GLU A 1 119 ? -28.861 -8.777  -36.498 1.00 24.31  ? 119 GLU A CB  1 
ATOM   991  C CG  . GLU A 1 119 ? -27.639 -8.093  -37.127 1.00 40.27  ? 119 GLU A CG  1 
ATOM   992  C CD  . GLU A 1 119 ? -27.071 -6.991  -36.200 1.00 49.98  ? 119 GLU A CD  1 
ATOM   993  O OE1 . GLU A 1 119 ? -27.559 -5.853  -36.258 1.00 56.69  ? 119 GLU A OE1 1 
ATOM   994  O OE2 . GLU A 1 119 ? -26.159 -7.260  -35.402 1.00 53.27  ? 119 GLU A OE2 1 
ATOM   995  N N   . GLY A 1 120 ? -28.082 -11.877 -36.148 1.00 15.85  ? 120 GLY A N   1 
ATOM   996  C CA  . GLY A 1 120 ? -27.123 -12.968 -36.204 1.00 17.67  ? 120 GLY A CA  1 
ATOM   997  C C   . GLY A 1 120 ? -27.544 -14.038 -37.198 1.00 18.02  ? 120 GLY A C   1 
ATOM   998  O O   . GLY A 1 120 ? -26.756 -14.487 -38.032 1.00 23.40  ? 120 GLY A O   1 
ATOM   999  N N   . ILE A 1 121 ? -28.810 -14.424 -37.151 1.00 16.96  ? 121 ILE A N   1 
ATOM   1000 C CA  . ILE A 1 121 ? -29.348 -15.408 -38.057 1.00 16.76  ? 121 ILE A CA  1 
ATOM   1001 C C   . ILE A 1 121 ? -29.401 -14.916 -39.508 1.00 21.62  ? 121 ILE A C   1 
ATOM   1002 O O   . ILE A 1 121 ? -29.142 -15.702 -40.416 1.00 19.65  ? 121 ILE A O   1 
ATOM   1003 C CB  . ILE A 1 121 ? -30.732 -15.780 -37.510 1.00 14.53  ? 121 ILE A CB  1 
ATOM   1004 C CG1 . ILE A 1 121 ? -30.514 -16.493 -36.169 1.00 17.01  ? 121 ILE A CG1 1 
ATOM   1005 C CG2 . ILE A 1 121 ? -31.494 -16.668 -38.482 1.00 15.44  ? 121 ILE A CG2 1 
ATOM   1006 C CD1 . ILE A 1 121 ? -31.793 -16.797 -35.365 1.00 18.94  ? 121 ILE A CD1 1 
ATOM   1007 N N   . GLN A 1 122 ? -29.760 -13.646 -39.792 1.00 21.61  ? 122 GLN A N   1 
ATOM   1008 C CA  . GLN A 1 122 ? -29.823 -13.124 -41.147 1.00 22.18  ? 122 GLN A CA  1 
ATOM   1009 C C   . GLN A 1 122 ? -28.461 -13.090 -41.789 1.00 22.21  ? 122 GLN A C   1 
ATOM   1010 O O   . GLN A 1 122 ? -28.349 -13.385 -42.976 1.00 25.45  ? 122 GLN A O   1 
ATOM   1011 C CB  . GLN A 1 122 ? -30.370 -11.709 -41.188 1.00 25.28  ? 122 GLN A CB  1 
ATOM   1012 C CG  . GLN A 1 122 ? -31.866 -11.858 -41.266 1.00 33.92  ? 122 GLN A CG  1 
ATOM   1013 C CD  . GLN A 1 122 ? -32.663 -10.589 -41.020 1.00 38.56  ? 122 GLN A CD  1 
ATOM   1014 O OE1 . GLN A 1 122 ? -33.810 -10.482 -41.449 1.00 39.85  ? 122 GLN A OE1 1 
ATOM   1015 N NE2 . GLN A 1 122 ? -32.128 -9.603  -40.289 1.00 41.46  ? 122 GLN A NE2 1 
ATOM   1016 N N   . THR A 1 123 ? -27.448 -12.721 -41.007 1.00 21.26  ? 123 THR A N   1 
ATOM   1017 C CA  . THR A 1 123 ? -26.083 -12.733 -41.477 1.00 24.81  ? 123 THR A CA  1 
ATOM   1018 C C   . THR A 1 123 ? -25.651 -14.152 -41.843 1.00 26.63  ? 123 THR A C   1 
ATOM   1019 O O   . THR A 1 123 ? -25.033 -14.315 -42.896 1.00 27.36  ? 123 THR A O   1 
ATOM   1020 C CB  . THR A 1 123 ? -25.195 -12.159 -40.397 1.00 26.59  ? 123 THR A CB  1 
ATOM   1021 O OG1 . THR A 1 123 ? -25.728 -10.868 -40.179 1.00 29.56  ? 123 THR A OG1 1 
ATOM   1022 C CG2 . THR A 1 123 ? -23.718 -12.029 -40.767 1.00 28.04  ? 123 THR A CG2 1 
ATOM   1023 N N   . LEU A 1 124 ? -25.961 -15.185 -41.026 1.00 25.94  ? 124 LEU A N   1 
ATOM   1024 C CA  . LEU A 1 124 ? -25.669 -16.584 -41.359 1.00 24.15  ? 124 LEU A CA  1 
ATOM   1025 C C   . LEU A 1 124 ? -26.400 -17.072 -42.609 1.00 24.03  ? 124 LEU A C   1 
ATOM   1026 O O   . LEU A 1 124 ? -25.847 -17.811 -43.417 1.00 24.52  ? 124 LEU A O   1 
ATOM   1027 C CB  . LEU A 1 124 ? -26.056 -17.477 -40.213 1.00 25.91  ? 124 LEU A CB  1 
ATOM   1028 C CG  . LEU A 1 124 ? -25.007 -17.999 -39.305 1.00 30.61  ? 124 LEU A CG  1 
ATOM   1029 C CD1 . LEU A 1 124 ? -25.674 -18.740 -38.141 1.00 35.10  ? 124 LEU A CD1 1 
ATOM   1030 C CD2 . LEU A 1 124 ? -24.110 -18.954 -40.082 1.00 33.06  ? 124 LEU A CD2 1 
ATOM   1031 N N   . MET A 1 125 ? -27.657 -16.699 -42.821 1.00 22.47  ? 125 MET A N   1 
ATOM   1032 C CA  . MET A 1 125 ? -28.380 -17.061 -44.031 1.00 26.45  ? 125 MET A CA  1 
ATOM   1033 C C   . MET A 1 125 ? -27.756 -16.498 -45.299 1.00 27.25  ? 125 MET A C   1 
ATOM   1034 O O   . MET A 1 125 ? -27.682 -17.173 -46.315 1.00 26.18  ? 125 MET A O   1 
ATOM   1035 C CB  . MET A 1 125 ? -29.794 -16.559 -43.977 1.00 23.61  ? 125 MET A CB  1 
ATOM   1036 C CG  . MET A 1 125 ? -30.577 -17.470 -43.101 1.00 31.16  ? 125 MET A CG  1 
ATOM   1037 S SD  . MET A 1 125 ? -32.199 -16.753 -42.850 1.00 37.70  ? 125 MET A SD  1 
ATOM   1038 C CE  . MET A 1 125 ? -32.948 -17.261 -44.367 1.00 32.09  ? 125 MET A CE  1 
ATOM   1039 N N   . GLY A 1 126 ? -27.325 -15.240 -45.243 1.00 28.33  ? 126 GLY A N   1 
ATOM   1040 C CA  . GLY A 1 126 ? -26.663 -14.570 -46.355 1.00 31.81  ? 126 GLY A CA  1 
ATOM   1041 C C   . GLY A 1 126 ? -25.375 -15.260 -46.794 1.00 31.67  ? 126 GLY A C   1 
ATOM   1042 O O   . GLY A 1 126 ? -25.051 -15.230 -47.973 1.00 35.89  ? 126 GLY A O   1 
ATOM   1043 N N   . ARG A 1 127 ? -24.630 -15.887 -45.885 1.00 29.46  ? 127 ARG A N   1 
ATOM   1044 C CA  . ARG A 1 127 ? -23.468 -16.686 -46.243 1.00 29.85  ? 127 ARG A CA  1 
ATOM   1045 C C   . ARG A 1 127 ? -23.878 -18.022 -46.903 1.00 32.49  ? 127 ARG A C   1 
ATOM   1046 O O   . ARG A 1 127 ? -23.134 -18.600 -47.693 1.00 32.21  ? 127 ARG A O   1 
ATOM   1047 C CB  . ARG A 1 127 ? -22.665 -17.014 -45.004 1.00 27.62  ? 127 ARG A CB  1 
ATOM   1048 C CG  . ARG A 1 127 ? -22.173 -15.887 -44.126 1.00 26.24  ? 127 ARG A CG  1 
ATOM   1049 C CD  . ARG A 1 127 ? -20.918 -15.366 -44.720 1.00 23.19  ? 127 ARG A CD  1 
ATOM   1050 N NE  . ARG A 1 127 ? -20.435 -14.380 -43.808 1.00 19.03  ? 127 ARG A NE  1 
ATOM   1051 C CZ  . ARG A 1 127 ? -19.331 -14.503 -43.082 1.00 23.66  ? 127 ARG A CZ  1 
ATOM   1052 N NH1 . ARG A 1 127 ? -18.497 -15.559 -43.097 1.00 27.93  ? 127 ARG A NH1 1 
ATOM   1053 N NH2 . ARG A 1 127 ? -19.094 -13.511 -42.240 1.00 21.94  ? 127 ARG A NH2 1 
ATOM   1054 N N   . LEU A 1 128 ? -25.053 -18.576 -46.570 1.00 35.64  ? 128 LEU A N   1 
ATOM   1055 C CA  . LEU A 1 128 ? -25.489 -19.879 -47.048 1.00 36.41  ? 128 LEU A CA  1 
ATOM   1056 C C   . LEU A 1 128 ? -26.439 -19.829 -48.223 1.00 41.26  ? 128 LEU A C   1 
ATOM   1057 O O   . LEU A 1 128 ? -26.898 -20.863 -48.710 1.00 44.39  ? 128 LEU A O   1 
ATOM   1058 C CB  . LEU A 1 128 ? -26.144 -20.616 -45.896 1.00 33.00  ? 128 LEU A CB  1 
ATOM   1059 C CG  . LEU A 1 128 ? -25.273 -20.926 -44.722 1.00 28.85  ? 128 LEU A CG  1 
ATOM   1060 C CD1 . LEU A 1 128 ? -26.068 -21.683 -43.692 1.00 29.90  ? 128 LEU A CD1 1 
ATOM   1061 C CD2 . LEU A 1 128 ? -24.103 -21.746 -45.179 1.00 29.26  ? 128 LEU A CD2 1 
ATOM   1062 N N   . GLU A 1 129 ? -26.774 -18.611 -48.650 1.00 48.09  ? 129 GLU A N   1 
ATOM   1063 C CA  . GLU A 1 129 ? -27.598 -18.394 -49.825 1.00 54.87  ? 129 GLU A CA  1 
ATOM   1064 C C   . GLU A 1 129 ? -26.725 -17.967 -50.988 1.00 55.31  ? 129 GLU A C   1 
ATOM   1065 O O   . GLU A 1 129 ? -26.890 -18.473 -52.096 1.00 59.46  ? 129 GLU A O   1 
ATOM   1066 C CB  . GLU A 1 129 ? -28.643 -17.303 -49.593 1.00 59.17  ? 129 GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 129 ? -29.752 -17.827 -48.688 1.00 68.04  ? 129 GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 129 ? -31.021 -16.987 -48.601 1.00 74.53  ? 129 GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 129 ? -30.932 -15.814 -48.215 1.00 77.61  ? 129 GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 129 ? -32.093 -17.526 -48.914 1.00 77.82  ? 129 GLU A OE2 1 
ATOM   1071 N N   . ALA A 1 155 ? -53.460 -11.664 -14.391 1.00 51.86  ? 155 ALA A N   1 
ATOM   1072 C CA  . ALA A 1 155 ? -52.119 -11.148 -14.621 1.00 48.19  ? 155 ALA A CA  1 
ATOM   1073 C C   . ALA A 1 155 ? -51.228 -12.357 -14.580 1.00 44.90  ? 155 ALA A C   1 
ATOM   1074 O O   . ALA A 1 155 ? -50.620 -12.679 -15.593 1.00 47.11  ? 155 ALA A O   1 
ATOM   1075 C CB  . ALA A 1 155 ? -51.610 -10.202 -13.517 1.00 49.07  ? 155 ALA A CB  1 
ATOM   1076 N N   . LEU A 1 156 ? -51.240 -13.034 -13.420 1.00 40.00  ? 156 LEU A N   1 
ATOM   1077 C CA  . LEU A 1 156 ? -50.372 -14.149 -13.154 1.00 38.29  ? 156 LEU A CA  1 
ATOM   1078 C C   . LEU A 1 156 ? -50.431 -15.270 -14.157 1.00 35.86  ? 156 LEU A C   1 
ATOM   1079 O O   . LEU A 1 156 ? -49.394 -15.604 -14.711 1.00 32.26  ? 156 LEU A O   1 
ATOM   1080 C CB  . LEU A 1 156 ? -50.664 -14.680 -11.752 1.00 37.64  ? 156 LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 156 ? -49.716 -14.179 -10.658 1.00 37.62  ? 156 LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 156 ? -49.501 -12.694 -10.792 1.00 39.47  ? 156 LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 156 ? -50.308 -14.469 -9.293  1.00 40.44  ? 156 LEU A CD2 1 
ATOM   1084 N N   . LEU A 1 157 ? -51.622 -15.746 -14.494 1.00 33.37  ? 157 LEU A N   1 
ATOM   1085 C CA  . LEU A 1 157 ? -51.709 -16.886 -15.361 1.00 32.59  ? 157 LEU A CA  1 
ATOM   1086 C C   . LEU A 1 157 ? -51.467 -16.556 -16.800 1.00 30.06  ? 157 LEU A C   1 
ATOM   1087 O O   . LEU A 1 157 ? -51.158 -17.425 -17.603 1.00 26.20  ? 157 LEU A O   1 
ATOM   1088 C CB  . LEU A 1 157 ? -53.058 -17.536 -15.231 1.00 38.36  ? 157 LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 157 ? -52.907 -19.050 -15.117 1.00 44.28  ? 157 LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 157 ? -52.618 -19.439 -13.668 1.00 45.52  ? 157 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 157 ? -54.174 -19.712 -15.616 1.00 51.11  ? 157 LEU A CD2 1 
ATOM   1092 N N   . LYS A 1 158 ? -51.578 -15.282 -17.107 1.00 27.74  ? 158 LYS A N   1 
ATOM   1093 C CA  . LYS A 1 158 ? -51.301 -14.810 -18.442 1.00 30.02  ? 158 LYS A CA  1 
ATOM   1094 C C   . LYS A 1 158 ? -49.779 -14.630 -18.653 1.00 26.76  ? 158 LYS A C   1 
ATOM   1095 O O   . LYS A 1 158 ? -49.211 -14.912 -19.716 1.00 25.60  ? 158 LYS A O   1 
ATOM   1096 C CB  . LYS A 1 158 ? -52.102 -13.530 -18.563 1.00 37.74  ? 158 LYS A CB  1 
ATOM   1097 C CG  . LYS A 1 158 ? -52.028 -12.841 -19.891 1.00 48.86  ? 158 LYS A CG  1 
ATOM   1098 C CD  . LYS A 1 158 ? -52.886 -13.548 -20.920 1.00 63.30  ? 158 LYS A CD  1 
ATOM   1099 C CE  . LYS A 1 158 ? -52.810 -12.707 -22.195 1.00 71.64  ? 158 LYS A CE  1 
ATOM   1100 N NZ  . LYS A 1 158 ? -53.855 -13.063 -23.150 1.00 80.61  ? 158 LYS A NZ  1 
ATOM   1101 N N   . ASN A 1 159 ? -49.108 -14.188 -17.594 1.00 21.89  ? 159 ASN A N   1 
ATOM   1102 C CA  . ASN A 1 159 ? -47.678 -14.014 -17.576 1.00 19.49  ? 159 ASN A CA  1 
ATOM   1103 C C   . ASN A 1 159 ? -47.067 -15.379 -17.619 1.00 17.64  ? 159 ASN A C   1 
ATOM   1104 O O   . ASN A 1 159 ? -46.069 -15.580 -18.270 1.00 17.98  ? 159 ASN A O   1 
ATOM   1105 C CB  . ASN A 1 159 ? -47.222 -13.341 -16.303 1.00 23.43  ? 159 ASN A CB  1 
ATOM   1106 C CG  . ASN A 1 159 ? -47.352 -11.828 -16.303 1.00 28.76  ? 159 ASN A CG  1 
ATOM   1107 O OD1 . ASN A 1 159 ? -47.048 -11.168 -17.291 1.00 33.30  ? 159 ASN A OD1 1 
ATOM   1108 N ND2 . ASN A 1 159 ? -47.786 -11.220 -15.205 1.00 31.63  ? 159 ASN A ND2 1 
ATOM   1109 N N   . TYR A 1 160 ? -47.654 -16.334 -16.914 1.00 18.46  ? 160 TYR A N   1 
ATOM   1110 C CA  . TYR A 1 160 ? -47.199 -17.719 -16.860 1.00 19.04  ? 160 TYR A CA  1 
ATOM   1111 C C   . TYR A 1 160 ? -47.305 -18.470 -18.194 1.00 16.13  ? 160 TYR A C   1 
ATOM   1112 O O   . TYR A 1 160 ? -46.433 -19.254 -18.505 1.00 16.96  ? 160 TYR A O   1 
ATOM   1113 C CB  . TYR A 1 160 ? -48.020 -18.424 -15.773 1.00 18.88  ? 160 TYR A CB  1 
ATOM   1114 C CG  . TYR A 1 160 ? -47.687 -19.873 -15.507 1.00 15.28  ? 160 TYR A CG  1 
ATOM   1115 C CD1 . TYR A 1 160 ? -46.462 -20.206 -15.004 1.00 14.14  ? 160 TYR A CD1 1 
ATOM   1116 C CD2 . TYR A 1 160 ? -48.638 -20.843 -15.746 1.00 22.31  ? 160 TYR A CD2 1 
ATOM   1117 C CE1 . TYR A 1 160 ? -46.167 -21.522 -14.729 1.00 18.43  ? 160 TYR A CE1 1 
ATOM   1118 C CE2 . TYR A 1 160 ? -48.341 -22.164 -15.468 1.00 22.74  ? 160 TYR A CE2 1 
ATOM   1119 C CZ  . TYR A 1 160 ? -47.110 -22.494 -14.957 1.00 19.17  ? 160 TYR A CZ  1 
ATOM   1120 O OH  . TYR A 1 160 ? -46.817 -23.806 -14.612 1.00 19.67  ? 160 TYR A OH  1 
ATOM   1121 N N   . GLY A 1 161 ? -48.378 -18.293 -18.951 1.00 16.41  ? 161 GLY A N   1 
ATOM   1122 C CA  . GLY A 1 161 ? -48.599 -18.917 -20.234 1.00 16.90  ? 161 GLY A CA  1 
ATOM   1123 C C   . GLY A 1 161 ? -47.630 -18.393 -21.259 1.00 19.28  ? 161 GLY A C   1 
ATOM   1124 O O   . GLY A 1 161 ? -47.102 -19.157 -22.055 1.00 17.39  ? 161 GLY A O   1 
ATOM   1125 N N   . LEU A 1 162 ? -47.350 -17.089 -21.217 1.00 20.10  ? 162 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 162 ? -46.425 -16.449 -22.140 1.00 18.84  ? 162 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 162 ? -44.985 -16.799 -21.793 1.00 19.41  ? 162 LEU A C   1 
ATOM   1128 O O   . LEU A 1 162 ? -44.163 -16.973 -22.700 1.00 21.08  ? 162 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 162 ? -46.645 -14.955 -22.075 1.00 23.31  ? 162 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 162 ? -46.362 -14.144 -23.315 1.00 30.92  ? 162 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 162 ? -47.181 -14.684 -24.493 1.00 32.19  ? 162 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 162 ? -46.703 -12.684 -23.037 1.00 34.34  ? 162 LEU A CD2 1 
ATOM   1133 N N   . LEU A 1 163 ? -44.648 -16.940 -20.501 1.00 14.61  ? 163 LEU A N   1 
ATOM   1134 C CA  . LEU A 1 163 ? -43.342 -17.395 -20.093 1.00 15.06  ? 163 LEU A CA  1 
ATOM   1135 C C   . LEU A 1 163 ? -43.171 -18.855 -20.472 1.00 16.57  ? 163 LEU A C   1 
ATOM   1136 O O   . LEU A 1 163 ? -42.069 -19.274 -20.816 1.00 16.10  ? 163 LEU A O   1 
ATOM   1137 C CB  . LEU A 1 163 ? -43.159 -17.281 -18.610 1.00 14.73  ? 163 LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 163 ? -42.539 -16.037 -18.014 1.00 22.14  ? 163 LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 163 ? -42.681 -16.127 -16.512 1.00 16.24  ? 163 LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 163 ? -41.066 -15.931 -18.353 1.00 21.34  ? 163 LEU A CD2 1 
ATOM   1141 N N   . TYR A 1 164 ? -44.229 -19.678 -20.411 1.00 16.92  ? 164 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 164 ? -44.142 -21.053 -20.907 1.00 19.01  ? 164 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 164 ? -43.765 -21.116 -22.398 1.00 14.61  ? 164 TYR A C   1 
ATOM   1144 O O   . TYR A 1 164 ? -42.934 -21.924 -22.775 1.00 14.89  ? 164 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 164 ? -45.490 -21.806 -20.711 1.00 16.55  ? 164 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 164 ? -45.728 -23.047 -21.598 1.00 20.67  ? 164 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 164 ? -45.189 -24.271 -21.240 1.00 24.13  ? 164 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 164 ? -46.516 -22.961 -22.756 1.00 24.31  ? 164 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 164 ? -45.441 -25.398 -22.026 1.00 28.59  ? 164 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 164 ? -46.771 -24.082 -23.540 1.00 27.11  ? 164 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 164 ? -46.231 -25.301 -23.164 1.00 30.03  ? 164 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 164 ? -46.503 -26.453 -23.902 1.00 37.86  ? 164 TYR A OH  1 
ATOM   1153 N N   . CYS A 1 165 ? -44.423 -20.309 -23.221 1.00 14.75  ? 165 CYS A N   1 
ATOM   1154 C CA  . CYS A 1 165 ? -44.257 -20.245 -24.674 1.00 18.93  ? 165 CYS A CA  1 
ATOM   1155 C C   . CYS A 1 165 ? -42.898 -19.672 -25.008 1.00 18.24  ? 165 CYS A C   1 
ATOM   1156 O O   . CYS A 1 165 ? -42.327 -20.076 -26.013 1.00 20.78  ? 165 CYS A O   1 
ATOM   1157 C CB  . CYS A 1 165 ? -45.257 -19.316 -25.365 1.00 20.74  ? 165 CYS A CB  1 
ATOM   1158 S SG  . CYS A 1 165 ? -47.042 -19.625 -25.266 1.00 24.72  ? 165 CYS A SG  1 
ATOM   1159 N N   . PHE A 1 166 ? -42.438 -18.716 -24.187 1.00 16.14  ? 166 PHE A N   1 
ATOM   1160 C CA  . PHE A 1 166 ? -41.151 -18.093 -24.390 1.00 16.12  ? 166 PHE A CA  1 
ATOM   1161 C C   . PHE A 1 166 ? -40.085 -19.126 -24.153 1.00 12.21  ? 166 PHE A C   1 
ATOM   1162 O O   . PHE A 1 166 ? -39.188 -19.281 -24.944 1.00 14.49  ? 166 PHE A O   1 
ATOM   1163 C CB  . PHE A 1 166 ? -40.970 -16.904 -23.437 1.00 15.88  ? 166 PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 166 ? -39.763 -16.023 -23.801 1.00 12.73  ? 166 PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 166 ? -39.637 -15.525 -25.091 1.00 12.21  ? 166 PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 166 ? -38.776 -15.797 -22.856 1.00 12.20  ? 166 PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 166 ? -38.516 -14.805 -25.452 1.00 11.94  ? 166 PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 166 ? -37.656 -15.077 -23.219 1.00 14.52  ? 166 PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 166 ? -37.529 -14.586 -24.510 1.00 11.41  ? 166 PHE A CZ  1 
ATOM   1170 N N   . ASN A 1 167 ? -40.180 -19.884 -23.090 1.00 15.68  ? 167 ASN A N   1 
ATOM   1171 C CA  . ASN A 1 167 ? -39.272 -20.963 -22.792 1.00 15.83  ? 167 ASN A CA  1 
ATOM   1172 C C   . ASN A 1 167 ? -39.350 -22.041 -23.861 1.00 14.92  ? 167 ASN A C   1 
ATOM   1173 O O   . ASN A 1 167 ? -38.314 -22.542 -24.243 1.00 15.35  ? 167 ASN A O   1 
ATOM   1174 C CB  . ASN A 1 167 ? -39.639 -21.544 -21.427 1.00 21.45  ? 167 ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 167 ? -38.786 -22.730 -21.030 1.00 24.12  ? 167 ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 167 ? -37.566 -22.672 -21.144 1.00 31.38  ? 167 ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 167 ? -39.391 -23.835 -20.602 1.00 28.05  ? 167 ASN A ND2 1 
ATOM   1178 N N   . LYS A 1 168 ? -40.520 -22.403 -24.381 1.00 13.15  ? 168 LYS A N   1 
ATOM   1179 C CA  . LYS A 1 168 ? -40.656 -23.444 -25.375 1.00 17.75  ? 168 LYS A CA  1 
ATOM   1180 C C   . LYS A 1 168 ? -39.971 -23.056 -26.684 1.00 16.96  ? 168 LYS A C   1 
ATOM   1181 O O   . LYS A 1 168 ? -39.253 -23.821 -27.313 1.00 13.35  ? 168 LYS A O   1 
ATOM   1182 C CB  . LYS A 1 168 ? -42.135 -23.686 -25.590 1.00 21.10  ? 168 LYS A CB  1 
ATOM   1183 C CG  . LYS A 1 168 ? -42.457 -24.888 -26.451 1.00 29.75  ? 168 LYS A CG  1 
ATOM   1184 C CD  . LYS A 1 168 ? -43.915 -24.822 -26.853 1.00 34.31  ? 168 LYS A CD  1 
ATOM   1185 C CE  . LYS A 1 168 ? -44.076 -23.626 -27.791 1.00 41.89  ? 168 LYS A CE  1 
ATOM   1186 N NZ  . LYS A 1 168 ? -45.373 -22.993 -27.624 1.00 43.30  ? 168 LYS A NZ  1 
ATOM   1187 N N   . ASP A 1 169 ? -40.158 -21.810 -27.064 1.00 16.24  ? 169 ASP A N   1 
ATOM   1188 C CA  . ASP A 1 169 ? -39.546 -21.327 -28.264 1.00 16.86  ? 169 ASP A CA  1 
ATOM   1189 C C   . ASP A 1 169 ? -38.073 -21.053 -28.190 1.00 14.69  ? 169 ASP A C   1 
ATOM   1190 O O   . ASP A 1 169 ? -37.378 -21.279 -29.171 1.00 18.66  ? 169 ASP A O   1 
ATOM   1191 C CB  . ASP A 1 169 ? -40.259 -20.068 -28.711 1.00 17.38  ? 169 ASP A CB  1 
ATOM   1192 C CG  . ASP A 1 169 ? -41.607 -20.341 -29.326 1.00 19.58  ? 169 ASP A CG  1 
ATOM   1193 O OD1 . ASP A 1 169 ? -41.983 -21.496 -29.523 1.00 21.53  ? 169 ASP A OD1 1 
ATOM   1194 O OD2 . ASP A 1 169 ? -42.284 -19.365 -29.603 1.00 21.52  ? 169 ASP A OD2 1 
ATOM   1195 N N   . MET A 1 170 ? -37.590 -20.529 -27.077 1.00 12.07  ? 170 MET A N   1 
ATOM   1196 C CA  . MET A 1 170 ? -36.190 -20.272 -26.947 1.00 12.79  ? 170 MET A CA  1 
ATOM   1197 C C   . MET A 1 170 ? -35.495 -21.612 -26.857 1.00 15.92  ? 170 MET A C   1 
ATOM   1198 O O   . MET A 1 170 ? -34.353 -21.697 -27.246 1.00 18.01  ? 170 MET A O   1 
ATOM   1199 C CB  . MET A 1 170 ? -35.914 -19.434 -25.700 1.00 8.60   ? 170 MET A CB  1 
ATOM   1200 C CG  . MET A 1 170 ? -36.296 -17.949 -25.895 1.00 13.42  ? 170 MET A CG  1 
ATOM   1201 S SD  . MET A 1 170 ? -35.929 -17.126 -27.469 1.00 16.87  ? 170 MET A SD  1 
ATOM   1202 C CE  . MET A 1 170 ? -37.410 -17.116 -28.440 1.00 13.27  ? 170 MET A CE  1 
ATOM   1203 N N   . SER A 1 171 ? -36.141 -22.678 -26.370 1.00 18.57  ? 171 SER A N   1 
ATOM   1204 C CA  . SER A 1 171 ? -35.588 -24.028 -26.338 1.00 18.73  ? 171 SER A CA  1 
ATOM   1205 C C   . SER A 1 171 ? -35.409 -24.592 -27.753 1.00 14.98  ? 171 SER A C   1 
ATOM   1206 O O   . SER A 1 171 ? -34.401 -25.195 -28.061 1.00 19.04  ? 171 SER A O   1 
ATOM   1207 C CB  . SER A 1 171 ? -36.517 -24.945 -25.559 1.00 19.62  ? 171 SER A CB  1 
ATOM   1208 O OG  . SER A 1 171 ? -35.775 -25.748 -24.671 1.00 31.02  ? 171 SER A OG  1 
ATOM   1209 N N   . LYS A 1 172 ? -36.353 -24.415 -28.638 1.00 14.36  ? 172 LYS A N   1 
ATOM   1210 C CA  . LYS A 1 172 ? -36.266 -24.827 -30.024 1.00 16.38  ? 172 LYS A CA  1 
ATOM   1211 C C   . LYS A 1 172 ? -35.195 -24.115 -30.790 1.00 18.17  ? 172 LYS A C   1 
ATOM   1212 O O   . LYS A 1 172 ? -34.433 -24.783 -31.488 1.00 18.74  ? 172 LYS A O   1 
ATOM   1213 C CB  . LYS A 1 172 ? -37.519 -24.547 -30.767 1.00 14.13  ? 172 LYS A CB  1 
ATOM   1214 C CG  . LYS A 1 172 ? -38.603 -25.450 -30.266 1.00 19.87  ? 172 LYS A CG  1 
ATOM   1215 C CD  . LYS A 1 172 ? -39.848 -25.053 -31.019 1.00 25.04  ? 172 LYS A CD  1 
ATOM   1216 C CE  . LYS A 1 172 ? -40.818 -26.193 -30.796 1.00 30.60  ? 172 LYS A CE  1 
ATOM   1217 N NZ  . LYS A 1 172 ? -42.068 -25.860 -31.437 1.00 37.56  ? 172 LYS A NZ  1 
ATOM   1218 N N   . VAL A 1 173 ? -35.130 -22.777 -30.642 1.00 17.37  ? 173 VAL A N   1 
ATOM   1219 C CA  . VAL A 1 173 ? -34.160 -21.969 -31.367 1.00 16.40  ? 173 VAL A CA  1 
ATOM   1220 C C   . VAL A 1 173 ? -32.758 -22.386 -31.001 1.00 14.54  ? 173 VAL A C   1 
ATOM   1221 O O   . VAL A 1 173 ? -31.892 -22.571 -31.839 1.00 16.41  ? 173 VAL A O   1 
ATOM   1222 C CB  . VAL A 1 173 ? -34.370 -20.443 -31.075 1.00 18.64  ? 173 VAL A CB  1 
ATOM   1223 C CG1 . VAL A 1 173 ? -33.345 -19.618 -31.872 1.00 16.58  ? 173 VAL A CG1 1 
ATOM   1224 C CG2 . VAL A 1 173 ? -35.731 -19.981 -31.567 1.00 19.29  ? 173 VAL A CG2 1 
ATOM   1225 N N   . SER A 1 174 ? -32.575 -22.588 -29.722 1.00 13.69  ? 174 SER A N   1 
ATOM   1226 C CA  . SER A 1 174 ? -31.347 -23.053 -29.153 1.00 16.98  ? 174 SER A CA  1 
ATOM   1227 C C   . SER A 1 174 ? -31.009 -24.424 -29.769 1.00 18.37  ? 174 SER A C   1 
ATOM   1228 O O   . SER A 1 174 ? -29.856 -24.656 -30.125 1.00 17.11  ? 174 SER A O   1 
ATOM   1229 C CB  . SER A 1 174 ? -31.591 -23.097 -27.651 1.00 18.54  ? 174 SER A CB  1 
ATOM   1230 O OG  . SER A 1 174 ? -30.461 -23.528 -26.941 1.00 29.14  ? 174 SER A OG  1 
ATOM   1231 N N   . THR A 1 175 ? -31.989 -25.321 -29.970 1.00 17.01  ? 175 THR A N   1 
ATOM   1232 C CA  . THR A 1 175 ? -31.745 -26.612 -30.609 1.00 21.79  ? 175 THR A CA  1 
ATOM   1233 C C   . THR A 1 175 ? -31.472 -26.534 -32.109 1.00 19.16  ? 175 THR A C   1 
ATOM   1234 O O   . THR A 1 175 ? -30.589 -27.255 -32.570 1.00 20.39  ? 175 THR A O   1 
ATOM   1235 C CB  . THR A 1 175 ? -32.933 -27.576 -30.350 1.00 21.08  ? 175 THR A CB  1 
ATOM   1236 O OG1 . THR A 1 175 ? -32.712 -27.974 -29.007 1.00 25.30  ? 175 THR A OG1 1 
ATOM   1237 C CG2 . THR A 1 175 ? -33.032 -28.804 -31.260 1.00 21.23  ? 175 THR A CG2 1 
ATOM   1238 N N   . TYR A 1 176 ? -32.160 -25.678 -32.847 1.00 16.63  ? 176 TYR A N   1 
ATOM   1239 C CA  . TYR A 1 176 ? -31.936 -25.523 -34.257 1.00 16.58  ? 176 TYR A CA  1 
ATOM   1240 C C   . TYR A 1 176 ? -30.582 -24.868 -34.525 1.00 19.33  ? 176 TYR A C   1 
ATOM   1241 O O   . TYR A 1 176 ? -29.921 -25.203 -35.510 1.00 20.10  ? 176 TYR A O   1 
ATOM   1242 C CB  . TYR A 1 176 ? -33.025 -24.669 -34.886 1.00 15.81  ? 176 TYR A CB  1 
ATOM   1243 C CG  . TYR A 1 176 ? -34.438 -25.210 -34.777 1.00 19.68  ? 176 TYR A CG  1 
ATOM   1244 C CD1 . TYR A 1 176 ? -34.644 -26.541 -34.478 1.00 19.54  ? 176 TYR A CD1 1 
ATOM   1245 C CD2 . TYR A 1 176 ? -35.511 -24.357 -34.895 1.00 17.23  ? 176 TYR A CD2 1 
ATOM   1246 C CE1 . TYR A 1 176 ? -35.908 -27.022 -34.276 1.00 19.41  ? 176 TYR A CE1 1 
ATOM   1247 C CE2 . TYR A 1 176 ? -36.785 -24.852 -34.686 1.00 20.80  ? 176 TYR A CE2 1 
ATOM   1248 C CZ  . TYR A 1 176 ? -36.967 -26.179 -34.370 1.00 19.66  ? 176 TYR A CZ  1 
ATOM   1249 O OH  . TYR A 1 176 ? -38.217 -26.692 -34.065 1.00 23.79  ? 176 TYR A OH  1 
ATOM   1250 N N   . LEU A 1 177 ? -30.118 -23.986 -33.641 1.00 18.08  ? 177 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 177 ? -28.842 -23.326 -33.823 1.00 18.54  ? 177 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 177 ? -27.681 -24.193 -33.354 1.00 20.27  ? 177 LEU A C   1 
ATOM   1253 O O   . LEU A 1 177 ? -26.583 -24.111 -33.918 1.00 21.98  ? 177 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 177 ? -28.862 -21.980 -33.091 1.00 13.77  ? 177 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 177 ? -29.820 -20.897 -33.643 1.00 17.94  ? 177 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 177 ? -29.587 -19.579 -32.900 1.00 13.68  ? 177 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 177 ? -29.550 -20.604 -35.102 1.00 19.09  ? 177 LEU A CD2 1 
ATOM   1258 N N   . ARG A 1 178 ? -27.847 -25.028 -32.324 1.00 19.95  ? 178 ARG A N   1 
ATOM   1259 C CA  . ARG A 1 178 ? -26.832 -26.009 -31.967 1.00 25.12  ? 178 ARG A CA  1 
ATOM   1260 C C   . ARG A 1 178 ? -26.702 -27.083 -33.072 1.00 26.06  ? 178 ARG A C   1 
ATOM   1261 O O   . ARG A 1 178 ? -25.625 -27.636 -33.234 1.00 30.91  ? 178 ARG A O   1 
ATOM   1262 C CB  . ARG A 1 178 ? -27.200 -26.690 -30.677 1.00 24.11  ? 178 ARG A CB  1 
ATOM   1263 C CG  . ARG A 1 178 ? -26.147 -27.627 -30.146 1.00 30.75  ? 178 ARG A CG  1 
ATOM   1264 C CD  . ARG A 1 178 ? -25.024 -26.858 -29.539 1.00 34.88  ? 178 ARG A CD  1 
ATOM   1265 N NE  . ARG A 1 178 ? -23.993 -27.803 -29.189 1.00 42.80  ? 178 ARG A NE  1 
ATOM   1266 C CZ  . ARG A 1 178 ? -22.984 -27.493 -28.363 1.00 50.27  ? 178 ARG A CZ  1 
ATOM   1267 N NH1 . ARG A 1 178 ? -22.840 -26.286 -27.801 1.00 50.46  ? 178 ARG A NH1 1 
ATOM   1268 N NH2 . ARG A 1 178 ? -22.076 -28.434 -28.097 1.00 51.74  ? 178 ARG A NH2 1 
ATOM   1269 N N   . THR A 1 179 ? -27.732 -27.427 -33.860 1.00 26.52  ? 179 THR A N   1 
ATOM   1270 C CA  . THR A 1 179 ? -27.632 -28.382 -34.979 1.00 27.28  ? 179 THR A CA  1 
ATOM   1271 C C   . THR A 1 179 ? -26.857 -27.748 -36.114 1.00 28.68  ? 179 THR A C   1 
ATOM   1272 O O   . THR A 1 179 ? -25.906 -28.352 -36.590 1.00 25.26  ? 179 THR A O   1 
ATOM   1273 C CB  . THR A 1 179 ? -29.017 -28.817 -35.560 1.00 28.35  ? 179 THR A CB  1 
ATOM   1274 O OG1 . THR A 1 179 ? -29.693 -29.402 -34.452 1.00 31.25  ? 179 THR A OG1 1 
ATOM   1275 C CG2 . THR A 1 179 ? -28.975 -29.834 -36.708 1.00 25.95  ? 179 THR A CG2 1 
ATOM   1276 N N   . VAL A 1 180 ? -27.244 -26.543 -36.560 1.00 28.78  ? 180 VAL A N   1 
ATOM   1277 C CA  . VAL A 1 180 ? -26.522 -25.823 -37.600 1.00 27.18  ? 180 VAL A CA  1 
ATOM   1278 C C   . VAL A 1 180 ? -25.066 -25.635 -37.184 1.00 29.27  ? 180 VAL A C   1 
ATOM   1279 O O   . VAL A 1 180 ? -24.183 -25.882 -37.991 1.00 29.15  ? 180 VAL A O   1 
ATOM   1280 C CB  . VAL A 1 180 ? -27.196 -24.475 -37.838 1.00 24.48  ? 180 VAL A CB  1 
ATOM   1281 C CG1 . VAL A 1 180 ? -26.354 -23.612 -38.791 1.00 26.86  ? 180 VAL A CG1 1 
ATOM   1282 C CG2 . VAL A 1 180 ? -28.579 -24.718 -38.400 1.00 21.25  ? 180 VAL A CG2 1 
ATOM   1283 N N   . GLN A 1 181 ? -24.806 -25.290 -35.922 1.00 27.73  ? 181 GLN A N   1 
ATOM   1284 C CA  . GLN A 1 181 ? -23.483 -25.094 -35.415 1.00 29.13  ? 181 GLN A CA  1 
ATOM   1285 C C   . GLN A 1 181 ? -22.745 -26.419 -35.505 1.00 36.08  ? 181 GLN A C   1 
ATOM   1286 O O   . GLN A 1 181 ? -21.578 -26.447 -35.903 1.00 37.84  ? 181 GLN A O   1 
ATOM   1287 C CB  . GLN A 1 181 ? -23.556 -24.639 -33.975 1.00 26.70  ? 181 GLN A CB  1 
ATOM   1288 C CG  . GLN A 1 181 ? -22.208 -24.563 -33.277 1.00 26.43  ? 181 GLN A CG  1 
ATOM   1289 C CD  . GLN A 1 181 ? -22.290 -24.398 -31.779 1.00 33.10  ? 181 GLN A CD  1 
ATOM   1290 O OE1 . GLN A 1 181 ? -23.029 -25.081 -31.077 1.00 39.75  ? 181 GLN A OE1 1 
ATOM   1291 N NE2 . GLN A 1 181 ? -21.523 -23.474 -31.222 1.00 33.92  ? 181 GLN A NE2 1 
ATOM   1292 N N   . CYS A 1 182 ? -23.383 -27.536 -35.149 1.00 39.31  ? 182 CYS A N   1 
ATOM   1293 C CA  . CYS A 1 182 ? -22.697 -28.802 -35.202 1.00 43.84  ? 182 CYS A CA  1 
ATOM   1294 C C   . CYS A 1 182 ? -22.423 -29.256 -36.616 1.00 44.38  ? 182 CYS A C   1 
ATOM   1295 O O   . CYS A 1 182 ? -21.455 -29.965 -36.808 1.00 49.24  ? 182 CYS A O   1 
ATOM   1296 C CB  . CYS A 1 182 ? -23.482 -29.867 -34.539 1.00 48.40  ? 182 CYS A CB  1 
ATOM   1297 S SG  . CYS A 1 182 ? -23.547 -29.739 -32.749 1.00 59.17  ? 182 CYS A SG  1 
ATOM   1298 N N   . ARG A 1 183 ? -23.209 -28.855 -37.609 1.00 45.26  ? 183 ARG A N   1 
ATOM   1299 C CA  . ARG A 1 183 ? -23.028 -29.235 -39.002 1.00 47.51  ? 183 ARG A CA  1 
ATOM   1300 C C   . ARG A 1 183 ? -22.173 -28.278 -39.788 1.00 52.47  ? 183 ARG A C   1 
ATOM   1301 O O   . ARG A 1 183 ? -21.801 -28.590 -40.919 1.00 56.14  ? 183 ARG A O   1 
ATOM   1302 C CB  . ARG A 1 183 ? -24.303 -29.259 -39.771 1.00 43.03  ? 183 ARG A CB  1 
ATOM   1303 C CG  . ARG A 1 183 ? -25.309 -30.274 -39.412 1.00 38.36  ? 183 ARG A CG  1 
ATOM   1304 C CD  . ARG A 1 183 ? -26.404 -29.806 -40.314 1.00 38.09  ? 183 ARG A CD  1 
ATOM   1305 N NE  . ARG A 1 183 ? -27.569 -30.639 -40.153 1.00 40.32  ? 183 ARG A NE  1 
ATOM   1306 C CZ  . ARG A 1 183 ? -28.780 -30.288 -40.546 1.00 38.27  ? 183 ARG A CZ  1 
ATOM   1307 N NH1 . ARG A 1 183 ? -29.044 -29.119 -41.123 1.00 36.19  ? 183 ARG A NH1 1 
ATOM   1308 N NH2 . ARG A 1 183 ? -29.732 -31.191 -40.367 1.00 41.71  ? 183 ARG A NH2 1 
ATOM   1309 N N   . SER A 1 184 ? -21.940 -27.081 -39.253 1.00 57.19  ? 184 SER A N   1 
ATOM   1310 C CA  . SER A 1 184 ? -21.188 -26.074 -39.968 1.00 61.88  ? 184 SER A CA  1 
ATOM   1311 C C   . SER A 1 184 ? -19.715 -26.211 -39.694 1.00 65.54  ? 184 SER A C   1 
ATOM   1312 O O   . SER A 1 184 ? -19.300 -27.336 -39.416 1.00 63.80  ? 184 SER A O   1 
ATOM   1313 C CB  . SER A 1 184 ? -21.735 -24.700 -39.584 1.00 59.41  ? 184 SER A CB  1 
ATOM   1314 O OG  . SER A 1 184 ? -22.996 -24.567 -40.237 1.00 57.48  ? 184 SER A OG  1 
ATOM   1315 N N   . VAL A 1 185 ? -18.910 -25.143 -39.725 1.00 74.51  ? 185 VAL A N   1 
ATOM   1316 C CA  . VAL A 1 185 ? -17.464 -25.336 -39.694 1.00 83.99  ? 185 VAL A CA  1 
ATOM   1317 C C   . VAL A 1 185 ? -16.929 -26.062 -38.449 1.00 88.92  ? 185 VAL A C   1 
ATOM   1318 O O   . VAL A 1 185 ? -15.773 -26.518 -38.463 1.00 91.05  ? 185 VAL A O   1 
ATOM   1319 C CB  . VAL A 1 185 ? -16.810 -23.925 -39.959 1.00 84.31  ? 185 VAL A CB  1 
ATOM   1320 C CG1 . VAL A 1 185 ? -15.272 -23.945 -39.928 1.00 83.16  ? 185 VAL A CG1 1 
ATOM   1321 C CG2 . VAL A 1 185 ? -17.183 -23.495 -41.382 1.00 83.27  ? 185 VAL A CG2 1 
ATOM   1322 N N   . GLU A 1 186 ? -17.706 -26.238 -37.367 1.00 91.39  ? 186 GLU A N   1 
ATOM   1323 C CA  . GLU A 1 186 ? -17.254 -27.282 -36.482 1.00 95.55  ? 186 GLU A CA  1 
ATOM   1324 C C   . GLU A 1 186 ? -18.245 -28.400 -36.688 1.00 96.99  ? 186 GLU A C   1 
ATOM   1325 O O   . GLU A 1 186 ? -19.309 -28.465 -36.063 1.00 97.29  ? 186 GLU A O   1 
ATOM   1326 C CB  . GLU A 1 186 ? -17.218 -26.934 -34.997 1.00 98.08  ? 186 GLU A CB  1 
ATOM   1327 C CG  . GLU A 1 186 ? -16.415 -28.083 -34.306 1.00 103.55 ? 186 GLU A CG  1 
ATOM   1328 C CD  . GLU A 1 186 ? -15.127 -28.589 -35.016 1.00 105.62 ? 186 GLU A CD  1 
ATOM   1329 O OE1 . GLU A 1 186 ? -14.080 -27.933 -34.931 1.00 106.38 ? 186 GLU A OE1 1 
ATOM   1330 O OE2 . GLU A 1 186 ? -15.170 -29.649 -35.657 1.00 106.46 ? 186 GLU A OE2 1 
ATOM   1331 N N   . GLY A 1 187 ? -17.792 -29.256 -37.624 1.00 98.14  ? 187 GLY A N   1 
ATOM   1332 C CA  . GLY A 1 187 ? -18.516 -30.427 -38.111 1.00 99.14  ? 187 GLY A CA  1 
ATOM   1333 C C   . GLY A 1 187 ? -18.534 -31.643 -37.185 1.00 100.24 ? 187 GLY A C   1 
ATOM   1334 O O   . GLY A 1 187 ? -18.527 -32.782 -37.664 1.00 100.27 ? 187 GLY A O   1 
ATOM   1335 N N   . SER A 1 188 ? -18.625 -31.364 -35.868 1.00 100.75 ? 188 SER A N   1 
ATOM   1336 C CA  . SER A 1 188 ? -18.619 -32.324 -34.768 1.00 100.85 ? 188 SER A CA  1 
ATOM   1337 C C   . SER A 1 188 ? -18.759 -31.612 -33.405 1.00 99.09  ? 188 SER A C   1 
ATOM   1338 O O   . SER A 1 188 ? -17.886 -31.705 -32.530 1.00 100.18 ? 188 SER A O   1 
ATOM   1339 C CB  . SER A 1 188 ? -17.302 -33.146 -34.816 1.00 103.18 ? 188 SER A CB  1 
ATOM   1340 O OG  . SER A 1 188 ? -16.113 -32.361 -34.933 1.00 105.15 ? 188 SER A OG  1 
ATOM   1341 N N   . CYS A 1 189 ? -19.870 -30.896 -33.158 1.00 95.94  ? 189 CYS A N   1 
ATOM   1342 C CA  . CYS A 1 189 ? -20.011 -30.161 -31.902 1.00 91.76  ? 189 CYS A CA  1 
ATOM   1343 C C   . CYS A 1 189 ? -20.828 -30.777 -30.770 1.00 92.98  ? 189 CYS A C   1 
ATOM   1344 O O   . CYS A 1 189 ? -20.386 -30.663 -29.628 1.00 93.51  ? 189 CYS A O   1 
ATOM   1345 C CB  . CYS A 1 189 ? -20.541 -28.779 -32.257 1.00 84.09  ? 189 CYS A CB  1 
ATOM   1346 S SG  . CYS A 1 189 ? -22.281 -28.406 -31.921 1.00 75.60  ? 189 CYS A SG  1 
ATOM   1347 N N   . GLY A 1 190 ? -21.983 -31.424 -31.017 1.00 95.32  ? 190 GLY A N   1 
ATOM   1348 C CA  . GLY A 1 190 ? -22.848 -32.057 -29.991 1.00 97.78  ? 190 GLY A CA  1 
ATOM   1349 C C   . GLY A 1 190 ? -23.899 -31.174 -29.268 1.00 98.41  ? 190 GLY A C   1 
ATOM   1350 O O   . GLY A 1 190 ? -24.806 -30.587 -29.872 1.00 99.83  ? 190 GLY A O   1 
ATOM   1351 N N   . PHE A 1 191 ? -23.831 -31.189 -27.927 1.00 96.95  ? 191 PHE A N   1 
ATOM   1352 C CA  . PHE A 1 191 ? -24.566 -30.285 -27.044 1.00 97.26  ? 191 PHE A CA  1 
ATOM   1353 C C   . PHE A 1 191 ? -23.984 -30.446 -25.643 1.00 97.60  ? 191 PHE A C   1 
ATOM   1354 O O   . PHE A 1 191 ? -23.333 -29.546 -25.108 1.00 99.24  ? 191 PHE A O   1 
ATOM   1355 C CB  . PHE A 1 191 ? -26.080 -30.576 -26.943 1.00 95.97  ? 191 PHE A CB  1 
ATOM   1356 C CG  . PHE A 1 191 ? -26.915 -29.319 -26.627 1.00 94.70  ? 191 PHE A CG  1 
ATOM   1357 C CD1 . PHE A 1 191 ? -26.574 -28.445 -25.604 1.00 92.27  ? 191 PHE A CD1 1 
ATOM   1358 C CD2 . PHE A 1 191 ? -28.039 -29.034 -27.393 1.00 95.60  ? 191 PHE A CD2 1 
ATOM   1359 C CE1 . PHE A 1 191 ? -27.340 -27.321 -25.363 1.00 91.20  ? 191 PHE A CE1 1 
ATOM   1360 C CE2 . PHE A 1 191 ? -28.805 -27.902 -27.145 1.00 93.14  ? 191 PHE A CE2 1 
ATOM   1361 C CZ  . PHE A 1 191 ? -28.455 -27.044 -26.128 1.00 91.71  ? 191 PHE A CZ  1 
HETATM 1362 O O   . HOH B 2 .   ? -25.713 -21.740 -35.021 1.00 24.10  ? 200 HOH A O   1 
HETATM 1363 O O   . HOH B 2 .   ? -28.722 -13.502 -25.664 1.00 15.59  ? 201 HOH A O   1 
HETATM 1364 O O   . HOH B 2 .   ? -28.136 -14.421 -17.011 1.00 52.45  ? 202 HOH A O   1 
HETATM 1365 O O   . HOH B 2 .   ? -39.632 -14.806 -12.494 1.00 17.42  ? 203 HOH A O   1 
HETATM 1366 O O   . HOH B 2 .   ? -35.479 -6.894  -17.657 1.00 26.42  ? 204 HOH A O   1 
HETATM 1367 O O   . HOH B 2 .   ? -32.755 -10.068 -11.475 1.00 15.71  ? 205 HOH A O   1 
HETATM 1368 O O   . HOH B 2 .   ? -12.017 -21.219 -31.454 1.00 57.07  ? 206 HOH A O   1 
HETATM 1369 O O   . HOH B 2 .   ? -28.835 -11.913 -27.910 1.00 25.03  ? 207 HOH A O   1 
HETATM 1370 O O   . HOH B 2 .   ? -50.107 -17.870 -5.193  1.00 34.27  ? 209 HOH A O   1 
HETATM 1371 O O   . HOH B 2 .   ? -46.028 -12.283 -33.460 1.00 39.65  ? 210 HOH A O   1 
HETATM 1372 O O   . HOH B 2 .   ? -37.308 -4.209  -17.187 1.00 42.26  ? 211 HOH A O   1 
HETATM 1373 O O   . HOH B 2 .   ? -24.023 -12.551 -44.784 1.00 30.18  ? 212 HOH A O   1 
HETATM 1374 O O   . HOH B 2 .   ? -21.701 -12.891 -34.088 1.00 32.36  ? 213 HOH A O   1 
HETATM 1375 O O   . HOH B 2 .   ? -34.424 -0.996  -27.366 1.00 35.55  ? 214 HOH A O   1 
HETATM 1376 O O   . HOH B 2 .   ? -18.280 -17.952 -29.682 1.00 25.93  ? 215 HOH A O   1 
HETATM 1377 O O   . HOH B 2 .   ? -35.979 -16.197 -6.711  1.00 40.87  ? 216 HOH A O   1 
HETATM 1378 O O   . HOH B 2 .   ? -40.766 -12.403 -11.646 1.00 18.15  ? 217 HOH A O   1 
HETATM 1379 O O   . HOH B 2 .   ? -50.588 -25.072 -3.384  1.00 41.43  ? 218 HOH A O   1 
HETATM 1380 O O   . HOH B 2 .   ? -36.718 -0.902  -32.708 1.00 66.60  ? 220 HOH A O   1 
HETATM 1381 O O   . HOH B 2 .   ? -38.708 -12.854 -7.158  1.00 39.59  ? 223 HOH A O   1 
HETATM 1382 O O   . HOH B 2 .   ? -45.896 -22.893 -6.391  1.00 34.09  ? 224 HOH A O   1 
HETATM 1383 O O   . HOH B 2 .   ? -13.892 -20.326 -29.138 1.00 24.41  ? 226 HOH A O   1 
HETATM 1384 O O   . HOH B 2 .   ? -23.830 -14.587 -35.273 1.00 36.98  ? 227 HOH A O   1 
HETATM 1385 O O   . HOH B 2 .   ? -47.498 -26.419 -15.906 1.00 28.20  ? 228 HOH A O   1 
HETATM 1386 O O   . HOH B 2 .   ? -32.084 -7.158  -36.976 1.00 64.35  ? 229 HOH A O   1 
HETATM 1387 O O   . HOH B 2 .   ? -15.590 -20.954 -40.657 1.00 32.21  ? 230 HOH A O   1 
HETATM 1388 O O   . HOH B 2 .   ? -24.183 -18.269 -22.807 1.00 53.50  ? 232 HOH A O   1 
HETATM 1389 O O   . HOH B 2 .   ? -39.604 -18.435 -6.598  1.00 32.97  ? 233 HOH A O   1 
HETATM 1390 O O   . HOH B 2 .   ? -27.481 -28.358 -44.751 1.00 32.09  ? 236 HOH A O   1 
HETATM 1391 O O   . HOH B 2 .   ? -35.235 -7.544  -8.983  1.00 39.62  ? 238 HOH A O   1 
HETATM 1392 O O   . HOH B 2 .   ? -29.415 -10.056 -9.411  1.00 69.69  ? 239 HOH A O   1 
HETATM 1393 O O   . HOH B 2 .   ? -17.775 -9.404  -41.502 1.00 44.80  ? 241 HOH A O   1 
HETATM 1394 O O   . HOH B 2 .   ? -25.626 -10.415 -33.841 1.00 33.08  ? 244 HOH A O   1 
HETATM 1395 O O   . HOH B 2 .   ? -29.455 -23.989 -24.437 1.00 32.66  ? 245 HOH A O   1 
HETATM 1396 O O   . HOH B 2 .   ? -40.224 -24.550 -10.092 1.00 54.06  ? 246 HOH A O   1 
HETATM 1397 O O   . HOH B 2 .   ? -43.426 -9.566  -33.720 1.00 27.10  ? 249 HOH A O   1 
HETATM 1398 O O   . HOH B 2 .   ? -44.096 -26.654 -15.503 1.00 45.64  ? 250 HOH A O   1 
HETATM 1399 O O   . HOH B 2 .   ? -40.816 -19.629 -3.944  1.00 58.99  ? 251 HOH A O   1 
HETATM 1400 O O   . HOH B 2 .   ? -51.255 -16.903 -31.817 1.00 80.75  ? 252 HOH A O   1 
HETATM 1401 O O   . HOH B 2 .   ? -42.999 -23.192 -31.250 1.00 35.15  ? 253 HOH A O   1 
HETATM 1402 O O   . HOH B 2 .   ? -37.874 -7.533  -37.712 1.00 56.52  ? 254 HOH A O   1 
HETATM 1403 O O   . HOH B 2 .   ? -47.699 -18.194 -3.505  1.00 30.58  ? 258 HOH A O   1 
HETATM 1404 O O   . HOH B 2 .   ? -47.245 -29.653 -21.611 1.00 67.43  ? 266 HOH A O   1 
HETATM 1405 O O   . HOH B 2 .   ? -29.500 -8.818  -12.580 1.00 53.01  ? 269 HOH A O   1 
HETATM 1406 O O   . HOH B 2 .   ? -34.559 -24.826 -21.123 1.00 46.09  ? 271 HOH A O   1 
HETATM 1407 O O   . HOH B 2 .   ? -33.102 0.579   -29.339 1.00 54.41  ? 272 HOH A O   1 
HETATM 1408 O O   . HOH B 2 .   ? -38.704 -15.651 -5.807  1.00 71.23  ? 273 HOH A O   1 
HETATM 1409 O O   . HOH B 2 .   ? -17.705 -10.989 -32.673 1.00 54.93  ? 274 HOH A O   1 
HETATM 1410 O O   . HOH B 2 .   ? -32.767 -26.637 -24.880 1.00 56.43  ? 275 HOH A O   1 
HETATM 1411 O O   . HOH B 2 .   ? -37.571 -7.516  -6.742  1.00 59.60  ? 285 HOH A O   1 
HETATM 1412 O O   . HOH B 2 .   ? -29.651 -2.806  -23.925 1.00 55.21  ? 288 HOH A O   1 
HETATM 1413 O O   . HOH B 2 .   ? -39.603 -26.888 -25.701 1.00 60.06  ? 289 HOH A O   1 
HETATM 1414 O O   . HOH B 2 .   ? -13.420 -19.233 -35.730 1.00 63.04  ? 290 HOH A O   1 
HETATM 1415 O O   . HOH B 2 .   ? -19.180 -24.055 -35.775 1.00 57.24  ? 291 HOH A O   1 
HETATM 1416 O O   . HOH B 2 .   ? -29.897 -6.165  -22.680 1.00 50.86  ? 292 HOH A O   1 
HETATM 1417 O O   . HOH B 2 .   ? -31.862 -0.496  -24.832 1.00 61.72  ? 293 HOH A O   1 
HETATM 1418 O O   . HOH B 2 .   ? -29.939 -5.783  -34.487 1.00 62.03  ? 294 HOH A O   1 
HETATM 1419 O O   . HOH B 2 .   ? -17.547 -20.313 -28.356 1.00 39.25  ? 295 HOH A O   1 
HETATM 1420 O O   . HOH B 2 .   ? -26.210 -25.403 -22.445 1.00 71.98  ? 296 HOH A O   1 
HETATM 1421 O O   . HOH B 2 .   ? -24.082 -14.145 -21.736 1.00 47.17  ? 297 HOH A O   1 
HETATM 1422 O O   . HOH B 2 .   ? -59.427 -25.035 -6.445  1.00 50.27  ? 298 HOH A O   1 
HETATM 1423 O O   . HOH B 2 .   ? -45.717 -23.394 -33.109 1.00 58.69  ? 299 HOH A O   1 
HETATM 1424 O O   . HOH B 2 .   ? -41.508 -27.150 -14.150 1.00 74.13  ? 300 HOH A O   1 
HETATM 1425 O O   . HOH B 2 .   ? -40.844 -11.913 -8.871  1.00 61.68  ? 301 HOH A O   1 
HETATM 1426 O O   . HOH B 2 .   ? -39.976 -9.719  -6.201  1.00 68.71  ? 302 HOH A O   1 
HETATM 1427 O O   . HOH B 2 .   ? -34.413 -2.600  -15.263 1.00 72.94  ? 303 HOH A O   1 
HETATM 1428 O O   . HOH B 2 .   ? -28.992 -3.795  -11.783 1.00 73.12  ? 304 HOH A O   1 
HETATM 1429 O O   . HOH B 2 .   ? -20.774 -10.838 -35.708 1.00 69.83  ? 305 HOH A O   1 
HETATM 1430 O O   . HOH B 2 .   ? -22.475 -9.126  -33.604 1.00 55.11  ? 306 HOH A O   1 
HETATM 1431 O O   . HOH B 2 .   ? -29.515 -22.267 -13.127 1.00 59.97  ? 307 HOH A O   1 
HETATM 1432 O O   . HOH B 2 .   ? -28.097 -22.519 -15.968 1.00 63.35  ? 308 HOH A O   1 
HETATM 1433 O O   . HOH B 2 .   ? -43.770 -25.287 -6.873  1.00 56.53  ? 309 HOH A O   1 
HETATM 1434 O O   . HOH B 2 .   ? -49.070 -12.614 -27.700 1.00 56.71  ? 310 HOH A O   1 
HETATM 1435 O O   . HOH B 2 .   ? -36.831 -11.653 -42.622 1.00 66.69  ? 311 HOH A O   1 
HETATM 1436 O O   . HOH B 2 .   ? -30.009 -4.855  -30.279 1.00 47.93  ? 312 HOH A O   1 
HETATM 1437 O O   . HOH B 2 .   ? -26.439 -11.902 -17.584 1.00 54.33  ? 313 HOH A O   1 
HETATM 1438 O O   . HOH B 2 .   ? -24.122 -10.675 -36.750 1.00 49.62  ? 314 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   1   1   PHE PHE A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  HIS 42  42  42  HIS HIS A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  TRP 45  45  45  TRP TRP A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ASP 130 130 ?   ?   ?   A . n 
A 1 131 GLY 131 131 ?   ?   ?   A . n 
A 1 132 SER 132 132 ?   ?   ?   A . n 
A 1 133 PRO 133 133 ?   ?   ?   A . n 
A 1 134 ARG 134 134 ?   ?   ?   A . n 
A 1 135 THR 135 135 ?   ?   ?   A . n 
A 1 136 GLY 136 136 ?   ?   ?   A . n 
A 1 137 GLN 137 137 ?   ?   ?   A . n 
A 1 138 ILE 138 138 ?   ?   ?   A . n 
A 1 139 PHE 139 139 ?   ?   ?   A . n 
A 1 140 LYS 140 140 ?   ?   ?   A . n 
A 1 141 GLN 141 141 ?   ?   ?   A . n 
A 1 142 THR 142 142 ?   ?   ?   A . n 
A 1 143 TYR 143 143 ?   ?   ?   A . n 
A 1 144 SER 144 144 ?   ?   ?   A . n 
A 1 145 LYS 145 145 ?   ?   ?   A . n 
A 1 146 PHE 146 146 ?   ?   ?   A . n 
A 1 147 ASP 147 147 ?   ?   ?   A . n 
A 1 148 THR 148 148 ?   ?   ?   A . n 
A 1 149 ASN 149 149 ?   ?   ?   A . n 
A 1 150 SER 150 150 ?   ?   ?   A . n 
A 1 151 HIS 151 151 ?   ?   ?   A . n 
A 1 152 ASN 152 152 ?   ?   ?   A . n 
A 1 153 ASP 153 153 ?   ?   ?   A . n 
A 1 154 ASP 154 154 ?   ?   ?   A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 CYS 165 165 165 CYS CYS A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 MET 170 170 170 MET MET A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  200 200 HOH HOH A . 
B 2 HOH 2  201 201 HOH HOH A . 
B 2 HOH 3  202 202 HOH HOH A . 
B 2 HOH 4  203 203 HOH HOH A . 
B 2 HOH 5  204 204 HOH HOH A . 
B 2 HOH 6  205 205 HOH HOH A . 
B 2 HOH 7  206 206 HOH HOH A . 
B 2 HOH 8  207 207 HOH HOH A . 
B 2 HOH 9  209 209 HOH HOH A . 
B 2 HOH 10 210 210 HOH HOH A . 
B 2 HOH 11 211 211 HOH HOH A . 
B 2 HOH 12 212 212 HOH HOH A . 
B 2 HOH 13 213 213 HOH HOH A . 
B 2 HOH 14 214 214 HOH HOH A . 
B 2 HOH 15 215 215 HOH HOH A . 
B 2 HOH 16 216 216 HOH HOH A . 
B 2 HOH 17 217 217 HOH HOH A . 
B 2 HOH 18 218 218 HOH HOH A . 
B 2 HOH 19 220 220 HOH HOH A . 
B 2 HOH 20 223 223 HOH HOH A . 
B 2 HOH 21 224 224 HOH HOH A . 
B 2 HOH 22 226 226 HOH HOH A . 
B 2 HOH 23 227 227 HOH HOH A . 
B 2 HOH 24 228 228 HOH HOH A . 
B 2 HOH 25 229 229 HOH HOH A . 
B 2 HOH 26 230 230 HOH HOH A . 
B 2 HOH 27 232 232 HOH HOH A . 
B 2 HOH 28 233 233 HOH HOH A . 
B 2 HOH 29 236 236 HOH HOH A . 
B 2 HOH 30 238 238 HOH HOH A . 
B 2 HOH 31 239 239 HOH HOH A . 
B 2 HOH 32 241 241 HOH HOH A . 
B 2 HOH 33 244 244 HOH HOH A . 
B 2 HOH 34 245 245 HOH HOH A . 
B 2 HOH 35 246 246 HOH HOH A . 
B 2 HOH 36 249 249 HOH HOH A . 
B 2 HOH 37 250 250 HOH HOH A . 
B 2 HOH 38 251 251 HOH HOH A . 
B 2 HOH 39 252 252 HOH HOH A . 
B 2 HOH 40 253 253 HOH HOH A . 
B 2 HOH 41 254 254 HOH HOH A . 
B 2 HOH 42 258 258 HOH HOH A . 
B 2 HOH 43 266 266 HOH HOH A . 
B 2 HOH 44 269 269 HOH HOH A . 
B 2 HOH 45 271 271 HOH HOH A . 
B 2 HOH 46 272 272 HOH HOH A . 
B 2 HOH 47 273 273 HOH HOH A . 
B 2 HOH 48 274 274 HOH HOH A . 
B 2 HOH 49 275 275 HOH HOH A . 
B 2 HOH 50 285 285 HOH HOH A . 
B 2 HOH 51 288 288 HOH HOH A . 
B 2 HOH 52 289 289 HOH HOH A . 
B 2 HOH 53 290 290 HOH HOH A . 
B 2 HOH 54 291 291 HOH HOH A . 
B 2 HOH 55 292 292 HOH HOH A . 
B 2 HOH 56 293 293 HOH HOH A . 
B 2 HOH 57 294 294 HOH HOH A . 
B 2 HOH 58 295 295 HOH HOH A . 
B 2 HOH 59 296 296 HOH HOH A . 
B 2 HOH 60 297 297 HOH HOH A . 
B 2 HOH 61 298 298 HOH HOH A . 
B 2 HOH 62 299 299 HOH HOH A . 
B 2 HOH 63 300 300 HOH HOH A . 
B 2 HOH 64 301 301 HOH HOH A . 
B 2 HOH 65 302 302 HOH HOH A . 
B 2 HOH 66 303 303 HOH HOH A . 
B 2 HOH 67 304 304 HOH HOH A . 
B 2 HOH 68 305 305 HOH HOH A . 
B 2 HOH 69 306 306 HOH HOH A . 
B 2 HOH 70 307 307 HOH HOH A . 
B 2 HOH 71 308 308 HOH HOH A . 
B 2 HOH 72 309 309 HOH HOH A . 
B 2 HOH 73 310 310 HOH HOH A . 
B 2 HOH 74 311 311 HOH HOH A . 
B 2 HOH 75 312 312 HOH HOH A . 
B 2 HOH 76 313 313 HOH HOH A . 
B 2 HOH 77 314 314 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_454 -x-1,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 -48.9915649282 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -39.9765401558 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            NE2 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             42 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             42 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.306 
_pdbx_validate_rmsd_bond.bond_target_value         1.373 
_pdbx_validate_rmsd_bond.bond_deviation            -0.067 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 14  ? ? CG  A TRP 14  ? ? CD2 A TRP 14  ? ? 112.04 106.30 5.74  0.80 N 
2  1 CE2 A TRP 14  ? ? CD2 A TRP 14  ? ? CG  A TRP 14  ? ? 101.82 107.30 -5.48 0.80 N 
3  1 NE  A ARG 16  ? ? CZ  A ARG 16  ? ? NH2 A ARG 16  ? ? 116.48 120.30 -3.82 0.50 N 
4  1 CD1 A TRP 45  ? ? CG  A TRP 45  ? ? CD2 A TRP 45  ? ? 112.25 106.30 5.95  0.80 N 
5  1 CE2 A TRP 45  ? ? CD2 A TRP 45  ? ? CG  A TRP 45  ? ? 101.72 107.30 -5.58 0.80 N 
6  1 CD1 A TRP 46  ? ? CG  A TRP 46  ? ? CD2 A TRP 46  ? ? 111.67 106.30 5.37  0.80 N 
7  1 CD1 A TRP 86  ? ? CG  A TRP 86  ? ? CD2 A TRP 86  ? ? 114.70 106.30 8.40  0.80 N 
8  1 CG  A TRP 86  ? ? CD1 A TRP 86  ? ? NE1 A TRP 86  ? ? 103.53 110.10 -6.57 1.00 N 
9  1 CE2 A TRP 86  ? ? CD2 A TRP 86  ? ? CG  A TRP 86  ? ? 100.39 107.30 -6.91 0.80 N 
10 1 NE  A ARG 127 ? ? CZ  A ARG 127 ? ? NH1 A ARG 127 ? ? 125.61 120.30 5.31  0.50 N 
11 1 NE  A ARG 127 ? ? CZ  A ARG 127 ? ? NH2 A ARG 127 ? ? 115.33 120.30 -4.97 0.50 N 
12 1 CA  A CYS 165 ? ? CB  A CYS 165 ? ? SG  A CYS 165 ? ? 121.00 114.20 6.80  1.10 N 
13 1 NE  A ARG 183 ? ? CZ  A ARG 183 ? ? NH2 A ARG 183 ? ? 115.96 120.30 -4.34 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 184 ? ? -88.44  -150.44 
2 1 SER A 188 ? ? -179.34 61.51   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 130 ? A ASP 130 
2  1 Y 1 A GLY 131 ? A GLY 131 
3  1 Y 1 A SER 132 ? A SER 132 
4  1 Y 1 A PRO 133 ? A PRO 133 
5  1 Y 1 A ARG 134 ? A ARG 134 
6  1 Y 1 A THR 135 ? A THR 135 
7  1 Y 1 A GLY 136 ? A GLY 136 
8  1 Y 1 A GLN 137 ? A GLN 137 
9  1 Y 1 A ILE 138 ? A ILE 138 
10 1 Y 1 A PHE 139 ? A PHE 139 
11 1 Y 1 A LYS 140 ? A LYS 140 
12 1 Y 1 A GLN 141 ? A GLN 141 
13 1 Y 1 A THR 142 ? A THR 142 
14 1 Y 1 A TYR 143 ? A TYR 143 
15 1 Y 1 A SER 144 ? A SER 144 
16 1 Y 1 A LYS 145 ? A LYS 145 
17 1 Y 1 A PHE 146 ? A PHE 146 
18 1 Y 1 A ASP 147 ? A ASP 147 
19 1 Y 1 A THR 148 ? A THR 148 
20 1 Y 1 A ASN 149 ? A ASN 149 
21 1 Y 1 A SER 150 ? A SER 150 
22 1 Y 1 A HIS 151 ? A HIS 151 
23 1 Y 1 A ASN 152 ? A ASN 152 
24 1 Y 1 A ASP 153 ? A ASP 153 
25 1 Y 1 A ASP 154 ? A ASP 154 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#