data_1HXW
# 
_entry.id   1HXW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HXW         
WWPDB D_1000174070 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HXW 
_pdbx_database_status.recvd_initial_deposition_date   1997-01-24 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Park, C.H.'   1 
'Nienaber, V.' 2 
'Kong, X.P.'   3 
# 
_citation.id                        primary 
_citation.title                     
'ABT-538 is a potent inhibitor of human immunodeficiency virus protease and has high oral bioavailability in humans.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            92 
_citation.page_first                2484 
_citation.page_last                 2488 
_citation.year                      1995 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7708670 
_citation.pdbx_database_id_DOI      10.1073/pnas.92.7.2484 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kempf, D.J.'     1  
primary 'Marsh, K.C.'     2  
primary 'Denissen, J.F.'  3  
primary 'McDonald, E.'    4  
primary 'Vasavanonda, S.' 5  
primary 'Flentge, C.A.'   6  
primary 'Green, B.E.'     7  
primary 'Fino, L.'        8  
primary 'Park, C.H.'      9  
primary 'Kong, X.P.'      10 
# 
_cell.entry_id           1HXW 
_cell.length_a           61.060 
_cell.length_b           86.880 
_cell.length_c           46.620 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1HXW 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIV-1 PROTEASE' 10830.781 2   3.4.23.16 ? ? ? 
2 non-polymer syn RITONAVIR        720.944   1   ?         ? ? ? 
3 water       nat water            18.015    100 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT
PVNIIGRNLLTQIGCTLNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  GLN n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 THR n 
1 13 ILE n 
1 14 LYS n 
1 15 ILE n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 LEU n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 MET n 
1 37 ASN n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 ARG n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 LEU n 
1 64 ILE n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 HIS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 VAL n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 LEU n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 ILE n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SCS-1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PBS7-CI 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    POL_HV1Z2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P12499 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;DGQYNNSLSEAGADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVR
QYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEIC
TEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSV
PLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQH
RTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTV
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HXW A 1 ? 99 ? P12499 24 ? 122 ? 1 99 
2 1 1HXW B 1 ? 99 ? P12499 24 ? 122 ? 1 99 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?       'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE        ?       'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?       'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?       'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE        ?       'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?       'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?       'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE         ?       'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE       ?       'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER           ?       'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?       'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE         ?       'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE          ?       'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE      ?       'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?       'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE         ?       'C5 H9 N O2'       115.130 
RIT peptide-like        . RITONAVIR       A-84538 'C37 H48 N6 O5 S2' 720.944 
THR 'L-peptide linking' y THREONINE       ?       'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?       'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE        ?       'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE          ?       'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1HXW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1994-04-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1HXW 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   18726 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         78.7 
_reflns.pdbx_Rmerge_I_obs            0.0434 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1HXW 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2010000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2010000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1520 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             100 
_refine_hist.number_atoms_total               1670 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        10.0 
# 
_struct.entry_id                  1HXW 
_struct.title                     'HIV-1 PROTEASE DIMER COMPLEXED WITH A-84538' 
_struct.pdbx_descriptor           'HIV-1 PROTEASE, RITONAVIR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HXW 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'ASPARTYL PROTEASE, HYDROLASE, ASPARTIC PROTEINASE, HIV, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 87 ? LEU A 90 ? ARG A 87 LEU A 90 1 ? 4 
HELX_P HELX_P2 2 ARG B 87 ? GLN B 92 ? ARG B 87 GLN B 92 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 10 ? ILE A 15 ? LEU A 10 ILE A 15 
A 2 GLN A 18 ? LEU A 23 ? GLN A 18 LEU A 23 
B 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 
B 2 GLY A 52 ? TYR A 59 ? GLY A 52 TYR A 59 
B 3 VAL A 75 ? GLY A 78 ? VAL A 75 GLY A 78 
C 1 ILE A 62 ? ILE A 66 ? ILE A 62 ILE A 66 
C 2 HIS A 69 ? GLY A 73 ? HIS A 69 GLY A 73 
D 1 THR A 96 ? ASN A 98 ? THR A 96 ASN A 98 
D 2 THR B 96 ? ASN B 98 ? THR B 96 ASN B 98 
E 1 LEU B 10 ? ILE B 15 ? LEU B 10 ILE B 15 
E 2 GLN B 18 ? LEU B 23 ? GLN B 18 LEU B 23 
F 1 LYS B 43 ? GLY B 49 ? LYS B 43 GLY B 49 
F 2 GLY B 52 ? TYR B 59 ? GLY B 52 TYR B 59 
F 3 VAL B 75 ? GLY B 78 ? VAL B 75 GLY B 78 
G 1 ILE B 62 ? ILE B 66 ? ILE B 62 ILE B 66 
G 2 HIS B 69 ? GLY B 73 ? HIS B 69 GLY B 73 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 11 ? O VAL A 11 N ALA A 22 ? N ALA A 22 
B 1 2 O LYS A 43 ? O LYS A 43 N GLN A 58 ? N GLN A 58 
B 2 3 O ARG A 57 ? O ARG A 57 N VAL A 77 ? N VAL A 77 
C 1 2 O ILE A 62 ? O ILE A 62 N GLY A 73 ? N GLY A 73 
D 1 2 O THR A 96 ? O THR A 96 N ASN B 98 ? N ASN B 98 
E 1 2 O VAL B 11 ? O VAL B 11 N ALA B 22 ? N ALA B 22 
F 1 2 O LYS B 43 ? O LYS B 43 N GLN B 58 ? N GLN B 58 
F 2 3 O ARG B 57 ? O ARG B 57 N VAL B 77 ? N VAL B 77 
G 1 2 O ILE B 62 ? O ILE B 62 N GLY B 73 ? N GLY B 73 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    20 
_struct_site.details              'BINDING SITE FOR RESIDUE RIT B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 TRP A 6  ? TRP A 6   . ? 4_455 ? 
2  AC1 20 ASP A 25 ? ASP A 25  . ? 1_555 ? 
3  AC1 20 GLY A 27 ? GLY A 27  . ? 1_555 ? 
4  AC1 20 ASP A 29 ? ASP A 29  . ? 1_555 ? 
5  AC1 20 GLY A 48 ? GLY A 48  . ? 1_555 ? 
6  AC1 20 GLY A 49 ? GLY A 49  . ? 1_555 ? 
7  AC1 20 ILE A 50 ? ILE A 50  . ? 1_555 ? 
8  AC1 20 VAL A 82 ? VAL A 82  . ? 1_555 ? 
9  AC1 20 HOH D .  ? HOH A 101 . ? 1_555 ? 
10 AC1 20 ARG B 8  ? ARG B 8   . ? 1_555 ? 
11 AC1 20 ASP B 25 ? ASP B 25  . ? 1_555 ? 
12 AC1 20 GLY B 27 ? GLY B 27  . ? 1_555 ? 
13 AC1 20 ASP B 29 ? ASP B 29  . ? 1_555 ? 
14 AC1 20 ASP B 30 ? ASP B 30  . ? 1_555 ? 
15 AC1 20 VAL B 32 ? VAL B 32  . ? 1_555 ? 
16 AC1 20 GLY B 49 ? GLY B 49  . ? 1_555 ? 
17 AC1 20 ILE B 50 ? ILE B 50  . ? 1_555 ? 
18 AC1 20 PRO B 81 ? PRO B 81  . ? 1_555 ? 
19 AC1 20 HOH E .  ? HOH B 302 . ? 1_555 ? 
20 AC1 20 HOH E .  ? HOH B 348 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HXW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1HXW 
_atom_sites.fract_transf_matrix[1][1]   0.016377 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011510 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021450 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . PRO A 1 1  ? 29.071 39.248 5.491   1.00 36.45  ? 1   PRO A N    1 
ATOM   2    C CA   . PRO A 1 1  ? 29.983 38.171 5.136   1.00 35.67  ? 1   PRO A CA   1 
ATOM   3    C C    . PRO A 1 1  ? 29.540 37.373 3.917   1.00 31.34  ? 1   PRO A C    1 
ATOM   4    O O    . PRO A 1 1  ? 28.380 37.476 3.533   1.00 34.24  ? 1   PRO A O    1 
ATOM   5    C CB   . PRO A 1 1  ? 30.126 37.270 6.375   1.00 35.64  ? 1   PRO A CB   1 
ATOM   6    C CG   . PRO A 1 1  ? 28.910 37.672 7.181   1.00 38.30  ? 1   PRO A CG   1 
ATOM   7    C CD   . PRO A 1 1  ? 28.927 39.170 6.913   1.00 39.93  ? 1   PRO A CD   1 
ATOM   8    H H2   . PRO A 1 1  ? 29.246 40.197 5.100   1.00 0.00   ? 1   PRO A H2   1 
ATOM   9    H H3   . PRO A 1 1  ? 28.124 39.059 5.075   1.00 0.00   ? 1   PRO A H3   1 
ATOM   10   N N    . GLN A 1 2  ? 30.417 36.603 3.299   1.00 30.20  ? 2   GLN A N    1 
ATOM   11   C CA   . GLN A 1 2  ? 30.037 35.792 2.165   1.00 32.99  ? 2   GLN A CA   1 
ATOM   12   C C    . GLN A 1 2  ? 30.067 34.364 2.629   1.00 33.44  ? 2   GLN A C    1 
ATOM   13   O O    . GLN A 1 2  ? 31.097 33.938 3.141   1.00 34.15  ? 2   GLN A O    1 
ATOM   14   C CB   . GLN A 1 2  ? 30.999 35.913 1.046   1.00 36.81  ? 2   GLN A CB   1 
ATOM   15   C CG   . GLN A 1 2  ? 30.349 35.299 -0.134  1.00 44.73  ? 2   GLN A CG   1 
ATOM   16   C CD   . GLN A 1 2  ? 31.238 35.322 -1.346  1.00 51.11  ? 2   GLN A CD   1 
ATOM   17   O OE1  . GLN A 1 2  ? 32.218 34.584 -1.345  1.00 54.41  ? 2   GLN A OE1  1 
ATOM   18   N NE2  . GLN A 1 2  ? 30.989 36.146 -2.352  1.00 49.42  ? 2   GLN A NE2  1 
ATOM   19   H H    . GLN A 1 2  ? 31.340 36.518 3.602   1.00 0.00   ? 2   GLN A H    1 
ATOM   20   H HE21 . GLN A 1 2  ? 31.567 36.076 -3.121  1.00 0.00   ? 2   GLN A HE21 1 
ATOM   21   H HE22 . GLN A 1 2  ? 30.232 36.770 -2.292  1.00 0.00   ? 2   GLN A HE22 1 
ATOM   22   N N    . ILE A 1 3  ? 28.952 33.657 2.537   1.00 30.28  ? 3   ILE A N    1 
ATOM   23   C CA   . ILE A 1 3  ? 28.864 32.290 3.024   1.00 26.83  ? 3   ILE A CA   1 
ATOM   24   C C    . ILE A 1 3  ? 28.747 31.269 1.863   1.00 25.88  ? 3   ILE A C    1 
ATOM   25   O O    . ILE A 1 3  ? 27.788 31.410 1.070   1.00 22.73  ? 3   ILE A O    1 
ATOM   26   C CB   . ILE A 1 3  ? 27.646 32.277 3.994   1.00 27.13  ? 3   ILE A CB   1 
ATOM   27   C CG1  . ILE A 1 3  ? 27.885 33.296 5.129   1.00 27.34  ? 3   ILE A CG1  1 
ATOM   28   C CG2  . ILE A 1 3  ? 27.429 30.848 4.533   1.00 24.72  ? 3   ILE A CG2  1 
ATOM   29   C CD1  . ILE A 1 3  ? 26.899 33.242 6.316   1.00 31.20  ? 3   ILE A CD1  1 
ATOM   30   H H    . ILE A 1 3  ? 28.179 34.033 2.064   1.00 0.00   ? 3   ILE A H    1 
ATOM   31   N N    . THR A 1 4  ? 29.708 30.345 1.676   1.00 24.57  ? 4   THR A N    1 
ATOM   32   C CA   . THR A 1 4  ? 29.614 29.358 0.616   1.00 23.12  ? 4   THR A CA   1 
ATOM   33   C C    . THR A 1 4  ? 28.807 28.229 1.263   1.00 19.99  ? 4   THR A C    1 
ATOM   34   O O    . THR A 1 4  ? 28.670 28.158 2.498   1.00 18.71  ? 4   THR A O    1 
ATOM   35   C CB   . THR A 1 4  ? 31.016 28.818 0.150   1.00 24.66  ? 4   THR A CB   1 
ATOM   36   O OG1  . THR A 1 4  ? 31.558 28.179 1.316   1.00 26.61  ? 4   THR A OG1  1 
ATOM   37   C CG2  . THR A 1 4  ? 31.897 29.889 -0.520  1.00 25.79  ? 4   THR A CG2  1 
ATOM   38   H H    . THR A 1 4  ? 30.459 30.247 2.292   1.00 0.00   ? 4   THR A H    1 
ATOM   39   H HG1  . THR A 1 4  ? 32.356 28.566 1.679   1.00 0.00   ? 4   THR A HG1  1 
ATOM   40   N N    . LEU A 1 5  ? 28.307 27.333 0.416   1.00 18.03  ? 5   LEU A N    1 
ATOM   41   C CA   . LEU A 1 5  ? 27.380 26.343 0.819   1.00 15.42  ? 5   LEU A CA   1 
ATOM   42   C C    . LEU A 1 5  ? 27.964 24.942 0.781   1.00 16.45  ? 5   LEU A C    1 
ATOM   43   O O    . LEU A 1 5  ? 27.277 23.946 0.690   1.00 11.79  ? 5   LEU A O    1 
ATOM   44   C CB   . LEU A 1 5  ? 26.147 26.556 -0.092  1.00 13.75  ? 5   LEU A CB   1 
ATOM   45   C CG   . LEU A 1 5  ? 25.511 27.966 0.053   1.00 13.25  ? 5   LEU A CG   1 
ATOM   46   C CD1  . LEU A 1 5  ? 24.443 28.269 -0.968  1.00 13.81  ? 5   LEU A CD1  1 
ATOM   47   C CD2  . LEU A 1 5  ? 24.963 28.006 1.453   1.00 13.27  ? 5   LEU A CD2  1 
ATOM   48   H H    . LEU A 1 5  ? 28.579 27.352 -0.514  1.00 0.00   ? 5   LEU A H    1 
ATOM   49   N N    . TRP A 1 6  ? 29.282 24.824 0.761   1.00 16.26  ? 6   TRP A N    1 
ATOM   50   C CA   . TRP A 1 6  ? 29.917 23.524 0.916   1.00 20.27  ? 6   TRP A CA   1 
ATOM   51   C C    . TRP A 1 6  ? 29.531 22.992 2.257   1.00 18.01  ? 6   TRP A C    1 
ATOM   52   O O    . TRP A 1 6  ? 29.453 21.812 2.420   1.00 22.18  ? 6   TRP A O    1 
ATOM   53   C CB   . TRP A 1 6  ? 31.405 23.575 0.944   1.00 15.79  ? 6   TRP A CB   1 
ATOM   54   C CG   . TRP A 1 6  ? 32.074 23.953 -0.361  1.00 18.64  ? 6   TRP A CG   1 
ATOM   55   C CD1  . TRP A 1 6  ? 32.313 25.243 -0.779  1.00 19.76  ? 6   TRP A CD1  1 
ATOM   56   C CD2  . TRP A 1 6  ? 32.541 23.008 -1.227  1.00 19.91  ? 6   TRP A CD2  1 
ATOM   57   N NE1  . TRP A 1 6  ? 32.916 25.104 -1.917  1.00 20.00  ? 6   TRP A NE1  1 
ATOM   58   C CE2  . TRP A 1 6  ? 33.086 23.797 -2.235  1.00 22.63  ? 6   TRP A CE2  1 
ATOM   59   C CE3  . TRP A 1 6  ? 32.574 21.616 -1.268  1.00 21.29  ? 6   TRP A CE3  1 
ATOM   60   C CZ2  . TRP A 1 6  ? 33.692 23.127 -3.316  1.00 24.23  ? 6   TRP A CZ2  1 
ATOM   61   C CZ3  . TRP A 1 6  ? 33.172 20.967 -2.342  1.00 23.22  ? 6   TRP A CZ3  1 
ATOM   62   C CH2  . TRP A 1 6  ? 33.737 21.723 -3.362  1.00 21.93  ? 6   TRP A CH2  1 
ATOM   63   H H    . TRP A 1 6  ? 29.838 25.630 0.751   1.00 0.00   ? 6   TRP A H    1 
ATOM   64   H HE1  . TRP A 1 6  ? 33.178 25.854 -2.492  1.00 0.00   ? 6   TRP A HE1  1 
ATOM   65   N N    . GLN A 1 7  ? 29.262 23.791 3.255   1.00 18.43  ? 7   GLN A N    1 
ATOM   66   C CA   . GLN A 1 7  ? 28.827 23.345 4.541   1.00 18.15  ? 7   GLN A CA   1 
ATOM   67   C C    . GLN A 1 7  ? 27.530 24.042 4.830   1.00 16.06  ? 7   GLN A C    1 
ATOM   68   O O    . GLN A 1 7  ? 27.108 24.948 4.137   1.00 18.09  ? 7   GLN A O    1 
ATOM   69   C CB   . GLN A 1 7  ? 29.818 23.723 5.608   1.00 28.80  ? 7   GLN A CB   1 
ATOM   70   C CG   . GLN A 1 7  ? 31.200 23.111 5.391   1.00 44.09  ? 7   GLN A CG   1 
ATOM   71   C CD   . GLN A 1 7  ? 32.375 23.984 5.867   1.00 53.77  ? 7   GLN A CD   1 
ATOM   72   O OE1  . GLN A 1 7  ? 32.568 25.167 5.554   1.00 61.48  ? 7   GLN A OE1  1 
ATOM   73   N NE2  . GLN A 1 7  ? 33.255 23.399 6.646   1.00 56.32  ? 7   GLN A NE2  1 
ATOM   74   H H    . GLN A 1 7  ? 29.312 24.762 3.138   1.00 0.00   ? 7   GLN A H    1 
ATOM   75   H HE21 . GLN A 1 7  ? 34.048 23.898 6.907   1.00 0.00   ? 7   GLN A HE21 1 
ATOM   76   H HE22 . GLN A 1 7  ? 33.103 22.473 6.906   1.00 0.00   ? 7   GLN A HE22 1 
ATOM   77   N N    . ARG A 1 8  ? 26.834 23.541 5.844   1.00 18.56  ? 8   ARG A N    1 
ATOM   78   C CA   . ARG A 1 8  ? 25.590 24.126 6.309   1.00 19.32  ? 8   ARG A CA   1 
ATOM   79   C C    . ARG A 1 8  ? 25.877 25.558 6.729   1.00 20.01  ? 8   ARG A C    1 
ATOM   80   O O    . ARG A 1 8  ? 26.858 25.719 7.478   1.00 18.56  ? 8   ARG A O    1 
ATOM   81   C CB   . ARG A 1 8  ? 25.039 23.350 7.512   1.00 21.88  ? 8   ARG A CB   1 
ATOM   82   C CG   . ARG A 1 8  ? 24.307 22.051 7.237   1.00 29.35  ? 8   ARG A CG   1 
ATOM   83   C CD   . ARG A 1 8  ? 23.948 21.359 8.528   1.00 39.12  ? 8   ARG A CD   1 
ATOM   84   N NE   . ARG A 1 8  ? 22.815 20.429 8.288   1.00 52.84  ? 8   ARG A NE   1 
ATOM   85   C CZ   . ARG A 1 8  ? 21.927 20.143 9.268   1.00 64.39  ? 8   ARG A CZ   1 
ATOM   86   N NH1  . ARG A 1 8  ? 21.979 20.814 10.472  1.00 70.05  ? 8   ARG A NH1  1 
ATOM   87   N NH2  . ARG A 1 8  ? 20.873 19.330 9.064   1.00 68.82  ? 8   ARG A NH2  1 
ATOM   88   H H    . ARG A 1 8  ? 27.161 22.745 6.271   1.00 0.00   ? 8   ARG A H    1 
ATOM   89   H HE   . ARG A 1 8  ? 22.749 19.897 7.464   1.00 0.00   ? 8   ARG A HE   1 
ATOM   90   H HH11 . ARG A 1 8  ? 22.763 21.433 10.658  1.00 0.00   ? 8   ARG A HH11 1 
ATOM   91   H HH12 . ARG A 1 8  ? 21.314 20.601 11.210  1.00 0.00   ? 8   ARG A HH12 1 
ATOM   92   H HH21 . ARG A 1 8  ? 20.741 18.836 8.224   1.00 0.00   ? 8   ARG A HH21 1 
ATOM   93   H HH22 . ARG A 1 8  ? 20.266 19.172 9.843   1.00 0.00   ? 8   ARG A HH22 1 
ATOM   94   N N    . PRO A 1 9  ? 25.098 26.578 6.301   1.00 21.99  ? 9   PRO A N    1 
ATOM   95   C CA   . PRO A 1 9  ? 25.313 27.964 6.736   1.00 22.09  ? 9   PRO A CA   1 
ATOM   96   C C    . PRO A 1 9  ? 24.826 28.218 8.188   1.00 19.31  ? 9   PRO A C    1 
ATOM   97   O O    . PRO A 1 9  ? 23.773 28.799 8.452   1.00 20.50  ? 9   PRO A O    1 
ATOM   98   C CB   . PRO A 1 9  ? 24.615 28.683 5.600   1.00 19.79  ? 9   PRO A CB   1 
ATOM   99   C CG   . PRO A 1 9  ? 23.436 27.844 5.214   1.00 19.75  ? 9   PRO A CG   1 
ATOM   100  C CD   . PRO A 1 9  ? 23.983 26.446 5.332   1.00 19.39  ? 9   PRO A CD   1 
ATOM   101  N N    . LEU A 1 10 ? 25.537 27.724 9.201   1.00 21.47  ? 10  LEU A N    1 
ATOM   102  C CA   . LEU A 1 10 ? 25.190 27.845 10.613  1.00 23.14  ? 10  LEU A CA   1 
ATOM   103  C C    . LEU A 1 10 ? 25.903 29.023 11.161  1.00 24.04  ? 10  LEU A C    1 
ATOM   104  O O    . LEU A 1 10 ? 27.077 29.149 10.844  1.00 27.14  ? 10  LEU A O    1 
ATOM   105  C CB   . LEU A 1 10 ? 25.645 26.677 11.404  1.00 26.15  ? 10  LEU A CB   1 
ATOM   106  C CG   . LEU A 1 10 ? 24.758 25.526 11.201  1.00 29.78  ? 10  LEU A CG   1 
ATOM   107  C CD1  . LEU A 1 10 ? 25.583 24.282 11.370  1.00 36.55  ? 10  LEU A CD1  1 
ATOM   108  C CD2  . LEU A 1 10 ? 23.599 25.621 12.150  1.00 32.86  ? 10  LEU A CD2  1 
ATOM   109  H H    . LEU A 1 10 ? 26.416 27.342 8.964   1.00 0.00   ? 10  LEU A H    1 
ATOM   110  N N    . VAL A 1 11 ? 25.198 29.866 11.930  1.00 23.25  ? 11  VAL A N    1 
ATOM   111  C CA   . VAL A 1 11 ? 25.693 31.151 12.494  1.00 23.13  ? 11  VAL A CA   1 
ATOM   112  C C    . VAL A 1 11 ? 25.242 31.179 13.928  1.00 21.37  ? 11  VAL A C    1 
ATOM   113  O O    . VAL A 1 11 ? 24.309 30.462 14.324  1.00 21.13  ? 11  VAL A O    1 
ATOM   114  C CB   . VAL A 1 11 ? 25.086 32.477 11.827  1.00 21.35  ? 11  VAL A CB   1 
ATOM   115  C CG1  . VAL A 1 11 ? 25.430 32.458 10.362  1.00 21.78  ? 11  VAL A CG1  1 
ATOM   116  C CG2  . VAL A 1 11 ? 23.563 32.604 11.972  1.00 20.71  ? 11  VAL A CG2  1 
ATOM   117  H H    . VAL A 1 11 ? 24.258 29.632 12.118  1.00 0.00   ? 11  VAL A H    1 
ATOM   118  N N    . THR A 1 12 ? 25.863 32.007 14.709  1.00 22.45  ? 12  THR A N    1 
ATOM   119  C CA   . THR A 1 12 ? 25.385 32.213 16.048  1.00 25.16  ? 12  THR A CA   1 
ATOM   120  C C    . THR A 1 12 ? 24.299 33.271 16.134  1.00 24.28  ? 12  THR A C    1 
ATOM   121  O O    . THR A 1 12 ? 24.376 34.309 15.478  1.00 27.42  ? 12  THR A O    1 
ATOM   122  C CB   . THR A 1 12 ? 26.588 32.573 16.951  1.00 27.38  ? 12  THR A CB   1 
ATOM   123  O OG1  . THR A 1 12 ? 27.523 31.496 16.836  1.00 28.64  ? 12  THR A OG1  1 
ATOM   124  C CG2  . THR A 1 12 ? 26.199 32.668 18.435  1.00 29.73  ? 12  THR A CG2  1 
ATOM   125  H H    . THR A 1 12 ? 26.704 32.426 14.432  1.00 0.00   ? 12  THR A H    1 
ATOM   126  H HG1  . THR A 1 12 ? 28.321 31.688 17.325  1.00 0.00   ? 12  THR A HG1  1 
ATOM   127  N N    . ILE A 1 13 ? 23.214 33.037 16.855  1.00 26.19  ? 13  ILE A N    1 
ATOM   128  C CA   . ILE A 1 13 ? 22.179 34.029 17.057  1.00 26.42  ? 13  ILE A CA   1 
ATOM   129  C C    . ILE A 1 13 ? 22.174 34.384 18.537  1.00 29.26  ? 13  ILE A C    1 
ATOM   130  O O    . ILE A 1 13 ? 22.518 33.503 19.353  1.00 25.78  ? 13  ILE A O    1 
ATOM   131  C CB   . ILE A 1 13 ? 20.738 33.534 16.710  1.00 25.30  ? 13  ILE A CB   1 
ATOM   132  C CG1  . ILE A 1 13 ? 20.331 32.241 17.416  1.00 21.75  ? 13  ILE A CG1  1 
ATOM   133  C CG2  . ILE A 1 13 ? 20.718 33.401 15.211  1.00 24.96  ? 13  ILE A CG2  1 
ATOM   134  C CD1  . ILE A 1 13 ? 18.804 31.976 17.372  1.00 27.62  ? 13  ILE A CD1  1 
ATOM   135  H H    . ILE A 1 13 ? 23.134 32.184 17.316  1.00 0.00   ? 13  ILE A H    1 
ATOM   136  N N    . LYS A 1 14 ? 21.756 35.599 18.886  1.00 28.37  ? 14  LYS A N    1 
ATOM   137  C CA   . LYS A 1 14 ? 21.598 35.921 20.275  1.00 28.73  ? 14  LYS A CA   1 
ATOM   138  C C    . LYS A 1 14 ? 20.141 36.254 20.369  1.00 26.19  ? 14  LYS A C    1 
ATOM   139  O O    . LYS A 1 14 ? 19.623 37.092 19.609  1.00 24.95  ? 14  LYS A O    1 
ATOM   140  C CB   . LYS A 1 14 ? 22.441 37.086 20.613  1.00 38.13  ? 14  LYS A CB   1 
ATOM   141  C CG   . LYS A 1 14 ? 22.578 37.168 22.114  1.00 49.08  ? 14  LYS A CG   1 
ATOM   142  C CD   . LYS A 1 14 ? 23.310 38.437 22.583  1.00 54.54  ? 14  LYS A CD   1 
ATOM   143  C CE   . LYS A 1 14 ? 24.547 38.940 21.778  1.00 63.02  ? 14  LYS A CE   1 
ATOM   144  N NZ   . LYS A 1 14 ? 25.652 38.011 21.547  1.00 65.91  ? 14  LYS A NZ   1 
ATOM   145  H H    . LYS A 1 14 ? 21.499 36.246 18.193  1.00 0.00   ? 14  LYS A H    1 
ATOM   146  H HZ1  . LYS A 1 14 ? 25.957 37.649 22.472  1.00 0.00   ? 14  LYS A HZ1  1 
ATOM   147  H HZ2  . LYS A 1 14 ? 25.328 37.216 20.958  1.00 0.00   ? 14  LYS A HZ2  1 
ATOM   148  H HZ3  . LYS A 1 14 ? 26.440 38.503 21.077  1.00 0.00   ? 14  LYS A HZ3  1 
ATOM   149  N N    . ILE A 1 15 ? 19.463 35.524 21.266  1.00 28.29  ? 15  ILE A N    1 
ATOM   150  C CA   . ILE A 1 15 ? 18.002 35.618 21.414  1.00 30.70  ? 15  ILE A CA   1 
ATOM   151  C C    . ILE A 1 15 ? 17.641 35.358 22.844  1.00 34.10  ? 15  ILE A C    1 
ATOM   152  O O    . ILE A 1 15 ? 18.103 34.352 23.381  1.00 37.43  ? 15  ILE A O    1 
ATOM   153  C CB   . ILE A 1 15 ? 17.258 34.580 20.512  1.00 28.66  ? 15  ILE A CB   1 
ATOM   154  C CG1  . ILE A 1 15 ? 15.854 34.586 20.920  1.00 26.90  ? 15  ILE A CG1  1 
ATOM   155  C CG2  . ILE A 1 15 ? 17.816 33.166 20.619  1.00 27.83  ? 15  ILE A CG2  1 
ATOM   156  C CD1  . ILE A 1 15 ? 14.921 34.308 19.778  1.00 24.15  ? 15  ILE A CD1  1 
ATOM   157  H H    . ILE A 1 15 ? 19.943 34.876 21.830  1.00 0.00   ? 15  ILE A H    1 
ATOM   158  N N    . GLY A 1 16 ? 16.882 36.245 23.482  1.00 37.74  ? 16  GLY A N    1 
ATOM   159  C CA   . GLY A 1 16 ? 16.447 36.085 24.875  1.00 43.34  ? 16  GLY A CA   1 
ATOM   160  C C    . GLY A 1 16 ? 17.597 35.744 25.842  1.00 44.56  ? 16  GLY A C    1 
ATOM   161  O O    . GLY A 1 16 ? 17.499 34.835 26.691  1.00 46.24  ? 16  GLY A O    1 
ATOM   162  H H    . GLY A 1 16 ? 16.622 37.059 23.012  1.00 0.00   ? 16  GLY A H    1 
ATOM   163  N N    . GLY A 1 17 ? 18.695 36.507 25.614  1.00 45.10  ? 17  GLY A N    1 
ATOM   164  C CA   . GLY A 1 17 ? 19.977 36.421 26.312  1.00 45.02  ? 17  GLY A CA   1 
ATOM   165  C C    . GLY A 1 17 ? 20.763 35.129 26.090  1.00 47.21  ? 17  GLY A C    1 
ATOM   166  O O    . GLY A 1 17 ? 21.757 34.928 26.796  1.00 48.99  ? 17  GLY A O    1 
ATOM   167  H H    . GLY A 1 17 ? 18.614 37.179 24.905  1.00 0.00   ? 17  GLY A H    1 
ATOM   168  N N    . GLN A 1 18 ? 20.424 34.193 25.188  1.00 46.59  ? 18  GLN A N    1 
ATOM   169  C CA   . GLN A 1 18 ? 21.211 32.994 25.029  1.00 41.59  ? 18  GLN A CA   1 
ATOM   170  C C    . GLN A 1 18 ? 21.752 33.011 23.618  1.00 36.38  ? 18  GLN A C    1 
ATOM   171  O O    . GLN A 1 18 ? 21.158 33.548 22.684  1.00 34.21  ? 18  GLN A O    1 
ATOM   172  C CB   . GLN A 1 18 ? 20.312 31.804 25.296  1.00 46.62  ? 18  GLN A CB   1 
ATOM   173  C CG   . GLN A 1 18 ? 19.857 31.703 26.762  1.00 56.16  ? 18  GLN A CG   1 
ATOM   174  C CD   . GLN A 1 18 ? 18.541 30.933 27.001  1.00 64.34  ? 18  GLN A CD   1 
ATOM   175  O OE1  . GLN A 1 18 ? 18.309 29.795 26.559  1.00 65.71  ? 18  GLN A OE1  1 
ATOM   176  N NE2  . GLN A 1 18 ? 17.586 31.489 27.745  1.00 68.16  ? 18  GLN A NE2  1 
ATOM   177  H H    . GLN A 1 18 ? 19.647 34.308 24.604  1.00 0.00   ? 18  GLN A H    1 
ATOM   178  H HE21 . GLN A 1 18 ? 16.756 30.996 27.819  1.00 0.00   ? 18  GLN A HE21 1 
ATOM   179  H HE22 . GLN A 1 18 ? 17.753 32.384 28.110  1.00 0.00   ? 18  GLN A HE22 1 
ATOM   180  N N    . LEU A 1 19 ? 22.953 32.503 23.474  1.00 33.19  ? 19  LEU A N    1 
ATOM   181  C CA   . LEU A 1 19 ? 23.511 32.354 22.154  1.00 32.72  ? 19  LEU A CA   1 
ATOM   182  C C    . LEU A 1 19 ? 23.096 30.990 21.630  1.00 33.84  ? 19  LEU A C    1 
ATOM   183  O O    . LEU A 1 19 ? 23.169 29.990 22.358  1.00 32.05  ? 19  LEU A O    1 
ATOM   184  C CB   . LEU A 1 19 ? 25.002 32.429 22.212  1.00 32.54  ? 19  LEU A CB   1 
ATOM   185  C CG   . LEU A 1 19 ? 25.510 33.769 22.619  1.00 34.25  ? 19  LEU A CG   1 
ATOM   186  C CD1  . LEU A 1 19 ? 26.948 33.719 22.964  1.00 35.42  ? 19  LEU A CD1  1 
ATOM   187  C CD2  . LEU A 1 19 ? 25.321 34.694 21.465  1.00 34.19  ? 19  LEU A CD2  1 
ATOM   188  H H    . LEU A 1 19 ? 23.402 32.107 24.244  1.00 0.00   ? 19  LEU A H    1 
ATOM   189  N N    . LYS A 1 20 ? 22.573 30.910 20.415  1.00 31.89  ? 20  LYS A N    1 
ATOM   190  C CA   . LYS A 1 20 ? 22.207 29.648 19.840  1.00 29.73  ? 20  LYS A CA   1 
ATOM   191  C C    . LYS A 1 20 ? 22.869 29.543 18.495  1.00 27.75  ? 20  LYS A C    1 
ATOM   192  O O    . LYS A 1 20 ? 23.407 30.496 17.955  1.00 24.82  ? 20  LYS A O    1 
ATOM   193  C CB   . LYS A 1 20 ? 20.724 29.589 19.710  1.00 32.99  ? 20  LYS A CB   1 
ATOM   194  C CG   . LYS A 1 20 ? 20.212 29.359 21.070  1.00 36.18  ? 20  LYS A CG   1 
ATOM   195  C CD   . LYS A 1 20 ? 18.785 28.970 21.101  1.00 45.14  ? 20  LYS A CD   1 
ATOM   196  C CE   . LYS A 1 20 ? 18.593 28.679 22.579  1.00 52.61  ? 20  LYS A CE   1 
ATOM   197  N NZ   . LYS A 1 20 ? 17.237 28.271 22.923  1.00 60.73  ? 20  LYS A NZ   1 
ATOM   198  H H    . LYS A 1 20 ? 22.475 31.708 19.854  1.00 0.00   ? 20  LYS A H    1 
ATOM   199  H HZ1  . LYS A 1 20 ? 16.978 27.422 22.381  1.00 0.00   ? 20  LYS A HZ1  1 
ATOM   200  H HZ2  . LYS A 1 20 ? 17.199 28.039 23.941  1.00 0.00   ? 20  LYS A HZ2  1 
ATOM   201  H HZ3  . LYS A 1 20 ? 16.566 29.039 22.724  1.00 0.00   ? 20  LYS A HZ3  1 
ATOM   202  N N    . GLU A 1 21 ? 22.803 28.389 17.889  1.00 26.72  ? 21  GLU A N    1 
ATOM   203  C CA   . GLU A 1 21 ? 23.450 28.145 16.618  1.00 28.53  ? 21  GLU A CA   1 
ATOM   204  C C    . GLU A 1 21 ? 22.243 28.053 15.685  1.00 24.82  ? 21  GLU A C    1 
ATOM   205  O O    . GLU A 1 21 ? 21.253 27.417 16.097  1.00 22.99  ? 21  GLU A O    1 
ATOM   206  C CB   . GLU A 1 21 ? 24.150 26.816 16.700  1.00 39.67  ? 21  GLU A CB   1 
ATOM   207  C CG   . GLU A 1 21 ? 25.151 26.513 15.622  1.00 58.04  ? 21  GLU A CG   1 
ATOM   208  C CD   . GLU A 1 21 ? 26.575 27.052 15.834  1.00 69.61  ? 21  GLU A CD   1 
ATOM   209  O OE1  . GLU A 1 21 ? 26.787 28.058 16.543  1.00 76.43  ? 21  GLU A OE1  1 
ATOM   210  O OE2  . GLU A 1 21 ? 27.486 26.439 15.258  1.00 76.42  ? 21  GLU A OE2  1 
ATOM   211  H H    . GLU A 1 21 ? 22.201 27.693 18.210  1.00 0.00   ? 21  GLU A H    1 
ATOM   212  N N    . ALA A 1 22 ? 22.172 28.605 14.483  1.00 22.55  ? 22  ALA A N    1 
ATOM   213  C CA   . ALA A 1 22 ? 20.970 28.391 13.679  1.00 19.12  ? 22  ALA A CA   1 
ATOM   214  C C    . ALA A 1 22 ? 21.378 28.449 12.231  1.00 17.58  ? 22  ALA A C    1 
ATOM   215  O O    . ALA A 1 22 ? 22.419 28.989 11.840  1.00 17.02  ? 22  ALA A O    1 
ATOM   216  C CB   . ALA A 1 22 ? 19.913 29.450 13.977  1.00 17.34  ? 22  ALA A CB   1 
ATOM   217  H H    . ALA A 1 22 ? 22.904 29.144 14.095  1.00 0.00   ? 22  ALA A H    1 
ATOM   218  N N    . LEU A 1 23 ? 20.534 27.822 11.440  1.00 16.35  ? 23  LEU A N    1 
ATOM   219  C CA   . LEU A 1 23 ? 20.815 27.673 10.058  1.00 15.78  ? 23  LEU A CA   1 
ATOM   220  C C    . LEU A 1 23 ? 20.315 28.849 9.251   1.00 16.18  ? 23  LEU A C    1 
ATOM   221  O O    . LEU A 1 23 ? 19.163 29.192 9.440   1.00 16.48  ? 23  LEU A O    1 
ATOM   222  C CB   . LEU A 1 23 ? 20.173 26.363 9.714   1.00 16.85  ? 23  LEU A CB   1 
ATOM   223  C CG   . LEU A 1 23 ? 20.244 25.799 8.339   1.00 22.07  ? 23  LEU A CG   1 
ATOM   224  C CD1  . LEU A 1 23 ? 21.649 25.411 8.062   1.00 20.88  ? 23  LEU A CD1  1 
ATOM   225  C CD2  . LEU A 1 23 ? 19.496 24.475 8.274   1.00 20.60  ? 23  LEU A CD2  1 
ATOM   226  H H    . LEU A 1 23 ? 19.682 27.501 11.763  1.00 0.00   ? 23  LEU A H    1 
ATOM   227  N N    . LEU A 1 24 ? 21.036 29.534 8.358   1.00 17.29  ? 24  LEU A N    1 
ATOM   228  C CA   . LEU A 1 24 ? 20.420 30.540 7.505   1.00 16.10  ? 24  LEU A CA   1 
ATOM   229  C C    . LEU A 1 24 ? 19.680 29.834 6.391   1.00 14.73  ? 24  LEU A C    1 
ATOM   230  O O    . LEU A 1 24 ? 20.277 29.251 5.469   1.00 15.98  ? 24  LEU A O    1 
ATOM   231  C CB   . LEU A 1 24 ? 21.459 31.496 6.899   1.00 17.00  ? 24  LEU A CB   1 
ATOM   232  C CG   . LEU A 1 24 ? 22.331 32.262 7.914   1.00 19.79  ? 24  LEU A CG   1 
ATOM   233  C CD1  . LEU A 1 24 ? 23.282 33.163 7.123   1.00 19.44  ? 24  LEU A CD1  1 
ATOM   234  C CD2  . LEU A 1 24 ? 21.470 32.998 8.926   1.00 16.28  ? 24  LEU A CD2  1 
ATOM   235  H H    . LEU A 1 24 ? 21.985 29.353 8.279   1.00 0.00   ? 24  LEU A H    1 
ATOM   236  N N    . ASP A 1 25 ? 18.373 29.903 6.445   1.00 14.72  ? 25  ASP A N    1 
ATOM   237  C CA   . ASP A 1 25 ? 17.532 29.120 5.530   1.00 14.73  ? 25  ASP A CA   1 
ATOM   238  C C    . ASP A 1 25 ? 16.606 29.856 4.522   1.00 12.62  ? 25  ASP A C    1 
ATOM   239  O O    . ASP A 1 25 ? 15.500 30.326 4.814   1.00 12.60  ? 25  ASP A O    1 
ATOM   240  C CB   . ASP A 1 25 ? 16.761 28.213 6.442   1.00 13.65  ? 25  ASP A CB   1 
ATOM   241  C CG   . ASP A 1 25 ? 16.007 27.086 5.756   1.00 20.56  ? 25  ASP A CG   1 
ATOM   242  O OD1  . ASP A 1 25 ? 15.938 26.981 4.533   1.00 15.86  ? 25  ASP A OD1  1 
ATOM   243  O OD2  . ASP A 1 25 ? 15.437 26.310 6.491   1.00 23.23  ? 25  ASP A OD2  1 
ATOM   244  H H    . ASP A 1 25 ? 17.940 30.518 7.077   1.00 0.00   ? 25  ASP A H    1 
ATOM   245  N N    . THR A 1 26 ? 17.012 29.925 3.262   1.00 14.62  ? 26  THR A N    1 
ATOM   246  C CA   . THR A 1 26 ? 16.244 30.615 2.230   1.00 15.49  ? 26  THR A CA   1 
ATOM   247  C C    . THR A 1 26 ? 14.973 29.898 1.841   1.00 14.90  ? 26  THR A C    1 
ATOM   248  O O    . THR A 1 26 ? 14.067 30.451 1.237   1.00 15.51  ? 26  THR A O    1 
ATOM   249  C CB   . THR A 1 26 ? 17.128 30.826 1.000   1.00 15.52  ? 26  THR A CB   1 
ATOM   250  O OG1  . THR A 1 26 ? 17.566 29.586 0.500   1.00 10.98  ? 26  THR A OG1  1 
ATOM   251  C CG2  . THR A 1 26 ? 18.309 31.751 1.397   1.00 11.58  ? 26  THR A CG2  1 
ATOM   252  H H    . THR A 1 26 ? 17.873 29.533 3.014   1.00 0.00   ? 26  THR A H    1 
ATOM   253  H HG1  . THR A 1 26 ? 18.516 29.589 0.635   1.00 0.00   ? 26  THR A HG1  1 
ATOM   254  N N    . GLY A 1 27 ? 14.864 28.659 2.220   1.00 13.35  ? 27  GLY A N    1 
ATOM   255  C CA   . GLY A 1 27 ? 13.709 27.881 1.909   1.00 9.04   ? 27  GLY A CA   1 
ATOM   256  C C    . GLY A 1 27 ? 12.751 27.876 3.047   1.00 12.26  ? 27  GLY A C    1 
ATOM   257  O O    . GLY A 1 27 ? 11.752 27.202 2.920   1.00 15.67  ? 27  GLY A O    1 
ATOM   258  H H    . GLY A 1 27 ? 15.534 28.262 2.790   1.00 0.00   ? 27  GLY A H    1 
ATOM   259  N N    . ALA A 1 28 ? 12.918 28.570 4.189   1.00 12.61  ? 28  ALA A N    1 
ATOM   260  C CA   . ALA A 1 28 ? 11.861 28.582 5.228   1.00 11.92  ? 28  ALA A CA   1 
ATOM   261  C C    . ALA A 1 28 ? 11.164 29.968 5.185   1.00 15.07  ? 28  ALA A C    1 
ATOM   262  O O    . ALA A 1 28 ? 11.829 31.029 5.217   1.00 13.87  ? 28  ALA A O    1 
ATOM   263  C CB   . ALA A 1 28 ? 12.525 28.391 6.574   1.00 10.33  ? 28  ALA A CB   1 
ATOM   264  H H    . ALA A 1 28 ? 13.661 29.197 4.306   1.00 0.00   ? 28  ALA A H    1 
ATOM   265  N N    . ASP A 1 29 ? 9.871  30.052 5.029   1.00 14.74  ? 29  ASP A N    1 
ATOM   266  C CA   . ASP A 1 29 ? 9.263  31.351 5.196   1.00 18.25  ? 29  ASP A CA   1 
ATOM   267  C C    . ASP A 1 29 ? 9.444  31.931 6.591   1.00 17.38  ? 29  ASP A C    1 
ATOM   268  O O    . ASP A 1 29 ? 9.559  33.125 6.764   1.00 15.61  ? 29  ASP A O    1 
ATOM   269  C CB   . ASP A 1 29 ? 7.801  31.299 5.016   1.00 18.95  ? 29  ASP A CB   1 
ATOM   270  C CG   . ASP A 1 29 ? 7.306  30.997 3.633   1.00 18.46  ? 29  ASP A CG   1 
ATOM   271  O OD1  . ASP A 1 29 ? 8.082  30.737 2.730   1.00 17.76  ? 29  ASP A OD1  1 
ATOM   272  O OD2  . ASP A 1 29 ? 6.095  31.027 3.509   1.00 18.56  ? 29  ASP A OD2  1 
ATOM   273  H H    . ASP A 1 29 ? 9.366  29.278 4.662   1.00 0.00   ? 29  ASP A H    1 
ATOM   274  N N    . ASP A 1 30 ? 9.468  31.037 7.575   1.00 16.65  ? 30  ASP A N    1 
ATOM   275  C CA   . ASP A 1 30 ? 9.399  31.352 8.981   1.00 17.93  ? 30  ASP A CA   1 
ATOM   276  C C    . ASP A 1 30 ? 10.669 31.004 9.697   1.00 15.32  ? 30  ASP A C    1 
ATOM   277  O O    . ASP A 1 30 ? 11.503 30.246 9.183   1.00 17.24  ? 30  ASP A O    1 
ATOM   278  C CB   . ASP A 1 30 ? 8.218  30.587 9.589   1.00 18.49  ? 30  ASP A CB   1 
ATOM   279  C CG   . ASP A 1 30 ? 6.828  30.895 9.046   1.00 24.59  ? 30  ASP A CG   1 
ATOM   280  O OD1  . ASP A 1 30 ? 6.356  32.046 8.948   1.00 27.49  ? 30  ASP A OD1  1 
ATOM   281  O OD2  . ASP A 1 30 ? 6.199  29.920 8.689   1.00 34.48  ? 30  ASP A OD2  1 
ATOM   282  H H    . ASP A 1 30 ? 9.580  30.096 7.328   1.00 0.00   ? 30  ASP A H    1 
ATOM   283  N N    . THR A 1 31 ? 10.841 31.624 10.862  1.00 16.05  ? 31  THR A N    1 
ATOM   284  C CA   . THR A 1 31 ? 11.987 31.391 11.729  1.00 15.52  ? 31  THR A CA   1 
ATOM   285  C C    . THR A 1 31 ? 11.405 30.484 12.811  1.00 12.49  ? 31  THR A C    1 
ATOM   286  O O    . THR A 1 31 ? 10.375 30.780 13.445  1.00 13.98  ? 31  THR A O    1 
ATOM   287  C CB   . THR A 1 31 ? 12.455 32.730 12.268  1.00 12.73  ? 31  THR A CB   1 
ATOM   288  O OG1  . THR A 1 31 ? 13.120 33.407 11.206  1.00 15.21  ? 31  THR A OG1  1 
ATOM   289  C CG2  . THR A 1 31 ? 13.346 32.545 13.429  1.00 12.80  ? 31  THR A CG2  1 
ATOM   290  H H    . THR A 1 31 ? 10.168 32.270 11.184  1.00 0.00   ? 31  THR A H    1 
ATOM   291  H HG1  . THR A 1 31 ? 12.426 33.693 10.608  1.00 0.00   ? 31  THR A HG1  1 
ATOM   292  N N    . VAL A 1 32 ? 12.104 29.350 12.980  1.00 14.34  ? 32  VAL A N    1 
ATOM   293  C CA   . VAL A 1 32 ? 11.637 28.280 13.846  1.00 14.01  ? 32  VAL A CA   1 
ATOM   294  C C    . VAL A 1 32 ? 12.840 27.837 14.624  1.00 13.25  ? 32  VAL A C    1 
ATOM   295  O O    . VAL A 1 32 ? 13.864 27.386 14.119  1.00 16.32  ? 32  VAL A O    1 
ATOM   296  C CB   . VAL A 1 32 ? 11.083 26.998 13.103  1.00 15.98  ? 32  VAL A CB   1 
ATOM   297  C CG1  . VAL A 1 32 ? 10.309 26.129 14.101  1.00 16.01  ? 32  VAL A CG1  1 
ATOM   298  C CG2  . VAL A 1 32 ? 10.146 27.337 12.000  1.00 13.03  ? 32  VAL A CG2  1 
ATOM   299  H H    . VAL A 1 32 ? 12.952 29.233 12.504  1.00 0.00   ? 32  VAL A H    1 
ATOM   300  N N    . LEU A 1 33 ? 12.638 28.007 15.923  1.00 19.02  ? 33  LEU A N    1 
ATOM   301  C CA   . LEU A 1 33 ? 13.572 27.662 16.992  1.00 17.51  ? 33  LEU A CA   1 
ATOM   302  C C    . LEU A 1 33 ? 12.969 26.589 17.929  1.00 17.31  ? 33  LEU A C    1 
ATOM   303  O O    . LEU A 1 33 ? 11.774 26.481 18.201  1.00 18.03  ? 33  LEU A O    1 
ATOM   304  C CB   . LEU A 1 33 ? 13.945 28.928 17.867  1.00 17.59  ? 33  LEU A CB   1 
ATOM   305  C CG   . LEU A 1 33 ? 14.469 30.168 17.133  1.00 20.96  ? 33  LEU A CG   1 
ATOM   306  C CD1  . LEU A 1 33 ? 14.996 31.171 18.139  1.00 20.01  ? 33  LEU A CD1  1 
ATOM   307  C CD2  . LEU A 1 33 ? 15.683 29.809 16.268  1.00 20.83  ? 33  LEU A CD2  1 
ATOM   308  H H    . LEU A 1 33 ? 11.762 28.345 16.214  1.00 0.00   ? 33  LEU A H    1 
ATOM   309  N N    . GLU A 1 34 ? 13.934 25.796 18.356  1.00 20.48  ? 34  GLU A N    1 
ATOM   310  C CA   . GLU A 1 34 ? 13.825 24.780 19.364  1.00 24.64  ? 34  GLU A CA   1 
ATOM   311  C C    . GLU A 1 34 ? 13.213 25.347 20.646  1.00 25.15  ? 34  GLU A C    1 
ATOM   312  O O    . GLU A 1 34 ? 13.224 26.566 20.877  1.00 29.05  ? 34  GLU A O    1 
ATOM   313  C CB   . GLU A 1 34 ? 15.198 24.245 19.666  1.00 28.01  ? 34  GLU A CB   1 
ATOM   314  C CG   . GLU A 1 34 ? 16.026 25.356 20.305  1.00 41.98  ? 34  GLU A CG   1 
ATOM   315  C CD   . GLU A 1 34 ? 17.174 24.856 21.127  1.00 48.34  ? 34  GLU A CD   1 
ATOM   316  O OE1  . GLU A 1 34 ? 17.728 23.791 20.822  1.00 52.96  ? 34  GLU A OE1  1 
ATOM   317  O OE2  . GLU A 1 34 ? 17.476 25.553 22.092  1.00 53.00  ? 34  GLU A OE2  1 
ATOM   318  H H    . GLU A 1 34 ? 14.822 25.952 17.968  1.00 0.00   ? 34  GLU A H    1 
ATOM   319  N N    . GLU A 1 35 ? 12.654 24.473 21.476  1.00 25.38  ? 35  GLU A N    1 
ATOM   320  C CA   . GLU A 1 35 ? 12.082 24.882 22.734  1.00 27.61  ? 35  GLU A CA   1 
ATOM   321  C C    . GLU A 1 35 ? 12.989 25.737 23.630  1.00 26.90  ? 35  GLU A C    1 
ATOM   322  O O    . GLU A 1 35 ? 14.115 25.417 24.041  1.00 26.94  ? 35  GLU A O    1 
ATOM   323  C CB   . GLU A 1 35 ? 11.638 23.636 23.467  1.00 30.43  ? 35  GLU A CB   1 
ATOM   324  C CG   . GLU A 1 35 ? 10.332 23.059 23.034  1.00 35.38  ? 35  GLU A CG   1 
ATOM   325  C CD   . GLU A 1 35 ? 9.114  23.925 23.269  1.00 40.24  ? 35  GLU A CD   1 
ATOM   326  O OE1  . GLU A 1 35 ? 9.170  24.916 23.987  1.00 43.66  ? 35  GLU A OE1  1 
ATOM   327  O OE2  . GLU A 1 35 ? 8.064  23.594 22.722  1.00 49.70  ? 35  GLU A OE2  1 
ATOM   328  H H    . GLU A 1 35 ? 12.640 23.538 21.245  1.00 0.00   ? 35  GLU A H    1 
ATOM   329  N N    . MET A 1 36 ? 12.429 26.901 23.894  1.00 29.35  ? 36  MET A N    1 
ATOM   330  C CA   . MET A 1 36 ? 13.126 27.882 24.710  1.00 31.21  ? 36  MET A CA   1 
ATOM   331  C C    . MET A 1 36 ? 12.051 28.758 25.276  1.00 32.40  ? 36  MET A C    1 
ATOM   332  O O    . MET A 1 36 ? 10.880 28.783 24.880  1.00 29.99  ? 36  MET A O    1 
ATOM   333  C CB   . MET A 1 36 ? 14.075 28.758 23.899  1.00 29.12  ? 36  MET A CB   1 
ATOM   334  C CG   . MET A 1 36 ? 13.440 29.710 22.895  1.00 25.75  ? 36  MET A CG   1 
ATOM   335  S SD   . MET A 1 36 ? 14.864 30.494 22.166  1.00 34.27  ? 36  MET A SD   1 
ATOM   336  C CE   . MET A 1 36 ? 15.481 31.492 23.496  1.00 32.05  ? 36  MET A CE   1 
ATOM   337  H H    . MET A 1 36 ? 11.540 27.124 23.555  1.00 0.00   ? 36  MET A H    1 
ATOM   338  N N    . ASN A 1 37 ? 12.521 29.433 26.290  1.00 36.94  ? 37  ASN A N    1 
ATOM   339  C CA   . ASN A 1 37 ? 11.663 30.349 27.018  1.00 43.31  ? 37  ASN A CA   1 
ATOM   340  C C    . ASN A 1 37 ? 11.708 31.747 26.396  1.00 39.75  ? 37  ASN A C    1 
ATOM   341  O O    . ASN A 1 37 ? 12.799 32.281 26.161  1.00 41.72  ? 37  ASN A O    1 
ATOM   342  C CB   . ASN A 1 37 ? 12.138 30.360 28.482  1.00 52.65  ? 37  ASN A CB   1 
ATOM   343  C CG   . ASN A 1 37 ? 11.350 31.401 29.287  1.00 62.90  ? 37  ASN A CG   1 
ATOM   344  O OD1  . ASN A 1 37 ? 10.104 31.423 29.241  1.00 67.99  ? 37  ASN A OD1  1 
ATOM   345  N ND2  . ASN A 1 37 ? 12.053 32.342 29.965  1.00 66.25  ? 37  ASN A ND2  1 
ATOM   346  H H    . ASN A 1 37 ? 13.474 29.435 26.492  1.00 0.00   ? 37  ASN A H    1 
ATOM   347  H HD21 . ASN A 1 37 ? 11.538 32.892 30.588  1.00 0.00   ? 37  ASN A HD21 1 
ATOM   348  H HD22 . ASN A 1 37 ? 13.023 32.401 29.845  1.00 0.00   ? 37  ASN A HD22 1 
ATOM   349  N N    . LEU A 1 38 ? 10.571 32.325 26.090  1.00 37.51  ? 38  LEU A N    1 
ATOM   350  C CA   . LEU A 1 38 ? 10.554 33.631 25.506  1.00 37.11  ? 38  LEU A CA   1 
ATOM   351  C C    . LEU A 1 38 ? 9.446  34.264 26.261  1.00 39.93  ? 38  LEU A C    1 
ATOM   352  O O    . LEU A 1 38 ? 8.480  33.649 26.728  1.00 40.61  ? 38  LEU A O    1 
ATOM   353  C CB   . LEU A 1 38 ? 10.209 33.675 24.018  1.00 32.28  ? 38  LEU A CB   1 
ATOM   354  C CG   . LEU A 1 38 ? 11.371 33.349 23.092  1.00 33.70  ? 38  LEU A CG   1 
ATOM   355  C CD1  . LEU A 1 38 ? 10.907 33.435 21.649  1.00 29.56  ? 38  LEU A CD1  1 
ATOM   356  C CD2  . LEU A 1 38 ? 12.534 34.295 23.374  1.00 33.77  ? 38  LEU A CD2  1 
ATOM   357  H H    . LEU A 1 38 ? 9.704  31.949 26.375  1.00 0.00   ? 38  LEU A H    1 
ATOM   358  N N    . PRO A 1 39 ? 9.652  35.547 26.464  1.00 44.17  ? 39  PRO A N    1 
ATOM   359  C CA   . PRO A 1 39 ? 8.653  36.388 27.078  1.00 44.64  ? 39  PRO A CA   1 
ATOM   360  C C    . PRO A 1 39 ? 7.566  36.804 26.123  1.00 42.94  ? 39  PRO A C    1 
ATOM   361  O O    . PRO A 1 39 ? 7.862  37.102 24.983  1.00 44.56  ? 39  PRO A O    1 
ATOM   362  C CB   . PRO A 1 39 ? 9.491  37.526 27.619  1.00 46.74  ? 39  PRO A CB   1 
ATOM   363  C CG   . PRO A 1 39 ? 10.517 37.727 26.543  1.00 47.25  ? 39  PRO A CG   1 
ATOM   364  C CD   . PRO A 1 39 ? 10.913 36.273 26.297  1.00 48.27  ? 39  PRO A CD   1 
ATOM   365  N N    . GLY A 1 40 ? 6.336  36.871 26.564  1.00 44.68  ? 40  GLY A N    1 
ATOM   366  C CA   . GLY A 1 40 ? 5.299  37.461 25.763  1.00 44.99  ? 40  GLY A CA   1 
ATOM   367  C C    . GLY A 1 40 ? 4.091  36.581 25.840  1.00 45.40  ? 40  GLY A C    1 
ATOM   368  O O    . GLY A 1 40 ? 3.934  35.602 26.581  1.00 47.97  ? 40  GLY A O    1 
ATOM   369  H H    . GLY A 1 40 ? 6.074  36.391 27.374  1.00 0.00   ? 40  GLY A H    1 
ATOM   370  N N    . ARG A 1 41 ? 3.176  37.066 25.066  1.00 46.66  ? 41  ARG A N    1 
ATOM   371  C CA   . ARG A 1 41 ? 2.006  36.270 24.818  1.00 49.57  ? 41  ARG A CA   1 
ATOM   372  C C    . ARG A 1 41 ? 2.451  35.634 23.506  1.00 43.73  ? 41  ARG A C    1 
ATOM   373  O O    . ARG A 1 41 ? 3.331  36.092 22.756  1.00 43.20  ? 41  ARG A O    1 
ATOM   374  C CB   . ARG A 1 41 ? 0.758  37.142 24.630  1.00 61.74  ? 41  ARG A CB   1 
ATOM   375  C CG   . ARG A 1 41 ? 1.086  38.573 24.181  1.00 80.81  ? 41  ARG A CG   1 
ATOM   376  C CD   . ARG A 1 41 ? -0.089 39.466 23.741  1.00 97.74  ? 41  ARG A CD   1 
ATOM   377  N NE   . ARG A 1 41 ? -1.059 39.937 24.743  1.00 112.02 ? 41  ARG A NE   1 
ATOM   378  C CZ   . ARG A 1 41 ? -0.973 41.126 25.395  1.00 118.13 ? 41  ARG A CZ   1 
ATOM   379  N NH1  . ARG A 1 41 ? 0.033  42.009 25.210  1.00 119.87 ? 41  ARG A NH1  1 
ATOM   380  N NH2  . ARG A 1 41 ? -1.983 41.474 26.207  1.00 121.41 ? 41  ARG A NH2  1 
ATOM   381  H H    . ARG A 1 41 ? 3.408  37.816 24.473  1.00 0.00   ? 41  ARG A H    1 
ATOM   382  H HE   . ARG A 1 41 ? -1.825 39.358 24.931  1.00 0.00   ? 41  ARG A HE   1 
ATOM   383  H HH11 . ARG A 1 41 ? 0.781  41.803 24.578  1.00 0.00   ? 41  ARG A HH11 1 
ATOM   384  H HH12 . ARG A 1 41 ? 0.052  42.863 25.732  1.00 0.00   ? 41  ARG A HH12 1 
ATOM   385  H HH21 . ARG A 1 41 ? -2.762 40.858 26.310  1.00 0.00   ? 41  ARG A HH21 1 
ATOM   386  H HH22 . ARG A 1 41 ? -1.953 42.339 26.707  1.00 0.00   ? 41  ARG A HH22 1 
ATOM   387  N N    . TRP A 1 42 ? 1.914  34.482 23.309  1.00 38.15  ? 42  TRP A N    1 
ATOM   388  C CA   . TRP A 1 42 ? 2.156  33.810 22.076  1.00 36.03  ? 42  TRP A CA   1 
ATOM   389  C C    . TRP A 1 42 ? 0.839  33.215 21.696  1.00 34.06  ? 42  TRP A C    1 
ATOM   390  O O    . TRP A 1 42 ? -0.075 33.156 22.519  1.00 33.72  ? 42  TRP A O    1 
ATOM   391  C CB   . TRP A 1 42 ? 3.181  32.753 22.269  1.00 34.95  ? 42  TRP A CB   1 
ATOM   392  C CG   . TRP A 1 42 ? 2.837  31.926 23.452  1.00 39.76  ? 42  TRP A CG   1 
ATOM   393  C CD1  . TRP A 1 42 ? 3.322  32.237 24.692  1.00 44.42  ? 42  TRP A CD1  1 
ATOM   394  C CD2  . TRP A 1 42 ? 2.067  30.816 23.399  1.00 40.91  ? 42  TRP A CD2  1 
ATOM   395  N NE1  . TRP A 1 42 ? 2.859  31.293 25.447  1.00 46.36  ? 42  TRP A NE1  1 
ATOM   396  C CE2  . TRP A 1 42 ? 2.112  30.433 24.733  1.00 42.17  ? 42  TRP A CE2  1 
ATOM   397  C CE3  . TRP A 1 42 ? 1.353  30.091 22.440  1.00 40.32  ? 42  TRP A CE3  1 
ATOM   398  C CZ2  . TRP A 1 42 ? 1.440  29.282 25.127  1.00 41.68  ? 42  TRP A CZ2  1 
ATOM   399  C CZ3  . TRP A 1 42 ? 0.678  28.935 22.826  1.00 40.35  ? 42  TRP A CZ3  1 
ATOM   400  C CH2  . TRP A 1 42 ? 0.720  28.542 24.170  1.00 42.59  ? 42  TRP A CH2  1 
ATOM   401  H H    . TRP A 1 42 ? 1.344  34.042 23.971  1.00 0.00   ? 42  TRP A H    1 
ATOM   402  H HE1  . TRP A 1 42 ? 3.142  31.188 26.380  1.00 0.00   ? 42  TRP A HE1  1 
ATOM   403  N N    . LYS A 1 43 ? 0.813  32.742 20.459  1.00 32.65  ? 43  LYS A N    1 
ATOM   404  C CA   . LYS A 1 43 ? -0.347 32.174 19.755  1.00 31.69  ? 43  LYS A CA   1 
ATOM   405  C C    . LYS A 1 43 ? 0.050  30.782 19.269  1.00 28.18  ? 43  LYS A C    1 
ATOM   406  O O    . LYS A 1 43 ? 1.221  30.611 18.913  1.00 27.30  ? 43  LYS A O    1 
ATOM   407  C CB   . LYS A 1 43 ? -0.766 32.928 18.473  1.00 34.91  ? 43  LYS A CB   1 
ATOM   408  C CG   . LYS A 1 43 ? -1.507 34.268 18.524  1.00 48.53  ? 43  LYS A CG   1 
ATOM   409  C CD   . LYS A 1 43 ? -2.206 34.620 17.193  1.00 56.70  ? 43  LYS A CD   1 
ATOM   410  C CE   . LYS A 1 43 ? -1.319 35.158 16.062  1.00 65.33  ? 43  LYS A CE   1 
ATOM   411  N NZ   . LYS A 1 43 ? -1.268 36.601 16.101  1.00 69.74  ? 43  LYS A NZ   1 
ATOM   412  H H    . LYS A 1 43 ? 1.651  32.802 19.949  1.00 0.00   ? 43  LYS A H    1 
ATOM   413  H HZ1  . LYS A 1 43 ? -2.253 36.966 16.058  1.00 0.00   ? 43  LYS A HZ1  1 
ATOM   414  H HZ2  . LYS A 1 43 ? -0.820 36.886 17.005  1.00 0.00   ? 43  LYS A HZ2  1 
ATOM   415  H HZ3  . LYS A 1 43 ? -0.728 36.973 15.286  1.00 0.00   ? 43  LYS A HZ3  1 
ATOM   416  N N    . PRO A 1 44 ? -0.816 29.772 19.263  1.00 24.92  ? 44  PRO A N    1 
ATOM   417  C CA   . PRO A 1 44 ? -0.514 28.536 18.602  1.00 21.88  ? 44  PRO A CA   1 
ATOM   418  C C    . PRO A 1 44 ? -0.617 28.727 17.093  1.00 20.12  ? 44  PRO A C    1 
ATOM   419  O O    . PRO A 1 44 ? -1.437 29.518 16.589  1.00 22.15  ? 44  PRO A O    1 
ATOM   420  C CB   . PRO A 1 44 ? -1.515 27.604 19.226  1.00 23.62  ? 44  PRO A CB   1 
ATOM   421  C CG   . PRO A 1 44 ? -2.750 28.462 19.436  1.00 23.27  ? 44  PRO A CG   1 
ATOM   422  C CD   . PRO A 1 44 ? -2.079 29.697 20.004  1.00 24.20  ? 44  PRO A CD   1 
ATOM   423  N N    . LYS A 1 45 ? 0.251  27.948 16.433  1.00 17.90  ? 45  LYS A N    1 
ATOM   424  C CA   . LYS A 1 45 ? 0.379  27.918 15.024  1.00 18.81  ? 45  LYS A CA   1 
ATOM   425  C C    . LYS A 1 45 ? 0.798  26.506 14.677  1.00 18.44  ? 45  LYS A C    1 
ATOM   426  O O    . LYS A 1 45 ? 1.423  25.844 15.509  1.00 21.04  ? 45  LYS A O    1 
ATOM   427  C CB   . LYS A 1 45 ? 1.462  28.865 14.586  1.00 18.47  ? 45  LYS A CB   1 
ATOM   428  C CG   . LYS A 1 45 ? 1.356  29.031 13.082  1.00 23.24  ? 45  LYS A CG   1 
ATOM   429  C CD   . LYS A 1 45 ? 2.325  30.084 12.581  1.00 30.77  ? 45  LYS A CD   1 
ATOM   430  C CE   . LYS A 1 45 ? 2.121  30.325 11.076  1.00 40.48  ? 45  LYS A CE   1 
ATOM   431  N NZ   . LYS A 1 45 ? 1.446  31.590 10.734  1.00 46.08  ? 45  LYS A NZ   1 
ATOM   432  H H    . LYS A 1 45 ? 0.871  27.366 16.934  1.00 0.00   ? 45  LYS A H    1 
ATOM   433  H HZ1  . LYS A 1 45 ? 0.505  31.672 11.165  1.00 0.00   ? 45  LYS A HZ1  1 
ATOM   434  H HZ2  . LYS A 1 45 ? 2.048  32.373 11.054  1.00 0.00   ? 45  LYS A HZ2  1 
ATOM   435  H HZ3  . LYS A 1 45 ? 1.355  31.632 9.698   1.00 0.00   ? 45  LYS A HZ3  1 
ATOM   436  N N    . MET A 1 46 ? 0.494  26.094 13.430  1.00 20.30  ? 46  MET A N    1 
ATOM   437  C CA   . MET A 1 46 ? 0.882  24.844 12.810  1.00 18.57  ? 46  MET A CA   1 
ATOM   438  C C    . MET A 1 46 ? 1.673  25.238 11.561  1.00 15.49  ? 46  MET A C    1 
ATOM   439  O O    . MET A 1 46 ? 1.175  26.026 10.768  1.00 16.77  ? 46  MET A O    1 
ATOM   440  C CB   . MET A 1 46 ? -0.301 24.090 12.314  1.00 21.62  ? 46  MET A CB   1 
ATOM   441  C CG   . MET A 1 46 ? -1.265 23.719 13.387  1.00 26.37  ? 46  MET A CG   1 
ATOM   442  S SD   . MET A 1 46 ? -0.653 22.396 14.409  1.00 33.04  ? 46  MET A SD   1 
ATOM   443  C CE   . MET A 1 46 ? -1.538 21.198 13.489  1.00 36.24  ? 46  MET A CE   1 
ATOM   444  H H    . MET A 1 46 ? 0.077  26.721 12.805  1.00 0.00   ? 46  MET A H    1 
ATOM   445  N N    . ILE A 1 47 ? 2.886  24.696 11.363  1.00 15.27  ? 47  ILE A N    1 
ATOM   446  C CA   . ILE A 1 47 ? 3.747  24.929 10.216  1.00 15.15  ? 47  ILE A CA   1 
ATOM   447  C C    . ILE A 1 47 ? 4.032  23.555 9.669   1.00 16.13  ? 47  ILE A C    1 
ATOM   448  O O    . ILE A 1 47 ? 4.167  22.626 10.461  1.00 14.46  ? 47  ILE A O    1 
ATOM   449  C CB   . ILE A 1 47 ? 5.143  25.527 10.538  1.00 15.65  ? 47  ILE A CB   1 
ATOM   450  C CG1  . ILE A 1 47 ? 5.720  24.960 11.754  1.00 13.75  ? 47  ILE A CG1  1 
ATOM   451  C CG2  . ILE A 1 47 ? 4.992  26.958 10.768  1.00 16.58  ? 47  ILE A CG2  1 
ATOM   452  C CD1  . ILE A 1 47 ? 7.105  25.484 11.947  1.00 21.69  ? 47  ILE A CD1  1 
ATOM   453  H H    . ILE A 1 47 ? 3.205  24.033 12.026  1.00 0.00   ? 47  ILE A H    1 
ATOM   454  N N    . GLY A 1 48 ? 4.216  23.404 8.373   1.00 16.81  ? 48  GLY A N    1 
ATOM   455  C CA   . GLY A 1 48 ? 4.527  22.121 7.818   1.00 14.85  ? 48  GLY A CA   1 
ATOM   456  C C    . GLY A 1 48 ? 5.629  22.281 6.835   1.00 16.00  ? 48  GLY A C    1 
ATOM   457  O O    . GLY A 1 48 ? 6.052  23.376 6.510   1.00 18.15  ? 48  GLY A O    1 
ATOM   458  H H    . GLY A 1 48 ? 4.259  24.189 7.783   1.00 0.00   ? 48  GLY A H    1 
ATOM   459  N N    . GLY A 1 49 ? 6.102  21.117 6.411   1.00 17.04  ? 49  GLY A N    1 
ATOM   460  C CA   . GLY A 1 49 ? 7.143  21.049 5.399   1.00 17.33  ? 49  GLY A CA   1 
ATOM   461  C C    . GLY A 1 49 ? 7.297  19.595 5.057   1.00 15.13  ? 49  GLY A C    1 
ATOM   462  O O    . GLY A 1 49 ? 6.305  18.882 5.092   1.00 16.20  ? 49  GLY A O    1 
ATOM   463  H H    . GLY A 1 49 ? 5.784  20.268 6.787   1.00 0.00   ? 49  GLY A H    1 
ATOM   464  N N    . ILE A 1 50 ? 8.507  19.135 4.784   1.00 16.29  ? 50  ILE A N    1 
ATOM   465  C CA   . ILE A 1 50 ? 8.764  17.731 4.562   1.00 17.54  ? 50  ILE A CA   1 
ATOM   466  C C    . ILE A 1 50 ? 8.553  16.992 5.874   1.00 17.86  ? 50  ILE A C    1 
ATOM   467  O O    . ILE A 1 50 ? 8.986  17.358 6.980   1.00 17.78  ? 50  ILE A O    1 
ATOM   468  C CB   . ILE A 1 50 ? 10.176 17.520 4.041   1.00 16.58  ? 50  ILE A CB   1 
ATOM   469  C CG1  . ILE A 1 50 ? 10.037 17.850 2.554   1.00 16.15  ? 50  ILE A CG1  1 
ATOM   470  C CG2  . ILE A 1 50 ? 10.751 16.091 4.261   1.00 18.97  ? 50  ILE A CG2  1 
ATOM   471  C CD1  . ILE A 1 50 ? 11.318 17.885 1.815   1.00 14.64  ? 50  ILE A CD1  1 
ATOM   472  H H    . ILE A 1 50 ? 9.247  19.790 4.734   1.00 0.00   ? 50  ILE A H    1 
ATOM   473  N N    . GLY A 1 51 ? 7.749  15.951 5.738   1.00 20.70  ? 51  GLY A N    1 
ATOM   474  C CA   . GLY A 1 51 ? 7.520  15.097 6.906   1.00 18.49  ? 51  GLY A CA   1 
ATOM   475  C C    . GLY A 1 51 ? 6.208  15.478 7.563   1.00 21.36  ? 51  GLY A C    1 
ATOM   476  O O    . GLY A 1 51 ? 5.742  14.703 8.406   1.00 25.99  ? 51  GLY A O    1 
ATOM   477  H H    . GLY A 1 51 ? 7.392  15.686 4.852   1.00 0.00   ? 51  GLY A H    1 
ATOM   478  N N    . GLY A 1 52 ? 5.524  16.559 7.203   1.00 21.00  ? 52  GLY A N    1 
ATOM   479  C CA   . GLY A 1 52 ? 4.285  16.903 7.886   1.00 19.90  ? 52  GLY A CA   1 
ATOM   480  C C    . GLY A 1 52 ? 4.392  18.177 8.716   1.00 21.04  ? 52  GLY A C    1 
ATOM   481  O O    . GLY A 1 52 ? 5.376  18.919 8.619   1.00 20.44  ? 52  GLY A O    1 
ATOM   482  H H    . GLY A 1 52 ? 5.859  17.132 6.487   1.00 0.00   ? 52  GLY A H    1 
ATOM   483  N N    . PHE A 1 53 ? 3.351  18.388 9.506   1.00 20.08  ? 53  PHE A N    1 
ATOM   484  C CA   . PHE A 1 53 ? 3.151  19.633 10.256  1.00 22.20  ? 53  PHE A CA   1 
ATOM   485  C C    . PHE A 1 53 ? 3.501  19.496 11.724  1.00 21.69  ? 53  PHE A C    1 
ATOM   486  O O    . PHE A 1 53 ? 3.424  18.355 12.226  1.00 25.16  ? 53  PHE A O    1 
ATOM   487  C CB   . PHE A 1 53 ? 1.663  20.106 10.106  1.00 19.04  ? 53  PHE A CB   1 
ATOM   488  C CG   . PHE A 1 53 ? 1.415  20.726 8.763   1.00 18.58  ? 53  PHE A CG   1 
ATOM   489  C CD1  . PHE A 1 53 ? 1.543  19.956 7.609   1.00 18.34  ? 53  PHE A CD1  1 
ATOM   490  C CD2  . PHE A 1 53 ? 1.111  22.085 8.708   1.00 21.10  ? 53  PHE A CD2  1 
ATOM   491  C CE1  . PHE A 1 53 ? 1.363  20.548 6.373   1.00 16.54  ? 53  PHE A CE1  1 
ATOM   492  C CE2  . PHE A 1 53 ? 0.932  22.673 7.456   1.00 21.23  ? 53  PHE A CE2  1 
ATOM   493  C CZ   . PHE A 1 53 ? 1.051  21.907 6.283   1.00 24.08  ? 53  PHE A CZ   1 
ATOM   494  H H    . PHE A 1 53 ? 2.761  17.629 9.719   1.00 0.00   ? 53  PHE A H    1 
ATOM   495  N N    . ILE A 1 54 ? 3.939  20.570 12.395  1.00 17.97  ? 54  ILE A N    1 
ATOM   496  C CA   . ILE A 1 54 ? 4.239  20.571 13.817  1.00 17.76  ? 54  ILE A CA   1 
ATOM   497  C C    . ILE A 1 54 ? 3.582  21.778 14.455  1.00 19.15  ? 54  ILE A C    1 
ATOM   498  O O    . ILE A 1 54 ? 3.366  22.755 13.755  1.00 20.82  ? 54  ILE A O    1 
ATOM   499  C CB   . ILE A 1 54 ? 5.793  20.615 14.172  1.00 15.89  ? 54  ILE A CB   1 
ATOM   500  C CG1  . ILE A 1 54 ? 6.532  21.792 13.568  1.00 13.51  ? 54  ILE A CG1  1 
ATOM   501  C CG2  . ILE A 1 54 ? 6.389  19.264 13.743  1.00 14.90  ? 54  ILE A CG2  1 
ATOM   502  C CD1  . ILE A 1 54 ? 7.933  21.976 14.225  1.00 11.43  ? 54  ILE A CD1  1 
ATOM   503  H H    . ILE A 1 54 ? 4.051  21.420 11.929  1.00 0.00   ? 54  ILE A H    1 
ATOM   504  N N    . LYS A 1 55 ? 3.249  21.781 15.750  1.00 18.55  ? 55  LYS A N    1 
ATOM   505  C CA   . LYS A 1 55 ? 2.619  22.911 16.404  1.00 19.64  ? 55  LYS A CA   1 
ATOM   506  C C    . LYS A 1 55 ? 3.732  23.634 17.152  1.00 19.64  ? 55  LYS A C    1 
ATOM   507  O O    . LYS A 1 55 ? 4.651  23.082 17.776  1.00 18.07  ? 55  LYS A O    1 
ATOM   508  C CB   . LYS A 1 55 ? 1.581  22.455 17.390  1.00 24.29  ? 55  LYS A CB   1 
ATOM   509  C CG   . LYS A 1 55 ? 0.538  23.507 17.772  1.00 30.71  ? 55  LYS A CG   1 
ATOM   510  C CD   . LYS A 1 55 ? -0.060 22.904 19.024  1.00 37.99  ? 55  LYS A CD   1 
ATOM   511  C CE   . LYS A 1 55 ? -1.261 23.650 19.616  1.00 42.16  ? 55  LYS A CE   1 
ATOM   512  N NZ   . LYS A 1 55 ? -2.561 23.333 19.025  1.00 46.54  ? 55  LYS A NZ   1 
ATOM   513  H H    . LYS A 1 55 ? 3.488  21.024 16.291  1.00 0.00   ? 55  LYS A H    1 
ATOM   514  H HZ1  . LYS A 1 55 ? -2.802 22.331 19.148  1.00 0.00   ? 55  LYS A HZ1  1 
ATOM   515  H HZ2  . LYS A 1 55 ? -3.267 23.922 19.515  1.00 0.00   ? 55  LYS A HZ2  1 
ATOM   516  H HZ3  . LYS A 1 55 ? -2.554 23.596 18.017  1.00 0.00   ? 55  LYS A HZ3  1 
ATOM   517  N N    . VAL A 1 56 ? 3.660  24.934 16.938  1.00 18.78  ? 56  VAL A N    1 
ATOM   518  C CA   . VAL A 1 56 ? 4.639  25.834 17.481  1.00 17.08  ? 56  VAL A CA   1 
ATOM   519  C C    . VAL A 1 56 ? 3.923  26.934 18.229  1.00 16.06  ? 56  VAL A C    1 
ATOM   520  O O    . VAL A 1 56 ? 2.698  27.115 18.151  1.00 17.65  ? 56  VAL A O    1 
ATOM   521  C CB   . VAL A 1 56 ? 5.483  26.392 16.346  1.00 17.35  ? 56  VAL A CB   1 
ATOM   522  C CG1  . VAL A 1 56 ? 6.308  25.257 15.808  1.00 14.84  ? 56  VAL A CG1  1 
ATOM   523  C CG2  . VAL A 1 56 ? 4.651  26.969 15.230  1.00 16.82  ? 56  VAL A CG2  1 
ATOM   524  H H    . VAL A 1 56 ? 2.889  25.312 16.482  1.00 0.00   ? 56  VAL A H    1 
ATOM   525  N N    . ARG A 1 57 ? 4.709  27.625 19.037  1.00 16.74  ? 57  ARG A N    1 
ATOM   526  C CA   . ARG A 1 57 ? 4.180  28.810 19.708  1.00 17.87  ? 57  ARG A CA   1 
ATOM   527  C C    . ARG A 1 57 ? 4.714  30.004 18.955  1.00 18.06  ? 57  ARG A C    1 
ATOM   528  O O    . ARG A 1 57 ? 5.919  30.090 18.699  1.00 20.15  ? 57  ARG A O    1 
ATOM   529  C CB   . ARG A 1 57 ? 4.650  28.871 21.149  1.00 15.27  ? 57  ARG A CB   1 
ATOM   530  C CG   . ARG A 1 57 ? 4.132  27.604 21.867  1.00 18.95  ? 57  ARG A CG   1 
ATOM   531  C CD   . ARG A 1 57 ? 4.343  27.667 23.376  1.00 22.35  ? 57  ARG A CD   1 
ATOM   532  N NE   . ARG A 1 57 ? 5.668  28.172 23.737  1.00 31.19  ? 57  ARG A NE   1 
ATOM   533  C CZ   . ARG A 1 57 ? 6.764  27.391 23.786  1.00 37.62  ? 57  ARG A CZ   1 
ATOM   534  N NH1  . ARG A 1 57 ? 6.651  26.094 23.492  1.00 40.48  ? 57  ARG A NH1  1 
ATOM   535  N NH2  . ARG A 1 57 ? 7.956  27.930 24.101  1.00 37.71  ? 57  ARG A NH2  1 
ATOM   536  H H    . ARG A 1 57 ? 5.640  27.354 19.171  1.00 0.00   ? 57  ARG A H    1 
ATOM   537  H HE   . ARG A 1 57 ? 5.769  29.130 23.917  1.00 0.00   ? 57  ARG A HE   1 
ATOM   538  H HH11 . ARG A 1 57 ? 5.761  25.706 23.259  1.00 0.00   ? 57  ARG A HH11 1 
ATOM   539  H HH12 . ARG A 1 57 ? 7.450  25.511 23.524  1.00 0.00   ? 57  ARG A HH12 1 
ATOM   540  H HH21 . ARG A 1 57 ? 8.021  28.914 24.265  1.00 0.00   ? 57  ARG A HH21 1 
ATOM   541  H HH22 . ARG A 1 57 ? 8.779  27.360 24.109  1.00 0.00   ? 57  ARG A HH22 1 
ATOM   542  N N    . GLN A 1 58 ? 3.833  30.872 18.517  1.00 17.05  ? 58  GLN A N    1 
ATOM   543  C CA   . GLN A 1 58 ? 4.202  32.068 17.775  1.00 17.09  ? 58  GLN A CA   1 
ATOM   544  C C    . GLN A 1 58 ? 4.452  33.237 18.685  1.00 14.92  ? 58  GLN A C    1 
ATOM   545  O O    . GLN A 1 58 ? 3.497  33.618 19.363  1.00 17.89  ? 58  GLN A O    1 
ATOM   546  C CB   . GLN A 1 58 ? 3.100  32.440 16.862  1.00 18.04  ? 58  GLN A CB   1 
ATOM   547  C CG   . GLN A 1 58 ? 3.412  33.622 16.043  1.00 17.63  ? 58  GLN A CG   1 
ATOM   548  C CD   . GLN A 1 58 ? 2.238  33.951 15.168  1.00 22.74  ? 58  GLN A CD   1 
ATOM   549  O OE1  . GLN A 1 58 ? 1.291  33.217 14.908  1.00 28.29  ? 58  GLN A OE1  1 
ATOM   550  N NE2  . GLN A 1 58 ? 2.213  35.156 14.673  1.00 24.42  ? 58  GLN A NE2  1 
ATOM   551  H H    . GLN A 1 58 ? 2.912  30.669 18.637  1.00 0.00   ? 58  GLN A H    1 
ATOM   552  H HE21 . GLN A 1 58 ? 1.467  35.363 14.074  1.00 0.00   ? 58  GLN A HE21 1 
ATOM   553  H HE22 . GLN A 1 58 ? 2.931  35.775 14.887  1.00 0.00   ? 58  GLN A HE22 1 
ATOM   554  N N    . TYR A 1 59 ? 5.628  33.823 18.737  1.00 15.88  ? 59  TYR A N    1 
ATOM   555  C CA   . TYR A 1 59 ? 5.815  35.006 19.514  1.00 19.23  ? 59  TYR A CA   1 
ATOM   556  C C    . TYR A 1 59 ? 6.113  36.125 18.569  1.00 20.70  ? 59  TYR A C    1 
ATOM   557  O O    . TYR A 1 59 ? 7.044  36.044 17.768  1.00 21.19  ? 59  TYR A O    1 
ATOM   558  C CB   . TYR A 1 59 ? 6.967  34.851 20.435  1.00 18.22  ? 59  TYR A CB   1 
ATOM   559  C CG   . TYR A 1 59 ? 6.816  33.890 21.605  1.00 23.25  ? 59  TYR A CG   1 
ATOM   560  C CD1  . TYR A 1 59 ? 7.146  32.531 21.491  1.00 23.15  ? 59  TYR A CD1  1 
ATOM   561  C CD2  . TYR A 1 59 ? 6.434  34.422 22.837  1.00 24.26  ? 59  TYR A CD2  1 
ATOM   562  C CE1  . TYR A 1 59 ? 7.107  31.705 22.631  1.00 29.39  ? 59  TYR A CE1  1 
ATOM   563  C CE2  . TYR A 1 59 ? 6.379  33.608 23.971  1.00 29.95  ? 59  TYR A CE2  1 
ATOM   564  C CZ   . TYR A 1 59 ? 6.731  32.266 23.858  1.00 28.75  ? 59  TYR A CZ   1 
ATOM   565  O OH   . TYR A 1 59 ? 6.702  31.511 24.994  1.00 31.16  ? 59  TYR A OH   1 
ATOM   566  H H    . TYR A 1 59 ? 6.381  33.471 18.217  1.00 0.00   ? 59  TYR A H    1 
ATOM   567  H HH   . TYR A 1 59 ? 6.887  30.593 24.790  1.00 0.00   ? 59  TYR A HH   1 
ATOM   568  N N    . ASP A 1 60 ? 5.418  37.246 18.656  1.00 24.49  ? 60  ASP A N    1 
ATOM   569  C CA   . ASP A 1 60 ? 5.716  38.344 17.759  1.00 25.50  ? 60  ASP A CA   1 
ATOM   570  C C    . ASP A 1 60 ? 6.701  39.390 18.337  1.00 26.40  ? 60  ASP A C    1 
ATOM   571  O O    . ASP A 1 60 ? 6.977  39.428 19.544  1.00 28.39  ? 60  ASP A O    1 
ATOM   572  C CB   . ASP A 1 60 ? 4.410  39.011 17.376  1.00 28.35  ? 60  ASP A CB   1 
ATOM   573  C CG   . ASP A 1 60 ? 3.357  38.087 16.775  1.00 29.73  ? 60  ASP A CG   1 
ATOM   574  O OD1  . ASP A 1 60 ? 3.641  37.401 15.811  1.00 28.13  ? 60  ASP A OD1  1 
ATOM   575  O OD2  . ASP A 1 60 ? 2.235  38.067 17.261  1.00 35.72  ? 60  ASP A OD2  1 
ATOM   576  H H    . ASP A 1 60 ? 4.777  37.357 19.400  1.00 0.00   ? 60  ASP A H    1 
ATOM   577  N N    . GLN A 1 61 ? 7.293  40.209 17.467  1.00 26.35  ? 61  GLN A N    1 
ATOM   578  C CA   . GLN A 1 61 ? 8.303  41.248 17.757  1.00 28.20  ? 61  GLN A CA   1 
ATOM   579  C C    . GLN A 1 61 ? 9.513  40.855 18.623  1.00 26.11  ? 61  GLN A C    1 
ATOM   580  O O    . GLN A 1 61 ? 9.880  41.518 19.600  1.00 28.86  ? 61  GLN A O    1 
ATOM   581  C CB   . GLN A 1 61 ? 7.594  42.479 18.377  1.00 37.87  ? 61  GLN A CB   1 
ATOM   582  C CG   . GLN A 1 61 ? 6.694  43.339 17.437  1.00 46.64  ? 61  GLN A CG   1 
ATOM   583  C CD   . GLN A 1 61 ? 5.694  44.216 18.212  1.00 53.80  ? 61  GLN A CD   1 
ATOM   584  O OE1  . GLN A 1 61 ? 4.473  44.185 17.991  1.00 57.26  ? 61  GLN A OE1  1 
ATOM   585  N NE2  . GLN A 1 61 ? 6.174  44.996 19.197  1.00 57.08  ? 61  GLN A NE2  1 
ATOM   586  H H    . GLN A 1 61 ? 7.042  40.110 16.533  1.00 0.00   ? 61  GLN A H    1 
ATOM   587  H HE21 . GLN A 1 61 ? 5.555  45.579 19.681  1.00 0.00   ? 61  GLN A HE21 1 
ATOM   588  H HE22 . GLN A 1 61 ? 7.130  44.946 19.400  1.00 0.00   ? 61  GLN A HE22 1 
ATOM   589  N N    . ILE A 1 62 ? 10.217 39.780 18.270  1.00 23.07  ? 62  ILE A N    1 
ATOM   590  C CA   . ILE A 1 62 ? 11.306 39.314 19.065  1.00 20.70  ? 62  ILE A CA   1 
ATOM   591  C C    . ILE A 1 62 ? 12.463 39.898 18.342  1.00 20.84  ? 62  ILE A C    1 
ATOM   592  O O    . ILE A 1 62 ? 12.529 39.901 17.117  1.00 24.07  ? 62  ILE A O    1 
ATOM   593  C CB   . ILE A 1 62 ? 11.298 37.792 19.037  1.00 21.77  ? 62  ILE A CB   1 
ATOM   594  C CG1  . ILE A 1 62 ? 10.052 37.299 19.693  1.00 18.59  ? 62  ILE A CG1  1 
ATOM   595  C CG2  . ILE A 1 62 ? 12.520 37.240 19.712  1.00 21.56  ? 62  ILE A CG2  1 
ATOM   596  C CD1  . ILE A 1 62 ? 9.940  37.558 21.177  1.00 21.49  ? 62  ILE A CD1  1 
ATOM   597  H H    . ILE A 1 62 ? 10.069 39.343 17.402  1.00 0.00   ? 62  ILE A H    1 
ATOM   598  N N    . LEU A 1 63 ? 13.417 40.319 19.149  1.00 23.08  ? 63  LEU A N    1 
ATOM   599  C CA   . LEU A 1 63 ? 14.629 40.912 18.682  1.00 22.39  ? 63  LEU A CA   1 
ATOM   600  C C    . LEU A 1 63 ? 15.634 39.798 18.630  1.00 22.31  ? 63  LEU A C    1 
ATOM   601  O O    . LEU A 1 63 ? 15.863 39.116 19.631  1.00 25.21  ? 63  LEU A O    1 
ATOM   602  C CB   . LEU A 1 63 ? 15.134 41.992 19.632  1.00 26.00  ? 63  LEU A CB   1 
ATOM   603  C CG   . LEU A 1 63 ? 16.517 42.478 19.213  1.00 32.84  ? 63  LEU A CG   1 
ATOM   604  C CD1  . LEU A 1 63 ? 16.369 43.867 18.727  1.00 34.89  ? 63  LEU A CD1  1 
ATOM   605  C CD2  . LEU A 1 63 ? 17.522 42.420 20.347  1.00 29.97  ? 63  LEU A CD2  1 
ATOM   606  H H    . LEU A 1 63 ? 13.384 40.116 20.097  1.00 0.00   ? 63  LEU A H    1 
ATOM   607  N N    . ILE A 1 64 ? 16.250 39.625 17.496  1.00 21.82  ? 64  ILE A N    1 
ATOM   608  C CA   . ILE A 1 64 ? 17.261 38.636 17.443  1.00 26.71  ? 64  ILE A CA   1 
ATOM   609  C C    . ILE A 1 64 ? 18.510 39.316 16.953  1.00 23.96  ? 64  ILE A C    1 
ATOM   610  O O    . ILE A 1 64 ? 18.432 40.200 16.125  1.00 27.93  ? 64  ILE A O    1 
ATOM   611  C CB   . ILE A 1 64 ? 16.903 37.465 16.470  1.00 28.34  ? 64  ILE A CB   1 
ATOM   612  C CG1  . ILE A 1 64 ? 15.751 36.653 16.985  1.00 35.13  ? 64  ILE A CG1  1 
ATOM   613  C CG2  . ILE A 1 64 ? 18.054 36.492 16.392  1.00 27.51  ? 64  ILE A CG2  1 
ATOM   614  C CD1  . ILE A 1 64 ? 15.655 35.293 16.197  1.00 37.81  ? 64  ILE A CD1  1 
ATOM   615  H H    . ILE A 1 64 ? 16.119 40.202 16.719  1.00 0.00   ? 64  ILE A H    1 
ATOM   616  N N    . GLU A 1 65 ? 19.668 38.866 17.336  1.00 22.87  ? 65  GLU A N    1 
ATOM   617  C CA   . GLU A 1 65 ? 20.824 39.445 16.815  1.00 26.42  ? 65  GLU A CA   1 
ATOM   618  C C    . GLU A 1 65 ? 21.367 38.404 15.901  1.00 26.70  ? 65  GLU A C    1 
ATOM   619  O O    . GLU A 1 65 ? 21.559 37.328 16.445  1.00 25.52  ? 65  GLU A O    1 
ATOM   620  C CB   . GLU A 1 65 ? 21.637 39.716 18.013  1.00 33.47  ? 65  GLU A CB   1 
ATOM   621  C CG   . GLU A 1 65 ? 22.807 40.551 17.639  1.00 44.85  ? 65  GLU A CG   1 
ATOM   622  C CD   . GLU A 1 65 ? 23.525 41.125 18.856  1.00 53.60  ? 65  GLU A CD   1 
ATOM   623  O OE1  . GLU A 1 65 ? 22.914 41.952 19.574  1.00 54.93  ? 65  GLU A OE1  1 
ATOM   624  O OE2  . GLU A 1 65 ? 24.689 40.716 19.060  1.00 57.10  ? 65  GLU A OE2  1 
ATOM   625  H H    . GLU A 1 65 ? 19.747 38.098 17.929  1.00 0.00   ? 65  GLU A H    1 
ATOM   626  N N    . ILE A 1 66 ? 21.636 38.548 14.611  1.00 26.61  ? 66  ILE A N    1 
ATOM   627  C CA   . ILE A 1 66 ? 22.141 37.458 13.787  1.00 32.09  ? 66  ILE A CA   1 
ATOM   628  C C    . ILE A 1 66 ? 23.549 37.870 13.395  1.00 32.92  ? 66  ILE A C    1 
ATOM   629  O O    . ILE A 1 66 ? 23.667 38.769 12.573  1.00 32.94  ? 66  ILE A O    1 
ATOM   630  C CB   . ILE A 1 66 ? 21.190 37.268 12.525  1.00 32.24  ? 66  ILE A CB   1 
ATOM   631  C CG1  . ILE A 1 66 ? 19.774 36.981 12.943  1.00 30.40  ? 66  ILE A CG1  1 
ATOM   632  C CG2  . ILE A 1 66 ? 21.690 36.127 11.666  1.00 29.04  ? 66  ILE A CG2  1 
ATOM   633  C CD1  . ILE A 1 66 ? 18.739 37.497 11.964  1.00 35.76  ? 66  ILE A CD1  1 
ATOM   634  H H    . ILE A 1 66 ? 21.347 39.340 14.142  1.00 0.00   ? 66  ILE A H    1 
ATOM   635  N N    . CYS A 1 67 ? 24.655 37.346 13.936  1.00 35.80  ? 67  CYS A N    1 
ATOM   636  C CA   . CYS A 1 67 ? 25.990 37.802 13.583  1.00 41.22  ? 67  CYS A CA   1 
ATOM   637  C C    . CYS A 1 67 ? 26.208 39.288 13.743  1.00 41.84  ? 67  CYS A C    1 
ATOM   638  O O    . CYS A 1 67 ? 26.664 39.991 12.821  1.00 43.83  ? 67  CYS A O    1 
ATOM   639  C CB   . CYS A 1 67 ? 26.326 37.487 12.143  1.00 44.60  ? 67  CYS A CB   1 
ATOM   640  S SG   . CYS A 1 67 ? 26.737 35.769 12.007  1.00 50.05  ? 67  CYS A SG   1 
ATOM   641  H H    . CYS A 1 67 ? 24.541 36.561 14.516  1.00 0.00   ? 67  CYS A H    1 
ATOM   642  N N    . GLY A 1 68 ? 25.772 39.820 14.885  1.00 42.18  ? 68  GLY A N    1 
ATOM   643  C CA   . GLY A 1 68 ? 25.903 41.263 15.119  1.00 40.96  ? 68  GLY A CA   1 
ATOM   644  C C    . GLY A 1 68 ? 24.800 42.120 14.477  1.00 43.04  ? 68  GLY A C    1 
ATOM   645  O O    . GLY A 1 68 ? 24.623 43.299 14.805  1.00 44.66  ? 68  GLY A O    1 
ATOM   646  H H    . GLY A 1 68 ? 25.319 39.259 15.548  1.00 0.00   ? 68  GLY A H    1 
ATOM   647  N N    . HIS A 1 69 ? 23.984 41.584 13.560  1.00 41.71  ? 69  HIS A N    1 
ATOM   648  C CA   . HIS A 1 69 ? 22.988 42.412 12.923  1.00 41.25  ? 69  HIS A CA   1 
ATOM   649  C C    . HIS A 1 69 ? 21.702 42.208 13.712  1.00 39.86  ? 69  HIS A C    1 
ATOM   650  O O    . HIS A 1 69 ? 21.323 41.091 14.058  1.00 36.57  ? 69  HIS A O    1 
ATOM   651  C CB   . HIS A 1 69 ? 22.832 42.002 11.463  1.00 42.84  ? 69  HIS A CB   1 
ATOM   652  C CG   . HIS A 1 69 ? 24.104 42.100 10.629  1.00 46.63  ? 69  HIS A CG   1 
ATOM   653  N ND1  . HIS A 1 69 ? 25.372 41.695 10.861  1.00 50.08  ? 69  HIS A ND1  1 
ATOM   654  C CD2  . HIS A 1 69 ? 24.105 42.677 9.383   1.00 47.49  ? 69  HIS A CD2  1 
ATOM   655  C CE1  . HIS A 1 69 ? 26.106 42.018 9.806   1.00 50.51  ? 69  HIS A CE1  1 
ATOM   656  N NE2  . HIS A 1 69 ? 25.315 42.595 8.925   1.00 51.13  ? 69  HIS A NE2  1 
ATOM   657  H H    . HIS A 1 69 ? 23.942 40.621 13.369  1.00 0.00   ? 69  HIS A H    1 
ATOM   658  H HD1  . HIS A 1 69 ? 25.655 41.076 11.567  1.00 0.00   ? 69  HIS A HD1  1 
ATOM   659  H HE2  . HIS A 1 69 ? 25.527 42.820 7.988   1.00 0.00   ? 69  HIS A HE2  1 
ATOM   660  N N    . LYS A 1 70 ? 21.067 43.318 14.062  1.00 38.94  ? 70  LYS A N    1 
ATOM   661  C CA   . LYS A 1 70 ? 19.876 43.277 14.849  1.00 39.15  ? 70  LYS A CA   1 
ATOM   662  C C    . LYS A 1 70 ? 18.753 43.139 13.845  1.00 37.37  ? 70  LYS A C    1 
ATOM   663  O O    . LYS A 1 70 ? 18.817 43.798 12.778  1.00 37.24  ? 70  LYS A O    1 
ATOM   664  C CB   . LYS A 1 70 ? 19.799 44.555 15.658  1.00 41.15  ? 70  LYS A CB   1 
ATOM   665  C CG   . LYS A 1 70 ? 20.633 44.337 16.895  1.00 45.25  ? 70  LYS A CG   1 
ATOM   666  C CD   . LYS A 1 70 ? 20.057 45.149 18.047  1.00 54.43  ? 70  LYS A CD   1 
ATOM   667  C CE   . LYS A 1 70 ? 20.649 46.580 18.250  1.00 60.96  ? 70  LYS A CE   1 
ATOM   668  N NZ   . LYS A 1 70 ? 19.882 47.354 19.244  1.00 64.53  ? 70  LYS A NZ   1 
ATOM   669  H H    . LYS A 1 70 ? 21.354 44.188 13.725  1.00 0.00   ? 70  LYS A H    1 
ATOM   670  H HZ1  . LYS A 1 70 ? 19.639 46.727 20.046  1.00 0.00   ? 70  LYS A HZ1  1 
ATOM   671  H HZ2  . LYS A 1 70 ? 20.427 48.156 19.628  1.00 0.00   ? 70  LYS A HZ2  1 
ATOM   672  H HZ3  . LYS A 1 70 ? 18.986 47.681 18.824  1.00 0.00   ? 70  LYS A HZ3  1 
ATOM   673  N N    . ALA A 1 71 ? 17.797 42.234 14.221  1.00 34.42  ? 71  ALA A N    1 
ATOM   674  C CA   . ALA A 1 71 ? 16.571 41.877 13.466  1.00 30.04  ? 71  ALA A CA   1 
ATOM   675  C C    . ALA A 1 71 ? 15.323 41.847 14.351  1.00 26.75  ? 71  ALA A C    1 
ATOM   676  O O    . ALA A 1 71 ? 15.454 41.405 15.484  1.00 30.10  ? 71  ALA A O    1 
ATOM   677  C CB   . ALA A 1 71 ? 16.736 40.471 12.812  1.00 32.79  ? 71  ALA A CB   1 
ATOM   678  H H    . ALA A 1 71 ? 17.884 41.786 15.091  1.00 0.00   ? 71  ALA A H    1 
ATOM   679  N N    . ILE A 1 72 ? 14.122 42.303 14.003  1.00 25.18  ? 72  ILE A N    1 
ATOM   680  C CA   . ILE A 1 72 ? 12.935 42.166 14.824  1.00 25.98  ? 72  ILE A CA   1 
ATOM   681  C C    . ILE A 1 72 ? 11.973 41.344 13.938  1.00 22.53  ? 72  ILE A C    1 
ATOM   682  O O    . ILE A 1 72 ? 11.919 41.567 12.729  1.00 22.76  ? 72  ILE A O    1 
ATOM   683  C CB   . ILE A 1 72 ? 12.193 43.567 15.238  1.00 27.08  ? 72  ILE A CB   1 
ATOM   684  C CG1  . ILE A 1 72 ? 12.402 43.885 16.682  1.00 29.89  ? 72  ILE A CG1  1 
ATOM   685  C CG2  . ILE A 1 72 ? 10.696 43.461 15.510  1.00 29.04  ? 72  ILE A CG2  1 
ATOM   686  C CD1  . ILE A 1 72 ? 13.683 44.654 16.957  1.00 32.58  ? 72  ILE A CD1  1 
ATOM   687  H H    . ILE A 1 72 ? 13.986 42.631 13.099  1.00 0.00   ? 72  ILE A H    1 
ATOM   688  N N    . GLY A 1 73 ? 11.224 40.364 14.466  1.00 23.21  ? 73  GLY A N    1 
ATOM   689  C CA   . GLY A 1 73 ? 10.203 39.684 13.681  1.00 21.48  ? 73  GLY A CA   1 
ATOM   690  C C    . GLY A 1 73 ? 9.640  38.585 14.513  1.00 18.76  ? 73  GLY A C    1 
ATOM   691  O O    . GLY A 1 73 ? 9.980  38.477 15.696  1.00 19.24  ? 73  GLY A O    1 
ATOM   692  H H    . GLY A 1 73 ? 11.442 40.006 15.360  1.00 0.00   ? 73  GLY A H    1 
ATOM   693  N N    . THR A 1 74 ? 8.688  37.897 13.903  1.00 19.69  ? 74  THR A N    1 
ATOM   694  C CA   . THR A 1 74 ? 8.069  36.719 14.503  1.00 20.19  ? 74  THR A CA   1 
ATOM   695  C C    . THR A 1 74 ? 9.081  35.565 14.596  1.00 21.21  ? 74  THR A C    1 
ATOM   696  O O    . THR A 1 74 ? 9.869  35.316 13.682  1.00 21.99  ? 74  THR A O    1 
ATOM   697  C CB   . THR A 1 74 ? 6.824  36.343 13.625  1.00 19.23  ? 74  THR A CB   1 
ATOM   698  O OG1  . THR A 1 74 ? 6.063  37.539 13.581  1.00 22.67  ? 74  THR A OG1  1 
ATOM   699  C CG2  . THR A 1 74 ? 5.877  35.257 14.162  1.00 16.68  ? 74  THR A CG2  1 
ATOM   700  H H    . THR A 1 74 ? 8.393  38.140 13.000  1.00 0.00   ? 74  THR A H    1 
ATOM   701  H HG1  . THR A 1 74 ? 5.680  37.714 14.444  1.00 0.00   ? 74  THR A HG1  1 
ATOM   702  N N    . VAL A 1 75 ? 9.069  34.871 15.711  1.00 19.96  ? 75  VAL A N    1 
ATOM   703  C CA   . VAL A 1 75 ? 9.882  33.720 15.945  1.00 20.35  ? 75  VAL A CA   1 
ATOM   704  C C    . VAL A 1 75 ? 8.871  32.691 16.389  1.00 16.92  ? 75  VAL A C    1 
ATOM   705  O O    . VAL A 1 75 ? 7.945  33.007 17.116  1.00 18.56  ? 75  VAL A O    1 
ATOM   706  C CB   . VAL A 1 75 ? 10.894 34.049 17.022  1.00 19.54  ? 75  VAL A CB   1 
ATOM   707  C CG1  . VAL A 1 75 ? 11.454 32.853 17.755  1.00 22.13  ? 75  VAL A CG1  1 
ATOM   708  C CG2  . VAL A 1 75 ? 12.057 34.714 16.293  1.00 17.34  ? 75  VAL A CG2  1 
ATOM   709  H H    . VAL A 1 75 ? 8.443  35.123 16.428  1.00 0.00   ? 75  VAL A H    1 
ATOM   710  N N    . LEU A 1 76 ? 8.935  31.470 15.868  1.00 19.53  ? 76  LEU A N    1 
ATOM   711  C CA   . LEU A 1 76 ? 8.064  30.352 16.260  1.00 18.50  ? 76  LEU A CA   1 
ATOM   712  C C    . LEU A 1 76 ? 8.931  29.414 17.048  1.00 15.66  ? 76  LEU A C    1 
ATOM   713  O O    . LEU A 1 76 ? 10.104 29.243 16.712  1.00 17.13  ? 76  LEU A O    1 
ATOM   714  C CB   . LEU A 1 76 ? 7.534  29.630 15.033  1.00 15.56  ? 76  LEU A CB   1 
ATOM   715  C CG   . LEU A 1 76 ? 6.906  30.500 13.943  1.00 15.20  ? 76  LEU A CG   1 
ATOM   716  C CD1  . LEU A 1 76 ? 6.492  29.520 12.839  1.00 14.73  ? 76  LEU A CD1  1 
ATOM   717  C CD2  . LEU A 1 76 ? 5.687  31.282 14.405  1.00 14.18  ? 76  LEU A CD2  1 
ATOM   718  H H    . LEU A 1 76 ? 9.626  31.263 15.203  1.00 0.00   ? 76  LEU A H    1 
ATOM   719  N N    . VAL A 1 77 ? 8.424  28.840 18.109  1.00 18.73  ? 77  VAL A N    1 
ATOM   720  C CA   . VAL A 1 77 ? 9.256  27.987 18.987  1.00 19.79  ? 77  VAL A CA   1 
ATOM   721  C C    . VAL A 1 77 ? 8.586  26.622 19.103  1.00 19.95  ? 77  VAL A C    1 
ATOM   722  O O    . VAL A 1 77 ? 7.348  26.482 19.353  1.00 19.91  ? 77  VAL A O    1 
ATOM   723  C CB   . VAL A 1 77 ? 9.362  28.680 20.356  1.00 18.12  ? 77  VAL A CB   1 
ATOM   724  C CG1  . VAL A 1 77 ? 9.942  27.766 21.388  1.00 17.86  ? 77  VAL A CG1  1 
ATOM   725  C CG2  . VAL A 1 77 ? 10.342 29.853 20.202  1.00 18.49  ? 77  VAL A CG2  1 
ATOM   726  H H    . VAL A 1 77 ? 7.491  29.020 18.353  1.00 0.00   ? 77  VAL A H    1 
ATOM   727  N N    . GLY A 1 78 ? 9.386  25.578 18.936  1.00 20.84  ? 78  GLY A N    1 
ATOM   728  C CA   . GLY A 1 78 ? 8.738  24.285 19.009  1.00 19.49  ? 78  GLY A CA   1 
ATOM   729  C C    . GLY A 1 78 ? 9.657  23.189 18.569  1.00 20.96  ? 78  GLY A C    1 
ATOM   730  O O    . GLY A 1 78 ? 10.861 23.443 18.469  1.00 18.89  ? 78  GLY A O    1 
ATOM   731  H H    . GLY A 1 78 ? 10.350 25.640 18.834  1.00 0.00   ? 78  GLY A H    1 
ATOM   732  N N    . PRO A 1 79 ? 9.141  21.968 18.371  1.00 22.45  ? 79  PRO A N    1 
ATOM   733  C CA   . PRO A 1 79 ? 9.971  20.794 18.251  1.00 24.63  ? 79  PRO A CA   1 
ATOM   734  C C    . PRO A 1 79 ? 10.643 20.757 16.907  1.00 24.22  ? 79  PRO A C    1 
ATOM   735  O O    . PRO A 1 79 ? 10.573 19.771 16.204  1.00 26.56  ? 79  PRO A O    1 
ATOM   736  C CB   . PRO A 1 79 ? 9.026  19.646 18.517  1.00 23.48  ? 79  PRO A CB   1 
ATOM   737  C CG   . PRO A 1 79 ? 7.704  20.208 18.058  1.00 23.39  ? 79  PRO A CG   1 
ATOM   738  C CD   . PRO A 1 79 ? 7.730  21.635 18.490  1.00 24.23  ? 79  PRO A CD   1 
ATOM   739  N N    . THR A 1 80 ? 11.355 21.771 16.500  1.00 25.16  ? 80  THR A N    1 
ATOM   740  C CA   . THR A 1 80 ? 12.031 21.718 15.240  1.00 20.70  ? 80  THR A CA   1 
ATOM   741  C C    . THR A 1 80 ? 13.323 20.948 15.542  1.00 22.29  ? 80  THR A C    1 
ATOM   742  O O    . THR A 1 80 ? 13.944 21.113 16.606  1.00 23.09  ? 80  THR A O    1 
ATOM   743  C CB   . THR A 1 80 ? 12.298 23.145 14.770  1.00 15.27  ? 80  THR A CB   1 
ATOM   744  O OG1  . THR A 1 80 ? 13.093 23.007 13.601  1.00 16.86  ? 80  THR A OG1  1 
ATOM   745  C CG2  . THR A 1 80 ? 13.049 23.980 15.749  1.00 12.04  ? 80  THR A CG2  1 
ATOM   746  H H    . THR A 1 80 ? 11.601 22.480 17.113  1.00 0.00   ? 80  THR A H    1 
ATOM   747  H HG1  . THR A 1 80 ? 13.577 23.830 13.435  1.00 0.00   ? 80  THR A HG1  1 
ATOM   748  N N    . PRO A 1 81 ? 13.738 20.100 14.592  1.00 23.10  ? 81  PRO A N    1 
ATOM   749  C CA   . PRO A 1 81 ? 15.009 19.427 14.668  1.00 22.87  ? 81  PRO A CA   1 
ATOM   750  C C    . PRO A 1 81 ? 16.157 20.401 14.618  1.00 24.84  ? 81  PRO A C    1 
ATOM   751  O O    . PRO A 1 81 ? 17.252 19.997 15.006  1.00 23.32  ? 81  PRO A O    1 
ATOM   752  C CB   . PRO A 1 81 ? 15.056 18.468 13.496  1.00 22.03  ? 81  PRO A CB   1 
ATOM   753  C CG   . PRO A 1 81 ? 13.829 18.727 12.613  1.00 23.65  ? 81  PRO A CG   1 
ATOM   754  C CD   . PRO A 1 81 ? 13.047 19.821 13.312  1.00 22.38  ? 81  PRO A CD   1 
ATOM   755  N N    . VAL A 1 82 ? 16.032 21.624 14.083  1.00 22.42  ? 82  VAL A N    1 
ATOM   756  C CA   . VAL A 1 82 ? 17.197 22.456 13.938  1.00 21.52  ? 82  VAL A CA   1 
ATOM   757  C C    . VAL A 1 82 ? 16.645 23.855 14.009  1.00 21.97  ? 82  VAL A C    1 
ATOM   758  O O    . VAL A 1 82 ? 15.461 24.086 13.742  1.00 19.79  ? 82  VAL A O    1 
ATOM   759  C CB   . VAL A 1 82 ? 17.907 22.095 12.562  1.00 21.21  ? 82  VAL A CB   1 
ATOM   760  C CG1  . VAL A 1 82 ? 17.117 22.488 11.374  1.00 20.88  ? 82  VAL A CG1  1 
ATOM   761  C CG2  . VAL A 1 82 ? 19.145 22.890 12.409  1.00 25.12  ? 82  VAL A CG2  1 
ATOM   762  H H    . VAL A 1 82 ? 15.172 21.988 13.779  1.00 0.00   ? 82  VAL A H    1 
ATOM   763  N N    . ASN A 1 83 ? 17.489 24.739 14.510  1.00 21.65  ? 83  ASN A N    1 
ATOM   764  C CA   . ASN A 1 83 ? 17.149 26.126 14.552  1.00 20.76  ? 83  ASN A CA   1 
ATOM   765  C C    . ASN A 1 83 ? 17.225 26.704 13.170  1.00 15.49  ? 83  ASN A C    1 
ATOM   766  O O    . ASN A 1 83 ? 18.283 26.631 12.588  1.00 18.35  ? 83  ASN A O    1 
ATOM   767  C CB   . ASN A 1 83 ? 18.105 26.849 15.451  1.00 20.33  ? 83  ASN A CB   1 
ATOM   768  C CG   . ASN A 1 83 ? 17.864 26.579 16.918  1.00 21.79  ? 83  ASN A CG   1 
ATOM   769  O OD1  . ASN A 1 83 ? 16.797 26.201 17.342  1.00 22.63  ? 83  ASN A OD1  1 
ATOM   770  N ND2  . ASN A 1 83 ? 18.846 26.713 17.775  1.00 28.49  ? 83  ASN A ND2  1 
ATOM   771  H H    . ASN A 1 83 ? 18.354 24.443 14.853  1.00 0.00   ? 83  ASN A H    1 
ATOM   772  H HD21 . ASN A 1 83 ? 18.663 26.488 18.706  1.00 0.00   ? 83  ASN A HD21 1 
ATOM   773  H HD22 . ASN A 1 83 ? 19.715 26.958 17.388  1.00 0.00   ? 83  ASN A HD22 1 
ATOM   774  N N    . ILE A 1 84 ? 16.139 27.278 12.687  1.00 17.06  ? 84  ILE A N    1 
ATOM   775  C CA   . ILE A 1 84 ? 15.992 27.844 11.350  1.00 15.62  ? 84  ILE A CA   1 
ATOM   776  C C    . ILE A 1 84 ? 15.737 29.342 11.363  1.00 12.22  ? 84  ILE A C    1 
ATOM   777  O O    . ILE A 1 84 ? 14.698 29.761 11.900  1.00 14.03  ? 84  ILE A O    1 
ATOM   778  C CB   . ILE A 1 84 ? 14.790 27.102 10.657  1.00 12.14  ? 84  ILE A CB   1 
ATOM   779  C CG1  . ILE A 1 84 ? 15.175 25.667 10.391  1.00 13.18  ? 84  ILE A CG1  1 
ATOM   780  C CG2  . ILE A 1 84 ? 14.434 27.744 9.343   1.00 14.76  ? 84  ILE A CG2  1 
ATOM   781  C CD1  . ILE A 1 84 ? 13.820 25.013 10.210  1.00 21.08  ? 84  ILE A CD1  1 
ATOM   782  H H    . ILE A 1 84 ? 15.381 27.321 13.271  1.00 0.00   ? 84  ILE A H    1 
ATOM   783  N N    . ILE A 1 85 ? 16.596 30.103 10.690  1.00 13.77  ? 85  ILE A N    1 
ATOM   784  C CA   . ILE A 1 85 ? 16.282 31.535 10.446  1.00 14.17  ? 85  ILE A CA   1 
ATOM   785  C C    . ILE A 1 85 ? 15.688 31.588 9.061   1.00 7.66   ? 85  ILE A C    1 
ATOM   786  O O    . ILE A 1 85 ? 16.464 31.333 8.158   1.00 12.80  ? 85  ILE A O    1 
ATOM   787  C CB   . ILE A 1 85 ? 17.577 32.501 10.535  1.00 16.06  ? 85  ILE A CB   1 
ATOM   788  C CG1  . ILE A 1 85 ? 18.232 32.272 11.961  1.00 15.50  ? 85  ILE A CG1  1 
ATOM   789  C CG2  . ILE A 1 85 ? 17.247 34.021 10.383  1.00 12.70  ? 85  ILE A CG2  1 
ATOM   790  C CD1  . ILE A 1 85 ? 17.444 32.606 13.244  1.00 16.46  ? 85  ILE A CD1  1 
ATOM   791  H H    . ILE A 1 85 ? 17.370 29.704 10.256  1.00 0.00   ? 85  ILE A H    1 
ATOM   792  N N    . GLY A 1 86 ? 14.387 31.877 8.933   1.00 9.37   ? 86  GLY A N    1 
ATOM   793  C CA   . GLY A 1 86 ? 13.660 31.911 7.671   1.00 11.59  ? 86  GLY A CA   1 
ATOM   794  C C    . GLY A 1 86 ? 13.691 33.282 7.022   1.00 12.58  ? 86  GLY A C    1 
ATOM   795  O O    . GLY A 1 86 ? 14.259 34.224 7.558   1.00 11.90  ? 86  GLY A O    1 
ATOM   796  H H    . GLY A 1 86 ? 13.900 32.075 9.761   1.00 0.00   ? 86  GLY A H    1 
ATOM   797  N N    . ARG A 1 87 ? 13.101 33.426 5.842   1.00 12.86  ? 87  ARG A N    1 
ATOM   798  C CA   . ARG A 1 87 ? 13.130 34.654 5.099   1.00 12.51  ? 87  ARG A CA   1 
ATOM   799  C C    . ARG A 1 87 ? 12.572 35.880 5.860   1.00 14.61  ? 87  ARG A C    1 
ATOM   800  O O    . ARG A 1 87 ? 13.118 36.971 5.615   1.00 17.07  ? 87  ARG A O    1 
ATOM   801  C CB   . ARG A 1 87 ? 12.374 34.506 3.832   1.00 12.48  ? 87  ARG A CB   1 
ATOM   802  C CG   . ARG A 1 87 ? 13.094 33.563 2.870   1.00 10.48  ? 87  ARG A CG   1 
ATOM   803  C CD   . ARG A 1 87 ? 12.410 33.636 1.513   1.00 9.90   ? 87  ARG A CD   1 
ATOM   804  N NE   . ARG A 1 87 ? 10.978 33.324 1.611   1.00 10.73  ? 87  ARG A NE   1 
ATOM   805  C CZ   . ARG A 1 87 ? 9.957  34.193 1.570   1.00 11.88  ? 87  ARG A CZ   1 
ATOM   806  N NH1  . ARG A 1 87 ? 10.114 35.515 1.495   1.00 17.55  ? 87  ARG A NH1  1 
ATOM   807  N NH2  . ARG A 1 87 ? 8.731  33.709 1.659   1.00 13.26  ? 87  ARG A NH2  1 
ATOM   808  H H    . ARG A 1 87 ? 12.610 32.678 5.470   1.00 0.00   ? 87  ARG A H    1 
ATOM   809  H HE   . ARG A 1 87 ? 10.743 32.392 1.776   1.00 0.00   ? 87  ARG A HE   1 
ATOM   810  H HH11 . ARG A 1 87 ? 11.025 35.899 1.478   1.00 0.00   ? 87  ARG A HH11 1 
ATOM   811  H HH12 . ARG A 1 87 ? 9.326  36.126 1.436   1.00 0.00   ? 87  ARG A HH12 1 
ATOM   812  H HH21 . ARG A 1 87 ? 8.591  32.725 1.785   1.00 0.00   ? 87  ARG A HH21 1 
ATOM   813  H HH22 . ARG A 1 87 ? 7.931  34.322 1.617   1.00 0.00   ? 87  ARG A HH22 1 
ATOM   814  N N    . ASN A 1 88 ? 11.674 35.718 6.844   1.00 11.99  ? 88  ASN A N    1 
ATOM   815  C CA   . ASN A 1 88 ? 11.154 36.846 7.598   1.00 12.91  ? 88  ASN A CA   1 
ATOM   816  C C    . ASN A 1 88 ? 12.204 37.630 8.375   1.00 14.81  ? 88  ASN A C    1 
ATOM   817  O O    . ASN A 1 88 ? 12.075 38.821 8.564   1.00 15.49  ? 88  ASN A O    1 
ATOM   818  C CB   . ASN A 1 88 ? 10.054 36.378 8.531   1.00 11.73  ? 88  ASN A CB   1 
ATOM   819  C CG   . ASN A 1 88 ? 10.490 35.716 9.825   1.00 15.61  ? 88  ASN A CG   1 
ATOM   820  O OD1  . ASN A 1 88 ? 11.231 34.744 9.797   1.00 17.70  ? 88  ASN A OD1  1 
ATOM   821  N ND2  . ASN A 1 88 ? 10.157 36.237 10.996  1.00 16.68  ? 88  ASN A ND2  1 
ATOM   822  H H    . ASN A 1 88 ? 11.294 34.820 6.983   1.00 0.00   ? 88  ASN A H    1 
ATOM   823  H HD21 . ASN A 1 88 ? 10.465 35.761 11.804  1.00 0.00   ? 88  ASN A HD21 1 
ATOM   824  H HD22 . ASN A 1 88 ? 9.641  37.074 11.036  1.00 0.00   ? 88  ASN A HD22 1 
ATOM   825  N N    . LEU A 1 89 ? 13.294 37.043 8.786   1.00 13.39  ? 89  LEU A N    1 
ATOM   826  C CA   . LEU A 1 89 ? 14.401 37.728 9.415   1.00 17.16  ? 89  LEU A CA   1 
ATOM   827  C C    . LEU A 1 89 ? 15.616 37.926 8.472   1.00 19.04  ? 89  LEU A C    1 
ATOM   828  O O    . LEU A 1 89 ? 16.377 38.901 8.615   1.00 18.70  ? 89  LEU A O    1 
ATOM   829  C CB   . LEU A 1 89 ? 14.783 36.930 10.690  1.00 18.60  ? 89  LEU A CB   1 
ATOM   830  C CG   . LEU A 1 89 ? 14.365 37.421 12.072  1.00 26.39  ? 89  LEU A CG   1 
ATOM   831  C CD1  . LEU A 1 89 ? 13.031 38.127 12.057  1.00 24.89  ? 89  LEU A CD1  1 
ATOM   832  C CD2  . LEU A 1 89 ? 14.339 36.204 12.979  1.00 25.70  ? 89  LEU A CD2  1 
ATOM   833  H H    . LEU A 1 89 ? 13.364 36.089 8.579   1.00 0.00   ? 89  LEU A H    1 
ATOM   834  N N    . LEU A 1 90 ? 15.804 37.046 7.442   1.00 15.55  ? 90  LEU A N    1 
ATOM   835  C CA   . LEU A 1 90 ? 16.946 37.161 6.524   1.00 16.70  ? 90  LEU A CA   1 
ATOM   836  C C    . LEU A 1 90 ? 16.814 38.474 5.749   1.00 13.77  ? 90  LEU A C    1 
ATOM   837  O O    . LEU A 1 90 ? 17.822 39.135 5.470   1.00 14.04  ? 90  LEU A O    1 
ATOM   838  C CB   . LEU A 1 90 ? 17.041 35.956 5.476   1.00 15.58  ? 90  LEU A CB   1 
ATOM   839  C CG   . LEU A 1 90 ? 17.307 34.492 5.968   1.00 15.90  ? 90  LEU A CG   1 
ATOM   840  C CD1  . LEU A 1 90 ? 17.106 33.470 4.854   1.00 11.08  ? 90  LEU A CD1  1 
ATOM   841  C CD2  . LEU A 1 90 ? 18.740 34.434 6.536   1.00 13.47  ? 90  LEU A CD2  1 
ATOM   842  H H    . LEU A 1 90 ? 15.184 36.274 7.360   1.00 0.00   ? 90  LEU A H    1 
ATOM   843  N N    . THR A 1 91 ? 15.604 38.886 5.451   1.00 14.07  ? 91  THR A N    1 
ATOM   844  C CA   . THR A 1 91 ? 15.486 40.155 4.723   1.00 18.13  ? 91  THR A CA   1 
ATOM   845  C C    . THR A 1 91 ? 15.897 41.311 5.623   1.00 18.37  ? 91  THR A C    1 
ATOM   846  O O    . THR A 1 91 ? 16.387 42.304 5.142   1.00 19.24  ? 91  THR A O    1 
ATOM   847  C CB   . THR A 1 91 ? 14.076 40.366 4.274   1.00 14.05  ? 91  THR A CB   1 
ATOM   848  O OG1  . THR A 1 91 ? 13.280 40.305 5.442   1.00 15.63  ? 91  THR A OG1  1 
ATOM   849  C CG2  . THR A 1 91 ? 13.636 39.336 3.283   1.00 12.43  ? 91  THR A CG2  1 
ATOM   850  H H    . THR A 1 91 ? 14.792 38.371 5.650   1.00 0.00   ? 91  THR A H    1 
ATOM   851  H HG1  . THR A 1 91 ? 13.091 41.193 5.774   1.00 0.00   ? 91  THR A HG1  1 
ATOM   852  N N    . GLN A 1 92 ? 15.726 41.190 6.935   1.00 17.18  ? 92  GLN A N    1 
ATOM   853  C CA   . GLN A 1 92 ? 16.028 42.252 7.850   1.00 15.29  ? 92  GLN A CA   1 
ATOM   854  C C    . GLN A 1 92 ? 17.499 42.456 8.013   1.00 20.23  ? 92  GLN A C    1 
ATOM   855  O O    . GLN A 1 92 ? 17.932 43.568 8.298   1.00 20.55  ? 92  GLN A O    1 
ATOM   856  C CB   . GLN A 1 92 ? 15.391 41.937 9.157   1.00 15.26  ? 92  GLN A CB   1 
ATOM   857  C CG   . GLN A 1 92 ? 13.846 41.940 9.021   1.00 12.59  ? 92  GLN A CG   1 
ATOM   858  C CD   . GLN A 1 92 ? 13.251 43.204 8.427   1.00 16.91  ? 92  GLN A CD   1 
ATOM   859  O OE1  . GLN A 1 92 ? 12.882 43.332 7.269   1.00 16.62  ? 92  GLN A OE1  1 
ATOM   860  N NE2  . GLN A 1 92 ? 13.120 44.239 9.191   1.00 12.56  ? 92  GLN A NE2  1 
ATOM   861  H H    . GLN A 1 92 ? 15.325 40.352 7.267   1.00 0.00   ? 92  GLN A H    1 
ATOM   862  H HE21 . GLN A 1 92 ? 12.677 44.970 8.722   1.00 0.00   ? 92  GLN A HE21 1 
ATOM   863  H HE22 . GLN A 1 92 ? 13.458 44.238 10.115  1.00 0.00   ? 92  GLN A HE22 1 
ATOM   864  N N    . ILE A 1 93 ? 18.331 41.435 7.832   1.00 18.16  ? 93  ILE A N    1 
ATOM   865  C CA   . ILE A 1 93 ? 19.755 41.636 7.920   1.00 19.75  ? 93  ILE A CA   1 
ATOM   866  C C    . ILE A 1 93 ? 20.362 41.885 6.581   1.00 17.24  ? 93  ILE A C    1 
ATOM   867  O O    . ILE A 1 93 ? 21.576 41.998 6.501   1.00 21.33  ? 93  ILE A O    1 
ATOM   868  C CB   . ILE A 1 93 ? 20.511 40.456 8.530   1.00 19.88  ? 93  ILE A CB   1 
ATOM   869  C CG1  . ILE A 1 93 ? 20.426 39.176 7.708   1.00 22.28  ? 93  ILE A CG1  1 
ATOM   870  C CG2  . ILE A 1 93 ? 19.962 40.386 9.964   1.00 21.54  ? 93  ILE A CG2  1 
ATOM   871  C CD1  . ILE A 1 93 ? 21.231 38.102 8.448   1.00 26.77  ? 93  ILE A CD1  1 
ATOM   872  H H    . ILE A 1 93 ? 17.946 40.555 7.624   1.00 0.00   ? 93  ILE A H    1 
ATOM   873  N N    . GLY A 1 94 ? 19.517 42.024 5.571   1.00 17.81  ? 94  GLY A N    1 
ATOM   874  C CA   . GLY A 1 94 ? 19.987 42.322 4.256   1.00 18.94  ? 94  GLY A CA   1 
ATOM   875  C C    . GLY A 1 94 ? 20.592 41.156 3.504   1.00 20.06  ? 94  GLY A C    1 
ATOM   876  O O    . GLY A 1 94 ? 21.483 41.317 2.674   1.00 18.05  ? 94  GLY A O    1 
ATOM   877  H H    . GLY A 1 94 ? 18.557 41.968 5.717   1.00 0.00   ? 94  GLY A H    1 
ATOM   878  N N    . CYS A 1 95 ? 20.060 39.985 3.766   1.00 19.13  ? 95  CYS A N    1 
ATOM   879  C CA   . CYS A 1 95 ? 20.601 38.781 3.134   1.00 18.07  ? 95  CYS A CA   1 
ATOM   880  C C    . CYS A 1 95 ? 20.084 38.524 1.710   1.00 15.37  ? 95  CYS A C    1 
ATOM   881  O O    . CYS A 1 95 ? 18.893 38.654 1.376   1.00 19.44  ? 95  CYS A O    1 
ATOM   882  C CB   . CYS A 1 95 ? 20.277 37.635 4.115   1.00 18.96  ? 95  CYS A CB   1 
ATOM   883  S SG   . CYS A 1 95 ? 21.250 36.160 3.882   1.00 28.12  ? 95  CYS A SG   1 
ATOM   884  H H    . CYS A 1 95 ? 19.227 39.921 4.281   1.00 0.00   ? 95  CYS A H    1 
ATOM   885  N N    . THR A 1 96 ? 21.003 38.295 0.780   1.00 15.80  ? 96  THR A N    1 
ATOM   886  C CA   . THR A 1 96 ? 20.678 37.871 -0.577  1.00 16.39  ? 96  THR A CA   1 
ATOM   887  C C    . THR A 1 96 ? 21.439 36.568 -0.992  1.00 18.41  ? 96  THR A C    1 
ATOM   888  O O    . THR A 1 96 ? 22.479 36.149 -0.399  1.00 15.60  ? 96  THR A O    1 
ATOM   889  C CB   . THR A 1 96 ? 21.027 38.958 -1.620  1.00 17.32  ? 96  THR A CB   1 
ATOM   890  O OG1  . THR A 1 96 ? 22.402 39.190 -1.450  1.00 17.48  ? 96  THR A OG1  1 
ATOM   891  C CG2  . THR A 1 96 ? 20.306 40.298 -1.466  1.00 18.46  ? 96  THR A CG2  1 
ATOM   892  H H    . THR A 1 96 ? 21.946 38.496 0.988   1.00 0.00   ? 96  THR A H    1 
ATOM   893  H HG1  . THR A 1 96 ? 22.626 39.867 -2.095  1.00 0.00   ? 96  THR A HG1  1 
ATOM   894  N N    . LEU A 1 97 ? 20.866 35.970 -2.063  1.00 18.43  ? 97  LEU A N    1 
ATOM   895  C CA   . LEU A 1 97 ? 21.379 34.834 -2.806  1.00 20.23  ? 97  LEU A CA   1 
ATOM   896  C C    . LEU A 1 97 ? 22.075 35.407 -4.021  1.00 19.03  ? 97  LEU A C    1 
ATOM   897  O O    . LEU A 1 97 ? 21.527 36.225 -4.701  1.00 19.11  ? 97  LEU A O    1 
ATOM   898  C CB   . LEU A 1 97 ? 20.228 33.994 -3.215  1.00 20.82  ? 97  LEU A CB   1 
ATOM   899  C CG   . LEU A 1 97 ? 20.116 32.585 -2.761  1.00 26.01  ? 97  LEU A CG   1 
ATOM   900  C CD1  . LEU A 1 97 ? 20.935 32.329 -1.538  1.00 26.60  ? 97  LEU A CD1  1 
ATOM   901  C CD2  . LEU A 1 97 ? 18.671 32.321 -2.466  1.00 25.06  ? 97  LEU A CD2  1 
ATOM   902  H H    . LEU A 1 97 ? 20.043 36.366 -2.400  1.00 0.00   ? 97  LEU A H    1 
ATOM   903  N N    . ASN A 1 98 ? 23.297 35.025 -4.300  1.00 18.58  ? 98  ASN A N    1 
ATOM   904  C CA   . ASN A 1 98 ? 24.090 35.535 -5.363  1.00 20.11  ? 98  ASN A CA   1 
ATOM   905  C C    . ASN A 1 98 ? 24.742 34.413 -6.156  1.00 22.83  ? 98  ASN A C    1 
ATOM   906  O O    . ASN A 1 98 ? 25.427 33.577 -5.530  1.00 20.41  ? 98  ASN A O    1 
ATOM   907  C CB   . ASN A 1 98 ? 25.196 36.382 -4.801  1.00 20.17  ? 98  ASN A CB   1 
ATOM   908  C CG   . ASN A 1 98 ? 24.747 37.645 -4.111  1.00 28.53  ? 98  ASN A CG   1 
ATOM   909  O OD1  . ASN A 1 98 ? 24.592 38.702 -4.712  1.00 32.54  ? 98  ASN A OD1  1 
ATOM   910  N ND2  . ASN A 1 98 ? 24.582 37.585 -2.800  1.00 30.55  ? 98  ASN A ND2  1 
ATOM   911  H H    . ASN A 1 98 ? 23.703 34.318 -3.745  1.00 0.00   ? 98  ASN A H    1 
ATOM   912  H HD21 . ASN A 1 98 ? 24.338 38.354 -2.244  1.00 0.00   ? 98  ASN A HD21 1 
ATOM   913  H HD22 . ASN A 1 98 ? 24.788 36.716 -2.437  1.00 0.00   ? 98  ASN A HD22 1 
ATOM   914  N N    . PHE A 1 99 ? 24.585 34.403 -7.494  1.00 22.68  ? 99  PHE A N    1 
ATOM   915  C CA   . PHE A 1 99 ? 25.310 33.504 -8.399  1.00 27.77  ? 99  PHE A CA   1 
ATOM   916  C C    . PHE A 1 99 ? 25.387 34.069 -9.832  1.00 29.60  ? 99  PHE A C    1 
ATOM   917  O O    . PHE A 1 99 ? 24.925 35.171 -10.055 1.00 34.28  ? 99  PHE A O    1 
ATOM   918  C CB   . PHE A 1 99 ? 24.617 32.129 -8.373  1.00 26.73  ? 99  PHE A CB   1 
ATOM   919  C CG   . PHE A 1 99 ? 23.161 32.134 -8.796  1.00 26.75  ? 99  PHE A CG   1 
ATOM   920  C CD1  . PHE A 1 99 ? 22.173 32.518 -7.901  1.00 28.12  ? 99  PHE A CD1  1 
ATOM   921  C CD2  . PHE A 1 99 ? 22.834 31.746 -10.092 1.00 30.05  ? 99  PHE A CD2  1 
ATOM   922  C CE1  . PHE A 1 99 ? 20.851 32.509 -8.312  1.00 29.58  ? 99  PHE A CE1  1 
ATOM   923  C CE2  . PHE A 1 99 ? 21.503 31.733 -10.501 1.00 32.20  ? 99  PHE A CE2  1 
ATOM   924  C CZ   . PHE A 1 99 ? 20.517 32.119 -9.602  1.00 29.95  ? 99  PHE A CZ   1 
ATOM   925  O OXT  . PHE A 1 99 ? 25.850 33.433 -10.773 1.00 37.63  ? 99  PHE A OXT  1 
ATOM   926  H H    . PHE A 1 99 ? 24.021 35.094 -7.895  1.00 0.00   ? 99  PHE A H    1 
ATOM   927  N N    . PRO B 1 1  ? 22.740 36.190 -10.794 1.00 42.91  ? 1   PRO B N    1 
ATOM   928  C CA   . PRO B 1 1  ? 21.831 37.194 -10.291 1.00 40.12  ? 1   PRO B CA   1 
ATOM   929  C C    . PRO B 1 1  ? 21.984 37.435 -8.790  1.00 37.32  ? 1   PRO B C    1 
ATOM   930  O O    . PRO B 1 1  ? 22.664 36.653 -8.124  1.00 38.44  ? 1   PRO B O    1 
ATOM   931  C CB   . PRO B 1 1  ? 20.429 36.703 -10.688 1.00 40.38  ? 1   PRO B CB   1 
ATOM   932  C CG   . PRO B 1 1  ? 20.574 35.310 -11.259 1.00 41.72  ? 1   PRO B CG   1 
ATOM   933  C CD   . PRO B 1 1  ? 21.992 35.450 -11.799 1.00 44.98  ? 1   PRO B CD   1 
ATOM   934  H H2   . PRO B 1 1  ? 23.678 36.509 -11.104 1.00 0.00   ? 1   PRO B H2   1 
ATOM   935  H H3   . PRO B 1 1  ? 23.017 35.583 -9.984  1.00 0.00   ? 1   PRO B H3   1 
ATOM   936  N N    . GLN B 1 2  ? 21.412 38.499 -8.245  1.00 33.38  ? 2   GLN B N    1 
ATOM   937  C CA   . GLN B 1 2  ? 21.419 38.698 -6.821  1.00 32.12  ? 2   GLN B CA   1 
ATOM   938  C C    . GLN B 1 2  ? 19.940 38.503 -6.513  1.00 30.17  ? 2   GLN B C    1 
ATOM   939  O O    . GLN B 1 2  ? 19.093 39.018 -7.255  1.00 31.36  ? 2   GLN B O    1 
ATOM   940  C CB   . GLN B 1 2  ? 21.853 40.085 -6.493  1.00 34.43  ? 2   GLN B CB   1 
ATOM   941  C CG   . GLN B 1 2  ? 21.601 40.398 -5.026  1.00 41.58  ? 2   GLN B CG   1 
ATOM   942  C CD   . GLN B 1 2  ? 22.061 41.792 -4.656  1.00 48.25  ? 2   GLN B CD   1 
ATOM   943  O OE1  . GLN B 1 2  ? 21.248 42.720 -4.553  1.00 53.36  ? 2   GLN B OE1  1 
ATOM   944  N NE2  . GLN B 1 2  ? 23.366 41.972 -4.442  1.00 48.95  ? 2   GLN B NE2  1 
ATOM   945  H H    . GLN B 1 2  ? 20.791 39.075 -8.750  1.00 0.00   ? 2   GLN B H    1 
ATOM   946  H HE21 . GLN B 1 2  ? 23.665 42.870 -4.182  1.00 0.00   ? 2   GLN B HE21 1 
ATOM   947  H HE22 . GLN B 1 2  ? 23.953 41.196 -4.557  1.00 0.00   ? 2   GLN B HE22 1 
ATOM   948  N N    . ILE B 1 3  ? 19.541 37.766 -5.483  1.00 25.12  ? 3   ILE B N    1 
ATOM   949  C CA   . ILE B 1 3  ? 18.142 37.448 -5.288  1.00 22.23  ? 3   ILE B CA   1 
ATOM   950  C C    . ILE B 1 3  ? 17.855 37.858 -3.854  1.00 20.83  ? 3   ILE B C    1 
ATOM   951  O O    . ILE B 1 3  ? 18.619 37.420 -2.981  1.00 19.53  ? 3   ILE B O    1 
ATOM   952  C CB   . ILE B 1 3  ? 17.938 35.933 -5.524  1.00 20.46  ? 3   ILE B CB   1 
ATOM   953  C CG1  . ILE B 1 3  ? 18.167 35.598 -6.994  1.00 24.79  ? 3   ILE B CG1  1 
ATOM   954  C CG2  . ILE B 1 3  ? 16.520 35.511 -5.144  1.00 17.33  ? 3   ILE B CG2  1 
ATOM   955  C CD1  . ILE B 1 3  ? 18.031 34.102 -7.300  1.00 24.92  ? 3   ILE B CD1  1 
ATOM   956  H H    . ILE B 1 3  ? 20.192 37.451 -4.822  1.00 0.00   ? 3   ILE B H    1 
ATOM   957  N N    . THR B 1 4  ? 16.848 38.755 -3.612  1.00 18.31  ? 4   THR B N    1 
ATOM   958  C CA   . THR B 1 4  ? 16.495 39.149 -2.251  1.00 18.67  ? 4   THR B CA   1 
ATOM   959  C C    . THR B 1 4  ? 15.439 38.160 -1.772  1.00 16.94  ? 4   THR B C    1 
ATOM   960  O O    . THR B 1 4  ? 14.794 37.429 -2.521  1.00 17.68  ? 4   THR B O    1 
ATOM   961  C CB   . THR B 1 4  ? 15.998 40.636 -2.274  1.00 19.64  ? 4   THR B CB   1 
ATOM   962  O OG1  . THR B 1 4  ? 14.962 40.739 -3.238  1.00 22.00  ? 4   THR B OG1  1 
ATOM   963  C CG2  . THR B 1 4  ? 17.143 41.589 -2.512  1.00 21.32  ? 4   THR B CG2  1 
ATOM   964  H H    . THR B 1 4  ? 16.282 39.070 -4.350  1.00 0.00   ? 4   THR B H    1 
ATOM   965  H HG1  . THR B 1 4  ? 14.811 41.675 -3.433  1.00 0.00   ? 4   THR B HG1  1 
ATOM   966  N N    . LEU B 1 5  ? 15.157 38.145 -0.488  1.00 19.90  ? 5   LEU B N    1 
ATOM   967  C CA   . LEU B 1 5  ? 14.337 37.068 0.049   1.00 18.01  ? 5   LEU B CA   1 
ATOM   968  C C    . LEU B 1 5  ? 13.027 37.554 0.553   1.00 18.45  ? 5   LEU B C    1 
ATOM   969  O O    . LEU B 1 5  ? 12.442 37.001 1.470   1.00 17.01  ? 5   LEU B O    1 
ATOM   970  C CB   . LEU B 1 5  ? 15.160 36.390 1.143   1.00 16.29  ? 5   LEU B CB   1 
ATOM   971  C CG   . LEU B 1 5  ? 16.445 35.705 0.573   1.00 13.36  ? 5   LEU B CG   1 
ATOM   972  C CD1  . LEU B 1 5  ? 17.392 35.395 1.680   1.00 16.24  ? 5   LEU B CD1  1 
ATOM   973  C CD2  . LEU B 1 5  ? 16.059 34.522 -0.212  1.00 13.08  ? 5   LEU B CD2  1 
ATOM   974  H H    . LEU B 1 5  ? 15.561 38.792 0.131   1.00 0.00   ? 5   LEU B H    1 
ATOM   975  N N    . TRP B 1 6  ? 12.572 38.676 -0.022  1.00 15.18  ? 6   TRP B N    1 
ATOM   976  C CA   . TRP B 1 6  ? 11.304 39.275 0.363   1.00 15.60  ? 6   TRP B CA   1 
ATOM   977  C C    . TRP B 1 6  ? 10.240 38.343 -0.139  1.00 16.67  ? 6   TRP B C    1 
ATOM   978  O O    . TRP B 1 6  ? 9.180  38.264 0.484   1.00 19.47  ? 6   TRP B O    1 
ATOM   979  C CB   . TRP B 1 6  ? 11.135 40.711 -0.265  1.00 16.77  ? 6   TRP B CB   1 
ATOM   980  C CG   . TRP B 1 6  ? 12.163 41.753 0.223   1.00 16.14  ? 6   TRP B CG   1 
ATOM   981  C CD1  . TRP B 1 6  ? 13.266 42.061 -0.511  1.00 15.64  ? 6   TRP B CD1  1 
ATOM   982  C CD2  . TRP B 1 6  ? 12.174 42.343 1.465   1.00 17.92  ? 6   TRP B CD2  1 
ATOM   983  N NE1  . TRP B 1 6  ? 13.993 42.806 0.272   1.00 16.57  ? 6   TRP B NE1  1 
ATOM   984  C CE2  . TRP B 1 6  ? 13.398 42.998 1.459   1.00 17.13  ? 6   TRP B CE2  1 
ATOM   985  C CE3  . TRP B 1 6  ? 11.337 42.382 2.580   1.00 17.00  ? 6   TRP B CE3  1 
ATOM   986  C CZ2  . TRP B 1 6  ? 13.834 43.736 2.587   1.00 17.53  ? 6   TRP B CZ2  1 
ATOM   987  C CZ3  . TRP B 1 6  ? 11.773 43.115 3.695   1.00 14.69  ? 6   TRP B CZ3  1 
ATOM   988  C CH2  . TRP B 1 6  ? 13.014 43.783 3.711   1.00 14.01  ? 6   TRP B CH2  1 
ATOM   989  H H    . TRP B 1 6  ? 13.016 38.960 -0.840  1.00 0.00   ? 6   TRP B H    1 
ATOM   990  H HE1  . TRP B 1 6  ? 14.821 43.287 0.021   1.00 0.00   ? 6   TRP B HE1  1 
ATOM   991  N N    . GLN B 1 7  ? 10.475 37.634 -1.263  1.00 18.54  ? 7   GLN B N    1 
ATOM   992  C CA   . GLN B 1 7  ? 9.592  36.613 -1.779  1.00 18.89  ? 7   GLN B CA   1 
ATOM   993  C C    . GLN B 1 7  ? 10.333 35.241 -1.808  1.00 16.61  ? 7   GLN B C    1 
ATOM   994  O O    . GLN B 1 7  ? 11.551 35.265 -1.752  1.00 12.67  ? 7   GLN B O    1 
ATOM   995  C CB   . GLN B 1 7  ? 9.230  36.901 -3.182  1.00 27.57  ? 7   GLN B CB   1 
ATOM   996  C CG   . GLN B 1 7  ? 8.306  38.078 -3.369  1.00 44.95  ? 7   GLN B CG   1 
ATOM   997  C CD   . GLN B 1 7  ? 8.052  38.367 -4.849  1.00 56.30  ? 7   GLN B CD   1 
ATOM   998  O OE1  . GLN B 1 7  ? 8.136  37.511 -5.758  1.00 60.69  ? 7   GLN B OE1  1 
ATOM   999  N NE2  . GLN B 1 7  ? 7.712  39.651 -5.048  1.00 60.94  ? 7   GLN B NE2  1 
ATOM   1000 H H    . GLN B 1 7  ? 11.356 37.637 -1.699  1.00 0.00   ? 7   GLN B H    1 
ATOM   1001 H HE21 . GLN B 1 7  ? 7.478  39.905 -5.961  1.00 0.00   ? 7   GLN B HE21 1 
ATOM   1002 H HE22 . GLN B 1 7  ? 7.703  40.272 -4.288  1.00 0.00   ? 7   GLN B HE22 1 
ATOM   1003 N N    . ARG B 1 8  ? 9.655  34.075 -1.893  1.00 17.48  ? 8   ARG B N    1 
ATOM   1004 C CA   . ARG B 1 8  ? 10.248 32.766 -2.013  1.00 15.32  ? 8   ARG B CA   1 
ATOM   1005 C C    . ARG B 1 8  ? 11.227 32.750 -3.139  1.00 14.45  ? 8   ARG B C    1 
ATOM   1006 O O    . ARG B 1 8  ? 10.846 33.287 -4.187  1.00 16.28  ? 8   ARG B O    1 
ATOM   1007 C CB   . ARG B 1 8  ? 9.214  31.733 -2.318  1.00 15.47  ? 8   ARG B CB   1 
ATOM   1008 C CG   . ARG B 1 8  ? 8.538  31.494 -1.050  1.00 12.62  ? 8   ARG B CG   1 
ATOM   1009 C CD   . ARG B 1 8  ? 7.561  30.411 -1.195  1.00 13.52  ? 8   ARG B CD   1 
ATOM   1010 N NE   . ARG B 1 8  ? 6.781  30.444 0.029   1.00 12.72  ? 8   ARG B NE   1 
ATOM   1011 C CZ   . ARG B 1 8  ? 5.476  30.119 0.083   1.00 14.64  ? 8   ARG B CZ   1 
ATOM   1012 N NH1  . ARG B 1 8  ? 4.758  29.683 -0.964  1.00 20.99  ? 8   ARG B NH1  1 
ATOM   1013 N NH2  . ARG B 1 8  ? 4.803  30.152 1.207   1.00 16.41  ? 8   ARG B NH2  1 
ATOM   1014 H H    . ARG B 1 8  ? 8.682  34.129 -1.946  1.00 0.00   ? 8   ARG B H    1 
ATOM   1015 H HE   . ARG B 1 8  ? 7.205  30.742 0.854   1.00 0.00   ? 8   ARG B HE   1 
ATOM   1016 H HH11 . ARG B 1 8  ? 5.201  29.578 -1.852  1.00 0.00   ? 8   ARG B HH11 1 
ATOM   1017 H HH12 . ARG B 1 8  ? 3.801  29.423 -0.866  1.00 0.00   ? 8   ARG B HH12 1 
ATOM   1018 H HH21 . ARG B 1 8  ? 5.243  30.366 2.062   1.00 0.00   ? 8   ARG B HH21 1 
ATOM   1019 H HH22 . ARG B 1 8  ? 3.845  29.865 1.184   1.00 0.00   ? 8   ARG B HH22 1 
ATOM   1020 N N    . PRO B 1 9  ? 12.447 32.211 -2.995  1.00 13.03  ? 9   PRO B N    1 
ATOM   1021 C CA   . PRO B 1 9  ? 13.404 32.155 -4.064  1.00 16.16  ? 9   PRO B CA   1 
ATOM   1022 C C    . PRO B 1 9  ? 13.106 30.991 -5.003  1.00 17.51  ? 9   PRO B C    1 
ATOM   1023 O O    . PRO B 1 9  ? 13.750 29.956 -4.951  1.00 17.73  ? 9   PRO B O    1 
ATOM   1024 C CB   . PRO B 1 9  ? 14.745 32.108 -3.345  1.00 15.46  ? 9   PRO B CB   1 
ATOM   1025 C CG   . PRO B 1 9  ? 14.454 31.355 -2.097  1.00 10.37  ? 9   PRO B CG   1 
ATOM   1026 C CD   . PRO B 1 9  ? 13.106 31.900 -1.724  1.00 11.28  ? 9   PRO B CD   1 
ATOM   1027 N N    . LEU B 1 10 ? 12.075 31.157 -5.833  1.00 19.82  ? 10  LEU B N    1 
ATOM   1028 C CA   . LEU B 1 10 ? 11.638 30.166 -6.814  1.00 22.21  ? 10  LEU B CA   1 
ATOM   1029 C C    . LEU B 1 10 ? 12.277 30.455 -8.167  1.00 24.42  ? 10  LEU B C    1 
ATOM   1030 O O    . LEU B 1 10 ? 12.324 31.633 -8.549  1.00 26.34  ? 10  LEU B O    1 
ATOM   1031 C CB   . LEU B 1 10 ? 10.133 30.234 -6.917  1.00 23.22  ? 10  LEU B CB   1 
ATOM   1032 C CG   . LEU B 1 10 ? 9.392  29.922 -5.665  1.00 27.03  ? 10  LEU B CG   1 
ATOM   1033 C CD1  . LEU B 1 10 ? 8.000  30.451 -5.779  1.00 32.50  ? 10  LEU B CD1  1 
ATOM   1034 C CD2  . LEU B 1 10 ? 9.396  28.420 -5.447  1.00 32.56  ? 10  LEU B CD2  1 
ATOM   1035 H H    . LEU B 1 10 ? 11.634 32.039 -5.851  1.00 0.00   ? 10  LEU B H    1 
ATOM   1036 N N    . VAL B 1 11 ? 12.872 29.475 -8.862  1.00 19.01  ? 11  VAL B N    1 
ATOM   1037 C CA   . VAL B 1 11 ? 13.510 29.686 -10.141 1.00 17.90  ? 11  VAL B CA   1 
ATOM   1038 C C    . VAL B 1 11 ? 13.007 28.566 -11.052 1.00 20.26  ? 11  VAL B C    1 
ATOM   1039 O O    . VAL B 1 11 ? 12.373 27.619 -10.568 1.00 21.64  ? 11  VAL B O    1 
ATOM   1040 C CB   . VAL B 1 11 ? 15.063 29.581 -10.064 1.00 19.25  ? 11  VAL B CB   1 
ATOM   1041 C CG1  . VAL B 1 11 ? 15.613 30.620 -9.128  1.00 22.32  ? 11  VAL B CG1  1 
ATOM   1042 C CG2  . VAL B 1 11 ? 15.508 28.217 -9.529  1.00 18.15  ? 11  VAL B CG2  1 
ATOM   1043 H H    . VAL B 1 11 ? 12.880 28.555 -8.519  1.00 0.00   ? 11  VAL B H    1 
ATOM   1044 N N    . THR B 1 12 ? 13.213 28.671 -12.367 1.00 19.65  ? 12  THR B N    1 
ATOM   1045 C CA   . THR B 1 12 ? 12.901 27.625 -13.343 1.00 17.41  ? 12  THR B CA   1 
ATOM   1046 C C    . THR B 1 12 ? 14.146 26.762 -13.453 1.00 14.88  ? 12  THR B C    1 
ATOM   1047 O O    . THR B 1 12 ? 15.289 27.242 -13.419 1.00 18.40  ? 12  THR B O    1 
ATOM   1048 C CB   . THR B 1 12 ? 12.564 28.254 -14.695 1.00 17.57  ? 12  THR B CB   1 
ATOM   1049 O OG1  . THR B 1 12 ? 11.481 29.066 -14.319 1.00 23.72  ? 12  THR B OG1  1 
ATOM   1050 C CG2  . THR B 1 12 ? 12.109 27.339 -15.829 1.00 21.94  ? 12  THR B CG2  1 
ATOM   1051 H H    . THR B 1 12 ? 13.725 29.433 -12.667 1.00 0.00   ? 12  THR B H    1 
ATOM   1052 H HG1  . THR B 1 12 ? 11.725 29.680 -13.623 1.00 0.00   ? 12  THR B HG1  1 
ATOM   1053 N N    . ILE B 1 13 ? 13.913 25.458 -13.524 1.00 16.92  ? 13  ILE B N    1 
ATOM   1054 C CA   . ILE B 1 13 ? 14.975 24.517 -13.713 1.00 15.48  ? 13  ILE B CA   1 
ATOM   1055 C C    . ILE B 1 13 ? 14.509 23.695 -14.888 1.00 14.36  ? 13  ILE B C    1 
ATOM   1056 O O    . ILE B 1 13 ? 13.321 23.614 -15.231 1.00 15.29  ? 13  ILE B O    1 
ATOM   1057 C CB   . ILE B 1 13 ? 15.186 23.590 -12.449 1.00 12.03  ? 13  ILE B CB   1 
ATOM   1058 C CG1  . ILE B 1 13 ? 13.952 22.828 -12.147 1.00 13.53  ? 13  ILE B CG1  1 
ATOM   1059 C CG2  . ILE B 1 13 ? 15.541 24.468 -11.225 1.00 15.27  ? 13  ILE B CG2  1 
ATOM   1060 C CD1  . ILE B 1 13 ? 14.166 21.605 -11.255 1.00 22.32  ? 13  ILE B CD1  1 
ATOM   1061 H H    . ILE B 1 13 ? 12.996 25.126 -13.553 1.00 0.00   ? 13  ILE B H    1 
ATOM   1062 N N    . LYS B 1 14 ? 15.452 23.068 -15.544 1.00 17.37  ? 14  LYS B N    1 
ATOM   1063 C CA   . LYS B 1 14 ? 15.135 22.257 -16.701 1.00 22.94  ? 14  LYS B CA   1 
ATOM   1064 C C    . LYS B 1 14 ? 15.803 20.933 -16.368 1.00 21.45  ? 14  LYS B C    1 
ATOM   1065 O O    . LYS B 1 14 ? 16.993 20.860 -16.072 1.00 22.48  ? 14  LYS B O    1 
ATOM   1066 C CB   . LYS B 1 14 ? 15.746 22.884 -17.970 1.00 20.44  ? 14  LYS B CB   1 
ATOM   1067 C CG   . LYS B 1 14 ? 15.093 22.355 -19.207 1.00 28.34  ? 14  LYS B CG   1 
ATOM   1068 C CD   . LYS B 1 14 ? 15.644 23.021 -20.431 1.00 32.58  ? 14  LYS B CD   1 
ATOM   1069 C CE   . LYS B 1 14 ? 14.865 22.571 -21.660 1.00 36.06  ? 14  LYS B CE   1 
ATOM   1070 N NZ   . LYS B 1 14 ? 15.591 23.099 -22.803 1.00 38.74  ? 14  LYS B NZ   1 
ATOM   1071 H H    . LYS B 1 14 ? 16.384 23.187 -15.264 1.00 0.00   ? 14  LYS B H    1 
ATOM   1072 H HZ1  . LYS B 1 14 ? 16.566 22.745 -22.762 1.00 0.00   ? 14  LYS B HZ1  1 
ATOM   1073 H HZ2  . LYS B 1 14 ? 15.122 22.802 -23.681 1.00 0.00   ? 14  LYS B HZ2  1 
ATOM   1074 H HZ3  . LYS B 1 14 ? 15.583 24.135 -22.726 1.00 0.00   ? 14  LYS B HZ3  1 
ATOM   1075 N N    . ILE B 1 15 ? 14.999 19.906 -16.321 1.00 24.35  ? 15  ILE B N    1 
ATOM   1076 C CA   . ILE B 1 15 ? 15.501 18.572 -16.057 1.00 27.96  ? 15  ILE B CA   1 
ATOM   1077 C C    . ILE B 1 15 ? 14.713 17.630 -16.955 1.00 30.65  ? 15  ILE B C    1 
ATOM   1078 O O    . ILE B 1 15 ? 13.490 17.697 -17.024 1.00 28.59  ? 15  ILE B O    1 
ATOM   1079 C CB   . ILE B 1 15 ? 15.352 18.181 -14.504 1.00 27.09  ? 15  ILE B CB   1 
ATOM   1080 C CG1  . ILE B 1 15 ? 15.917 16.741 -14.356 1.00 26.86  ? 15  ILE B CG1  1 
ATOM   1081 C CG2  . ILE B 1 15 ? 13.934 18.331 -13.965 1.00 26.32  ? 15  ILE B CG2  1 
ATOM   1082 C CD1  . ILE B 1 15 ? 16.295 16.377 -12.909 1.00 18.51  ? 15  ILE B CD1  1 
ATOM   1083 H H    . ILE B 1 15 ? 14.044 20.042 -16.497 1.00 0.00   ? 15  ILE B H    1 
ATOM   1084 N N    . GLY B 1 16 ? 15.380 16.816 -17.763 1.00 34.41  ? 16  GLY B N    1 
ATOM   1085 C CA   . GLY B 1 16 ? 14.663 15.843 -18.601 1.00 33.22  ? 16  GLY B CA   1 
ATOM   1086 C C    . GLY B 1 16 ? 13.881 16.547 -19.716 1.00 33.26  ? 16  GLY B C    1 
ATOM   1087 O O    . GLY B 1 16 ? 12.856 16.050 -20.180 1.00 31.59  ? 16  GLY B O    1 
ATOM   1088 H H    . GLY B 1 16 ? 16.355 16.866 -17.767 1.00 0.00   ? 16  GLY B H    1 
ATOM   1089 N N    . GLY B 1 17 ? 14.389 17.727 -20.137 1.00 31.33  ? 17  GLY B N    1 
ATOM   1090 C CA   . GLY B 1 17 ? 13.681 18.543 -21.112 1.00 31.24  ? 17  GLY B CA   1 
ATOM   1091 C C    . GLY B 1 17 ? 12.361 19.102 -20.556 1.00 30.62  ? 17  GLY B C    1 
ATOM   1092 O O    . GLY B 1 17 ? 11.492 19.541 -21.320 1.00 36.32  ? 17  GLY B O    1 
ATOM   1093 H H    . GLY B 1 17 ? 15.251 18.047 -19.806 1.00 0.00   ? 17  GLY B H    1 
ATOM   1094 N N    . GLN B 1 18 ? 12.098 19.081 -19.246 1.00 28.95  ? 18  GLN B N    1 
ATOM   1095 C CA   . GLN B 1 18 ? 10.877 19.678 -18.723 1.00 29.37  ? 18  GLN B CA   1 
ATOM   1096 C C    . GLN B 1 18 ? 11.305 20.852 -17.925 1.00 25.32  ? 18  GLN B C    1 
ATOM   1097 O O    . GLN B 1 18 ? 12.366 20.853 -17.295 1.00 23.45  ? 18  GLN B O    1 
ATOM   1098 C CB   . GLN B 1 18 ? 10.136 18.798 -17.760 1.00 37.25  ? 18  GLN B CB   1 
ATOM   1099 C CG   . GLN B 1 18 ? 10.047 17.363 -18.227 1.00 51.20  ? 18  GLN B CG   1 
ATOM   1100 C CD   . GLN B 1 18 ? 9.490  16.374 -17.195 1.00 59.01  ? 18  GLN B CD   1 
ATOM   1101 O OE1  . GLN B 1 18 ? 10.039 15.291 -16.893 1.00 64.34  ? 18  GLN B OE1  1 
ATOM   1102 N NE2  . GLN B 1 18 ? 8.315  16.718 -16.658 1.00 60.86  ? 18  GLN B NE2  1 
ATOM   1103 H H    . GLN B 1 18 ? 12.674 18.583 -18.628 1.00 0.00   ? 18  GLN B H    1 
ATOM   1104 H HE21 . GLN B 1 18 ? 7.919  16.116 -15.996 1.00 0.00   ? 18  GLN B HE21 1 
ATOM   1105 H HE22 . GLN B 1 18 ? 7.901  17.558 -16.951 1.00 0.00   ? 18  GLN B HE22 1 
ATOM   1106 N N    . LEU B 1 19 ? 10.431 21.830 -17.956 1.00 24.96  ? 19  LEU B N    1 
ATOM   1107 C CA   . LEU B 1 19 ? 10.690 22.977 -17.124 1.00 26.92  ? 19  LEU B CA   1 
ATOM   1108 C C    . LEU B 1 19 ? 9.937  22.784 -15.823 1.00 25.36  ? 19  LEU B C    1 
ATOM   1109 O O    . LEU B 1 19 ? 8.779  22.344 -15.877 1.00 25.51  ? 19  LEU B O    1 
ATOM   1110 C CB   . LEU B 1 19 ? 10.204 24.316 -17.719 1.00 24.52  ? 19  LEU B CB   1 
ATOM   1111 C CG   . LEU B 1 19 ? 10.919 24.773 -18.995 1.00 23.96  ? 19  LEU B CG   1 
ATOM   1112 C CD1  . LEU B 1 19 ? 10.315 26.080 -19.463 1.00 26.01  ? 19  LEU B CD1  1 
ATOM   1113 C CD2  . LEU B 1 19 ? 12.392 24.914 -18.757 1.00 21.04  ? 19  LEU B CD2  1 
ATOM   1114 H H    . LEU B 1 19 ? 9.583  21.747 -18.428 1.00 0.00   ? 19  LEU B H    1 
ATOM   1115 N N    . LYS B 1 20 ? 10.542 23.069 -14.681 1.00 22.82  ? 20  LYS B N    1 
ATOM   1116 C CA   . LYS B 1 20 ? 9.861  22.971 -13.428 1.00 22.48  ? 20  LYS B CA   1 
ATOM   1117 C C    . LYS B 1 20 ? 10.284 24.190 -12.617 1.00 19.32  ? 20  LYS B C    1 
ATOM   1118 O O    . LYS B 1 20 ? 11.297 24.841 -12.866 1.00 21.91  ? 20  LYS B O    1 
ATOM   1119 C CB   . LYS B 1 20 ? 10.252 21.654 -12.715 1.00 25.44  ? 20  LYS B CB   1 
ATOM   1120 C CG   . LYS B 1 20 ? 9.826  20.348 -13.410 1.00 31.71  ? 20  LYS B CG   1 
ATOM   1121 C CD   . LYS B 1 20 ? 10.236 19.109 -12.567 1.00 36.65  ? 20  LYS B CD   1 
ATOM   1122 C CE   . LYS B 1 20 ? 9.200  17.959 -12.425 1.00 42.92  ? 20  LYS B CE   1 
ATOM   1123 N NZ   . LYS B 1 20 ? 9.609  16.943 -11.442 1.00 48.55  ? 20  LYS B NZ   1 
ATOM   1124 H H    . LYS B 1 20 ? 11.457 23.436 -14.701 1.00 0.00   ? 20  LYS B H    1 
ATOM   1125 H HZ1  . LYS B 1 20 ? 10.580 16.630 -11.646 1.00 0.00   ? 20  LYS B HZ1  1 
ATOM   1126 H HZ2  . LYS B 1 20 ? 9.561  17.365 -10.493 1.00 0.00   ? 20  LYS B HZ2  1 
ATOM   1127 H HZ3  . LYS B 1 20 ? 8.950  16.144 -11.522 1.00 0.00   ? 20  LYS B HZ3  1 
ATOM   1128 N N    . GLU B 1 21 ? 9.524  24.614 -11.629 1.00 18.46  ? 21  GLU B N    1 
ATOM   1129 C CA   . GLU B 1 21 ? 9.915  25.695 -10.693 1.00 21.34  ? 21  GLU B CA   1 
ATOM   1130 C C    . GLU B 1 21 ? 10.600 25.025 -9.519  1.00 18.50  ? 21  GLU B C    1 
ATOM   1131 O O    . GLU B 1 21 ? 10.117 23.944 -9.158  1.00 18.79  ? 21  GLU B O    1 
ATOM   1132 C CB   . GLU B 1 21 ? 8.720  26.435 -10.089 1.00 30.62  ? 21  GLU B CB   1 
ATOM   1133 C CG   . GLU B 1 21 ? 7.827  27.290 -10.975 1.00 49.38  ? 21  GLU B CG   1 
ATOM   1134 C CD   . GLU B 1 21 ? 8.435  28.670 -11.340 1.00 58.93  ? 21  GLU B CD   1 
ATOM   1135 O OE1  . GLU B 1 21 ? 9.439  28.719 -12.088 1.00 65.30  ? 21  GLU B OE1  1 
ATOM   1136 O OE2  . GLU B 1 21 ? 7.892  29.699 -10.884 1.00 63.35  ? 21  GLU B OE2  1 
ATOM   1137 H H    . GLU B 1 21 ? 8.700  24.126 -11.443 1.00 0.00   ? 21  GLU B H    1 
ATOM   1138 N N    . ALA B 1 22 ? 11.576 25.565 -8.855  1.00 13.69  ? 22  ALA B N    1 
ATOM   1139 C CA   . ALA B 1 22 ? 12.174 24.901 -7.749  1.00 14.36  ? 22  ALA B CA   1 
ATOM   1140 C C    . ALA B 1 22 ? 12.520 25.962 -6.768  1.00 15.23  ? 22  ALA B C    1 
ATOM   1141 O O    . ALA B 1 22 ? 12.725 27.089 -7.162  1.00 17.55  ? 22  ALA B O    1 
ATOM   1142 C CB   . ALA B 1 22 ? 13.412 24.279 -8.162  1.00 13.33  ? 22  ALA B CB   1 
ATOM   1143 H H    . ALA B 1 22 ? 11.897 26.466 -9.097  1.00 0.00   ? 22  ALA B H    1 
ATOM   1144 N N    . LEU B 1 23 ? 12.577 25.709 -5.505  1.00 14.18  ? 23  LEU B N    1 
ATOM   1145 C CA   . LEU B 1 23 ? 12.984 26.641 -4.480  1.00 13.13  ? 23  LEU B CA   1 
ATOM   1146 C C    . LEU B 1 23 ? 14.486 26.642 -4.269  1.00 16.16  ? 23  LEU B C    1 
ATOM   1147 O O    . LEU B 1 23 ? 15.006 25.536 -4.044  1.00 16.63  ? 23  LEU B O    1 
ATOM   1148 C CB   . LEU B 1 23 ? 12.231 26.205 -3.231  1.00 16.67  ? 23  LEU B CB   1 
ATOM   1149 C CG   . LEU B 1 23 ? 12.159 26.961 -1.935  1.00 18.50  ? 23  LEU B CG   1 
ATOM   1150 C CD1  . LEU B 1 23 ? 11.462 28.302 -2.298  1.00 14.63  ? 23  LEU B CD1  1 
ATOM   1151 C CD2  . LEU B 1 23 ? 11.391 26.194 -0.853  1.00 14.79  ? 23  LEU B CD2  1 
ATOM   1152 H H    . LEU B 1 23 ? 12.338 24.805 -5.230  1.00 0.00   ? 23  LEU B H    1 
ATOM   1153 N N    . LEU B 1 24 ? 15.261 27.746 -4.258  1.00 13.38  ? 24  LEU B N    1 
ATOM   1154 C CA   . LEU B 1 24 ? 16.673 27.723 -3.901  1.00 15.71  ? 24  LEU B CA   1 
ATOM   1155 C C    . LEU B 1 24 ? 16.781 27.659 -2.380  1.00 14.52  ? 24  LEU B C    1 
ATOM   1156 O O    . LEU B 1 24 ? 16.292 28.519 -1.651  1.00 13.10  ? 24  LEU B O    1 
ATOM   1157 C CB   . LEU B 1 24 ? 17.358 28.957 -4.409  1.00 18.36  ? 24  LEU B CB   1 
ATOM   1158 C CG   . LEU B 1 24 ? 17.399 29.182 -5.922  1.00 20.09  ? 24  LEU B CG   1 
ATOM   1159 C CD1  . LEU B 1 24 ? 18.481 30.234 -6.172  1.00 19.58  ? 24  LEU B CD1  1 
ATOM   1160 C CD2  . LEU B 1 24 ? 17.726 27.904 -6.688  1.00 19.20  ? 24  LEU B CD2  1 
ATOM   1161 H H    . LEU B 1 24 ? 14.843 28.606 -4.409  1.00 0.00   ? 24  LEU B H    1 
ATOM   1162 N N    . ASP B 1 25 ? 17.371 26.552 -1.888  1.00 12.60  ? 25  ASP B N    1 
ATOM   1163 C CA   . ASP B 1 25 ? 17.304 26.329 -0.480  1.00 14.39  ? 25  ASP B CA   1 
ATOM   1164 C C    . ASP B 1 25 ? 18.588 26.024 0.194   1.00 16.27  ? 25  ASP B C    1 
ATOM   1165 O O    . ASP B 1 25 ? 19.105 24.924 0.116   1.00 14.19  ? 25  ASP B O    1 
ATOM   1166 C CB   . ASP B 1 25 ? 16.268 25.225 -0.273  1.00 16.09  ? 25  ASP B CB   1 
ATOM   1167 C CG   . ASP B 1 25 ? 15.868 24.996 1.165   1.00 19.31  ? 25  ASP B CG   1 
ATOM   1168 O OD1  . ASP B 1 25 ? 16.196 25.780 2.052   1.00 17.68  ? 25  ASP B OD1  1 
ATOM   1169 O OD2  . ASP B 1 25 ? 15.183 24.014 1.349   1.00 20.78  ? 25  ASP B OD2  1 
ATOM   1170 H H    . ASP B 1 25 ? 17.772 25.869 -2.466  1.00 0.00   ? 25  ASP B H    1 
ATOM   1171 N N    . THR B 1 26 ? 19.030 27.001 0.949   1.00 13.32  ? 26  THR B N    1 
ATOM   1172 C CA   . THR B 1 26 ? 20.271 26.828 1.675   1.00 14.34  ? 26  THR B CA   1 
ATOM   1173 C C    . THR B 1 26 ? 20.064 25.939 2.911   1.00 11.83  ? 26  THR B C    1 
ATOM   1174 O O    . THR B 1 26 ? 21.011 25.390 3.427   1.00 13.24  ? 26  THR B O    1 
ATOM   1175 C CB   . THR B 1 26 ? 20.844 28.223 2.058   1.00 9.38   ? 26  THR B CB   1 
ATOM   1176 O OG1  . THR B 1 26 ? 19.849 28.856 2.851   1.00 12.38  ? 26  THR B OG1  1 
ATOM   1177 C CG2  . THR B 1 26 ? 21.212 29.078 0.819   1.00 9.31   ? 26  THR B CG2  1 
ATOM   1178 H H    . THR B 1 26 ? 18.513 27.832 0.996   1.00 0.00   ? 26  THR B H    1 
ATOM   1179 H HG1  . THR B 1 26 ? 20.325 29.251 3.616   1.00 0.00   ? 26  THR B HG1  1 
ATOM   1180 N N    . GLY B 1 27 ? 18.872 25.724 3.380   1.00 10.72  ? 27  GLY B N    1 
ATOM   1181 C CA   . GLY B 1 27 ? 18.608 24.869 4.477   1.00 11.26  ? 27  GLY B CA   1 
ATOM   1182 C C    . GLY B 1 27 ? 18.372 23.418 3.996   1.00 15.20  ? 27  GLY B C    1 
ATOM   1183 O O    . GLY B 1 27 ? 18.106 22.583 4.849   1.00 17.20  ? 27  GLY B O    1 
ATOM   1184 H H    . GLY B 1 27 ? 18.114 26.171 2.957   1.00 0.00   ? 27  GLY B H    1 
ATOM   1185 N N    . ALA B 1 28 ? 18.469 23.027 2.732   1.00 12.82  ? 28  ALA B N    1 
ATOM   1186 C CA   . ALA B 1 28 ? 18.397 21.646 2.359   1.00 12.95  ? 28  ALA B CA   1 
ATOM   1187 C C    . ALA B 1 28 ? 19.798 21.139 2.007   1.00 13.21  ? 28  ALA B C    1 
ATOM   1188 O O    . ALA B 1 28 ? 20.533 21.667 1.146   1.00 12.27  ? 28  ALA B O    1 
ATOM   1189 C CB   . ALA B 1 28 ? 17.490 21.572 1.204   1.00 8.55   ? 28  ALA B CB   1 
ATOM   1190 H H    . ALA B 1 28 ? 18.569 23.681 2.010   1.00 0.00   ? 28  ALA B H    1 
ATOM   1191 N N    . ASP B 1 29 ? 20.298 20.091 2.661   1.00 12.54  ? 29  ASP B N    1 
ATOM   1192 C CA   . ASP B 1 29 ? 21.637 19.570 2.306   1.00 14.40  ? 29  ASP B CA   1 
ATOM   1193 C C    . ASP B 1 29 ? 21.627 18.983 0.912   1.00 12.88  ? 29  ASP B C    1 
ATOM   1194 O O    . ASP B 1 29 ? 22.601 19.138 0.186   1.00 16.32  ? 29  ASP B O    1 
ATOM   1195 C CB   . ASP B 1 29 ? 22.091 18.468 3.258   1.00 17.69  ? 29  ASP B CB   1 
ATOM   1196 C CG   . ASP B 1 29 ? 21.952 18.856 4.737   1.00 22.57  ? 29  ASP B CG   1 
ATOM   1197 O OD1  . ASP B 1 29 ? 22.532 19.837 5.175   1.00 19.54  ? 29  ASP B OD1  1 
ATOM   1198 O OD2  . ASP B 1 29 ? 21.235 18.175 5.503   1.00 26.94  ? 29  ASP B OD2  1 
ATOM   1199 H H    . ASP B 1 29 ? 19.773 19.713 3.399   1.00 0.00   ? 29  ASP B H    1 
ATOM   1200 N N    . ASP B 1 30 ? 20.523 18.389 0.459   1.00 10.37  ? 30  ASP B N    1 
ATOM   1201 C CA   . ASP B 1 30 ? 20.489 17.773 -0.846  1.00 11.39  ? 30  ASP B CA   1 
ATOM   1202 C C    . ASP B 1 30 ? 19.376 18.295 -1.720  1.00 9.67   ? 30  ASP B C    1 
ATOM   1203 O O    . ASP B 1 30 ? 18.526 18.996 -1.236  1.00 13.69  ? 30  ASP B O    1 
ATOM   1204 C CB   . ASP B 1 30 ? 20.300 16.275 -0.731  1.00 18.34  ? 30  ASP B CB   1 
ATOM   1205 C CG   . ASP B 1 30 ? 21.417 15.663 0.086   1.00 23.91  ? 30  ASP B CG   1 
ATOM   1206 O OD1  . ASP B 1 30 ? 22.592 15.822 -0.269  1.00 26.94  ? 30  ASP B OD1  1 
ATOM   1207 O OD2  . ASP B 1 30 ? 21.079 15.072 1.106   1.00 23.65  ? 30  ASP B OD2  1 
ATOM   1208 H H    . ASP B 1 30 ? 19.645 18.533 0.864   1.00 0.00   ? 30  ASP B H    1 
ATOM   1209 N N    . THR B 1 31 ? 19.323 17.932 -2.985  1.00 11.85  ? 31  THR B N    1 
ATOM   1210 C CA   . THR B 1 31 ? 18.348 18.404 -3.915  1.00 12.36  ? 31  THR B CA   1 
ATOM   1211 C C    . THR B 1 31 ? 17.243 17.387 -3.971  1.00 15.57  ? 31  THR B C    1 
ATOM   1212 O O    . THR B 1 31 ? 17.586 16.229 -4.190  1.00 12.11  ? 31  THR B O    1 
ATOM   1213 C CB   . THR B 1 31 ? 19.043 18.552 -5.229  1.00 11.27  ? 31  THR B CB   1 
ATOM   1214 O OG1  . THR B 1 31 ? 19.815 19.742 -5.113  1.00 14.11  ? 31  THR B OG1  1 
ATOM   1215 C CG2  . THR B 1 31 ? 18.103 18.728 -6.382  1.00 13.22  ? 31  THR B CG2  1 
ATOM   1216 H H    . THR B 1 31 ? 19.898 17.214 -3.297  1.00 0.00   ? 31  THR B H    1 
ATOM   1217 H HG1  . THR B 1 31 ? 20.520 19.552 -4.490  1.00 0.00   ? 31  THR B HG1  1 
ATOM   1218 N N    . VAL B 1 32 ? 15.967 17.811 -3.819  1.00 13.78  ? 32  VAL B N    1 
ATOM   1219 C CA   . VAL B 1 32 ? 14.875 16.865 -3.780  1.00 15.88  ? 32  VAL B CA   1 
ATOM   1220 C C    . VAL B 1 32 ? 13.840 17.210 -4.780  1.00 16.69  ? 32  VAL B C    1 
ATOM   1221 O O    . VAL B 1 32 ? 13.295 18.302 -4.687  1.00 17.22  ? 32  VAL B O    1 
ATOM   1222 C CB   . VAL B 1 32 ? 14.153 16.802 -2.442  1.00 19.18  ? 32  VAL B CB   1 
ATOM   1223 C CG1  . VAL B 1 32 ? 13.523 15.392 -2.360  1.00 21.88  ? 32  VAL B CG1  1 
ATOM   1224 C CG2  . VAL B 1 32 ? 15.051 17.029 -1.276  1.00 23.64  ? 32  VAL B CG2  1 
ATOM   1225 H H    . VAL B 1 32 ? 15.782 18.760 -3.737  1.00 0.00   ? 32  VAL B H    1 
ATOM   1226 N N    . LEU B 1 33 ? 13.443 16.355 -5.674  1.00 15.70  ? 33  LEU B N    1 
ATOM   1227 C CA   . LEU B 1 33 ? 12.440 16.685 -6.659  1.00 17.68  ? 33  LEU B CA   1 
ATOM   1228 C C    . LEU B 1 33 ? 11.212 15.834 -6.410  1.00 19.37  ? 33  LEU B C    1 
ATOM   1229 O O    . LEU B 1 33 ? 11.300 14.729 -5.863  1.00 16.07  ? 33  LEU B O    1 
ATOM   1230 C CB   . LEU B 1 33 ? 13.004 16.393 -8.024  1.00 19.86  ? 33  LEU B CB   1 
ATOM   1231 C CG   . LEU B 1 33 ? 14.311 17.049 -8.413  1.00 26.13  ? 33  LEU B CG   1 
ATOM   1232 C CD1  . LEU B 1 33 ? 14.676 16.641 -9.797  1.00 28.69  ? 33  LEU B CD1  1 
ATOM   1233 C CD2  . LEU B 1 33 ? 14.146 18.558 -8.487  1.00 29.49  ? 33  LEU B CD2  1 
ATOM   1234 H H    . LEU B 1 33 ? 13.730 15.432 -5.635  1.00 0.00   ? 33  LEU B H    1 
ATOM   1235 N N    . GLU B 1 34 ? 10.073 16.397 -6.790  1.00 18.62  ? 34  GLU B N    1 
ATOM   1236 C CA   . GLU B 1 34 ? 8.818  15.682 -6.845  1.00 17.48  ? 34  GLU B CA   1 
ATOM   1237 C C    . GLU B 1 34 ? 8.987  14.455 -7.680  1.00 20.08  ? 34  GLU B C    1 
ATOM   1238 O O    . GLU B 1 34 ? 9.864  14.358 -8.522  1.00 21.53  ? 34  GLU B O    1 
ATOM   1239 C CB   . GLU B 1 34 ? 7.723  16.436 -7.534  1.00 18.53  ? 34  GLU B CB   1 
ATOM   1240 C CG   . GLU B 1 34 ? 7.548  17.730 -6.825  1.00 30.55  ? 34  GLU B CG   1 
ATOM   1241 C CD   . GLU B 1 34 ? 6.519  18.592 -7.510  1.00 34.75  ? 34  GLU B CD   1 
ATOM   1242 O OE1  . GLU B 1 34 ? 5.424  18.100 -7.707  1.00 43.38  ? 34  GLU B OE1  1 
ATOM   1243 O OE2  . GLU B 1 34 ? 6.778  19.730 -7.873  1.00 38.19  ? 34  GLU B OE2  1 
ATOM   1244 H H    . GLU B 1 34 ? 10.129 17.303 -7.143  1.00 0.00   ? 34  GLU B H    1 
ATOM   1245 N N    . GLU B 1 35 ? 8.099  13.521 -7.473  1.00 21.03  ? 35  GLU B N    1 
ATOM   1246 C CA   . GLU B 1 35 ? 8.112  12.265 -8.157  1.00 23.20  ? 35  GLU B CA   1 
ATOM   1247 C C    . GLU B 1 35 ? 8.304  12.423 -9.638  1.00 24.06  ? 35  GLU B C    1 
ATOM   1248 O O    . GLU B 1 35 ? 7.502  13.129 -10.236 1.00 28.20  ? 35  GLU B O    1 
ATOM   1249 C CB   . GLU B 1 35 ? 6.788  11.544 -7.801  1.00 28.59  ? 35  GLU B CB   1 
ATOM   1250 C CG   . GLU B 1 35 ? 6.560  10.135 -8.360  1.00 36.79  ? 35  GLU B CG   1 
ATOM   1251 C CD   . GLU B 1 35 ? 7.722  9.213  -8.030  1.00 39.91  ? 35  GLU B CD   1 
ATOM   1252 O OE1  . GLU B 1 35 ? 8.146  9.237  -6.864  1.00 37.72  ? 35  GLU B OE1  1 
ATOM   1253 O OE2  . GLU B 1 35 ? 8.203  8.531  -8.948  1.00 42.47  ? 35  GLU B OE2  1 
ATOM   1254 H H    . GLU B 1 35 ? 7.454  13.667 -6.750  1.00 0.00   ? 35  GLU B H    1 
ATOM   1255 N N    . MET B 1 36 ? 9.376  11.900 -10.229 1.00 25.32  ? 36  MET B N    1 
ATOM   1256 C CA   . MET B 1 36 ? 9.524  11.874 -11.679 1.00 30.02  ? 36  MET B CA   1 
ATOM   1257 C C    . MET B 1 36 ? 10.315 10.644 -12.162 1.00 33.99  ? 36  MET B C    1 
ATOM   1258 O O    . MET B 1 36 ? 10.859 9.869  -11.354 1.00 34.45  ? 36  MET B O    1 
ATOM   1259 C CB   . MET B 1 36 ? 10.220 13.145 -12.197 1.00 27.39  ? 36  MET B CB   1 
ATOM   1260 C CG   . MET B 1 36 ? 11.664 13.250 -11.874 1.00 26.93  ? 36  MET B CG   1 
ATOM   1261 S SD   . MET B 1 36 ? 12.074 14.917 -12.313 1.00 27.98  ? 36  MET B SD   1 
ATOM   1262 C CE   . MET B 1 36 ? 12.363 14.586 -14.037 1.00 29.05  ? 36  MET B CE   1 
ATOM   1263 H H    . MET B 1 36 ? 10.099 11.520 -9.706  1.00 0.00   ? 36  MET B H    1 
ATOM   1264 N N    . ASN B 1 37 ? 10.371 10.402 -13.479 1.00 39.65  ? 37  ASN B N    1 
ATOM   1265 C CA   . ASN B 1 37 ? 11.124 9.253  -13.954 1.00 44.74  ? 37  ASN B CA   1 
ATOM   1266 C C    . ASN B 1 37 ? 12.429 9.818  -14.381 1.00 40.65  ? 37  ASN B C    1 
ATOM   1267 O O    . ASN B 1 37 ? 12.539 10.756 -15.176 1.00 39.91  ? 37  ASN B O    1 
ATOM   1268 C CB   . ASN B 1 37 ? 10.523 8.523  -15.169 1.00 56.44  ? 37  ASN B CB   1 
ATOM   1269 C CG   . ASN B 1 37 ? 9.930  7.126  -14.836 1.00 69.79  ? 37  ASN B CG   1 
ATOM   1270 O OD1  . ASN B 1 37 ? 8.698  6.987  -14.778 1.00 75.76  ? 37  ASN B OD1  1 
ATOM   1271 N ND2  . ASN B 1 37 ? 10.651 6.006  -14.615 1.00 74.95  ? 37  ASN B ND2  1 
ATOM   1272 H H    . ASN B 1 37 ? 9.944  11.009 -14.125 1.00 0.00   ? 37  ASN B H    1 
ATOM   1273 H HD21 . ASN B 1 37 ? 10.128 5.193  -14.456 1.00 0.00   ? 37  ASN B HD21 1 
ATOM   1274 H HD22 . ASN B 1 37 ? 11.630 6.042  -14.646 1.00 0.00   ? 37  ASN B HD22 1 
ATOM   1275 N N    . LEU B 1 38 ? 13.377 9.258  -13.639 1.00 37.13  ? 38  LEU B N    1 
ATOM   1276 C CA   . LEU B 1 38 ? 14.754 9.545  -13.890 1.00 34.29  ? 38  LEU B CA   1 
ATOM   1277 C C    . LEU B 1 38 ? 15.494 8.291  -14.382 1.00 36.20  ? 38  LEU B C    1 
ATOM   1278 O O    . LEU B 1 38 ? 14.985 7.158  -14.303 1.00 36.99  ? 38  LEU B O    1 
ATOM   1279 C CB   . LEU B 1 38 ? 15.346 10.144 -12.595 1.00 29.62  ? 38  LEU B CB   1 
ATOM   1280 C CG   . LEU B 1 38 ? 15.103 11.662 -12.392 1.00 27.46  ? 38  LEU B CG   1 
ATOM   1281 C CD1  . LEU B 1 38 ? 16.052 12.204 -11.359 1.00 25.56  ? 38  LEU B CD1  1 
ATOM   1282 C CD2  . LEU B 1 38 ? 15.240 12.373 -13.729 1.00 25.28  ? 38  LEU B CD2  1 
ATOM   1283 H H    . LEU B 1 38 ? 13.160 8.550  -13.002 1.00 0.00   ? 38  LEU B H    1 
ATOM   1284 N N    . PRO B 1 39 ? 16.660 8.440  -15.024 1.00 35.46  ? 39  PRO B N    1 
ATOM   1285 C CA   . PRO B 1 39 ? 17.406 7.333  -15.576 1.00 35.99  ? 39  PRO B CA   1 
ATOM   1286 C C    . PRO B 1 39 ? 18.309 6.557  -14.600 1.00 33.36  ? 39  PRO B C    1 
ATOM   1287 O O    . PRO B 1 39 ? 18.939 7.201  -13.713 1.00 33.22  ? 39  PRO B O    1 
ATOM   1288 C CB   . PRO B 1 39 ? 18.145 8.032  -16.707 1.00 36.46  ? 39  PRO B CB   1 
ATOM   1289 C CG   . PRO B 1 39 ? 18.650 9.303  -16.023 1.00 35.99  ? 39  PRO B CG   1 
ATOM   1290 C CD   . PRO B 1 39 ? 17.359 9.698  -15.327 1.00 38.38  ? 39  PRO B CD   1 
ATOM   1291 N N    . GLY B 1 40 ? 18.421 5.218  -14.837 1.00 31.70  ? 40  GLY B N    1 
ATOM   1292 C CA   . GLY B 1 40 ? 19.432 4.440  -14.149 1.00 25.71  ? 40  GLY B CA   1 
ATOM   1293 C C    . GLY B 1 40 ? 18.889 3.880  -12.866 1.00 23.58  ? 40  GLY B C    1 
ATOM   1294 O O    . GLY B 1 40 ? 17.666 3.737  -12.705 1.00 25.10  ? 40  GLY B O    1 
ATOM   1295 H H    . GLY B 1 40 ? 17.700 4.757  -15.306 1.00 0.00   ? 40  GLY B H    1 
ATOM   1296 N N    . ARG B 1 41 ? 19.879 3.482  -12.052 1.00 22.92  ? 41  ARG B N    1 
ATOM   1297 C CA   . ARG B 1 41 ? 19.591 2.794  -10.807 1.00 21.38  ? 41  ARG B CA   1 
ATOM   1298 C C    . ARG B 1 41 ? 19.543 3.800  -9.690  1.00 21.66  ? 41  ARG B C    1 
ATOM   1299 O O    . ARG B 1 41 ? 20.328 4.707  -9.761  1.00 23.57  ? 41  ARG B O    1 
ATOM   1300 C CB   . ARG B 1 41 ? 20.678 1.742  -10.471 1.00 20.60  ? 41  ARG B CB   1 
ATOM   1301 C CG   . ARG B 1 41 ? 20.583 0.529  -11.378 1.00 20.07  ? 41  ARG B CG   1 
ATOM   1302 C CD   . ARG B 1 41 ? 21.603 -0.520 -11.031 1.00 21.55  ? 41  ARG B CD   1 
ATOM   1303 N NE   . ARG B 1 41 ? 21.396 -1.142 -9.714  1.00 23.67  ? 41  ARG B NE   1 
ATOM   1304 C CZ   . ARG B 1 41 ? 20.493 -2.115 -9.387  1.00 19.90  ? 41  ARG B CZ   1 
ATOM   1305 N NH1  . ARG B 1 41 ? 19.602 -2.692 -10.206 1.00 16.70  ? 41  ARG B NH1  1 
ATOM   1306 N NH2  . ARG B 1 41 ? 20.469 -2.543 -8.140  1.00 19.69  ? 41  ARG B NH2  1 
ATOM   1307 H H    . ARG B 1 41 ? 20.796 3.760  -12.220 1.00 0.00   ? 41  ARG B H    1 
ATOM   1308 H HE   . ARG B 1 41 ? 21.979 -0.843 -8.990  1.00 0.00   ? 41  ARG B HE   1 
ATOM   1309 H HH11 . ARG B 1 41 ? 19.563 -2.374 -11.150 1.00 0.00   ? 41  ARG B HH11 1 
ATOM   1310 H HH12 . ARG B 1 41 ? 18.960 -3.380 -9.874  1.00 0.00   ? 41  ARG B HH12 1 
ATOM   1311 H HH21 . ARG B 1 41 ? 21.112 -2.164 -7.475  1.00 0.00   ? 41  ARG B HH21 1 
ATOM   1312 H HH22 . ARG B 1 41 ? 19.827 -3.265 -7.866  1.00 0.00   ? 41  ARG B HH22 1 
ATOM   1313 N N    . TRP B 1 42 ? 18.732 3.608  -8.674  1.00 20.35  ? 42  TRP B N    1 
ATOM   1314 C CA   . TRP B 1 42 ? 18.683 4.427  -7.513  1.00 17.61  ? 42  TRP B CA   1 
ATOM   1315 C C    . TRP B 1 42 ? 19.077 3.679  -6.251  1.00 20.88  ? 42  TRP B C    1 
ATOM   1316 O O    . TRP B 1 42 ? 19.137 2.436  -6.192  1.00 18.12  ? 42  TRP B O    1 
ATOM   1317 C CB   . TRP B 1 42 ? 17.334 4.974  -7.421  1.00 12.92  ? 42  TRP B CB   1 
ATOM   1318 C CG   . TRP B 1 42 ? 16.222 3.980  -7.281  1.00 14.56  ? 42  TRP B CG   1 
ATOM   1319 C CD1  . TRP B 1 42 ? 15.591 3.406  -8.351  1.00 16.81  ? 42  TRP B CD1  1 
ATOM   1320 C CD2  . TRP B 1 42 ? 15.706 3.584  -6.097  1.00 16.32  ? 42  TRP B CD2  1 
ATOM   1321 N NE1  . TRP B 1 42 ? 14.654 2.634  -7.841  1.00 14.36  ? 42  TRP B NE1  1 
ATOM   1322 C CE2  . TRP B 1 42 ? 14.693 2.699  -6.510  1.00 16.27  ? 42  TRP B CE2  1 
ATOM   1323 C CE3  . TRP B 1 42 ? 15.958 3.850  -4.755  1.00 13.98  ? 42  TRP B CE3  1 
ATOM   1324 C CZ2  . TRP B 1 42 ? 13.898 2.041  -5.585  1.00 13.74  ? 42  TRP B CZ2  1 
ATOM   1325 C CZ3  . TRP B 1 42 ? 15.142 3.178  -3.850  1.00 17.13  ? 42  TRP B CZ3  1 
ATOM   1326 C CH2  . TRP B 1 42 ? 14.121 2.280  -4.253  1.00 16.12  ? 42  TRP B CH2  1 
ATOM   1327 H H    . TRP B 1 42 ? 18.176 2.824  -8.634  1.00 0.00   ? 42  TRP B H    1 
ATOM   1328 H HE1  . TRP B 1 42 ? 14.022 2.075  -8.363  1.00 0.00   ? 42  TRP B HE1  1 
ATOM   1329 N N    . LYS B 1 43 ? 19.380 4.469  -5.238  1.00 20.92  ? 43  LYS B N    1 
ATOM   1330 C CA   . LYS B 1 43 ? 19.778 3.982  -3.918  1.00 23.20  ? 43  LYS B CA   1 
ATOM   1331 C C    . LYS B 1 43 ? 18.836 4.581  -2.881  1.00 22.19  ? 43  LYS B C    1 
ATOM   1332 O O    . LYS B 1 43 ? 18.142 5.538  -3.210  1.00 22.78  ? 43  LYS B O    1 
ATOM   1333 C CB   . LYS B 1 43 ? 21.191 4.380  -3.590  1.00 28.97  ? 43  LYS B CB   1 
ATOM   1334 C CG   . LYS B 1 43 ? 22.283 3.429  -4.051  1.00 40.22  ? 43  LYS B CG   1 
ATOM   1335 C CD   . LYS B 1 43 ? 23.459 4.381  -3.877  1.00 50.65  ? 43  LYS B CD   1 
ATOM   1336 C CE   . LYS B 1 43 ? 24.901 3.863  -3.809  1.00 58.44  ? 43  LYS B CE   1 
ATOM   1337 N NZ   . LYS B 1 43 ? 25.775 5.028  -3.647  1.00 62.45  ? 43  LYS B NZ   1 
ATOM   1338 H H    . LYS B 1 43 ? 19.329 5.432  -5.388  1.00 0.00   ? 43  LYS B H    1 
ATOM   1339 H HZ1  . LYS B 1 43 ? 25.491 5.524  -2.780  1.00 0.00   ? 43  LYS B HZ1  1 
ATOM   1340 H HZ2  . LYS B 1 43 ? 26.763 4.716  -3.571  1.00 0.00   ? 43  LYS B HZ2  1 
ATOM   1341 H HZ3  . LYS B 1 43 ? 25.669 5.667  -4.462  1.00 0.00   ? 43  LYS B HZ3  1 
ATOM   1342 N N    . PRO B 1 44 ? 18.565 3.960  -1.719  1.00 23.74  ? 44  PRO B N    1 
ATOM   1343 C CA   . PRO B 1 44 ? 17.532 4.419  -0.825  1.00 20.41  ? 44  PRO B CA   1 
ATOM   1344 C C    . PRO B 1 44 ? 18.096 5.560  0.026   1.00 22.87  ? 44  PRO B C    1 
ATOM   1345 O O    . PRO B 1 44 ? 19.301 5.526  0.343   1.00 21.73  ? 44  PRO B O    1 
ATOM   1346 C CB   . PRO B 1 44 ? 17.190 3.202  -0.013  1.00 20.94  ? 44  PRO B CB   1 
ATOM   1347 C CG   . PRO B 1 44 ? 18.474 2.418  0.073   1.00 21.71  ? 44  PRO B CG   1 
ATOM   1348 C CD   . PRO B 1 44 ? 19.171 2.661  -1.265  1.00 23.28  ? 44  PRO B CD   1 
ATOM   1349 N N    . LYS B 1 45 ? 17.281 6.578  0.415   1.00 23.23  ? 45  LYS B N    1 
ATOM   1350 C CA   . LYS B 1 45 ? 17.739 7.549  1.386   1.00 22.91  ? 45  LYS B CA   1 
ATOM   1351 C C    . LYS B 1 45 ? 16.533 7.996  2.186   1.00 20.28  ? 45  LYS B C    1 
ATOM   1352 O O    . LYS B 1 45 ? 15.415 7.953  1.729   1.00 21.46  ? 45  LYS B O    1 
ATOM   1353 C CB   . LYS B 1 45 ? 18.401 8.717  0.665   1.00 28.80  ? 45  LYS B CB   1 
ATOM   1354 C CG   . LYS B 1 45 ? 19.377 9.372  1.641   1.00 34.28  ? 45  LYS B CG   1 
ATOM   1355 C CD   . LYS B 1 45 ? 19.955 10.450 0.808   1.00 39.15  ? 45  LYS B CD   1 
ATOM   1356 C CE   . LYS B 1 45 ? 21.291 10.888 1.300   1.00 42.04  ? 45  LYS B CE   1 
ATOM   1357 N NZ   . LYS B 1 45 ? 21.196 11.544 2.572   1.00 43.41  ? 45  LYS B NZ   1 
ATOM   1358 H H    . LYS B 1 45 ? 16.369 6.660  0.076   1.00 0.00   ? 45  LYS B H    1 
ATOM   1359 H HZ1  . LYS B 1 45 ? 20.535 12.342 2.477   1.00 0.00   ? 45  LYS B HZ1  1 
ATOM   1360 H HZ2  . LYS B 1 45 ? 20.865 10.875 3.297   1.00 0.00   ? 45  LYS B HZ2  1 
ATOM   1361 H HZ3  . LYS B 1 45 ? 22.145 11.896 2.806   1.00 0.00   ? 45  LYS B HZ3  1 
ATOM   1362 N N    . MET B 1 46 ? 16.743 8.377  3.422   1.00 22.28  ? 46  MET B N    1 
ATOM   1363 C CA   . MET B 1 46 ? 15.736 8.832  4.358   1.00 25.84  ? 46  MET B CA   1 
ATOM   1364 C C    . MET B 1 46 ? 16.143 10.293 4.527   1.00 26.11  ? 46  MET B C    1 
ATOM   1365 O O    . MET B 1 46 ? 17.354 10.501 4.756   1.00 26.90  ? 46  MET B O    1 
ATOM   1366 C CB   . MET B 1 46 ? 15.940 8.253  5.681   1.00 33.15  ? 46  MET B CB   1 
ATOM   1367 C CG   . MET B 1 46 ? 14.722 8.309  6.493   1.00 42.80  ? 46  MET B CG   1 
ATOM   1368 S SD   . MET B 1 46 ? 13.847 6.892  5.826   1.00 49.10  ? 46  MET B SD   1 
ATOM   1369 C CE   . MET B 1 46 ? 14.773 5.640  6.667   1.00 46.32  ? 46  MET B CE   1 
ATOM   1370 H H    . MET B 1 46 ? 17.667 8.472  3.720   1.00 0.00   ? 46  MET B H    1 
ATOM   1371 N N    . ILE B 1 47 ? 15.280 11.308 4.392   1.00 23.40  ? 47  ILE B N    1 
ATOM   1372 C CA   . ILE B 1 47 ? 15.708 12.677 4.648   1.00 22.58  ? 47  ILE B CA   1 
ATOM   1373 C C    . ILE B 1 47 ? 14.758 13.228 5.662   1.00 18.78  ? 47  ILE B C    1 
ATOM   1374 O O    . ILE B 1 47 ? 13.583 12.892 5.660   1.00 18.97  ? 47  ILE B O    1 
ATOM   1375 C CB   . ILE B 1 47 ? 15.697 13.593 3.374   1.00 22.26  ? 47  ILE B CB   1 
ATOM   1376 C CG1  . ILE B 1 47 ? 14.417 13.581 2.682   1.00 18.76  ? 47  ILE B CG1  1 
ATOM   1377 C CG2  . ILE B 1 47 ? 16.699 13.074 2.370   1.00 23.58  ? 47  ILE B CG2  1 
ATOM   1378 C CD1  . ILE B 1 47 ? 14.300 14.548 1.503   1.00 24.66  ? 47  ILE B CD1  1 
ATOM   1379 H H    . ILE B 1 47 ? 14.336 11.127 4.213   1.00 0.00   ? 47  ILE B H    1 
ATOM   1380 N N    . GLY B 1 48 ? 15.218 14.090 6.539   1.00 17.17  ? 48  GLY B N    1 
ATOM   1381 C CA   . GLY B 1 48 ? 14.318 14.626 7.538   1.00 16.02  ? 48  GLY B CA   1 
ATOM   1382 C C    . GLY B 1 48 ? 14.092 16.087 7.300   1.00 14.33  ? 48  GLY B C    1 
ATOM   1383 O O    . GLY B 1 48 ? 15.000 16.769 6.888   1.00 17.35  ? 48  GLY B O    1 
ATOM   1384 H H    . GLY B 1 48 ? 16.124 14.432 6.492   1.00 0.00   ? 48  GLY B H    1 
ATOM   1385 N N    . GLY B 1 49 ? 12.871 16.475 7.523   1.00 16.78  ? 49  GLY B N    1 
ATOM   1386 C CA   . GLY B 1 49 ? 12.405 17.832 7.364   1.00 17.14  ? 49  GLY B CA   1 
ATOM   1387 C C    . GLY B 1 49 ? 11.764 18.200 8.651   1.00 17.01  ? 49  GLY B C    1 
ATOM   1388 O O    . GLY B 1 49 ? 11.899 17.530 9.659   1.00 17.24  ? 49  GLY B O    1 
ATOM   1389 H H    . GLY B 1 49 ? 12.213 15.825 7.803   1.00 0.00   ? 49  GLY B H    1 
ATOM   1390 N N    . ILE B 1 50 ? 10.948 19.205 8.574   1.00 17.70  ? 50  ILE B N    1 
ATOM   1391 C CA   . ILE B 1 50 ? 10.461 19.824 9.767   1.00 18.35  ? 50  ILE B CA   1 
ATOM   1392 C C    . ILE B 1 50 ? 9.500  18.925 10.490  1.00 21.36  ? 50  ILE B C    1 
ATOM   1393 O O    . ILE B 1 50 ? 9.444  18.908 11.734  1.00 19.79  ? 50  ILE B O    1 
ATOM   1394 C CB   . ILE B 1 50 ? 9.866  21.239 9.334   1.00 16.14  ? 50  ILE B CB   1 
ATOM   1395 C CG1  . ILE B 1 50 ? 9.610  22.082 10.580  1.00 19.67  ? 50  ILE B CG1  1 
ATOM   1396 C CG2  . ILE B 1 50 ? 8.506  21.194 8.682   1.00 18.33  ? 50  ILE B CG2  1 
ATOM   1397 C CD1  . ILE B 1 50 ? 10.858 22.317 11.427  1.00 21.86  ? 50  ILE B CD1  1 
ATOM   1398 H H    . ILE B 1 50 ? 10.777 19.601 7.692   1.00 0.00   ? 50  ILE B H    1 
ATOM   1399 N N    . GLY B 1 51 ? 8.748  18.170 9.701   1.00 19.85  ? 51  GLY B N    1 
ATOM   1400 C CA   . GLY B 1 51 ? 7.773  17.320 10.343  1.00 21.31  ? 51  GLY B CA   1 
ATOM   1401 C C    . GLY B 1 51 ? 8.276  15.908 10.556  1.00 22.08  ? 51  GLY B C    1 
ATOM   1402 O O    . GLY B 1 51 ? 7.574  15.129 11.162  1.00 24.11  ? 51  GLY B O    1 
ATOM   1403 H H    . GLY B 1 51 ? 8.853  18.182 8.726   1.00 0.00   ? 51  GLY B H    1 
ATOM   1404 N N    . GLY B 1 52 ? 9.441  15.477 10.149  1.00 23.89  ? 52  GLY B N    1 
ATOM   1405 C CA   . GLY B 1 52 ? 9.787  14.085 10.304  1.00 26.11  ? 52  GLY B CA   1 
ATOM   1406 C C    . GLY B 1 52 ? 10.565 13.665 9.070   1.00 27.77  ? 52  GLY B C    1 
ATOM   1407 O O    . GLY B 1 52 ? 11.165 14.486 8.374   1.00 24.25  ? 52  GLY B O    1 
ATOM   1408 H H    . GLY B 1 52 ? 10.057 16.107 9.718   1.00 0.00   ? 52  GLY B H    1 
ATOM   1409 N N    . PHE B 1 53 ? 10.570 12.380 8.720   1.00 29.17  ? 53  PHE B N    1 
ATOM   1410 C CA   . PHE B 1 53 ? 11.430 11.801 7.660   1.00 28.44  ? 53  PHE B CA   1 
ATOM   1411 C C    . PHE B 1 53 ? 10.602 11.218 6.518   1.00 27.23  ? 53  PHE B C    1 
ATOM   1412 O O    . PHE B 1 53 ? 9.454  10.816 6.712   1.00 26.28  ? 53  PHE B O    1 
ATOM   1413 C CB   . PHE B 1 53 ? 12.330 10.670 8.207   1.00 30.33  ? 53  PHE B CB   1 
ATOM   1414 C CG   . PHE B 1 53 ? 13.346 11.116 9.234   1.00 32.98  ? 53  PHE B CG   1 
ATOM   1415 C CD1  . PHE B 1 53 ? 12.879 11.462 10.508  1.00 37.97  ? 53  PHE B CD1  1 
ATOM   1416 C CD2  . PHE B 1 53 ? 14.702 11.237 8.917   1.00 35.75  ? 53  PHE B CD2  1 
ATOM   1417 C CE1  . PHE B 1 53 ? 13.756 11.941 11.477  1.00 36.03  ? 53  PHE B CE1  1 
ATOM   1418 C CE2  . PHE B 1 53 ? 15.582 11.726 9.902   1.00 38.77  ? 53  PHE B CE2  1 
ATOM   1419 C CZ   . PHE B 1 53 ? 15.112 12.080 11.182  1.00 38.31  ? 53  PHE B CZ   1 
ATOM   1420 H H    . PHE B 1 53 ? 9.876  11.803 9.087   1.00 0.00   ? 53  PHE B H    1 
ATOM   1421 N N    . ILE B 1 54 ? 11.165 11.214 5.318   1.00 24.64  ? 54  ILE B N    1 
ATOM   1422 C CA   . ILE B 1 54 ? 10.579 10.585 4.172   1.00 22.95  ? 54  ILE B CA   1 
ATOM   1423 C C    . ILE B 1 54 ? 11.645 9.718  3.525   1.00 24.09  ? 54  ILE B C    1 
ATOM   1424 O O    . ILE B 1 54 ? 12.836 10.001 3.673   1.00 23.50  ? 54  ILE B O    1 
ATOM   1425 C CB   . ILE B 1 54 ? 10.084 11.565 3.089   1.00 23.25  ? 54  ILE B CB   1 
ATOM   1426 C CG1  . ILE B 1 54 ? 11.083 12.633 2.712   1.00 20.72  ? 54  ILE B CG1  1 
ATOM   1427 C CG2  . ILE B 1 54 ? 8.791  12.094 3.601   1.00 24.49  ? 54  ILE B CG2  1 
ATOM   1428 C CD1  . ILE B 1 54 ? 10.449 13.285 1.473   1.00 22.79  ? 54  ILE B CD1  1 
ATOM   1429 H H    . ILE B 1 54 ? 12.059 11.608 5.202   1.00 0.00   ? 54  ILE B H    1 
ATOM   1430 N N    . LYS B 1 55 ? 11.216 8.688  2.767   1.00 24.01  ? 55  LYS B N    1 
ATOM   1431 C CA   . LYS B 1 55 ? 12.137 7.817  2.061   1.00 23.83  ? 55  LYS B CA   1 
ATOM   1432 C C    . LYS B 1 55 ? 12.199 8.397  0.690   1.00 19.37  ? 55  LYS B C    1 
ATOM   1433 O O    . LYS B 1 55 ? 11.153 8.802  0.193   1.00 18.95  ? 55  LYS B O    1 
ATOM   1434 C CB   . LYS B 1 55 ? 11.635 6.405  1.901   1.00 28.04  ? 55  LYS B CB   1 
ATOM   1435 C CG   . LYS B 1 55 ? 11.902 5.622  3.149   1.00 40.65  ? 55  LYS B CG   1 
ATOM   1436 C CD   . LYS B 1 55 ? 12.242 4.160  2.788   1.00 56.86  ? 55  LYS B CD   1 
ATOM   1437 C CE   . LYS B 1 55 ? 13.632 3.538  3.263   1.00 61.55  ? 55  LYS B CE   1 
ATOM   1438 N NZ   . LYS B 1 55 ? 14.848 4.116  2.677   1.00 60.24  ? 55  LYS B NZ   1 
ATOM   1439 H H    . LYS B 1 55 ? 10.267 8.603  2.562   1.00 0.00   ? 55  LYS B H    1 
ATOM   1440 H HZ1  . LYS B 1 55 ? 14.820 4.026  1.639   1.00 0.00   ? 55  LYS B HZ1  1 
ATOM   1441 H HZ2  . LYS B 1 55 ? 14.957 5.114  2.945   1.00 0.00   ? 55  LYS B HZ2  1 
ATOM   1442 H HZ3  . LYS B 1 55 ? 15.660 3.569  3.031   1.00 0.00   ? 55  LYS B HZ3  1 
ATOM   1443 N N    . VAL B 1 56 ? 13.365 8.524  0.100   1.00 17.38  ? 56  VAL B N    1 
ATOM   1444 C CA   . VAL B 1 56 ? 13.475 9.045  -1.206  1.00 17.41  ? 56  VAL B CA   1 
ATOM   1445 C C    . VAL B 1 56 ? 14.426 8.115  -1.956  1.00 16.10  ? 56  VAL B C    1 
ATOM   1446 O O    . VAL B 1 56 ? 15.127 7.258  -1.388  1.00 15.02  ? 56  VAL B O    1 
ATOM   1447 C CB   . VAL B 1 56 ? 14.004 10.530 -1.128  1.00 14.36  ? 56  VAL B CB   1 
ATOM   1448 C CG1  . VAL B 1 56 ? 12.995 11.455 -0.504  1.00 11.36  ? 56  VAL B CG1  1 
ATOM   1449 C CG2  . VAL B 1 56 ? 15.281 10.551 -0.371  1.00 15.95  ? 56  VAL B CG2  1 
ATOM   1450 H H    . VAL B 1 56 ? 14.161 8.151  0.501   1.00 0.00   ? 56  VAL B H    1 
ATOM   1451 N N    . ARG B 1 57 ? 14.448 8.295  -3.271  1.00 13.53  ? 57  ARG B N    1 
ATOM   1452 C CA   . ARG B 1 57 ? 15.283 7.502  -4.135  1.00 14.25  ? 57  ARG B CA   1 
ATOM   1453 C C    . ARG B 1 57 ? 16.383 8.414  -4.598  1.00 14.67  ? 57  ARG B C    1 
ATOM   1454 O O    . ARG B 1 57 ? 16.102 9.465  -5.176  1.00 16.94  ? 57  ARG B O    1 
ATOM   1455 C CB   . ARG B 1 57 ? 14.504 7.022  -5.346  1.00 11.01  ? 57  ARG B CB   1 
ATOM   1456 C CG   . ARG B 1 57 ? 13.206 6.325  -4.921  1.00 15.78  ? 57  ARG B CG   1 
ATOM   1457 C CD   . ARG B 1 57 ? 12.414 5.634  -6.034  1.00 22.49  ? 57  ARG B CD   1 
ATOM   1458 N NE   . ARG B 1 57 ? 12.496 6.297  -7.325  1.00 25.62  ? 57  ARG B NE   1 
ATOM   1459 C CZ   . ARG B 1 57 ? 11.578 7.149  -7.827  1.00 31.07  ? 57  ARG B CZ   1 
ATOM   1460 N NH1  . ARG B 1 57 ? 10.482 7.461  -7.154  1.00 28.35  ? 57  ARG B NH1  1 
ATOM   1461 N NH2  . ARG B 1 57 ? 11.771 7.718  -9.044  1.00 32.66  ? 57  ARG B NH2  1 
ATOM   1462 H H    . ARG B 1 57 ? 13.902 8.993  -3.682  1.00 0.00   ? 57  ARG B H    1 
ATOM   1463 H HE   . ARG B 1 57 ? 13.317 6.146  -7.842  1.00 0.00   ? 57  ARG B HE   1 
ATOM   1464 H HH11 . ARG B 1 57 ? 10.333 7.120  -6.228  1.00 0.00   ? 57  ARG B HH11 1 
ATOM   1465 H HH12 . ARG B 1 57 ? 9.855  8.113  -7.569  1.00 0.00   ? 57  ARG B HH12 1 
ATOM   1466 H HH21 . ARG B 1 57 ? 12.590 7.477  -9.569  1.00 0.00   ? 57  ARG B HH21 1 
ATOM   1467 H HH22 . ARG B 1 57 ? 11.089 8.332  -9.445  1.00 0.00   ? 57  ARG B HH22 1 
ATOM   1468 N N    . GLN B 1 58 ? 17.618 8.010  -4.413  1.00 15.34  ? 58  GLN B N    1 
ATOM   1469 C CA   . GLN B 1 58 ? 18.764 8.727  -4.888  1.00 15.06  ? 58  GLN B CA   1 
ATOM   1470 C C    . GLN B 1 58 ? 19.272 8.378  -6.264  1.00 17.92  ? 58  GLN B C    1 
ATOM   1471 O O    . GLN B 1 58 ? 19.659 7.237  -6.508  1.00 21.05  ? 58  GLN B O    1 
ATOM   1472 C CB   . GLN B 1 58 ? 19.835 8.526  -3.867  1.00 12.47  ? 58  GLN B CB   1 
ATOM   1473 C CG   . GLN B 1 58 ? 21.028 9.268  -4.273  1.00 18.42  ? 58  GLN B CG   1 
ATOM   1474 C CD   . GLN B 1 58 ? 22.097 9.054  -3.261  1.00 22.26  ? 58  GLN B CD   1 
ATOM   1475 O OE1  . GLN B 1 58 ? 21.842 8.992  -2.077  1.00 29.25  ? 58  GLN B OE1  1 
ATOM   1476 N NE2  . GLN B 1 58 ? 23.352 9.005  -3.607  1.00 24.97  ? 58  GLN B NE2  1 
ATOM   1477 H H    . GLN B 1 58 ? 17.783 7.185  -3.927  1.00 0.00   ? 58  GLN B H    1 
ATOM   1478 H HE21 . GLN B 1 58 ? 23.963 8.873  -2.856  1.00 0.00   ? 58  GLN B HE21 1 
ATOM   1479 H HE22 . GLN B 1 58 ? 23.663 9.099  -4.521  1.00 0.00   ? 58  GLN B HE22 1 
ATOM   1480 N N    . TYR B 1 59 ? 19.364 9.312  -7.179  1.00 15.94  ? 59  TYR B N    1 
ATOM   1481 C CA   . TYR B 1 59 ? 19.962 9.108  -8.471  1.00 15.99  ? 59  TYR B CA   1 
ATOM   1482 C C    . TYR B 1 59 ? 21.249 9.928  -8.579  1.00 21.15  ? 59  TYR B C    1 
ATOM   1483 O O    . TYR B 1 59 ? 21.355 11.055 -8.050  1.00 21.01  ? 59  TYR B O    1 
ATOM   1484 C CB   . TYR B 1 59 ? 19.016 9.561  -9.506  1.00 15.95  ? 59  TYR B CB   1 
ATOM   1485 C CG   . TYR B 1 59 ? 17.740 8.782  -9.583  1.00 16.91  ? 59  TYR B CG   1 
ATOM   1486 C CD1  . TYR B 1 59 ? 16.662 9.077  -8.748  1.00 16.53  ? 59  TYR B CD1  1 
ATOM   1487 C CD2  . TYR B 1 59 ? 17.672 7.704  -10.471 1.00 15.62  ? 59  TYR B CD2  1 
ATOM   1488 C CE1  . TYR B 1 59 ? 15.486 8.342  -8.841  1.00 19.34  ? 59  TYR B CE1  1 
ATOM   1489 C CE2  . TYR B 1 59 ? 16.504 6.951  -10.567 1.00 15.37  ? 59  TYR B CE2  1 
ATOM   1490 C CZ   . TYR B 1 59 ? 15.424 7.273  -9.749  1.00 19.59  ? 59  TYR B CZ   1 
ATOM   1491 O OH   . TYR B 1 59 ? 14.273 6.529  -9.845  1.00 21.23  ? 59  TYR B OH   1 
ATOM   1492 H H    . TYR B 1 59 ? 18.986 10.191 -6.988  1.00 0.00   ? 59  TYR B H    1 
ATOM   1493 H HH   . TYR B 1 59 ? 13.679 6.829  -9.154  1.00 0.00   ? 59  TYR B HH   1 
ATOM   1494 N N    . ASP B 1 60 ? 22.320 9.453  -9.215  1.00 21.37  ? 60  ASP B N    1 
ATOM   1495 C CA   . ASP B 1 60 ? 23.541 10.251 -9.271  1.00 24.50  ? 60  ASP B CA   1 
ATOM   1496 C C    . ASP B 1 60 ? 23.890 10.771 -10.662 1.00 23.40  ? 60  ASP B C    1 
ATOM   1497 O O    . ASP B 1 60 ? 23.303 10.287 -11.599 1.00 20.74  ? 60  ASP B O    1 
ATOM   1498 C CB   . ASP B 1 60 ? 24.682 9.396  -8.696  1.00 29.28  ? 60  ASP B CB   1 
ATOM   1499 C CG   . ASP B 1 60 ? 24.577 8.965  -7.227  1.00 35.32  ? 60  ASP B CG   1 
ATOM   1500 O OD1  . ASP B 1 60 ? 24.002 9.678  -6.415  1.00 35.80  ? 60  ASP B OD1  1 
ATOM   1501 O OD2  . ASP B 1 60 ? 25.095 7.894  -6.902  1.00 43.42  ? 60  ASP B OD2  1 
ATOM   1502 H H    . ASP B 1 60 ? 22.341 8.557  -9.616  1.00 0.00   ? 60  ASP B H    1 
ATOM   1503 N N    . GLN B 1 61 ? 24.770 11.725 -10.896 1.00 23.91  ? 61  GLN B N    1 
ATOM   1504 C CA   . GLN B 1 61 ? 25.110 12.219 -12.219 1.00 25.89  ? 61  GLN B CA   1 
ATOM   1505 C C    . GLN B 1 61 ? 23.968 12.629 -13.102 1.00 22.72  ? 61  GLN B C    1 
ATOM   1506 O O    . GLN B 1 61 ? 23.966 12.344 -14.301 1.00 24.16  ? 61  GLN B O    1 
ATOM   1507 C CB   . GLN B 1 61 ? 25.954 11.209 -12.979 1.00 31.01  ? 61  GLN B CB   1 
ATOM   1508 C CG   . GLN B 1 61 ? 27.335 11.016 -12.402 1.00 45.26  ? 61  GLN B CG   1 
ATOM   1509 C CD   . GLN B 1 61 ? 28.168 12.228 -12.010 1.00 51.03  ? 61  GLN B CD   1 
ATOM   1510 O OE1  . GLN B 1 61 ? 27.883 12.785 -10.967 1.00 54.32  ? 61  GLN B OE1  1 
ATOM   1511 N NE2  . GLN B 1 61 ? 29.260 12.699 -12.589 1.00 54.65  ? 61  GLN B NE2  1 
ATOM   1512 H H    . GLN B 1 61 ? 25.118 12.211 -10.121 1.00 0.00   ? 61  GLN B H    1 
ATOM   1513 H HE21 . GLN B 1 61 ? 29.558 13.465 -12.097 1.00 0.00   ? 61  GLN B HE21 1 
ATOM   1514 H HE22 . GLN B 1 61 ? 29.734 12.359 -13.381 1.00 0.00   ? 61  GLN B HE22 1 
ATOM   1515 N N    . ILE B 1 62 ? 23.047 13.409 -12.509 1.00 21.55  ? 62  ILE B N    1 
ATOM   1516 C CA   . ILE B 1 62 ? 21.863 13.905 -13.201 1.00 20.33  ? 62  ILE B CA   1 
ATOM   1517 C C    . ILE B 1 62 ? 22.136 15.346 -13.604 1.00 19.57  ? 62  ILE B C    1 
ATOM   1518 O O    . ILE B 1 62 ? 22.622 16.126 -12.778 1.00 20.31  ? 62  ILE B O    1 
ATOM   1519 C CB   . ILE B 1 62 ? 20.619 13.811 -12.237 1.00 16.92  ? 62  ILE B CB   1 
ATOM   1520 C CG1  . ILE B 1 62 ? 20.332 12.310 -11.854 1.00 17.13  ? 62  ILE B CG1  1 
ATOM   1521 C CG2  . ILE B 1 62 ? 19.407 14.470 -12.884 1.00 13.82  ? 62  ILE B CG2  1 
ATOM   1522 C CD1  . ILE B 1 62 ? 19.897 11.349 -12.988 1.00 13.50  ? 62  ILE B CD1  1 
ATOM   1523 H H    . ILE B 1 62 ? 23.167 13.693 -11.571 1.00 0.00   ? 62  ILE B H    1 
ATOM   1524 N N    . LEU B 1 63 ? 21.904 15.727 -14.850 1.00 20.35  ? 63  LEU B N    1 
ATOM   1525 C CA   . LEU B 1 63 ? 21.949 17.134 -15.236 1.00 24.08  ? 63  LEU B CA   1 
ATOM   1526 C C    . LEU B 1 63 ? 20.599 17.865 -15.062 1.00 21.64  ? 63  LEU B C    1 
ATOM   1527 O O    . LEU B 1 63 ? 19.441 17.422 -15.287 1.00 20.35  ? 63  LEU B O    1 
ATOM   1528 C CB   . LEU B 1 63 ? 22.409 17.290 -16.694 1.00 31.78  ? 63  LEU B CB   1 
ATOM   1529 C CG   . LEU B 1 63 ? 22.604 18.698 -17.325 1.00 36.76  ? 63  LEU B CG   1 
ATOM   1530 C CD1  . LEU B 1 63 ? 23.865 19.431 -16.856 1.00 37.57  ? 63  LEU B CD1  1 
ATOM   1531 C CD2  . LEU B 1 63 ? 22.772 18.468 -18.807 1.00 41.50  ? 63  LEU B CD2  1 
ATOM   1532 H H    . LEU B 1 63 ? 21.667 15.049 -15.518 1.00 0.00   ? 63  LEU B H    1 
ATOM   1533 N N    . ILE B 1 64 ? 20.805 19.072 -14.570 1.00 21.12  ? 64  ILE B N    1 
ATOM   1534 C CA   . ILE B 1 64 ? 19.700 19.925 -14.219 1.00 23.43  ? 64  ILE B CA   1 
ATOM   1535 C C    . ILE B 1 64 ? 20.283 21.283 -14.468 1.00 22.69  ? 64  ILE B C    1 
ATOM   1536 O O    . ILE B 1 64 ? 21.439 21.575 -14.166 1.00 23.69  ? 64  ILE B O    1 
ATOM   1537 C CB   . ILE B 1 64 ? 19.349 19.583 -12.747 1.00 26.59  ? 64  ILE B CB   1 
ATOM   1538 C CG1  . ILE B 1 64 ? 18.237 20.414 -12.241 1.00 31.73  ? 64  ILE B CG1  1 
ATOM   1539 C CG2  . ILE B 1 64 ? 20.547 19.807 -11.841 1.00 33.84  ? 64  ILE B CG2  1 
ATOM   1540 C CD1  . ILE B 1 64 ? 17.772 19.618 -10.965 1.00 35.91  ? 64  ILE B CD1  1 
ATOM   1541 H H    . ILE B 1 64 ? 21.720 19.409 -14.424 1.00 0.00   ? 64  ILE B H    1 
ATOM   1542 N N    . GLU B 1 65 ? 19.525 22.044 -15.224 1.00 23.79  ? 65  GLU B N    1 
ATOM   1543 C CA   . GLU B 1 65 ? 19.881 23.426 -15.496 1.00 23.79  ? 65  GLU B CA   1 
ATOM   1544 C C    . GLU B 1 65 ? 19.067 24.319 -14.533 1.00 21.13  ? 65  GLU B C    1 
ATOM   1545 O O    . GLU B 1 65 ? 17.860 24.190 -14.368 1.00 21.92  ? 65  GLU B O    1 
ATOM   1546 C CB   . GLU B 1 65 ? 19.564 23.518 -16.934 1.00 25.32  ? 65  GLU B CB   1 
ATOM   1547 C CG   . GLU B 1 65 ? 20.156 24.712 -17.541 1.00 41.44  ? 65  GLU B CG   1 
ATOM   1548 C CD   . GLU B 1 65 ? 19.562 24.939 -18.921 1.00 48.70  ? 65  GLU B CD   1 
ATOM   1549 O OE1  . GLU B 1 65 ? 19.771 24.073 -19.784 1.00 53.10  ? 65  GLU B OE1  1 
ATOM   1550 O OE2  . GLU B 1 65 ? 18.873 25.957 -19.094 1.00 51.27  ? 65  GLU B OE2  1 
ATOM   1551 H H    . GLU B 1 65 ? 18.682 21.678 -15.581 1.00 0.00   ? 65  GLU B H    1 
ATOM   1552 N N    . ILE B 1 66 ? 19.702 25.199 -13.784 1.00 19.72  ? 66  ILE B N    1 
ATOM   1553 C CA   . ILE B 1 66 ? 19.083 25.985 -12.714 1.00 20.44  ? 66  ILE B CA   1 
ATOM   1554 C C    . ILE B 1 66 ? 19.293 27.373 -13.216 1.00 25.65  ? 66  ILE B C    1 
ATOM   1555 O O    . ILE B 1 66 ? 20.445 27.816 -13.294 1.00 22.25  ? 66  ILE B O    1 
ATOM   1556 C CB   . ILE B 1 66 ? 19.844 25.768 -11.424 1.00 19.31  ? 66  ILE B CB   1 
ATOM   1557 C CG1  . ILE B 1 66 ? 19.841 24.227 -11.147 1.00 22.73  ? 66  ILE B CG1  1 
ATOM   1558 C CG2  . ILE B 1 66 ? 19.265 26.596 -10.305 1.00 15.04  ? 66  ILE B CG2  1 
ATOM   1559 C CD1  . ILE B 1 66 ? 20.924 23.885 -10.169 1.00 26.89  ? 66  ILE B CD1  1 
ATOM   1560 H H    . ILE B 1 66 ? 20.660 25.321 -13.901 1.00 0.00   ? 66  ILE B H    1 
ATOM   1561 N N    . CYS B 1 67 ? 18.232 28.020 -13.693 1.00 30.30  ? 67  CYS B N    1 
ATOM   1562 C CA   . CYS B 1 67 ? 18.362 29.389 -14.205 1.00 34.25  ? 67  CYS B CA   1 
ATOM   1563 C C    . CYS B 1 67 ? 19.456 29.525 -15.259 1.00 33.12  ? 67  CYS B C    1 
ATOM   1564 O O    . CYS B 1 67 ? 20.329 30.404 -15.176 1.00 35.22  ? 67  CYS B O    1 
ATOM   1565 C CB   . CYS B 1 67 ? 18.670 30.355 -13.058 1.00 36.20  ? 67  CYS B CB   1 
ATOM   1566 S SG   . CYS B 1 67 ? 17.087 31.127 -12.844 1.00 50.16  ? 67  CYS B SG   1 
ATOM   1567 H H    . CYS B 1 67 ? 17.358 27.556 -13.691 1.00 0.00   ? 67  CYS B H    1 
ATOM   1568 N N    . GLY B 1 68 ? 19.469 28.573 -16.190 1.00 32.08  ? 68  GLY B N    1 
ATOM   1569 C CA   . GLY B 1 68 ? 20.440 28.550 -17.280 1.00 31.51  ? 68  GLY B CA   1 
ATOM   1570 C C    . GLY B 1 68 ? 21.832 28.086 -16.870 1.00 32.18  ? 68  GLY B C    1 
ATOM   1571 O O    . GLY B 1 68 ? 22.699 28.138 -17.735 1.00 34.76  ? 68  GLY B O    1 
ATOM   1572 H H    . GLY B 1 68 ? 18.854 27.817 -16.105 1.00 0.00   ? 68  GLY B H    1 
ATOM   1573 N N    . HIS B 1 69 ? 22.143 27.674 -15.611 1.00 30.76  ? 69  HIS B N    1 
ATOM   1574 C CA   . HIS B 1 69 ? 23.475 27.188 -15.210 1.00 32.64  ? 69  HIS B CA   1 
ATOM   1575 C C    . HIS B 1 69 ? 23.329 25.676 -15.011 1.00 30.31  ? 69  HIS B C    1 
ATOM   1576 O O    . HIS B 1 69 ? 22.473 25.255 -14.233 1.00 30.40  ? 69  HIS B O    1 
ATOM   1577 C CB   . HIS B 1 69 ? 23.987 27.741 -13.864 1.00 36.09  ? 69  HIS B CB   1 
ATOM   1578 C CG   . HIS B 1 69 ? 24.015 29.253 -13.745 1.00 43.97  ? 69  HIS B CG   1 
ATOM   1579 N ND1  . HIS B 1 69 ? 25.007 30.111 -13.955 1.00 49.57  ? 69  HIS B ND1  1 
ATOM   1580 C CD2  . HIS B 1 69 ? 22.904 30.001 -13.441 1.00 49.80  ? 69  HIS B CD2  1 
ATOM   1581 C CE1  . HIS B 1 69 ? 24.544 31.344 -13.813 1.00 52.84  ? 69  HIS B CE1  1 
ATOM   1582 N NE2  . HIS B 1 69 ? 23.268 31.264 -13.504 1.00 54.09  ? 69  HIS B NE2  1 
ATOM   1583 H H    . HIS B 1 69 ? 21.436 27.616 -14.935 1.00 0.00   ? 69  HIS B H    1 
ATOM   1584 H HD1  . HIS B 1 69 ? 25.956 29.873 -13.983 1.00 0.00   ? 69  HIS B HD1  1 
ATOM   1585 H HE2  . HIS B 1 69 ? 22.625 32.004 -13.459 1.00 0.00   ? 69  HIS B HE2  1 
ATOM   1586 N N    . LYS B 1 70 ? 24.102 24.857 -15.743 1.00 28.66  ? 70  LYS B N    1 
ATOM   1587 C CA   . LYS B 1 70 ? 24.062 23.393 -15.753 1.00 29.19  ? 70  LYS B CA   1 
ATOM   1588 C C    . LYS B 1 70 ? 24.806 22.925 -14.535 1.00 27.38  ? 70  LYS B C    1 
ATOM   1589 O O    . LYS B 1 70 ? 25.896 23.398 -14.207 1.00 29.88  ? 70  LYS B O    1 
ATOM   1590 C CB   . LYS B 1 70 ? 24.728 22.849 -17.039 1.00 32.38  ? 70  LYS B CB   1 
ATOM   1591 C CG   . LYS B 1 70 ? 23.828 23.141 -18.236 1.00 42.61  ? 70  LYS B CG   1 
ATOM   1592 C CD   . LYS B 1 70 ? 23.857 22.176 -19.441 1.00 50.98  ? 70  LYS B CD   1 
ATOM   1593 C CE   . LYS B 1 70 ? 22.583 22.258 -20.383 1.00 57.88  ? 70  LYS B CE   1 
ATOM   1594 N NZ   . LYS B 1 70 ? 21.300 21.720 -19.876 1.00 60.79  ? 70  LYS B NZ   1 
ATOM   1595 H H    . LYS B 1 70 ? 24.822 25.268 -16.269 1.00 0.00   ? 70  LYS B H    1 
ATOM   1596 H HZ1  . LYS B 1 70 ? 21.395 20.713 -19.637 1.00 0.00   ? 70  LYS B HZ1  1 
ATOM   1597 H HZ2  . LYS B 1 70 ? 20.979 22.246 -19.037 1.00 0.00   ? 70  LYS B HZ2  1 
ATOM   1598 H HZ3  . LYS B 1 70 ? 20.580 21.822 -20.620 1.00 0.00   ? 70  LYS B HZ3  1 
ATOM   1599 N N    . ALA B 1 71 ? 24.179 22.033 -13.826 1.00 21.75  ? 71  ALA B N    1 
ATOM   1600 C CA   . ALA B 1 71 ? 24.831 21.470 -12.688 1.00 19.06  ? 71  ALA B CA   1 
ATOM   1601 C C    . ALA B 1 71 ? 24.722 19.959 -12.973 1.00 20.89  ? 71  ALA B C    1 
ATOM   1602 O O    . ALA B 1 71 ? 23.821 19.584 -13.736 1.00 20.76  ? 71  ALA B O    1 
ATOM   1603 C CB   . ALA B 1 71 ? 24.057 21.875 -11.456 1.00 16.21  ? 71  ALA B CB   1 
ATOM   1604 H H    . ALA B 1 71 ? 23.317 21.654 -14.124 1.00 0.00   ? 71  ALA B H    1 
ATOM   1605 N N    . ILE B 1 72 ? 25.585 19.066 -12.454 1.00 19.22  ? 72  ILE B N    1 
ATOM   1606 C CA   . ILE B 1 72 ? 25.420 17.634 -12.668 1.00 16.43  ? 72  ILE B CA   1 
ATOM   1607 C C    . ILE B 1 72 ? 25.679 17.008 -11.318 1.00 14.76  ? 72  ILE B C    1 
ATOM   1608 O O    . ILE B 1 72 ? 26.750 17.144 -10.782 1.00 14.84  ? 72  ILE B O    1 
ATOM   1609 C CB   . ILE B 1 72 ? 26.417 17.073 -13.700 1.00 18.52  ? 72  ILE B CB   1 
ATOM   1610 C CG1  . ILE B 1 72 ? 26.250 17.768 -15.049 1.00 18.16  ? 72  ILE B CG1  1 
ATOM   1611 C CG2  . ILE B 1 72 ? 26.175 15.554 -13.786 1.00 17.15  ? 72  ILE B CG2  1 
ATOM   1612 C CD1  . ILE B 1 72 ? 27.279 17.438 -16.129 1.00 18.80  ? 72  ILE B CD1  1 
ATOM   1613 H H    . ILE B 1 72 ? 26.346 19.398 -11.925 1.00 0.00   ? 72  ILE B H    1 
ATOM   1614 N N    . GLY B 1 73 ? 24.759 16.305 -10.706 1.00 14.05  ? 73  GLY B N    1 
ATOM   1615 C CA   . GLY B 1 73 ? 25.002 15.786 -9.383  1.00 15.41  ? 73  GLY B CA   1 
ATOM   1616 C C    . GLY B 1 73 ? 23.873 14.898 -8.975  1.00 14.93  ? 73  GLY B C    1 
ATOM   1617 O O    . GLY B 1 73 ? 23.100 14.454 -9.804  1.00 17.92  ? 73  GLY B O    1 
ATOM   1618 H H    . GLY B 1 73 ? 23.881 16.162 -11.156 1.00 0.00   ? 73  GLY B H    1 
ATOM   1619 N N    . THR B 1 74 ? 23.844 14.620 -7.706  1.00 15.68  ? 74  THR B N    1 
ATOM   1620 C CA   . THR B 1 74 ? 22.897 13.758 -7.070  1.00 16.62  ? 74  THR B CA   1 
ATOM   1621 C C    . THR B 1 74 ? 21.607 14.476 -6.857  1.00 17.55  ? 74  THR B C    1 
ATOM   1622 O O    . THR B 1 74 ? 21.597 15.565 -6.269  1.00 19.93  ? 74  THR B O    1 
ATOM   1623 C CB   . THR B 1 74 ? 23.464 13.339 -5.754  1.00 17.98  ? 74  THR B CB   1 
ATOM   1624 O OG1  . THR B 1 74 ? 24.614 12.569 -6.117  1.00 22.44  ? 74  THR B OG1  1 
ATOM   1625 C CG2  . THR B 1 74 ? 22.461 12.648 -4.844  1.00 21.92  ? 74  THR B CG2  1 
ATOM   1626 H H    . THR B 1 74 ? 24.435 15.100 -7.090  1.00 0.00   ? 74  THR B H    1 
ATOM   1627 H HG1  . THR B 1 74 ? 25.268 13.067 -6.615  1.00 0.00   ? 74  THR B HG1  1 
ATOM   1628 N N    . VAL B 1 75 ? 20.528 13.811 -7.199  1.00 12.14  ? 75  VAL B N    1 
ATOM   1629 C CA   . VAL B 1 75 ? 19.190 14.328 -7.082  1.00 14.62  ? 75  VAL B CA   1 
ATOM   1630 C C    . VAL B 1 75 ? 18.414 13.227 -6.376  1.00 17.90  ? 75  VAL B C    1 
ATOM   1631 O O    . VAL B 1 75 ? 18.551 12.043 -6.707  1.00 19.47  ? 75  VAL B O    1 
ATOM   1632 C CB   . VAL B 1 75 ? 18.759 14.565 -8.512  1.00 18.82  ? 75  VAL B CB   1 
ATOM   1633 C CG1  . VAL B 1 75 ? 17.298 14.497 -8.600  1.00 23.12  ? 75  VAL B CG1  1 
ATOM   1634 C CG2  . VAL B 1 75 ? 19.154 15.957 -8.986  1.00 20.37  ? 75  VAL B CG2  1 
ATOM   1635 H H    . VAL B 1 75 ? 20.619 12.888 -7.529  1.00 0.00   ? 75  VAL B H    1 
ATOM   1636 N N    . LEU B 1 76 ? 17.667 13.599 -5.348  1.00 14.36  ? 76  LEU B N    1 
ATOM   1637 C CA   . LEU B 1 76 ? 16.747 12.709 -4.638  1.00 14.76  ? 76  LEU B CA   1 
ATOM   1638 C C    . LEU B 1 76 ? 15.322 12.964 -5.173  1.00 17.52  ? 76  LEU B C    1 
ATOM   1639 O O    . LEU B 1 76 ? 14.951 14.092 -5.517  1.00 16.92  ? 76  LEU B O    1 
ATOM   1640 C CB   . LEU B 1 76 ? 16.831 12.976 -3.099  1.00 11.56  ? 76  LEU B CB   1 
ATOM   1641 C CG   . LEU B 1 76 ? 18.198 13.105 -2.416  1.00 14.05  ? 76  LEU B CG   1 
ATOM   1642 C CD1  . LEU B 1 76 ? 17.951 13.417 -0.911  1.00 12.92  ? 76  LEU B CD1  1 
ATOM   1643 C CD2  . LEU B 1 76 ? 19.028 11.857 -2.604  1.00 13.60  ? 76  LEU B CD2  1 
ATOM   1644 H H    . LEU B 1 76 ? 17.725 14.538 -5.052  1.00 0.00   ? 76  LEU B H    1 
ATOM   1645 N N    . VAL B 1 77 ? 14.540 11.927 -5.380  1.00 14.33  ? 77  VAL B N    1 
ATOM   1646 C CA   . VAL B 1 77 ? 13.204 11.985 -5.870  1.00 17.45  ? 77  VAL B CA   1 
ATOM   1647 C C    . VAL B 1 77 ? 12.304 11.347 -4.840  1.00 16.56  ? 77  VAL B C    1 
ATOM   1648 O O    . VAL B 1 77 ? 12.538 10.239 -4.388  1.00 16.79  ? 77  VAL B O    1 
ATOM   1649 C CB   . VAL B 1 77 ? 13.068 11.217 -7.196  1.00 19.01  ? 77  VAL B CB   1 
ATOM   1650 C CG1  . VAL B 1 77 ? 11.647 11.165 -7.712  1.00 17.70  ? 77  VAL B CG1  1 
ATOM   1651 C CG2  . VAL B 1 77 ? 13.918 11.968 -8.201  1.00 18.56  ? 77  VAL B CG2  1 
ATOM   1652 H H    . VAL B 1 77 ? 14.943 11.058 -5.207  1.00 0.00   ? 77  VAL B H    1 
ATOM   1653 N N    . GLY B 1 78 ? 11.241 11.990 -4.430  1.00 16.33  ? 78  GLY B N    1 
ATOM   1654 C CA   . GLY B 1 78 ? 10.316 11.318 -3.547  1.00 18.04  ? 78  GLY B CA   1 
ATOM   1655 C C    . GLY B 1 78 ? 9.176  12.258 -3.255  1.00 19.46  ? 78  GLY B C    1 
ATOM   1656 O O    . GLY B 1 78 ? 8.946  13.142 -4.075  1.00 17.85  ? 78  GLY B O    1 
ATOM   1657 H H    . GLY B 1 78 ? 11.034 12.901 -4.765  1.00 0.00   ? 78  GLY B H    1 
ATOM   1658 N N    . PRO B 1 79 ? 8.430  12.129 -2.186  1.00 19.01  ? 79  PRO B N    1 
ATOM   1659 C CA   . PRO B 1 79 ? 7.179  12.835 -2.026  1.00 22.30  ? 79  PRO B CA   1 
ATOM   1660 C C    . PRO B 1 79 ? 7.271  14.209 -1.369  1.00 24.54  ? 79  PRO B C    1 
ATOM   1661 O O    . PRO B 1 79 ? 6.641  14.581 -0.359  1.00 27.39  ? 79  PRO B O    1 
ATOM   1662 C CB   . PRO B 1 79 ? 6.317  11.828 -1.290  1.00 24.58  ? 79  PRO B CB   1 
ATOM   1663 C CG   . PRO B 1 79 ? 7.271  11.100 -0.387  1.00 23.72  ? 79  PRO B CG   1 
ATOM   1664 C CD   . PRO B 1 79 ? 8.468  10.953 -1.332  1.00 20.39  ? 79  PRO B CD   1 
ATOM   1665 N N    . THR B 1 80 ? 8.004  15.066 -2.066  1.00 21.60  ? 80  THR B N    1 
ATOM   1666 C CA   . THR B 1 80 ? 8.125  16.415 -1.633  1.00 20.37  ? 80  THR B CA   1 
ATOM   1667 C C    . THR B 1 80 ? 7.073  17.107 -2.501  1.00 20.42  ? 80  THR B C    1 
ATOM   1668 O O    . THR B 1 80 ? 6.796  16.790 -3.676  1.00 22.18  ? 80  THR B O    1 
ATOM   1669 C CB   . THR B 1 80 ? 9.522  16.934 -1.904  1.00 17.76  ? 80  THR B CB   1 
ATOM   1670 O OG1  . THR B 1 80 ? 9.352  18.271 -1.478  1.00 18.38  ? 80  THR B OG1  1 
ATOM   1671 C CG2  . THR B 1 80 ? 10.030 16.885 -3.330  1.00 12.11  ? 80  THR B CG2  1 
ATOM   1672 H H    . THR B 1 80 ? 8.261  14.866 -2.999  1.00 0.00   ? 80  THR B H    1 
ATOM   1673 H HG1  . THR B 1 80 ? 9.740  18.401 -0.606  1.00 0.00   ? 80  THR B HG1  1 
ATOM   1674 N N    . PRO B 1 81 ? 6.394  18.059 -1.876  1.00 20.83  ? 81  PRO B N    1 
ATOM   1675 C CA   . PRO B 1 81 ? 5.479  18.932 -2.572  1.00 19.50  ? 81  PRO B CA   1 
ATOM   1676 C C    . PRO B 1 81 ? 6.080  20.126 -3.277  1.00 20.08  ? 81  PRO B C    1 
ATOM   1677 O O    . PRO B 1 81 ? 5.313  20.850 -3.900  1.00 24.22  ? 81  PRO B O    1 
ATOM   1678 C CB   . PRO B 1 81 ? 4.550  19.325 -1.536  1.00 19.99  ? 81  PRO B CB   1 
ATOM   1679 C CG   . PRO B 1 81 ? 5.412  19.381 -0.320  1.00 20.57  ? 81  PRO B CG   1 
ATOM   1680 C CD   . PRO B 1 81 ? 6.393  18.251 -0.436  1.00 19.11  ? 81  PRO B CD   1 
ATOM   1681 N N    . VAL B 1 82 ? 7.388  20.399 -3.221  1.00 19.22  ? 82  VAL B N    1 
ATOM   1682 C CA   . VAL B 1 82 ? 8.034  21.544 -3.880  1.00 18.07  ? 82  VAL B CA   1 
ATOM   1683 C C    . VAL B 1 82 ? 9.350  20.963 -4.341  1.00 13.82  ? 82  VAL B C    1 
ATOM   1684 O O    . VAL B 1 82 ? 9.934  20.191 -3.604  1.00 12.62  ? 82  VAL B O    1 
ATOM   1685 C CB   . VAL B 1 82 ? 8.582  22.756 -3.047  1.00 22.42  ? 82  VAL B CB   1 
ATOM   1686 C CG1  . VAL B 1 82 ? 8.109  24.070 -3.690  1.00 26.57  ? 82  VAL B CG1  1 
ATOM   1687 C CG2  . VAL B 1 82 ? 8.357  22.487 -1.613  1.00 18.61  ? 82  VAL B CG2  1 
ATOM   1688 H H    . VAL B 1 82 ? 7.998  19.740 -2.819  1.00 0.00   ? 82  VAL B H    1 
ATOM   1689 N N    . ASN B 1 83 ? 9.947  21.359 -5.468  1.00 13.37  ? 83  ASN B N    1 
ATOM   1690 C CA   . ASN B 1 83 ? 11.243 20.905 -5.886  1.00 14.61  ? 83  ASN B CA   1 
ATOM   1691 C C    . ASN B 1 83 ? 12.160 21.809 -5.113  1.00 15.85  ? 83  ASN B C    1 
ATOM   1692 O O    . ASN B 1 83 ? 11.894 23.014 -5.069  1.00 18.21  ? 83  ASN B O    1 
ATOM   1693 C CB   . ASN B 1 83 ? 11.429 21.125 -7.386  1.00 15.42  ? 83  ASN B CB   1 
ATOM   1694 C CG   . ASN B 1 83 ? 10.475 20.229 -8.155  1.00 19.60  ? 83  ASN B CG   1 
ATOM   1695 O OD1  . ASN B 1 83 ? 10.417 19.000 -7.964  1.00 17.68  ? 83  ASN B OD1  1 
ATOM   1696 N ND2  . ASN B 1 83 ? 9.650  20.831 -9.001  1.00 17.68  ? 83  ASN B ND2  1 
ATOM   1697 H H    . ASN B 1 83 ? 9.475  21.999 -6.034  1.00 0.00   ? 83  ASN B H    1 
ATOM   1698 H HD21 . ASN B 1 83 ? 9.021  20.271 -9.489  1.00 0.00   ? 83  ASN B HD21 1 
ATOM   1699 H HD22 . ASN B 1 83 ? 9.746  21.797 -9.095  1.00 0.00   ? 83  ASN B HD22 1 
ATOM   1700 N N    . ILE B 1 84 ? 13.187 21.307 -4.462  1.00 15.08  ? 84  ILE B N    1 
ATOM   1701 C CA   . ILE B 1 84 ? 14.109 22.054 -3.653  1.00 14.46  ? 84  ILE B CA   1 
ATOM   1702 C C    . ILE B 1 84 ? 15.504 21.848 -4.205  1.00 17.20  ? 84  ILE B C    1 
ATOM   1703 O O    . ILE B 1 84 ? 15.969 20.671 -4.252  1.00 17.10  ? 84  ILE B O    1 
ATOM   1704 C CB   . ILE B 1 84 ? 13.937 21.477 -2.250  1.00 17.69  ? 84  ILE B CB   1 
ATOM   1705 C CG1  . ILE B 1 84 ? 12.602 21.870 -1.617  1.00 13.17  ? 84  ILE B CG1  1 
ATOM   1706 C CG2  . ILE B 1 84 ? 15.112 21.931 -1.447  1.00 18.50  ? 84  ILE B CG2  1 
ATOM   1707 C CD1  . ILE B 1 84 ? 12.305 20.802 -0.570  1.00 14.66  ? 84  ILE B CD1  1 
ATOM   1708 H H    . ILE B 1 84 ? 13.309 20.337 -4.457  1.00 0.00   ? 84  ILE B H    1 
ATOM   1709 N N    . ILE B 1 85 ? 16.214 22.938 -4.584  1.00 14.04  ? 85  ILE B N    1 
ATOM   1710 C CA   . ILE B 1 85 ? 17.600 22.810 -4.979  1.00 12.31  ? 85  ILE B CA   1 
ATOM   1711 C C    . ILE B 1 85 ? 18.415 22.986 -3.692  1.00 14.92  ? 85  ILE B C    1 
ATOM   1712 O O    . ILE B 1 85 ? 18.309 24.026 -3.065  1.00 18.82  ? 85  ILE B O    1 
ATOM   1713 C CB   . ILE B 1 85 ? 17.960 23.874 -6.051  1.00 14.46  ? 85  ILE B CB   1 
ATOM   1714 C CG1  . ILE B 1 85 ? 17.066 23.726 -7.314  1.00 14.70  ? 85  ILE B CG1  1 
ATOM   1715 C CG2  . ILE B 1 85 ? 19.430 23.705 -6.414  1.00 8.51   ? 85  ILE B CG2  1 
ATOM   1716 C CD1  . ILE B 1 85 ? 16.962 22.303 -7.963  1.00 15.15  ? 85  ILE B CD1  1 
ATOM   1717 H H    . ILE B 1 85 ? 15.804 23.830 -4.496  1.00 0.00   ? 85  ILE B H    1 
ATOM   1718 N N    . GLY B 1 86 ? 19.216 22.037 -3.206  1.00 11.89  ? 86  GLY B N    1 
ATOM   1719 C CA   . GLY B 1 86 ? 19.867 22.194 -1.941  1.00 8.85   ? 86  GLY B CA   1 
ATOM   1720 C C    . GLY B 1 86 ? 21.307 22.463 -2.167  1.00 7.26   ? 86  GLY B C    1 
ATOM   1721 O O    . GLY B 1 86 ? 21.766 22.658 -3.287  1.00 10.87  ? 86  GLY B O    1 
ATOM   1722 H H    . GLY B 1 86 ? 19.370 21.254 -3.760  1.00 0.00   ? 86  GLY B H    1 
ATOM   1723 N N    . ARG B 1 87 ? 22.094 22.441 -1.123  1.00 8.13   ? 87  ARG B N    1 
ATOM   1724 C CA   . ARG B 1 87 ? 23.471 22.849 -1.184  1.00 7.97   ? 87  ARG B CA   1 
ATOM   1725 C C    . ARG B 1 87 ? 24.357 22.126 -2.108  1.00 13.47  ? 87  ARG B C    1 
ATOM   1726 O O    . ARG B 1 87 ? 25.313 22.674 -2.657  1.00 14.35  ? 87  ARG B O    1 
ATOM   1727 C CB   . ARG B 1 87 ? 24.019 22.772 0.180   1.00 10.47  ? 87  ARG B CB   1 
ATOM   1728 C CG   . ARG B 1 87 ? 23.342 23.805 1.090   1.00 7.36   ? 87  ARG B CG   1 
ATOM   1729 C CD   . ARG B 1 87 ? 24.030 23.876 2.404   1.00 10.64  ? 87  ARG B CD   1 
ATOM   1730 N NE   . ARG B 1 87 ? 24.067 22.617 3.134   1.00 12.84  ? 87  ARG B NE   1 
ATOM   1731 C CZ   . ARG B 1 87 ? 25.104 21.753 3.199   1.00 15.69  ? 87  ARG B CZ   1 
ATOM   1732 N NH1  . ARG B 1 87 ? 26.263 21.911 2.601   1.00 11.72  ? 87  ARG B NH1  1 
ATOM   1733 N NH2  . ARG B 1 87 ? 24.995 20.653 3.902   1.00 16.99  ? 87  ARG B NH2  1 
ATOM   1734 H H    . ARG B 1 87 ? 21.709 22.137 -0.275  1.00 0.00   ? 87  ARG B H    1 
ATOM   1735 H HE   . ARG B 1 87 ? 23.270 22.336 3.621   1.00 0.00   ? 87  ARG B HE   1 
ATOM   1736 H HH11 . ARG B 1 87 ? 26.415 22.719 2.036   1.00 0.00   ? 87  ARG B HH11 1 
ATOM   1737 H HH12 . ARG B 1 87 ? 26.976 21.212 2.673   1.00 0.00   ? 87  ARG B HH12 1 
ATOM   1738 H HH21 . ARG B 1 87 ? 24.177 20.497 4.445   1.00 0.00   ? 87  ARG B HH21 1 
ATOM   1739 H HH22 . ARG B 1 87 ? 25.758 20.008 3.961   1.00 0.00   ? 87  ARG B HH22 1 
ATOM   1740 N N    . ASN B 1 88 ? 24.077 20.876 -2.361  1.00 15.20  ? 88  ASN B N    1 
ATOM   1741 C CA   . ASN B 1 88 ? 24.961 20.126 -3.261  1.00 15.22  ? 88  ASN B CA   1 
ATOM   1742 C C    . ASN B 1 88 ? 24.997 20.751 -4.664  1.00 13.14  ? 88  ASN B C    1 
ATOM   1743 O O    . ASN B 1 88 ? 26.044 20.725 -5.306  1.00 16.96  ? 88  ASN B O    1 
ATOM   1744 C CB   . ASN B 1 88 ? 24.485 18.627 -3.338  1.00 16.69  ? 88  ASN B CB   1 
ATOM   1745 C CG   . ASN B 1 88 ? 23.188 18.358 -4.078  1.00 11.75  ? 88  ASN B CG   1 
ATOM   1746 O OD1  . ASN B 1 88 ? 22.140 18.921 -3.781  1.00 13.25  ? 88  ASN B OD1  1 
ATOM   1747 N ND2  . ASN B 1 88 ? 23.213 17.497 -5.082  1.00 14.49  ? 88  ASN B ND2  1 
ATOM   1748 H H    . ASN B 1 88 ? 23.314 20.452 -1.914  1.00 0.00   ? 88  ASN B H    1 
ATOM   1749 H HD21 . ASN B 1 88 ? 22.413 17.341 -5.613  1.00 0.00   ? 88  ASN B HD21 1 
ATOM   1750 H HD22 . ASN B 1 88 ? 24.051 17.026 -5.261  1.00 0.00   ? 88  ASN B HD22 1 
ATOM   1751 N N    . LEU B 1 89 ? 23.885 21.278 -5.204  1.00 12.48  ? 89  LEU B N    1 
ATOM   1752 C CA   . LEU B 1 89 ? 23.879 21.875 -6.515  1.00 11.06  ? 89  LEU B CA   1 
ATOM   1753 C C    . LEU B 1 89 ? 24.036 23.351 -6.461  1.00 13.27  ? 89  LEU B C    1 
ATOM   1754 O O    . LEU B 1 89 ? 24.578 23.921 -7.391  1.00 13.94  ? 89  LEU B O    1 
ATOM   1755 C CB   . LEU B 1 89 ? 22.639 21.517 -7.204  1.00 10.70  ? 89  LEU B CB   1 
ATOM   1756 C CG   . LEU B 1 89 ? 22.540 19.978 -7.501  1.00 13.72  ? 89  LEU B CG   1 
ATOM   1757 C CD1  . LEU B 1 89 ? 21.313 19.761 -8.353  1.00 15.90  ? 89  LEU B CD1  1 
ATOM   1758 C CD2  . LEU B 1 89 ? 23.694 19.419 -8.290  1.00 15.11  ? 89  LEU B CD2  1 
ATOM   1759 H H    . LEU B 1 89 ? 23.045 21.286 -4.687  1.00 0.00   ? 89  LEU B H    1 
ATOM   1760 N N    . LEU B 1 90 ? 23.685 23.937 -5.334  1.00 14.14  ? 90  LEU B N    1 
ATOM   1761 C CA   . LEU B 1 90 ? 23.936 25.352 -5.156  1.00 15.93  ? 90  LEU B CA   1 
ATOM   1762 C C    . LEU B 1 90 ? 25.431 25.591 -5.110  1.00 17.48  ? 90  LEU B C    1 
ATOM   1763 O O    . LEU B 1 90 ? 25.880 26.579 -5.706  1.00 17.13  ? 90  LEU B O    1 
ATOM   1764 C CB   . LEU B 1 90 ? 23.272 25.905 -3.873  1.00 16.18  ? 90  LEU B CB   1 
ATOM   1765 C CG   . LEU B 1 90 ? 21.726 25.877 -3.707  1.00 17.42  ? 90  LEU B CG   1 
ATOM   1766 C CD1  . LEU B 1 90 ? 21.363 26.263 -2.256  1.00 11.90  ? 90  LEU B CD1  1 
ATOM   1767 C CD2  . LEU B 1 90 ? 21.067 26.743 -4.788  1.00 15.65  ? 90  LEU B CD2  1 
ATOM   1768 H H    . LEU B 1 90 ? 23.191 23.435 -4.662  1.00 0.00   ? 90  LEU B H    1 
ATOM   1769 N N    . THR B 1 91 ? 26.328 24.764 -4.567  1.00 19.37  ? 91  THR B N    1 
ATOM   1770 C CA   . THR B 1 91 ? 27.726 25.115 -4.633  1.00 19.36  ? 91  THR B CA   1 
ATOM   1771 C C    . THR B 1 91 ? 28.275 24.984 -6.020  1.00 17.67  ? 91  THR B C    1 
ATOM   1772 O O    . THR B 1 91 ? 29.163 25.775 -6.402  1.00 17.05  ? 91  THR B O    1 
ATOM   1773 C CB   . THR B 1 91 ? 28.566 24.254 -3.678  1.00 21.44  ? 91  THR B CB   1 
ATOM   1774 O OG1  . THR B 1 91 ? 28.758 22.987 -4.238  1.00 32.35  ? 91  THR B OG1  1 
ATOM   1775 C CG2  . THR B 1 91 ? 27.840 24.006 -2.405  1.00 15.28  ? 91  THR B CG2  1 
ATOM   1776 H H    . THR B 1 91 ? 26.047 23.963 -4.084  1.00 0.00   ? 91  THR B H    1 
ATOM   1777 H HG1  . THR B 1 91 ? 29.611 23.017 -4.691  1.00 0.00   ? 91  THR B HG1  1 
ATOM   1778 N N    . GLN B 1 92 ? 27.749 24.022 -6.800  1.00 16.27  ? 92  GLN B N    1 
ATOM   1779 C CA   . GLN B 1 92 ? 28.254 23.851 -8.144  1.00 17.85  ? 92  GLN B CA   1 
ATOM   1780 C C    . GLN B 1 92 ? 28.113 25.028 -9.031  1.00 17.56  ? 92  GLN B C    1 
ATOM   1781 O O    . GLN B 1 92 ? 29.064 25.367 -9.723  1.00 21.92  ? 92  GLN B O    1 
ATOM   1782 C CB   . GLN B 1 92 ? 27.603 22.784 -8.959  1.00 18.74  ? 92  GLN B CB   1 
ATOM   1783 C CG   . GLN B 1 92 ? 27.925 21.415 -8.431  1.00 17.43  ? 92  GLN B CG   1 
ATOM   1784 C CD   . GLN B 1 92 ? 27.535 20.373 -9.464  1.00 22.56  ? 92  GLN B CD   1 
ATOM   1785 O OE1  . GLN B 1 92 ? 27.358 20.610 -10.667 1.00 20.49  ? 92  GLN B OE1  1 
ATOM   1786 N NE2  . GLN B 1 92 ? 27.449 19.137 -8.988  1.00 23.21  ? 92  GLN B NE2  1 
ATOM   1787 H H    . GLN B 1 92 ? 27.073 23.423 -6.440  1.00 0.00   ? 92  GLN B H    1 
ATOM   1788 H HE21 . GLN B 1 92 ? 27.338 18.409 -9.630  1.00 0.00   ? 92  GLN B HE21 1 
ATOM   1789 H HE22 . GLN B 1 92 ? 27.591 18.994 -8.038  1.00 0.00   ? 92  GLN B HE22 1 
ATOM   1790 N N    . ILE B 1 93 ? 26.939 25.677 -8.944  1.00 19.07  ? 93  ILE B N    1 
ATOM   1791 C CA   . ILE B 1 93 ? 26.674 26.860 -9.760  1.00 19.04  ? 93  ILE B CA   1 
ATOM   1792 C C    . ILE B 1 93 ? 27.277 28.096 -9.081  1.00 21.52  ? 93  ILE B C    1 
ATOM   1793 O O    . ILE B 1 93 ? 27.114 29.193 -9.588  1.00 24.02  ? 93  ILE B O    1 
ATOM   1794 C CB   . ILE B 1 93 ? 25.134 27.069 -10.055 1.00 16.30  ? 93  ILE B CB   1 
ATOM   1795 C CG1  . ILE B 1 93 ? 24.309 27.454 -8.883  1.00 18.11  ? 93  ILE B CG1  1 
ATOM   1796 C CG2  . ILE B 1 93 ? 24.597 25.756 -10.634 1.00 13.87  ? 93  ILE B CG2  1 
ATOM   1797 C CD1  . ILE B 1 93 ? 22.960 27.861 -9.518  1.00 20.24  ? 93  ILE B CD1  1 
ATOM   1798 H H    . ILE B 1 93 ? 26.232 25.310 -8.371  1.00 0.00   ? 93  ILE B H    1 
ATOM   1799 N N    . GLY B 1 94 ? 28.021 27.996 -7.972  1.00 23.69  ? 94  GLY B N    1 
ATOM   1800 C CA   . GLY B 1 94 ? 28.685 29.104 -7.312  1.00 20.49  ? 94  GLY B CA   1 
ATOM   1801 C C    . GLY B 1 94 ? 27.816 29.997 -6.459  1.00 23.08  ? 94  GLY B C    1 
ATOM   1802 O O    . GLY B 1 94 ? 28.292 31.088 -6.147  1.00 25.20  ? 94  GLY B O    1 
ATOM   1803 H H    . GLY B 1 94 ? 28.154 27.105 -7.584  1.00 0.00   ? 94  GLY B H    1 
ATOM   1804 N N    . CYS B 1 95 ? 26.650 29.566 -5.979  1.00 20.12  ? 95  CYS B N    1 
ATOM   1805 C CA   . CYS B 1 95 ? 25.769 30.385 -5.185  1.00 20.37  ? 95  CYS B CA   1 
ATOM   1806 C C    . CYS B 1 95 ? 26.255 30.625 -3.770  1.00 20.10  ? 95  CYS B C    1 
ATOM   1807 O O    . CYS B 1 95 ? 26.800 29.715 -3.143  1.00 21.98  ? 95  CYS B O    1 
ATOM   1808 C CB   . CYS B 1 95 ? 24.425 29.703 -5.215  1.00 15.91  ? 95  CYS B CB   1 
ATOM   1809 S SG   . CYS B 1 95 ? 23.005 30.554 -4.478  1.00 23.80  ? 95  CYS B SG   1 
ATOM   1810 H H    . CYS B 1 95 ? 26.425 28.623 -6.091  1.00 0.00   ? 95  CYS B H    1 
ATOM   1811 N N    . THR B 1 96 ? 26.170 31.853 -3.237  1.00 19.66  ? 96  THR B N    1 
ATOM   1812 C CA   . THR B 1 96 ? 26.549 32.160 -1.882  1.00 20.22  ? 96  THR B CA   1 
ATOM   1813 C C    . THR B 1 96 ? 25.464 33.016 -1.265  1.00 17.71  ? 96  THR B C    1 
ATOM   1814 O O    . THR B 1 96 ? 24.606 33.542 -1.983  1.00 17.84  ? 96  THR B O    1 
ATOM   1815 C CB   . THR B 1 96 ? 27.912 32.955 -1.769  1.00 21.83  ? 96  THR B CB   1 
ATOM   1816 O OG1  . THR B 1 96 ? 27.860 34.107 -2.639  1.00 24.19  ? 96  THR B OG1  1 
ATOM   1817 C CG2  . THR B 1 96 ? 29.133 32.127 -2.178  1.00 24.49  ? 96  THR B CG2  1 
ATOM   1818 H H    . THR B 1 96 ? 25.813 32.603 -3.764  1.00 0.00   ? 96  THR B H    1 
ATOM   1819 H HG1  . THR B 1 96 ? 28.105 33.833 -3.541  1.00 0.00   ? 96  THR B HG1  1 
ATOM   1820 N N    . LEU B 1 97 ? 25.508 33.115 0.068   1.00 17.86  ? 97  LEU B N    1 
ATOM   1821 C CA   . LEU B 1 97 ? 24.663 34.004 0.882   1.00 19.51  ? 97  LEU B CA   1 
ATOM   1822 C C    . LEU B 1 97 ? 25.517 35.193 1.266   1.00 17.79  ? 97  LEU B C    1 
ATOM   1823 O O    . LEU B 1 97 ? 26.658 35.085 1.683   1.00 19.84  ? 97  LEU B O    1 
ATOM   1824 C CB   . LEU B 1 97 ? 24.216 33.384 2.199   1.00 21.08  ? 97  LEU B CB   1 
ATOM   1825 C CG   . LEU B 1 97 ? 23.157 32.345 2.236   1.00 19.59  ? 97  LEU B CG   1 
ATOM   1826 C CD1  . LEU B 1 97 ? 23.000 31.731 3.586   1.00 21.25  ? 97  LEU B CD1  1 
ATOM   1827 C CD2  . LEU B 1 97 ? 21.890 33.052 1.883   1.00 21.60  ? 97  LEU B CD2  1 
ATOM   1828 H H    . LEU B 1 97 ? 26.158 32.557 0.538   1.00 0.00   ? 97  LEU B H    1 
ATOM   1829 N N    . ASN B 1 98 ? 24.983 36.372 1.091   1.00 20.22  ? 98  ASN B N    1 
ATOM   1830 C CA   . ASN B 1 98 ? 25.769 37.569 1.334   1.00 21.37  ? 98  ASN B CA   1 
ATOM   1831 C C    . ASN B 1 98 ? 25.023 38.472 2.219   1.00 20.88  ? 98  ASN B C    1 
ATOM   1832 O O    . ASN B 1 98 ? 23.822 38.601 2.035   1.00 19.74  ? 98  ASN B O    1 
ATOM   1833 C CB   . ASN B 1 98 ? 25.998 38.328 0.081   1.00 20.56  ? 98  ASN B CB   1 
ATOM   1834 C CG   . ASN B 1 98 ? 26.962 37.510 -0.735  1.00 24.48  ? 98  ASN B CG   1 
ATOM   1835 O OD1  . ASN B 1 98 ? 28.138 37.764 -0.808  1.00 29.13  ? 98  ASN B OD1  1 
ATOM   1836 N ND2  . ASN B 1 98 ? 26.525 36.451 -1.373  1.00 17.49  ? 98  ASN B ND2  1 
ATOM   1837 H H    . ASN B 1 98 ? 24.031 36.492 0.936   1.00 0.00   ? 98  ASN B H    1 
ATOM   1838 H HD21 . ASN B 1 98 ? 27.143 35.930 -1.942  1.00 0.00   ? 98  ASN B HD21 1 
ATOM   1839 H HD22 . ASN B 1 98 ? 25.607 36.193 -1.197  1.00 0.00   ? 98  ASN B HD22 1 
ATOM   1840 N N    . PHE B 1 99 ? 25.671 38.993 3.219   1.00 25.69  ? 99  PHE B N    1 
ATOM   1841 C CA   . PHE B 1 99 ? 25.068 40.048 4.028   1.00 26.93  ? 99  PHE B CA   1 
ATOM   1842 C C    . PHE B 1 99 ? 26.192 40.847 4.666   1.00 29.26  ? 99  PHE B C    1 
ATOM   1843 O O    . PHE B 1 99 ? 25.929 41.665 5.512   1.00 31.62  ? 99  PHE B O    1 
ATOM   1844 C CB   . PHE B 1 99 ? 24.143 39.499 5.136   1.00 23.95  ? 99  PHE B CB   1 
ATOM   1845 C CG   . PHE B 1 99 ? 24.696 38.603 6.206   1.00 24.48  ? 99  PHE B CG   1 
ATOM   1846 C CD1  . PHE B 1 99 ? 24.760 37.261 5.951   1.00 22.73  ? 99  PHE B CD1  1 
ATOM   1847 C CD2  . PHE B 1 99 ? 25.028 39.105 7.455   1.00 24.84  ? 99  PHE B CD2  1 
ATOM   1848 C CE1  . PHE B 1 99 ? 25.142 36.424 6.982   1.00 25.64  ? 99  PHE B CE1  1 
ATOM   1849 C CE2  . PHE B 1 99 ? 25.411 38.252 8.481   1.00 27.55  ? 99  PHE B CE2  1 
ATOM   1850 C CZ   . PHE B 1 99 ? 25.465 36.890 8.247   1.00 26.52  ? 99  PHE B CZ   1 
ATOM   1851 O OXT  . PHE B 1 99 ? 27.366 40.623 4.383   1.00 33.49  ? 99  PHE B OXT  1 
ATOM   1852 H H    . PHE B 1 99 ? 26.610 38.762 3.363   1.00 0.00   ? 99  PHE B H    1 
HETATM 1853 C C1   . RIT C 2 .  ? 16.662 17.790 1.494   1.00 25.90  ? 301 RIT B C1   1 
HETATM 1854 C C2   . RIT C 2 .  ? 16.229 17.935 2.784   1.00 22.61  ? 301 RIT B C2   1 
HETATM 1855 S S3   . RIT C 2 .  ? 17.345 17.324 4.036   1.00 37.28  ? 301 RIT B S3   1 
HETATM 1856 C C4   . RIT C 2 .  ? 18.316 17.113 2.555   1.00 25.37  ? 301 RIT B C4   1 
HETATM 1857 N N5   . RIT C 2 .  ? 17.867 17.366 1.377   1.00 26.82  ? 301 RIT B N5   1 
HETATM 1858 C C6   . RIT C 2 .  ? 15.073 18.417 3.489   1.00 25.01  ? 301 RIT B C6   1 
HETATM 1859 O O7   . RIT C 2 .  ? 15.186 19.813 3.708   1.00 23.27  ? 301 RIT B O7   1 
HETATM 1860 C C10  . RIT C 2 .  ? 14.216 20.602 4.339   1.00 20.46  ? 301 RIT B C10  1 
HETATM 1861 O O24  . RIT C 2 .  ? 13.103 20.170 4.660   1.00 19.88  ? 301 RIT B O24  1 
HETATM 1862 N N11  . RIT C 2 .  ? 14.650 21.872 4.525   1.00 21.07  ? 301 RIT B N11  1 
HETATM 1863 C C12  . RIT C 2 .  ? 13.873 22.912 5.228   1.00 20.84  ? 301 RIT B C12  1 
HETATM 1864 C C13  . RIT C 2 .  ? 13.503 24.140 4.392   1.00 14.80  ? 301 RIT B C13  1 
HETATM 1865 C C14  . RIT C 2 .  ? 12.672 23.806 3.171   1.00 16.63  ? 301 RIT B C14  1 
HETATM 1866 C C15  . RIT C 2 .  ? 11.140 23.572 3.315   1.00 17.71  ? 301 RIT B C15  1 
HETATM 1867 C C26  . RIT C 2 .  ? 14.261 23.243 6.671   1.00 20.89  ? 301 RIT B C26  1 
HETATM 1868 C C28  . RIT C 2 .  ? 14.816 22.225 7.534   1.00 23.55  ? 301 RIT B C28  1 
HETATM 1869 C C31  . RIT C 2 .  ? 13.799 21.708 8.344   1.00 22.42  ? 301 RIT B C31  1 
HETATM 1870 C C32  . RIT C 2 .  ? 14.098 20.603 9.157   1.00 27.29  ? 301 RIT B C32  1 
HETATM 1871 C C33  . RIT C 2 .  ? 15.374 20.013 9.171   1.00 23.46  ? 301 RIT B C33  1 
HETATM 1872 C C34  . RIT C 2 .  ? 16.392 20.566 8.364   1.00 23.55  ? 301 RIT B C34  1 
HETATM 1873 C C35  . RIT C 2 .  ? 16.115 21.668 7.549   1.00 22.31  ? 301 RIT B C35  1 
HETATM 1874 O O41  . RIT C 2 .  ? 14.754 24.664 3.978   1.00 15.07  ? 301 RIT B O41  1 
HETATM 1875 C C44  . RIT C 2 .  ? 10.569 23.586 1.929   1.00 16.65  ? 301 RIT B C44  1 
HETATM 1876 C C45  . RIT C 2 .  ? 9.254  22.978 2.001   1.00 17.33  ? 301 RIT B C45  1 
HETATM 1877 C C48  . RIT C 2 .  ? 8.149  23.845 2.018   1.00 16.59  ? 301 RIT B C48  1 
HETATM 1878 C C49  . RIT C 2 .  ? 6.836  23.335 2.041   1.00 15.14  ? 301 RIT B C49  1 
HETATM 1879 C C50  . RIT C 2 .  ? 6.660  21.949 2.026   1.00 16.63  ? 301 RIT B C50  1 
HETATM 1880 C C51  . RIT C 2 .  ? 7.756  21.090 2.003   1.00 15.02  ? 301 RIT B C51  1 
HETATM 1881 C C52  . RIT C 2 .  ? 9.059  21.593 1.992   1.00 11.94  ? 301 RIT B C52  1 
HETATM 1882 N N58  . RIT C 2 .  ? 10.469 24.554 4.137   1.00 18.81  ? 301 RIT B N58  1 
HETATM 1883 N N20  . RIT C 2 .  ? 7.906  25.680 5.503   1.00 16.74  ? 301 RIT B N20  1 
HETATM 1884 C C19  . RIT C 2 .  ? 9.274  25.515 5.996   1.00 16.74  ? 301 RIT B C19  1 
HETATM 1885 C C18  . RIT C 2 .  ? 9.960  24.298 5.348   1.00 20.01  ? 301 RIT B C18  1 
HETATM 1886 O O61  . RIT C 2 .  ? 9.968  23.159 5.858   1.00 17.30  ? 301 RIT B O61  1 
HETATM 1887 C C62  . RIT C 2 .  ? 9.255  25.567 7.557   1.00 17.69  ? 301 RIT B C62  1 
HETATM 1888 C C64  . RIT C 2 .  ? 10.596 25.275 8.282   1.00 17.97  ? 301 RIT B C64  1 
HETATM 1889 C C68  . RIT C 2 .  ? 8.565  26.841 8.095   1.00 11.98  ? 301 RIT B C68  1 
HETATM 1890 C C21  . RIT C 2 .  ? 7.665  26.518 4.481   1.00 19.37  ? 301 RIT B C21  1 
HETATM 1891 N N74  . RIT C 2 .  ? 6.423  26.400 3.958   1.00 22.34  ? 301 RIT B N74  1 
HETATM 1892 C C75  . RIT C 2 .  ? 5.969  27.345 2.938   1.00 22.61  ? 301 RIT B C75  1 
HETATM 1893 O O76  . RIT C 2 .  ? 8.471  27.427 4.192   1.00 17.30  ? 301 RIT B O76  1 
HETATM 1894 C C77  . RIT C 2 .  ? 5.910  26.849 1.559   1.00 24.53  ? 301 RIT B C77  1 
HETATM 1895 C C80  . RIT C 2 .  ? 7.024  27.012 0.784   1.00 25.95  ? 301 RIT B C80  1 
HETATM 1896 S S81  . RIT C 2 .  ? 6.639  26.257 -0.785  1.00 28.31  ? 301 RIT B S81  1 
HETATM 1897 C C82  . RIT C 2 .  ? 5.087  25.736 -0.124  1.00 30.65  ? 301 RIT B C82  1 
HETATM 1898 N N83  . RIT C 2 .  ? 4.871  26.263 1.044   1.00 28.12  ? 301 RIT B N83  1 
HETATM 1899 C C85  . RIT C 2 .  ? 4.497  24.886 -1.046  1.00 36.11  ? 301 RIT B C85  1 
HETATM 1900 C C86  . RIT C 2 .  ? 4.139  25.131 -2.506  1.00 37.18  ? 301 RIT B C86  1 
HETATM 1901 C C90  . RIT C 2 .  ? 3.245  24.373 -0.462  1.00 36.27  ? 301 RIT B C90  1 
HETATM 1902 C C95  . RIT C 2 .  ? 5.484  25.508 4.240   1.00 19.68  ? 301 RIT B C95  1 
HETATM 1903 O O    . HOH D 3 .  ? 8.272  38.594 10.899  1.00 16.71  ? 100 HOH A O    1 
HETATM 1904 H H1   . HOH D 3 .  ? 8.298  39.561 10.899  1.00 0.00   ? 100 HOH A H1   1 
HETATM 1905 H H2   . HOH D 3 .  ? 8.230  38.403 9.959   1.00 0.00   ? 100 HOH A H2   1 
HETATM 1906 O O    . HOH D 3 .  ? 9.545  28.751 1.862   1.00 19.65  ? 101 HOH A O    1 
HETATM 1907 H H1   . HOH D 3 .  ? 10.089 29.479 1.514   1.00 0.00   ? 101 HOH A H1   1 
HETATM 1908 H H2   . HOH D 3 .  ? 9.533  28.108 1.155   1.00 0.00   ? 101 HOH A H2   1 
HETATM 1909 O O    . HOH D 3 .  ? 11.185 30.425 0.768   1.00 18.18  ? 102 HOH A O    1 
HETATM 1910 H H1   . HOH D 3 .  ? 11.700 31.199 1.038   1.00 0.00   ? 102 HOH A H1   1 
HETATM 1911 H H2   . HOH D 3 .  ? 11.691 30.086 0.029   1.00 0.00   ? 102 HOH A H2   1 
HETATM 1912 O O    . HOH D 3 .  ? 8.653  33.399 11.919  1.00 17.16  ? 103 HOH A O    1 
HETATM 1913 H H1   . HOH D 3 .  ? 8.636  34.340 12.107  1.00 0.00   ? 103 HOH A H1   1 
HETATM 1914 H H2   . HOH D 3 .  ? 8.259  33.323 11.047  1.00 0.00   ? 103 HOH A H2   1 
HETATM 1915 O O    . HOH D 3 .  ? 17.089 42.320 2.448   1.00 20.96  ? 104 HOH A O    1 
HETATM 1916 H H1   . HOH D 3 .  ? 16.956 43.253 2.644   1.00 0.00   ? 104 HOH A H1   1 
HETATM 1917 H H2   . HOH D 3 .  ? 17.111 42.299 1.495   1.00 0.00   ? 104 HOH A H2   1 
HETATM 1918 O O    . HOH D 3 .  ? 12.589 21.137 20.935  1.00 30.84  ? 105 HOH A O    1 
HETATM 1919 H H1   . HOH D 3 .  ? 12.791 22.061 20.902  1.00 0.00   ? 105 HOH A H1   1 
HETATM 1920 H H2   . HOH D 3 .  ? 12.792 20.820 20.046  1.00 0.00   ? 105 HOH A H2   1 
HETATM 1921 O O    . HOH D 3 .  ? 0.851  16.536 9.055   1.00 26.33  ? 106 HOH A O    1 
HETATM 1922 H H1   . HOH D 3 .  ? 0.247  17.273 9.286   1.00 0.00   ? 106 HOH A H1   1 
HETATM 1923 H H2   . HOH D 3 .  ? 0.434  16.147 8.288   1.00 0.00   ? 106 HOH A H2   1 
HETATM 1924 O O    . HOH D 3 .  ? 3.103  25.893 6.790   1.00 24.10  ? 107 HOH A O    1 
HETATM 1925 H H1   . HOH D 3 .  ? 3.380  26.800 6.951   1.00 0.00   ? 107 HOH A H1   1 
HETATM 1926 H H2   . HOH D 3 .  ? 3.326  25.761 5.860   1.00 0.00   ? 107 HOH A H2   1 
HETATM 1927 O O    . HOH D 3 .  ? 27.942 20.984 7.231   1.00 24.76  ? 108 HOH A O    1 
HETATM 1928 H H1   . HOH D 3 .  ? 27.830 21.921 7.347   1.00 0.00   ? 108 HOH A H1   1 
HETATM 1929 H H2   . HOH D 3 .  ? 27.755 20.761 6.312   1.00 0.00   ? 108 HOH A H2   1 
HETATM 1930 O O    . HOH D 3 .  ? 10.218 39.761 5.274   1.00 25.07  ? 109 HOH A O    1 
HETATM 1931 H H1   . HOH D 3 .  ? 10.630 40.615 5.425   1.00 0.00   ? 109 HOH A H1   1 
HETATM 1932 H H2   . HOH D 3 .  ? 10.611 39.481 4.444   1.00 0.00   ? 109 HOH A H2   1 
HETATM 1933 O O    . HOH D 3 .  ? 4.003  29.992 5.546   1.00 30.24  ? 110 HOH A O    1 
HETATM 1934 H H1   . HOH D 3 .  ? 3.970  30.938 5.384   1.00 0.00   ? 110 HOH A H1   1 
HETATM 1935 H H2   . HOH D 3 .  ? 3.761  29.587 4.693   1.00 0.00   ? 110 HOH A H2   1 
HETATM 1936 O O    . HOH D 3 .  ? 27.602 20.960 -0.572  1.00 27.46  ? 111 HOH A O    1 
HETATM 1937 H H1   . HOH D 3 .  ? 27.576 21.886 -0.302  1.00 0.00   ? 111 HOH A H1   1 
HETATM 1938 H H2   . HOH D 3 .  ? 27.796 21.004 -1.516  1.00 0.00   ? 111 HOH A H2   1 
HETATM 1939 O O    . HOH D 3 .  ? 34.156 27.926 1.402   1.00 31.86  ? 112 HOH A O    1 
HETATM 1940 H H1   . HOH D 3 .  ? 34.753 28.436 1.967   1.00 0.00   ? 112 HOH A H1   1 
HETATM 1941 H H2   . HOH D 3 .  ? 34.653 27.813 0.589   1.00 0.00   ? 112 HOH A H2   1 
HETATM 1942 O O    . HOH D 3 .  ? 28.261 27.540 5.059   1.00 24.50  ? 113 HOH A O    1 
HETATM 1943 H H1   . HOH D 3 .  ? 28.240 28.480 4.876   1.00 0.00   ? 113 HOH A H1   1 
HETATM 1944 H H2   . HOH D 3 .  ? 28.295 27.192 4.159   1.00 0.00   ? 113 HOH A H2   1 
HETATM 1945 O O    . HOH D 3 .  ? 23.721 41.302 0.080   1.00 31.53  ? 114 HOH A O    1 
HETATM 1946 H H1   . HOH D 3 .  ? 23.262 41.934 0.652   1.00 0.00   ? 114 HOH A H1   1 
HETATM 1947 H H2   . HOH D 3 .  ? 23.008 40.887 -0.408  1.00 0.00   ? 114 HOH A H2   1 
HETATM 1948 O O    . HOH D 3 .  ? 30.826 26.458 3.484   1.00 31.72  ? 115 HOH A O    1 
HETATM 1949 H H1   . HOH D 3 .  ? 30.659 27.362 3.780   1.00 0.00   ? 115 HOH A H1   1 
HETATM 1950 H H2   . HOH D 3 .  ? 31.231 26.590 2.623   1.00 0.00   ? 115 HOH A H2   1 
HETATM 1951 O O    . HOH D 3 .  ? 8.395  35.142 5.138   1.00 30.28  ? 116 HOH A O    1 
HETATM 1952 H H1   . HOH D 3 .  ? 8.281  36.092 5.056   1.00 0.00   ? 116 HOH A H1   1 
HETATM 1953 H H2   . HOH D 3 .  ? 8.290  34.867 4.225   1.00 0.00   ? 116 HOH A H2   1 
HETATM 1954 O O    . HOH D 3 .  ? 3.747  18.874 16.877  1.00 30.20  ? 117 HOH A O    1 
HETATM 1955 H H1   . HOH D 3 .  ? 3.639  19.778 17.151  1.00 0.00   ? 117 HOH A H1   1 
HETATM 1956 H H2   . HOH D 3 .  ? 3.534  18.800 15.945  1.00 0.00   ? 117 HOH A H2   1 
HETATM 1957 O O    . HOH D 3 .  ? 5.483  28.262 6.631   1.00 24.31  ? 118 HOH A O    1 
HETATM 1958 H H1   . HOH D 3 .  ? 4.919  29.063 6.602   1.00 0.00   ? 118 HOH A H1   1 
HETATM 1959 H H2   . HOH D 3 .  ? 5.444  27.997 5.705   1.00 0.00   ? 118 HOH A H2   1 
HETATM 1960 O O    . HOH D 3 .  ? 28.001 33.559 13.375  1.00 45.56  ? 119 HOH A O    1 
HETATM 1961 H H1   . HOH D 3 .  ? 27.910 34.509 13.239  1.00 0.00   ? 119 HOH A H1   1 
HETATM 1962 H H2   . HOH D 3 .  ? 28.041 33.228 12.470  1.00 0.00   ? 119 HOH A H2   1 
HETATM 1963 O O    . HOH D 3 .  ? 12.858 40.878 21.912  1.00 52.96  ? 120 HOH A O    1 
HETATM 1964 H H1   . HOH D 3 .  ? 12.508 41.676 22.315  1.00 0.00   ? 120 HOH A H1   1 
HETATM 1965 H H2   . HOH D 3 .  ? 12.083 40.565 21.441  1.00 0.00   ? 120 HOH A H2   1 
HETATM 1966 O O    . HOH D 3 .  ? -4.251 31.040 16.746  1.00 44.80  ? 121 HOH A O    1 
HETATM 1967 H H1   . HOH D 3 .  ? -3.804 31.886 16.749  1.00 0.00   ? 121 HOH A H1   1 
HETATM 1968 H H2   . HOH D 3 .  ? -3.806 30.622 16.002  1.00 0.00   ? 121 HOH A H2   1 
HETATM 1969 O O    . HOH D 3 .  ? 18.223 39.480 21.903  1.00 50.10  ? 122 HOH A O    1 
HETATM 1970 H H1   . HOH D 3 .  ? 17.826 40.348 22.028  1.00 0.00   ? 122 HOH A H1   1 
HETATM 1971 H H2   . HOH D 3 .  ? 17.709 39.128 21.166  1.00 0.00   ? 122 HOH A H2   1 
HETATM 1972 O O    . HOH D 3 .  ? 16.565 45.570 10.871  1.00 49.62  ? 123 HOH A O    1 
HETATM 1973 H H1   . HOH D 3 .  ? 16.907 46.441 11.102  1.00 0.00   ? 123 HOH A H1   1 
HETATM 1974 H H2   . HOH D 3 .  ? 17.225 45.219 10.266  1.00 0.00   ? 123 HOH A H2   1 
HETATM 1975 O O    . HOH D 3 .  ? 29.261 24.893 9.327   1.00 58.37  ? 124 HOH A O    1 
HETATM 1976 H H1   . HOH D 3 .  ? 28.907 25.762 9.136   1.00 0.00   ? 124 HOH A H1   1 
HETATM 1977 H H2   . HOH D 3 .  ? 29.002 24.418 8.533   1.00 0.00   ? 124 HOH A H2   1 
HETATM 1978 O O    . HOH D 3 .  ? 20.609 24.360 15.138  1.00 50.11  ? 125 HOH A O    1 
HETATM 1979 H H1   . HOH D 3 .  ? 21.061 25.183 15.358  1.00 0.00   ? 125 HOH A H1   1 
HETATM 1980 H H2   . HOH D 3 .  ? 21.122 24.002 14.408  1.00 0.00   ? 125 HOH A H2   1 
HETATM 1981 O O    . HOH D 3 .  ? 2.241  36.256 19.438  1.00 38.25  ? 126 HOH A O    1 
HETATM 1982 H H1   . HOH D 3 .  ? 1.887  37.145 19.377  1.00 0.00   ? 126 HOH A H1   1 
HETATM 1983 H H2   . HOH D 3 .  ? 1.973  35.811 18.640  1.00 0.00   ? 126 HOH A H2   1 
HETATM 1984 O O    . HOH D 3 .  ? 22.353 26.039 19.445  1.00 37.47  ? 127 HOH A O    1 
HETATM 1985 H H1   . HOH D 3 .  ? 21.732 26.710 19.719  1.00 0.00   ? 127 HOH A H1   1 
HETATM 1986 H H2   . HOH D 3 .  ? 21.939 25.565 18.718  1.00 0.00   ? 127 HOH A H2   1 
HETATM 1987 O O    . HOH D 3 .  ? 31.713 30.087 3.874   1.00 43.99  ? 128 HOH A O    1 
HETATM 1988 H H1   . HOH D 3 .  ? 32.011 30.972 4.134   1.00 0.00   ? 128 HOH A H1   1 
HETATM 1989 H H2   . HOH D 3 .  ? 32.404 29.813 3.271   1.00 0.00   ? 128 HOH A H2   1 
HETATM 1990 O O    . HOH D 3 .  ? 21.993 44.387 8.531   1.00 54.21  ? 129 HOH A O    1 
HETATM 1991 H H1   . HOH D 3 .  ? 21.693 45.306 8.388   1.00 0.00   ? 129 HOH A H1   1 
HETATM 1992 H H2   . HOH D 3 .  ? 21.885 44.057 7.628   1.00 0.00   ? 129 HOH A H2   1 
HETATM 1993 O O    . HOH D 3 .  ? 7.480  20.544 22.426  1.00 55.27  ? 130 HOH A O    1 
HETATM 1994 H H1   . HOH D 3 .  ? 8.084  21.231 22.719  1.00 0.00   ? 130 HOH A H1   1 
HETATM 1995 H H2   . HOH D 3 .  ? 8.046  19.957 21.917  1.00 0.00   ? 130 HOH A H2   1 
HETATM 1996 O O    . HOH D 3 .  ? 5.425  38.658 21.696  1.00 46.91  ? 131 HOH A O    1 
HETATM 1997 H H1   . HOH D 3 .  ? 5.890  39.428 22.029  1.00 0.00   ? 131 HOH A H1   1 
HETATM 1998 H H2   . HOH D 3 .  ? 6.037  38.398 21.000  1.00 0.00   ? 131 HOH A H2   1 
HETATM 1999 O O    . HOH D 3 .  ? 1.603  40.596 19.269  1.00 60.54  ? 132 HOH A O    1 
HETATM 2000 H H1   . HOH D 3 .  ? 1.812  41.519 19.454  1.00 0.00   ? 132 HOH A H1   1 
HETATM 2001 H H2   . HOH D 3 .  ? 1.770  40.517 18.330  1.00 0.00   ? 132 HOH A H2   1 
HETATM 2002 O O    . HOH D 3 .  ? 20.475 46.028 6.965   1.00 20.00  ? 133 HOH A O    1 
HETATM 2003 H H1   . HOH D 3 .  ? 20.287 46.968 6.954   1.00 0.00   ? 133 HOH A H1   1 
HETATM 2004 H H2   . HOH D 3 .  ? 20.251 45.743 6.081   1.00 0.00   ? 133 HOH A H2   1 
HETATM 2005 O O    . HOH D 3 .  ? -1.478 32.326 14.689  1.00 20.00  ? 134 HOH A O    1 
HETATM 2006 H H1   . HOH D 3 .  ? -1.322 33.260 14.953  1.00 0.00   ? 134 HOH A H1   1 
HETATM 2007 H H2   . HOH D 3 .  ? -1.511 32.346 13.721  1.00 0.00   ? 134 HOH A H2   1 
HETATM 2008 O O    . HOH D 3 .  ? 33.968 33.007 -0.466  1.00 20.00  ? 135 HOH A O    1 
HETATM 2009 H H1   . HOH D 3 .  ? 33.608 33.893 -0.629  1.00 0.00   ? 135 HOH A H1   1 
HETATM 2010 H H2   . HOH D 3 .  ? 33.783 32.592 -1.311  1.00 0.00   ? 135 HOH A H2   1 
HETATM 2011 O O    . HOH D 3 .  ? 28.676 37.306 -4.562  1.00 20.00  ? 136 HOH A O    1 
HETATM 2012 H H1   . HOH D 3 .  ? 28.757 38.248 -4.415  1.00 0.00   ? 136 HOH A H1   1 
HETATM 2013 H H2   . HOH D 3 .  ? 28.794 37.219 -5.505  1.00 0.00   ? 136 HOH A H2   1 
HETATM 2014 O O    . HOH D 3 .  ? 15.446 38.392 22.190  1.00 20.00  ? 137 HOH A O    1 
HETATM 2015 H H1   . HOH D 3 .  ? 15.291 39.331 22.263  1.00 0.00   ? 137 HOH A H1   1 
HETATM 2016 H H2   . HOH D 3 .  ? 15.412 38.218 21.245  1.00 0.00   ? 137 HOH A H2   1 
HETATM 2017 O O    . HOH D 3 .  ? 33.585 32.949 2.406   1.00 20.00  ? 138 HOH A O    1 
HETATM 2018 H H1   . HOH D 3 .  ? 33.477 33.899 2.445   1.00 0.00   ? 138 HOH A H1   1 
HETATM 2019 H H2   . HOH D 3 .  ? 33.627 32.787 1.450   1.00 0.00   ? 138 HOH A H2   1 
HETATM 2020 O O    . HOH D 3 .  ? 12.913 17.324 16.587  1.00 20.00  ? 139 HOH A O    1 
HETATM 2021 H H1   . HOH D 3 .  ? 12.650 18.243 16.595  1.00 0.00   ? 139 HOH A H1   1 
HETATM 2022 H H2   . HOH D 3 .  ? 12.615 17.022 15.717  1.00 0.00   ? 139 HOH A H2   1 
HETATM 2023 O O    . HOH D 3 .  ? 23.152 45.834 15.537  1.00 20.00  ? 140 HOH A O    1 
HETATM 2024 H H1   . HOH D 3 .  ? 23.577 46.691 15.585  1.00 0.00   ? 140 HOH A H1   1 
HETATM 2025 H H2   . HOH D 3 .  ? 23.663 45.334 14.901  1.00 0.00   ? 140 HOH A H2   1 
HETATM 2026 O O    . HOH D 3 .  ? 5.929  36.518 9.222   1.00 20.00  ? 141 HOH A O    1 
HETATM 2027 H H1   . HOH D 3 .  ? 6.204  37.434 9.288   1.00 0.00   ? 141 HOH A H1   1 
HETATM 2028 H H2   . HOH D 3 .  ? 6.277  36.224 8.383   1.00 0.00   ? 141 HOH A H2   1 
HETATM 2029 O O    . HOH E 3 .  ? 10.725 20.624 5.870   1.00 12.67  ? 302 HOH B O    1 
HETATM 2030 H H1   . HOH E 3 .  ? 10.618 21.611 5.875   1.00 0.00   ? 302 HOH B H1   1 
HETATM 2031 H H2   . HOH E 3 .  ? 11.547 20.566 5.307   1.00 0.00   ? 302 HOH B H2   1 
HETATM 2032 O O    . HOH E 3 .  ? 21.776 23.154 4.776   1.00 17.14  ? 303 HOH B O    1 
HETATM 2033 H H1   . HOH E 3 .  ? 21.652 24.102 4.592   1.00 0.00   ? 303 HOH B H1   1 
HETATM 2034 H H2   . HOH E 3 .  ? 21.903 22.820 3.884   1.00 0.00   ? 303 HOH B H2   1 
HETATM 2035 O O    . HOH E 3 .  ? 25.894 16.239 -6.045  1.00 16.22  ? 304 HOH B O    1 
HETATM 2036 H H1   . HOH E 3 .  ? 26.322 17.063 -5.742  1.00 0.00   ? 304 HOH B H1   1 
HETATM 2037 H H2   . HOH E 3 .  ? 26.521 15.959 -6.723  1.00 0.00   ? 304 HOH B H2   1 
HETATM 2038 O O    . HOH E 3 .  ? 29.166 16.019 -11.653 1.00 22.58  ? 305 HOH B O    1 
HETATM 2039 H H1   . HOH E 3 .  ? 28.600 16.782 -11.454 1.00 0.00   ? 305 HOH B H1   1 
HETATM 2040 H H2   . HOH E 3 .  ? 28.671 15.547 -12.314 1.00 0.00   ? 305 HOH B H2   1 
HETATM 2041 O O    . HOH E 3 .  ? 21.025 15.597 -3.790  1.00 18.73  ? 306 HOH B O    1 
HETATM 2042 H H1   . HOH E 3 .  ? 21.374 16.486 -3.814  1.00 0.00   ? 306 HOH B H1   1 
HETATM 2043 H H2   . HOH E 3 .  ? 21.101 15.349 -4.732  1.00 0.00   ? 306 HOH B H2   1 
HETATM 2044 O O    . HOH E 3 .  ? 28.998 28.133 -2.313  1.00 23.81  ? 307 HOH B O    1 
HETATM 2045 H H1   . HOH E 3 .  ? 28.459 28.946 -2.316  1.00 0.00   ? 307 HOH B H1   1 
HETATM 2046 H H2   . HOH E 3 .  ? 28.717 27.744 -3.144  1.00 0.00   ? 307 HOH B H2   1 
HETATM 2047 O O    . HOH E 3 .  ? 16.513 44.700 -0.204  1.00 25.39  ? 308 HOH B O    1 
HETATM 2048 H H1   . HOH E 3 .  ? 16.584 45.658 -0.039  1.00 0.00   ? 308 HOH B H1   1 
HETATM 2049 H H2   . HOH E 3 .  ? 16.746 44.652 -1.137  1.00 0.00   ? 308 HOH B H2   1 
HETATM 2050 O O    . HOH E 3 .  ? 26.148 12.286 -8.352  1.00 25.00  ? 309 HOH B O    1 
HETATM 2051 H H1   . HOH E 3 .  ? 26.643 13.082 -8.154  1.00 0.00   ? 309 HOH B H1   1 
HETATM 2052 H H2   . HOH E 3 .  ? 26.744 11.868 -8.990  1.00 0.00   ? 309 HOH B H2   1 
HETATM 2053 O O    . HOH E 3 .  ? 7.881  23.062 -7.137  1.00 30.19  ? 310 HOH B O    1 
HETATM 2054 H H1   . HOH E 3 .  ? 8.043  24.012 -7.064  1.00 0.00   ? 310 HOH B H1   1 
HETATM 2055 H H2   . HOH E 3 .  ? 8.163  22.883 -8.041  1.00 0.00   ? 310 HOH B H2   1 
HETATM 2056 O O    . HOH E 3 .  ? 21.594 7.037  -10.717 1.00 23.62  ? 311 HOH B O    1 
HETATM 2057 H H1   . HOH E 3 .  ? 21.409 7.888  -11.137 1.00 0.00   ? 311 HOH B H1   1 
HETATM 2058 H H2   . HOH E 3 .  ? 21.536 6.434  -11.458 1.00 0.00   ? 311 HOH B H2   1 
HETATM 2059 O O    . HOH E 3 .  ? 13.429 15.704 10.868  1.00 23.47  ? 312 HOH B O    1 
HETATM 2060 H H1   . HOH E 3 .  ? 13.289 16.656 10.761  1.00 0.00   ? 312 HOH B H1   1 
HETATM 2061 H H2   . HOH E 3 .  ? 13.520 15.470 9.947   1.00 0.00   ? 312 HOH B H2   1 
HETATM 2062 O O    . HOH E 3 .  ? 17.154 26.821 -16.490 1.00 30.63  ? 313 HOH B O    1 
HETATM 2063 H H1   . HOH E 3 .  ? 16.405 27.432 -16.380 1.00 0.00   ? 313 HOH B H1   1 
HETATM 2064 H H2   . HOH E 3 .  ? 16.912 26.285 -17.250 1.00 0.00   ? 313 HOH B H2   1 
HETATM 2065 O O    . HOH E 3 .  ? 6.549  34.289 -2.272  1.00 22.25  ? 314 HOH B O    1 
HETATM 2066 H H1   . HOH E 3 .  ? 6.353  35.214 -2.433  1.00 0.00   ? 314 HOH B H1   1 
HETATM 2067 H H2   . HOH E 3 .  ? 6.558  33.914 -3.162  1.00 0.00   ? 314 HOH B H2   1 
HETATM 2068 O O    . HOH E 3 .  ? 12.242 39.112 -3.480  1.00 32.89  ? 315 HOH B O    1 
HETATM 2069 H H1   . HOH E 3 .  ? 12.582 40.006 -3.555  1.00 0.00   ? 315 HOH B H1   1 
HETATM 2070 H H2   . HOH E 3 .  ? 12.460 38.715 -4.329  1.00 0.00   ? 315 HOH B H2   1 
HETATM 2071 O O    . HOH E 3 .  ? 13.276 35.689 -3.691  1.00 37.83  ? 316 HOH B O    1 
HETATM 2072 H H1   . HOH E 3 .  ? 13.791 36.411 -3.271  1.00 0.00   ? 316 HOH B H1   1 
HETATM 2073 H H2   . HOH E 3 .  ? 13.402 35.798 -4.626  1.00 0.00   ? 316 HOH B H2   1 
HETATM 2074 O O    . HOH E 3 .  ? 26.377 26.607 -17.439 1.00 42.37  ? 317 HOH B O    1 
HETATM 2075 H H1   . HOH E 3 .  ? 26.518 27.499 -17.760 1.00 0.00   ? 317 HOH B H1   1 
HETATM 2076 H H2   . HOH E 3 .  ? 26.488 26.091 -18.244 1.00 0.00   ? 317 HOH B H2   1 
HETATM 2077 O O    . HOH E 3 .  ? 5.986  14.596 -5.260  1.00 45.62  ? 318 HOH B O    1 
HETATM 2078 H H1   . HOH E 3 .  ? 5.516  15.367 -4.892  1.00 0.00   ? 318 HOH B H1   1 
HETATM 2079 H H2   . HOH E 3 .  ? 5.482  14.553 -6.064  1.00 0.00   ? 318 HOH B H2   1 
HETATM 2080 O O    . HOH E 3 .  ? 14.295 4.799  -0.308  1.00 33.45  ? 319 HOH B O    1 
HETATM 2081 H H1   . HOH E 3 .  ? 14.303 5.739  -0.096  1.00 0.00   ? 319 HOH B H1   1 
HETATM 2082 H H2   . HOH E 3 .  ? 14.205 4.826  -1.267  1.00 0.00   ? 319 HOH B H2   1 
HETATM 2083 O O    . HOH E 3 .  ? 8.243  7.976  3.756   1.00 46.29  ? 320 HOH B O    1 
HETATM 2084 H H1   . HOH E 3 .  ? 8.373  8.920  3.706   1.00 0.00   ? 320 HOH B H1   1 
HETATM 2085 H H2   . HOH E 3 .  ? 8.467  7.614  2.899   1.00 0.00   ? 320 HOH B H2   1 
HETATM 2086 O O    . HOH E 3 .  ? 14.148 31.389 -13.076 1.00 28.89  ? 321 HOH B O    1 
HETATM 2087 H H1   . HOH E 3 .  ? 14.253 32.335 -12.910 1.00 0.00   ? 321 HOH B H1   1 
HETATM 2088 H H2   . HOH E 3 .  ? 14.313 31.314 -14.016 1.00 0.00   ? 321 HOH B H2   1 
HETATM 2089 O O    . HOH E 3 .  ? 5.794  28.934 -4.000  1.00 50.96  ? 322 HOH B O    1 
HETATM 2090 H H1   . HOH E 3 .  ? 6.202  29.792 -3.856  1.00 0.00   ? 322 HOH B H1   1 
HETATM 2091 H H2   . HOH E 3 .  ? 6.215  28.622 -4.804  1.00 0.00   ? 322 HOH B H2   1 
HETATM 2092 O O    . HOH E 3 .  ? 22.549 9.368  -14.959 1.00 52.25  ? 323 HOH B O    1 
HETATM 2093 H H1   . HOH E 3 .  ? 22.251 10.262 -14.752 1.00 0.00   ? 323 HOH B H1   1 
HETATM 2094 H H2   . HOH E 3 .  ? 21.997 9.125  -15.703 1.00 0.00   ? 323 HOH B H2   1 
HETATM 2095 O O    . HOH E 3 .  ? 6.515  15.472 2.608   1.00 53.74  ? 324 HOH B O    1 
HETATM 2096 H H1   . HOH E 3 .  ? 6.357  16.388 2.369   1.00 0.00   ? 324 HOH B H1   1 
HETATM 2097 H H2   . HOH E 3 .  ? 6.583  15.021 1.751   1.00 0.00   ? 324 HOH B H2   1 
HETATM 2098 O O    . HOH E 3 .  ? 9.882  7.201  -2.671  1.00 30.36  ? 325 HOH B O    1 
HETATM 2099 H H1   . HOH E 3 .  ? 10.103 8.130  -2.591  1.00 0.00   ? 325 HOH B H1   1 
HETATM 2100 H H2   . HOH E 3 .  ? 10.056 7.004  -3.595  1.00 0.00   ? 325 HOH B H2   1 
HETATM 2101 O O    . HOH E 3 .  ? 29.081 34.216 -5.700  1.00 43.76  ? 326 HOH B O    1 
HETATM 2102 H H1   . HOH E 3 .  ? 28.628 35.040 -5.871  1.00 0.00   ? 326 HOH B H1   1 
HETATM 2103 H H2   . HOH E 3 .  ? 28.695 33.606 -6.354  1.00 0.00   ? 326 HOH B H2   1 
HETATM 2104 O O    . HOH E 3 .  ? 4.506  15.252 12.028  1.00 40.54  ? 327 HOH B O    1 
HETATM 2105 H H1   . HOH E 3 .  ? 4.496  16.211 11.971  1.00 0.00   ? 327 HOH B H1   1 
HETATM 2106 H H2   . HOH E 3 .  ? 4.663  14.986 11.112  1.00 0.00   ? 327 HOH B H2   1 
HETATM 2107 O O    . HOH E 3 .  ? 9.820  17.490 13.926  1.00 32.89  ? 328 HOH B O    1 
HETATM 2108 H H1   . HOH E 3 .  ? 9.749  18.441 14.062  1.00 0.00   ? 328 HOH B H1   1 
HETATM 2109 H H2   . HOH E 3 .  ? 9.605  17.430 12.986  1.00 0.00   ? 328 HOH B H2   1 
HETATM 2110 O O    . HOH E 3 .  ? 20.572 14.894 3.719   1.00 38.92  ? 329 HOH B O    1 
HETATM 2111 H H1   . HOH E 3 .  ? 21.281 15.529 3.883   1.00 0.00   ? 329 HOH B H1   1 
HETATM 2112 H H2   . HOH E 3 .  ? 20.941 14.341 3.018   1.00 0.00   ? 329 HOH B H2   1 
HETATM 2113 O O    . HOH E 3 .  ? 18.087 14.569 6.292   1.00 33.69  ? 330 HOH B O    1 
HETATM 2114 H H1   . HOH E 3 .  ? 18.300 15.512 6.300   1.00 0.00   ? 330 HOH B H1   1 
HETATM 2115 H H2   . HOH E 3 .  ? 18.515 14.273 5.476   1.00 0.00   ? 330 HOH B H2   1 
HETATM 2116 O O    . HOH E 3 .  ? 20.049 21.301 6.233   1.00 35.86  ? 331 HOH B O    1 
HETATM 2117 H H1   . HOH E 3 .  ? 20.045 22.230 6.492   1.00 0.00   ? 331 HOH B H1   1 
HETATM 2118 H H2   . HOH E 3 .  ? 19.776 21.406 5.323   1.00 0.00   ? 331 HOH B H2   1 
HETATM 2119 O O    . HOH E 3 .  ? 23.183 12.272 -0.947  1.00 56.51  ? 332 HOH B O    1 
HETATM 2120 H H1   . HOH E 3 .  ? 22.758 13.116 -0.812  1.00 0.00   ? 332 HOH B H1   1 
HETATM 2121 H H2   . HOH E 3 .  ? 22.732 11.875 -1.689  1.00 0.00   ? 332 HOH B H2   1 
HETATM 2122 O O    . HOH E 3 .  ? 28.323 25.703 -13.737 1.00 41.85  ? 333 HOH B O    1 
HETATM 2123 H H1   . HOH E 3 .  ? 28.204 26.604 -14.017 1.00 0.00   ? 333 HOH B H1   1 
HETATM 2124 H H2   . HOH E 3 .  ? 27.893 25.182 -14.427 1.00 0.00   ? 333 HOH B H2   1 
HETATM 2125 O O    . HOH E 3 .  ? 5.385  22.399 -7.937  1.00 45.05  ? 334 HOH B O    1 
HETATM 2126 H H1   . HOH E 3 .  ? 6.094  22.764 -7.384  1.00 0.00   ? 334 HOH B H1   1 
HETATM 2127 H H2   . HOH E 3 .  ? 5.863  21.782 -8.485  1.00 0.00   ? 334 HOH B H2   1 
HETATM 2128 O O    . HOH E 3 .  ? 6.895  36.301 1.484   1.00 33.10  ? 335 HOH B O    1 
HETATM 2129 H H1   . HOH E 3 .  ? 7.214  37.197 1.651   1.00 0.00   ? 335 HOH B H1   1 
HETATM 2130 H H2   . HOH E 3 .  ? 7.174  36.154 0.578   1.00 0.00   ? 335 HOH B H2   1 
HETATM 2131 O O    . HOH E 3 .  ? 27.465 18.642 3.112   1.00 46.63  ? 336 HOH B O    1 
HETATM 2132 H H1   . HOH E 3 .  ? 27.570 19.594 3.078   1.00 0.00   ? 336 HOH B H1   1 
HETATM 2133 H H2   . HOH E 3 .  ? 27.300 18.415 2.195   1.00 0.00   ? 336 HOH B H2   1 
HETATM 2134 O O    . HOH E 3 .  ? 8.892  13.050 -16.131 1.00 37.03  ? 337 HOH B O    1 
HETATM 2135 H H1   . HOH E 3 .  ? 9.343  13.908 -16.294 1.00 0.00   ? 337 HOH B H1   1 
HETATM 2136 H H2   . HOH E 3 .  ? 9.003  12.609 -16.973 1.00 0.00   ? 337 HOH B H2   1 
HETATM 2137 O O    . HOH E 3 .  ? 9.496  10.653 11.079  1.00 49.85  ? 338 HOH B O    1 
HETATM 2138 H H1   . HOH E 3 .  ? 9.144  11.537 10.970  1.00 0.00   ? 338 HOH B H1   1 
HETATM 2139 H H2   . HOH E 3 .  ? 9.246  10.191 10.268  1.00 0.00   ? 338 HOH B H2   1 
HETATM 2140 O O    . HOH E 3 .  ? 25.349 18.818 0.528   1.00 32.02  ? 339 HOH B O    1 
HETATM 2141 H H1   . HOH E 3 .  ? 25.558 19.739 0.694   1.00 0.00   ? 339 HOH B H1   1 
HETATM 2142 H H2   . HOH E 3 .  ? 25.360 18.800 -0.426  1.00 0.00   ? 339 HOH B H2   1 
HETATM 2143 O O    . HOH E 3 .  ? 1.905  29.224 3.423   1.00 41.27  ? 340 HOH B O    1 
HETATM 2144 H H1   . HOH E 3 .  ? 1.559  30.112 3.297   1.00 0.00   ? 340 HOH B H1   1 
HETATM 2145 H H2   . HOH E 3 .  ? 1.555  28.737 2.652   1.00 0.00   ? 340 HOH B H2   1 
HETATM 2146 O O    . HOH E 3 .  ? 16.308 16.089 10.706  1.00 40.61  ? 341 HOH B O    1 
HETATM 2147 H H1   . HOH E 3 .  ? 16.223 17.041 10.728  1.00 0.00   ? 341 HOH B H1   1 
HETATM 2148 H H2   . HOH E 3 .  ? 16.276 15.884 9.775   1.00 0.00   ? 341 HOH B H2   1 
HETATM 2149 O O    . HOH E 3 .  ? 24.944 7.526  -13.722 1.00 51.35  ? 342 HOH B O    1 
HETATM 2150 H H1   . HOH E 3 .  ? 24.352 8.278  -13.601 1.00 0.00   ? 342 HOH B H1   1 
HETATM 2151 H H2   . HOH E 3 .  ? 24.600 7.118  -14.510 1.00 0.00   ? 342 HOH B H2   1 
HETATM 2152 O O    . HOH E 3 .  ? 15.169 28.883 -17.190 1.00 45.98  ? 343 HOH B O    1 
HETATM 2153 H H1   . HOH E 3 .  ? 15.589 29.745 -17.187 1.00 0.00   ? 343 HOH B H1   1 
HETATM 2154 H H2   . HOH E 3 .  ? 15.484 28.466 -17.997 1.00 0.00   ? 343 HOH B H2   1 
HETATM 2155 O O    . HOH E 3 .  ? 31.457 26.818 -5.413  1.00 20.00  ? 344 HOH B O    1 
HETATM 2156 H H1   . HOH E 3 .  ? 31.265 27.749 -5.533  1.00 0.00   ? 344 HOH B H1   1 
HETATM 2157 H H2   . HOH E 3 .  ? 31.220 26.412 -6.249  1.00 0.00   ? 344 HOH B H2   1 
HETATM 2158 O O    . HOH E 3 .  ? 7.151  22.760 -11.574 1.00 20.00  ? 345 HOH B O    1 
HETATM 2159 H H1   . HOH E 3 .  ? 6.801  23.657 -11.517 1.00 0.00   ? 345 HOH B H1   1 
HETATM 2160 H H2   . HOH E 3 .  ? 6.926  22.512 -12.480 1.00 0.00   ? 345 HOH B H2   1 
HETATM 2161 O O    . HOH E 3 .  ? 7.291  5.871  -8.370  1.00 20.00  ? 346 HOH B O    1 
HETATM 2162 H H1   . HOH E 3 .  ? 7.461  6.806  -8.348  1.00 0.00   ? 346 HOH B H1   1 
HETATM 2163 H H2   . HOH E 3 .  ? 7.477  5.613  -9.274  1.00 0.00   ? 346 HOH B H2   1 
HETATM 2164 O O    . HOH E 3 .  ? 7.505  40.126 1.858   1.00 20.00  ? 347 HOH B O    1 
HETATM 2165 H H1   . HOH E 3 .  ? 7.774  41.039 1.881   1.00 0.00   ? 347 HOH B H1   1 
HETATM 2166 H H2   . HOH E 3 .  ? 7.874  39.756 1.058   1.00 0.00   ? 347 HOH B H2   1 
HETATM 2167 O O    . HOH E 3 .  ? 2.181  26.803 2.127   1.00 20.00  ? 348 HOH B O    1 
HETATM 2168 H H1   . HOH E 3 .  ? 2.789  27.514 2.324   1.00 0.00   ? 348 HOH B H1   1 
HETATM 2169 H H2   . HOH E 3 .  ? 2.615  26.380 1.377   1.00 0.00   ? 348 HOH B H2   1 
HETATM 2170 O O    . HOH E 3 .  ? 28.222 18.715 -5.443  1.00 20.00  ? 349 HOH B O    1 
HETATM 2171 H H1   . HOH E 3 .  ? 27.884 19.622 -5.397  1.00 0.00   ? 349 HOH B H1   1 
HETATM 2172 H H2   . HOH E 3 .  ? 28.387 18.553 -6.379  1.00 0.00   ? 349 HOH B H2   1 
HETATM 2173 O O    . HOH E 3 .  ? 28.647 31.839 -10.496 1.00 20.00  ? 350 HOH B O    1 
HETATM 2174 H H1   . HOH E 3 .  ? 28.039 32.589 -10.343 1.00 0.00   ? 350 HOH B H1   1 
HETATM 2175 H H2   . HOH E 3 .  ? 28.159 31.417 -11.195 1.00 0.00   ? 350 HOH B H2   1 
HETATM 2176 O O    . HOH E 3 .  ? 7.782  33.972 -5.591  1.00 20.00  ? 351 HOH B O    1 
HETATM 2177 H H1   . HOH E 3 .  ? 8.148  34.862 -5.548  1.00 0.00   ? 351 HOH B H1   1 
HETATM 2178 H H2   . HOH E 3 .  ? 8.108  33.702 -6.448  1.00 0.00   ? 351 HOH B H2   1 
HETATM 2179 O O    . HOH E 3 .  ? 1.878  29.722 -0.827  1.00 20.00  ? 352 HOH B O    1 
HETATM 2180 H H1   . HOH E 3 .  ? 1.829  30.680 -0.833  1.00 0.00   ? 352 HOH B H1   1 
HETATM 2181 H H2   . HOH E 3 .  ? 1.840  29.482 -1.752  1.00 0.00   ? 352 HOH B H2   1 
HETATM 2182 O O    . HOH E 3 .  ? 22.695 6.291  -6.675  1.00 20.00  ? 353 HOH B O    1 
HETATM 2183 H H1   . HOH E 3 .  ? 22.505 7.222  -6.659  1.00 0.00   ? 353 HOH B H1   1 
HETATM 2184 H H2   . HOH E 3 .  ? 22.487 6.018  -7.576  1.00 0.00   ? 353 HOH B H2   1 
HETATM 2185 O O    . HOH E 3 .  ? 24.406 15.840 2.350   1.00 20.00  ? 354 HOH B O    1 
HETATM 2186 H H1   . HOH E 3 .  ? 24.572 16.782 2.197   1.00 0.00   ? 354 HOH B H1   1 
HETATM 2187 H H2   . HOH E 3 .  ? 24.510 15.455 1.481   1.00 0.00   ? 354 HOH B H2   1 
HETATM 2188 O O    . HOH E 3 .  ? 18.295 13.225 -16.280 1.00 20.00  ? 355 HOH B O    1 
HETATM 2189 H H1   . HOH E 3 .  ? 18.329 14.178 -16.206 1.00 0.00   ? 355 HOH B H1   1 
HETATM 2190 H H2   . HOH E 3 .  ? 18.315 13.043 -17.222 1.00 0.00   ? 355 HOH B H2   1 
HETATM 2191 O O    . HOH E 3 .  ? 25.790 44.461 -5.203  1.00 20.00  ? 356 HOH B O    1 
HETATM 2192 H H1   . HOH E 3 .  ? 25.523 45.379 -5.184  1.00 0.00   ? 356 HOH B H1   1 
HETATM 2193 H H2   . HOH E 3 .  ? 25.522 44.200 -6.088  1.00 0.00   ? 356 HOH B H2   1 
HETATM 2194 O O    . HOH E 3 .  ? 11.938 15.371 13.091  1.00 20.00  ? 357 HOH B O    1 
HETATM 2195 H H1   . HOH E 3 .  ? 12.008 16.326 13.082  1.00 0.00   ? 357 HOH B H1   1 
HETATM 2196 H H2   . HOH E 3 .  ? 12.350 15.092 12.268  1.00 0.00   ? 357 HOH B H2   1 
HETATM 2197 O O    . HOH E 3 .  ? 29.344 20.486 -3.440  1.00 20.00  ? 358 HOH B O    1 
HETATM 2198 H H1   . HOH E 3 .  ? 29.063 21.400 -3.598  1.00 0.00   ? 358 HOH B H1   1 
HETATM 2199 H H2   . HOH E 3 .  ? 29.327 20.051 -4.301  1.00 0.00   ? 358 HOH B H2   1 
HETATM 2200 O O    . HOH E 3 .  ? 4.192  16.357 -5.770  1.00 20.00  ? 359 HOH B O    1 
HETATM 2201 H H1   . HOH E 3 .  ? 3.785  17.173 -5.438  1.00 0.00   ? 359 HOH B H1   1 
HETATM 2202 H H2   . HOH E 3 .  ? 3.846  16.329 -6.657  1.00 0.00   ? 359 HOH B H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  GLN 2  2  2  GLN GLN A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  TRP 6  6  6  TRP TRP A . n 
A 1 7  GLN 7  7  7  GLN GLN A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 THR 12 12 12 THR THR A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 MET 36 36 36 MET MET A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 MET 46 46 46 MET MET A . n 
A 1 47 ILE 47 47 47 ILE ILE A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 PHE 53 53 53 PHE PHE A . n 
A 1 54 ILE 54 54 54 ILE ILE A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 LEU 63 63 63 LEU LEU A . n 
A 1 64 ILE 64 64 64 ILE ILE A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 CYS 67 67 67 CYS CYS A . n 
A 1 68 GLY 68 68 68 GLY GLY A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 LYS 70 70 70 LYS LYS A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 ILE 72 72 72 ILE ILE A . n 
A 1 73 GLY 73 73 73 GLY GLY A . n 
A 1 74 THR 74 74 74 THR THR A . n 
A 1 75 VAL 75 75 75 VAL VAL A . n 
A 1 76 LEU 76 76 76 LEU LEU A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 THR 80 80 80 THR THR A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 VAL 82 82 82 VAL VAL A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 ILE 84 84 84 ILE ILE A . n 
A 1 85 ILE 85 85 85 ILE ILE A . n 
A 1 86 GLY 86 86 86 GLY GLY A . n 
A 1 87 ARG 87 87 87 ARG ARG A . n 
A 1 88 ASN 88 88 88 ASN ASN A . n 
A 1 89 LEU 89 89 89 LEU LEU A . n 
A 1 90 LEU 90 90 90 LEU LEU A . n 
A 1 91 THR 91 91 91 THR THR A . n 
A 1 92 GLN 92 92 92 GLN GLN A . n 
A 1 93 ILE 93 93 93 ILE ILE A . n 
A 1 94 GLY 94 94 94 GLY GLY A . n 
A 1 95 CYS 95 95 95 CYS CYS A . n 
A 1 96 THR 96 96 96 THR THR A . n 
A 1 97 LEU 97 97 97 LEU LEU A . n 
A 1 98 ASN 98 98 98 ASN ASN A . n 
A 1 99 PHE 99 99 99 PHE PHE A . n 
B 1 1  PRO 1  1  1  PRO PRO B . n 
B 1 2  GLN 2  2  2  GLN GLN B . n 
B 1 3  ILE 3  3  3  ILE ILE B . n 
B 1 4  THR 4  4  4  THR THR B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  TRP 6  6  6  TRP TRP B . n 
B 1 7  GLN 7  7  7  GLN GLN B . n 
B 1 8  ARG 8  8  8  ARG ARG B . n 
B 1 9  PRO 9  9  9  PRO PRO B . n 
B 1 10 LEU 10 10 10 LEU LEU B . n 
B 1 11 VAL 11 11 11 VAL VAL B . n 
B 1 12 THR 12 12 12 THR THR B . n 
B 1 13 ILE 13 13 13 ILE ILE B . n 
B 1 14 LYS 14 14 14 LYS LYS B . n 
B 1 15 ILE 15 15 15 ILE ILE B . n 
B 1 16 GLY 16 16 16 GLY GLY B . n 
B 1 17 GLY 17 17 17 GLY GLY B . n 
B 1 18 GLN 18 18 18 GLN GLN B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 LYS 20 20 20 LYS LYS B . n 
B 1 21 GLU 21 21 21 GLU GLU B . n 
B 1 22 ALA 22 22 22 ALA ALA B . n 
B 1 23 LEU 23 23 23 LEU LEU B . n 
B 1 24 LEU 24 24 24 LEU LEU B . n 
B 1 25 ASP 25 25 25 ASP ASP B . n 
B 1 26 THR 26 26 26 THR THR B . n 
B 1 27 GLY 27 27 27 GLY GLY B . n 
B 1 28 ALA 28 28 28 ALA ALA B . n 
B 1 29 ASP 29 29 29 ASP ASP B . n 
B 1 30 ASP 30 30 30 ASP ASP B . n 
B 1 31 THR 31 31 31 THR THR B . n 
B 1 32 VAL 32 32 32 VAL VAL B . n 
B 1 33 LEU 33 33 33 LEU LEU B . n 
B 1 34 GLU 34 34 34 GLU GLU B . n 
B 1 35 GLU 35 35 35 GLU GLU B . n 
B 1 36 MET 36 36 36 MET MET B . n 
B 1 37 ASN 37 37 37 ASN ASN B . n 
B 1 38 LEU 38 38 38 LEU LEU B . n 
B 1 39 PRO 39 39 39 PRO PRO B . n 
B 1 40 GLY 40 40 40 GLY GLY B . n 
B 1 41 ARG 41 41 41 ARG ARG B . n 
B 1 42 TRP 42 42 42 TRP TRP B . n 
B 1 43 LYS 43 43 43 LYS LYS B . n 
B 1 44 PRO 44 44 44 PRO PRO B . n 
B 1 45 LYS 45 45 45 LYS LYS B . n 
B 1 46 MET 46 46 46 MET MET B . n 
B 1 47 ILE 47 47 47 ILE ILE B . n 
B 1 48 GLY 48 48 48 GLY GLY B . n 
B 1 49 GLY 49 49 49 GLY GLY B . n 
B 1 50 ILE 50 50 50 ILE ILE B . n 
B 1 51 GLY 51 51 51 GLY GLY B . n 
B 1 52 GLY 52 52 52 GLY GLY B . n 
B 1 53 PHE 53 53 53 PHE PHE B . n 
B 1 54 ILE 54 54 54 ILE ILE B . n 
B 1 55 LYS 55 55 55 LYS LYS B . n 
B 1 56 VAL 56 56 56 VAL VAL B . n 
B 1 57 ARG 57 57 57 ARG ARG B . n 
B 1 58 GLN 58 58 58 GLN GLN B . n 
B 1 59 TYR 59 59 59 TYR TYR B . n 
B 1 60 ASP 60 60 60 ASP ASP B . n 
B 1 61 GLN 61 61 61 GLN GLN B . n 
B 1 62 ILE 62 62 62 ILE ILE B . n 
B 1 63 LEU 63 63 63 LEU LEU B . n 
B 1 64 ILE 64 64 64 ILE ILE B . n 
B 1 65 GLU 65 65 65 GLU GLU B . n 
B 1 66 ILE 66 66 66 ILE ILE B . n 
B 1 67 CYS 67 67 67 CYS CYS B . n 
B 1 68 GLY 68 68 68 GLY GLY B . n 
B 1 69 HIS 69 69 69 HIS HIS B . n 
B 1 70 LYS 70 70 70 LYS LYS B . n 
B 1 71 ALA 71 71 71 ALA ALA B . n 
B 1 72 ILE 72 72 72 ILE ILE B . n 
B 1 73 GLY 73 73 73 GLY GLY B . n 
B 1 74 THR 74 74 74 THR THR B . n 
B 1 75 VAL 75 75 75 VAL VAL B . n 
B 1 76 LEU 76 76 76 LEU LEU B . n 
B 1 77 VAL 77 77 77 VAL VAL B . n 
B 1 78 GLY 78 78 78 GLY GLY B . n 
B 1 79 PRO 79 79 79 PRO PRO B . n 
B 1 80 THR 80 80 80 THR THR B . n 
B 1 81 PRO 81 81 81 PRO PRO B . n 
B 1 82 VAL 82 82 82 VAL VAL B . n 
B 1 83 ASN 83 83 83 ASN ASN B . n 
B 1 84 ILE 84 84 84 ILE ILE B . n 
B 1 85 ILE 85 85 85 ILE ILE B . n 
B 1 86 GLY 86 86 86 GLY GLY B . n 
B 1 87 ARG 87 87 87 ARG ARG B . n 
B 1 88 ASN 88 88 88 ASN ASN B . n 
B 1 89 LEU 89 89 89 LEU LEU B . n 
B 1 90 LEU 90 90 90 LEU LEU B . n 
B 1 91 THR 91 91 91 THR THR B . n 
B 1 92 GLN 92 92 92 GLN GLN B . n 
B 1 93 ILE 93 93 93 ILE ILE B . n 
B 1 94 GLY 94 94 94 GLY GLY B . n 
B 1 95 CYS 95 95 95 CYS CYS B . n 
B 1 96 THR 96 96 96 THR THR B . n 
B 1 97 LEU 97 97 97 LEU LEU B . n 
B 1 98 ASN 98 98 98 ASN ASN B . n 
B 1 99 PHE 99 99 99 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 RIT 1  301 301 RIT RIT B . 
D 3 HOH 1  100 3   HOH HOH A . 
D 3 HOH 2  101 5   HOH HOH A . 
D 3 HOH 3  102 6   HOH HOH A . 
D 3 HOH 4  103 7   HOH HOH A . 
D 3 HOH 5  104 8   HOH HOH A . 
D 3 HOH 6  105 10  HOH HOH A . 
D 3 HOH 7  106 13  HOH HOH A . 
D 3 HOH 8  107 14  HOH HOH A . 
D 3 HOH 9  108 15  HOH HOH A . 
D 3 HOH 10 109 16  HOH HOH A . 
D 3 HOH 11 110 20  HOH HOH A . 
D 3 HOH 12 111 22  HOH HOH A . 
D 3 HOH 13 112 23  HOH HOH A . 
D 3 HOH 14 113 24  HOH HOH A . 
D 3 HOH 15 114 27  HOH HOH A . 
D 3 HOH 16 115 29  HOH HOH A . 
D 3 HOH 17 116 34  HOH HOH A . 
D 3 HOH 18 117 35  HOH HOH A . 
D 3 HOH 19 118 36  HOH HOH A . 
D 3 HOH 20 119 40  HOH HOH A . 
D 3 HOH 21 120 43  HOH HOH A . 
D 3 HOH 22 121 48  HOH HOH A . 
D 3 HOH 23 122 57  HOH HOH A . 
D 3 HOH 24 123 58  HOH HOH A . 
D 3 HOH 25 124 59  HOH HOH A . 
D 3 HOH 26 125 62  HOH HOH A . 
D 3 HOH 27 126 63  HOH HOH A . 
D 3 HOH 28 127 65  HOH HOH A . 
D 3 HOH 29 128 66  HOH HOH A . 
D 3 HOH 30 129 67  HOH HOH A . 
D 3 HOH 31 130 69  HOH HOH A . 
D 3 HOH 32 131 71  HOH HOH A . 
D 3 HOH 33 132 74  HOH HOH A . 
D 3 HOH 34 133 3   HOH HOH A . 
D 3 HOH 35 134 5   HOH HOH A . 
D 3 HOH 36 135 7   HOH HOH A . 
D 3 HOH 37 136 8   HOH HOH A . 
D 3 HOH 38 137 12  HOH HOH A . 
D 3 HOH 39 138 18  HOH HOH A . 
D 3 HOH 40 139 20  HOH HOH A . 
D 3 HOH 41 140 22  HOH HOH A . 
D 3 HOH 42 141 24  HOH HOH A . 
E 3 HOH 1  302 1   HOH HOH B . 
E 3 HOH 2  303 2   HOH HOH B . 
E 3 HOH 3  304 4   HOH HOH B . 
E 3 HOH 4  305 9   HOH HOH B . 
E 3 HOH 5  306 11  HOH HOH B . 
E 3 HOH 6  307 12  HOH HOH B . 
E 3 HOH 7  308 17  HOH HOH B . 
E 3 HOH 8  309 18  HOH HOH B . 
E 3 HOH 9  310 19  HOH HOH B . 
E 3 HOH 10 311 21  HOH HOH B . 
E 3 HOH 11 312 25  HOH HOH B . 
E 3 HOH 12 313 26  HOH HOH B . 
E 3 HOH 13 314 28  HOH HOH B . 
E 3 HOH 14 315 30  HOH HOH B . 
E 3 HOH 15 316 31  HOH HOH B . 
E 3 HOH 16 317 32  HOH HOH B . 
E 3 HOH 17 318 33  HOH HOH B . 
E 3 HOH 18 319 37  HOH HOH B . 
E 3 HOH 19 320 38  HOH HOH B . 
E 3 HOH 20 321 39  HOH HOH B . 
E 3 HOH 21 322 41  HOH HOH B . 
E 3 HOH 22 323 42  HOH HOH B . 
E 3 HOH 23 324 44  HOH HOH B . 
E 3 HOH 24 325 45  HOH HOH B . 
E 3 HOH 25 326 46  HOH HOH B . 
E 3 HOH 26 327 47  HOH HOH B . 
E 3 HOH 27 328 49  HOH HOH B . 
E 3 HOH 28 329 50  HOH HOH B . 
E 3 HOH 29 330 51  HOH HOH B . 
E 3 HOH 30 331 52  HOH HOH B . 
E 3 HOH 31 332 53  HOH HOH B . 
E 3 HOH 32 333 54  HOH HOH B . 
E 3 HOH 33 334 55  HOH HOH B . 
E 3 HOH 34 335 56  HOH HOH B . 
E 3 HOH 35 336 60  HOH HOH B . 
E 3 HOH 36 337 61  HOH HOH B . 
E 3 HOH 37 338 64  HOH HOH B . 
E 3 HOH 38 339 68  HOH HOH B . 
E 3 HOH 39 340 70  HOH HOH B . 
E 3 HOH 40 341 72  HOH HOH B . 
E 3 HOH 41 342 73  HOH HOH B . 
E 3 HOH 42 343 75  HOH HOH B . 
E 3 HOH 43 344 2   HOH HOH B . 
E 3 HOH 44 345 4   HOH HOH B . 
E 3 HOH 45 346 6   HOH HOH B . 
E 3 HOH 46 347 9   HOH HOH B . 
E 3 HOH 47 348 10  HOH HOH B . 
E 3 HOH 48 349 11  HOH HOH B . 
E 3 HOH 49 350 13  HOH HOH B . 
E 3 HOH 50 351 14  HOH HOH B . 
E 3 HOH 51 352 15  HOH HOH B . 
E 3 HOH 52 353 16  HOH HOH B . 
E 3 HOH 53 354 19  HOH HOH B . 
E 3 HOH 54 355 21  HOH HOH B . 
E 3 HOH 55 356 23  HOH HOH B . 
E 3 HOH 56 357 25  HOH HOH B . 
E 3 HOH 57 358 26  HOH HOH B . 
E 3 HOH 58 359 27  HOH HOH B . 
# 
_pdbx_molecule_features.prd_id    PRD_001001 
_pdbx_molecule_features.name      RITONAVIR 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_001001 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5060 ? 
1 MORE         -37  ? 
1 'SSA (A^2)'  9240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-04 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-02-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
R-AXIS 'data reduction' . ? 3 
R-AXIS 'data scaling'   . ? 4 
X-PLOR phasing          . ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   HH21 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    57 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   HH 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    59 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.33 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HH12 A ARG 41 ? ? 1_555 HH12 A ARG 41 ? ? 2_565 1.16 
2 1 HE21 A GLN 92 ? ? 1_555 H    B TRP 42 ? ? 3_555 1.34 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            NE2 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             69 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             69 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.296 
_pdbx_validate_rmsd_bond.bond_target_value         1.373 
_pdbx_validate_rmsd_bond.bond_deviation            -0.077 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 6  ? ? CG  A TRP 6  ? ? CD2 A TRP 6  ? ? 113.38 106.30 7.08   0.80 N 
2  1 CE2 A TRP 6  ? ? CD2 A TRP 6  ? ? CG  A TRP 6  ? ? 101.61 107.30 -5.69  0.80 N 
3  1 CB  A ASP 30 ? ? CG  A ASP 30 ? ? OD1 A ASP 30 ? ? 124.02 118.30 5.72   0.90 N 
4  1 NE  A ARG 41 ? ? CZ  A ARG 41 ? ? NH1 A ARG 41 ? ? 123.59 120.30 3.29   0.50 N 
5  1 CD1 A TRP 42 ? ? CG  A TRP 42 ? ? CD2 A TRP 42 ? ? 115.11 106.30 8.81   0.80 N 
6  1 CG  A TRP 42 ? ? CD1 A TRP 42 ? ? NE1 A TRP 42 ? ? 103.66 110.10 -6.44  1.00 N 
7  1 CE2 A TRP 42 ? ? CD2 A TRP 42 ? ? CG  A TRP 42 ? ? 99.81  107.30 -7.49  0.80 N 
8  1 CG1 A ILE 72 ? ? CB  A ILE 72 ? ? CG2 A ILE 72 ? ? 88.84  111.40 -22.56 2.20 N 
9  1 NE  A ARG 87 ? ? CZ  A ARG 87 ? ? NH1 A ARG 87 ? ? 123.67 120.30 3.37   0.50 N 
10 1 CD1 B TRP 6  ? ? CG  B TRP 6  ? ? CD2 B TRP 6  ? ? 112.57 106.30 6.27   0.80 N 
11 1 CE2 B TRP 6  ? ? CD2 B TRP 6  ? ? CG  B TRP 6  ? ? 101.86 107.30 -5.44  0.80 N 
12 1 NE  B ARG 8  ? ? CZ  B ARG 8  ? ? NH1 B ARG 8  ? ? 124.46 120.30 4.16   0.50 N 
13 1 NE  B ARG 41 ? ? CZ  B ARG 41 ? ? NH1 B ARG 41 ? ? 126.81 120.30 6.51   0.50 N 
14 1 CD1 B TRP 42 ? ? CG  B TRP 42 ? ? CD2 B TRP 42 ? ? 112.72 106.30 6.42   0.80 N 
15 1 CE2 B TRP 42 ? ? CD2 B TRP 42 ? ? CG  B TRP 42 ? ? 101.66 107.30 -5.64  0.80 N 
16 1 CA  B CYS 67 ? ? CB  B CYS 67 ? ? SG  B CYS 67 ? ? 100.69 114.00 -13.31 1.80 N 
17 1 CB  B VAL 82 ? ? CA  B VAL 82 ? ? C   B VAL 82 ? ? 98.91  111.40 -12.49 1.90 N 
18 1 CG1 B VAL 82 ? ? CB  B VAL 82 ? ? CG2 B VAL 82 ? ? 121.00 110.90 10.10  1.60 N 
19 1 NE  B ARG 87 ? ? CZ  B ARG 87 ? ? NH1 B ARG 87 ? ? 125.33 120.30 5.03   0.50 N 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 RITONAVIR RIT 
3 water     HOH 
#