data_1HYH
# 
_entry.id   1HYH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1HYH         
WWPDB D_1000174072 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1HYH 
_pdbx_database_status.recvd_initial_deposition_date   1995-06-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Niefind, K.'   1 ? 
'Hecht, H.-J.'  2 ? 
'Schomburg, D.' 3 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structure of L-2-hydroxyisocaproate dehydrogenase from Lactobacillus confusus at 2.2 A resolution. An example of strong asymmetry between subunits.
;
J.Mol.Biol.                                                        251 256 281 1995 JMOBAK UK 0022-2836 0070 ? 7643402 
10.1006/jmbi.1995.0433 
1       'Deletion Variants of L-Hydroxyisocaproate Dehydrogenase-Probing Substrate Specificity' Eur.J.Biochem. 223 857 ?   1994 
EJBCAI IX 0014-2956 0262 ? 8055963 ?                      
2       
;Roentgenkristallographische Untersuchungen an Drei Mikrobiellen Enzymen: D-2-Hydroxyisocaproat-Dehydrogenase Aus Lactobacillus Casei, L-2-Hydroxyisocaproat-Dehydrogenase Aus Lactobacillus Confusus, Alkalische Protease Aus Bacillus Alcalophilus(Slash)Variante Q59R (German, with English Summary)
;
'Thesis, Technische Universitat Carolo-Wilhelmina Zu Braunschweig' ?   ?   ?   1993 ?      GW ?         2069 ? ?       ? 
3       
;Cloning, Sequencing and Expression of the L-2-Hydroxyisocaproate Dehydrogenase-Encoding Gene of Lactobacillus Confusus in Escherichia Coli
;
Gene                                                               83  263 ?   1989 GENED6 NE 0378-1119 0861 ? 2684788 ? 
4       
;L-2-Hydroxyisocaproate Dehydrogenase-A New Enzyme from Lactobacillus Confusus for the Stereospecific Reduction of 2-Ketocarboxylic Acids
;
Appl.Microbiol.Biotechnol.                                         19  167 ?   1984 AMBIDG GW 0175-7598 0786 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Niefind, K.'   1  
primary 'Hecht, H.J.'   2  
primary 'Schomburg, D.' 3  
1       'Feil, I.K.'    4  
1       'Lerch, H.-P.'  5  
1       'Schomburg, D.' 6  
2       'Niefind, K.'   7  
3       'Lerch, H.-P.'  8  
3       'Frank, R.'     9  
3       'Collins, J.'   10 
4       'Schuette, H.'  11 
4       'Hummel, W.'    12 
4       'Kula, M.-R.'   13 
# 
_cell.entry_id           1HYH 
_cell.length_a           135.900 
_cell.length_b           135.900 
_cell.length_c           205.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1HYH 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'L-2-HYDROXYISOCAPROATE DEHYDROGENASE' 33080.125 4   1.1.1.27 ? ? ? 
2 non-polymer syn 'SULFATE ION'                          96.063    4   ?        ? ? ? 
3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE      663.425   4   ?        ? ? ? 
4 water       nat water                                  18.015    309 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        L-HICDH 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ARKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVKADQIDFQDAMANLEAHGNIVINDWAALADADVVISTLGNI
KLQQDNPTGDRFAELKFTSSMVQSVGTNLKESGFHGVLVVISNPVDVITALFQHVTGFPAHKVIGTGTLLDTARMQRAVG
EAFDLDPRSVSGYNLGEHGNSQFVAWSTVRVMGQPIVTLADAGDIDLAAIEEEARKGGFTVLNGKGYTSYGVATSAIRIA
KAVMADAHAELVVSNRRDDMGMYLSYPAIIGRDGVLAETTLDLTTDEQEKLLQSRDYIQQRFDEIVDTL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ARKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVKADQIDFQDAMANLEAHGNIVINDWAALADADVVISTLGNI
KLQQDNPTGDRFAELKFTSSMVQSVGTNLKESGFHGVLVVISNPVDVITALFQHVTGFPAHKVIGTGTLLDTARMQRAVG
EAFDLDPRSVSGYNLGEHGNSQFVAWSTVRVMGQPIVTLADAGDIDLAAIEEEARKGGFTVLNGKGYTSYGVATSAIRIA
KAVMADAHAELVVSNRRDDMGMYLSYPAIIGRDGVLAETTLDLTTDEQEKLLQSRDYIQQRFDEIVDTL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   LYS n 
1 4   ILE n 
1 5   GLY n 
1 6   ILE n 
1 7   ILE n 
1 8   GLY n 
1 9   LEU n 
1 10  GLY n 
1 11  ASN n 
1 12  VAL n 
1 13  GLY n 
1 14  ALA n 
1 15  ALA n 
1 16  VAL n 
1 17  ALA n 
1 18  HIS n 
1 19  GLY n 
1 20  LEU n 
1 21  ILE n 
1 22  ALA n 
1 23  GLN n 
1 24  GLY n 
1 25  VAL n 
1 26  ALA n 
1 27  ASP n 
1 28  ASP n 
1 29  TYR n 
1 30  VAL n 
1 31  PHE n 
1 32  ILE n 
1 33  ASP n 
1 34  ALA n 
1 35  ASN n 
1 36  GLU n 
1 37  ALA n 
1 38  LYS n 
1 39  VAL n 
1 40  LYS n 
1 41  ALA n 
1 42  ASP n 
1 43  GLN n 
1 44  ILE n 
1 45  ASP n 
1 46  PHE n 
1 47  GLN n 
1 48  ASP n 
1 49  ALA n 
1 50  MET n 
1 51  ALA n 
1 52  ASN n 
1 53  LEU n 
1 54  GLU n 
1 55  ALA n 
1 56  HIS n 
1 57  GLY n 
1 58  ASN n 
1 59  ILE n 
1 60  VAL n 
1 61  ILE n 
1 62  ASN n 
1 63  ASP n 
1 64  TRP n 
1 65  ALA n 
1 66  ALA n 
1 67  LEU n 
1 68  ALA n 
1 69  ASP n 
1 70  ALA n 
1 71  ASP n 
1 72  VAL n 
1 73  VAL n 
1 74  ILE n 
1 75  SER n 
1 76  THR n 
1 77  LEU n 
1 78  GLY n 
1 79  ASN n 
1 80  ILE n 
1 81  LYS n 
1 82  LEU n 
1 83  GLN n 
1 84  GLN n 
1 85  ASP n 
1 86  ASN n 
1 87  PRO n 
1 88  THR n 
1 89  GLY n 
1 90  ASP n 
1 91  ARG n 
1 92  PHE n 
1 93  ALA n 
1 94  GLU n 
1 95  LEU n 
1 96  LYS n 
1 97  PHE n 
1 98  THR n 
1 99  SER n 
1 100 SER n 
1 101 MET n 
1 102 VAL n 
1 103 GLN n 
1 104 SER n 
1 105 VAL n 
1 106 GLY n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 LYS n 
1 111 GLU n 
1 112 SER n 
1 113 GLY n 
1 114 PHE n 
1 115 HIS n 
1 116 GLY n 
1 117 VAL n 
1 118 LEU n 
1 119 VAL n 
1 120 VAL n 
1 121 ILE n 
1 122 SER n 
1 123 ASN n 
1 124 PRO n 
1 125 VAL n 
1 126 ASP n 
1 127 VAL n 
1 128 ILE n 
1 129 THR n 
1 130 ALA n 
1 131 LEU n 
1 132 PHE n 
1 133 GLN n 
1 134 HIS n 
1 135 VAL n 
1 136 THR n 
1 137 GLY n 
1 138 PHE n 
1 139 PRO n 
1 140 ALA n 
1 141 HIS n 
1 142 LYS n 
1 143 VAL n 
1 144 ILE n 
1 145 GLY n 
1 146 THR n 
1 147 GLY n 
1 148 THR n 
1 149 LEU n 
1 150 LEU n 
1 151 ASP n 
1 152 THR n 
1 153 ALA n 
1 154 ARG n 
1 155 MET n 
1 156 GLN n 
1 157 ARG n 
1 158 ALA n 
1 159 VAL n 
1 160 GLY n 
1 161 GLU n 
1 162 ALA n 
1 163 PHE n 
1 164 ASP n 
1 165 LEU n 
1 166 ASP n 
1 167 PRO n 
1 168 ARG n 
1 169 SER n 
1 170 VAL n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 ASN n 
1 175 LEU n 
1 176 GLY n 
1 177 GLU n 
1 178 HIS n 
1 179 GLY n 
1 180 ASN n 
1 181 SER n 
1 182 GLN n 
1 183 PHE n 
1 184 VAL n 
1 185 ALA n 
1 186 TRP n 
1 187 SER n 
1 188 THR n 
1 189 VAL n 
1 190 ARG n 
1 191 VAL n 
1 192 MET n 
1 193 GLY n 
1 194 GLN n 
1 195 PRO n 
1 196 ILE n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 ALA n 
1 201 ASP n 
1 202 ALA n 
1 203 GLY n 
1 204 ASP n 
1 205 ILE n 
1 206 ASP n 
1 207 LEU n 
1 208 ALA n 
1 209 ALA n 
1 210 ILE n 
1 211 GLU n 
1 212 GLU n 
1 213 GLU n 
1 214 ALA n 
1 215 ARG n 
1 216 LYS n 
1 217 GLY n 
1 218 GLY n 
1 219 PHE n 
1 220 THR n 
1 221 VAL n 
1 222 LEU n 
1 223 ASN n 
1 224 GLY n 
1 225 LYS n 
1 226 GLY n 
1 227 TYR n 
1 228 THR n 
1 229 SER n 
1 230 TYR n 
1 231 GLY n 
1 232 VAL n 
1 233 ALA n 
1 234 THR n 
1 235 SER n 
1 236 ALA n 
1 237 ILE n 
1 238 ARG n 
1 239 ILE n 
1 240 ALA n 
1 241 LYS n 
1 242 ALA n 
1 243 VAL n 
1 244 MET n 
1 245 ALA n 
1 246 ASP n 
1 247 ALA n 
1 248 HIS n 
1 249 ALA n 
1 250 GLU n 
1 251 LEU n 
1 252 VAL n 
1 253 VAL n 
1 254 SER n 
1 255 ASN n 
1 256 ARG n 
1 257 ARG n 
1 258 ASP n 
1 259 ASP n 
1 260 MET n 
1 261 GLY n 
1 262 MET n 
1 263 TYR n 
1 264 LEU n 
1 265 SER n 
1 266 TYR n 
1 267 PRO n 
1 268 ALA n 
1 269 ILE n 
1 270 ILE n 
1 271 GLY n 
1 272 ARG n 
1 273 ASP n 
1 274 GLY n 
1 275 VAL n 
1 276 LEU n 
1 277 ALA n 
1 278 GLU n 
1 279 THR n 
1 280 THR n 
1 281 LEU n 
1 282 ASP n 
1 283 LEU n 
1 284 THR n 
1 285 THR n 
1 286 ASP n 
1 287 GLU n 
1 288 GLN n 
1 289 GLU n 
1 290 LYS n 
1 291 LEU n 
1 292 LEU n 
1 293 GLN n 
1 294 SER n 
1 295 ARG n 
1 296 ASP n 
1 297 TYR n 
1 298 ILE n 
1 299 GLN n 
1 300 GLN n 
1 301 ARG n 
1 302 PHE n 
1 303 ASP n 
1 304 GLU n 
1 305 ILE n 
1 306 VAL n 
1 307 ASP n 
1 308 THR n 
1 309 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Weissella 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Weissella confusa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1583 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JM103 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHL6 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GERMAN COLLECTION OF MICROORGANISMS (DSM) NUMBER DSM 20196, CELL PLASM' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DHL2_LACCO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P14295 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ARKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVKADQIDFQDAMANLEAHGNIVINDWAALADADVVISTLGNI
KLQQDNPTGDRFAELKFTSSMVQSVGTNLKESGFHGVLVVISNPVDVITALFQHVTGFPAHKVIGTGTLLDTARMQRAVG
EAFDLDPRSVSGYNLGEHGNSQFVAWSTVRVMGQPIVTLADAGDIDLAAIEEEARKGGFTVLNGKGYTSYGVATSAIRIA
KAVMADAHAELVVSNRRDDMGMYLSYPAIIGRDGVLAETTLDLTTDEQEKLLQSRDYIQQRFDEIVDTL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1HYH A 1 ? 309 ? P14295 1 ? 309 ? 21 329 
2 1 1HYH B 1 ? 309 ? P14295 1 ? 309 ? 21 329 
3 1 1HYH C 1 ? 309 ? P14295 1 ? 309 ? 21 329 
4 1 1HYH D 1 ? 309 ? P14295 1 ? 309 ? 21 329 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                     ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1HYH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.15 
_exptl_crystal.density_percent_sol   70.34 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-11-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1HYH 
_reflns.observed_criterion_sigma_I   3. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.1 
_reflns.d_resolution_high            2.22 
_reflns.number_obs                   105688 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1HYH 
_refine.ls_number_reflns_obs                     102618 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8. 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    93.2 
_refine.ls_R_factor_obs                          0.210 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               27.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;NO NON-CRYSTALLOGRAPHIC SYMMETRY RESTRAINTS WERE APPLIED
IN THE FINAL REFINEMENT.

FOUR L-HICDH SUBUNITS ARE INCLUDED.  EACH SUBUNIT HAS NAD+
AND A SULFATE ION IN THE ACTIVE SITE.

THE *SCALE* TRANSFORMATION BELOW GENERATES FRACTIONAL.
COORDINATES WITH RESPECT TO SPACE GROUP P 32 2 1.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8811 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         196 
_refine_hist.number_atoms_solvent             309 
_refine_hist.number_atoms_total               9316 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        8. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.015 0.015 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.030 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.034 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.260 1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.964 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         1.383 1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        1.953 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.011 0.015 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.065 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.180 0.200 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.194 0.200 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        2.0   2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     15.0  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   33.8  33.8  ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.999990  -0.003090 0.002180  -0.003090 -0.999990 -0.001610 0.002190  0.001600  -1.000000 0.00903 0.01442  -0.05906 
2 given ? -0.999980 0.002870  -0.005370 0.002910  0.999970  -0.006560 0.005350  -0.006570 -0.999960 0.00929 0.21671  -0.06222 
3 given ? -1.000000 -0.000110 -0.002370 0.000100  -0.999980 0.006730  -0.002370 0.006730  0.999970  0.00131 -0.22078 0.03004  
# 
_struct.entry_id                  1HYH 
_struct.title                     
;CRYSTAL STRUCTURE OF L-2-HYDROXYISOCAPROATE DEHYDROGENASE FROM LACTOBACILLUS CONFUSUS AT 2.2 ANGSTROMS RESOLUTION-AN EXAMPLE OF STRONG ASYMMETRY BETWEEN SUBUNITS
;
_struct.pdbx_descriptor           'L-2-HYDROXYISOCAPROATE DEHYDROGENASE, NICOTINAMIDE-ADENINE-DINUCLEOTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1HYH 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE (CHOH(D)-NAD+(A))' 
_struct_keywords.text            'L-2-HYDROXYCARBOXYLATE DEHYDROGENASE, L-LACTATE DEHYDROGENASE, OXIDOREDUCTASE (CHOH(D)-NAD+(A))' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;NON-CRYSTALLOGRAPHIC SYMMETRY IS WELL PRESERVED AROUND
THE MOLECULAR P-AXIS, WHILE IT IS STRONGLY DISTURBED AROUND
Q AND R.  STRUCTURAL DIFFERENCES BETWEEN THE CHAINS *A* AND
*B* ON THE ONE SIDE AND *C* AND *D* ON THE OTHER ARE
ESPECIALLY PRONOUNCED IN THE REGION OF THE ACTIVE SITE.

MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO           TRANSFORMED TO
 MTRIX      RESIDUES               RESIDUES         RMSD
   M1   A   21  ..  A  331     B   21  ..  B  331   0.244
   M2   A   21  ..  A  331     C   21  ..  C  331   5.043
   M3   A   21  ..  A  331     D   21  ..  D  331   5.041

  THE FIRST MTRIX-OPERATION DESCRIBES THE TWO-FOLD
  ROTATION AROUND THE MOLECULAR P-AXIS AND MAPS CHAIN *A*
  ON CHAIN *B* (INCLUDING THE BOUND NAD+ AND SULFATE,
  RESPECTIVELY).
  THE SECOND MTRIX-OPERATION DESCRIBES THE TWO-FOLD
  ROTATION AROUND THE MOLECULAR Q-AXIS AND MAPS CHAIN *A*
  ON CHAIN *C* (INCLUDING THE BOUND NAD+ AND SULFATE,
  RESPECTIVELY).
  THE THIRD MTRIX-OPERATION DESCRIBES THE TWO-FOLD
  ROTATION AROUND THE MOLECULAR R-AXIS AND MAPS CHAIN *A*
  ON CHAIN *D* (INCLUDING THE BOUND NAD+ AND SULFATE,
  RESPECTIVELY).
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 11  ? GLN A 23  ? ASN A 31  GLN A 43  1 ? 13 
HELX_P HELX_P2  2  GLU A 36  ? ASN A 52  ? GLU A 56  ASN A 72  1 ? 17 
HELX_P HELX_P3  3  TRP A 64  ? LEU A 67  ? TRP A 84  LEU A 87  5 ? 4  
HELX_P HELX_P4  4  ILE A 80  ? GLN A 83  ? ILE A 100 GLN A 103 5 ? 4  
HELX_P HELX_P5  5  ALA A 93  ? GLU A 111 ? ALA A 113 GLU A 131 5 ? 19 
HELX_P HELX_P6  6  VAL A 125 ? THR A 136 ? VAL A 145 THR A 156 1 ? 12 
HELX_P HELX_P7  7  GLY A 147 ? PHE A 163 ? GLY A 167 PHE A 183 1 ? 17 
HELX_P HELX_P8  8  LEU A 207 ? LYS A 225 ? LEU A 227 LYS A 245 1 ? 19 
HELX_P HELX_P9  9  TYR A 230 ? MET A 244 ? TYR A 250 MET A 264 1 ? 15 
HELX_P HELX_P10 10 THR A 285 ? VAL A 306 ? THR A 305 VAL A 326 1 ? 22 
HELX_P HELX_P11 11 ASN B 11  ? GLN B 23  ? ASN B 31  GLN B 43  1 ? 13 
HELX_P HELX_P12 12 GLU B 36  ? ASN B 52  ? GLU B 56  ASN B 72  1 ? 17 
HELX_P HELX_P13 13 TRP B 64  ? LEU B 67  ? TRP B 84  LEU B 87  5 ? 4  
HELX_P HELX_P14 14 ILE B 80  ? GLN B 83  ? ILE B 100 GLN B 103 5 ? 4  
HELX_P HELX_P15 15 ALA B 93  ? SER B 112 ? ALA B 113 SER B 132 5 ? 20 
HELX_P HELX_P16 16 VAL B 125 ? THR B 136 ? VAL B 145 THR B 156 1 ? 12 
HELX_P HELX_P17 17 GLY B 147 ? PHE B 163 ? GLY B 167 PHE B 183 1 ? 17 
HELX_P HELX_P18 18 LEU B 207 ? LYS B 225 ? LEU B 227 LYS B 245 1 ? 19 
HELX_P HELX_P19 19 TYR B 230 ? MET B 244 ? TYR B 250 MET B 264 1 ? 15 
HELX_P HELX_P20 20 THR B 285 ? ILE B 305 ? THR B 305 ILE B 325 1 ? 21 
HELX_P HELX_P21 21 ASN C 11  ? GLN C 23  ? ASN C 31  GLN C 43  1 ? 13 
HELX_P HELX_P22 22 GLU C 36  ? ASN C 52  ? GLU C 56  ASN C 72  1 ? 17 
HELX_P HELX_P23 23 TRP C 64  ? ASP C 69  ? TRP C 84  ASP C 89  5 ? 6  
HELX_P HELX_P24 24 ASP C 90  ? SER C 112 ? ASP C 110 SER C 132 1 ? 23 
HELX_P HELX_P25 25 VAL C 125 ? THR C 136 ? VAL C 145 THR C 156 1 ? 12 
HELX_P HELX_P26 26 LEU C 149 ? ALA C 162 ? LEU C 169 ALA C 182 1 ? 14 
HELX_P HELX_P27 27 ILE C 196 ? ASP C 201 ? ILE C 216 ASP C 221 1 ? 6  
HELX_P HELX_P28 28 LEU C 207 ? LYS C 225 ? LEU C 227 LYS C 245 1 ? 19 
HELX_P HELX_P29 29 TYR C 230 ? MET C 244 ? TYR C 250 MET C 264 1 ? 15 
HELX_P HELX_P30 30 THR C 285 ? THR C 308 ? THR C 305 THR C 328 1 ? 24 
HELX_P HELX_P31 31 ASN D 11  ? ALA D 22  ? ASN D 31  ALA D 42  1 ? 12 
HELX_P HELX_P32 32 GLU D 36  ? ASN D 52  ? GLU D 56  ASN D 72  1 ? 17 
HELX_P HELX_P33 33 TRP D 64  ? LEU D 67  ? TRP D 84  LEU D 87  5 ? 4  
HELX_P HELX_P34 34 ASP D 90  ? SER D 112 ? ASP D 110 SER D 132 1 ? 23 
HELX_P HELX_P35 35 VAL D 125 ? THR D 136 ? VAL D 145 THR D 156 1 ? 12 
HELX_P HELX_P36 36 GLY D 147 ? PHE D 163 ? GLY D 167 PHE D 183 1 ? 17 
HELX_P HELX_P37 37 ILE D 196 ? ASP D 201 ? ILE D 216 ASP D 221 1 ? 6  
HELX_P HELX_P38 38 LEU D 207 ? LYS D 225 ? LEU D 227 LYS D 245 1 ? 19 
HELX_P HELX_P39 39 TYR D 230 ? ALA D 245 ? TYR D 250 ALA D 265 1 ? 16 
HELX_P HELX_P40 40 THR D 285 ? ASP D 307 ? THR D 305 ASP D 327 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 123 A . ? ASN 143 A PRO 124 A ? PRO 144 A 1 -3.55 
2 ASN 123 B . ? ASN 143 B PRO 124 B ? PRO 144 B 1 -3.60 
3 ASN 123 C . ? ASN 143 C PRO 124 C ? PRO 144 C 1 0.51  
4 ASN 123 D . ? ASN 143 D PRO 124 D ? PRO 144 D 1 1.08  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 3 ? 
D ? 6 ? 
E ? 3 ? 
F ? 3 ? 
G ? 6 ? 
H ? 3 ? 
I ? 3 ? 
J ? 6 ? 
K ? 3 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 143 ? GLY A 145 ? VAL A 163 GLY A 165 
A 2 VAL A 117 ? VAL A 120 ? VAL A 137 VAL A 140 
A 3 VAL A 72  ? SER A 75  ? VAL A 92  SER A 95  
A 4 LYS A 3   ? ILE A 7   ? LYS A 23  ILE A 27  
A 5 ASP A 28  ? ILE A 32  ? ASP A 48  ILE A 52  
A 6 ASN A 58  ? ILE A 61  ? ASN A 78  ILE A 81  
B 1 TYR A 173 ? LEU A 175 ? TYR A 193 LEU A 195 
B 2 PHE A 183 ? VAL A 191 ? PHE A 203 VAL A 211 
B 3 GLN A 194 ? PRO A 195 ? GLN A 214 PRO A 215 
C 1 ALA A 249 ? ARG A 256 ? ALA A 269 ARG A 276 
C 2 TYR A 263 ? GLY A 271 ? TYR A 283 GLY A 291 
C 3 GLY A 274 ? GLU A 278 ? GLY A 294 GLU A 298 
D 1 VAL B 143 ? GLY B 145 ? VAL B 163 GLY B 165 
D 2 VAL B 117 ? VAL B 120 ? VAL B 137 VAL B 140 
D 3 VAL B 72  ? SER B 75  ? VAL B 92  SER B 95  
D 4 LYS B 3   ? ILE B 7   ? LYS B 23  ILE B 27  
D 5 ASP B 28  ? ILE B 32  ? ASP B 48  ILE B 52  
D 6 ASN B 58  ? ILE B 61  ? ASN B 78  ILE B 81  
E 1 TYR B 173 ? LEU B 175 ? TYR B 193 LEU B 195 
E 2 PHE B 183 ? VAL B 191 ? PHE B 203 VAL B 211 
E 3 GLN B 194 ? PRO B 195 ? GLN B 214 PRO B 215 
F 1 ALA B 249 ? ASN B 255 ? ALA B 269 ASN B 275 
F 2 LEU B 264 ? GLY B 271 ? LEU B 284 GLY B 291 
F 3 GLY B 274 ? GLU B 278 ? GLY B 294 GLU B 298 
G 1 VAL C 143 ? GLY C 145 ? VAL C 163 GLY C 165 
G 2 VAL C 117 ? VAL C 120 ? VAL C 137 VAL C 140 
G 3 VAL C 72  ? SER C 75  ? VAL C 92  SER C 95  
G 4 LYS C 3   ? ILE C 7   ? LYS C 23  ILE C 27  
G 5 ASP C 28  ? ILE C 32  ? ASP C 48  ILE C 52  
G 6 ASN C 58  ? ILE C 61  ? ASN C 78  ILE C 81  
H 1 TYR C 173 ? LEU C 175 ? TYR C 193 LEU C 195 
H 2 PHE C 183 ? VAL C 191 ? PHE C 203 VAL C 211 
H 3 GLN C 194 ? PRO C 195 ? GLN C 214 PRO C 215 
I 1 ALA C 249 ? ARG C 256 ? ALA C 269 ARG C 276 
I 2 TYR C 263 ? GLY C 271 ? TYR C 283 GLY C 291 
I 3 GLY C 274 ? GLU C 278 ? GLY C 294 GLU C 298 
J 1 VAL D 143 ? GLY D 145 ? VAL D 163 GLY D 165 
J 2 VAL D 117 ? VAL D 120 ? VAL D 137 VAL D 140 
J 3 VAL D 72  ? SER D 75  ? VAL D 92  SER D 95  
J 4 LYS D 3   ? ILE D 7   ? LYS D 23  ILE D 27  
J 5 ASP D 28  ? ILE D 32  ? ASP D 48  ILE D 52  
J 6 ASN D 58  ? ILE D 61  ? ASN D 78  ILE D 81  
K 1 TYR D 173 ? LEU D 175 ? TYR D 193 LEU D 195 
K 2 PHE D 183 ? VAL D 191 ? PHE D 203 VAL D 211 
K 3 GLN D 194 ? PRO D 195 ? GLN D 214 PRO D 215 
L 1 ALA D 249 ? ARG D 256 ? ALA D 269 ARG D 276 
L 2 TYR D 263 ? GLY D 271 ? TYR D 283 GLY D 291 
L 3 GLY D 274 ? GLU D 278 ? GLY D 294 GLU D 298 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 144 ? O ILE A 164 N LEU A 118 ? N LEU A 138 
A 2 3 O VAL A 117 ? O VAL A 137 N VAL A 73  ? N VAL A 93  
A 3 4 O VAL A 72  ? O VAL A 92  N GLY A 5   ? N GLY A 25  
A 4 5 O ILE A 4   ? O ILE A 24  N ASP A 28  ? N ASP A 48  
A 5 6 O TYR A 29  ? O TYR A 49  N ASN A 58  ? N ASN A 78  
B 1 2 O TYR A 173 ? O TYR A 193 N ALA A 185 ? N ALA A 205 
B 2 3 O ARG A 190 ? O ARG A 210 N GLN A 194 ? N GLN A 214 
C 1 2 O ALA A 249 ? O ALA A 269 N ILE A 270 ? N ILE A 290 
C 2 3 O ILE A 269 ? O ILE A 289 N ALA A 277 ? N ALA A 297 
D 1 2 O ILE B 144 ? O ILE B 164 N LEU B 118 ? N LEU B 138 
D 2 3 O VAL B 117 ? O VAL B 137 N VAL B 73  ? N VAL B 93  
D 3 4 O VAL B 72  ? O VAL B 92  N GLY B 5   ? N GLY B 25  
D 4 5 O ILE B 4   ? O ILE B 24  N ASP B 28  ? N ASP B 48  
D 5 6 O TYR B 29  ? O TYR B 49  N ASN B 58  ? N ASN B 78  
E 1 2 O TYR B 173 ? O TYR B 193 N ALA B 185 ? N ALA B 205 
E 2 3 O ARG B 190 ? O ARG B 210 N GLN B 194 ? N GLN B 214 
F 1 2 O ALA B 249 ? O ALA B 269 N ILE B 270 ? N ILE B 290 
F 2 3 O ILE B 269 ? O ILE B 289 N ALA B 277 ? N ALA B 297 
G 1 2 O ILE C 144 ? O ILE C 164 N LEU C 118 ? N LEU C 138 
G 2 3 O VAL C 117 ? O VAL C 137 N VAL C 73  ? N VAL C 93  
G 3 4 O VAL C 72  ? O VAL C 92  N GLY C 5   ? N GLY C 25  
G 4 5 O ILE C 4   ? O ILE C 24  N ASP C 28  ? N ASP C 48  
G 5 6 O TYR C 29  ? O TYR C 49  N ASN C 58  ? N ASN C 78  
H 1 2 O TYR C 173 ? O TYR C 193 N ALA C 185 ? N ALA C 205 
H 2 3 O ARG C 190 ? O ARG C 210 N GLN C 194 ? N GLN C 214 
I 1 2 O ALA C 249 ? O ALA C 269 N ILE C 270 ? N ILE C 290 
I 2 3 O ILE C 269 ? O ILE C 289 N ALA C 277 ? N ALA C 297 
J 1 2 O ILE D 144 ? O ILE D 164 N LEU D 118 ? N LEU D 138 
J 2 3 O VAL D 117 ? O VAL D 137 N VAL D 73  ? N VAL D 93  
J 3 4 O VAL D 72  ? O VAL D 92  N GLY D 5   ? N GLY D 25  
J 4 5 O ILE D 4   ? O ILE D 24  N ASP D 28  ? N ASP D 48  
J 5 6 O TYR D 29  ? O TYR D 49  N ASN D 58  ? N ASN D 78  
K 1 2 O TYR D 173 ? O TYR D 193 N ALA D 185 ? N ALA D 205 
K 2 3 O ARG D 190 ? O ARG D 210 N GLN D 194 ? N GLN D 214 
L 1 2 O ALA D 249 ? O ALA D 269 N ILE D 270 ? N ILE D 290 
L 2 3 O ILE D 269 ? O ILE D 289 N ALA D 277 ? N ALA D 297 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 331' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 B 331' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 331' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 D 331' 
AC5 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAD A 330' 
AC6 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAD B 330' 
AC7 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE NAD C 330' 
AC8 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE NAD D 330' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  ASN A 123 ? ASN A 143 . ? 1_555 ? 
2   AC1 7  LEU A 150 ? LEU A 170 . ? 1_555 ? 
3   AC1 7  ARG A 154 ? ARG A 174 . ? 1_555 ? 
4   AC1 7  HIS A 178 ? HIS A 198 . ? 1_555 ? 
5   AC1 7  THR A 228 ? THR A 248 . ? 1_555 ? 
6   AC1 7  NAD F .   ? NAD A 330 . ? 1_555 ? 
7   AC1 7  HOH M .   ? HOH A 403 . ? 1_555 ? 
8   AC2 6  ASN B 123 ? ASN B 143 . ? 1_555 ? 
9   AC2 6  LEU B 150 ? LEU B 170 . ? 1_555 ? 
10  AC2 6  ARG B 154 ? ARG B 174 . ? 1_555 ? 
11  AC2 6  HIS B 178 ? HIS B 198 . ? 1_555 ? 
12  AC2 6  THR B 228 ? THR B 248 . ? 1_555 ? 
13  AC2 6  NAD H .   ? NAD B 330 . ? 1_555 ? 
14  AC3 4  ARG C 154 ? ARG C 174 . ? 1_555 ? 
15  AC3 4  HIS C 178 ? HIS C 198 . ? 1_555 ? 
16  AC3 4  THR C 228 ? THR C 248 . ? 1_555 ? 
17  AC3 4  NAD J .   ? NAD C 330 . ? 1_555 ? 
18  AC4 5  LEU D 150 ? LEU D 170 . ? 1_555 ? 
19  AC4 5  ARG D 154 ? ARG D 174 . ? 1_555 ? 
20  AC4 5  HIS D 178 ? HIS D 198 . ? 1_555 ? 
21  AC4 5  THR D 228 ? THR D 248 . ? 1_555 ? 
22  AC4 5  NAD L .   ? NAD D 330 . ? 1_555 ? 
23  AC5 29 GLY A 8   ? GLY A 28  . ? 1_555 ? 
24  AC5 29 GLY A 10  ? GLY A 30  . ? 1_555 ? 
25  AC5 29 ASN A 11  ? ASN A 31  . ? 1_555 ? 
26  AC5 29 VAL A 12  ? VAL A 32  . ? 1_555 ? 
27  AC5 29 ASP A 33  ? ASP A 53  . ? 1_555 ? 
28  AC5 29 ALA A 34  ? ALA A 54  . ? 1_555 ? 
29  AC5 29 THR A 76  ? THR A 96  . ? 1_555 ? 
30  AC5 29 LEU A 77  ? LEU A 97  . ? 1_555 ? 
31  AC5 29 GLY A 78  ? GLY A 98  . ? 1_555 ? 
32  AC5 29 ASN A 79  ? ASN A 99  . ? 1_555 ? 
33  AC5 29 ILE A 80  ? ILE A 100 . ? 1_555 ? 
34  AC5 29 GLU A 94  ? GLU A 114 . ? 1_555 ? 
35  AC5 29 MET A 101 ? MET A 121 . ? 1_555 ? 
36  AC5 29 ILE A 121 ? ILE A 141 . ? 1_555 ? 
37  AC5 29 SER A 122 ? SER A 142 . ? 1_555 ? 
38  AC5 29 ASN A 123 ? ASN A 143 . ? 1_555 ? 
39  AC5 29 THR A 146 ? THR A 166 . ? 1_555 ? 
40  AC5 29 LEU A 150 ? LEU A 170 . ? 1_555 ? 
41  AC5 29 HIS A 178 ? HIS A 198 . ? 1_555 ? 
42  AC5 29 THR A 228 ? THR A 248 . ? 1_555 ? 
43  AC5 29 VAL A 232 ? VAL A 252 . ? 1_555 ? 
44  AC5 29 SO4 E .   ? SO4 A 331 . ? 1_555 ? 
45  AC5 29 HOH M .   ? HOH A 339 . ? 1_555 ? 
46  AC5 29 HOH M .   ? HOH A 367 . ? 1_555 ? 
47  AC5 29 HOH M .   ? HOH A 388 . ? 1_555 ? 
48  AC5 29 HOH M .   ? HOH A 389 . ? 1_555 ? 
49  AC5 29 HOH M .   ? HOH A 397 . ? 1_555 ? 
50  AC5 29 HOH M .   ? HOH A 400 . ? 1_555 ? 
51  AC5 29 HOH M .   ? HOH A 410 . ? 1_555 ? 
52  AC6 26 LEU B 9   ? LEU B 29  . ? 1_555 ? 
53  AC6 26 GLY B 10  ? GLY B 30  . ? 1_555 ? 
54  AC6 26 ASN B 11  ? ASN B 31  . ? 1_555 ? 
55  AC6 26 VAL B 12  ? VAL B 32  . ? 1_555 ? 
56  AC6 26 ASP B 33  ? ASP B 53  . ? 1_555 ? 
57  AC6 26 ALA B 34  ? ALA B 54  . ? 1_555 ? 
58  AC6 26 THR B 76  ? THR B 96  . ? 1_555 ? 
59  AC6 26 LEU B 77  ? LEU B 97  . ? 1_555 ? 
60  AC6 26 GLY B 78  ? GLY B 98  . ? 1_555 ? 
61  AC6 26 ASN B 79  ? ASN B 99  . ? 1_555 ? 
62  AC6 26 ILE B 80  ? ILE B 100 . ? 1_555 ? 
63  AC6 26 GLU B 94  ? GLU B 114 . ? 1_555 ? 
64  AC6 26 MET B 101 ? MET B 121 . ? 1_555 ? 
65  AC6 26 ILE B 121 ? ILE B 141 . ? 1_555 ? 
66  AC6 26 SER B 122 ? SER B 142 . ? 1_555 ? 
67  AC6 26 ASN B 123 ? ASN B 143 . ? 1_555 ? 
68  AC6 26 VAL B 125 ? VAL B 145 . ? 1_555 ? 
69  AC6 26 LEU B 150 ? LEU B 170 . ? 1_555 ? 
70  AC6 26 HIS B 178 ? HIS B 198 . ? 1_555 ? 
71  AC6 26 THR B 228 ? THR B 248 . ? 1_555 ? 
72  AC6 26 VAL B 232 ? VAL B 252 . ? 1_555 ? 
73  AC6 26 SO4 G .   ? SO4 B 331 . ? 1_555 ? 
74  AC6 26 HOH N .   ? HOH B 342 . ? 1_555 ? 
75  AC6 26 HOH N .   ? HOH B 370 . ? 1_555 ? 
76  AC6 26 HOH N .   ? HOH B 390 . ? 1_555 ? 
77  AC6 26 HOH N .   ? HOH B 391 . ? 1_555 ? 
78  AC7 22 GLY C 8   ? GLY C 28  . ? 1_555 ? 
79  AC7 22 GLY C 10  ? GLY C 30  . ? 1_555 ? 
80  AC7 22 ASN C 11  ? ASN C 31  . ? 1_555 ? 
81  AC7 22 VAL C 12  ? VAL C 32  . ? 1_555 ? 
82  AC7 22 ASP C 33  ? ASP C 53  . ? 1_555 ? 
83  AC7 22 ALA C 34  ? ALA C 54  . ? 1_555 ? 
84  AC7 22 THR C 76  ? THR C 96  . ? 1_555 ? 
85  AC7 22 LEU C 77  ? LEU C 97  . ? 1_555 ? 
86  AC7 22 GLY C 78  ? GLY C 98  . ? 1_555 ? 
87  AC7 22 MET C 101 ? MET C 121 . ? 1_555 ? 
88  AC7 22 ILE C 121 ? ILE C 141 . ? 1_555 ? 
89  AC7 22 SER C 122 ? SER C 142 . ? 1_555 ? 
90  AC7 22 ASN C 123 ? ASN C 143 . ? 1_555 ? 
91  AC7 22 LEU C 150 ? LEU C 170 . ? 1_555 ? 
92  AC7 22 HIS C 178 ? HIS C 198 . ? 1_555 ? 
93  AC7 22 THR C 228 ? THR C 248 . ? 1_555 ? 
94  AC7 22 SO4 I .   ? SO4 C 331 . ? 1_555 ? 
95  AC7 22 HOH O .   ? HOH C 341 . ? 1_555 ? 
96  AC7 22 HOH O .   ? HOH C 366 . ? 1_555 ? 
97  AC7 22 HOH O .   ? HOH C 397 . ? 1_555 ? 
98  AC7 22 HOH O .   ? HOH C 404 . ? 1_555 ? 
99  AC7 22 HOH P .   ? HOH D 399 . ? 4_545 ? 
100 AC8 21 HOH O .   ? HOH C 396 . ? 4_655 ? 
101 AC8 21 GLY D 8   ? GLY D 28  . ? 1_555 ? 
102 AC8 21 LEU D 9   ? LEU D 29  . ? 1_555 ? 
103 AC8 21 GLY D 10  ? GLY D 30  . ? 1_555 ? 
104 AC8 21 ASN D 11  ? ASN D 31  . ? 1_555 ? 
105 AC8 21 VAL D 12  ? VAL D 32  . ? 1_555 ? 
106 AC8 21 ASP D 33  ? ASP D 53  . ? 1_555 ? 
107 AC8 21 ALA D 34  ? ALA D 54  . ? 1_555 ? 
108 AC8 21 THR D 76  ? THR D 96  . ? 1_555 ? 
109 AC8 21 LEU D 77  ? LEU D 97  . ? 1_555 ? 
110 AC8 21 GLY D 78  ? GLY D 98  . ? 1_555 ? 
111 AC8 21 MET D 101 ? MET D 121 . ? 1_555 ? 
112 AC8 21 SER D 122 ? SER D 142 . ? 1_555 ? 
113 AC8 21 ASN D 123 ? ASN D 143 . ? 1_555 ? 
114 AC8 21 LEU D 150 ? LEU D 170 . ? 1_555 ? 
115 AC8 21 HIS D 178 ? HIS D 198 . ? 1_555 ? 
116 AC8 21 THR D 228 ? THR D 248 . ? 1_555 ? 
117 AC8 21 VAL D 232 ? VAL D 252 . ? 1_555 ? 
118 AC8 21 SO4 K .   ? SO4 D 331 . ? 1_555 ? 
119 AC8 21 HOH P .   ? HOH D 348 . ? 1_555 ? 
120 AC8 21 HOH P .   ? HOH D 372 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1HYH 
_database_PDB_matrix.origx[1][1]       -0.841744 
_database_PDB_matrix.origx[1][2]       -0.495301 
_database_PDB_matrix.origx[1][3]       0.214789 
_database_PDB_matrix.origx[2][1]       0.488184 
_database_PDB_matrix.origx[2][2]       -0.528440 
_database_PDB_matrix.origx[2][3]       0.694573 
_database_PDB_matrix.origx[3][1]       -0.230524 
_database_PDB_matrix.origx[3][2]       0.689510 
_database_PDB_matrix.origx[3][3]       0.686614 
_database_PDB_matrix.origx_vector[1]   69.78027 
_database_PDB_matrix.origx_vector[2]   -0.23980 
_database_PDB_matrix.origx_vector[3]   0.40915 
# 
_atom_sites.entry_id                    1HYH 
_atom_sites.fract_transf_matrix[1][1]   -0.004120 
_atom_sites.fract_transf_matrix[1][2]   -0.005889 
_atom_sites.fract_transf_matrix[1][3]   0.004531 
_atom_sites.fract_transf_matrix[2][1]   0.004148 
_atom_sites.fract_transf_matrix[2][2]   -0.004490 
_atom_sites.fract_transf_matrix[2][3]   0.005902 
_atom_sites.fract_transf_matrix[3][1]   -0.001119 
_atom_sites.fract_transf_matrix[3][2]   0.003348 
_atom_sites.fract_transf_matrix[3][3]   0.003334 
_atom_sites.fract_transf_vector[1]      0.51242 
_atom_sites.fract_transf_vector[2]      -0.00204 
_atom_sites.fract_transf_vector[3]      0.00199 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A   144' 
2 'CIS PROLINE - PRO B   144' 
3 'CIS PROLINE - PRO C   144' 
4 'CIS PROLINE - PRO D   144' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -2.163  -0.548  18.406  1.00 13.29 ? 21  ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -2.514  0.202   17.123  1.00 13.29 ? 21  ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -1.459  1.263   16.952  1.00 13.29 ? 21  ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -0.680  1.472   17.901  1.00 13.29 ? 21  ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -3.905  0.720   17.229  1.00 13.38 ? 21  ALA A CB  1 
ATOM   6    N N   . ARG A 1 2   ? -1.420  1.894   15.751  1.00 11.39 ? 22  ARG A N   1 
ATOM   7    C CA  . ARG A 1 2   ? -0.383  2.934   15.515  1.00 11.39 ? 22  ARG A CA  1 
ATOM   8    C C   . ARG A 1 2   ? -0.948  4.316   15.725  1.00 11.39 ? 22  ARG A C   1 
ATOM   9    O O   . ARG A 1 2   ? -2.061  4.613   15.278  1.00 11.39 ? 22  ARG A O   1 
ATOM   10   C CB  . ARG A 1 2   ? 0.148   2.808   14.106  1.00 13.03 ? 22  ARG A CB  1 
ATOM   11   C CG  . ARG A 1 2   ? 1.097   1.672   13.842  1.00 13.03 ? 22  ARG A CG  1 
ATOM   12   C CD  . ARG A 1 2   ? 1.317   1.488   12.388  1.00 13.03 ? 22  ARG A CD  1 
ATOM   13   N NE  . ARG A 1 2   ? 2.075   0.368   11.952  1.00 13.03 ? 22  ARG A NE  1 
ATOM   14   C CZ  . ARG A 1 2   ? 2.120   -0.037  10.657  1.00 13.03 ? 22  ARG A CZ  1 
ATOM   15   N NH1 . ARG A 1 2   ? 1.462   0.617   9.712   1.00 13.03 ? 22  ARG A NH1 1 
ATOM   16   N NH2 . ARG A 1 2   ? 2.789   -1.121  10.331  1.00 13.03 ? 22  ARG A NH2 1 
ATOM   17   N N   . LYS A 1 3   ? -0.238  5.173   16.412  1.00 11.92 ? 23  LYS A N   1 
ATOM   18   C CA  . LYS A 1 3   ? -0.684  6.530   16.683  1.00 11.92 ? 23  LYS A CA  1 
ATOM   19   C C   . LYS A 1 3   ? 0.462   7.500   16.446  1.00 11.92 ? 23  LYS A C   1 
ATOM   20   O O   . LYS A 1 3   ? 1.535   7.330   17.042  1.00 11.92 ? 23  LYS A O   1 
ATOM   21   C CB  . LYS A 1 3   ? -1.183  6.682   18.130  1.00 12.16 ? 23  LYS A CB  1 
ATOM   22   C CG  . LYS A 1 3   ? -1.499  8.154   18.401  1.00 12.16 ? 23  LYS A CG  1 
ATOM   23   C CD  . LYS A 1 3   ? -1.959  8.342   19.814  1.00 12.16 ? 23  LYS A CD  1 
ATOM   24   C CE  . LYS A 1 3   ? -3.413  7.920   19.959  1.00 12.16 ? 23  LYS A CE  1 
ATOM   25   N NZ  . LYS A 1 3   ? -3.888  8.570   21.225  1.00 12.16 ? 23  LYS A NZ  1 
ATOM   26   N N   . ILE A 1 4   ? 0.207   8.515   15.612  1.00 11.72 ? 24  ILE A N   1 
ATOM   27   C CA  . ILE A 1 4   ? 1.216   9.511   15.286  1.00 11.72 ? 24  ILE A CA  1 
ATOM   28   C C   . ILE A 1 4   ? 0.708   10.911  15.583  1.00 11.72 ? 24  ILE A C   1 
ATOM   29   O O   . ILE A 1 4   ? -0.442  11.241  15.305  1.00 11.72 ? 24  ILE A O   1 
ATOM   30   C CB  . ILE A 1 4   ? 1.599   9.445   13.789  1.00 14.25 ? 24  ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 4   ? 2.253   8.099   13.472  1.00 14.25 ? 24  ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 4   ? 2.616   10.515  13.406  1.00 14.25 ? 24  ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 4   ? 2.282   7.758   11.988  1.00 14.25 ? 24  ILE A CD1 1 
ATOM   34   N N   . GLY A 1 5   ? 1.557   11.707  16.225  1.00 9.64  ? 25  GLY A N   1 
ATOM   35   C CA  . GLY A 1 5   ? 1.210   13.076  16.538  1.00 9.64  ? 25  GLY A CA  1 
ATOM   36   C C   . GLY A 1 5   ? 2.000   13.997  15.623  1.00 9.64  ? 25  GLY A C   1 
ATOM   37   O O   . GLY A 1 5   ? 3.163   13.723  15.354  1.00 9.64  ? 25  GLY A O   1 
ATOM   38   N N   . ILE A 1 6   ? 1.358   15.058  15.079  1.00 11.27 ? 26  ILE A N   1 
ATOM   39   C CA  . ILE A 1 6   ? 2.065   16.011  14.200  1.00 11.27 ? 26  ILE A CA  1 
ATOM   40   C C   . ILE A 1 6   ? 1.871   17.401  14.770  1.00 11.27 ? 26  ILE A C   1 
ATOM   41   O O   . ILE A 1 6   ? 0.734   17.827  14.904  1.00 11.27 ? 26  ILE A O   1 
ATOM   42   C CB  . ILE A 1 6   ? 1.569   15.987  12.749  1.00 11.51 ? 26  ILE A CB  1 
ATOM   43   C CG1 . ILE A 1 6   ? 1.651   14.593  12.152  1.00 11.51 ? 26  ILE A CG1 1 
ATOM   44   C CG2 . ILE A 1 6   ? 2.427   16.911  11.899  1.00 11.51 ? 26  ILE A CG2 1 
ATOM   45   C CD1 . ILE A 1 6   ? 1.023   14.392  10.815  1.00 11.51 ? 26  ILE A CD1 1 
ATOM   46   N N   . ILE A 1 7   ? 2.955   18.068  15.149  1.00 13.25 ? 27  ILE A N   1 
ATOM   47   C CA  . ILE A 1 7   ? 2.911   19.395  15.732  1.00 13.25 ? 27  ILE A CA  1 
ATOM   48   C C   . ILE A 1 7   ? 3.328   20.404  14.666  1.00 13.25 ? 27  ILE A C   1 
ATOM   49   O O   . ILE A 1 7   ? 4.491   20.406  14.248  1.00 13.25 ? 27  ILE A O   1 
ATOM   50   C CB  . ILE A 1 7   ? 3.822   19.508  16.954  1.00 13.30 ? 27  ILE A CB  1 
ATOM   51   C CG1 . ILE A 1 7   ? 3.458   18.412  17.966  1.00 13.30 ? 27  ILE A CG1 1 
ATOM   52   C CG2 . ILE A 1 7   ? 3.677   20.868  17.637  1.00 13.30 ? 27  ILE A CG2 1 
ATOM   53   C CD1 . ILE A 1 7   ? 4.346   18.353  19.165  1.00 13.30 ? 27  ILE A CD1 1 
ATOM   54   N N   . GLY A 1 8   ? 2.374   21.224  14.233  1.00 13.63 ? 28  GLY A N   1 
ATOM   55   C CA  . GLY A 1 8   ? 2.648   22.252  13.198  1.00 13.63 ? 28  GLY A CA  1 
ATOM   56   C C   . GLY A 1 8   ? 2.122   21.739  11.880  1.00 13.63 ? 28  GLY A C   1 
ATOM   57   O O   . GLY A 1 8   ? 2.843   21.003  11.261  1.00 13.63 ? 28  GLY A O   1 
ATOM   58   N N   . LEU A 1 9   ? 0.901   22.046  11.495  1.00 15.23 ? 29  LEU A N   1 
ATOM   59   C CA  . LEU A 1 9   ? 0.292   21.589  10.282  1.00 15.23 ? 29  LEU A CA  1 
ATOM   60   C C   . LEU A 1 9   ? 0.399   22.659  9.188   1.00 15.23 ? 29  LEU A C   1 
ATOM   61   O O   . LEU A 1 9   ? -0.621  23.212  8.794   1.00 15.23 ? 29  LEU A O   1 
ATOM   62   C CB  . LEU A 1 9   ? -1.193  21.216  10.481  1.00 14.94 ? 29  LEU A CB  1 
ATOM   63   C CG  . LEU A 1 9   ? -1.570  19.754  10.776  1.00 14.94 ? 29  LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 9   ? -1.284  18.790  9.659   1.00 14.94 ? 29  LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 9   ? -0.799  19.262  12.016  1.00 14.94 ? 29  LEU A CD2 1 
ATOM   66   N N   . GLY A 1 10  ? 1.595   22.924  8.725   1.00 15.54 ? 30  GLY A N   1 
ATOM   67   C CA  . GLY A 1 10  ? 1.884   23.850  7.674   1.00 15.54 ? 30  GLY A CA  1 
ATOM   68   C C   . GLY A 1 10  ? 2.174   23.079  6.404   1.00 15.54 ? 30  GLY A C   1 
ATOM   69   O O   . GLY A 1 10  ? 1.620   21.970  6.233   1.00 15.54 ? 30  GLY A O   1 
ATOM   70   N N   . ASN A 1 11  ? 3.012   23.596  5.520   1.00 13.35 ? 31  ASN A N   1 
ATOM   71   C CA  . ASN A 1 11  ? 3.298   22.889  4.279   1.00 13.35 ? 31  ASN A CA  1 
ATOM   72   C C   . ASN A 1 11  ? 3.898   21.513  4.535   1.00 13.35 ? 31  ASN A C   1 
ATOM   73   O O   . ASN A 1 11  ? 3.502   20.579  3.877   1.00 13.35 ? 31  ASN A O   1 
ATOM   74   C CB  . ASN A 1 11  ? 4.319   23.598  3.374   1.00 13.93 ? 31  ASN A CB  1 
ATOM   75   C CG  . ASN A 1 11  ? 3.783   24.968  2.970   1.00 13.93 ? 31  ASN A CG  1 
ATOM   76   O OD1 . ASN A 1 11  ? 2.752   24.976  2.287   1.00 13.93 ? 31  ASN A OD1 1 
ATOM   77   N ND2 . ASN A 1 11  ? 4.445   26.054  3.330   1.00 13.93 ? 31  ASN A ND2 1 
ATOM   78   N N   . VAL A 1 12  ? 4.865   21.424  5.408   1.00 13.75 ? 32  VAL A N   1 
ATOM   79   C CA  . VAL A 1 12  ? 5.520   20.143  5.681   1.00 13.75 ? 32  VAL A CA  1 
ATOM   80   C C   . VAL A 1 12  ? 4.629   19.275  6.522   1.00 13.75 ? 32  VAL A C   1 
ATOM   81   O O   . VAL A 1 12  ? 4.351   18.128  6.163   1.00 13.75 ? 32  VAL A O   1 
ATOM   82   C CB  . VAL A 1 12  ? 6.847   20.384  6.408   1.00 12.57 ? 32  VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 12  ? 7.572   19.064  6.601   1.00 12.57 ? 32  VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 12  ? 7.744   21.283  5.613   1.00 12.57 ? 32  VAL A CG2 1 
ATOM   85   N N   . GLY A 1 13  ? 4.100   19.746  7.642   1.00 12.43 ? 33  GLY A N   1 
ATOM   86   C CA  . GLY A 1 13  ? 3.271   18.874  8.471   1.00 12.43 ? 33  GLY A CA  1 
ATOM   87   C C   . GLY A 1 13  ? 2.085   18.283  7.778   1.00 12.43 ? 33  GLY A C   1 
ATOM   88   O O   . GLY A 1 13  ? 1.749   17.118  7.968   1.00 12.43 ? 33  GLY A O   1 
ATOM   89   N N   . ALA A 1 14  ? 1.414   19.055  6.951   1.00 11.36 ? 34  ALA A N   1 
ATOM   90   C CA  . ALA A 1 14  ? 0.251   18.604  6.174   1.00 11.36 ? 34  ALA A CA  1 
ATOM   91   C C   . ALA A 1 14  ? 0.647   17.647  5.107   1.00 11.36 ? 34  ALA A C   1 
ATOM   92   O O   . ALA A 1 14  ? -0.121  16.687  4.800   1.00 11.36 ? 34  ALA A O   1 
ATOM   93   C CB  . ALA A 1 14  ? -0.463  19.870  5.649   1.00 10.98 ? 34  ALA A CB  1 
ATOM   94   N N   . ALA A 1 15  ? 1.849   17.713  4.538   1.00 10.76 ? 35  ALA A N   1 
ATOM   95   C CA  . ALA A 1 15  ? 2.330   16.749  3.537   1.00 10.76 ? 35  ALA A CA  1 
ATOM   96   C C   . ALA A 1 15  ? 2.675   15.434  4.233   1.00 10.76 ? 35  ALA A C   1 
ATOM   97   O O   . ALA A 1 15  ? 2.478   14.347  3.665   1.00 10.76 ? 35  ALA A O   1 
ATOM   98   C CB  . ALA A 1 15  ? 3.564   17.205  2.772   1.00 8.81  ? 35  ALA A CB  1 
ATOM   99   N N   . VAL A 1 16  ? 3.197   15.516  5.465   1.00 11.59 ? 36  VAL A N   1 
ATOM   100  C CA  . VAL A 1 16  ? 3.504   14.317  6.289   1.00 11.59 ? 36  VAL A CA  1 
ATOM   101  C C   . VAL A 1 16  ? 2.202   13.585  6.530   1.00 11.59 ? 36  VAL A C   1 
ATOM   102  O O   . VAL A 1 16  ? 2.088   12.377  6.294   1.00 11.59 ? 36  VAL A O   1 
ATOM   103  C CB  . VAL A 1 16  ? 4.150   14.682  7.614   1.00 11.11 ? 36  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 16  ? 4.256   13.500  8.551   1.00 11.11 ? 36  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 16  ? 5.590   15.216  7.326   1.00 11.11 ? 36  VAL A CG2 1 
ATOM   106  N N   . ALA A 1 17  ? 1.203   14.315  6.989   1.00 11.90 ? 37  ALA A N   1 
ATOM   107  C CA  . ALA A 1 17  ? -0.125  13.745  7.248   1.00 11.90 ? 37  ALA A CA  1 
ATOM   108  C C   . ALA A 1 17  ? -0.699  13.160  6.004   1.00 11.90 ? 37  ALA A C   1 
ATOM   109  O O   . ALA A 1 17  ? -1.235  11.992  6.001   1.00 11.90 ? 37  ALA A O   1 
ATOM   110  C CB  . ALA A 1 17  ? -1.016  14.879  7.742   1.00 11.32 ? 37  ALA A CB  1 
ATOM   111  N N   . HIS A 1 18  ? -0.648  13.827  4.846   1.00 12.79 ? 38  HIS A N   1 
ATOM   112  C CA  . HIS A 1 18  ? -1.220  13.245  3.622   1.00 12.79 ? 38  HIS A CA  1 
ATOM   113  C C   . HIS A 1 18  ? -0.475  12.010  3.174   1.00 12.79 ? 38  HIS A C   1 
ATOM   114  O O   . HIS A 1 18  ? -1.067  11.022  2.662   1.00 12.79 ? 38  HIS A O   1 
ATOM   115  C CB  . HIS A 1 18  ? -1.245  14.341  2.536   1.00 12.58 ? 38  HIS A CB  1 
ATOM   116  C CG  . HIS A 1 18  ? -2.041  13.936  1.325   1.00 12.58 ? 38  HIS A CG  1 
ATOM   117  N ND1 . HIS A 1 18  ? -1.882  14.541  0.067   1.00 12.58 ? 38  HIS A ND1 1 
ATOM   118  C CD2 . HIS A 1 18  ? -2.999  12.980  1.199   1.00 12.58 ? 38  HIS A CD2 1 
ATOM   119  C CE1 . HIS A 1 18  ? -2.726  13.918  -0.755  1.00 12.58 ? 38  HIS A CE1 1 
ATOM   120  N NE2 . HIS A 1 18  ? -3.402  12.955  -0.097  1.00 12.58 ? 38  HIS A NE2 1 
ATOM   121  N N   . GLY A 1 19  ? 0.830   11.996  3.310   1.00 13.48 ? 39  GLY A N   1 
ATOM   122  C CA  . GLY A 1 19  ? 1.627   10.797  2.936   1.00 13.48 ? 39  GLY A CA  1 
ATOM   123  C C   . GLY A 1 19  ? 1.273   9.590   3.800   1.00 13.48 ? 39  GLY A C   1 
ATOM   124  O O   . GLY A 1 19  ? 1.197   8.478   3.282   1.00 13.48 ? 39  GLY A O   1 
ATOM   125  N N   . LEU A 1 20  ? 1.074   9.791   5.118   1.00 12.16 ? 40  LEU A N   1 
ATOM   126  C CA  . LEU A 1 20  ? 0.692   8.737   6.038   1.00 12.16 ? 40  LEU A CA  1 
ATOM   127  C C   . LEU A 1 20  ? -0.746  8.341   5.750   1.00 12.16 ? 40  LEU A C   1 
ATOM   128  O O   . LEU A 1 20  ? -0.975  7.143   5.535   1.00 12.16 ? 40  LEU A O   1 
ATOM   129  C CB  . LEU A 1 20  ? 0.738   9.227   7.472   1.00 9.60  ? 40  LEU A CB  1 
ATOM   130  C CG  . LEU A 1 20  ? 2.150   9.538   8.000   1.00 9.60  ? 40  LEU A CG  1 
ATOM   131  C CD1 . LEU A 1 20  ? 2.057   10.338  9.253   1.00 9.60  ? 40  LEU A CD1 1 
ATOM   132  C CD2 . LEU A 1 20  ? 2.894   8.229   8.232   1.00 9.60  ? 40  LEU A CD2 1 
ATOM   133  N N   . ILE A 1 21  ? -1.645  9.336   5.681   1.00 14.06 ? 41  ILE A N   1 
ATOM   134  C CA  . ILE A 1 21  ? -3.074  8.927   5.455   1.00 14.06 ? 41  ILE A CA  1 
ATOM   135  C C   . ILE A 1 21  ? -3.324  8.256   4.139   1.00 14.06 ? 41  ILE A C   1 
ATOM   136  O O   . ILE A 1 21  ? -4.132  7.302   4.031   1.00 14.06 ? 41  ILE A O   1 
ATOM   137  C CB  . ILE A 1 21  ? -3.949  10.210  5.650   1.00 12.15 ? 41  ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 21  ? -4.066  10.503  7.126   1.00 12.15 ? 41  ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 21  ? -5.332  10.037  5.037   1.00 12.15 ? 41  ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 21  ? -4.542  11.851  7.531   1.00 12.15 ? 41  ILE A CD1 1 
ATOM   141  N N   . ALA A 1 22  ? -2.634  8.663   3.065   1.00 16.97 ? 42  ALA A N   1 
ATOM   142  C CA  . ALA A 1 22  ? -2.797  8.083   1.739   1.00 16.97 ? 42  ALA A CA  1 
ATOM   143  C C   . ALA A 1 22  ? -2.401  6.611   1.729   1.00 16.97 ? 42  ALA A C   1 
ATOM   144  O O   . ALA A 1 22  ? -2.973  5.797   1.008   1.00 16.97 ? 42  ALA A O   1 
ATOM   145  C CB  . ALA A 1 22  ? -1.984  8.917   0.743   1.00 15.79 ? 42  ALA A CB  1 
ATOM   146  N N   . GLN A 1 23  ? -1.414  6.194   2.511   1.00 19.98 ? 43  GLN A N   1 
ATOM   147  C CA  . GLN A 1 23  ? -1.035  4.790   2.565   1.00 19.98 ? 43  GLN A CA  1 
ATOM   148  C C   . GLN A 1 23  ? -1.723  4.082   3.742   1.00 19.98 ? 43  GLN A C   1 
ATOM   149  O O   . GLN A 1 23  ? -1.536  2.865   3.919   1.00 19.98 ? 43  GLN A O   1 
ATOM   150  C CB  . GLN A 1 23  ? 0.460   4.612   2.759   1.00 23.69 ? 43  GLN A CB  1 
ATOM   151  C CG  . GLN A 1 23  ? 1.349   5.392   1.920   1.00 23.69 ? 43  GLN A CG  1 
ATOM   152  C CD  . GLN A 1 23  ? 2.811   5.311   2.329   1.00 23.69 ? 43  GLN A CD  1 
ATOM   153  O OE1 . GLN A 1 23  ? 3.437   4.307   2.031   1.00 23.69 ? 43  GLN A OE1 1 
ATOM   154  N NE2 . GLN A 1 23  ? 3.291   6.384   2.943   1.00 23.69 ? 43  GLN A NE2 1 
ATOM   155  N N   . GLY A 1 24  ? -2.442  4.785   4.590   1.00 18.31 ? 44  GLY A N   1 
ATOM   156  C CA  . GLY A 1 24  ? -3.080  4.099   5.729   1.00 18.31 ? 44  GLY A CA  1 
ATOM   157  C C   . GLY A 1 24  ? -2.037  3.577   6.689   1.00 18.31 ? 44  GLY A C   1 
ATOM   158  O O   . GLY A 1 24  ? -2.179  2.436   7.114   1.00 18.31 ? 44  GLY A O   1 
ATOM   159  N N   . VAL A 1 25  ? -1.031  4.350   7.004   1.00 15.91 ? 45  VAL A N   1 
ATOM   160  C CA  . VAL A 1 25  ? 0.033   3.905   7.880   1.00 15.91 ? 45  VAL A CA  1 
ATOM   161  C C   . VAL A 1 25  ? -0.395  3.829   9.345   1.00 15.91 ? 45  VAL A C   1 
ATOM   162  O O   . VAL A 1 25  ? -0.077  2.831   9.978   1.00 15.91 ? 45  VAL A O   1 
ATOM   163  C CB  . VAL A 1 25  ? 1.292   4.813   7.795   1.00 13.29 ? 45  VAL A CB  1 
ATOM   164  C CG1 . VAL A 1 25  ? 2.338   4.374   8.802   1.00 13.29 ? 45  VAL A CG1 1 
ATOM   165  C CG2 . VAL A 1 25  ? 1.890   4.725   6.396   1.00 13.29 ? 45  VAL A CG2 1 
ATOM   166  N N   . ALA A 1 26  ? -1.034  4.849   9.881   1.00 12.24 ? 46  ALA A N   1 
ATOM   167  C CA  . ALA A 1 26  ? -1.434  4.878   11.262  1.00 12.24 ? 46  ALA A CA  1 
ATOM   168  C C   . ALA A 1 26  ? -2.938  4.691   11.423  1.00 12.24 ? 46  ALA A C   1 
ATOM   169  O O   . ALA A 1 26  ? -3.699  4.700   10.465  1.00 12.24 ? 46  ALA A O   1 
ATOM   170  C CB  . ALA A 1 26  ? -1.033  6.202   11.914  1.00 11.35 ? 46  ALA A CB  1 
ATOM   171  N N   . ASP A 1 27  ? -3.339  4.448   12.676  1.00 10.80 ? 47  ASP A N   1 
ATOM   172  C CA  . ASP A 1 27  ? -4.753  4.270   12.952  1.00 10.80 ? 47  ASP A CA  1 
ATOM   173  C C   . ASP A 1 27  ? -5.298  5.566   13.496  1.00 10.80 ? 47  ASP A C   1 
ATOM   174  O O   . ASP A 1 27  ? -6.376  5.975   13.149  1.00 10.80 ? 47  ASP A O   1 
ATOM   175  C CB  . ASP A 1 27  ? -4.943  3.121   13.957  1.00 11.06 ? 47  ASP A CB  1 
ATOM   176  C CG  . ASP A 1 27  ? -4.468  1.808   13.393  1.00 11.06 ? 47  ASP A CG  1 
ATOM   177  O OD1 . ASP A 1 27  ? -5.102  1.291   12.447  1.00 11.06 ? 47  ASP A OD1 1 
ATOM   178  O OD2 . ASP A 1 27  ? -3.435  1.293   13.885  1.00 11.06 ? 47  ASP A OD2 1 
ATOM   179  N N   . ASP A 1 28  ? -4.556  6.206   14.398  1.00 11.80 ? 48  ASP A N   1 
ATOM   180  C CA  . ASP A 1 28  ? -4.927  7.420   15.080  1.00 11.80 ? 48  ASP A CA  1 
ATOM   181  C C   . ASP A 1 28  ? -3.890  8.513   14.857  1.00 11.80 ? 48  ASP A C   1 
ATOM   182  O O   . ASP A 1 28  ? -2.690  8.246   14.954  1.00 11.80 ? 48  ASP A O   1 
ATOM   183  C CB  . ASP A 1 28  ? -5.049  7.182   16.590  1.00 15.59 ? 48  ASP A CB  1 
ATOM   184  C CG  . ASP A 1 28  ? -6.059  6.128   16.953  1.00 15.59 ? 48  ASP A CG  1 
ATOM   185  O OD1 . ASP A 1 28  ? -7.231  6.142   16.522  1.00 15.59 ? 48  ASP A OD1 1 
ATOM   186  O OD2 . ASP A 1 28  ? -5.697  5.169   17.686  1.00 15.59 ? 48  ASP A OD2 1 
ATOM   187  N N   . TYR A 1 29  ? -4.389  9.748   14.549  1.00 9.37  ? 49  TYR A N   1 
ATOM   188  C CA  . TYR A 1 29  ? -3.504  10.866  14.319  1.00 9.37  ? 49  TYR A CA  1 
ATOM   189  C C   . TYR A 1 29  ? -3.899  12.024  15.222  1.00 9.37  ? 49  TYR A C   1 
ATOM   190  O O   . TYR A 1 29  ? -5.084  12.182  15.525  1.00 9.37  ? 49  TYR A O   1 
ATOM   191  C CB  . TYR A 1 29  ? -3.530  11.434  12.863  1.00 2.00  ? 49  TYR A CB  1 
ATOM   192  C CG  . TYR A 1 29  ? -3.225  10.454  11.751  1.00 2.00  ? 49  TYR A CG  1 
ATOM   193  C CD1 . TYR A 1 29  ? -4.254  9.609   11.225  1.00 2.00  ? 49  TYR A CD1 1 
ATOM   194  C CD2 . TYR A 1 29  ? -1.957  10.308  11.307  1.00 2.00  ? 49  TYR A CD2 1 
ATOM   195  C CE1 . TYR A 1 29  ? -3.982  8.700   10.243  1.00 2.00  ? 49  TYR A CE1 1 
ATOM   196  C CE2 . TYR A 1 29  ? -1.689  9.371   10.330  1.00 2.00  ? 49  TYR A CE2 1 
ATOM   197  C CZ  . TYR A 1 29  ? -2.686  8.614   9.792   1.00 2.00  ? 49  TYR A CZ  1 
ATOM   198  O OH  . TYR A 1 29  ? -2.348  7.711   8.769   1.00 2.00  ? 49  TYR A OH  1 
ATOM   199  N N   . VAL A 1 30  ? -2.909  12.787  15.688  1.00 10.64 ? 50  VAL A N   1 
ATOM   200  C CA  . VAL A 1 30  ? -3.216  13.926  16.552  1.00 10.64 ? 50  VAL A CA  1 
ATOM   201  C C   . VAL A 1 30  ? -2.586  15.127  15.853  1.00 10.64 ? 50  VAL A C   1 
ATOM   202  O O   . VAL A 1 30  ? -1.365  15.088  15.661  1.00 10.64 ? 50  VAL A O   1 
ATOM   203  C CB  . VAL A 1 30  ? -2.657  13.819  17.957  1.00 10.36 ? 50  VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 30  ? -3.040  14.983  18.864  1.00 10.36 ? 50  VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 30  ? -3.184  12.549  18.654  1.00 10.36 ? 50  VAL A CG2 1 
ATOM   206  N N   . PHE A 1 31  ? -3.419  16.109  15.452  1.00 11.52 ? 51  PHE A N   1 
ATOM   207  C CA  . PHE A 1 31  ? -2.858  17.284  14.729  1.00 11.52 ? 51  PHE A CA  1 
ATOM   208  C C   . PHE A 1 31  ? -2.811  18.401  15.740  1.00 11.52 ? 51  PHE A C   1 
ATOM   209  O O   . PHE A 1 31  ? -3.808  18.576  16.439  1.00 11.52 ? 51  PHE A O   1 
ATOM   210  C CB  . PHE A 1 31  ? -3.685  17.710  13.541  1.00 12.35 ? 51  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 31  ? -3.715  16.817  12.334  1.00 12.35 ? 51  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 31  ? -2.881  15.719  12.247  1.00 12.35 ? 51  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 31  ? -4.573  17.037  11.259  1.00 12.35 ? 51  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 31  ? -2.912  14.831  11.195  1.00 12.35 ? 51  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 31  ? -4.581  16.149  10.195  1.00 12.35 ? 51  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 31  ? -3.760  15.051  10.131  1.00 12.35 ? 51  PHE A CZ  1 
ATOM   217  N N   . ILE A 1 32  ? -1.707  19.084  15.897  1.00 12.91 ? 52  ILE A N   1 
ATOM   218  C CA  . ILE A 1 32  ? -1.625  20.177  16.854  1.00 12.91 ? 52  ILE A CA  1 
ATOM   219  C C   . ILE A 1 32  ? -1.051  21.403  16.128  1.00 12.91 ? 52  ILE A C   1 
ATOM   220  O O   . ILE A 1 32  ? -0.021  21.279  15.456  1.00 12.91 ? 52  ILE A O   1 
ATOM   221  C CB  . ILE A 1 32  ? -0.732  19.849  18.072  1.00 14.51 ? 52  ILE A CB  1 
ATOM   222  C CG1 . ILE A 1 32  ? -1.375  18.747  18.939  1.00 14.51 ? 52  ILE A CG1 1 
ATOM   223  C CG2 . ILE A 1 32  ? -0.486  21.086  18.913  1.00 14.51 ? 52  ILE A CG2 1 
ATOM   224  C CD1 . ILE A 1 32  ? -0.638  18.275  20.151  1.00 14.51 ? 52  ILE A CD1 1 
ATOM   225  N N   . ASP A 1 33  ? -1.726  22.548  16.252  1.00 14.65 ? 53  ASP A N   1 
ATOM   226  C CA  . ASP A 1 33  ? -1.195  23.747  15.608  1.00 14.65 ? 53  ASP A CA  1 
ATOM   227  C C   . ASP A 1 33  ? -1.645  24.957  16.402  1.00 14.65 ? 53  ASP A C   1 
ATOM   228  O O   . ASP A 1 33  ? -2.782  24.871  16.884  1.00 14.65 ? 53  ASP A O   1 
ATOM   229  C CB  . ASP A 1 33  ? -1.697  23.920  14.184  1.00 15.67 ? 53  ASP A CB  1 
ATOM   230  C CG  . ASP A 1 33  ? -0.824  24.844  13.362  1.00 15.67 ? 53  ASP A CG  1 
ATOM   231  O OD1 . ASP A 1 33  ? -0.739  26.036  13.688  1.00 15.67 ? 53  ASP A OD1 1 
ATOM   232  O OD2 . ASP A 1 33  ? -0.155  24.371  12.437  1.00 15.67 ? 53  ASP A OD2 1 
ATOM   233  N N   . ALA A 1 34  ? -0.832  25.970  16.511  1.00 18.17 ? 54  ALA A N   1 
ATOM   234  C CA  . ALA A 1 34  ? -1.184  27.167  17.257  1.00 18.17 ? 54  ALA A CA  1 
ATOM   235  C C   . ALA A 1 34  ? -2.343  27.887  16.578  1.00 18.17 ? 54  ALA A C   1 
ATOM   236  O O   . ALA A 1 34  ? -3.229  28.524  17.203  1.00 18.17 ? 54  ALA A O   1 
ATOM   237  C CB  . ALA A 1 34  ? 0.041   28.064  17.356  1.00 15.54 ? 54  ALA A CB  1 
ATOM   238  N N   . ASN A 1 35  ? -2.372  27.833  15.256  1.00 20.42 ? 55  ASN A N   1 
ATOM   239  C CA  . ASN A 1 35  ? -3.440  28.436  14.491  1.00 20.42 ? 55  ASN A CA  1 
ATOM   240  C C   . ASN A 1 35  ? -4.585  27.451  14.463  1.00 20.42 ? 55  ASN A C   1 
ATOM   241  O O   . ASN A 1 35  ? -4.543  26.457  13.750  1.00 20.42 ? 55  ASN A O   1 
ATOM   242  C CB  . ASN A 1 35  ? -2.953  28.744  13.083  1.00 22.10 ? 55  ASN A CB  1 
ATOM   243  C CG  . ASN A 1 35  ? -3.986  29.367  12.172  1.00 22.10 ? 55  ASN A CG  1 
ATOM   244  O OD1 . ASN A 1 35  ? -5.098  29.729  12.531  1.00 22.10 ? 55  ASN A OD1 1 
ATOM   245  N ND2 . ASN A 1 35  ? -3.650  29.480  10.911  1.00 22.10 ? 55  ASN A ND2 1 
ATOM   246  N N   . GLU A 1 36  ? -5.595  27.727  15.269  1.00 24.09 ? 56  GLU A N   1 
ATOM   247  C CA  . GLU A 1 36  ? -6.752  26.846  15.375  1.00 24.09 ? 56  GLU A CA  1 
ATOM   248  C C   . GLU A 1 36  ? -7.554  26.660  14.115  1.00 24.09 ? 56  GLU A C   1 
ATOM   249  O O   . GLU A 1 36  ? -7.858  25.524  13.746  1.00 24.09 ? 56  GLU A O   1 
ATOM   250  C CB  . GLU A 1 36  ? -7.726  27.421  16.423  1.00 31.60 ? 56  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 36  ? -7.140  27.381  17.788  1.00 31.60 ? 56  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 36  ? -7.888  26.487  18.779  1.00 31.60 ? 56  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 36  ? -9.156  26.463  18.712  1.00 31.60 ? 56  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 36  ? -7.155  25.869  19.629  1.00 31.60 ? 56  GLU A OE2 1 
ATOM   255  N N   . ALA A 1 37  ? -7.920  27.729  13.425  1.00 21.65 ? 57  ALA A N   1 
ATOM   256  C CA  . ALA A 1 37  ? -8.734  27.577  12.198  1.00 21.65 ? 57  ALA A CA  1 
ATOM   257  C C   . ALA A 1 37  ? -8.022  26.744  11.152  1.00 21.65 ? 57  ALA A C   1 
ATOM   258  O O   . ALA A 1 37  ? -8.706  25.970  10.460  1.00 21.65 ? 57  ALA A O   1 
ATOM   259  C CB  . ALA A 1 37  ? -9.084  28.949  11.648  1.00 21.28 ? 57  ALA A CB  1 
ATOM   260  N N   . LYS A 1 38  ? -6.710  26.845  11.016  1.00 19.24 ? 58  LYS A N   1 
ATOM   261  C CA  . LYS A 1 38  ? -5.962  26.082  10.037  1.00 19.24 ? 58  LYS A CA  1 
ATOM   262  C C   . LYS A 1 38  ? -6.019  24.585  10.290  1.00 19.24 ? 58  LYS A C   1 
ATOM   263  O O   . LYS A 1 38  ? -6.341  23.790  9.419   1.00 19.24 ? 58  LYS A O   1 
ATOM   264  C CB  . LYS A 1 38  ? -4.476  26.440  10.045  1.00 20.22 ? 58  LYS A CB  1 
ATOM   265  C CG  . LYS A 1 38  ? -3.709  26.400  8.780   1.00 20.22 ? 58  LYS A CG  1 
ATOM   266  C CD  . LYS A 1 38  ? -4.007  25.229  7.871   1.00 20.22 ? 58  LYS A CD  1 
ATOM   267  C CE  . LYS A 1 38  ? -3.004  25.127  6.734   1.00 20.22 ? 58  LYS A CE  1 
ATOM   268  N NZ  . LYS A 1 38  ? -2.467  23.713  6.535   1.00 20.22 ? 58  LYS A NZ  1 
ATOM   269  N N   . VAL A 1 39  ? -5.689  24.187  11.528  1.00 19.32 ? 59  VAL A N   1 
ATOM   270  C CA  . VAL A 1 39  ? -5.676  22.761  11.857  1.00 19.32 ? 59  VAL A CA  1 
ATOM   271  C C   . VAL A 1 39  ? -7.060  22.144  11.773  1.00 19.32 ? 59  VAL A C   1 
ATOM   272  O O   . VAL A 1 39  ? -7.245  21.017  11.277  1.00 19.32 ? 59  VAL A O   1 
ATOM   273  C CB  . VAL A 1 39  ? -5.028  22.567  13.245  1.00 18.23 ? 59  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 39  ? -5.946  22.914  14.383  1.00 18.23 ? 59  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 39  ? -4.611  21.113  13.323  1.00 18.23 ? 59  VAL A CG2 1 
ATOM   276  N N   . LYS A 1 40  ? -8.085  22.875  12.154  1.00 19.35 ? 60  LYS A N   1 
ATOM   277  C CA  . LYS A 1 40  ? -9.473  22.379  12.050  1.00 19.35 ? 60  LYS A CA  1 
ATOM   278  C C   . LYS A 1 40  ? -9.857  22.250  10.599  1.00 19.35 ? 60  LYS A C   1 
ATOM   279  O O   . LYS A 1 40  ? -10.592 21.337  10.206  1.00 19.35 ? 60  LYS A O   1 
ATOM   280  C CB  . LYS A 1 40  ? -10.350 23.321  12.853  1.00 27.47 ? 60  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 40  ? -11.826 23.172  12.778  1.00 27.47 ? 60  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 40  ? -12.331 21.758  12.748  1.00 27.47 ? 60  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 40  ? -13.270 21.430  13.932  1.00 27.47 ? 60  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 40  ? -12.877 20.141  14.669  1.00 27.47 ? 60  LYS A NZ  1 
ATOM   285  N N   . ALA A 1 41  ? -9.354  23.129  9.713   1.00 17.57 ? 61  ALA A N   1 
ATOM   286  C CA  . ALA A 1 41  ? -9.599  23.058  8.282   1.00 17.57 ? 61  ALA A CA  1 
ATOM   287  C C   . ALA A 1 41  ? -9.020  21.807  7.670   1.00 17.57 ? 61  ALA A C   1 
ATOM   288  O O   . ALA A 1 41  ? -9.689  21.119  6.876   1.00 17.57 ? 61  ALA A O   1 
ATOM   289  C CB  . ALA A 1 41  ? -8.956  24.242  7.545   1.00 17.55 ? 61  ALA A CB  1 
ATOM   290  N N   . ASP A 1 42  ? -7.787  21.478  8.067   1.00 17.73 ? 62  ASP A N   1 
ATOM   291  C CA  . ASP A 1 42  ? -7.115  20.263  7.602   1.00 17.73 ? 62  ASP A CA  1 
ATOM   292  C C   . ASP A 1 42  ? -7.766  18.995  8.152   1.00 17.73 ? 62  ASP A C   1 
ATOM   293  O O   . ASP A 1 42  ? -7.857  17.967  7.471   1.00 17.73 ? 62  ASP A O   1 
ATOM   294  C CB  . ASP A 1 42  ? -5.631  20.263  8.010   1.00 19.91 ? 62  ASP A CB  1 
ATOM   295  C CG  . ASP A 1 42  ? -4.790  21.086  7.072   1.00 19.91 ? 62  ASP A CG  1 
ATOM   296  O OD1 . ASP A 1 42  ? -5.080  21.165  5.842   1.00 19.91 ? 62  ASP A OD1 1 
ATOM   297  O OD2 . ASP A 1 42  ? -3.798  21.706  7.468   1.00 19.91 ? 62  ASP A OD2 1 
ATOM   298  N N   . GLN A 1 43  ? -8.237  19.021  9.404   1.00 15.66 ? 63  GLN A N   1 
ATOM   299  C CA  . GLN A 1 43  ? -8.911  17.862  9.979   1.00 15.66 ? 63  GLN A CA  1 
ATOM   300  C C   . GLN A 1 43  ? -10.148 17.510  9.178   1.00 15.66 ? 63  GLN A C   1 
ATOM   301  O O   . GLN A 1 43  ? -10.315 16.364  8.752   1.00 15.66 ? 63  GLN A O   1 
ATOM   302  C CB  . GLN A 1 43  ? -9.315  18.198  11.422  1.00 16.11 ? 63  GLN A CB  1 
ATOM   303  C CG  . GLN A 1 43  ? -10.196 17.098  11.964  1.00 16.11 ? 63  GLN A CG  1 
ATOM   304  C CD  . GLN A 1 43  ? -10.721 17.368  13.342  1.00 16.11 ? 63  GLN A CD  1 
ATOM   305  O OE1 . GLN A 1 43  ? -11.154 18.475  13.644  1.00 16.11 ? 63  GLN A OE1 1 
ATOM   306  N NE2 . GLN A 1 43  ? -10.763 16.330  14.165  1.00 16.11 ? 63  GLN A NE2 1 
ATOM   307  N N   . ILE A 1 44  ? -11.009 18.502  8.953   1.00 14.64 ? 64  ILE A N   1 
ATOM   308  C CA  . ILE A 1 44  ? -12.241 18.302  8.184   1.00 14.64 ? 64  ILE A CA  1 
ATOM   309  C C   . ILE A 1 44  ? -11.967 17.851  6.751   1.00 14.64 ? 64  ILE A C   1 
ATOM   310  O O   . ILE A 1 44  ? -12.597 16.948  6.200   1.00 14.64 ? 64  ILE A O   1 
ATOM   311  C CB  . ILE A 1 44  ? -13.079 19.579  8.102   1.00 17.40 ? 64  ILE A CB  1 
ATOM   312  C CG1 . ILE A 1 44  ? -13.457 20.182  9.461   1.00 17.40 ? 64  ILE A CG1 1 
ATOM   313  C CG2 . ILE A 1 44  ? -14.371 19.260  7.339   1.00 17.40 ? 64  ILE A CG2 1 
ATOM   314  C CD1 . ILE A 1 44  ? -14.357 19.224  10.252  1.00 17.40 ? 64  ILE A CD1 1 
ATOM   315  N N   . ASP A 1 45  ? -11.025 18.494  6.099   1.00 14.05 ? 65  ASP A N   1 
ATOM   316  C CA  . ASP A 1 45  ? -10.686 18.159  4.698   1.00 14.05 ? 65  ASP A CA  1 
ATOM   317  C C   . ASP A 1 45  ? -10.226 16.740  4.600   1.00 14.05 ? 65  ASP A C   1 
ATOM   318  O O   . ASP A 1 45  ? -10.606 16.045  3.648   1.00 14.05 ? 65  ASP A O   1 
ATOM   319  C CB  . ASP A 1 45  ? -9.651  19.174  4.194   1.00 14.22 ? 65  ASP A CB  1 
ATOM   320  C CG  . ASP A 1 45  ? -9.500  19.222  2.694   1.00 14.22 ? 65  ASP A CG  1 
ATOM   321  O OD1 . ASP A 1 45  ? -10.389 18.725  1.956   1.00 14.22 ? 65  ASP A OD1 1 
ATOM   322  O OD2 . ASP A 1 45  ? -8.477  19.747  2.226   1.00 14.22 ? 65  ASP A OD2 1 
ATOM   323  N N   . PHE A 1 46  ? -9.456  16.248  5.578   1.00 12.92 ? 66  PHE A N   1 
ATOM   324  C CA  . PHE A 1 46  ? -9.017  14.834  5.629   1.00 12.92 ? 66  PHE A CA  1 
ATOM   325  C C   . PHE A 1 46  ? -10.173 13.896  5.951   1.00 12.92 ? 66  PHE A C   1 
ATOM   326  O O   . PHE A 1 46  ? -10.333 12.822  5.345   1.00 12.92 ? 66  PHE A O   1 
ATOM   327  C CB  . PHE A 1 46  ? -7.918  14.632  6.665   1.00 9.14  ? 66  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 46  ? -6.535  14.916  6.134   1.00 9.14  ? 66  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 46  ? -6.029  14.226  5.077   1.00 9.14  ? 66  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 46  ? -5.728  15.856  6.781   1.00 9.14  ? 66  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 46  ? -4.761  14.517  4.572   1.00 9.14  ? 66  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 46  ? -4.461  16.138  6.301   1.00 9.14  ? 66  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 46  ? -3.981  15.445  5.223   1.00 9.14  ? 66  PHE A CZ  1 
ATOM   334  N N   . GLN A 1 47  ? -11.056 14.325  6.851   1.00 13.69 ? 67  GLN A N   1 
ATOM   335  C CA  . GLN A 1 47  ? -12.233 13.540  7.187   1.00 13.69 ? 67  GLN A CA  1 
ATOM   336  C C   . GLN A 1 47  ? -13.206 13.454  6.044   1.00 13.69 ? 67  GLN A C   1 
ATOM   337  O O   . GLN A 1 47  ? -13.989 12.483  5.960   1.00 13.69 ? 67  GLN A O   1 
ATOM   338  C CB  . GLN A 1 47  ? -12.943 14.153  8.413   1.00 15.57 ? 67  GLN A CB  1 
ATOM   339  C CG  . GLN A 1 47  ? -12.089 14.081  9.648   1.00 15.57 ? 67  GLN A CG  1 
ATOM   340  C CD  . GLN A 1 47  ? -12.757 14.662  10.860  1.00 15.57 ? 67  GLN A CD  1 
ATOM   341  O OE1 . GLN A 1 47  ? -12.483 14.202  12.028  1.00 15.57 ? 67  GLN A OE1 1 
ATOM   342  N NE2 . GLN A 1 47  ? -13.594 15.663  10.721  1.00 15.57 ? 67  GLN A NE2 1 
ATOM   343  N N   . ASP A 1 48  ? -13.200 14.395  5.130   1.00 14.91 ? 68  ASP A N   1 
ATOM   344  C CA  . ASP A 1 48  ? -14.011 14.378  3.914   1.00 14.91 ? 68  ASP A CA  1 
ATOM   345  C C   . ASP A 1 48  ? -13.423 13.416  2.890   1.00 14.91 ? 68  ASP A C   1 
ATOM   346  O O   . ASP A 1 48  ? -14.141 12.877  2.043   1.00 14.91 ? 68  ASP A O   1 
ATOM   347  C CB  . ASP A 1 48  ? -14.088 15.770  3.267   1.00 15.80 ? 68  ASP A CB  1 
ATOM   348  C CG  . ASP A 1 48  ? -14.956 16.718  4.042   1.00 15.80 ? 68  ASP A CG  1 
ATOM   349  O OD1 . ASP A 1 48  ? -15.773 16.305  4.906   1.00 15.80 ? 68  ASP A OD1 1 
ATOM   350  O OD2 . ASP A 1 48  ? -14.851 17.960  3.835   1.00 15.80 ? 68  ASP A OD2 1 
ATOM   351  N N   . ALA A 1 49  ? -12.131 13.123  3.000   1.00 12.73 ? 69  ALA A N   1 
ATOM   352  C CA  . ALA A 1 49  ? -11.477 12.189  2.097   1.00 12.73 ? 69  ALA A CA  1 
ATOM   353  C C   . ALA A 1 49  ? -11.737 10.771  2.465   1.00 12.73 ? 69  ALA A C   1 
ATOM   354  O O   . ALA A 1 49  ? -11.718 9.831   1.666   1.00 12.73 ? 69  ALA A O   1 
ATOM   355  C CB  . ALA A 1 49  ? -9.954  12.456  2.172   1.00 12.47 ? 69  ALA A CB  1 
ATOM   356  N N   . MET A 1 50  ? -11.959 10.521  3.776   1.00 14.05 ? 70  MET A N   1 
ATOM   357  C CA  . MET A 1 50  ? -12.153 9.171   4.324   1.00 14.05 ? 70  MET A CA  1 
ATOM   358  C C   . MET A 1 50  ? -13.173 8.370   3.577   1.00 14.05 ? 70  MET A C   1 
ATOM   359  O O   . MET A 1 50  ? -12.861 7.175   3.235   1.00 14.05 ? 70  MET A O   1 
ATOM   360  C CB  . MET A 1 50  ? -12.556 9.203   5.826   1.00 14.54 ? 70  MET A CB  1 
ATOM   361  C CG  . MET A 1 50  ? -11.494 9.535   6.851   1.00 14.54 ? 70  MET A CG  1 
ATOM   362  S SD  . MET A 1 50  ? -10.073 8.400   6.727   1.00 14.54 ? 70  MET A SD  1 
ATOM   363  C CE  . MET A 1 50  ? -8.843  9.467   7.563   1.00 14.54 ? 70  MET A CE  1 
ATOM   364  N N   . ALA A 1 51  ? -14.353 8.822   3.190   1.00 12.57 ? 71  ALA A N   1 
ATOM   365  C CA  . ALA A 1 51  ? -15.259 7.933   2.468   1.00 12.57 ? 71  ALA A CA  1 
ATOM   366  C C   . ALA A 1 51  ? -14.665 7.430   1.188   1.00 12.57 ? 71  ALA A C   1 
ATOM   367  O O   . ALA A 1 51  ? -15.138 6.421   0.654   1.00 12.57 ? 71  ALA A O   1 
ATOM   368  C CB  . ALA A 1 51  ? -16.561 8.623   2.048   1.00 13.46 ? 71  ALA A CB  1 
ATOM   369  N N   . ASN A 1 52  ? -13.710 8.158   0.607   1.00 14.29 ? 72  ASN A N   1 
ATOM   370  C CA  . ASN A 1 52  ? -13.119 7.740   -0.650  1.00 14.29 ? 72  ASN A CA  1 
ATOM   371  C C   . ASN A 1 52  ? -11.717 7.207   -0.516  1.00 14.29 ? 72  ASN A C   1 
ATOM   372  O O   . ASN A 1 52  ? -11.062 6.912   -1.548  1.00 14.29 ? 72  ASN A O   1 
ATOM   373  C CB  . ASN A 1 52  ? -13.173 8.904   -1.669  1.00 15.19 ? 72  ASN A CB  1 
ATOM   374  C CG  . ASN A 1 52  ? -14.590 9.241   -2.081  1.00 15.19 ? 72  ASN A CG  1 
ATOM   375  O OD1 . ASN A 1 52  ? -15.403 8.356   -2.365  1.00 15.19 ? 72  ASN A OD1 1 
ATOM   376  N ND2 . ASN A 1 52  ? -14.937 10.502  -2.072  1.00 15.19 ? 72  ASN A ND2 1 
ATOM   377  N N   . LEU A 1 53  ? -11.246 7.050   0.732   1.00 16.66 ? 73  LEU A N   1 
ATOM   378  C CA  . LEU A 1 53  ? -9.899  6.458   0.944   1.00 16.66 ? 73  LEU A CA  1 
ATOM   379  C C   . LEU A 1 53  ? -10.019 4.951   1.152   1.00 16.66 ? 73  LEU A C   1 
ATOM   380  O O   . LEU A 1 53  ? -11.104 4.461   1.529   1.00 16.66 ? 73  LEU A O   1 
ATOM   381  C CB  . LEU A 1 53  ? -9.215  7.086   2.138   1.00 14.10 ? 73  LEU A CB  1 
ATOM   382  C CG  . LEU A 1 53  ? -8.571  8.443   2.006   1.00 14.10 ? 73  LEU A CG  1 
ATOM   383  C CD1 . LEU A 1 53  ? -8.307  9.064   3.346   1.00 14.10 ? 73  LEU A CD1 1 
ATOM   384  C CD2 . LEU A 1 53  ? -7.233  8.334   1.270   1.00 14.10 ? 73  LEU A CD2 1 
ATOM   385  N N   . GLU A 1 54  ? -8.966  4.182   0.979   1.00 19.23 ? 74  GLU A N   1 
ATOM   386  C CA  . GLU A 1 54  ? -9.013  2.733   1.171   1.00 19.23 ? 74  GLU A CA  1 
ATOM   387  C C   . GLU A 1 54  ? -8.850  2.288   2.613   1.00 19.23 ? 74  GLU A C   1 
ATOM   388  O O   . GLU A 1 54  ? -9.404  1.258   3.018   1.00 19.23 ? 74  GLU A O   1 
ATOM   389  C CB  . GLU A 1 54  ? -7.891  2.062   0.355   1.00 26.71 ? 74  GLU A CB  1 
ATOM   390  C CG  . GLU A 1 54  ? -8.312  1.914   -1.071  1.00 26.71 ? 74  GLU A CG  1 
ATOM   391  C CD  . GLU A 1 54  ? -7.372  2.622   -2.029  1.00 26.71 ? 74  GLU A CD  1 
ATOM   392  O OE1 . GLU A 1 54  ? -7.424  3.875   -2.166  1.00 26.71 ? 74  GLU A OE1 1 
ATOM   393  O OE2 . GLU A 1 54  ? -6.568  1.864   -2.691  1.00 26.71 ? 74  GLU A OE2 1 
ATOM   394  N N   . ALA A 1 55  ? -8.121  3.016   3.411   1.00 16.44 ? 75  ALA A N   1 
ATOM   395  C CA  . ALA A 1 55  ? -7.850  2.704   4.807   1.00 16.44 ? 75  ALA A CA  1 
ATOM   396  C C   . ALA A 1 55  ? -8.421  3.805   5.682   1.00 16.44 ? 75  ALA A C   1 
ATOM   397  O O   . ALA A 1 55  ? -8.458  4.937   5.216   1.00 16.44 ? 75  ALA A O   1 
ATOM   398  C CB  . ALA A 1 55  ? -6.350  2.665   5.027   1.00 15.12 ? 75  ALA A CB  1 
ATOM   399  N N   . HIS A 1 56  ? -8.808  3.454   6.895   1.00 13.40 ? 76  HIS A N   1 
ATOM   400  C CA  . HIS A 1 56  ? -9.394  4.419   7.836   1.00 13.40 ? 76  HIS A CA  1 
ATOM   401  C C   . HIS A 1 56  ? -8.357  4.948   8.812   1.00 13.40 ? 76  HIS A C   1 
ATOM   402  O O   . HIS A 1 56  ? -7.393  4.274   9.159   1.00 13.40 ? 76  HIS A O   1 
ATOM   403  C CB  . HIS A 1 56  ? -10.549 3.755   8.595   1.00 12.73 ? 76  HIS A CB  1 
ATOM   404  C CG  . HIS A 1 56  ? -11.120 4.590   9.702   1.00 12.73 ? 76  HIS A CG  1 
ATOM   405  N ND1 . HIS A 1 56  ? -12.217 5.431   9.478   1.00 12.73 ? 76  HIS A ND1 1 
ATOM   406  C CD2 . HIS A 1 56  ? -10.754 4.769   10.992  1.00 12.73 ? 76  HIS A CD2 1 
ATOM   407  C CE1 . HIS A 1 56  ? -12.489 6.085   10.593  1.00 12.73 ? 76  HIS A CE1 1 
ATOM   408  N NE2 . HIS A 1 56  ? -11.622 5.699   11.515  1.00 12.73 ? 76  HIS A NE2 1 
ATOM   409  N N   . GLY A 1 57  ? -8.573  6.189   9.256   1.00 11.14 ? 77  GLY A N   1 
ATOM   410  C CA  . GLY A 1 57  ? -7.660  6.784   10.245  1.00 11.14 ? 77  GLY A CA  1 
ATOM   411  C C   . GLY A 1 57  ? -8.518  7.735   11.064  1.00 11.14 ? 77  GLY A C   1 
ATOM   412  O O   . GLY A 1 57  ? -9.474  8.260   10.518  1.00 11.14 ? 77  GLY A O   1 
ATOM   413  N N   . ASN A 1 58  ? -8.225  7.889   12.337  1.00 12.13 ? 78  ASN A N   1 
ATOM   414  C CA  . ASN A 1 58  ? -8.978  8.773   13.219  1.00 12.13 ? 78  ASN A CA  1 
ATOM   415  C C   . ASN A 1 58  ? -8.154  9.992   13.449  1.00 12.13 ? 78  ASN A C   1 
ATOM   416  O O   . ASN A 1 58  ? -6.920  9.898   13.591  1.00 12.13 ? 78  ASN A O   1 
ATOM   417  C CB  . ASN A 1 58  ? -9.221  8.081   14.584  1.00 13.33 ? 78  ASN A CB  1 
ATOM   418  C CG  . ASN A 1 58  ? -9.981  6.805   14.441  1.00 13.33 ? 78  ASN A CG  1 
ATOM   419  O OD1 . ASN A 1 58  ? -11.178 6.835   14.053  1.00 13.33 ? 78  ASN A OD1 1 
ATOM   420  N ND2 . ASN A 1 58  ? -9.369  5.652   14.711  1.00 13.33 ? 78  ASN A ND2 1 
ATOM   421  N N   . ILE A 1 59  ? -8.770  11.190  13.488  1.00 14.00 ? 79  ILE A N   1 
ATOM   422  C CA  . ILE A 1 59  ? -7.975  12.423  13.681  1.00 14.00 ? 79  ILE A CA  1 
ATOM   423  C C   . ILE A 1 59  ? -8.503  13.309  14.765  1.00 14.00 ? 79  ILE A C   1 
ATOM   424  O O   . ILE A 1 59  ? -9.671  13.608  14.718  1.00 14.00 ? 79  ILE A O   1 
ATOM   425  C CB  . ILE A 1 59  ? -7.969  13.268  12.376  1.00 13.36 ? 79  ILE A CB  1 
ATOM   426  C CG1 . ILE A 1 59  ? -7.413  12.471  11.204  1.00 13.36 ? 79  ILE A CG1 1 
ATOM   427  C CG2 . ILE A 1 59  ? -7.137  14.546  12.540  1.00 13.36 ? 79  ILE A CG2 1 
ATOM   428  C CD1 . ILE A 1 59  ? -7.778  12.917  9.842   1.00 13.36 ? 79  ILE A CD1 1 
ATOM   429  N N   . VAL A 1 60  ? -7.686  13.701  15.732  1.00 13.93 ? 80  VAL A N   1 
ATOM   430  C CA  . VAL A 1 60  ? -8.151  14.598  16.786  1.00 13.93 ? 80  VAL A CA  1 
ATOM   431  C C   . VAL A 1 60  ? -7.221  15.792  16.713  1.00 13.93 ? 80  VAL A C   1 
ATOM   432  O O   . VAL A 1 60  ? -6.116  15.673  16.170  1.00 13.93 ? 80  VAL A O   1 
ATOM   433  C CB  . VAL A 1 60  ? -8.138  14.072  18.235  1.00 14.63 ? 80  VAL A CB  1 
ATOM   434  C CG1 . VAL A 1 60  ? -8.958  12.767  18.306  1.00 14.63 ? 80  VAL A CG1 1 
ATOM   435  C CG2 . VAL A 1 60  ? -6.769  13.798  18.792  1.00 14.63 ? 80  VAL A CG2 1 
ATOM   436  N N   . ILE A 1 61  ? -7.681  16.956  17.164  1.00 15.82 ? 81  ILE A N   1 
ATOM   437  C CA  . ILE A 1 61  ? -6.824  18.135  17.079  1.00 15.82 ? 81  ILE A CA  1 
ATOM   438  C C   . ILE A 1 61  ? -6.610  18.785  18.426  1.00 15.82 ? 81  ILE A C   1 
ATOM   439  O O   . ILE A 1 61  ? -7.414  18.660  19.347  1.00 15.82 ? 81  ILE A O   1 
ATOM   440  C CB  . ILE A 1 61  ? -7.368  19.205  16.093  1.00 15.90 ? 81  ILE A CB  1 
ATOM   441  C CG1 . ILE A 1 61  ? -8.693  19.743  16.613  1.00 15.90 ? 81  ILE A CG1 1 
ATOM   442  C CG2 . ILE A 1 61  ? -7.516  18.619  14.709  1.00 15.90 ? 81  ILE A CG2 1 
ATOM   443  C CD1 . ILE A 1 61  ? -9.305  20.844  15.762  1.00 15.90 ? 81  ILE A CD1 1 
ATOM   444  N N   . ASN A 1 62  ? -5.480  19.455  18.541  1.00 17.91 ? 82  ASN A N   1 
ATOM   445  C CA  . ASN A 1 62  ? -5.041  20.196  19.686  1.00 17.91 ? 82  ASN A CA  1 
ATOM   446  C C   . ASN A 1 62  ? -5.413  19.588  21.011  1.00 17.91 ? 82  ASN A C   1 
ATOM   447  O O   . ASN A 1 62  ? -5.991  20.248  21.883  1.00 17.91 ? 82  ASN A O   1 
ATOM   448  C CB  . ASN A 1 62  ? -5.606  21.624  19.617  1.00 18.34 ? 82  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 62  ? -4.939  22.445  18.533  1.00 18.34 ? 82  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 62  ? -4.002  22.006  17.869  1.00 18.34 ? 82  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 62  ? -5.456  23.658  18.314  1.00 18.34 ? 82  ASN A ND2 1 
ATOM   452  N N   . ASP A 1 63  ? -5.001  18.348  21.217  1.00 18.75 ? 83  ASP A N   1 
ATOM   453  C CA  . ASP A 1 63  ? -5.255  17.616  22.447  1.00 18.75 ? 83  ASP A CA  1 
ATOM   454  C C   . ASP A 1 63  ? -3.948  17.014  22.902  1.00 18.75 ? 83  ASP A C   1 
ATOM   455  O O   . ASP A 1 63  ? -3.616  15.939  22.362  1.00 18.75 ? 83  ASP A O   1 
ATOM   456  C CB  . ASP A 1 63  ? -6.265  16.499  22.159  1.00 22.36 ? 83  ASP A CB  1 
ATOM   457  C CG  . ASP A 1 63  ? -6.717  15.796  23.423  1.00 22.36 ? 83  ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 63  ? -6.346  16.194  24.563  1.00 22.36 ? 83  ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 63  ? -7.474  14.811  23.288  1.00 22.36 ? 83  ASP A OD2 1 
ATOM   460  N N   . TRP A 1 64  ? -3.231  17.672  23.795  1.00 16.91 ? 84  TRP A N   1 
ATOM   461  C CA  . TRP A 1 64  ? -1.939  17.152  24.251  1.00 16.91 ? 84  TRP A CA  1 
ATOM   462  C C   . TRP A 1 64  ? -2.011  15.803  24.927  1.00 16.91 ? 84  TRP A C   1 
ATOM   463  O O   . TRP A 1 64  ? -1.199  14.893  24.702  1.00 16.91 ? 84  TRP A O   1 
ATOM   464  C CB  . TRP A 1 64  ? -1.308  18.175  25.209  1.00 15.20 ? 84  TRP A CB  1 
ATOM   465  C CG  . TRP A 1 64  ? -0.858  19.428  24.515  1.00 15.20 ? 84  TRP A CG  1 
ATOM   466  C CD1 . TRP A 1 64  ? -1.478  20.642  24.534  1.00 15.20 ? 84  TRP A CD1 1 
ATOM   467  C CD2 . TRP A 1 64  ? 0.320   19.593  23.711  1.00 15.20 ? 84  TRP A CD2 1 
ATOM   468  N NE1 . TRP A 1 64  ? -0.759  21.550  23.798  1.00 15.20 ? 84  TRP A NE1 1 
ATOM   469  C CE2 . TRP A 1 64  ? 0.357   20.913  23.262  1.00 15.20 ? 84  TRP A CE2 1 
ATOM   470  C CE3 . TRP A 1 64  ? 1.357   18.741  23.332  1.00 15.20 ? 84  TRP A CE3 1 
ATOM   471  C CZ2 . TRP A 1 64  ? 1.377   21.435  22.485  1.00 15.20 ? 84  TRP A CZ2 1 
ATOM   472  C CZ3 . TRP A 1 64  ? 2.370   19.240  22.531  1.00 15.20 ? 84  TRP A CZ3 1 
ATOM   473  C CH2 . TRP A 1 64  ? 2.376   20.566  22.109  1.00 15.20 ? 84  TRP A CH2 1 
ATOM   474  N N   . ALA A 1 65  ? -3.038  15.578  25.737  1.00 17.99 ? 85  ALA A N   1 
ATOM   475  C CA  . ALA A 1 65  ? -3.204  14.313  26.455  1.00 17.99 ? 85  ALA A CA  1 
ATOM   476  C C   . ALA A 1 65  ? -3.352  13.156  25.514  1.00 17.99 ? 85  ALA A C   1 
ATOM   477  O O   . ALA A 1 65  ? -2.937  12.016  25.848  1.00 17.99 ? 85  ALA A O   1 
ATOM   478  C CB  . ALA A 1 65  ? -4.400  14.389  27.408  1.00 16.57 ? 85  ALA A CB  1 
ATOM   479  N N   . ALA A 1 66  ? -3.826  13.360  24.287  1.00 18.31 ? 86  ALA A N   1 
ATOM   480  C CA  . ALA A 1 66  ? -3.939  12.337  23.267  1.00 18.31 ? 86  ALA A CA  1 
ATOM   481  C C   . ALA A 1 66  ? -2.574  11.874  22.789  1.00 18.31 ? 86  ALA A C   1 
ATOM   482  O O   . ALA A 1 66  ? -2.512  10.841  22.100  1.00 18.31 ? 86  ALA A O   1 
ATOM   483  C CB  . ALA A 1 66  ? -4.728  12.885  22.069  1.00 18.24 ? 86  ALA A CB  1 
ATOM   484  N N   . LEU A 1 67  ? -1.501  12.579  23.096  1.00 17.70 ? 87  LEU A N   1 
ATOM   485  C CA  . LEU A 1 67  ? -0.167  12.142  22.738  1.00 17.70 ? 87  LEU A CA  1 
ATOM   486  C C   . LEU A 1 67  ? 0.451   11.114  23.656  1.00 17.70 ? 87  LEU A C   1 
ATOM   487  O O   . LEU A 1 67  ? 1.447   10.462  23.305  1.00 17.70 ? 87  LEU A O   1 
ATOM   488  C CB  . LEU A 1 67  ? 0.718   13.404  22.766  1.00 15.39 ? 87  LEU A CB  1 
ATOM   489  C CG  . LEU A 1 67  ? 0.480   14.333  21.566  1.00 15.39 ? 87  LEU A CG  1 
ATOM   490  C CD1 . LEU A 1 67  ? 1.621   15.332  21.528  1.00 15.39 ? 87  LEU A CD1 1 
ATOM   491  C CD2 . LEU A 1 67  ? 0.461   13.584  20.250  1.00 15.39 ? 87  LEU A CD2 1 
ATOM   492  N N   . ALA A 1 68  ? -0.109  10.870  24.820  1.00 19.10 ? 88  ALA A N   1 
ATOM   493  C CA  . ALA A 1 68  ? 0.367   9.962   25.829  1.00 19.10 ? 88  ALA A CA  1 
ATOM   494  C C   . ALA A 1 68  ? 0.764   8.595   25.294  1.00 19.10 ? 88  ALA A C   1 
ATOM   495  O O   . ALA A 1 68  ? 1.857   8.104   25.633  1.00 19.10 ? 88  ALA A O   1 
ATOM   496  C CB  . ALA A 1 68  ? -0.720  9.735   26.878  1.00 18.33 ? 88  ALA A CB  1 
ATOM   497  N N   . ASP A 1 69  ? -0.045  8.014   24.430  1.00 20.80 ? 89  ASP A N   1 
ATOM   498  C CA  . ASP A 1 69  ? 0.287   6.696   23.869  1.00 20.80 ? 89  ASP A CA  1 
ATOM   499  C C   . ASP A 1 69  ? 0.658   6.740   22.387  1.00 20.80 ? 89  ASP A C   1 
ATOM   500  O O   . ASP A 1 69  ? 0.505   5.743   21.656  1.00 20.80 ? 89  ASP A O   1 
ATOM   501  C CB  . ASP A 1 69  ? -0.884  5.738   24.085  1.00 23.82 ? 89  ASP A CB  1 
ATOM   502  C CG  . ASP A 1 69  ? -2.162  6.205   23.460  1.00 23.82 ? 89  ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 69  ? -2.461  7.427   23.375  1.00 23.82 ? 89  ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 69  ? -2.915  5.295   23.037  1.00 23.82 ? 89  ASP A OD2 1 
ATOM   505  N N   . ALA A 1 70  ? 1.203   7.877   21.941  1.00 18.01 ? 90  ALA A N   1 
ATOM   506  C CA  . ALA A 1 70  ? 1.645   7.947   20.555  1.00 18.01 ? 90  ALA A CA  1 
ATOM   507  C C   . ALA A 1 70  ? 2.977   7.238   20.432  1.00 18.01 ? 90  ALA A C   1 
ATOM   508  O O   . ALA A 1 70  ? 3.825   7.278   21.345  1.00 18.01 ? 90  ALA A O   1 
ATOM   509  C CB  . ALA A 1 70  ? 1.751   9.410   20.183  1.00 16.55 ? 90  ALA A CB  1 
ATOM   510  N N   . ASP A 1 71  ? 3.198   6.600   19.282  1.00 16.64 ? 91  ASP A N   1 
ATOM   511  C CA  . ASP A 1 71  ? 4.454   5.902   19.002  1.00 16.64 ? 91  ASP A CA  1 
ATOM   512  C C   . ASP A 1 71  ? 5.523   6.904   18.636  1.00 16.64 ? 91  ASP A C   1 
ATOM   513  O O   . ASP A 1 71  ? 6.679   6.823   19.021  1.00 16.64 ? 91  ASP A O   1 
ATOM   514  C CB  . ASP A 1 71  ? 4.305   4.943   17.833  1.00 16.11 ? 91  ASP A CB  1 
ATOM   515  C CG  . ASP A 1 71  ? 3.267   3.896   18.087  1.00 16.11 ? 91  ASP A CG  1 
ATOM   516  O OD1 . ASP A 1 71  ? 2.060   4.152   17.972  1.00 16.11 ? 91  ASP A OD1 1 
ATOM   517  O OD2 . ASP A 1 71  ? 3.629   2.741   18.401  1.00 16.11 ? 91  ASP A OD2 1 
ATOM   518  N N   . VAL A 1 72  ? 5.122   7.845   17.737  1.00 14.26 ? 92  VAL A N   1 
ATOM   519  C CA  . VAL A 1 72  ? 5.987   8.876   17.190  1.00 14.26 ? 92  VAL A CA  1 
ATOM   520  C C   . VAL A 1 72  ? 5.302   10.218  17.192  1.00 14.26 ? 92  VAL A C   1 
ATOM   521  O O   . VAL A 1 72  ? 4.087   10.291  16.981  1.00 14.26 ? 92  VAL A O   1 
ATOM   522  C CB  . VAL A 1 72  ? 6.353   8.508   15.735  1.00 14.85 ? 92  VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 72  ? 7.366   9.526   15.228  1.00 14.85 ? 92  VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 72  ? 7.020   7.167   15.552  1.00 14.85 ? 92  VAL A CG2 1 
ATOM   525  N N   . VAL A 1 73  ? 6.049   11.248  17.518  1.00 13.74 ? 93  VAL A N   1 
ATOM   526  C CA  . VAL A 1 73  ? 5.523   12.619  17.471  1.00 13.74 ? 93  VAL A CA  1 
ATOM   527  C C   . VAL A 1 73  ? 6.458   13.371  16.499  1.00 13.74 ? 93  VAL A C   1 
ATOM   528  O O   . VAL A 1 73  ? 7.700   13.262  16.667  1.00 13.74 ? 93  VAL A O   1 
ATOM   529  C CB  . VAL A 1 73  ? 5.415   13.349  18.790  1.00 11.60 ? 93  VAL A CB  1 
ATOM   530  C CG1 . VAL A 1 73  ? 5.124   14.843  18.637  1.00 11.60 ? 93  VAL A CG1 1 
ATOM   531  C CG2 . VAL A 1 73  ? 4.246   12.805  19.623  1.00 11.60 ? 93  VAL A CG2 1 
ATOM   532  N N   . ILE A 1 74  ? 5.902   14.002  15.465  1.00 14.15 ? 94  ILE A N   1 
ATOM   533  C CA  . ILE A 1 74  ? 6.707   14.727  14.463  1.00 14.15 ? 94  ILE A CA  1 
ATOM   534  C C   . ILE A 1 74  ? 6.546   16.218  14.626  1.00 14.15 ? 94  ILE A C   1 
ATOM   535  O O   . ILE A 1 74  ? 5.421   16.706  14.658  1.00 14.15 ? 94  ILE A O   1 
ATOM   536  C CB  . ILE A 1 74  ? 6.323   14.279  13.057  1.00 14.42 ? 94  ILE A CB  1 
ATOM   537  C CG1 . ILE A 1 74  ? 6.625   12.810  12.898  1.00 14.42 ? 94  ILE A CG1 1 
ATOM   538  C CG2 . ILE A 1 74  ? 7.158   15.035  12.012  1.00 14.42 ? 94  ILE A CG2 1 
ATOM   539  C CD1 . ILE A 1 74  ? 6.045   12.053  11.796  1.00 14.42 ? 94  ILE A CD1 1 
ATOM   540  N N   . SER A 1 75  ? 7.638   16.935  14.848  1.00 14.68 ? 95  SER A N   1 
ATOM   541  C CA  . SER A 1 75  ? 7.603   18.379  15.020  1.00 14.68 ? 95  SER A CA  1 
ATOM   542  C C   . SER A 1 75  ? 7.910   19.099  13.720  1.00 14.68 ? 95  SER A C   1 
ATOM   543  O O   . SER A 1 75  ? 9.034   19.032  13.199  1.00 14.68 ? 95  SER A O   1 
ATOM   544  C CB  . SER A 1 75  ? 8.611   18.827  16.065  1.00 15.09 ? 95  SER A CB  1 
ATOM   545  O OG  . SER A 1 75  ? 8.581   20.264  16.151  1.00 15.09 ? 95  SER A OG  1 
ATOM   546  N N   . THR A 1 76  ? 6.899   19.750  13.157  1.00 17.08 ? 96  THR A N   1 
ATOM   547  C CA  . THR A 1 76  ? 7.051   20.448  11.889  1.00 17.08 ? 96  THR A CA  1 
ATOM   548  C C   . THR A 1 76  ? 6.632   21.910  11.998  1.00 17.08 ? 96  THR A C   1 
ATOM   549  O O   . THR A 1 76  ? 6.267   22.546  10.994  1.00 17.08 ? 96  THR A O   1 
ATOM   550  C CB  . THR A 1 76  ? 6.255   19.712  10.813  1.00 17.10 ? 96  THR A CB  1 
ATOM   551  O OG1 . THR A 1 76  ? 4.999   19.286  11.332  1.00 17.10 ? 96  THR A OG1 1 
ATOM   552  C CG2 . THR A 1 76  ? 6.937   18.431  10.341  1.00 17.10 ? 96  THR A CG2 1 
ATOM   553  N N   . LEU A 1 77  ? 6.690   22.491  13.163  1.00 16.74 ? 97  LEU A N   1 
ATOM   554  C CA  . LEU A 1 77  ? 6.356   23.869  13.434  1.00 16.74 ? 97  LEU A CA  1 
ATOM   555  C C   . LEU A 1 77  ? 7.506   24.771  12.984  1.00 16.74 ? 97  LEU A C   1 
ATOM   556  O O   . LEU A 1 77  ? 8.661   24.340  12.857  1.00 16.74 ? 97  LEU A O   1 
ATOM   557  C CB  . LEU A 1 77  ? 6.038   24.090  14.919  1.00 14.44 ? 97  LEU A CB  1 
ATOM   558  C CG  . LEU A 1 77  ? 7.133   23.875  15.957  1.00 14.44 ? 97  LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 77  ? 8.004   25.118  16.176  1.00 14.44 ? 97  LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 77  ? 6.518   23.491  17.280  1.00 14.44 ? 97  LEU A CD2 1 
ATOM   561  N N   . GLY A 1 78  ? 7.178   26.043  12.728  1.00 18.76 ? 98  GLY A N   1 
ATOM   562  C CA  . GLY A 1 78  ? 8.178   27.014  12.269  1.00 18.76 ? 98  GLY A CA  1 
ATOM   563  C C   . GLY A 1 78  ? 7.468   28.113  11.489  1.00 18.76 ? 98  GLY A C   1 
ATOM   564  O O   . GLY A 1 78  ? 6.240   28.286  11.610  1.00 18.76 ? 98  GLY A O   1 
ATOM   565  N N   . ASN A 1 79  ? 8.240   28.923  10.804  1.00 18.93 ? 99  ASN A N   1 
ATOM   566  C CA  . ASN A 1 79  ? 7.633   30.025  10.020  1.00 18.93 ? 99  ASN A CA  1 
ATOM   567  C C   . ASN A 1 79  ? 8.419   30.070  8.722   1.00 18.93 ? 99  ASN A C   1 
ATOM   568  O O   . ASN A 1 79  ? 9.517   30.624  8.669   1.00 18.93 ? 99  ASN A O   1 
ATOM   569  C CB  . ASN A 1 79  ? 7.718   31.308  10.784  1.00 19.67 ? 99  ASN A CB  1 
ATOM   570  C CG  . ASN A 1 79  ? 7.016   32.473  10.118  1.00 19.67 ? 99  ASN A CG  1 
ATOM   571  O OD1 . ASN A 1 79  ? 6.502   32.388  9.001   1.00 19.67 ? 99  ASN A OD1 1 
ATOM   572  N ND2 . ASN A 1 79  ? 6.987   33.612  10.796  1.00 19.67 ? 99  ASN A ND2 1 
ATOM   573  N N   . ILE A 1 80  ? 7.917   29.468  7.663   1.00 22.08 ? 100 ILE A N   1 
ATOM   574  C CA  . ILE A 1 80  ? 8.621   29.435  6.385   1.00 22.08 ? 100 ILE A CA  1 
ATOM   575  C C   . ILE A 1 80  ? 8.887   30.811  5.825   1.00 22.08 ? 100 ILE A C   1 
ATOM   576  O O   . ILE A 1 80  ? 9.852   30.985  5.026   1.00 22.08 ? 100 ILE A O   1 
ATOM   577  C CB  . ILE A 1 80  ? 7.824   28.588  5.349   1.00 20.00 ? 100 ILE A CB  1 
ATOM   578  C CG1 . ILE A 1 80  ? 8.699   28.192  4.145   1.00 20.00 ? 100 ILE A CG1 1 
ATOM   579  C CG2 . ILE A 1 80  ? 6.596   29.340  4.868   1.00 20.00 ? 100 ILE A CG2 1 
ATOM   580  C CD1 . ILE A 1 80  ? 9.961   27.382  4.503   1.00 20.00 ? 100 ILE A CD1 1 
ATOM   581  N N   . LYS A 1 81  ? 8.156   31.867  6.198   1.00 29.28 ? 101 LYS A N   1 
ATOM   582  C CA  . LYS A 1 81  ? 8.414   33.216  5.745   1.00 29.28 ? 101 LYS A CA  1 
ATOM   583  C C   . LYS A 1 81  ? 9.809   33.636  6.189   1.00 29.28 ? 101 LYS A C   1 
ATOM   584  O O   . LYS A 1 81  ? 10.418  34.434  5.494   1.00 29.28 ? 101 LYS A O   1 
ATOM   585  C CB  . LYS A 1 81  ? 7.468   34.273  6.277   1.00 31.95 ? 101 LYS A CB  1 
ATOM   586  C CG  . LYS A 1 81  ? 6.004   34.033  5.958   1.00 31.95 ? 101 LYS A CG  1 
ATOM   587  C CD  . LYS A 1 81  ? 5.260   35.385  6.132   1.00 31.95 ? 101 LYS A CD  1 
ATOM   588  N N   . LEU A 1 82  ? 10.371  33.145  7.253   1.00 35.39 ? 102 LEU A N   1 
ATOM   589  C CA  . LEU A 1 82  ? 11.710  33.497  7.675   1.00 35.39 ? 102 LEU A CA  1 
ATOM   590  C C   . LEU A 1 82  ? 12.731  32.773  6.837   1.00 35.39 ? 102 LEU A C   1 
ATOM   591  O O   . LEU A 1 82  ? 13.918  33.116  6.953   1.00 35.39 ? 102 LEU A O   1 
ATOM   592  C CB  . LEU A 1 82  ? 11.901  33.187  9.163   1.00 32.10 ? 102 LEU A CB  1 
ATOM   593  C CG  . LEU A 1 82  ? 11.131  34.141  10.081  1.00 32.10 ? 102 LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 82  ? 11.213  33.701  11.529  1.00 32.10 ? 102 LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 82  ? 11.687  35.550  9.962   1.00 32.10 ? 102 LEU A CD2 1 
ATOM   596  N N   . GLN A 1 83  ? 12.401  31.803  6.012   1.00 43.85 ? 103 GLN A N   1 
ATOM   597  C CA  . GLN A 1 83  ? 13.364  31.157  5.148   1.00 43.85 ? 103 GLN A CA  1 
ATOM   598  C C   . GLN A 1 83  ? 13.273  31.806  3.752   1.00 43.85 ? 103 GLN A C   1 
ATOM   599  O O   . GLN A 1 83  ? 14.235  31.884  3.000   1.00 43.85 ? 103 GLN A O   1 
ATOM   600  C CB  . GLN A 1 83  ? 13.124  29.675  4.927   1.00 46.31 ? 103 GLN A CB  1 
ATOM   601  C CG  . GLN A 1 83  ? 13.256  28.789  6.164   1.00 46.31 ? 103 GLN A CG  1 
ATOM   602  C CD  . GLN A 1 83  ? 14.658  28.760  6.756   1.00 46.31 ? 103 GLN A CD  1 
ATOM   603  O OE1 . GLN A 1 83  ? 15.620  28.995  5.846   1.00 46.31 ? 103 GLN A OE1 1 
ATOM   604  N NE2 . GLN A 1 83  ? 14.877  28.536  7.956   1.00 46.31 ? 103 GLN A NE2 1 
ATOM   605  N N   . GLN A 1 84  ? 12.069  32.254  3.392   1.00 50.58 ? 104 GLN A N   1 
ATOM   606  C CA  . GLN A 1 84  ? 11.832  32.836  2.068   1.00 50.58 ? 104 GLN A CA  1 
ATOM   607  C C   . GLN A 1 84  ? 12.714  34.027  1.858   1.00 50.58 ? 104 GLN A C   1 
ATOM   608  O O   . GLN A 1 84  ? 12.669  35.018  2.591   1.00 50.58 ? 104 GLN A O   1 
ATOM   609  C CB  . GLN A 1 84  ? 10.331  33.172  1.926   1.00 52.63 ? 104 GLN A CB  1 
ATOM   610  C CG  . GLN A 1 84  ? 9.469   31.904  1.888   1.00 52.63 ? 104 GLN A CG  1 
ATOM   611  C CD  . GLN A 1 84  ? 7.979   32.117  1.857   1.00 52.63 ? 104 GLN A CD  1 
ATOM   612  O OE1 . GLN A 1 84  ? 7.464   33.245  1.928   1.00 52.63 ? 104 GLN A OE1 1 
ATOM   613  N NE2 . GLN A 1 84  ? 7.168   31.036  1.762   1.00 52.63 ? 104 GLN A NE2 1 
ATOM   614  N N   . PHE A 1 92  ? 17.887  28.759  9.554   1.00 47.51 ? 112 PHE A N   1 
ATOM   615  C CA  . PHE A 1 92  ? 18.664  29.377  10.568  1.00 47.51 ? 112 PHE A CA  1 
ATOM   616  C C   . PHE A 1 92  ? 18.224  30.763  10.982  1.00 47.51 ? 112 PHE A C   1 
ATOM   617  O O   . PHE A 1 92  ? 18.290  31.066  12.199  1.00 47.51 ? 112 PHE A O   1 
ATOM   618  C CB  . PHE A 1 92  ? 20.163  29.572  10.137  1.00 50.55 ? 112 PHE A CB  1 
ATOM   619  C CG  . PHE A 1 92  ? 20.974  29.066  11.331  1.00 50.55 ? 112 PHE A CG  1 
ATOM   620  C CD1 . PHE A 1 92  ? 20.900  29.697  12.557  1.00 50.55 ? 112 PHE A CD1 1 
ATOM   621  C CD2 . PHE A 1 92  ? 21.727  27.918  11.179  1.00 50.55 ? 112 PHE A CD2 1 
ATOM   622  C CE1 . PHE A 1 92  ? 21.569  29.175  13.640  1.00 50.55 ? 112 PHE A CE1 1 
ATOM   623  C CE2 . PHE A 1 92  ? 22.413  27.401  12.259  1.00 50.55 ? 112 PHE A CE2 1 
ATOM   624  C CZ  . PHE A 1 92  ? 22.333  28.040  13.484  1.00 50.55 ? 112 PHE A CZ  1 
ATOM   625  N N   . ALA A 1 93  ? 17.692  31.650  10.112  1.00 40.84 ? 113 ALA A N   1 
ATOM   626  C CA  . ALA A 1 93  ? 17.208  32.971  10.606  1.00 40.84 ? 113 ALA A CA  1 
ATOM   627  C C   . ALA A 1 93  ? 15.879  32.757  11.361  1.00 40.84 ? 113 ALA A C   1 
ATOM   628  O O   . ALA A 1 93  ? 15.364  33.530  12.172  1.00 40.84 ? 113 ALA A O   1 
ATOM   629  C CB  . ALA A 1 93  ? 16.960  33.932  9.480   1.00 41.98 ? 113 ALA A CB  1 
ATOM   630  N N   . GLU A 1 94  ? 15.317  31.568  11.110  1.00 30.01 ? 114 GLU A N   1 
ATOM   631  C CA  . GLU A 1 94  ? 14.160  31.011  11.683  1.00 30.01 ? 114 GLU A CA  1 
ATOM   632  C C   . GLU A 1 94  ? 14.409  30.660  13.137  1.00 30.01 ? 114 GLU A C   1 
ATOM   633  O O   . GLU A 1 94  ? 13.445  30.522  13.898  1.00 30.01 ? 114 GLU A O   1 
ATOM   634  C CB  . GLU A 1 94  ? 13.760  29.723  10.934  1.00 26.48 ? 114 GLU A CB  1 
ATOM   635  C CG  . GLU A 1 94  ? 12.269  29.496  11.000  1.00 26.48 ? 114 GLU A CG  1 
ATOM   636  C CD  . GLU A 1 94  ? 11.794  28.301  10.232  1.00 26.48 ? 114 GLU A CD  1 
ATOM   637  O OE1 . GLU A 1 94  ? 12.463  27.905  9.260   1.00 26.48 ? 114 GLU A OE1 1 
ATOM   638  O OE2 . GLU A 1 94  ? 10.748  27.743  10.613  1.00 26.48 ? 114 GLU A OE2 1 
ATOM   639  N N   . LEU A 1 95  ? 15.657  30.563  13.570  1.00 24.94 ? 115 LEU A N   1 
ATOM   640  C CA  . LEU A 1 95  ? 16.042  30.232  14.925  1.00 24.94 ? 115 LEU A CA  1 
ATOM   641  C C   . LEU A 1 95  ? 15.361  31.098  15.963  1.00 24.94 ? 115 LEU A C   1 
ATOM   642  O O   . LEU A 1 95  ? 14.905  30.543  17.005  1.00 24.94 ? 115 LEU A O   1 
ATOM   643  C CB  . LEU A 1 95  ? 17.565  30.309  15.128  1.00 24.32 ? 115 LEU A CB  1 
ATOM   644  C CG  . LEU A 1 95  ? 18.148  29.860  16.469  1.00 24.32 ? 115 LEU A CG  1 
ATOM   645  C CD1 . LEU A 1 95  ? 17.677  28.465  16.829  1.00 24.32 ? 115 LEU A CD1 1 
ATOM   646  C CD2 . LEU A 1 95  ? 19.673  29.851  16.435  1.00 24.32 ? 115 LEU A CD2 1 
ATOM   647  N N   . LYS A 1 96  ? 15.201  32.411  15.787  1.00 23.59 ? 116 LYS A N   1 
ATOM   648  C CA  . LYS A 1 96  ? 14.524  33.259  16.772  1.00 23.59 ? 116 LYS A CA  1 
ATOM   649  C C   . LYS A 1 96  ? 13.071  32.842  16.940  1.00 23.59 ? 116 LYS A C   1 
ATOM   650  O O   . LYS A 1 96  ? 12.497  32.937  18.017  1.00 23.59 ? 116 LYS A O   1 
ATOM   651  C CB  . LYS A 1 96  ? 14.530  34.729  16.388  1.00 31.77 ? 116 LYS A CB  1 
ATOM   652  C CG  . LYS A 1 96  ? 13.892  35.041  15.031  1.00 31.77 ? 116 LYS A CG  1 
ATOM   653  C CD  . LYS A 1 96  ? 13.480  36.497  14.896  1.00 31.77 ? 116 LYS A CD  1 
ATOM   654  C CE  . LYS A 1 96  ? 13.115  36.916  13.489  1.00 31.77 ? 116 LYS A CE  1 
ATOM   655  N NZ  . LYS A 1 96  ? 14.281  37.148  12.548  1.00 31.77 ? 116 LYS A NZ  1 
ATOM   656  N N   . PHE A 1 97  ? 12.442  32.377  15.892  1.00 19.82 ? 117 PHE A N   1 
ATOM   657  C CA  . PHE A 1 97  ? 11.081  31.906  15.921  1.00 19.82 ? 117 PHE A CA  1 
ATOM   658  C C   . PHE A 1 97  ? 10.974  30.542  16.566  1.00 19.82 ? 117 PHE A C   1 
ATOM   659  O O   . PHE A 1 97  ? 10.405  30.392  17.649  1.00 19.82 ? 117 PHE A O   1 
ATOM   660  C CB  . PHE A 1 97  ? 10.502  31.796  14.468  1.00 16.68 ? 117 PHE A CB  1 
ATOM   661  C CG  . PHE A 1 97  ? 9.037   31.408  14.493  1.00 16.68 ? 117 PHE A CG  1 
ATOM   662  C CD1 . PHE A 1 97  ? 8.067   32.367  14.583  1.00 16.68 ? 117 PHE A CD1 1 
ATOM   663  C CD2 . PHE A 1 97  ? 8.661   30.089  14.453  1.00 16.68 ? 117 PHE A CD2 1 
ATOM   664  C CE1 . PHE A 1 97  ? 6.738   32.011  14.624  1.00 16.68 ? 117 PHE A CE1 1 
ATOM   665  C CE2 . PHE A 1 97  ? 7.334   29.731  14.530  1.00 16.68 ? 117 PHE A CE2 1 
ATOM   666  C CZ  . PHE A 1 97  ? 6.353   30.688  14.579  1.00 16.68 ? 117 PHE A CZ  1 
ATOM   667  N N   . THR A 1 98  ? 11.560  29.534  15.892  1.00 18.65 ? 118 THR A N   1 
ATOM   668  C CA  . THR A 1 98  ? 11.404  28.166  16.433  1.00 18.65 ? 118 THR A CA  1 
ATOM   669  C C   . THR A 1 98  ? 11.940  28.003  17.831  1.00 18.65 ? 118 THR A C   1 
ATOM   670  O O   . THR A 1 98  ? 11.297  27.274  18.632  1.00 18.65 ? 118 THR A O   1 
ATOM   671  C CB  . THR A 1 98  ? 12.020  27.135  15.506  1.00 18.19 ? 118 THR A CB  1 
ATOM   672  O OG1 . THR A 1 98  ? 13.312  27.605  15.172  1.00 18.19 ? 118 THR A OG1 1 
ATOM   673  C CG2 . THR A 1 98  ? 11.167  26.988  14.259  1.00 18.19 ? 118 THR A CG2 1 
ATOM   674  N N   . SER A 1 99  ? 13.025  28.635  18.227  1.00 21.00 ? 119 SER A N   1 
ATOM   675  C CA  . SER A 1 99  ? 13.564  28.499  19.588  1.00 21.00 ? 119 SER A CA  1 
ATOM   676  C C   . SER A 1 99  ? 12.621  29.117  20.595  1.00 21.00 ? 119 SER A C   1 
ATOM   677  O O   . SER A 1 99  ? 12.573  28.649  21.761  1.00 21.00 ? 119 SER A O   1 
ATOM   678  C CB  . SER A 1 99  ? 14.946  29.123  19.706  1.00 20.94 ? 119 SER A CB  1 
ATOM   679  O OG  . SER A 1 99  ? 14.953  30.510  19.799  1.00 20.94 ? 119 SER A OG  1 
ATOM   680  N N   . SER A 1 100 ? 11.828  30.102  20.189  1.00 21.90 ? 120 SER A N   1 
ATOM   681  C CA  . SER A 1 100 ? 10.825  30.723  21.035  1.00 21.90 ? 120 SER A CA  1 
ATOM   682  C C   . SER A 1 100 ? 9.696   29.742  21.310  1.00 21.90 ? 120 SER A C   1 
ATOM   683  O O   . SER A 1 100 ? 9.057   29.809  22.379  1.00 21.90 ? 120 SER A O   1 
ATOM   684  C CB  . SER A 1 100 ? 10.251  31.961  20.344  1.00 20.78 ? 120 SER A CB  1 
ATOM   685  O OG  . SER A 1 100 ? 11.181  33.039  20.297  1.00 20.78 ? 120 SER A OG  1 
ATOM   686  N N   . MET A 1 101 ? 9.454   28.772  20.435  1.00 22.12 ? 121 MET A N   1 
ATOM   687  C CA  . MET A 1 101 ? 8.386   27.814  20.589  1.00 22.12 ? 121 MET A CA  1 
ATOM   688  C C   . MET A 1 101 ? 8.707   26.547  21.361  1.00 22.12 ? 121 MET A C   1 
ATOM   689  O O   . MET A 1 101 ? 7.784   25.951  21.957  1.00 22.12 ? 121 MET A O   1 
ATOM   690  C CB  . MET A 1 101 ? 7.930   27.382  19.166  1.00 22.16 ? 121 MET A CB  1 
ATOM   691  C CG  . MET A 1 101 ? 7.444   28.557  18.340  1.00 22.16 ? 121 MET A CG  1 
ATOM   692  S SD  . MET A 1 101 ? 6.155   29.486  19.181  1.00 22.16 ? 121 MET A SD  1 
ATOM   693  C CE  . MET A 1 101 ? 5.998   30.842  18.017  1.00 22.16 ? 121 MET A CE  1 
ATOM   694  N N   . VAL A 1 102 ? 9.959   26.114  21.355  1.00 24.35 ? 122 VAL A N   1 
ATOM   695  C CA  . VAL A 1 102 ? 10.352  24.874  22.032  1.00 24.35 ? 122 VAL A CA  1 
ATOM   696  C C   . VAL A 1 102 ? 10.075  24.809  23.527  1.00 24.35 ? 122 VAL A C   1 
ATOM   697  O O   . VAL A 1 102 ? 9.694   23.724  24.020  1.00 24.35 ? 122 VAL A O   1 
ATOM   698  C CB  . VAL A 1 102 ? 11.851  24.624  21.799  1.00 24.02 ? 122 VAL A CB  1 
ATOM   699  C CG1 . VAL A 1 102 ? 12.321  23.365  22.532  1.00 24.02 ? 122 VAL A CG1 1 
ATOM   700  C CG2 . VAL A 1 102 ? 12.121  24.437  20.335  1.00 24.02 ? 122 VAL A CG2 1 
ATOM   701  N N   . GLN A 1 103 ? 10.204  25.840  24.337  1.00 26.97 ? 123 GLN A N   1 
ATOM   702  C CA  . GLN A 1 103 ? 9.926   25.733  25.753  1.00 26.97 ? 123 GLN A CA  1 
ATOM   703  C C   . GLN A 1 103 ? 8.490   25.283  25.986  1.00 26.97 ? 123 GLN A C   1 
ATOM   704  O O   . GLN A 1 103 ? 8.326   24.262  26.677  1.00 26.97 ? 123 GLN A O   1 
ATOM   705  C CB  . GLN A 1 103 ? 10.099  27.036  26.515  1.00 37.17 ? 123 GLN A CB  1 
ATOM   706  C CG  . GLN A 1 103 ? 9.798   26.779  28.032  1.00 37.17 ? 123 GLN A CG  1 
ATOM   707  C CD  . GLN A 1 103 ? 11.070  26.258  28.709  1.00 37.17 ? 123 GLN A CD  1 
ATOM   708  O OE1 . GLN A 1 103 ? 11.208  25.130  29.239  1.00 37.17 ? 123 GLN A OE1 1 
ATOM   709  N NE2 . GLN A 1 103 ? 12.067  27.177  28.696  1.00 37.17 ? 123 GLN A NE2 1 
ATOM   710  N N   . SER A 1 104 ? 7.506   25.990  25.443  1.00 23.99 ? 124 SER A N   1 
ATOM   711  C CA  . SER A 1 104 ? 6.105   25.600  25.693  1.00 23.99 ? 124 SER A CA  1 
ATOM   712  C C   . SER A 1 104 ? 5.709   24.292  25.023  1.00 23.99 ? 124 SER A C   1 
ATOM   713  O O   . SER A 1 104 ? 5.029   23.471  25.635  1.00 23.99 ? 124 SER A O   1 
ATOM   714  C CB  . SER A 1 104 ? 5.159   26.721  25.247  1.00 24.17 ? 124 SER A CB  1 
ATOM   715  O OG  . SER A 1 104 ? 5.252   26.914  23.839  1.00 24.17 ? 124 SER A OG  1 
ATOM   716  N N   . VAL A 1 105 ? 6.117   24.074  23.789  1.00 21.26 ? 125 VAL A N   1 
ATOM   717  C CA  . VAL A 1 105 ? 5.801   22.826  23.092  1.00 21.26 ? 125 VAL A CA  1 
ATOM   718  C C   . VAL A 1 105 ? 6.474   21.674  23.830  1.00 21.26 ? 125 VAL A C   1 
ATOM   719  O O   . VAL A 1 105 ? 5.859   20.631  24.059  1.00 21.26 ? 125 VAL A O   1 
ATOM   720  C CB  . VAL A 1 105 ? 6.254   22.856  21.633  1.00 20.01 ? 125 VAL A CB  1 
ATOM   721  C CG1 . VAL A 1 105 ? 6.017   21.499  20.971  1.00 20.01 ? 125 VAL A CG1 1 
ATOM   722  C CG2 . VAL A 1 105 ? 5.512   23.931  20.869  1.00 20.01 ? 125 VAL A CG2 1 
ATOM   723  N N   . GLY A 1 106 ? 7.741   21.855  24.194  1.00 21.38 ? 126 GLY A N   1 
ATOM   724  C CA  . GLY A 1 106 ? 8.495   20.859  24.919  1.00 21.38 ? 126 GLY A CA  1 
ATOM   725  C C   . GLY A 1 106 ? 7.873   20.523  26.275  1.00 21.38 ? 126 GLY A C   1 
ATOM   726  O O   . GLY A 1 106 ? 7.759   19.335  26.626  1.00 21.38 ? 126 GLY A O   1 
ATOM   727  N N   . THR A 1 107 ? 7.474   21.528  27.039  1.00 20.76 ? 127 THR A N   1 
ATOM   728  C CA  . THR A 1 107 ? 6.877   21.271  28.334  1.00 20.76 ? 127 THR A CA  1 
ATOM   729  C C   . THR A 1 107 ? 5.556   20.565  28.183  1.00 20.76 ? 127 THR A C   1 
ATOM   730  O O   . THR A 1 107 ? 5.308   19.602  28.944  1.00 20.76 ? 127 THR A O   1 
ATOM   731  C CB  . THR A 1 107 ? 6.674   22.596  29.091  1.00 21.34 ? 127 THR A CB  1 
ATOM   732  O OG1 . THR A 1 107 ? 7.966   23.222  29.110  1.00 21.34 ? 127 THR A OG1 1 
ATOM   733  C CG2 . THR A 1 107 ? 6.178   22.386  30.494  1.00 21.34 ? 127 THR A CG2 1 
ATOM   734  N N   . ASN A 1 108 ? 4.684   20.928  27.279  1.00 20.62 ? 128 ASN A N   1 
ATOM   735  C CA  . ASN A 1 108 ? 3.403   20.244  27.093  1.00 20.62 ? 128 ASN A CA  1 
ATOM   736  C C   . ASN A 1 108 ? 3.627   18.791  26.685  1.00 20.62 ? 128 ASN A C   1 
ATOM   737  O O   . ASN A 1 108 ? 2.924   17.867  27.097  1.00 20.62 ? 128 ASN A O   1 
ATOM   738  C CB  . ASN A 1 108 ? 2.584   20.951  26.008  1.00 21.93 ? 128 ASN A CB  1 
ATOM   739  C CG  . ASN A 1 108 ? 2.068   22.322  26.430  1.00 21.93 ? 128 ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 108 ? 1.662   22.503  27.586  1.00 21.93 ? 128 ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 108 ? 2.095   23.309  25.530  1.00 21.93 ? 128 ASN A ND2 1 
ATOM   742  N N   . LEU A 1 109 ? 4.640   18.565  25.855  1.00 21.44 ? 129 LEU A N   1 
ATOM   743  C CA  . LEU A 1 109 ? 4.999   17.241  25.375  1.00 21.44 ? 129 LEU A CA  1 
ATOM   744  C C   . LEU A 1 109 ? 5.432   16.356  26.539  1.00 21.44 ? 129 LEU A C   1 
ATOM   745  O O   . LEU A 1 109 ? 4.903   15.243  26.667  1.00 21.44 ? 129 LEU A O   1 
ATOM   746  C CB  . LEU A 1 109 ? 6.067   17.345  24.273  1.00 20.82 ? 129 LEU A CB  1 
ATOM   747  C CG  . LEU A 1 109 ? 6.243   16.116  23.376  1.00 20.82 ? 129 LEU A CG  1 
ATOM   748  C CD1 . LEU A 1 109 ? 4.923   15.681  22.737  1.00 20.82 ? 129 LEU A CD1 1 
ATOM   749  C CD2 . LEU A 1 109 ? 7.288   16.358  22.300  1.00 20.82 ? 129 LEU A CD2 1 
ATOM   750  N N   . LYS A 1 110 ? 6.293   16.841  27.396  1.00 24.55 ? 130 LYS A N   1 
ATOM   751  C CA  . LYS A 1 110 ? 6.737   16.132  28.576  1.00 24.55 ? 130 LYS A CA  1 
ATOM   752  C C   . LYS A 1 110 ? 5.565   15.842  29.522  1.00 24.55 ? 130 LYS A C   1 
ATOM   753  O O   . LYS A 1 110 ? 5.301   14.725  29.977  1.00 24.55 ? 130 LYS A O   1 
ATOM   754  C CB  . LYS A 1 110 ? 7.743   16.992  29.303  1.00 29.68 ? 130 LYS A CB  1 
ATOM   755  C CG  . LYS A 1 110 ? 8.391   16.318  30.494  1.00 29.68 ? 130 LYS A CG  1 
ATOM   756  C CD  . LYS A 1 110 ? 8.636   17.373  31.564  1.00 29.68 ? 130 LYS A CD  1 
ATOM   757  C CE  . LYS A 1 110 ? 9.691   18.391  31.165  1.00 29.68 ? 130 LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 110 ? 9.518   19.655  31.997  1.00 29.68 ? 130 LYS A NZ  1 
ATOM   759  N N   . GLU A 1 111 ? 4.761   16.861  29.806  1.00 25.30 ? 131 GLU A N   1 
ATOM   760  C CA  . GLU A 1 111 ? 3.598   16.743  30.646  1.00 25.30 ? 131 GLU A CA  1 
ATOM   761  C C   . GLU A 1 111 ? 2.524   15.861  30.102  1.00 25.30 ? 131 GLU A C   1 
ATOM   762  O O   . GLU A 1 111 ? 1.733   15.329  30.907  1.00 25.30 ? 131 GLU A O   1 
ATOM   763  C CB  . GLU A 1 111 ? 2.990   18.133  30.871  1.00 30.04 ? 131 GLU A CB  1 
ATOM   764  C CG  . GLU A 1 111 ? 3.864   19.119  31.612  1.00 30.04 ? 131 GLU A CG  1 
ATOM   765  C CD  . GLU A 1 111 ? 4.107   18.750  33.059  1.00 30.04 ? 131 GLU A CD  1 
ATOM   766  O OE1 . GLU A 1 111 ? 3.348   17.914  33.617  1.00 30.04 ? 131 GLU A OE1 1 
ATOM   767  O OE2 . GLU A 1 111 ? 5.062   19.300  33.663  1.00 30.04 ? 131 GLU A OE2 1 
ATOM   768  N N   . SER A 1 112 ? 2.396   15.570  28.815  1.00 21.06 ? 132 SER A N   1 
ATOM   769  C CA  . SER A 1 112 ? 1.336   14.739  28.307  1.00 21.06 ? 132 SER A CA  1 
ATOM   770  C C   . SER A 1 112 ? 1.510   13.279  28.639  1.00 21.06 ? 132 SER A C   1 
ATOM   771  O O   . SER A 1 112 ? 0.540   12.532  28.435  1.00 21.06 ? 132 SER A O   1 
ATOM   772  C CB  . SER A 1 112 ? 1.242   14.778  26.757  1.00 19.69 ? 132 SER A CB  1 
ATOM   773  O OG  . SER A 1 112 ? 2.453   14.248  26.238  1.00 19.69 ? 132 SER A OG  1 
ATOM   774  N N   . GLY A 1 113 ? 2.723   12.873  29.019  1.00 18.32 ? 133 GLY A N   1 
ATOM   775  C CA  . GLY A 1 113 ? 2.987   11.491  29.340  1.00 18.32 ? 133 GLY A CA  1 
ATOM   776  C C   . GLY A 1 113 ? 3.550   10.724  28.165  1.00 18.32 ? 133 GLY A C   1 
ATOM   777  O O   . GLY A 1 113 ? 3.722   9.496   28.203  1.00 18.32 ? 133 GLY A O   1 
ATOM   778  N N   . PHE A 1 114 ? 3.824   11.462  27.089  1.00 15.79 ? 134 PHE A N   1 
ATOM   779  C CA  . PHE A 1 114 ? 4.372   10.885  25.868  1.00 15.79 ? 134 PHE A CA  1 
ATOM   780  C C   . PHE A 1 114 ? 5.709   10.231  26.173  1.00 15.79 ? 134 PHE A C   1 
ATOM   781  O O   . PHE A 1 114 ? 6.525   10.857  26.864  1.00 15.79 ? 134 PHE A O   1 
ATOM   782  C CB  . PHE A 1 114 ? 4.552   11.992  24.830  1.00 8.99  ? 134 PHE A CB  1 
ATOM   783  C CG  . PHE A 1 114 ? 5.330   11.574  23.622  1.00 8.99  ? 134 PHE A CG  1 
ATOM   784  C CD1 . PHE A 1 114 ? 4.787   10.693  22.725  1.00 8.99  ? 134 PHE A CD1 1 
ATOM   785  C CD2 . PHE A 1 114 ? 6.604   12.096  23.423  1.00 8.99  ? 134 PHE A CD2 1 
ATOM   786  C CE1 . PHE A 1 114 ? 5.543   10.295  21.625  1.00 8.99  ? 134 PHE A CE1 1 
ATOM   787  C CE2 . PHE A 1 114 ? 7.332   11.731  22.288  1.00 8.99  ? 134 PHE A CE2 1 
ATOM   788  C CZ  . PHE A 1 114 ? 6.773   10.840  21.425  1.00 8.99  ? 134 PHE A CZ  1 
ATOM   789  N N   . HIS A 1 115 ? 5.956   9.052   25.625  1.00 17.99 ? 135 HIS A N   1 
ATOM   790  C CA  . HIS A 1 115 ? 7.252   8.424   25.911  1.00 17.99 ? 135 HIS A CA  1 
ATOM   791  C C   . HIS A 1 115 ? 7.743   7.686   24.691  1.00 17.99 ? 135 HIS A C   1 
ATOM   792  O O   . HIS A 1 115 ? 8.492   6.721   24.861  1.00 17.99 ? 135 HIS A O   1 
ATOM   793  C CB  . HIS A 1 115 ? 7.150   7.471   27.126  1.00 21.87 ? 135 HIS A CB  1 
ATOM   794  C CG  . HIS A 1 115 ? 5.951   6.582   27.065  1.00 21.87 ? 135 HIS A CG  1 
ATOM   795  N ND1 . HIS A 1 115 ? 4.711   6.964   27.546  1.00 21.87 ? 135 HIS A ND1 1 
ATOM   796  C CD2 . HIS A 1 115 ? 5.783   5.332   26.566  1.00 21.87 ? 135 HIS A CD2 1 
ATOM   797  C CE1 . HIS A 1 115 ? 3.839   5.988   27.348  1.00 21.87 ? 135 HIS A CE1 1 
ATOM   798  N NE2 . HIS A 1 115 ? 4.457   4.983   26.748  1.00 21.87 ? 135 HIS A NE2 1 
ATOM   799  N N   . GLY A 1 116 ? 7.309   8.098   23.512  1.00 15.57 ? 136 GLY A N   1 
ATOM   800  C CA  . GLY A 1 116 ? 7.748   7.431   22.278  1.00 15.57 ? 136 GLY A CA  1 
ATOM   801  C C   . GLY A 1 116 ? 8.946   8.179   21.745  1.00 15.57 ? 136 GLY A C   1 
ATOM   802  O O   . GLY A 1 116 ? 9.595   8.878   22.524  1.00 15.57 ? 136 GLY A O   1 
ATOM   803  N N   . VAL A 1 117 ? 9.143   8.135   20.433  1.00 14.35 ? 137 VAL A N   1 
ATOM   804  C CA  . VAL A 1 117 ? 10.261  8.856   19.797  1.00 14.35 ? 137 VAL A CA  1 
ATOM   805  C C   . VAL A 1 117 ? 9.781   10.169  19.199  1.00 14.35 ? 137 VAL A C   1 
ATOM   806  O O   . VAL A 1 117 ? 8.720   10.250  18.599  1.00 14.35 ? 137 VAL A O   1 
ATOM   807  C CB  . VAL A 1 117 ? 10.932  7.993   18.714  1.00 12.98 ? 137 VAL A CB  1 
ATOM   808  C CG1 . VAL A 1 117 ? 12.078  8.667   18.003  1.00 12.98 ? 137 VAL A CG1 1 
ATOM   809  C CG2 . VAL A 1 117 ? 11.516  6.737   19.416  1.00 12.98 ? 137 VAL A CG2 1 
ATOM   810  N N   . LEU A 1 118 ? 10.578  11.216  19.397  1.00 14.34 ? 138 LEU A N   1 
ATOM   811  C CA  . LEU A 1 118 ? 10.292  12.542  18.879  1.00 14.34 ? 138 LEU A CA  1 
ATOM   812  C C   . LEU A 1 118 ? 11.162  12.808  17.665  1.00 14.34 ? 138 LEU A C   1 
ATOM   813  O O   . LEU A 1 118 ? 12.392  12.715  17.755  1.00 14.34 ? 138 LEU A O   1 
ATOM   814  C CB  . LEU A 1 118 ? 10.578  13.609  19.940  1.00 15.22 ? 138 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 118 ? 10.393  15.080  19.554  1.00 15.22 ? 138 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 118 ? 8.936   15.373  19.300  1.00 15.22 ? 138 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 118 ? 10.882  16.030  20.632  1.00 15.22 ? 138 LEU A CD2 1 
ATOM   818  N N   . VAL A 1 119 ? 10.531  13.088  16.509  1.00 14.58 ? 139 VAL A N   1 
ATOM   819  C CA  . VAL A 1 119 ? 11.259  13.365  15.282  1.00 14.58 ? 139 VAL A CA  1 
ATOM   820  C C   . VAL A 1 119 ? 11.088  14.829  14.945  1.00 14.58 ? 139 VAL A C   1 
ATOM   821  O O   . VAL A 1 119 ? 9.967   15.316  14.749  1.00 14.58 ? 139 VAL A O   1 
ATOM   822  C CB  . VAL A 1 119 ? 10.742  12.497  14.136  1.00 14.13 ? 139 VAL A CB  1 
ATOM   823  C CG1 . VAL A 1 119 ? 11.593  12.682  12.883  1.00 14.13 ? 139 VAL A CG1 1 
ATOM   824  C CG2 . VAL A 1 119 ? 10.724  11.021  14.531  1.00 14.13 ? 139 VAL A CG2 1 
ATOM   825  N N   . VAL A 1 120 ? 12.163  15.607  14.916  1.00 16.38 ? 140 VAL A N   1 
ATOM   826  C CA  . VAL A 1 120 ? 12.146  17.034  14.672  1.00 16.38 ? 140 VAL A CA  1 
ATOM   827  C C   . VAL A 1 120 ? 12.501  17.373  13.242  1.00 16.38 ? 140 VAL A C   1 
ATOM   828  O O   . VAL A 1 120 ? 13.424  16.808  12.664  1.00 16.38 ? 140 VAL A O   1 
ATOM   829  C CB  . VAL A 1 120 ? 13.144  17.749  15.605  1.00 15.61 ? 140 VAL A CB  1 
ATOM   830  C CG1 . VAL A 1 120 ? 13.151  19.232  15.462  1.00 15.61 ? 140 VAL A CG1 1 
ATOM   831  C CG2 . VAL A 1 120 ? 12.816  17.389  17.089  1.00 15.61 ? 140 VAL A CG2 1 
ATOM   832  N N   . ILE A 1 121 ? 11.732  18.287  12.658  1.00 15.41 ? 141 ILE A N   1 
ATOM   833  C CA  . ILE A 1 121 ? 11.951  18.769  11.293  1.00 15.41 ? 141 ILE A CA  1 
ATOM   834  C C   . ILE A 1 121 ? 12.242  20.271  11.362  1.00 15.41 ? 141 ILE A C   1 
ATOM   835  O O   . ILE A 1 121 ? 13.065  20.751  10.597  1.00 15.41 ? 141 ILE A O   1 
ATOM   836  C CB  . ILE A 1 121 ? 10.738  18.513  10.400  1.00 14.83 ? 141 ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 121 ? 10.659  17.041  10.026  1.00 14.83 ? 141 ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 121 ? 10.802  19.330  9.099   1.00 14.83 ? 141 ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 121 ? 9.609   16.658  9.031   1.00 14.83 ? 141 ILE A CD1 1 
ATOM   840  N N   . SER A 1 122 ? 11.613  20.957  12.314  1.00 14.74 ? 142 SER A N   1 
ATOM   841  C CA  . SER A 1 122 ? 11.769  22.397  12.501  1.00 14.74 ? 142 SER A CA  1 
ATOM   842  C C   . SER A 1 122 ? 13.201  22.859  12.330  1.00 14.74 ? 142 SER A C   1 
ATOM   843  O O   . SER A 1 122 ? 14.068  22.233  12.947  1.00 14.74 ? 142 SER A O   1 
ATOM   844  C CB  . SER A 1 122 ? 11.274  22.755  13.926  1.00 14.02 ? 142 SER A CB  1 
ATOM   845  O OG  . SER A 1 122 ? 9.938   22.292  14.064  1.00 14.02 ? 142 SER A OG  1 
ATOM   846  N N   . ASN A 1 123 ? 13.471  23.911  11.522  1.00 16.44 ? 143 ASN A N   1 
ATOM   847  C CA  . ASN A 1 123 ? 14.829  24.401  11.307  1.00 16.44 ? 143 ASN A CA  1 
ATOM   848  C C   . ASN A 1 123 ? 15.201  25.521  12.261  1.00 16.44 ? 143 ASN A C   1 
ATOM   849  O O   . ASN A 1 123 ? 14.352  26.265  12.773  1.00 16.44 ? 143 ASN A O   1 
ATOM   850  C CB  . ASN A 1 123 ? 14.980  24.936  9.885   1.00 17.52 ? 143 ASN A CB  1 
ATOM   851  C CG  . ASN A 1 123 ? 15.387  23.877  8.917   1.00 17.52 ? 143 ASN A CG  1 
ATOM   852  O OD1 . ASN A 1 123 ? 16.029  22.907  9.297   1.00 17.52 ? 143 ASN A OD1 1 
ATOM   853  N ND2 . ASN A 1 123 ? 15.036  24.047  7.654   1.00 17.52 ? 143 ASN A ND2 1 
ATOM   854  N N   . PRO A 1 124 ? 16.504  25.656  12.561  1.00 18.63 ? 144 PRO A N   1 
ATOM   855  C CA  . PRO A 1 124 ? 17.584  24.800  12.125  1.00 18.63 ? 144 PRO A CA  1 
ATOM   856  C C   . PRO A 1 124 ? 17.519  23.456  12.857  1.00 18.63 ? 144 PRO A C   1 
ATOM   857  O O   . PRO A 1 124 ? 17.755  23.390  14.077  1.00 18.63 ? 144 PRO A O   1 
ATOM   858  C CB  . PRO A 1 124 ? 18.867  25.568  12.462  1.00 17.49 ? 144 PRO A CB  1 
ATOM   859  C CG  . PRO A 1 124 ? 18.461  26.471  13.577  1.00 17.49 ? 144 PRO A CG  1 
ATOM   860  C CD  . PRO A 1 124 ? 16.973  26.695  13.498  1.00 17.49 ? 144 PRO A CD  1 
ATOM   861  N N   . VAL A 1 125 ? 17.193  22.389  12.145  1.00 19.51 ? 145 VAL A N   1 
ATOM   862  C CA  . VAL A 1 125 ? 17.000  21.039  12.679  1.00 19.51 ? 145 VAL A CA  1 
ATOM   863  C C   . VAL A 1 125 ? 18.002  20.587  13.686  1.00 19.51 ? 145 VAL A C   1 
ATOM   864  O O   . VAL A 1 125 ? 17.585  20.160  14.824  1.00 19.51 ? 145 VAL A O   1 
ATOM   865  C CB  . VAL A 1 125 ? 16.884  20.085  11.463  1.00 18.63 ? 145 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 125 ? 18.193  19.754  10.830  1.00 18.63 ? 145 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 125 ? 16.161  18.831  11.954  1.00 18.63 ? 145 VAL A CG2 1 
ATOM   868  N N   . ASP A 1 126 ? 19.295  20.664  13.503  1.00 18.93 ? 146 ASP A N   1 
ATOM   869  C CA  . ASP A 1 126 ? 20.221  20.205  14.558  1.00 18.93 ? 146 ASP A CA  1 
ATOM   870  C C   . ASP A 1 126 ? 20.065  20.970  15.833  1.00 18.93 ? 146 ASP A C   1 
ATOM   871  O O   . ASP A 1 126 ? 19.954  20.319  16.869  1.00 18.93 ? 146 ASP A O   1 
ATOM   872  C CB  . ASP A 1 126 ? 21.673  20.302  14.061  1.00 18.80 ? 146 ASP A CB  1 
ATOM   873  C CG  . ASP A 1 126 ? 21.817  19.444  12.852  1.00 18.80 ? 146 ASP A CG  1 
ATOM   874  O OD1 . ASP A 1 126 ? 21.775  18.200  12.931  1.00 18.80 ? 146 ASP A OD1 1 
ATOM   875  O OD2 . ASP A 1 126 ? 21.895  20.010  11.731  1.00 18.80 ? 146 ASP A OD2 1 
ATOM   876  N N   . VAL A 1 127 ? 20.038  22.281  15.823  1.00 18.73 ? 147 VAL A N   1 
ATOM   877  C CA  . VAL A 1 127 ? 19.909  23.056  17.054  1.00 18.73 ? 147 VAL A CA  1 
ATOM   878  C C   . VAL A 1 127 ? 18.541  22.855  17.680  1.00 18.73 ? 147 VAL A C   1 
ATOM   879  O O   . VAL A 1 127 ? 18.509  22.661  18.923  1.00 18.73 ? 147 VAL A O   1 
ATOM   880  C CB  . VAL A 1 127 ? 20.122  24.548  16.822  1.00 18.20 ? 147 VAL A CB  1 
ATOM   881  C CG1 . VAL A 1 127 ? 20.051  25.364  18.110  1.00 18.20 ? 147 VAL A CG1 1 
ATOM   882  C CG2 . VAL A 1 127 ? 21.498  24.752  16.217  1.00 18.20 ? 147 VAL A CG2 1 
ATOM   883  N N   . ILE A 1 128 ? 17.467  22.846  16.938  1.00 18.26 ? 148 ILE A N   1 
ATOM   884  C CA  . ILE A 1 128 ? 16.144  22.632  17.556  1.00 18.26 ? 148 ILE A CA  1 
ATOM   885  C C   . ILE A 1 128 ? 15.998  21.252  18.111  1.00 18.26 ? 148 ILE A C   1 
ATOM   886  O O   . ILE A 1 128 ? 15.385  21.064  19.164  1.00 18.26 ? 148 ILE A O   1 
ATOM   887  C CB  . ILE A 1 128 ? 15.012  22.909  16.537  1.00 16.19 ? 148 ILE A CB  1 
ATOM   888  C CG1 . ILE A 1 128 ? 15.121  24.361  16.043  1.00 16.19 ? 148 ILE A CG1 1 
ATOM   889  C CG2 . ILE A 1 128 ? 13.655  22.711  17.144  1.00 16.19 ? 148 ILE A CG2 1 
ATOM   890  C CD1 . ILE A 1 128 ? 15.134  25.398  17.163  1.00 16.19 ? 148 ILE A CD1 1 
ATOM   891  N N   . THR A 1 129 ? 16.587  20.244  17.452  1.00 18.58 ? 149 THR A N   1 
ATOM   892  C CA  . THR A 1 129 ? 16.533  18.889  18.027  1.00 18.58 ? 149 THR A CA  1 
ATOM   893  C C   . THR A 1 129 ? 17.173  18.926  19.404  1.00 18.58 ? 149 THR A C   1 
ATOM   894  O O   . THR A 1 129 ? 16.619  18.409  20.410  1.00 18.58 ? 149 THR A O   1 
ATOM   895  C CB  . THR A 1 129 ? 17.232  17.886  17.104  1.00 17.23 ? 149 THR A CB  1 
ATOM   896  O OG1 . THR A 1 129 ? 16.593  17.916  15.835  1.00 17.23 ? 149 THR A OG1 1 
ATOM   897  C CG2 . THR A 1 129 ? 17.123  16.460  17.590  1.00 17.23 ? 149 THR A CG2 1 
ATOM   898  N N   . ALA A 1 130 ? 18.342  19.521  19.558  1.00 19.52 ? 150 ALA A N   1 
ATOM   899  C CA  . ALA A 1 130 ? 19.043  19.624  20.825  1.00 19.52 ? 150 ALA A CA  1 
ATOM   900  C C   . ALA A 1 130 ? 18.254  20.383  21.863  1.00 19.52 ? 150 ALA A C   1 
ATOM   901  O O   . ALA A 1 130 ? 18.171  19.909  23.027  1.00 19.52 ? 150 ALA A O   1 
ATOM   902  C CB  . ALA A 1 130 ? 20.360  20.330  20.574  1.00 17.81 ? 150 ALA A CB  1 
ATOM   903  N N   . LEU A 1 131 ? 17.627  21.499  21.540  1.00 21.08 ? 151 LEU A N   1 
ATOM   904  C CA  . LEU A 1 131 ? 16.856  22.232  22.546  1.00 21.08 ? 151 LEU A CA  1 
ATOM   905  C C   . LEU A 1 131 ? 15.631  21.452  22.973  1.00 21.08 ? 151 LEU A C   1 
ATOM   906  O O   . LEU A 1 131 ? 15.231  21.554  24.133  1.00 21.08 ? 151 LEU A O   1 
ATOM   907  C CB  . LEU A 1 131 ? 16.397  23.600  22.063  1.00 21.39 ? 151 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 131 ? 17.477  24.635  21.766  1.00 21.39 ? 151 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 131 ? 16.869  25.805  21.010  1.00 21.39 ? 151 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 131 ? 18.153  25.165  23.024  1.00 21.39 ? 151 LEU A CD2 1 
ATOM   911  N N   . PHE A 1 132 ? 15.041  20.667  22.085  1.00 21.88 ? 152 PHE A N   1 
ATOM   912  C CA  . PHE A 1 132 ? 13.891  19.848  22.433  1.00 21.88 ? 152 PHE A CA  1 
ATOM   913  C C   . PHE A 1 132 ? 14.347  18.808  23.449  1.00 21.88 ? 152 PHE A C   1 
ATOM   914  O O   . PHE A 1 132 ? 13.717  18.661  24.475  1.00 21.88 ? 152 PHE A O   1 
ATOM   915  C CB  . PHE A 1 132 ? 13.280  19.119  21.231  1.00 21.44 ? 152 PHE A CB  1 
ATOM   916  C CG  . PHE A 1 132 ? 12.017  19.750  20.705  1.00 21.44 ? 152 PHE A CG  1 
ATOM   917  C CD1 . PHE A 1 132 ? 10.910  19.902  21.505  1.00 21.44 ? 152 PHE A CD1 1 
ATOM   918  C CD2 . PHE A 1 132 ? 11.937  20.212  19.379  1.00 21.44 ? 152 PHE A CD2 1 
ATOM   919  C CE1 . PHE A 1 132 ? 9.752   20.473  21.017  1.00 21.44 ? 152 PHE A CE1 1 
ATOM   920  C CE2 . PHE A 1 132 ? 10.790  20.786  18.877  1.00 21.44 ? 152 PHE A CE2 1 
ATOM   921  C CZ  . PHE A 1 132 ? 9.683   20.910  19.702  1.00 21.44 ? 152 PHE A CZ  1 
ATOM   922  N N   . GLN A 1 133 ? 15.491  18.170  23.161  1.00 23.32 ? 153 GLN A N   1 
ATOM   923  C CA  . GLN A 1 133 ? 16.023  17.170  24.117  1.00 23.32 ? 153 GLN A CA  1 
ATOM   924  C C   . GLN A 1 133 ? 16.236  17.836  25.457  1.00 23.32 ? 153 GLN A C   1 
ATOM   925  O O   . GLN A 1 133 ? 15.885  17.298  26.520  1.00 23.32 ? 153 GLN A O   1 
ATOM   926  C CB  . GLN A 1 133 ? 17.273  16.536  23.577  1.00 23.27 ? 153 GLN A CB  1 
ATOM   927  C CG  . GLN A 1 133 ? 17.759  15.245  24.238  1.00 23.27 ? 153 GLN A CG  1 
ATOM   928  C CD  . GLN A 1 133 ? 18.517  15.548  25.525  1.00 23.27 ? 153 GLN A CD  1 
ATOM   929  O OE1 . GLN A 1 133 ? 19.440  16.375  25.530  1.00 23.27 ? 153 GLN A OE1 1 
ATOM   930  N NE2 . GLN A 1 133 ? 18.128  14.900  26.619  1.00 23.27 ? 153 GLN A NE2 1 
ATOM   931  N N   . HIS A 1 134 ? 16.788  19.031  25.450  1.00 25.64 ? 154 HIS A N   1 
ATOM   932  C CA  . HIS A 1 134 ? 17.057  19.818  26.641  1.00 25.64 ? 154 HIS A CA  1 
ATOM   933  C C   . HIS A 1 134 ? 15.823  20.223  27.413  1.00 25.64 ? 154 HIS A C   1 
ATOM   934  O O   . HIS A 1 134 ? 15.833  20.182  28.683  1.00 25.64 ? 154 HIS A O   1 
ATOM   935  C CB  . HIS A 1 134 ? 17.837  21.084  26.156  1.00 26.92 ? 154 HIS A CB  1 
ATOM   936  C CG  . HIS A 1 134 ? 18.208  21.967  27.310  1.00 26.92 ? 154 HIS A CG  1 
ATOM   937  N ND1 . HIS A 1 134 ? 19.323  21.713  28.091  1.00 26.92 ? 154 HIS A ND1 1 
ATOM   938  C CD2 . HIS A 1 134 ? 17.618  23.051  27.836  1.00 26.92 ? 154 HIS A CD2 1 
ATOM   939  C CE1 . HIS A 1 134 ? 19.407  22.603  29.048  1.00 26.92 ? 154 HIS A CE1 1 
ATOM   940  N NE2 . HIS A 1 134 ? 18.381  23.428  28.929  1.00 26.92 ? 154 HIS A NE2 1 
ATOM   941  N N   . VAL A 1 135 ? 14.731  20.657  26.812  1.00 25.75 ? 155 VAL A N   1 
ATOM   942  C CA  . VAL A 1 135 ? 13.516  21.071  27.515  1.00 25.75 ? 155 VAL A CA  1 
ATOM   943  C C   . VAL A 1 135 ? 12.690  19.889  27.967  1.00 25.75 ? 155 VAL A C   1 
ATOM   944  O O   . VAL A 1 135 ? 12.184  19.882  29.084  1.00 25.75 ? 155 VAL A O   1 
ATOM   945  C CB  . VAL A 1 135 ? 12.658  21.982  26.596  1.00 24.83 ? 155 VAL A CB  1 
ATOM   946  C CG1 . VAL A 1 135 ? 11.360  22.442  27.211  1.00 24.83 ? 155 VAL A CG1 1 
ATOM   947  C CG2 . VAL A 1 135 ? 13.495  23.214  26.257  1.00 24.83 ? 155 VAL A CG2 1 
ATOM   948  N N   . THR A 1 136 ? 12.523  18.879  27.119  1.00 25.96 ? 156 THR A N   1 
ATOM   949  C CA  . THR A 1 136 ? 11.674  17.745  27.504  1.00 25.96 ? 156 THR A CA  1 
ATOM   950  C C   . THR A 1 136 ? 12.322  16.893  28.538  1.00 25.96 ? 156 THR A C   1 
ATOM   951  O O   . THR A 1 136 ? 11.643  16.242  29.348  1.00 25.96 ? 156 THR A O   1 
ATOM   952  C CB  . THR A 1 136 ? 11.344  16.845  26.287  1.00 24.43 ? 156 THR A CB  1 
ATOM   953  O OG1 . THR A 1 136 ? 12.573  16.344  25.775  1.00 24.43 ? 156 THR A OG1 1 
ATOM   954  C CG2 . THR A 1 136 ? 10.602  17.673  25.230  1.00 24.43 ? 156 THR A CG2 1 
ATOM   955  N N   . GLY A 1 137 ? 13.652  16.781  28.460  1.00 24.40 ? 157 GLY A N   1 
ATOM   956  C CA  . GLY A 1 137 ? 14.366  15.914  29.388  1.00 24.40 ? 157 GLY A CA  1 
ATOM   957  C C   . GLY A 1 137 ? 14.312  14.471  28.938  1.00 24.40 ? 157 GLY A C   1 
ATOM   958  O O   . GLY A 1 137 ? 14.747  13.581  29.688  1.00 24.40 ? 157 GLY A O   1 
ATOM   959  N N   . PHE A 1 138 ? 13.806  14.199  27.744  1.00 22.34 ? 158 PHE A N   1 
ATOM   960  C CA  . PHE A 1 138 ? 13.739  12.828  27.228  1.00 22.34 ? 158 PHE A CA  1 
ATOM   961  C C   . PHE A 1 138 ? 15.158  12.353  26.971  1.00 22.34 ? 158 PHE A C   1 
ATOM   962  O O   . PHE A 1 138 ? 16.065  13.146  26.687  1.00 22.34 ? 158 PHE A O   1 
ATOM   963  C CB  . PHE A 1 138 ? 12.921  12.789  25.951  1.00 21.59 ? 158 PHE A CB  1 
ATOM   964  C CG  . PHE A 1 138 ? 11.470  13.174  26.074  1.00 21.59 ? 158 PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 138 ? 10.805  13.093  27.271  1.00 21.59 ? 158 PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 138 ? 10.749  13.577  24.962  1.00 21.59 ? 158 PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 138 ? 9.462   13.434  27.385  1.00 21.59 ? 158 PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 138 ? 9.420   13.900  25.039  1.00 21.59 ? 158 PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 138 ? 8.755   13.842  26.259  1.00 21.59 ? 158 PHE A CZ  1 
ATOM   970  N N   . PRO A 1 139 ? 15.381  11.061  27.021  1.00 21.79 ? 159 PRO A N   1 
ATOM   971  C CA  . PRO A 1 139 ? 16.719  10.547  26.735  1.00 21.79 ? 159 PRO A CA  1 
ATOM   972  C C   . PRO A 1 139 ? 17.090  10.976  25.349  1.00 21.79 ? 159 PRO A C   1 
ATOM   973  O O   . PRO A 1 139 ? 16.258  10.873  24.434  1.00 21.79 ? 159 PRO A O   1 
ATOM   974  C CB  . PRO A 1 139 ? 16.645  9.053   26.943  1.00 21.43 ? 159 PRO A CB  1 
ATOM   975  C CG  . PRO A 1 139 ? 15.213  8.769   27.244  1.00 21.43 ? 159 PRO A CG  1 
ATOM   976  C CD  . PRO A 1 139 ? 14.415  10.030  27.339  1.00 21.43 ? 159 PRO A CD  1 
ATOM   977  N N   . ALA A 1 140 ? 18.333  11.361  25.097  1.00 20.80 ? 160 ALA A N   1 
ATOM   978  C CA  . ALA A 1 140 ? 18.797  11.779  23.780  1.00 20.80 ? 160 ALA A CA  1 
ATOM   979  C C   . ALA A 1 140 ? 18.540  10.760  22.698  1.00 20.80 ? 160 ALA A C   1 
ATOM   980  O O   . ALA A 1 140 ? 18.346  11.155  21.529  1.00 20.80 ? 160 ALA A O   1 
ATOM   981  C CB  . ALA A 1 140 ? 20.281  12.070  23.871  1.00 20.60 ? 160 ALA A CB  1 
ATOM   982  N N   . HIS A 1 141 ? 18.460  9.466   22.968  1.00 19.97 ? 161 HIS A N   1 
ATOM   983  C CA  . HIS A 1 141 ? 18.171  8.477   21.918  1.00 19.97 ? 161 HIS A CA  1 
ATOM   984  C C   . HIS A 1 141 ? 16.710  8.441   21.528  1.00 19.97 ? 161 HIS A C   1 
ATOM   985  O O   . HIS A 1 141 ? 16.345  7.735   20.580  1.00 19.97 ? 161 HIS A O   1 
ATOM   986  C CB  . HIS A 1 141 ? 18.620  7.082   22.365  1.00 18.88 ? 161 HIS A CB  1 
ATOM   987  C CG  . HIS A 1 141 ? 17.942  6.531   23.572  1.00 18.88 ? 161 HIS A CG  1 
ATOM   988  N ND1 . HIS A 1 141 ? 16.882  5.654   23.471  1.00 18.88 ? 161 HIS A ND1 1 
ATOM   989  C CD2 . HIS A 1 141 ? 18.165  6.711   24.889  1.00 18.88 ? 161 HIS A CD2 1 
ATOM   990  C CE1 . HIS A 1 141 ? 16.485  5.321   24.709  1.00 18.88 ? 161 HIS A CE1 1 
ATOM   991  N NE2 . HIS A 1 141 ? 17.232  5.968   25.571  1.00 18.88 ? 161 HIS A NE2 1 
ATOM   992  N N   . LYS A 1 142 ? 15.840  9.127   22.264  1.00 19.24 ? 162 LYS A N   1 
ATOM   993  C CA  . LYS A 1 142 ? 14.446  9.210   21.921  1.00 19.24 ? 162 LYS A CA  1 
ATOM   994  C C   . LYS A 1 142 ? 14.109  10.489  21.147  1.00 19.24 ? 162 LYS A C   1 
ATOM   995  O O   . LYS A 1 142 ? 12.962  10.698  20.760  1.00 19.24 ? 162 LYS A O   1 
ATOM   996  C CB  . LYS A 1 142 ? 13.610  9.265   23.192  1.00 21.69 ? 162 LYS A CB  1 
ATOM   997  C CG  . LYS A 1 142 ? 13.693  7.989   24.000  1.00 21.69 ? 162 LYS A CG  1 
ATOM   998  C CD  . LYS A 1 142 ? 12.729  6.934   23.552  1.00 21.69 ? 162 LYS A CD  1 
ATOM   999  C CE  . LYS A 1 142 ? 11.979  6.358   24.764  1.00 21.69 ? 162 LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 142 ? 11.154  5.184   24.217  1.00 21.69 ? 162 LYS A NZ  1 
ATOM   1001 N N   . VAL A 1 143 ? 15.051  11.406  21.000  1.00 17.20 ? 163 VAL A N   1 
ATOM   1002 C CA  . VAL A 1 143 ? 14.887  12.659  20.313  1.00 17.20 ? 163 VAL A CA  1 
ATOM   1003 C C   . VAL A 1 143 ? 15.866  12.775  19.166  1.00 17.20 ? 163 VAL A C   1 
ATOM   1004 O O   . VAL A 1 143 ? 17.075  12.946  19.377  1.00 17.20 ? 163 VAL A O   1 
ATOM   1005 C CB  . VAL A 1 143 ? 15.175  13.866  21.236  1.00 15.42 ? 163 VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 143 ? 14.873  15.158  20.482  1.00 15.42 ? 163 VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 143 ? 14.324  13.805  22.467  1.00 15.42 ? 163 VAL A CG2 1 
ATOM   1008 N N   . ILE A 1 144 ? 15.359  12.684  17.934  1.00 16.62 ? 164 ILE A N   1 
ATOM   1009 C CA  . ILE A 1 144 ? 16.192  12.750  16.743  1.00 16.62 ? 164 ILE A CA  1 
ATOM   1010 C C   . ILE A 1 144 ? 15.629  13.735  15.708  1.00 16.62 ? 164 ILE A C   1 
ATOM   1011 O O   . ILE A 1 144 ? 14.500  14.191  15.818  1.00 16.62 ? 164 ILE A O   1 
ATOM   1012 C CB  . ILE A 1 144 ? 16.313  11.367  16.074  1.00 17.07 ? 164 ILE A CB  1 
ATOM   1013 C CG1 . ILE A 1 144 ? 14.906  10.776  15.918  1.00 17.07 ? 164 ILE A CG1 1 
ATOM   1014 C CG2 . ILE A 1 144 ? 17.166  10.406  16.867  1.00 17.07 ? 164 ILE A CG2 1 
ATOM   1015 C CD1 . ILE A 1 144 ? 14.955  9.472   15.106  1.00 17.07 ? 164 ILE A CD1 1 
ATOM   1016 N N   . GLY A 1 145 ? 16.439  14.082  14.720  1.00 15.16 ? 165 GLY A N   1 
ATOM   1017 C CA  . GLY A 1 145 ? 16.022  15.024  13.679  1.00 15.16 ? 165 GLY A CA  1 
ATOM   1018 C C   . GLY A 1 145 ? 16.206  14.458  12.309  1.00 15.16 ? 165 GLY A C   1 
ATOM   1019 O O   . GLY A 1 145 ? 17.087  13.620  12.093  1.00 15.16 ? 165 GLY A O   1 
ATOM   1020 N N   . THR A 1 146 ? 15.428  14.906  11.315  1.00 14.48 ? 166 THR A N   1 
ATOM   1021 C CA  . THR A 1 146 ? 15.615  14.397  9.942   1.00 14.48 ? 166 THR A CA  1 
ATOM   1022 C C   . THR A 1 146 ? 17.031  14.701  9.470   1.00 14.48 ? 166 THR A C   1 
ATOM   1023 O O   . THR A 1 146 ? 17.599  13.949  8.657   1.00 14.48 ? 166 THR A O   1 
ATOM   1024 C CB  . THR A 1 146 ? 14.604  14.998  8.971   1.00 13.28 ? 166 THR A CB  1 
ATOM   1025 O OG1 . THR A 1 146 ? 14.565  16.417  9.161   1.00 13.28 ? 166 THR A OG1 1 
ATOM   1026 C CG2 . THR A 1 146 ? 13.208  14.423  9.234   1.00 13.28 ? 166 THR A CG2 1 
ATOM   1027 N N   . GLY A 1 147 ? 17.588  15.820  9.891   1.00 16.09 ? 167 GLY A N   1 
ATOM   1028 C CA  . GLY A 1 147 ? 18.945  16.232  9.555   1.00 16.09 ? 167 GLY A CA  1 
ATOM   1029 C C   . GLY A 1 147 ? 19.325  16.018  8.133   1.00 16.09 ? 167 GLY A C   1 
ATOM   1030 O O   . GLY A 1 147 ? 18.556  16.460  7.255   1.00 16.09 ? 167 GLY A O   1 
ATOM   1031 N N   . THR A 1 148 ? 20.430  15.353  7.795   1.00 16.82 ? 168 THR A N   1 
ATOM   1032 C CA  . THR A 1 148 ? 20.798  15.228  6.382   1.00 16.82 ? 168 THR A CA  1 
ATOM   1033 C C   . THR A 1 148 ? 20.209  14.035  5.705   1.00 16.82 ? 168 THR A C   1 
ATOM   1034 O O   . THR A 1 148 ? 20.705  13.637  4.620   1.00 16.82 ? 168 THR A O   1 
ATOM   1035 C CB  . THR A 1 148 ? 22.326  15.186  6.210   1.00 15.86 ? 168 THR A CB  1 
ATOM   1036 O OG1 . THR A 1 148 ? 22.806  14.088  6.955   1.00 15.86 ? 168 THR A OG1 1 
ATOM   1037 C CG2 . THR A 1 148 ? 22.959  16.461  6.744   1.00 15.86 ? 168 THR A CG2 1 
ATOM   1038 N N   . LEU A 1 149 ? 19.090  13.490  6.165   1.00 17.11 ? 169 LEU A N   1 
ATOM   1039 C CA  . LEU A 1 149 ? 18.444  12.381  5.425   1.00 17.11 ? 169 LEU A CA  1 
ATOM   1040 C C   . LEU A 1 149 ? 17.881  12.996  4.137   1.00 17.11 ? 169 LEU A C   1 
ATOM   1041 O O   . LEU A 1 149 ? 17.789  12.291  3.141   1.00 17.11 ? 169 LEU A O   1 
ATOM   1042 C CB  . LEU A 1 149 ? 17.374  11.679  6.241   1.00 14.41 ? 169 LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 149 ? 16.645  10.447  5.669   1.00 14.41 ? 169 LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 149 ? 17.624  9.347   5.284   1.00 14.41 ? 169 LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 149 ? 15.652  9.895   6.662   1.00 14.41 ? 169 LEU A CD2 1 
ATOM   1046 N N   . LEU A 1 150 ? 17.485  14.270  4.168   1.00 17.73 ? 170 LEU A N   1 
ATOM   1047 C CA  . LEU A 1 150 ? 16.964  14.974  3.028   1.00 17.73 ? 170 LEU A CA  1 
ATOM   1048 C C   . LEU A 1 150 ? 18.114  15.333  2.098   1.00 17.73 ? 170 LEU A C   1 
ATOM   1049 O O   . LEU A 1 150 ? 18.076  15.016  0.908   1.00 17.73 ? 170 LEU A O   1 
ATOM   1050 C CB  . LEU A 1 150 ? 16.250  16.255  3.450   1.00 17.39 ? 170 LEU A CB  1 
ATOM   1051 C CG  . LEU A 1 150 ? 15.789  17.213  2.334   1.00 17.39 ? 170 LEU A CG  1 
ATOM   1052 C CD1 . LEU A 1 150 ? 14.854  16.493  1.356   1.00 17.39 ? 170 LEU A CD1 1 
ATOM   1053 C CD2 . LEU A 1 150 ? 15.116  18.413  2.934   1.00 17.39 ? 170 LEU A CD2 1 
ATOM   1054 N N   . ASP A 1 151 ? 19.180  15.892  2.672   1.00 18.59 ? 171 ASP A N   1 
ATOM   1055 C CA  . ASP A 1 151 ? 20.379  16.230  1.915   1.00 18.59 ? 171 ASP A CA  1 
ATOM   1056 C C   . ASP A 1 151 ? 20.948  15.045  1.199   1.00 18.59 ? 171 ASP A C   1 
ATOM   1057 O O   . ASP A 1 151 ? 21.343  15.177  0.025   1.00 18.59 ? 171 ASP A O   1 
ATOM   1058 C CB  . ASP A 1 151 ? 21.452  16.747  2.857   1.00 21.17 ? 171 ASP A CB  1 
ATOM   1059 C CG  . ASP A 1 151 ? 20.931  17.941  3.594   1.00 21.17 ? 171 ASP A CG  1 
ATOM   1060 O OD1 . ASP A 1 151 ? 20.810  19.014  2.943   1.00 21.17 ? 171 ASP A OD1 1 
ATOM   1061 O OD2 . ASP A 1 151 ? 20.573  17.939  4.750   1.00 21.17 ? 171 ASP A OD2 1 
ATOM   1062 N N   . THR A 1 152 ? 20.977  13.881  1.864   1.00 15.32 ? 172 THR A N   1 
ATOM   1063 C CA  . THR A 1 152 ? 21.467  12.658  1.204   1.00 15.32 ? 172 THR A CA  1 
ATOM   1064 C C   . THR A 1 152 ? 20.555  12.244  0.076   1.00 15.32 ? 172 THR A C   1 
ATOM   1065 O O   . THR A 1 152 ? 21.042  11.799  -0.989  1.00 15.32 ? 172 THR A O   1 
ATOM   1066 C CB  . THR A 1 152 ? 21.546  11.514  2.243   1.00 13.44 ? 172 THR A CB  1 
ATOM   1067 O OG1 . THR A 1 152 ? 22.409  11.977  3.240   1.00 13.44 ? 172 THR A OG1 1 
ATOM   1068 C CG2 . THR A 1 152 ? 22.054  10.235  1.633   1.00 13.44 ? 172 THR A CG2 1 
ATOM   1069 N N   . ALA A 1 153 ? 19.246  12.428  0.213   1.00 14.27 ? 173 ALA A N   1 
ATOM   1070 C CA  . ALA A 1 153 ? 18.295  12.059  -0.833  1.00 14.27 ? 173 ALA A CA  1 
ATOM   1071 C C   . ALA A 1 153 ? 18.466  12.983  -2.046  1.00 14.27 ? 173 ALA A C   1 
ATOM   1072 O O   . ALA A 1 153 ? 18.173  12.553  -3.177  1.00 14.27 ? 173 ALA A O   1 
ATOM   1073 C CB  . ALA A 1 153 ? 16.880  12.113  -0.339  1.00 14.30 ? 173 ALA A CB  1 
ATOM   1074 N N   . ARG A 1 154 ? 18.914  14.207  -1.853  1.00 16.09 ? 174 ARG A N   1 
ATOM   1075 C CA  . ARG A 1 154 ? 19.165  15.167  -2.967  1.00 16.09 ? 174 ARG A CA  1 
ATOM   1076 C C   . ARG A 1 154 ? 20.431  14.765  -3.708  1.00 16.09 ? 174 ARG A C   1 
ATOM   1077 O O   . ARG A 1 154 ? 20.530  14.798  -4.928  1.00 16.09 ? 174 ARG A O   1 
ATOM   1078 C CB  . ARG A 1 154 ? 19.307  16.544  -2.372  1.00 14.80 ? 174 ARG A CB  1 
ATOM   1079 C CG  . ARG A 1 154 ? 17.926  17.080  -2.024  1.00 14.80 ? 174 ARG A CG  1 
ATOM   1080 C CD  . ARG A 1 154 ? 18.018  18.472  -1.418  1.00 14.80 ? 174 ARG A CD  1 
ATOM   1081 N NE  . ARG A 1 154 ? 16.604  18.928  -1.230  1.00 14.80 ? 174 ARG A NE  1 
ATOM   1082 C CZ  . ARG A 1 154 ? 16.284  19.810  -0.310  1.00 14.80 ? 174 ARG A CZ  1 
ATOM   1083 N NH1 . ARG A 1 154 ? 17.251  20.330  0.440   1.00 14.80 ? 174 ARG A NH1 1 
ATOM   1084 N NH2 . ARG A 1 154 ? 14.999  20.152  -0.138  1.00 14.80 ? 174 ARG A NH2 1 
ATOM   1085 N N   . MET A 1 155 ? 21.402  14.270  -2.930  1.00 18.56 ? 175 MET A N   1 
ATOM   1086 C CA  . MET A 1 155 ? 22.671  13.745  -3.436  1.00 18.56 ? 175 MET A CA  1 
ATOM   1087 C C   . MET A 1 155 ? 22.351  12.510  -4.244  1.00 18.56 ? 175 MET A C   1 
ATOM   1088 O O   . MET A 1 155 ? 22.749  12.386  -5.408  1.00 18.56 ? 175 MET A O   1 
ATOM   1089 C CB  . MET A 1 155 ? 23.634  13.374  -2.337  1.00 19.35 ? 175 MET A CB  1 
ATOM   1090 C CG  . MET A 1 155 ? 24.957  12.776  -2.785  1.00 19.35 ? 175 MET A CG  1 
ATOM   1091 S SD  . MET A 1 155 ? 24.881  10.959  -2.974  1.00 19.35 ? 175 MET A SD  1 
ATOM   1092 C CE  . MET A 1 155 ? 24.889  10.468  -1.238  1.00 19.35 ? 175 MET A CE  1 
ATOM   1093 N N   . GLN A 1 156 ? 21.561  11.599  -3.735  1.00 18.45 ? 176 GLN A N   1 
ATOM   1094 C CA  . GLN A 1 156 ? 21.231  10.407  -4.517  1.00 18.45 ? 176 GLN A CA  1 
ATOM   1095 C C   . GLN A 1 156 ? 20.474  10.769  -5.780  1.00 18.45 ? 176 GLN A C   1 
ATOM   1096 O O   . GLN A 1 156 ? 20.690  10.115  -6.805  1.00 18.45 ? 176 GLN A O   1 
ATOM   1097 C CB  . GLN A 1 156 ? 20.419  9.438   -3.690  1.00 18.61 ? 176 GLN A CB  1 
ATOM   1098 C CG  . GLN A 1 156 ? 21.094  9.075   -2.353  1.00 18.61 ? 176 GLN A CG  1 
ATOM   1099 C CD  . GLN A 1 156 ? 20.133  8.244   -1.519  1.00 18.61 ? 176 GLN A CD  1 
ATOM   1100 O OE1 . GLN A 1 156 ? 19.520  8.736   -0.585  1.00 18.61 ? 176 GLN A OE1 1 
ATOM   1101 N NE2 . GLN A 1 156 ? 19.952  6.999   -1.900  1.00 18.61 ? 176 GLN A NE2 1 
ATOM   1102 N N   . ARG A 1 157 ? 19.590  11.762  -5.750  1.00 19.91 ? 177 ARG A N   1 
ATOM   1103 C CA  . ARG A 1 157 ? 18.847  12.192  -6.919  1.00 19.91 ? 177 ARG A CA  1 
ATOM   1104 C C   . ARG A 1 157 ? 19.823  12.731  -7.967  1.00 19.91 ? 177 ARG A C   1 
ATOM   1105 O O   . ARG A 1 157 ? 19.743  12.297  -9.101  1.00 19.91 ? 177 ARG A O   1 
ATOM   1106 C CB  . ARG A 1 157 ? 17.846  13.311  -6.614  1.00 21.28 ? 177 ARG A CB  1 
ATOM   1107 C CG  . ARG A 1 157 ? 17.284  13.986  -7.848  1.00 21.28 ? 177 ARG A CG  1 
ATOM   1108 C CD  . ARG A 1 157 ? 16.350  15.127  -7.577  1.00 21.28 ? 177 ARG A CD  1 
ATOM   1109 N NE  . ARG A 1 157 ? 16.958  16.249  -6.895  1.00 21.28 ? 177 ARG A NE  1 
ATOM   1110 C CZ  . ARG A 1 157 ? 17.798  17.108  -7.444  1.00 21.28 ? 177 ARG A CZ  1 
ATOM   1111 N NH1 . ARG A 1 157 ? 18.163  16.932  -8.695  1.00 21.28 ? 177 ARG A NH1 1 
ATOM   1112 N NH2 . ARG A 1 157 ? 18.271  18.139  -6.735  1.00 21.28 ? 177 ARG A NH2 1 
ATOM   1113 N N   . ALA A 1 158 ? 20.713  13.624  -7.541  1.00 19.56 ? 178 ALA A N   1 
ATOM   1114 C CA  . ALA A 1 158 ? 21.711  14.215  -8.424  1.00 19.56 ? 178 ALA A CA  1 
ATOM   1115 C C   . ALA A 1 158 ? 22.598  13.140  -8.996  1.00 19.56 ? 178 ALA A C   1 
ATOM   1116 O O   . ALA A 1 158 ? 22.741  13.075  -10.226 1.00 19.56 ? 178 ALA A O   1 
ATOM   1117 C CB  . ALA A 1 158 ? 22.568  15.248  -7.707  1.00 19.24 ? 178 ALA A CB  1 
ATOM   1118 N N   . VAL A 1 159 ? 23.146  12.238  -8.169  1.00 21.48 ? 179 VAL A N   1 
ATOM   1119 C CA  . VAL A 1 159 ? 23.978  11.159  -8.752  1.00 21.48 ? 179 VAL A CA  1 
ATOM   1120 C C   . VAL A 1 159 ? 23.148  10.237  -9.615  1.00 21.48 ? 179 VAL A C   1 
ATOM   1121 O O   . VAL A 1 159 ? 23.660  9.647   -10.604 1.00 21.48 ? 179 VAL A O   1 
ATOM   1122 C CB  . VAL A 1 159 ? 24.726  10.371  -7.694  1.00 19.71 ? 179 VAL A CB  1 
ATOM   1123 C CG1 . VAL A 1 159 ? 25.537  9.221   -8.335  1.00 19.71 ? 179 VAL A CG1 1 
ATOM   1124 C CG2 . VAL A 1 159 ? 25.697  11.249  -6.946  1.00 19.71 ? 179 VAL A CG2 1 
ATOM   1125 N N   . GLY A 1 160 ? 21.875  10.067  -9.288  1.00 23.38 ? 180 GLY A N   1 
ATOM   1126 C CA  . GLY A 1 160 ? 20.999  9.203   -10.060 1.00 23.38 ? 180 GLY A CA  1 
ATOM   1127 C C   . GLY A 1 160 ? 20.787  9.747   -11.458 1.00 23.38 ? 180 GLY A C   1 
ATOM   1128 O O   . GLY A 1 160 ? 20.854  8.993   -12.431 1.00 23.38 ? 180 GLY A O   1 
ATOM   1129 N N   . GLU A 1 161 ? 20.535  11.042  -11.565 1.00 27.09 ? 181 GLU A N   1 
ATOM   1130 C CA  . GLU A 1 161 ? 20.310  11.685  -12.863 1.00 27.09 ? 181 GLU A CA  1 
ATOM   1131 C C   . GLU A 1 161 ? 21.555  11.546  -13.740 1.00 27.09 ? 181 GLU A C   1 
ATOM   1132 O O   . GLU A 1 161 ? 21.446  11.224  -14.927 1.00 27.09 ? 181 GLU A O   1 
ATOM   1133 C CB  . GLU A 1 161 ? 19.958  13.155  -12.689 1.00 31.21 ? 181 GLU A CB  1 
ATOM   1134 C CG  . GLU A 1 161 ? 18.531  13.494  -12.297 1.00 31.21 ? 181 GLU A CG  1 
ATOM   1135 C CD  . GLU A 1 161 ? 18.324  14.918  -11.842 1.00 31.21 ? 181 GLU A CD  1 
ATOM   1136 O OE1 . GLU A 1 161 ? 19.087  15.841  -12.272 1.00 31.21 ? 181 GLU A OE1 1 
ATOM   1137 O OE2 . GLU A 1 161 ? 17.383  15.198  -11.034 1.00 31.21 ? 181 GLU A OE2 1 
ATOM   1138 N N   . ALA A 1 162 ? 22.729  11.760  -13.162 1.00 27.40 ? 182 ALA A N   1 
ATOM   1139 C CA  . ALA A 1 162 ? 23.987  11.649  -13.872 1.00 27.40 ? 182 ALA A CA  1 
ATOM   1140 C C   . ALA A 1 162 ? 24.210  10.261  -14.440 1.00 27.40 ? 182 ALA A C   1 
ATOM   1141 O O   . ALA A 1 162 ? 24.650  10.156  -15.607 1.00 27.40 ? 182 ALA A O   1 
ATOM   1142 C CB  . ALA A 1 162 ? 25.180  11.950  -12.963 1.00 25.79 ? 182 ALA A CB  1 
ATOM   1143 N N   . PHE A 1 163 ? 23.967  9.180   -13.676 1.00 27.24 ? 183 PHE A N   1 
ATOM   1144 C CA  . PHE A 1 163 ? 24.175  7.839   -14.202 1.00 27.24 ? 183 PHE A CA  1 
ATOM   1145 C C   . PHE A 1 163 ? 22.906  7.179   -14.696 1.00 27.24 ? 183 PHE A C   1 
ATOM   1146 O O   . PHE A 1 163 ? 22.902  5.986   -15.053 1.00 27.24 ? 183 PHE A O   1 
ATOM   1147 C CB  . PHE A 1 163 ? 24.735  6.947   -13.103 1.00 25.56 ? 183 PHE A CB  1 
ATOM   1148 C CG  . PHE A 1 163 ? 26.142  7.335   -12.727 1.00 25.56 ? 183 PHE A CG  1 
ATOM   1149 C CD1 . PHE A 1 163 ? 26.359  8.273   -11.737 1.00 25.56 ? 183 PHE A CD1 1 
ATOM   1150 C CD2 . PHE A 1 163 ? 27.206  6.758   -13.386 1.00 25.56 ? 183 PHE A CD2 1 
ATOM   1151 C CE1 . PHE A 1 163 ? 27.651  8.646   -11.394 1.00 25.56 ? 183 PHE A CE1 1 
ATOM   1152 C CE2 . PHE A 1 163 ? 28.499  7.124   -13.040 1.00 25.56 ? 183 PHE A CE2 1 
ATOM   1153 C CZ  . PHE A 1 163 ? 28.724  8.056   -12.053 1.00 25.56 ? 183 PHE A CZ  1 
ATOM   1154 N N   . ASP A 1 164 ? 21.827  7.927   -14.709 1.00 29.97 ? 184 ASP A N   1 
ATOM   1155 C CA  . ASP A 1 164 ? 20.538  7.399   -15.174 1.00 29.97 ? 184 ASP A CA  1 
ATOM   1156 C C   . ASP A 1 164 ? 20.176  6.140   -14.374 1.00 29.97 ? 184 ASP A C   1 
ATOM   1157 O O   . ASP A 1 164 ? 19.783  5.110   -14.941 1.00 29.97 ? 184 ASP A O   1 
ATOM   1158 C CB  . ASP A 1 164 ? 20.585  7.086   -16.665 1.00 36.27 ? 184 ASP A CB  1 
ATOM   1159 C CG  . ASP A 1 164 ? 19.190  7.024   -17.264 1.00 36.27 ? 184 ASP A CG  1 
ATOM   1160 O OD1 . ASP A 1 164 ? 18.199  7.436   -16.582 1.00 36.27 ? 184 ASP A OD1 1 
ATOM   1161 O OD2 . ASP A 1 164 ? 19.041  6.540   -18.423 1.00 36.27 ? 184 ASP A OD2 1 
ATOM   1162 N N   . LEU A 1 165 ? 20.316  6.233   -13.047 1.00 27.10 ? 185 LEU A N   1 
ATOM   1163 C CA  . LEU A 1 165 ? 20.054  5.185   -12.099 1.00 27.10 ? 185 LEU A CA  1 
ATOM   1164 C C   . LEU A 1 165 ? 18.919  5.525   -11.120 1.00 27.10 ? 185 LEU A C   1 
ATOM   1165 O O   . LEU A 1 165 ? 18.570  6.664   -10.899 1.00 27.10 ? 185 LEU A O   1 
ATOM   1166 C CB  . LEU A 1 165 ? 21.243  5.049   -11.154 1.00 27.62 ? 185 LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 165 ? 22.419  4.202   -11.455 1.00 27.62 ? 185 LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 165 ? 23.329  4.171   -10.220 1.00 27.62 ? 185 LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 165 ? 22.007  2.765   -11.823 1.00 27.62 ? 185 LEU A CD2 1 
ATOM   1170 N N   . ASP A 1 166 ? 18.402  4.459   -10.519 1.00 21.87 ? 186 ASP A N   1 
ATOM   1171 C CA  . ASP A 1 166 ? 17.356  4.596   -9.476  1.00 21.87 ? 186 ASP A CA  1 
ATOM   1172 C C   . ASP A 1 166 ? 18.096  5.243   -8.333  1.00 21.87 ? 186 ASP A C   1 
ATOM   1173 O O   . ASP A 1 166 ? 19.166  4.749   -7.952  1.00 21.87 ? 186 ASP A O   1 
ATOM   1174 C CB  . ASP A 1 166 ? 16.871  3.223   -9.089  1.00 20.79 ? 186 ASP A CB  1 
ATOM   1175 C CG  . ASP A 1 166 ? 15.818  3.120   -8.029  1.00 20.79 ? 186 ASP A CG  1 
ATOM   1176 O OD1 . ASP A 1 166 ? 15.635  4.085   -7.231  1.00 20.79 ? 186 ASP A OD1 1 
ATOM   1177 O OD2 . ASP A 1 166 ? 15.125  2.097   -7.961  1.00 20.79 ? 186 ASP A OD2 1 
ATOM   1178 N N   . PRO A 1 167 ? 17.609  6.328   -7.751  1.00 19.36 ? 187 PRO A N   1 
ATOM   1179 C CA  . PRO A 1 167 ? 18.307  6.996   -6.655  1.00 19.36 ? 187 PRO A CA  1 
ATOM   1180 C C   . PRO A 1 167 ? 18.505  6.070   -5.460  1.00 19.36 ? 187 PRO A C   1 
ATOM   1181 O O   . PRO A 1 167 ? 19.478  6.194   -4.721  1.00 19.36 ? 187 PRO A O   1 
ATOM   1182 C CB  . PRO A 1 167 ? 17.463  8.219   -6.293  1.00 18.44 ? 187 PRO A CB  1 
ATOM   1183 C CG  . PRO A 1 167 ? 16.220  8.083   -7.088  1.00 18.44 ? 187 PRO A CG  1 
ATOM   1184 C CD  . PRO A 1 167 ? 16.388  7.003   -8.143  1.00 18.44 ? 187 PRO A CD  1 
ATOM   1185 N N   . ARG A 1 168 ? 17.638  5.102   -5.245  1.00 20.06 ? 188 ARG A N   1 
ATOM   1186 C CA  . ARG A 1 168 ? 17.681  4.121   -4.209  1.00 20.06 ? 188 ARG A CA  1 
ATOM   1187 C C   . ARG A 1 168 ? 18.863  3.192   -4.406  1.00 20.06 ? 188 ARG A C   1 
ATOM   1188 O O   . ARG A 1 168 ? 19.320  2.580   -3.437  1.00 20.06 ? 188 ARG A O   1 
ATOM   1189 C CB  . ARG A 1 168 ? 16.401  3.267   -4.188  1.00 21.35 ? 188 ARG A CB  1 
ATOM   1190 C CG  . ARG A 1 168 ? 15.174  4.006   -3.729  1.00 21.35 ? 188 ARG A CG  1 
ATOM   1191 C CD  . ARG A 1 168 ? 13.850  3.286   -3.932  1.00 21.35 ? 188 ARG A CD  1 
ATOM   1192 N NE  . ARG A 1 168 ? 13.663  2.788   -5.278  1.00 21.35 ? 188 ARG A NE  1 
ATOM   1193 C CZ  . ARG A 1 168 ? 12.777  1.874   -5.656  1.00 21.35 ? 188 ARG A CZ  1 
ATOM   1194 N NH1 . ARG A 1 168 ? 11.926  1.376   -4.730  1.00 21.35 ? 188 ARG A NH1 1 
ATOM   1195 N NH2 . ARG A 1 168 ? 12.709  1.391   -6.911  1.00 21.35 ? 188 ARG A NH2 1 
ATOM   1196 N N   . SER A 1 169 ? 19.416  3.134   -5.638  1.00 19.58 ? 189 SER A N   1 
ATOM   1197 C CA  . SER A 1 169 ? 20.589  2.340   -5.937  1.00 19.58 ? 189 SER A CA  1 
ATOM   1198 C C   . SER A 1 169 ? 21.908  3.070   -5.687  1.00 19.58 ? 189 SER A C   1 
ATOM   1199 O O   . SER A 1 169 ? 23.000  2.513   -5.914  1.00 19.58 ? 189 SER A O   1 
ATOM   1200 C CB  . SER A 1 169 ? 20.597  1.868   -7.387  1.00 17.83 ? 189 SER A CB  1 
ATOM   1201 O OG  . SER A 1 169 ? 19.451  1.076   -7.647  1.00 17.83 ? 189 SER A OG  1 
ATOM   1202 N N   . VAL A 1 170 ? 21.856  4.291   -5.208  1.00 20.31 ? 190 VAL A N   1 
ATOM   1203 C CA  . VAL A 1 170 ? 23.065  5.037   -4.919  1.00 20.31 ? 190 VAL A CA  1 
ATOM   1204 C C   . VAL A 1 170 ? 23.318  4.971   -3.432  1.00 20.31 ? 190 VAL A C   1 
ATOM   1205 O O   . VAL A 1 170 ? 22.410  5.333   -2.658  1.00 20.31 ? 190 VAL A O   1 
ATOM   1206 C CB  . VAL A 1 170 ? 22.901  6.514   -5.303  1.00 19.39 ? 190 VAL A CB  1 
ATOM   1207 C CG1 . VAL A 1 170 ? 24.061  7.355   -4.773  1.00 19.39 ? 190 VAL A CG1 1 
ATOM   1208 C CG2 . VAL A 1 170 ? 22.781  6.600   -6.809  1.00 19.39 ? 190 VAL A CG2 1 
ATOM   1209 N N   . SER A 1 171 ? 24.536  4.606   -3.032  1.00 22.76 ? 191 SER A N   1 
ATOM   1210 C CA  . SER A 1 171 ? 24.755  4.538   -1.572  1.00 22.76 ? 191 SER A CA  1 
ATOM   1211 C C   . SER A 1 171 ? 25.686  5.630   -1.133  1.00 22.76 ? 191 SER A C   1 
ATOM   1212 O O   . SER A 1 171 ? 26.326  6.247   -2.013  1.00 22.76 ? 191 SER A O   1 
ATOM   1213 C CB  . SER A 1 171 ? 25.268  3.173   -1.171  1.00 25.60 ? 191 SER A CB  1 
ATOM   1214 O OG  . SER A 1 171 ? 26.481  2.844   -1.827  1.00 25.60 ? 191 SER A OG  1 
ATOM   1215 N N   . GLY A 1 172 ? 25.713  5.938   0.161   1.00 21.81 ? 192 GLY A N   1 
ATOM   1216 C CA  . GLY A 1 172 ? 26.592  7.031   0.600   1.00 21.81 ? 192 GLY A CA  1 
ATOM   1217 C C   . GLY A 1 172 ? 25.791  8.005   1.423   1.00 21.81 ? 192 GLY A C   1 
ATOM   1218 O O   . GLY A 1 172 ? 24.557  7.944   1.483   1.00 21.81 ? 192 GLY A O   1 
ATOM   1219 N N   . TYR A 1 173 ? 26.482  8.903   2.127   1.00 22.93 ? 193 TYR A N   1 
ATOM   1220 C CA  . TYR A 1 173 ? 25.803  9.856   2.941   1.00 22.93 ? 193 TYR A CA  1 
ATOM   1221 C C   . TYR A 1 173 ? 26.395  11.273  2.871   1.00 22.93 ? 193 TYR A C   1 
ATOM   1222 O O   . TYR A 1 173 ? 27.545  11.439  2.496   1.00 22.93 ? 193 TYR A O   1 
ATOM   1223 C CB  . TYR A 1 173 ? 25.903  9.537   4.476   1.00 28.50 ? 193 TYR A CB  1 
ATOM   1224 C CG  . TYR A 1 173 ? 25.731  8.082   4.805   1.00 28.50 ? 193 TYR A CG  1 
ATOM   1225 C CD1 . TYR A 1 173 ? 24.493  7.483   4.911   1.00 28.50 ? 193 TYR A CD1 1 
ATOM   1226 C CD2 . TYR A 1 173 ? 26.855  7.302   4.908   1.00 28.50 ? 193 TYR A CD2 1 
ATOM   1227 C CE1 . TYR A 1 173 ? 24.384  6.115   5.174   1.00 28.50 ? 193 TYR A CE1 1 
ATOM   1228 C CE2 . TYR A 1 173 ? 26.772  5.923   5.168   1.00 28.50 ? 193 TYR A CE2 1 
ATOM   1229 C CZ  . TYR A 1 173 ? 25.515  5.365   5.292   1.00 28.50 ? 193 TYR A CZ  1 
ATOM   1230 O OH  . TYR A 1 173 ? 25.474  3.996   5.564   1.00 28.50 ? 193 TYR A OH  1 
ATOM   1231 N N   . ASN A 1 174 ? 25.539  12.185  3.266   1.00 23.92 ? 194 ASN A N   1 
ATOM   1232 C CA  . ASN A 1 174 ? 25.774  13.593  3.454   1.00 23.92 ? 194 ASN A CA  1 
ATOM   1233 C C   . ASN A 1 174 ? 25.830  13.761  4.978   1.00 23.92 ? 194 ASN A C   1 
ATOM   1234 O O   . ASN A 1 174 ? 24.895  13.309  5.651   1.00 23.92 ? 194 ASN A O   1 
ATOM   1235 C CB  . ASN A 1 174 ? 24.654  14.478  2.940   1.00 24.41 ? 194 ASN A CB  1 
ATOM   1236 C CG  . ASN A 1 174 ? 24.843  14.909  1.497   1.00 24.41 ? 194 ASN A CG  1 
ATOM   1237 O OD1 . ASN A 1 174 ? 24.996  13.960  0.591   1.00 24.41 ? 194 ASN A OD1 1 
ATOM   1238 N ND2 . ASN A 1 174 ? 24.850  16.140  1.233   1.00 24.41 ? 194 ASN A ND2 1 
ATOM   1239 N N   . LEU A 1 175 ? 26.869  14.314  5.526   1.00 25.19 ? 195 LEU A N   1 
ATOM   1240 C CA  . LEU A 1 175 ? 26.923  14.406  6.999   1.00 25.19 ? 195 LEU A CA  1 
ATOM   1241 C C   . LEU A 1 175 ? 27.011  15.804  7.501   1.00 25.19 ? 195 LEU A C   1 
ATOM   1242 O O   . LEU A 1 175 ? 27.127  16.716  6.669   1.00 25.19 ? 195 LEU A O   1 
ATOM   1243 C CB  . LEU A 1 175 ? 28.164  13.637  7.487   1.00 24.57 ? 195 LEU A CB  1 
ATOM   1244 C CG  . LEU A 1 175 ? 28.361  12.232  6.881   1.00 24.57 ? 195 LEU A CG  1 
ATOM   1245 C CD1 . LEU A 1 175 ? 29.821  11.826  6.991   1.00 24.57 ? 195 LEU A CD1 1 
ATOM   1246 C CD2 . LEU A 1 175 ? 27.456  11.204  7.541   1.00 24.57 ? 195 LEU A CD2 1 
ATOM   1247 N N   . GLY A 1 176 ? 26.958  16.002  8.809   1.00 26.90 ? 196 GLY A N   1 
ATOM   1248 C CA  . GLY A 1 176 ? 27.067  17.319  9.351   1.00 26.90 ? 196 GLY A CA  1 
ATOM   1249 C C   . GLY A 1 176 ? 25.797  18.087  9.622   1.00 26.90 ? 196 GLY A C   1 
ATOM   1250 O O   . GLY A 1 176 ? 24.773  17.472  9.905   1.00 26.90 ? 196 GLY A O   1 
ATOM   1251 N N   . GLU A 1 177 ? 25.872  19.408  9.551   1.00 28.27 ? 197 GLU A N   1 
ATOM   1252 C CA  . GLU A 1 177 ? 24.803  20.342  9.864   1.00 28.27 ? 197 GLU A CA  1 
ATOM   1253 C C   . GLU A 1 177 ? 23.911  20.660  8.677   1.00 28.27 ? 197 GLU A C   1 
ATOM   1254 O O   . GLU A 1 177 ? 24.368  21.222  7.682   1.00 28.27 ? 197 GLU A O   1 
ATOM   1255 C CB  . GLU A 1 177 ? 25.490  21.612  10.375  1.00 31.33 ? 197 GLU A CB  1 
ATOM   1256 C CG  . GLU A 1 177 ? 24.648  22.789  10.708  1.00 31.33 ? 197 GLU A CG  1 
ATOM   1257 C CD  . GLU A 1 177 ? 25.434  24.096  10.777  1.00 31.33 ? 197 GLU A CD  1 
ATOM   1258 O OE1 . GLU A 1 177 ? 26.391  24.314  9.961   1.00 31.33 ? 197 GLU A OE1 1 
ATOM   1259 O OE2 . GLU A 1 177 ? 25.118  24.961  11.647  1.00 31.33 ? 197 GLU A OE2 1 
ATOM   1260 N N   . HIS A 1 178 ? 22.643  20.265  8.763   1.00 29.55 ? 198 HIS A N   1 
ATOM   1261 C CA  . HIS A 1 178 ? 21.693  20.483  7.712   1.00 29.55 ? 198 HIS A CA  1 
ATOM   1262 C C   . HIS A 1 178 ? 21.500  21.992  7.535   1.00 29.55 ? 198 HIS A C   1 
ATOM   1263 O O   . HIS A 1 178 ? 21.294  22.710  8.509   1.00 29.55 ? 198 HIS A O   1 
ATOM   1264 C CB  . HIS A 1 178 ? 20.324  19.864  7.962   1.00 27.89 ? 198 HIS A CB  1 
ATOM   1265 C CG  . HIS A 1 178 ? 19.257  20.308  7.005   1.00 27.89 ? 198 HIS A CG  1 
ATOM   1266 N ND1 . HIS A 1 178 ? 19.036  19.730  5.775   1.00 27.89 ? 198 HIS A ND1 1 
ATOM   1267 C CD2 . HIS A 1 178 ? 18.365  21.320  7.118   1.00 27.89 ? 198 HIS A CD2 1 
ATOM   1268 C CE1 . HIS A 1 178 ? 18.033  20.360  5.158   1.00 27.89 ? 198 HIS A CE1 1 
ATOM   1269 N NE2 . HIS A 1 178 ? 17.635  21.332  5.938   1.00 27.89 ? 198 HIS A NE2 1 
ATOM   1270 N N   . GLY A 1 179 ? 21.522  22.387  6.273   1.00 34.10 ? 199 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 179 ? 21.299  23.733  5.820   1.00 34.10 ? 199 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 179 ? 22.426  24.722  6.065   1.00 34.10 ? 199 GLY A C   1 
ATOM   1273 O O   . GLY A 1 179 ? 22.210  25.930  6.212   1.00 34.10 ? 199 GLY A O   1 
ATOM   1274 N N   . ASN A 1 180 ? 23.639  24.223  6.126   1.00 35.92 ? 200 ASN A N   1 
ATOM   1275 C CA  . ASN A 1 180 ? 24.792  25.093  6.359   1.00 35.92 ? 200 ASN A CA  1 
ATOM   1276 C C   . ASN A 1 180 ? 26.040  24.274  6.075   1.00 35.92 ? 200 ASN A C   1 
ATOM   1277 O O   . ASN A 1 180 ? 26.252  23.995  4.882   1.00 35.92 ? 200 ASN A O   1 
ATOM   1278 C CB  . ASN A 1 180 ? 24.814  25.687  7.759   1.00 38.92 ? 200 ASN A CB  1 
ATOM   1279 C CG  . ASN A 1 180 ? 25.939  26.708  7.919   1.00 38.92 ? 200 ASN A CG  1 
ATOM   1280 O OD1 . ASN A 1 180 ? 26.412  27.254  6.895   1.00 38.92 ? 200 ASN A OD1 1 
ATOM   1281 N ND2 . ASN A 1 180 ? 26.353  26.960  9.165   1.00 38.92 ? 200 ASN A ND2 1 
ATOM   1282 N N   . SER A 1 181 ? 26.786  23.810  7.070   1.00 33.57 ? 201 SER A N   1 
ATOM   1283 C CA  . SER A 1 181 ? 27.994  23.031  6.762   1.00 33.57 ? 201 SER A CA  1 
ATOM   1284 C C   . SER A 1 181 ? 27.795  21.577  6.434   1.00 33.57 ? 201 SER A C   1 
ATOM   1285 O O   . SER A 1 181 ? 28.833  20.873  6.381   1.00 33.57 ? 201 SER A O   1 
ATOM   1286 C CB  . SER A 1 181 ? 28.952  23.164  7.973   1.00 32.34 ? 201 SER A CB  1 
ATOM   1287 O OG  . SER A 1 181 ? 28.305  22.902  9.185   1.00 32.34 ? 201 SER A OG  1 
ATOM   1288 N N   . GLN A 1 182 ? 26.632  21.020  6.129   1.00 30.71 ? 202 GLN A N   1 
ATOM   1289 C CA  . GLN A 1 182 ? 26.545  19.594  5.750   1.00 30.71 ? 202 GLN A CA  1 
ATOM   1290 C C   . GLN A 1 182 ? 27.367  19.331  4.496   1.00 30.71 ? 202 GLN A C   1 
ATOM   1291 O O   . GLN A 1 182 ? 27.501  20.240  3.674   1.00 30.71 ? 202 GLN A O   1 
ATOM   1292 C CB  . GLN A 1 182 ? 25.098  19.213  5.518   1.00 32.85 ? 202 GLN A CB  1 
ATOM   1293 C CG  . GLN A 1 182 ? 24.393  19.808  4.335   1.00 32.85 ? 202 GLN A CG  1 
ATOM   1294 C CD  . GLN A 1 182 ? 24.562  18.962  3.092   1.00 32.85 ? 202 GLN A CD  1 
ATOM   1295 O OE1 . GLN A 1 182 ? 24.714  17.639  3.191   1.00 32.85 ? 202 GLN A OE1 1 
ATOM   1296 N NE2 . GLN A 1 182 ? 24.574  19.477  1.976   1.00 32.85 ? 202 GLN A NE2 1 
ATOM   1297 N N   . PHE A 1 183 ? 27.927  18.142  4.271   1.00 26.66 ? 203 PHE A N   1 
ATOM   1298 C CA  . PHE A 1 183 ? 28.741  17.859  3.107   1.00 26.66 ? 203 PHE A CA  1 
ATOM   1299 C C   . PHE A 1 183 ? 28.520  16.477  2.580   1.00 26.66 ? 203 PHE A C   1 
ATOM   1300 O O   . PHE A 1 183 ? 28.001  15.677  3.333   1.00 26.66 ? 203 PHE A O   1 
ATOM   1301 C CB  . PHE A 1 183 ? 30.246  17.952  3.430   1.00 22.89 ? 203 PHE A CB  1 
ATOM   1302 C CG  . PHE A 1 183 ? 30.677  17.144  4.612   1.00 22.89 ? 203 PHE A CG  1 
ATOM   1303 C CD1 . PHE A 1 183 ? 30.447  17.587  5.899   1.00 22.89 ? 203 PHE A CD1 1 
ATOM   1304 C CD2 . PHE A 1 183 ? 31.341  15.949  4.422   1.00 22.89 ? 203 PHE A CD2 1 
ATOM   1305 C CE1 . PHE A 1 183 ? 30.844  16.815  6.992   1.00 22.89 ? 203 PHE A CE1 1 
ATOM   1306 C CE2 . PHE A 1 183 ? 31.743  15.173  5.512   1.00 22.89 ? 203 PHE A CE2 1 
ATOM   1307 C CZ  . PHE A 1 183 ? 31.493  15.616  6.792   1.00 22.89 ? 203 PHE A CZ  1 
ATOM   1308 N N   . VAL A 1 184 ? 28.890  16.175  1.367   1.00 26.49 ? 204 VAL A N   1 
ATOM   1309 C CA  . VAL A 1 184 ? 28.738  14.827  0.832   1.00 26.49 ? 204 VAL A CA  1 
ATOM   1310 C C   . VAL A 1 184 ? 29.998  14.054  1.182   1.00 26.49 ? 204 VAL A C   1 
ATOM   1311 O O   . VAL A 1 184 ? 31.063  14.621  0.875   1.00 26.49 ? 204 VAL A O   1 
ATOM   1312 C CB  . VAL A 1 184 ? 28.633  14.813  -0.692  1.00 25.82 ? 204 VAL A CB  1 
ATOM   1313 C CG1 . VAL A 1 184 ? 28.576  13.373  -1.200  1.00 25.82 ? 204 VAL A CG1 1 
ATOM   1314 C CG2 . VAL A 1 184 ? 27.392  15.542  -1.168  1.00 25.82 ? 204 VAL A CG2 1 
ATOM   1315 N N   . ALA A 1 185 ? 29.912  12.912  1.818   1.00 26.26 ? 205 ALA A N   1 
ATOM   1316 C CA  . ALA A 1 185 ? 31.102  12.098  2.141   1.00 26.26 ? 205 ALA A CA  1 
ATOM   1317 C C   . ALA A 1 185 ? 31.327  11.220  0.924   1.00 26.26 ? 205 ALA A C   1 
ATOM   1318 O O   . ALA A 1 185 ? 30.943  10.056  0.898   1.00 26.26 ? 205 ALA A O   1 
ATOM   1319 C CB  . ALA A 1 185 ? 30.922  11.272  3.397   1.00 25.04 ? 205 ALA A CB  1 
ATOM   1320 N N   . TRP A 1 186 ? 32.007  11.766  -0.087  1.00 26.50 ? 206 TRP A N   1 
ATOM   1321 C CA  . TRP A 1 186 ? 32.220  11.057  -1.345  1.00 26.50 ? 206 TRP A CA  1 
ATOM   1322 C C   . TRP A 1 186 ? 32.935  9.750   -1.172  1.00 26.50 ? 206 TRP A C   1 
ATOM   1323 O O   . TRP A 1 186 ? 32.831  8.873   -2.045  1.00 26.50 ? 206 TRP A O   1 
ATOM   1324 C CB  . TRP A 1 186 ? 32.993  11.961  -2.327  1.00 25.13 ? 206 TRP A CB  1 
ATOM   1325 C CG  . TRP A 1 186 ? 32.173  13.134  -2.812  1.00 25.13 ? 206 TRP A CG  1 
ATOM   1326 C CD1 . TRP A 1 186 ? 32.421  14.430  -2.518  1.00 25.13 ? 206 TRP A CD1 1 
ATOM   1327 C CD2 . TRP A 1 186 ? 30.994  13.117  -3.617  1.00 25.13 ? 206 TRP A CD2 1 
ATOM   1328 N NE1 . TRP A 1 186 ? 31.464  15.237  -3.111  1.00 25.13 ? 206 TRP A NE1 1 
ATOM   1329 C CE2 . TRP A 1 186 ? 30.575  14.450  -3.796  1.00 25.13 ? 206 TRP A CE2 1 
ATOM   1330 C CE3 . TRP A 1 186 ? 30.241  12.085  -4.197  1.00 25.13 ? 206 TRP A CE3 1 
ATOM   1331 C CZ2 . TRP A 1 186 ? 29.444  14.811  -4.529  1.00 25.13 ? 206 TRP A CZ2 1 
ATOM   1332 C CZ3 . TRP A 1 186 ? 29.117  12.436  -4.935  1.00 25.13 ? 206 TRP A CZ3 1 
ATOM   1333 C CH2 . TRP A 1 186 ? 28.721  13.802  -5.089  1.00 25.13 ? 206 TRP A CH2 1 
ATOM   1334 N N   . SER A 1 187 ? 33.659  9.535   -0.075  1.00 27.44 ? 207 SER A N   1 
ATOM   1335 C CA  . SER A 1 187 ? 34.308  8.251   0.137   1.00 27.44 ? 207 SER A CA  1 
ATOM   1336 C C   . SER A 1 187 ? 33.266  7.165   0.343   1.00 27.44 ? 207 SER A C   1 
ATOM   1337 O O   . SER A 1 187 ? 33.528  6.002   -0.020  1.00 27.44 ? 207 SER A O   1 
ATOM   1338 C CB  . SER A 1 187 ? 35.223  8.304   1.359   1.00 27.37 ? 207 SER A CB  1 
ATOM   1339 O OG  . SER A 1 187 ? 34.614  8.603   2.564   1.00 27.37 ? 207 SER A OG  1 
ATOM   1340 N N   . THR A 1 188 ? 32.078  7.462   0.866   1.00 26.77 ? 208 THR A N   1 
ATOM   1341 C CA  . THR A 1 188 ? 31.025  6.501   1.107   1.00 26.77 ? 208 THR A CA  1 
ATOM   1342 C C   . THR A 1 188 ? 30.117  6.282   -0.070  1.00 26.77 ? 208 THR A C   1 
ATOM   1343 O O   . THR A 1 188 ? 29.329  5.336   -0.082  1.00 26.77 ? 208 THR A O   1 
ATOM   1344 C CB  . THR A 1 188 ? 30.141  6.980   2.298   1.00 24.80 ? 208 THR A CB  1 
ATOM   1345 O OG1 . THR A 1 188 ? 29.396  8.137   1.942   1.00 24.80 ? 208 THR A OG1 1 
ATOM   1346 C CG2 . THR A 1 188 ? 30.996  7.360   3.504   1.00 24.80 ? 208 THR A CG2 1 
ATOM   1347 N N   . VAL A 1 189 ? 30.170  7.131   -1.094  1.00 27.75 ? 209 VAL A N   1 
ATOM   1348 C CA  . VAL A 1 189 ? 29.220  6.985   -2.217  1.00 27.75 ? 209 VAL A CA  1 
ATOM   1349 C C   . VAL A 1 189 ? 29.621  5.924   -3.183  1.00 27.75 ? 209 VAL A C   1 
ATOM   1350 O O   . VAL A 1 189 ? 30.788  5.849   -3.571  1.00 27.75 ? 209 VAL A O   1 
ATOM   1351 C CB  . VAL A 1 189 ? 29.075  8.348   -2.951  1.00 24.63 ? 209 VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 189 ? 28.066  8.255   -4.071  1.00 24.63 ? 209 VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 189 ? 28.617  9.420   -1.971  1.00 24.63 ? 209 VAL A CG2 1 
ATOM   1354 N N   . ARG A 1 190 ? 28.731  5.034   -3.603  1.00 32.24 ? 210 ARG A N   1 
ATOM   1355 C CA  . ARG A 1 190 ? 29.093  4.006   -4.575  1.00 32.24 ? 210 ARG A CA  1 
ATOM   1356 C C   . ARG A 1 190 ? 27.966  3.832   -5.576  1.00 32.24 ? 210 ARG A C   1 
ATOM   1357 O O   . ARG A 1 190 ? 26.792  3.870   -5.187  1.00 32.24 ? 210 ARG A O   1 
ATOM   1358 C CB  . ARG A 1 190 ? 29.341  2.637   -3.928  1.00 42.62 ? 210 ARG A CB  1 
ATOM   1359 C CG  . ARG A 1 190 ? 30.114  2.620   -2.676  1.00 42.62 ? 210 ARG A CG  1 
ATOM   1360 C CD  . ARG A 1 190 ? 30.722  1.413   -2.086  1.00 42.62 ? 210 ARG A CD  1 
ATOM   1361 N NE  . ARG A 1 190 ? 31.768  0.831   -2.947  1.00 42.62 ? 210 ARG A NE  1 
ATOM   1362 C CZ  . ARG A 1 190 ? 31.476  -0.113  -3.854  1.00 42.62 ? 210 ARG A CZ  1 
ATOM   1363 N NH1 . ARG A 1 190 ? 30.232  -0.589  -3.984  1.00 42.62 ? 210 ARG A NH1 1 
ATOM   1364 N NH2 . ARG A 1 190 ? 32.457  -0.611  -4.621  1.00 42.62 ? 210 ARG A NH2 1 
ATOM   1365 N N   . VAL A 1 191 ? 28.294  3.701   -6.858  1.00 33.29 ? 211 VAL A N   1 
ATOM   1366 C CA  . VAL A 1 191 ? 27.305  3.535   -7.903  1.00 33.29 ? 211 VAL A CA  1 
ATOM   1367 C C   . VAL A 1 191 ? 27.757  2.441   -8.861  1.00 33.29 ? 211 VAL A C   1 
ATOM   1368 O O   . VAL A 1 191 ? 28.885  2.426   -9.346  1.00 33.29 ? 211 VAL A O   1 
ATOM   1369 C CB  . VAL A 1 191 ? 27.068  4.772   -8.773  1.00 33.57 ? 211 VAL A CB  1 
ATOM   1370 C CG1 . VAL A 1 191 ? 26.293  5.834   -8.026  1.00 33.57 ? 211 VAL A CG1 1 
ATOM   1371 C CG2 . VAL A 1 191 ? 28.380  5.375   -9.248  1.00 33.57 ? 211 VAL A CG2 1 
ATOM   1372 N N   . MET A 1 192 ? 26.832  1.534   -9.091  1.00 36.21 ? 212 MET A N   1 
ATOM   1373 C CA  . MET A 1 192 ? 27.056  0.406   -9.972  1.00 36.21 ? 212 MET A CA  1 
ATOM   1374 C C   . MET A 1 192 ? 28.298  -0.414  -9.691  1.00 36.21 ? 212 MET A C   1 
ATOM   1375 O O   . MET A 1 192 ? 29.058  -0.766  -10.619 1.00 36.21 ? 212 MET A O   1 
ATOM   1376 C CB  . MET A 1 192 ? 27.203  0.907   -11.403 1.00 37.89 ? 212 MET A CB  1 
ATOM   1377 C CG  . MET A 1 192 ? 25.874  1.031   -12.140 1.00 37.89 ? 212 MET A CG  1 
ATOM   1378 S SD  . MET A 1 192 ? 26.195  2.144   -13.505 1.00 37.89 ? 212 MET A SD  1 
ATOM   1379 C CE  . MET A 1 192 ? 24.579  2.197   -14.281 1.00 37.89 ? 212 MET A CE  1 
ATOM   1380 N N   . GLY A 1 193 ? 28.521  -0.745  -8.419  1.00 38.48 ? 213 GLY A N   1 
ATOM   1381 C CA  . GLY A 1 193 ? 29.606  -1.514  -7.938  1.00 38.48 ? 213 GLY A CA  1 
ATOM   1382 C C   . GLY A 1 193 ? 30.892  -0.812  -7.654  1.00 38.48 ? 213 GLY A C   1 
ATOM   1383 O O   . GLY A 1 193 ? 31.756  -1.387  -6.975  1.00 38.48 ? 213 GLY A O   1 
ATOM   1384 N N   . GLN A 1 194 ? 31.081  0.404   -8.109  1.00 39.82 ? 214 GLN A N   1 
ATOM   1385 C CA  . GLN A 1 194 ? 32.298  1.164   -7.945  1.00 39.82 ? 214 GLN A CA  1 
ATOM   1386 C C   . GLN A 1 194 ? 32.103  2.386   -7.067  1.00 39.82 ? 214 GLN A C   1 
ATOM   1387 O O   . GLN A 1 194 ? 30.991  2.927   -7.014  1.00 39.82 ? 214 GLN A O   1 
ATOM   1388 C CB  . GLN A 1 194 ? 32.742  1.694   -9.316  1.00 44.37 ? 214 GLN A CB  1 
ATOM   1389 C CG  . GLN A 1 194 ? 32.998  0.618   -10.370 1.00 44.37 ? 214 GLN A CG  1 
ATOM   1390 C CD  . GLN A 1 194 ? 34.353  -0.044  -10.142 1.00 44.37 ? 214 GLN A CD  1 
ATOM   1391 O OE1 . GLN A 1 194 ? 35.384  0.659   -10.142 1.00 44.37 ? 214 GLN A OE1 1 
ATOM   1392 N NE2 . GLN A 1 194 ? 34.356  -1.348  -9.932  1.00 44.37 ? 214 GLN A NE2 1 
ATOM   1393 N N   . PRO A 1 195 ? 33.149  2.804   -6.388  1.00 38.58 ? 215 PRO A N   1 
ATOM   1394 C CA  . PRO A 1 195 ? 33.142  3.985   -5.544  1.00 38.58 ? 215 PRO A CA  1 
ATOM   1395 C C   . PRO A 1 195 ? 33.084  5.142   -6.519  1.00 38.58 ? 215 PRO A C   1 
ATOM   1396 O O   . PRO A 1 195 ? 33.850  5.101   -7.498  1.00 38.58 ? 215 PRO A O   1 
ATOM   1397 C CB  . PRO A 1 195 ? 34.410  3.972   -4.737  1.00 38.30 ? 215 PRO A CB  1 
ATOM   1398 C CG  . PRO A 1 195 ? 35.082  2.690   -5.111  1.00 38.30 ? 215 PRO A CG  1 
ATOM   1399 C CD  . PRO A 1 195 ? 34.478  2.217   -6.426  1.00 38.30 ? 215 PRO A CD  1 
ATOM   1400 N N   . ILE A 1 196 ? 32.248  6.125   -6.275  1.00 40.22 ? 216 ILE A N   1 
ATOM   1401 C CA  . ILE A 1 196 ? 32.136  7.227   -7.248  1.00 40.22 ? 216 ILE A CA  1 
ATOM   1402 C C   . ILE A 1 196 ? 33.450  7.945   -7.395  1.00 40.22 ? 216 ILE A C   1 
ATOM   1403 O O   . ILE A 1 196 ? 33.699  8.386   -8.543  1.00 40.22 ? 216 ILE A O   1 
ATOM   1404 C CB  . ILE A 1 196 ? 31.001  8.184   -6.858  1.00 37.75 ? 216 ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 196 ? 30.558  8.935   -8.112  1.00 37.75 ? 216 ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 196 ? 31.399  9.130   -5.750  1.00 37.75 ? 216 ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 196 ? 29.192  9.580   -8.010  1.00 37.75 ? 216 ILE A CD1 1 
ATOM   1408 N N   . VAL A 1 197 ? 34.329  8.057   -6.402  1.00 44.13 ? 217 VAL A N   1 
ATOM   1409 C CA  . VAL A 1 197 ? 35.580  8.766   -6.662  1.00 44.13 ? 217 VAL A CA  1 
ATOM   1410 C C   . VAL A 1 197 ? 36.450  8.046   -7.656  1.00 44.13 ? 217 VAL A C   1 
ATOM   1411 O O   . VAL A 1 197 ? 37.236  8.776   -8.315  1.00 44.13 ? 217 VAL A O   1 
ATOM   1412 C CB  . VAL A 1 197 ? 36.431  9.038   -5.411  1.00 44.05 ? 217 VAL A CB  1 
ATOM   1413 C CG1 . VAL A 1 197 ? 35.618  9.820   -4.387  1.00 44.05 ? 217 VAL A CG1 1 
ATOM   1414 C CG2 . VAL A 1 197 ? 36.928  7.726   -4.822  1.00 44.05 ? 217 VAL A CG2 1 
ATOM   1415 N N   . THR A 1 198 ? 36.330  6.736   -7.892  1.00 47.15 ? 218 THR A N   1 
ATOM   1416 C CA  . THR A 1 198 ? 37.179  6.170   -8.951  1.00 47.15 ? 218 THR A CA  1 
ATOM   1417 C C   . THR A 1 198 ? 36.433  6.240   -10.290 1.00 47.15 ? 218 THR A C   1 
ATOM   1418 O O   . THR A 1 198 ? 36.810  5.493   -11.205 1.00 47.15 ? 218 THR A O   1 
ATOM   1419 C CB  . THR A 1 198 ? 37.690  4.741   -8.706  1.00 47.57 ? 218 THR A CB  1 
ATOM   1420 O OG1 . THR A 1 198 ? 36.778  3.741   -9.186  1.00 47.57 ? 218 THR A OG1 1 
ATOM   1421 C CG2 . THR A 1 198 ? 37.910  4.475   -7.209  1.00 47.57 ? 218 THR A CG2 1 
ATOM   1422 N N   . LEU A 1 199 ? 35.447  7.091   -10.457 1.00 49.37 ? 219 LEU A N   1 
ATOM   1423 C CA  . LEU A 1 199 ? 34.730  7.264   -11.708 1.00 49.37 ? 219 LEU A CA  1 
ATOM   1424 C C   . LEU A 1 199 ? 34.855  8.699   -12.228 1.00 49.37 ? 219 LEU A C   1 
ATOM   1425 O O   . LEU A 1 199 ? 34.996  9.689   -11.505 1.00 49.37 ? 219 LEU A O   1 
ATOM   1426 C CB  . LEU A 1 199 ? 33.250  6.944   -11.589 1.00 49.48 ? 219 LEU A CB  1 
ATOM   1427 C CG  . LEU A 1 199 ? 32.808  5.506   -11.402 1.00 49.48 ? 219 LEU A CG  1 
ATOM   1428 C CD1 . LEU A 1 199 ? 31.328  5.328   -11.792 1.00 49.48 ? 219 LEU A CD1 1 
ATOM   1429 C CD2 . LEU A 1 199 ? 33.591  4.508   -12.232 1.00 49.48 ? 219 LEU A CD2 1 
ATOM   1430 N N   . ILE A 1 205 ? 32.950  12.068  -14.291 1.00 60.41 ? 225 ILE A N   1 
ATOM   1431 C CA  . ILE A 1 205 ? 31.962  12.945  -13.724 1.00 60.41 ? 225 ILE A CA  1 
ATOM   1432 C C   . ILE A 1 205 ? 32.507  14.142  -12.935 1.00 60.41 ? 225 ILE A C   1 
ATOM   1433 O O   . ILE A 1 205 ? 33.603  14.072  -12.336 1.00 60.41 ? 225 ILE A O   1 
ATOM   1434 C CB  . ILE A 1 205 ? 31.047  12.064  -12.772 1.00 60.56 ? 225 ILE A CB  1 
ATOM   1435 N N   . ASP A 1 206 ? 31.768  15.271  -12.909 1.00 57.15 ? 226 ASP A N   1 
ATOM   1436 C CA  . ASP A 1 206 ? 32.217  16.453  -12.122 1.00 57.15 ? 226 ASP A CA  1 
ATOM   1437 C C   . ASP A 1 206 ? 31.548  16.330  -10.748 1.00 57.15 ? 226 ASP A C   1 
ATOM   1438 O O   . ASP A 1 206 ? 30.418  16.807  -10.589 1.00 57.15 ? 226 ASP A O   1 
ATOM   1439 N N   . LEU A 1 207 ? 32.207  15.729  -9.767  1.00 52.82 ? 227 LEU A N   1 
ATOM   1440 C CA  . LEU A 1 207 ? 31.607  15.544  -8.444  1.00 52.82 ? 227 LEU A CA  1 
ATOM   1441 C C   . LEU A 1 207 ? 31.109  16.820  -7.790  1.00 52.82 ? 227 LEU A C   1 
ATOM   1442 O O   . LEU A 1 207 ? 30.046  16.818  -7.131  1.00 52.82 ? 227 LEU A O   1 
ATOM   1443 C CB  . LEU A 1 207 ? 32.596  14.839  -7.502  1.00 50.46 ? 227 LEU A CB  1 
ATOM   1444 C CG  . LEU A 1 207 ? 32.973  13.406  -7.844  1.00 50.46 ? 227 LEU A CG  1 
ATOM   1445 C CD1 . LEU A 1 207 ? 33.405  12.698  -6.565  1.00 50.46 ? 227 LEU A CD1 1 
ATOM   1446 C CD2 . LEU A 1 207 ? 31.847  12.620  -8.480  1.00 50.46 ? 227 LEU A CD2 1 
ATOM   1447 N N   . ALA A 1 208 ? 31.832  17.910  -7.933  1.00 49.90 ? 228 ALA A N   1 
ATOM   1448 C CA  . ALA A 1 208 ? 31.437  19.215  -7.383  1.00 49.90 ? 228 ALA A CA  1 
ATOM   1449 C C   . ALA A 1 208 ? 30.201  19.735  -8.104  1.00 49.90 ? 228 ALA A C   1 
ATOM   1450 O O   . ALA A 1 208 ? 29.385  20.380  -7.442  1.00 49.90 ? 228 ALA A O   1 
ATOM   1451 C CB  . ALA A 1 208 ? 32.584  20.199  -7.474  1.00 51.29 ? 228 ALA A CB  1 
ATOM   1452 N N   . ALA A 1 209 ? 30.022  19.445  -9.385  1.00 45.35 ? 229 ALA A N   1 
ATOM   1453 C CA  . ALA A 1 209 ? 28.832  19.808  -10.142 1.00 45.35 ? 229 ALA A CA  1 
ATOM   1454 C C   . ALA A 1 209 ? 27.605  19.094  -9.524  1.00 45.35 ? 229 ALA A C   1 
ATOM   1455 O O   . ALA A 1 209 ? 26.570  19.693  -9.250  1.00 45.35 ? 229 ALA A O   1 
ATOM   1456 C CB  . ALA A 1 209 ? 28.973  19.373  -11.584 1.00 44.90 ? 229 ALA A CB  1 
ATOM   1457 N N   . ILE A 1 210 ? 27.818  17.780  -9.277  1.00 42.27 ? 230 ILE A N   1 
ATOM   1458 C CA  . ILE A 1 210 ? 26.831  16.930  -8.649  1.00 42.27 ? 230 ILE A CA  1 
ATOM   1459 C C   . ILE A 1 210 ? 26.607  17.482  -7.241  1.00 42.27 ? 230 ILE A C   1 
ATOM   1460 O O   . ILE A 1 210 ? 25.467  17.707  -6.878  1.00 42.27 ? 230 ILE A O   1 
ATOM   1461 C CB  . ILE A 1 210 ? 27.259  15.452  -8.553  1.00 40.83 ? 230 ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 210 ? 27.333  14.846  -9.947  1.00 40.83 ? 230 ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 210 ? 26.270  14.640  -7.727  1.00 40.83 ? 230 ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 210 ? 27.891  13.458  -10.051 1.00 40.83 ? 230 ILE A CD1 1 
ATOM   1465 N N   . GLU A 1 211 ? 27.668  17.768  -6.486  1.00 42.33 ? 231 GLU A N   1 
ATOM   1466 C CA  . GLU A 1 211 ? 27.463  18.330  -5.163  1.00 42.33 ? 231 GLU A CA  1 
ATOM   1467 C C   . GLU A 1 211 ? 26.746  19.673  -5.222  1.00 42.33 ? 231 GLU A C   1 
ATOM   1468 O O   . GLU A 1 211 ? 25.939  19.996  -4.331  1.00 42.33 ? 231 GLU A O   1 
ATOM   1469 C CB  . GLU A 1 211 ? 28.815  18.484  -4.434  1.00 46.84 ? 231 GLU A CB  1 
ATOM   1470 C CG  . GLU A 1 211 ? 28.672  18.618  -2.914  1.00 46.84 ? 231 GLU A CG  1 
ATOM   1471 C CD  . GLU A 1 211 ? 29.973  18.451  -2.132  1.00 46.84 ? 231 GLU A CD  1 
ATOM   1472 O OE1 . GLU A 1 211 ? 31.007  18.412  -2.871  1.00 46.84 ? 231 GLU A OE1 1 
ATOM   1473 O OE2 . GLU A 1 211 ? 30.002  18.382  -0.847  1.00 46.84 ? 231 GLU A OE2 1 
ATOM   1474 N N   . GLU A 1 212 ? 26.974  20.499  -6.223  1.00 40.13 ? 232 GLU A N   1 
ATOM   1475 C CA  . GLU A 1 212 ? 26.309  21.795  -6.324  1.00 40.13 ? 232 GLU A CA  1 
ATOM   1476 C C   . GLU A 1 212 ? 24.804  21.662  -6.590  1.00 40.13 ? 232 GLU A C   1 
ATOM   1477 O O   . GLU A 1 212 ? 23.969  22.360  -6.031  1.00 40.13 ? 232 GLU A O   1 
ATOM   1478 C CB  . GLU A 1 212 ? 26.921  22.582  -7.489  1.00 46.54 ? 232 GLU A CB  1 
ATOM   1479 C CG  . GLU A 1 212 ? 26.390  24.019  -7.488  1.00 46.54 ? 232 GLU A CG  1 
ATOM   1480 C CD  . GLU A 1 212 ? 26.992  24.816  -8.626  1.00 46.54 ? 232 GLU A CD  1 
ATOM   1481 O OE1 . GLU A 1 212 ? 27.425  24.237  -9.657  1.00 46.54 ? 232 GLU A OE1 1 
ATOM   1482 O OE2 . GLU A 1 212 ? 27.019  26.075  -8.493  1.00 46.54 ? 232 GLU A OE2 1 
ATOM   1483 N N   . GLU A 1 213 ? 24.482  20.745  -7.476  1.00 37.35 ? 233 GLU A N   1 
ATOM   1484 C CA  . GLU A 1 213 ? 23.121  20.387  -7.834  1.00 37.35 ? 233 GLU A CA  1 
ATOM   1485 C C   . GLU A 1 213 ? 22.415  19.845  -6.598  1.00 37.35 ? 233 GLU A C   1 
ATOM   1486 O O   . GLU A 1 213 ? 21.246  20.150  -6.388  1.00 37.35 ? 233 GLU A O   1 
ATOM   1487 C CB  . GLU A 1 213 ? 23.145  19.338  -8.915  1.00 38.72 ? 233 GLU A CB  1 
ATOM   1488 C CG  . GLU A 1 213 ? 21.840  18.710  -9.329  1.00 38.72 ? 233 GLU A CG  1 
ATOM   1489 C CD  . GLU A 1 213 ? 20.894  19.704  -9.971  1.00 38.72 ? 233 GLU A CD  1 
ATOM   1490 O OE1 . GLU A 1 213 ? 21.234  20.222  -11.088 1.00 38.72 ? 233 GLU A OE1 1 
ATOM   1491 O OE2 . GLU A 1 213 ? 19.847  19.966  -9.353  1.00 38.72 ? 233 GLU A OE2 1 
ATOM   1492 N N   . ALA A 1 214 ? 23.120  19.079  -5.769  1.00 36.92 ? 234 ALA A N   1 
ATOM   1493 C CA  . ALA A 1 214 ? 22.595  18.540  -4.526  1.00 36.92 ? 234 ALA A CA  1 
ATOM   1494 C C   . ALA A 1 214 ? 22.390  19.683  -3.542  1.00 36.92 ? 234 ALA A C   1 
ATOM   1495 O O   . ALA A 1 214 ? 21.248  19.860  -3.100  1.00 36.92 ? 234 ALA A O   1 
ATOM   1496 C CB  . ALA A 1 214 ? 23.524  17.515  -3.909  1.00 36.18 ? 234 ALA A CB  1 
ATOM   1497 N N   . ARG A 1 215 ? 23.401  20.467  -3.227  1.00 36.43 ? 235 ARG A N   1 
ATOM   1498 C CA  . ARG A 1 215 ? 23.324  21.595  -2.303  1.00 36.43 ? 235 ARG A CA  1 
ATOM   1499 C C   . ARG A 1 215 ? 22.454  22.760  -2.753  1.00 36.43 ? 235 ARG A C   1 
ATOM   1500 O O   . ARG A 1 215 ? 21.769  23.307  -1.863  1.00 36.43 ? 235 ARG A O   1 
ATOM   1501 C CB  . ARG A 1 215 ? 24.748  22.125  -2.024  1.00 35.78 ? 235 ARG A CB  1 
ATOM   1502 N N   . LYS A 1 216 ? 22.430  23.149  -4.019  1.00 35.54 ? 236 LYS A N   1 
ATOM   1503 C CA  . LYS A 1 216 ? 21.602  24.268  -4.457  1.00 35.54 ? 236 LYS A CA  1 
ATOM   1504 C C   . LYS A 1 216 ? 20.212  23.854  -4.827  1.00 35.54 ? 236 LYS A C   1 
ATOM   1505 O O   . LYS A 1 216 ? 19.322  24.698  -4.830  1.00 35.54 ? 236 LYS A O   1 
ATOM   1506 C CB  . LYS A 1 216 ? 22.295  24.947  -5.644  1.00 37.46 ? 236 LYS A CB  1 
ATOM   1507 C CG  . LYS A 1 216 ? 23.102  26.119  -5.114  1.00 37.46 ? 236 LYS A CG  1 
ATOM   1508 C CD  . LYS A 1 216 ? 24.507  25.710  -4.742  1.00 37.46 ? 236 LYS A CD  1 
ATOM   1509 C CE  . LYS A 1 216 ? 25.406  26.967  -4.935  1.00 37.46 ? 236 LYS A CE  1 
ATOM   1510 N NZ  . LYS A 1 216 ? 25.932  27.017  -6.326  1.00 37.46 ? 236 LYS A NZ  1 
ATOM   1511 N N   . GLY A 1 217 ? 20.004  22.555  -5.063  1.00 34.53 ? 237 GLY A N   1 
ATOM   1512 C CA  . GLY A 1 217 ? 18.713  21.961  -5.371  1.00 34.53 ? 237 GLY A CA  1 
ATOM   1513 C C   . GLY A 1 217 ? 17.621  22.313  -4.390  1.00 34.53 ? 237 GLY A C   1 
ATOM   1514 O O   . GLY A 1 217 ? 16.469  22.526  -4.816  1.00 34.53 ? 237 GLY A O   1 
ATOM   1515 N N   . GLY A 1 218 ? 17.880  22.460  -3.118  1.00 32.18 ? 238 GLY A N   1 
ATOM   1516 C CA  . GLY A 1 218 ? 16.921  22.848  -2.112  1.00 32.18 ? 238 GLY A CA  1 
ATOM   1517 C C   . GLY A 1 218 ? 16.517  24.293  -2.240  1.00 32.18 ? 238 GLY A C   1 
ATOM   1518 O O   . GLY A 1 218 ? 15.361  24.625  -1.912  1.00 32.18 ? 238 GLY A O   1 
ATOM   1519 N N   . PHE A 1 219 ? 17.416  25.178  -2.722  1.00 31.91 ? 239 PHE A N   1 
ATOM   1520 C CA  . PHE A 1 219 ? 17.046  26.603  -2.896  1.00 31.91 ? 239 PHE A CA  1 
ATOM   1521 C C   . PHE A 1 219 ? 16.197  26.711  -4.164  1.00 31.91 ? 239 PHE A C   1 
ATOM   1522 O O   . PHE A 1 219 ? 15.247  27.477  -4.222  1.00 31.91 ? 239 PHE A O   1 
ATOM   1523 C CB  . PHE A 1 219 ? 18.171  27.614  -3.008  1.00 40.60 ? 239 PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 219 ? 19.284  27.330  -2.064  1.00 40.60 ? 239 PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 219 ? 19.084  27.118  -0.705  1.00 40.60 ? 239 PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 219 ? 20.568  27.256  -2.577  1.00 40.60 ? 239 PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 219 ? 20.162  26.839  0.140   1.00 40.60 ? 239 PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 219 ? 21.652  26.988  -1.749  1.00 40.60 ? 239 PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 219 ? 21.445  26.778  -0.395  1.00 40.60 ? 239 PHE A CZ  1 
ATOM   1530 N N   . THR A 1 220 ? 16.488  25.906  -5.167  1.00 25.55 ? 240 THR A N   1 
ATOM   1531 C CA  . THR A 1 220 ? 15.685  25.883  -6.379  1.00 25.55 ? 240 THR A CA  1 
ATOM   1532 C C   . THR A 1 220 ? 14.239  25.614  -6.032  1.00 25.55 ? 240 THR A C   1 
ATOM   1533 O O   . THR A 1 220 ? 13.334  26.313  -6.482  1.00 25.55 ? 240 THR A O   1 
ATOM   1534 C CB  . THR A 1 220 ? 16.210  24.787  -7.314  1.00 25.33 ? 240 THR A CB  1 
ATOM   1535 O OG1 . THR A 1 220 ? 17.632  25.014  -7.464  1.00 25.33 ? 240 THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 220 ? 15.489  24.792  -8.638  1.00 25.33 ? 240 THR A CG2 1 
ATOM   1537 N N   . VAL A 1 221 ? 13.988  24.606  -5.180  1.00 22.33 ? 241 VAL A N   1 
ATOM   1538 C CA  . VAL A 1 221 ? 12.608  24.275  -4.805  1.00 22.33 ? 241 VAL A CA  1 
ATOM   1539 C C   . VAL A 1 221 ? 11.956  25.379  -4.014  1.00 22.33 ? 241 VAL A C   1 
ATOM   1540 O O   . VAL A 1 221 ? 10.857  25.778  -4.350  1.00 22.33 ? 241 VAL A O   1 
ATOM   1541 C CB  . VAL A 1 221 ? 12.575  22.931  -4.036  1.00 19.79 ? 241 VAL A CB  1 
ATOM   1542 C CG1 . VAL A 1 221 ? 11.164  22.616  -3.565  1.00 19.79 ? 241 VAL A CG1 1 
ATOM   1543 C CG2 . VAL A 1 221 ? 13.101  21.831  -4.949  1.00 19.79 ? 241 VAL A CG2 1 
ATOM   1544 N N   . LEU A 1 222 ? 12.593  25.942  -3.019  1.00 24.22 ? 242 LEU A N   1 
ATOM   1545 C CA  . LEU A 1 222 ? 12.037  27.025  -2.193  1.00 24.22 ? 242 LEU A CA  1 
ATOM   1546 C C   . LEU A 1 222 ? 11.754  28.250  -3.050  1.00 24.22 ? 242 LEU A C   1 
ATOM   1547 O O   . LEU A 1 222 ? 10.723  28.928  -3.012  1.00 24.22 ? 242 LEU A O   1 
ATOM   1548 C CB  . LEU A 1 222 ? 13.011  27.279  -1.070  1.00 26.32 ? 242 LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 222 ? 12.902  28.439  -0.109  1.00 26.32 ? 242 LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 222 ? 11.691  28.340  0.787   1.00 26.32 ? 242 LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 222 ? 14.160  28.450  0.774   1.00 26.32 ? 242 LEU A CD2 1 
ATOM   1552 N N   . ASN A 1 223 ? 12.741  28.524  -3.911  1.00 26.30 ? 243 ASN A N   1 
ATOM   1553 C CA  . ASN A 1 223 ? 12.659  29.603  -4.861  1.00 26.30 ? 243 ASN A CA  1 
ATOM   1554 C C   . ASN A 1 223 ? 11.508  29.396  -5.817  1.00 26.30 ? 243 ASN A C   1 
ATOM   1555 O O   . ASN A 1 223 ? 10.802  30.344  -6.114  1.00 26.30 ? 243 ASN A O   1 
ATOM   1556 C CB  . ASN A 1 223 ? 13.951  29.704  -5.695  1.00 32.91 ? 243 ASN A CB  1 
ATOM   1557 C CG  . ASN A 1 223 ? 14.919  30.680  -5.077  1.00 32.91 ? 243 ASN A CG  1 
ATOM   1558 O OD1 . ASN A 1 223 ? 14.795  31.912  -5.598  1.00 32.91 ? 243 ASN A OD1 1 
ATOM   1559 N ND2 . ASN A 1 223 ? 15.743  30.415  -4.197  1.00 32.91 ? 243 ASN A ND2 1 
ATOM   1560 N N   . GLY A 1 224 ? 11.273  28.215  -6.328  1.00 21.90 ? 244 GLY A N   1 
ATOM   1561 C CA  . GLY A 1 224 ? 10.196  27.955  -7.271  1.00 21.90 ? 244 GLY A CA  1 
ATOM   1562 C C   . GLY A 1 224 ? 8.808   27.976  -6.747  1.00 21.90 ? 244 GLY A C   1 
ATOM   1563 O O   . GLY A 1 224 ? 7.884   28.371  -7.461  1.00 21.90 ? 244 GLY A O   1 
ATOM   1564 N N   . LYS A 1 225 ? 8.574   27.468  -5.511  1.00 18.23 ? 245 LYS A N   1 
ATOM   1565 C CA  . LYS A 1 225 ? 7.202   27.442  -5.007  1.00 18.23 ? 245 LYS A CA  1 
ATOM   1566 C C   . LYS A 1 225 ? 7.057   28.055  -3.648  1.00 18.23 ? 245 LYS A C   1 
ATOM   1567 O O   . LYS A 1 225 ? 5.913   28.165  -3.166  1.00 18.23 ? 245 LYS A O   1 
ATOM   1568 C CB  . LYS A 1 225 ? 6.657   26.007  -5.012  1.00 16.77 ? 245 LYS A CB  1 
ATOM   1569 C CG  . LYS A 1 225 ? 7.345   25.004  -4.089  1.00 16.77 ? 245 LYS A CG  1 
ATOM   1570 C CD  . LYS A 1 225 ? 6.774   23.602  -4.392  1.00 16.77 ? 245 LYS A CD  1 
ATOM   1571 C CE  . LYS A 1 225 ? 7.319   22.622  -3.329  1.00 16.77 ? 245 LYS A CE  1 
ATOM   1572 N NZ  . LYS A 1 225 ? 6.864   21.222  -3.619  1.00 16.77 ? 245 LYS A NZ  1 
ATOM   1573 N N   . GLY A 1 226 ? 8.146   28.492  -3.005  1.00 17.55 ? 246 GLY A N   1 
ATOM   1574 C CA  . GLY A 1 226 ? 8.037   29.133  -1.701  1.00 17.55 ? 246 GLY A CA  1 
ATOM   1575 C C   . GLY A 1 226 ? 8.246   28.289  -0.481  1.00 17.55 ? 246 GLY A C   1 
ATOM   1576 O O   . GLY A 1 226 ? 8.172   28.786  0.666   1.00 17.55 ? 246 GLY A O   1 
ATOM   1577 N N   . TYR A 1 227 ? 8.450   26.996  -0.617  1.00 16.50 ? 247 TYR A N   1 
ATOM   1578 C CA  . TYR A 1 227 ? 8.670   26.075  0.490   1.00 16.50 ? 247 TYR A CA  1 
ATOM   1579 C C   . TYR A 1 227 ? 9.137   24.769  -0.094  1.00 16.50 ? 247 TYR A C   1 
ATOM   1580 O O   . TYR A 1 227 ? 9.240   24.660  -1.314  1.00 16.50 ? 247 TYR A O   1 
ATOM   1581 C CB  . TYR A 1 227 ? 7.352   25.809  1.240   1.00 13.44 ? 247 TYR A CB  1 
ATOM   1582 C CG  . TYR A 1 227 ? 6.264   25.335  0.314   1.00 13.44 ? 247 TYR A CG  1 
ATOM   1583 C CD1 . TYR A 1 227 ? 6.069   23.989  0.051   1.00 13.44 ? 247 TYR A CD1 1 
ATOM   1584 C CD2 . TYR A 1 227 ? 5.408   26.223  -0.310  1.00 13.44 ? 247 TYR A CD2 1 
ATOM   1585 C CE1 . TYR A 1 227 ? 5.092   23.541  -0.797  1.00 13.44 ? 247 TYR A CE1 1 
ATOM   1586 C CE2 . TYR A 1 227 ? 4.434   25.813  -1.189  1.00 13.44 ? 247 TYR A CE2 1 
ATOM   1587 C CZ  . TYR A 1 227 ? 4.296   24.486  -1.440  1.00 13.44 ? 247 TYR A CZ  1 
ATOM   1588 O OH  . TYR A 1 227 ? 3.311   24.008  -2.311  1.00 13.44 ? 247 TYR A OH  1 
ATOM   1589 N N   . THR A 1 228 ? 9.407   23.796  0.773   1.00 19.00 ? 248 THR A N   1 
ATOM   1590 C CA  . THR A 1 228 ? 9.784   22.445  0.284   1.00 19.00 ? 248 THR A CA  1 
ATOM   1591 C C   . THR A 1 228 ? 8.890   21.505  1.155   1.00 19.00 ? 248 THR A C   1 
ATOM   1592 O O   . THR A 1 228 ? 8.636   21.879  2.304   1.00 19.00 ? 248 THR A O   1 
ATOM   1593 C CB  . THR A 1 228 ? 11.220  22.012  0.323   1.00 21.02 ? 248 THR A CB  1 
ATOM   1594 O OG1 . THR A 1 228 ? 11.601  21.676  1.666   1.00 21.02 ? 248 THR A OG1 1 
ATOM   1595 C CG2 . THR A 1 228 ? 12.237  23.066  -0.109  1.00 21.02 ? 248 THR A CG2 1 
ATOM   1596 N N   . SER A 1 229 ? 8.329   20.449  0.568   1.00 17.82 ? 249 SER A N   1 
ATOM   1597 C CA  . SER A 1 229 ? 7.448   19.594  1.326   1.00 17.82 ? 249 SER A CA  1 
ATOM   1598 C C   . SER A 1 229 ? 7.624   18.133  1.031   1.00 17.82 ? 249 SER A C   1 
ATOM   1599 O O   . SER A 1 229 ? 7.919   17.421  2.006   1.00 17.82 ? 249 SER A O   1 
ATOM   1600 C CB  . SER A 1 229 ? 5.960   19.967  1.091   1.00 16.94 ? 249 SER A CB  1 
ATOM   1601 O OG  . SER A 1 229 ? 5.712   19.906  -0.301  1.00 16.94 ? 249 SER A OG  1 
ATOM   1602 N N   . TYR A 1 230 ? 7.486   17.606  -0.146  1.00 16.75 ? 250 TYR A N   1 
ATOM   1603 C CA  . TYR A 1 230 ? 7.599   16.172  -0.393  1.00 16.75 ? 250 TYR A CA  1 
ATOM   1604 C C   . TYR A 1 230 ? 8.903   15.539  -0.023  1.00 16.75 ? 250 TYR A C   1 
ATOM   1605 O O   . TYR A 1 230 ? 8.886   14.417  0.578   1.00 16.75 ? 250 TYR A O   1 
ATOM   1606 C CB  . TYR A 1 230 ? 7.287   15.876  -1.901  1.00 15.23 ? 250 TYR A CB  1 
ATOM   1607 C CG  . TYR A 1 230 ? 6.043   16.639  -2.323  1.00 15.23 ? 250 TYR A CG  1 
ATOM   1608 C CD1 . TYR A 1 230 ? 4.843   16.426  -1.646  1.00 15.23 ? 250 TYR A CD1 1 
ATOM   1609 C CD2 . TYR A 1 230 ? 6.057   17.578  -3.349  1.00 15.23 ? 250 TYR A CD2 1 
ATOM   1610 C CE1 . TYR A 1 230 ? 3.709   17.108  -1.958  1.00 15.23 ? 250 TYR A CE1 1 
ATOM   1611 C CE2 . TYR A 1 230 ? 4.920   18.270  -3.673  1.00 15.23 ? 250 TYR A CE2 1 
ATOM   1612 C CZ  . TYR A 1 230 ? 3.743   18.041  -2.983  1.00 15.23 ? 250 TYR A CZ  1 
ATOM   1613 O OH  . TYR A 1 230 ? 2.597   18.747  -3.291  1.00 15.23 ? 250 TYR A OH  1 
ATOM   1614 N N   . GLY A 1 231 ? 10.059  16.125  -0.276  1.00 15.72 ? 251 GLY A N   1 
ATOM   1615 C CA  . GLY A 1 231 ? 11.342  15.624  0.074   1.00 15.72 ? 251 GLY A CA  1 
ATOM   1616 C C   . GLY A 1 231 ? 11.479  15.329  1.568   1.00 15.72 ? 251 GLY A C   1 
ATOM   1617 O O   . GLY A 1 231 ? 11.802  14.206  1.946   1.00 15.72 ? 251 GLY A O   1 
ATOM   1618 N N   . VAL A 1 232 ? 11.285  16.340  2.409   1.00 15.65 ? 252 VAL A N   1 
ATOM   1619 C CA  . VAL A 1 232 ? 11.459  16.192  3.840   1.00 15.65 ? 252 VAL A CA  1 
ATOM   1620 C C   . VAL A 1 232 ? 10.312  15.425  4.480   1.00 15.65 ? 252 VAL A C   1 
ATOM   1621 O O   . VAL A 1 232 ? 10.563  14.671  5.471   1.00 15.65 ? 252 VAL A O   1 
ATOM   1622 C CB  . VAL A 1 232 ? 11.666  17.563  4.508   1.00 15.11 ? 252 VAL A CB  1 
ATOM   1623 C CG1 . VAL A 1 232 ? 10.433  18.442  4.475   1.00 15.11 ? 252 VAL A CG1 1 
ATOM   1624 C CG2 . VAL A 1 232 ? 12.065  17.369  5.970   1.00 15.11 ? 252 VAL A CG2 1 
ATOM   1625 N N   . ALA A 1 233 ? 9.107   15.512  3.985   1.00 15.13 ? 253 ALA A N   1 
ATOM   1626 C CA  . ALA A 1 233 ? 7.962   14.796  4.538   1.00 15.13 ? 253 ALA A CA  1 
ATOM   1627 C C   . ALA A 1 233 ? 8.203   13.309  4.417   1.00 15.13 ? 253 ALA A C   1 
ATOM   1628 O O   . ALA A 1 233 ? 7.933   12.565  5.362   1.00 15.13 ? 253 ALA A O   1 
ATOM   1629 C CB  . ALA A 1 233 ? 6.653   15.035  3.795   1.00 13.20 ? 253 ALA A CB  1 
ATOM   1630 N N   . THR A 1 234 ? 8.703   12.871  3.288   1.00 14.23 ? 254 THR A N   1 
ATOM   1631 C CA  . THR A 1 234 ? 8.972   11.465  3.029   1.00 14.23 ? 254 THR A CA  1 
ATOM   1632 C C   . THR A 1 234 ? 10.125  10.987  3.889   1.00 14.23 ? 254 THR A C   1 
ATOM   1633 O O   . THR A 1 234 ? 10.107  9.808   4.299   1.00 14.23 ? 254 THR A O   1 
ATOM   1634 C CB  . THR A 1 234 ? 9.284   11.246  1.542   1.00 13.81 ? 254 THR A CB  1 
ATOM   1635 O OG1 . THR A 1 234 ? 8.104   11.736  0.782   1.00 13.81 ? 254 THR A OG1 1 
ATOM   1636 C CG2 . THR A 1 234 ? 9.528   9.832   1.173   1.00 13.81 ? 254 THR A CG2 1 
ATOM   1637 N N   . SER A 1 235 ? 11.104  11.808  4.227   1.00 14.92 ? 255 SER A N   1 
ATOM   1638 C CA  . SER A 1 235 ? 12.252  11.450  5.057   1.00 14.92 ? 255 SER A CA  1 
ATOM   1639 C C   . SER A 1 235 ? 11.739  11.179  6.472   1.00 14.92 ? 255 SER A C   1 
ATOM   1640 O O   . SER A 1 235 ? 12.113  10.189  7.101   1.00 14.92 ? 255 SER A O   1 
ATOM   1641 C CB  . SER A 1 235 ? 13.293  12.586  4.907   1.00 14.68 ? 255 SER A CB  1 
ATOM   1642 O OG  A SER A 1 235 ? 13.652  12.532  3.544   0.50 14.68 ? 255 SER A OG  1 
ATOM   1643 O OG  B SER A 1 235 ? 12.854  13.596  5.836   0.50 14.68 ? 255 SER A OG  1 
ATOM   1644 N N   . ALA A 1 236 ? 10.802  11.983  7.013   1.00 14.99 ? 256 ALA A N   1 
ATOM   1645 C CA  . ALA A 1 236 ? 10.173  11.859  8.303   1.00 14.99 ? 256 ALA A CA  1 
ATOM   1646 C C   . ALA A 1 236 ? 9.314   10.593  8.345   1.00 14.99 ? 256 ALA A C   1 
ATOM   1647 O O   . ALA A 1 236 ? 9.343   9.856   9.337   1.00 14.99 ? 256 ALA A O   1 
ATOM   1648 C CB  . ALA A 1 236 ? 9.309   13.071  8.598   1.00 13.91 ? 256 ALA A CB  1 
ATOM   1649 N N   . ILE A 1 237 ? 8.578   10.280  7.312   1.00 14.89 ? 257 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 237 ? 7.723   9.108   7.244   1.00 14.89 ? 257 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 237 ? 8.590   7.870   7.267   1.00 14.89 ? 257 ILE A C   1 
ATOM   1652 O O   . ILE A 1 237 ? 8.225   6.908   7.941   1.00 14.89 ? 257 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 237 ? 6.842   9.102   6.012   1.00 11.96 ? 257 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 237 ? 5.750   10.178  6.215   1.00 11.96 ? 257 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 237 ? 6.166   7.784   5.737   1.00 11.96 ? 257 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 237 ? 5.081   10.501  4.868   1.00 11.96 ? 257 ILE A CD1 1 
ATOM   1657 N N   . ARG A 1 238 ? 9.723   7.867   6.579   1.00 16.01 ? 258 ARG A N   1 
ATOM   1658 C CA  . ARG A 1 238 ? 10.601  6.720   6.579   1.00 16.01 ? 258 ARG A CA  1 
ATOM   1659 C C   . ARG A 1 238 ? 11.123  6.435   7.993   1.00 16.01 ? 258 ARG A C   1 
ATOM   1660 O O   . ARG A 1 238 ? 11.196  5.263   8.389   1.00 16.01 ? 258 ARG A O   1 
ATOM   1661 C CB  . ARG A 1 238 ? 11.806  6.950   5.679   1.00 17.60 ? 258 ARG A CB  1 
ATOM   1662 C CG  . ARG A 1 238 ? 12.435  5.628   5.291   1.00 17.60 ? 258 ARG A CG  1 
ATOM   1663 C CD  . ARG A 1 238 ? 13.730  5.822   4.562   1.00 17.60 ? 258 ARG A CD  1 
ATOM   1664 N NE  . ARG A 1 238 ? 14.399  4.550   4.350   1.00 17.60 ? 258 ARG A NE  1 
ATOM   1665 C CZ  . ARG A 1 238 ? 15.538  4.418   3.660   1.00 17.60 ? 258 ARG A CZ  1 
ATOM   1666 N NH1 . ARG A 1 238 ? 16.099  5.448   3.023   1.00 17.60 ? 258 ARG A NH1 1 
ATOM   1667 N NH2 . ARG A 1 238 ? 16.085  3.197   3.582   1.00 17.60 ? 258 ARG A NH2 1 
ATOM   1668 N N   . ILE A 1 239 ? 11.527  7.464   8.731   1.00 15.17 ? 259 ILE A N   1 
ATOM   1669 C CA  . ILE A 1 239 ? 11.990  7.318   10.084  1.00 15.17 ? 259 ILE A CA  1 
ATOM   1670 C C   . ILE A 1 239 ? 10.811  6.911   10.908  1.00 15.17 ? 259 ILE A C   1 
ATOM   1671 O O   . ILE A 1 239 ? 10.989  5.899   11.673  1.00 15.17 ? 259 ILE A O   1 
ATOM   1672 C CB  . ILE A 1 239 ? 12.525  8.640   10.654  1.00 12.93 ? 259 ILE A CB  1 
ATOM   1673 C CG1 . ILE A 1 239 ? 13.791  9.047   9.895   1.00 12.93 ? 259 ILE A CG1 1 
ATOM   1674 C CG2 . ILE A 1 239 ? 12.860  8.511   12.140  1.00 12.93 ? 259 ILE A CG2 1 
ATOM   1675 C CD1 . ILE A 1 239 ? 14.197  10.506  10.142  1.00 12.93 ? 259 ILE A CD1 1 
ATOM   1676 N N   . ALA A 1 240 ? 9.651   7.500   10.884  1.00 14.48 ? 260 ALA A N   1 
ATOM   1677 C CA  . ALA A 1 240 ? 8.504   7.095   11.671  1.00 14.48 ? 260 ALA A CA  1 
ATOM   1678 C C   . ALA A 1 240 ? 8.146   5.679   11.404  1.00 14.48 ? 260 ALA A C   1 
ATOM   1679 O O   . ALA A 1 240 ? 7.833   4.995   12.402  1.00 14.48 ? 260 ALA A O   1 
ATOM   1680 C CB  . ALA A 1 240 ? 7.303   7.964   11.340  1.00 13.78 ? 260 ALA A CB  1 
ATOM   1681 N N   . LYS A 1 241 ? 8.165   5.074   10.274  1.00 12.40 ? 261 LYS A N   1 
ATOM   1682 C CA  . LYS A 1 241 ? 7.873   3.674   10.048  1.00 12.40 ? 261 LYS A CA  1 
ATOM   1683 C C   . LYS A 1 241 ? 8.942   2.760   10.613  1.00 12.40 ? 261 LYS A C   1 
ATOM   1684 O O   . LYS A 1 241 ? 8.596   1.652   10.985  1.00 12.40 ? 261 LYS A O   1 
ATOM   1685 C CB  . LYS A 1 241 ? 7.794   3.425   8.529   1.00 10.93 ? 261 LYS A CB  1 
ATOM   1686 C CG  . LYS A 1 241 ? 6.545   4.000   7.905   1.00 10.93 ? 261 LYS A CG  1 
ATOM   1687 C CD  . LYS A 1 241 ? 6.520   3.465   6.477   1.00 10.93 ? 261 LYS A CD  1 
ATOM   1688 C CE  . LYS A 1 241 ? 5.448   4.207   5.696   1.00 10.93 ? 261 LYS A CE  1 
ATOM   1689 N NZ  . LYS A 1 241 ? 5.261   3.471   4.418   1.00 10.93 ? 261 LYS A NZ  1 
ATOM   1690 N N   . ALA A 1 242 ? 10.215  3.178   10.643  1.00 13.14 ? 262 ALA A N   1 
ATOM   1691 C CA  . ALA A 1 242 ? 11.304  2.377   11.180  1.00 13.14 ? 262 ALA A CA  1 
ATOM   1692 C C   . ALA A 1 242 ? 11.151  2.277   12.676  1.00 13.14 ? 262 ALA A C   1 
ATOM   1693 O O   . ALA A 1 242 ? 11.463  1.239   13.256  1.00 13.14 ? 262 ALA A O   1 
ATOM   1694 C CB  . ALA A 1 242 ? 12.672  2.974   10.860  1.00 11.39 ? 262 ALA A CB  1 
ATOM   1695 N N   . VAL A 1 243 ? 10.685  3.291   13.356  1.00 13.94 ? 263 VAL A N   1 
ATOM   1696 C CA  . VAL A 1 243 ? 10.455  3.317   14.767  1.00 13.94 ? 263 VAL A CA  1 
ATOM   1697 C C   . VAL A 1 243 ? 9.315   2.388   15.126  1.00 13.94 ? 263 VAL A C   1 
ATOM   1698 O O   . VAL A 1 243 ? 9.551   1.399   15.856  1.00 13.94 ? 263 VAL A O   1 
ATOM   1699 C CB  . VAL A 1 243 ? 10.111  4.738   15.244  1.00 11.63 ? 263 VAL A CB  1 
ATOM   1700 C CG1 . VAL A 1 243 ? 9.647   4.756   16.676  1.00 11.63 ? 263 VAL A CG1 1 
ATOM   1701 C CG2 . VAL A 1 243 ? 11.338  5.626   15.086  1.00 11.63 ? 263 VAL A CG2 1 
ATOM   1702 N N   . MET A 1 244 ? 8.141   2.584   14.594  1.00 16.16 ? 264 MET A N   1 
ATOM   1703 C CA  . MET A 1 244 ? 6.986   1.750   14.907  1.00 16.16 ? 264 MET A CA  1 
ATOM   1704 C C   . MET A 1 244 ? 7.201   0.287   14.638  1.00 16.16 ? 264 MET A C   1 
ATOM   1705 O O   . MET A 1 244 ? 6.717   -0.597  15.401  1.00 16.16 ? 264 MET A O   1 
ATOM   1706 C CB  . MET A 1 244 ? 5.762   2.233   14.086  1.00 15.35 ? 264 MET A CB  1 
ATOM   1707 C CG  . MET A 1 244 ? 5.426   3.672   14.449  1.00 15.35 ? 264 MET A CG  1 
ATOM   1708 S SD  . MET A 1 244 ? 3.868   4.183   13.722  1.00 15.35 ? 264 MET A SD  1 
ATOM   1709 C CE  . MET A 1 244 ? 4.257   4.158   11.957  1.00 15.35 ? 264 MET A CE  1 
ATOM   1710 N N   . ALA A 1 245 ? 7.913   -0.085  13.607  1.00 14.99 ? 265 ALA A N   1 
ATOM   1711 C CA  . ALA A 1 245 ? 8.153   -1.464  13.225  1.00 14.99 ? 265 ALA A CA  1 
ATOM   1712 C C   . ALA A 1 245 ? 9.363   -2.022  13.918  1.00 14.99 ? 265 ALA A C   1 
ATOM   1713 O O   . ALA A 1 245 ? 9.703   -3.176  13.686  1.00 14.99 ? 265 ALA A O   1 
ATOM   1714 C CB  . ALA A 1 245 ? 8.368   -1.545  11.700  1.00 13.80 ? 265 ALA A CB  1 
ATOM   1715 N N   . ASP A 1 246 ? 10.078  -1.201  14.666  1.00 17.04 ? 266 ASP A N   1 
ATOM   1716 C CA  . ASP A 1 246 ? 11.301  -1.622  15.346  1.00 17.04 ? 266 ASP A CA  1 
ATOM   1717 C C   . ASP A 1 246 ? 12.228  -2.307  14.362  1.00 17.04 ? 266 ASP A C   1 
ATOM   1718 O O   . ASP A 1 246 ? 12.784  -3.365  14.653  1.00 17.04 ? 266 ASP A O   1 
ATOM   1719 C CB  . ASP A 1 246 ? 10.910  -2.570  16.469  1.00 19.40 ? 266 ASP A CB  1 
ATOM   1720 C CG  . ASP A 1 246 ? 12.003  -2.759  17.458  1.00 19.40 ? 266 ASP A CG  1 
ATOM   1721 O OD1 . ASP A 1 246 ? 12.849  -1.864  17.655  1.00 19.40 ? 266 ASP A OD1 1 
ATOM   1722 O OD2 . ASP A 1 246 ? 12.058  -3.866  18.095  1.00 19.40 ? 266 ASP A OD2 1 
ATOM   1723 N N   . ALA A 1 247 ? 12.455  -1.666  13.178  1.00 16.01 ? 267 ALA A N   1 
ATOM   1724 C CA  . ALA A 1 247 ? 13.248  -2.258  12.130  1.00 16.01 ? 267 ALA A CA  1 
ATOM   1725 C C   . ALA A 1 247 ? 14.712  -2.414  12.387  1.00 16.01 ? 267 ALA A C   1 
ATOM   1726 O O   . ALA A 1 247 ? 15.332  -3.288  11.737  1.00 16.01 ? 267 ALA A O   1 
ATOM   1727 C CB  . ALA A 1 247 ? 13.088  -1.417  10.819  1.00 13.59 ? 267 ALA A CB  1 
ATOM   1728 N N   . HIS A 1 248 ? 15.328  -1.565  13.205  1.00 18.90 ? 268 HIS A N   1 
ATOM   1729 C CA  . HIS A 1 248 ? 16.781  -1.599  13.408  1.00 18.90 ? 268 HIS A CA  1 
ATOM   1730 C C   . HIS A 1 248 ? 17.440  -1.246  12.073  1.00 18.90 ? 268 HIS A C   1 
ATOM   1731 O O   . HIS A 1 248 ? 18.426  -1.871  11.642  1.00 18.90 ? 268 HIS A O   1 
ATOM   1732 C CB  . HIS A 1 248 ? 17.278  -2.954  13.824  1.00 20.31 ? 268 HIS A CB  1 
ATOM   1733 C CG  . HIS A 1 248 ? 16.881  -3.301  15.231  1.00 20.31 ? 268 HIS A CG  1 
ATOM   1734 N ND1 . HIS A 1 248 ? 17.769  -3.757  16.142  1.00 20.31 ? 268 HIS A ND1 1 
ATOM   1735 C CD2 . HIS A 1 248 ? 15.670  -3.202  15.837  1.00 20.31 ? 268 HIS A CD2 1 
ATOM   1736 C CE1 . HIS A 1 248 ? 17.119  -3.950  17.276  1.00 20.31 ? 268 HIS A CE1 1 
ATOM   1737 N NE2 . HIS A 1 248 ? 15.847  -3.624  17.104  1.00 20.31 ? 268 HIS A NE2 1 
ATOM   1738 N N   . ALA A 1 249 ? 16.892  -0.202  11.423  1.00 18.75 ? 269 ALA A N   1 
ATOM   1739 C CA  . ALA A 1 249 ? 17.322  0.264   10.127  1.00 18.75 ? 269 ALA A CA  1 
ATOM   1740 C C   . ALA A 1 249 ? 18.382  1.319   10.277  1.00 18.75 ? 269 ALA A C   1 
ATOM   1741 O O   . ALA A 1 249 ? 18.331  2.173   11.144  1.00 18.75 ? 269 ALA A O   1 
ATOM   1742 C CB  . ALA A 1 249 ? 16.137  0.868   9.398   1.00 18.54 ? 269 ALA A CB  1 
ATOM   1743 N N   . GLU A 1 250 ? 19.385  1.256   9.429   1.00 18.75 ? 270 GLU A N   1 
ATOM   1744 C CA  . GLU A 1 250 ? 20.441  2.282   9.446   1.00 18.75 ? 270 GLU A CA  1 
ATOM   1745 C C   . GLU A 1 250 ? 19.955  3.462   8.636   1.00 18.75 ? 270 GLU A C   1 
ATOM   1746 O O   . GLU A 1 250 ? 19.594  3.331   7.446   1.00 18.75 ? 270 GLU A O   1 
ATOM   1747 C CB  . GLU A 1 250 ? 21.693  1.701   8.815   1.00 21.58 ? 270 GLU A CB  1 
ATOM   1748 C CG  . GLU A 1 250 ? 22.879  2.659   8.922   1.00 21.58 ? 270 GLU A CG  1 
ATOM   1749 C CD  . GLU A 1 250 ? 23.941  2.234   7.944   1.00 21.58 ? 270 GLU A CD  1 
ATOM   1750 O OE1 . GLU A 1 250 ? 23.579  1.867   6.803   1.00 21.58 ? 270 GLU A OE1 1 
ATOM   1751 O OE2 . GLU A 1 250 ? 25.131  2.213   8.232   1.00 21.58 ? 270 GLU A OE2 1 
ATOM   1752 N N   . LEU A 1 251 ? 19.887  4.636   9.217   1.00 17.49 ? 271 LEU A N   1 
ATOM   1753 C CA  . LEU A 1 251 ? 19.440  5.863   8.598   1.00 17.49 ? 271 LEU A CA  1 
ATOM   1754 C C   . LEU A 1 251 ? 20.329  6.992   9.034   1.00 17.49 ? 271 LEU A C   1 
ATOM   1755 O O   . LEU A 1 251 ? 20.774  7.026   10.188  1.00 17.49 ? 271 LEU A O   1 
ATOM   1756 C CB  . LEU A 1 251 ? 18.015  6.239   9.049   1.00 13.99 ? 271 LEU A CB  1 
ATOM   1757 C CG  . LEU A 1 251 ? 16.920  5.231   8.653   1.00 13.99 ? 271 LEU A CG  1 
ATOM   1758 C CD1 . LEU A 1 251 ? 15.625  5.521   9.332   1.00 13.99 ? 271 LEU A CD1 1 
ATOM   1759 C CD2 . LEU A 1 251 ? 16.786  5.284   7.147   1.00 13.99 ? 271 LEU A CD2 1 
ATOM   1760 N N   . VAL A 1 252 ? 20.578  7.945   8.106   1.00 17.17 ? 272 VAL A N   1 
ATOM   1761 C CA  . VAL A 1 252 ? 21.410  9.086   8.511   1.00 17.17 ? 272 VAL A CA  1 
ATOM   1762 C C   . VAL A 1 252 ? 20.422  10.049  9.102   1.00 17.17 ? 272 VAL A C   1 
ATOM   1763 O O   . VAL A 1 252 ? 19.377  10.349  8.552   1.00 17.17 ? 272 VAL A O   1 
ATOM   1764 C CB  . VAL A 1 252 ? 22.245  9.587   7.323   1.00 15.97 ? 272 VAL A CB  1 
ATOM   1765 C CG1 . VAL A 1 252 ? 21.326  10.052  6.238   1.00 15.97 ? 272 VAL A CG1 1 
ATOM   1766 C CG2 . VAL A 1 252 ? 23.174  10.699  7.752   1.00 15.97 ? 272 VAL A CG2 1 
ATOM   1767 N N   . VAL A 1 253 ? 20.526  10.412  10.379  1.00 16.93 ? 273 VAL A N   1 
ATOM   1768 C CA  . VAL A 1 253 ? 19.603  11.287  11.059  1.00 16.93 ? 273 VAL A CA  1 
ATOM   1769 C C   . VAL A 1 253 ? 20.438  12.127  12.014  1.00 16.93 ? 273 VAL A C   1 
ATOM   1770 O O   . VAL A 1 253 ? 21.613  11.789  12.234  1.00 16.93 ? 273 VAL A O   1 
ATOM   1771 C CB  . VAL A 1 253 ? 18.534  10.555  11.886  1.00 16.07 ? 273 VAL A CB  1 
ATOM   1772 C CG1 . VAL A 1 253 ? 17.574  9.715   11.037  1.00 16.07 ? 273 VAL A CG1 1 
ATOM   1773 C CG2 . VAL A 1 253 ? 19.162  9.588   12.924  1.00 16.07 ? 273 VAL A CG2 1 
ATOM   1774 N N   . SER A 1 254 ? 19.830  13.165  12.540  1.00 20.11 ? 274 SER A N   1 
ATOM   1775 C CA  . SER A 1 254 ? 20.540  14.042  13.484  1.00 20.11 ? 274 SER A CA  1 
ATOM   1776 C C   . SER A 1 254 ? 20.416  13.358  14.842  1.00 20.11 ? 274 SER A C   1 
ATOM   1777 O O   . SER A 1 254 ? 19.297  13.180  15.363  1.00 20.11 ? 274 SER A O   1 
ATOM   1778 C CB  . SER A 1 254 ? 19.971  15.448  13.448  1.00 18.74 ? 274 SER A CB  1 
ATOM   1779 O OG  . SER A 1 254 ? 20.624  16.289  14.388  1.00 18.74 ? 274 SER A OG  1 
ATOM   1780 N N   . ASN A 1 255 ? 21.537  12.836  15.360  1.00 23.03 ? 275 ASN A N   1 
ATOM   1781 C CA  . ASN A 1 255 ? 21.548  12.135  16.631  1.00 23.03 ? 275 ASN A CA  1 
ATOM   1782 C C   . ASN A 1 255 ? 22.746  12.555  17.454  1.00 23.03 ? 275 ASN A C   1 
ATOM   1783 O O   . ASN A 1 255 ? 23.750  13.015  16.932  1.00 23.03 ? 275 ASN A O   1 
ATOM   1784 C CB  . ASN A 1 255 ? 21.578  10.625  16.422  1.00 21.47 ? 275 ASN A CB  1 
ATOM   1785 C CG  . ASN A 1 255 ? 22.747  10.089  15.671  1.00 21.47 ? 275 ASN A CG  1 
ATOM   1786 O OD1 . ASN A 1 255 ? 23.624  9.386   16.187  1.00 21.47 ? 275 ASN A OD1 1 
ATOM   1787 N ND2 . ASN A 1 255 ? 22.806  10.337  14.355  1.00 21.47 ? 275 ASN A ND2 1 
ATOM   1788 N N   . ARG A 1 256 ? 22.625  12.404  18.770  1.00 27.50 ? 276 ARG A N   1 
ATOM   1789 C CA  . ARG A 1 256 ? 23.745  12.805  19.608  1.00 27.50 ? 276 ARG A CA  1 
ATOM   1790 C C   . ARG A 1 256 ? 24.719  11.663  19.881  1.00 27.50 ? 276 ARG A C   1 
ATOM   1791 O O   . ARG A 1 256 ? 24.446  10.787  20.704  1.00 27.50 ? 276 ARG A O   1 
ATOM   1792 C CB  . ARG A 1 256 ? 23.265  13.351  20.967  1.00 33.20 ? 276 ARG A CB  1 
ATOM   1793 C CG  . ARG A 1 256 ? 24.408  14.177  21.576  1.00 33.20 ? 276 ARG A CG  1 
ATOM   1794 C CD  . ARG A 1 256 ? 23.903  14.896  22.826  1.00 33.20 ? 276 ARG A CD  1 
ATOM   1795 N NE  . ARG A 1 256 ? 23.750  13.888  23.847  1.00 33.20 ? 276 ARG A NE  1 
ATOM   1796 C CZ  . ARG A 1 256 ? 23.237  13.941  25.051  1.00 33.20 ? 276 ARG A CZ  1 
ATOM   1797 N NH1 . ARG A 1 256 ? 22.698  15.036  25.578  1.00 33.20 ? 276 ARG A NH1 1 
ATOM   1798 N NH2 . ARG A 1 256 ? 23.245  12.795  25.785  1.00 33.20 ? 276 ARG A NH2 1 
ATOM   1799 N N   . ARG A 1 257 ? 25.835  11.708  19.182  1.00 30.65 ? 277 ARG A N   1 
ATOM   1800 C CA  . ARG A 1 257 ? 26.852  10.675  19.368  1.00 30.65 ? 277 ARG A CA  1 
ATOM   1801 C C   . ARG A 1 257 ? 27.692  10.997  20.584  1.00 30.65 ? 277 ARG A C   1 
ATOM   1802 O O   . ARG A 1 257 ? 27.944  12.177  20.903  1.00 30.65 ? 277 ARG A O   1 
ATOM   1803 C CB  . ARG A 1 257 ? 27.744  10.630  18.141  1.00 27.78 ? 277 ARG A CB  1 
ATOM   1804 C CG  . ARG A 1 257 ? 27.063  10.106  16.890  1.00 27.78 ? 277 ARG A CG  1 
ATOM   1805 C CD  . ARG A 1 257 ? 28.027  10.255  15.740  1.00 27.78 ? 277 ARG A CD  1 
ATOM   1806 N NE  . ARG A 1 257 ? 29.253  9.536   15.964  1.00 27.78 ? 277 ARG A NE  1 
ATOM   1807 C CZ  . ARG A 1 257 ? 29.494  8.260   15.705  1.00 27.78 ? 277 ARG A CZ  1 
ATOM   1808 N NH1 . ARG A 1 257 ? 28.608  7.410   15.225  1.00 27.78 ? 277 ARG A NH1 1 
ATOM   1809 N NH2 . ARG A 1 257 ? 30.724  7.781   15.939  1.00 27.78 ? 277 ARG A NH2 1 
ATOM   1810 N N   . ASP A 1 258 ? 28.158  9.993   21.292  1.00 36.73 ? 278 ASP A N   1 
ATOM   1811 C CA  . ASP A 1 258 ? 28.970  10.261  22.493  1.00 36.73 ? 278 ASP A CA  1 
ATOM   1812 C C   . ASP A 1 258 ? 30.250  11.003  22.163  1.00 36.73 ? 278 ASP A C   1 
ATOM   1813 O O   . ASP A 1 258 ? 30.617  12.009  22.779  1.00 36.73 ? 278 ASP A O   1 
ATOM   1814 C CB  . ASP A 1 258 ? 29.302  8.934   23.152  1.00 42.32 ? 278 ASP A CB  1 
ATOM   1815 C CG  . ASP A 1 258 ? 28.090  8.235   23.753  1.00 42.32 ? 278 ASP A CG  1 
ATOM   1816 O OD1 . ASP A 1 258 ? 27.322  8.860   24.529  1.00 42.32 ? 278 ASP A OD1 1 
ATOM   1817 O OD2 . ASP A 1 258 ? 27.904  7.016   23.456  1.00 42.32 ? 278 ASP A OD2 1 
ATOM   1818 N N   . ASP A 1 259 ? 30.930  10.566  21.112  1.00 37.60 ? 279 ASP A N   1 
ATOM   1819 C CA  . ASP A 1 259 ? 32.176  11.192  20.678  1.00 37.60 ? 279 ASP A CA  1 
ATOM   1820 C C   . ASP A 1 259 ? 32.017  12.623  20.192  1.00 37.60 ? 279 ASP A C   1 
ATOM   1821 O O   . ASP A 1 259 ? 33.011  13.367  20.188  1.00 37.60 ? 279 ASP A O   1 
ATOM   1822 C CB  . ASP A 1 259 ? 32.804  10.364  19.553  1.00 42.02 ? 279 ASP A CB  1 
ATOM   1823 C CG  . ASP A 1 259 ? 32.020  10.255  18.276  1.00 42.02 ? 279 ASP A CG  1 
ATOM   1824 O OD1 . ASP A 1 259 ? 30.763  10.337  18.340  1.00 42.02 ? 279 ASP A OD1 1 
ATOM   1825 O OD2 . ASP A 1 259 ? 32.618  10.078  17.172  1.00 42.02 ? 279 ASP A OD2 1 
ATOM   1826 N N   . MET A 1 260 ? 30.847  13.016  19.735  1.00 32.23 ? 280 MET A N   1 
ATOM   1827 C CA  . MET A 1 260 ? 30.562  14.348  19.210  1.00 32.23 ? 280 MET A CA  1 
ATOM   1828 C C   . MET A 1 260 ? 30.081  15.261  20.311  1.00 32.23 ? 280 MET A C   1 
ATOM   1829 O O   . MET A 1 260 ? 30.415  16.449  20.357  1.00 32.23 ? 280 MET A O   1 
ATOM   1830 C CB  . MET A 1 260 ? 29.491  14.218  18.106  1.00 31.45 ? 280 MET A CB  1 
ATOM   1831 C CG  . MET A 1 260 ? 30.060  13.478  16.871  1.00 31.45 ? 280 MET A CG  1 
ATOM   1832 S SD  . MET A 1 260 ? 31.295  14.576  16.113  1.00 31.45 ? 280 MET A SD  1 
ATOM   1833 C CE  . MET A 1 260 ? 32.583  13.448  15.672  1.00 31.45 ? 280 MET A CE  1 
ATOM   1834 N N   . GLY A 1 261 ? 29.253  14.740  21.240  1.00 29.10 ? 281 GLY A N   1 
ATOM   1835 C CA  . GLY A 1 261 ? 28.726  15.533  22.338  1.00 29.10 ? 281 GLY A CA  1 
ATOM   1836 C C   . GLY A 1 261 ? 27.707  16.591  21.972  1.00 29.10 ? 281 GLY A C   1 
ATOM   1837 O O   . GLY A 1 261 ? 27.283  17.409  22.814  1.00 29.10 ? 281 GLY A O   1 
ATOM   1838 N N   . MET A 1 262 ? 27.217  16.608  20.760  1.00 26.37 ? 282 MET A N   1 
ATOM   1839 C CA  . MET A 1 262 ? 26.247  17.528  20.232  1.00 26.37 ? 282 MET A CA  1 
ATOM   1840 C C   . MET A 1 262 ? 25.547  16.817  19.085  1.00 26.37 ? 282 MET A C   1 
ATOM   1841 O O   . MET A 1 262 ? 26.133  15.901  18.472  1.00 26.37 ? 282 MET A O   1 
ATOM   1842 C CB  . MET A 1 262 ? 26.942  18.780  19.682  1.00 28.38 ? 282 MET A CB  1 
ATOM   1843 C CG  . MET A 1 262 ? 25.985  19.856  19.158  1.00 28.38 ? 282 MET A CG  1 
ATOM   1844 S SD  . MET A 1 262 ? 24.711  20.183  20.427  1.00 28.38 ? 282 MET A SD  1 
ATOM   1845 C CE  . MET A 1 262 ? 23.353  20.566  19.378  1.00 28.38 ? 282 MET A CE  1 
ATOM   1846 N N   . TYR A 1 263 ? 24.328  17.211  18.838  1.00 22.98 ? 283 TYR A N   1 
ATOM   1847 C CA  . TYR A 1 263 ? 23.551  16.630  17.747  1.00 22.98 ? 283 TYR A CA  1 
ATOM   1848 C C   . TYR A 1 263 ? 24.136  17.018  16.406  1.00 22.98 ? 283 TYR A C   1 
ATOM   1849 O O   . TYR A 1 263 ? 24.522  18.172  16.242  1.00 22.98 ? 283 TYR A O   1 
ATOM   1850 C CB  . TYR A 1 263 ? 22.112  17.134  17.830  1.00 19.05 ? 283 TYR A CB  1 
ATOM   1851 C CG  . TYR A 1 263 ? 21.223  16.361  18.779  1.00 19.05 ? 283 TYR A CG  1 
ATOM   1852 C CD1 . TYR A 1 263 ? 21.120  16.728  20.106  1.00 19.05 ? 283 TYR A CD1 1 
ATOM   1853 C CD2 . TYR A 1 263 ? 20.483  15.285  18.334  1.00 19.05 ? 283 TYR A CD2 1 
ATOM   1854 C CE1 . TYR A 1 263 ? 20.288  16.031  21.008  1.00 19.05 ? 283 TYR A CE1 1 
ATOM   1855 C CE2 . TYR A 1 263 ? 19.658  14.572  19.213  1.00 19.05 ? 283 TYR A CE2 1 
ATOM   1856 C CZ  . TYR A 1 263 ? 19.569  14.957  20.544  1.00 19.05 ? 283 TYR A CZ  1 
ATOM   1857 O OH  . TYR A 1 263 ? 18.758  14.256  21.403  1.00 19.05 ? 283 TYR A OH  1 
ATOM   1858 N N   . LEU A 1 264 ? 24.228  16.112  15.464  1.00 23.55 ? 284 LEU A N   1 
ATOM   1859 C CA  . LEU A 1 264 ? 24.707  16.370  14.107  1.00 23.55 ? 284 LEU A CA  1 
ATOM   1860 C C   . LEU A 1 264 ? 24.349  15.058  13.359  1.00 23.55 ? 284 LEU A C   1 
ATOM   1861 O O   . LEU A 1 264 ? 24.128  14.062  14.031  1.00 23.55 ? 284 LEU A O   1 
ATOM   1862 C CB  . LEU A 1 264 ? 26.118  16.781  13.932  1.00 26.75 ? 284 LEU A CB  1 
ATOM   1863 C CG  . LEU A 1 264 ? 27.323  15.994  14.390  1.00 26.75 ? 284 LEU A CG  1 
ATOM   1864 C CD1 . LEU A 1 264 ? 27.448  14.637  13.747  1.00 26.75 ? 284 LEU A CD1 1 
ATOM   1865 C CD2 . LEU A 1 264 ? 28.583  16.793  14.010  1.00 26.75 ? 284 LEU A CD2 1 
ATOM   1866 N N   . SER A 1 265 ? 24.230  15.126  12.058  1.00 22.40 ? 285 SER A N   1 
ATOM   1867 C CA  . SER A 1 265 ? 23.871  13.956  11.288  1.00 22.40 ? 285 SER A CA  1 
ATOM   1868 C C   . SER A 1 265 ? 25.038  13.023  10.992  1.00 22.40 ? 285 SER A C   1 
ATOM   1869 O O   . SER A 1 265 ? 26.135  13.391  10.571  1.00 22.40 ? 285 SER A O   1 
ATOM   1870 C CB  . SER A 1 265 ? 23.247  14.343  9.939   1.00 21.67 ? 285 SER A CB  1 
ATOM   1871 O OG  . SER A 1 265 ? 21.985  14.921  10.095  1.00 21.67 ? 285 SER A OG  1 
ATOM   1872 N N   . TYR A 1 266 ? 24.744  11.751  11.234  1.00 20.03 ? 286 TYR A N   1 
ATOM   1873 C CA  . TYR A 1 266 ? 25.664  10.639  11.073  1.00 20.03 ? 286 TYR A CA  1 
ATOM   1874 C C   . TYR A 1 266 ? 24.770  9.417   11.143  1.00 20.03 ? 286 TYR A C   1 
ATOM   1875 O O   . TYR A 1 266 ? 23.855  9.385   11.982  1.00 20.03 ? 286 TYR A O   1 
ATOM   1876 C CB  . TYR A 1 266 ? 26.671  10.687  12.218  1.00 23.75 ? 286 TYR A CB  1 
ATOM   1877 C CG  . TYR A 1 266 ? 27.952  9.910   12.042  1.00 23.75 ? 286 TYR A CG  1 
ATOM   1878 C CD1 . TYR A 1 266 ? 28.005  8.523   12.126  1.00 23.75 ? 286 TYR A CD1 1 
ATOM   1879 C CD2 . TYR A 1 266 ? 29.148  10.573  11.794  1.00 23.75 ? 286 TYR A CD2 1 
ATOM   1880 C CE1 . TYR A 1 266 ? 29.199  7.832   11.953  1.00 23.75 ? 286 TYR A CE1 1 
ATOM   1881 C CE2 . TYR A 1 266 ? 30.355  9.906   11.599  1.00 23.75 ? 286 TYR A CE2 1 
ATOM   1882 C CZ  . TYR A 1 266 ? 30.361  8.522   11.690  1.00 23.75 ? 286 TYR A CZ  1 
ATOM   1883 O OH  . TYR A 1 266 ? 31.574  7.882   11.492  1.00 23.75 ? 286 TYR A OH  1 
ATOM   1884 N N   . PRO A 1 267 ? 24.983  8.453   10.273  1.00 18.02 ? 287 PRO A N   1 
ATOM   1885 C CA  . PRO A 1 267 ? 24.167  7.243   10.282  1.00 18.02 ? 287 PRO A CA  1 
ATOM   1886 C C   . PRO A 1 267 ? 24.061  6.576   11.626  1.00 18.02 ? 287 PRO A C   1 
ATOM   1887 O O   . PRO A 1 267 ? 25.051  6.499   12.395  1.00 18.02 ? 287 PRO A O   1 
ATOM   1888 C CB  . PRO A 1 267 ? 24.834  6.323   9.229   1.00 17.13 ? 287 PRO A CB  1 
ATOM   1889 C CG  . PRO A 1 267 ? 26.058  7.033   8.753   1.00 17.13 ? 287 PRO A CG  1 
ATOM   1890 C CD  . PRO A 1 267 ? 26.010  8.458   9.251   1.00 17.13 ? 287 PRO A CD  1 
ATOM   1891 N N   . ALA A 1 268 ? 22.912  6.043   12.003  1.00 16.45 ? 288 ALA A N   1 
ATOM   1892 C CA  . ALA A 1 268 ? 22.628  5.380   13.250  1.00 16.45 ? 288 ALA A CA  1 
ATOM   1893 C C   . ALA A 1 268 ? 21.614  4.285   13.013  1.00 16.45 ? 288 ALA A C   1 
ATOM   1894 O O   . ALA A 1 268 ? 21.098  4.148   11.882  1.00 16.45 ? 288 ALA A O   1 
ATOM   1895 C CB  . ALA A 1 268 ? 22.037  6.343   14.276  1.00 14.98 ? 288 ALA A CB  1 
ATOM   1896 N N   . ILE A 1 269 ? 21.403  3.440   14.035  1.00 16.21 ? 289 ILE A N   1 
ATOM   1897 C CA  . ILE A 1 269 ? 20.453  2.328   13.934  1.00 16.21 ? 289 ILE A CA  1 
ATOM   1898 C C   . ILE A 1 269 ? 19.204  2.702   14.686  1.00 16.21 ? 289 ILE A C   1 
ATOM   1899 O O   . ILE A 1 269 ? 19.250  3.066   15.849  1.00 16.21 ? 289 ILE A O   1 
ATOM   1900 C CB  . ILE A 1 269 ? 21.095  1.038   14.464  1.00 16.44 ? 289 ILE A CB  1 
ATOM   1901 C CG1 . ILE A 1 269 ? 22.442  0.839   13.740  1.00 16.44 ? 289 ILE A CG1 1 
ATOM   1902 C CG2 . ILE A 1 269 ? 20.184  -0.138  14.254  1.00 16.44 ? 289 ILE A CG2 1 
ATOM   1903 C CD1 . ILE A 1 269 ? 22.456  0.619   12.268  1.00 16.44 ? 289 ILE A CD1 1 
ATOM   1904 N N   . ILE A 1 270 ? 18.074  2.716   13.972  1.00 13.66 ? 290 ILE A N   1 
ATOM   1905 C CA  . ILE A 1 270 ? 16.789  3.189   14.481  1.00 13.66 ? 290 ILE A CA  1 
ATOM   1906 C C   . ILE A 1 270 ? 15.790  2.078   14.697  1.00 13.66 ? 290 ILE A C   1 
ATOM   1907 O O   . ILE A 1 270 ? 15.610  1.198   13.849  1.00 13.66 ? 290 ILE A O   1 
ATOM   1908 C CB  . ILE A 1 270 ? 16.149  4.228   13.487  1.00 12.41 ? 290 ILE A CB  1 
ATOM   1909 C CG1 . ILE A 1 270 ? 17.157  5.348   13.175  1.00 12.41 ? 290 ILE A CG1 1 
ATOM   1910 C CG2 . ILE A 1 270 ? 14.887  4.852   14.024  1.00 12.41 ? 290 ILE A CG2 1 
ATOM   1911 C CD1 . ILE A 1 270 ? 17.692  6.006   14.446  1.00 12.41 ? 290 ILE A CD1 1 
ATOM   1912 N N   . GLY A 1 271 ? 15.138  2.119   15.865  1.00 12.44 ? 291 GLY A N   1 
ATOM   1913 C CA  . GLY A 1 271 ? 14.139  1.071   16.170  1.00 12.44 ? 291 GLY A CA  1 
ATOM   1914 C C   . GLY A 1 271 ? 13.090  1.690   17.041  1.00 12.44 ? 291 GLY A C   1 
ATOM   1915 O O   . GLY A 1 271 ? 13.111  2.915   17.263  1.00 12.44 ? 291 GLY A O   1 
ATOM   1916 N N   . ARG A 1 272 ? 12.219  0.901   17.655  1.00 15.07 ? 292 ARG A N   1 
ATOM   1917 C CA  . ARG A 1 272 ? 11.141  1.456   18.504  1.00 15.07 ? 292 ARG A CA  1 
ATOM   1918 C C   . ARG A 1 272 ? 11.589  2.318   19.638  1.00 15.07 ? 292 ARG A C   1 
ATOM   1919 O O   . ARG A 1 272 ? 10.759  3.204   20.045  1.00 15.07 ? 292 ARG A O   1 
ATOM   1920 C CB  . ARG A 1 272 ? 10.271  0.335   19.013  1.00 14.56 ? 292 ARG A CB  1 
ATOM   1921 C CG  . ARG A 1 272 ? 8.843   0.749   19.363  1.00 14.56 ? 292 ARG A CG  1 
ATOM   1922 C CD  . ARG A 1 272 ? 7.982   -0.530  19.513  1.00 14.56 ? 292 ARG A CD  1 
ATOM   1923 N NE  . ARG A 1 272 ? 7.691   -1.112  18.231  1.00 14.56 ? 292 ARG A NE  1 
ATOM   1924 C CZ  . ARG A 1 272 ? 7.359   -2.331  17.908  1.00 14.56 ? 292 ARG A CZ  1 
ATOM   1925 N NH1 . ARG A 1 272 ? 7.369   -3.231  18.885  1.00 14.56 ? 292 ARG A NH1 1 
ATOM   1926 N NH2 . ARG A 1 272 ? 7.086   -2.746  16.687  1.00 14.56 ? 292 ARG A NH2 1 
ATOM   1927 N N   . ASP A 1 273 ? 12.789  2.226   20.159  1.00 19.74 ? 293 ASP A N   1 
ATOM   1928 C CA  . ASP A 1 273 ? 13.237  3.101   21.248  1.00 19.74 ? 293 ASP A CA  1 
ATOM   1929 C C   . ASP A 1 273 ? 14.151  4.219   20.782  1.00 19.74 ? 293 ASP A C   1 
ATOM   1930 O O   . ASP A 1 273 ? 14.771  4.841   21.642  1.00 19.74 ? 293 ASP A O   1 
ATOM   1931 C CB  . ASP A 1 273 ? 14.005  2.349   22.333  1.00 29.01 ? 293 ASP A CB  1 
ATOM   1932 C CG  . ASP A 1 273 ? 13.048  1.470   23.111  1.00 29.01 ? 293 ASP A CG  1 
ATOM   1933 O OD1 . ASP A 1 273 ? 12.036  1.975   23.662  1.00 29.01 ? 293 ASP A OD1 1 
ATOM   1934 O OD2 . ASP A 1 273 ? 13.308  0.235   23.121  1.00 29.01 ? 293 ASP A OD2 1 
ATOM   1935 N N   . GLY A 1 274 ? 14.161  4.442   19.469  1.00 18.24 ? 294 GLY A N   1 
ATOM   1936 C CA  . GLY A 1 274 ? 14.977  5.510   18.917  1.00 18.24 ? 294 GLY A CA  1 
ATOM   1937 C C   . GLY A 1 274 ? 16.323  4.971   18.470  1.00 18.24 ? 294 GLY A C   1 
ATOM   1938 O O   . GLY A 1 274 ? 16.378  3.928   17.815  1.00 18.24 ? 294 GLY A O   1 
ATOM   1939 N N   . VAL A 1 275 ? 17.373  5.704   18.797  1.00 20.07 ? 295 VAL A N   1 
ATOM   1940 C CA  . VAL A 1 275 ? 18.715  5.319   18.387  1.00 20.07 ? 295 VAL A CA  1 
ATOM   1941 C C   . VAL A 1 275 ? 19.165  4.130   19.213  1.00 20.07 ? 295 VAL A C   1 
ATOM   1942 O O   . VAL A 1 275 ? 19.362  4.238   20.432  1.00 20.07 ? 295 VAL A O   1 
ATOM   1943 C CB  . VAL A 1 275 ? 19.701  6.480   18.542  1.00 18.43 ? 295 VAL A CB  1 
ATOM   1944 C CG1 . VAL A 1 275 ? 21.016  6.148   17.903  1.00 18.43 ? 295 VAL A CG1 1 
ATOM   1945 C CG2 . VAL A 1 275 ? 19.157  7.749   17.860  1.00 18.43 ? 295 VAL A CG2 1 
ATOM   1946 N N   . LEU A 1 276 ? 19.286  2.971   18.564  1.00 23.02 ? 296 LEU A N   1 
ATOM   1947 C CA  . LEU A 1 276 ? 19.701  1.757   19.253  1.00 23.02 ? 296 LEU A CA  1 
ATOM   1948 C C   . LEU A 1 276 ? 21.199  1.556   19.167  1.00 23.02 ? 296 LEU A C   1 
ATOM   1949 O O   . LEU A 1 276 ? 21.754  0.862   20.026  1.00 23.02 ? 296 LEU A O   1 
ATOM   1950 C CB  . LEU A 1 276 ? 19.067  0.488   18.673  1.00 19.35 ? 296 LEU A CB  1 
ATOM   1951 C CG  . LEU A 1 276 ? 17.565  0.651   18.396  1.00 19.35 ? 296 LEU A CG  1 
ATOM   1952 C CD1 . LEU A 1 276 ? 17.013  -0.608  17.742  1.00 19.35 ? 296 LEU A CD1 1 
ATOM   1953 C CD2 . LEU A 1 276 ? 16.803  0.975   19.654  1.00 19.35 ? 296 LEU A CD2 1 
ATOM   1954 N N   . ALA A 1 277 ? 21.834  2.147   18.135  1.00 26.33 ? 297 ALA A N   1 
ATOM   1955 C CA  . ALA A 1 277 ? 23.288  1.971   18.025  1.00 26.33 ? 297 ALA A CA  1 
ATOM   1956 C C   . ALA A 1 277 ? 23.891  2.988   17.100  1.00 26.33 ? 297 ALA A C   1 
ATOM   1957 O O   . ALA A 1 277 ? 23.171  3.462   16.200  1.00 26.33 ? 297 ALA A O   1 
ATOM   1958 C CB  . ALA A 1 277 ? 23.587  0.576   17.490  1.00 24.71 ? 297 ALA A CB  1 
ATOM   1959 N N   . GLU A 1 278 ? 25.161  3.303   17.257  1.00 29.22 ? 298 GLU A N   1 
ATOM   1960 C CA  . GLU A 1 278 ? 25.839  4.232   16.371  1.00 29.22 ? 298 GLU A CA  1 
ATOM   1961 C C   . GLU A 1 278 ? 26.573  3.431   15.302  1.00 29.22 ? 298 GLU A C   1 
ATOM   1962 O O   . GLU A 1 278 ? 26.846  2.247   15.530  1.00 29.22 ? 298 GLU A O   1 
ATOM   1963 C CB  . GLU A 1 278 ? 26.845  5.072   17.142  1.00 32.71 ? 298 GLU A CB  1 
ATOM   1964 C CG  . GLU A 1 278 ? 26.278  5.885   18.285  1.00 32.71 ? 298 GLU A CG  1 
ATOM   1965 C CD  . GLU A 1 278 ? 27.346  6.545   19.135  1.00 32.71 ? 298 GLU A CD  1 
ATOM   1966 O OE1 . GLU A 1 278 ? 28.581  6.322   18.896  1.00 32.71 ? 298 GLU A OE1 1 
ATOM   1967 O OE2 . GLU A 1 278 ? 26.953  7.306   20.065  1.00 32.71 ? 298 GLU A OE2 1 
ATOM   1968 N N   . THR A 1 279 ? 26.868  4.036   14.154  1.00 29.33 ? 299 THR A N   1 
ATOM   1969 C CA  . THR A 1 279 ? 27.622  3.331   13.129  1.00 29.33 ? 299 THR A CA  1 
ATOM   1970 C C   . THR A 1 279 ? 29.027  3.981   13.143  1.00 29.33 ? 299 THR A C   1 
ATOM   1971 O O   . THR A 1 279 ? 29.257  4.966   13.874  1.00 29.33 ? 299 THR A O   1 
ATOM   1972 C CB  . THR A 1 279 ? 27.070  3.372   11.714  1.00 29.96 ? 299 THR A CB  1 
ATOM   1973 O OG1 . THR A 1 279 ? 27.166  4.695   11.189  1.00 29.96 ? 299 THR A OG1 1 
ATOM   1974 C CG2 . THR A 1 279 ? 25.609  2.959   11.635  1.00 29.96 ? 299 THR A CG2 1 
ATOM   1975 N N   . THR A 1 280 ? 29.932  3.384   12.384  1.00 30.83 ? 300 THR A N   1 
ATOM   1976 C CA  . THR A 1 280 ? 31.293  3.883   12.292  1.00 30.83 ? 300 THR A CA  1 
ATOM   1977 C C   . THR A 1 280 ? 31.694  3.960   10.828  1.00 30.83 ? 300 THR A C   1 
ATOM   1978 O O   . THR A 1 280 ? 31.637  2.983   10.085  1.00 30.83 ? 300 THR A O   1 
ATOM   1979 C CB  . THR A 1 280 ? 32.284  2.968   13.023  1.00 31.98 ? 300 THR A CB  1 
ATOM   1980 O OG1 . THR A 1 280 ? 31.901  2.840   14.412  1.00 31.98 ? 300 THR A OG1 1 
ATOM   1981 C CG2 . THR A 1 280 ? 33.692  3.527   12.997  1.00 31.98 ? 300 THR A CG2 1 
ATOM   1982 N N   . LEU A 1 281 ? 32.057  5.162   10.432  1.00 33.78 ? 301 LEU A N   1 
ATOM   1983 C CA  . LEU A 1 281 ? 32.472  5.377   9.041   1.00 33.78 ? 301 LEU A CA  1 
ATOM   1984 C C   . LEU A 1 281 ? 33.971  5.617   8.981   1.00 33.78 ? 301 LEU A C   1 
ATOM   1985 O O   . LEU A 1 281 ? 34.561  6.257   9.880   1.00 33.78 ? 301 LEU A O   1 
ATOM   1986 C CB  . LEU A 1 281 ? 31.712  6.569   8.455   1.00 30.56 ? 301 LEU A CB  1 
ATOM   1987 C CG  . LEU A 1 281 ? 30.187  6.434   8.329   1.00 30.56 ? 301 LEU A CG  1 
ATOM   1988 C CD1 . LEU A 1 281 ? 29.576  7.726   7.810   1.00 30.56 ? 301 LEU A CD1 1 
ATOM   1989 C CD2 . LEU A 1 281 ? 29.818  5.298   7.383   1.00 30.56 ? 301 LEU A CD2 1 
ATOM   1990 N N   . ASP A 1 282 ? 34.581  5.115   7.911   1.00 39.75 ? 302 ASP A N   1 
ATOM   1991 C CA  . ASP A 1 282 ? 36.036  5.393   7.747   1.00 39.75 ? 302 ASP A CA  1 
ATOM   1992 C C   . ASP A 1 282 ? 36.106  6.584   6.786   1.00 39.75 ? 302 ASP A C   1 
ATOM   1993 O O   . ASP A 1 282 ? 36.182  6.500   5.560   1.00 39.75 ? 302 ASP A O   1 
ATOM   1994 C CB  . ASP A 1 282 ? 36.787  4.173   7.276   1.00 45.54 ? 302 ASP A CB  1 
ATOM   1995 C CG  . ASP A 1 282 ? 36.955  3.117   8.365   1.00 45.54 ? 302 ASP A CG  1 
ATOM   1996 O OD1 . ASP A 1 282 ? 37.090  3.476   9.578   1.00 45.54 ? 302 ASP A OD1 1 
ATOM   1997 O OD2 . ASP A 1 282 ? 36.940  1.886   8.002   1.00 45.54 ? 302 ASP A OD2 1 
ATOM   1998 N N   . LEU A 1 283 ? 36.004  7.764   7.415   1.00 38.49 ? 303 LEU A N   1 
ATOM   1999 C CA  . LEU A 1 283 ? 36.030  9.011   6.661   1.00 38.49 ? 303 LEU A CA  1 
ATOM   2000 C C   . LEU A 1 283 ? 37.440  9.481   6.373   1.00 38.49 ? 303 LEU A C   1 
ATOM   2001 O O   . LEU A 1 283 ? 38.337  9.327   7.195   1.00 38.49 ? 303 LEU A O   1 
ATOM   2002 C CB  . LEU A 1 283 ? 35.312  10.120  7.434   1.00 34.86 ? 303 LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 283 ? 33.879  9.821   7.859   1.00 34.86 ? 303 LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 283 ? 33.300  11.072  8.515   1.00 34.86 ? 303 LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 283 ? 33.020  9.408   6.676   1.00 34.86 ? 303 LEU A CD2 1 
ATOM   2006 N N   . THR A 1 284 ? 37.626  10.123  5.207   1.00 39.03 ? 304 THR A N   1 
ATOM   2007 C CA  . THR A 1 284 ? 39.011  10.632  5.004   1.00 39.03 ? 304 THR A CA  1 
ATOM   2008 C C   . THR A 1 284 ? 39.222  11.669  6.083   1.00 39.03 ? 304 THR A C   1 
ATOM   2009 O O   . THR A 1 284 ? 38.292  12.079  6.802   1.00 39.03 ? 304 THR A O   1 
ATOM   2010 C CB  . THR A 1 284 ? 39.159  11.176  3.605   1.00 38.32 ? 304 THR A CB  1 
ATOM   2011 O OG1 . THR A 1 284 ? 38.460  12.422  3.537   1.00 38.32 ? 304 THR A OG1 1 
ATOM   2012 C CG2 . THR A 1 284 ? 38.556  10.230  2.582   1.00 38.32 ? 304 THR A CG2 1 
ATOM   2013 N N   . THR A 1 285 ? 40.445  12.112  6.229   1.00 42.30 ? 305 THR A N   1 
ATOM   2014 C CA  . THR A 1 285 ? 40.828  13.111  7.251   1.00 42.30 ? 305 THR A CA  1 
ATOM   2015 C C   . THR A 1 285 ? 40.124  14.412  6.948   1.00 42.30 ? 305 THR A C   1 
ATOM   2016 O O   . THR A 1 285 ? 39.651  15.176  7.792   1.00 42.30 ? 305 THR A O   1 
ATOM   2017 C CB  . THR A 1 285 ? 42.348  13.263  7.204   1.00 44.92 ? 305 THR A CB  1 
ATOM   2018 O OG1 . THR A 1 285 ? 42.742  13.045  5.828   1.00 44.92 ? 305 THR A OG1 1 
ATOM   2019 C CG2 . THR A 1 285 ? 43.043  12.269  8.125   1.00 44.92 ? 305 THR A CG2 1 
ATOM   2020 N N   . ASP A 1 286 ? 40.003  14.678  5.667   1.00 42.89 ? 306 ASP A N   1 
ATOM   2021 C CA  . ASP A 1 286 ? 39.285  15.789  5.087   1.00 42.89 ? 306 ASP A CA  1 
ATOM   2022 C C   . ASP A 1 286 ? 37.831  15.799  5.553   1.00 42.89 ? 306 ASP A C   1 
ATOM   2023 O O   . ASP A 1 286 ? 37.288  16.801  6.001   1.00 42.89 ? 306 ASP A O   1 
ATOM   2024 C CB  . ASP A 1 286 ? 39.283  15.601  3.556   1.00 49.50 ? 306 ASP A CB  1 
ATOM   2025 C CG  . ASP A 1 286 ? 40.722  15.577  3.042   1.00 49.50 ? 306 ASP A CG  1 
ATOM   2026 O OD1 . ASP A 1 286 ? 41.180  16.742  2.756   1.00 49.50 ? 306 ASP A OD1 1 
ATOM   2027 O OD2 . ASP A 1 286 ? 41.348  14.489  2.912   1.00 49.50 ? 306 ASP A OD2 1 
ATOM   2028 N N   . GLU A 1 287 ? 37.206  14.604  5.446   1.00 38.99 ? 307 GLU A N   1 
ATOM   2029 C CA  . GLU A 1 287 ? 35.807  14.454  5.834   1.00 38.99 ? 307 GLU A CA  1 
ATOM   2030 C C   . GLU A 1 287 ? 35.667  14.523  7.332   1.00 38.99 ? 307 GLU A C   1 
ATOM   2031 O O   . GLU A 1 287 ? 34.731  15.158  7.833   1.00 38.99 ? 307 GLU A O   1 
ATOM   2032 C CB  . GLU A 1 287 ? 35.270  13.132  5.295   1.00 36.91 ? 307 GLU A CB  1 
ATOM   2033 C CG  . GLU A 1 287 ? 35.111  13.131  3.789   1.00 36.91 ? 307 GLU A CG  1 
ATOM   2034 C CD  . GLU A 1 287 ? 34.889  11.767  3.178   1.00 36.91 ? 307 GLU A CD  1 
ATOM   2035 O OE1 . GLU A 1 287 ? 35.097  10.718  3.844   1.00 36.91 ? 307 GLU A OE1 1 
ATOM   2036 O OE2 . GLU A 1 287 ? 34.513  11.698  1.969   1.00 36.91 ? 307 GLU A OE2 1 
ATOM   2037 N N   . GLN A 1 288 ? 36.601  13.961  8.105   1.00 40.28 ? 308 GLN A N   1 
ATOM   2038 C CA  . GLN A 1 288 ? 36.463  14.082  9.573   1.00 40.28 ? 308 GLN A CA  1 
ATOM   2039 C C   . GLN A 1 288 ? 36.563  15.551  9.966   1.00 40.28 ? 308 GLN A C   1 
ATOM   2040 O O   . GLN A 1 288 ? 35.811  16.040  10.813  1.00 40.28 ? 308 GLN A O   1 
ATOM   2041 C CB  . GLN A 1 288 ? 37.495  13.299  10.316  1.00 45.46 ? 308 GLN A CB  1 
ATOM   2042 C CG  . GLN A 1 288 ? 37.753  11.878  9.851   1.00 45.46 ? 308 GLN A CG  1 
ATOM   2043 C CD  . GLN A 1 288 ? 39.004  11.278  10.473  1.00 45.46 ? 308 GLN A CD  1 
ATOM   2044 O OE1 . GLN A 1 288 ? 39.661  11.949  11.303  1.00 45.46 ? 308 GLN A OE1 1 
ATOM   2045 N NE2 . GLN A 1 288 ? 39.373  10.055  10.066  1.00 45.46 ? 308 GLN A NE2 1 
ATOM   2046 N N   . GLU A 1 289 ? 37.503  16.253  9.327   1.00 39.24 ? 309 GLU A N   1 
ATOM   2047 C CA  . GLU A 1 289 ? 37.740  17.671  9.568   1.00 39.24 ? 309 GLU A CA  1 
ATOM   2048 C C   . GLU A 1 289 ? 36.467  18.494  9.412   1.00 39.24 ? 309 GLU A C   1 
ATOM   2049 O O   . GLU A 1 289 ? 36.106  19.311  10.262  1.00 39.24 ? 309 GLU A O   1 
ATOM   2050 N N   . LYS A 1 290 ? 35.771  18.276  8.292   1.00 37.69 ? 310 LYS A N   1 
ATOM   2051 C CA  . LYS A 1 290 ? 34.513  18.961  8.016   1.00 37.69 ? 310 LYS A CA  1 
ATOM   2052 C C   . LYS A 1 290 ? 33.450  18.589  9.048   1.00 37.69 ? 310 LYS A C   1 
ATOM   2053 O O   . LYS A 1 290 ? 32.718  19.485  9.527   1.00 37.69 ? 310 LYS A O   1 
ATOM   2054 C CB  . LYS A 1 290 ? 34.020  18.612  6.624   1.00 40.47 ? 310 LYS A CB  1 
ATOM   2055 C CG  . LYS A 1 290 ? 35.022  18.952  5.525   1.00 40.47 ? 310 LYS A CG  1 
ATOM   2056 C CD  . LYS A 1 290 ? 34.256  19.112  4.227   1.00 40.47 ? 310 LYS A CD  1 
ATOM   2057 C CE  . LYS A 1 290 ? 35.092  18.825  2.996   1.00 40.47 ? 310 LYS A CE  1 
ATOM   2058 N NZ  . LYS A 1 290 ? 34.174  18.475  1.838   1.00 40.47 ? 310 LYS A NZ  1 
ATOM   2059 N N   . LEU A 1 291 ? 33.409  17.302  9.418   1.00 35.00 ? 311 LEU A N   1 
ATOM   2060 C CA  . LEU A 1 291 ? 32.454  16.843  10.405  1.00 35.00 ? 311 LEU A CA  1 
ATOM   2061 C C   . LEU A 1 291 ? 32.627  17.590  11.702  1.00 35.00 ? 311 LEU A C   1 
ATOM   2062 O O   . LEU A 1 291 ? 31.609  18.044  12.234  1.00 35.00 ? 311 LEU A O   1 
ATOM   2063 C CB  . LEU A 1 291 ? 32.578  15.350  10.650  1.00 32.81 ? 311 LEU A CB  1 
ATOM   2064 C CG  . LEU A 1 291 ? 31.303  14.759  11.267  1.00 32.81 ? 311 LEU A CG  1 
ATOM   2065 C CD1 . LEU A 1 291 ? 30.119  14.786  10.325  1.00 32.81 ? 311 LEU A CD1 1 
ATOM   2066 C CD2 . LEU A 1 291 ? 31.601  13.329  11.666  1.00 32.81 ? 311 LEU A CD2 1 
ATOM   2067 N N   . LEU A 1 292 ? 33.832  17.801  12.216  1.00 35.82 ? 312 LEU A N   1 
ATOM   2068 C CA  . LEU A 1 292 ? 33.934  18.547  13.493  1.00 35.82 ? 312 LEU A CA  1 
ATOM   2069 C C   . LEU A 1 292 ? 33.640  20.018  13.310  1.00 35.82 ? 312 LEU A C   1 
ATOM   2070 O O   . LEU A 1 292 ? 33.215  20.696  14.257  1.00 35.82 ? 312 LEU A O   1 
ATOM   2071 C CB  . LEU A 1 292 ? 35.330  18.377  14.082  1.00 37.88 ? 312 LEU A CB  1 
ATOM   2072 C CG  . LEU A 1 292 ? 35.659  16.896  14.372  1.00 37.88 ? 312 LEU A CG  1 
ATOM   2073 C CD1 . LEU A 1 292 ? 37.170  16.729  14.376  1.00 37.88 ? 312 LEU A CD1 1 
ATOM   2074 C CD2 . LEU A 1 292 ? 35.032  16.467  15.675  1.00 37.88 ? 312 LEU A CD2 1 
ATOM   2075 N N   . GLN A 1 293 ? 33.801  20.547  12.089  1.00 35.99 ? 313 GLN A N   1 
ATOM   2076 C CA  . GLN A 1 293 ? 33.455  21.956  11.841  1.00 35.99 ? 313 GLN A CA  1 
ATOM   2077 C C   . GLN A 1 293 ? 31.959  22.107  12.091  1.00 35.99 ? 313 GLN A C   1 
ATOM   2078 O O   . GLN A 1 293 ? 31.527  22.972  12.857  1.00 35.99 ? 313 GLN A O   1 
ATOM   2079 C CB  . GLN A 1 293 ? 33.813  22.404  10.430  1.00 36.03 ? 313 GLN A CB  1 
ATOM   2080 N N   . SER A 1 294 ? 31.151  21.205  11.514  1.00 35.24 ? 314 SER A N   1 
ATOM   2081 C CA  . SER A 1 294 ? 29.703  21.233  11.695  1.00 35.24 ? 314 SER A CA  1 
ATOM   2082 C C   . SER A 1 294 ? 29.345  21.135  13.176  1.00 35.24 ? 314 SER A C   1 
ATOM   2083 O O   . SER A 1 294 ? 28.508  21.875  13.681  1.00 35.24 ? 314 SER A O   1 
ATOM   2084 C CB  . SER A 1 294 ? 29.025  20.087  10.966  1.00 33.08 ? 314 SER A CB  1 
ATOM   2085 O OG  . SER A 1 294 ? 29.135  20.120  9.574   1.00 33.08 ? 314 SER A OG  1 
ATOM   2086 N N   . ARG A 1 295 ? 29.997  20.239  13.907  1.00 39.28 ? 315 ARG A N   1 
ATOM   2087 C CA  . ARG A 1 295 ? 29.794  20.030  15.337  1.00 39.28 ? 315 ARG A CA  1 
ATOM   2088 C C   . ARG A 1 295 ? 29.987  21.321  16.124  1.00 39.28 ? 315 ARG A C   1 
ATOM   2089 O O   . ARG A 1 295 ? 29.208  21.721  16.984  1.00 39.28 ? 315 ARG A O   1 
ATOM   2090 C CB  . ARG A 1 295 ? 30.767  18.962  15.846  1.00 45.15 ? 315 ARG A CB  1 
ATOM   2091 C CG  . ARG A 1 295 ? 30.376  18.351  17.169  1.00 45.15 ? 315 ARG A CG  1 
ATOM   2092 C CD  . ARG A 1 295 ? 30.776  19.208  18.352  1.00 45.15 ? 315 ARG A CD  1 
ATOM   2093 N NE  . ARG A 1 295 ? 32.187  19.569  18.333  1.00 45.15 ? 315 ARG A NE  1 
ATOM   2094 C CZ  . ARG A 1 295 ? 33.178  18.684  18.449  1.00 45.15 ? 315 ARG A CZ  1 
ATOM   2095 N NH1 . ARG A 1 295 ? 32.885  17.380  18.622  1.00 45.15 ? 315 ARG A NH1 1 
ATOM   2096 N NH2 . ARG A 1 295 ? 34.447  19.046  18.413  1.00 45.15 ? 315 ARG A NH2 1 
ATOM   2097 N N   . ASP A 1 296 ? 31.082  22.008  15.788  1.00 42.04 ? 316 ASP A N   1 
ATOM   2098 C CA  . ASP A 1 296 ? 31.393  23.286  16.434  1.00 42.04 ? 316 ASP A CA  1 
ATOM   2099 C C   . ASP A 1 296 ? 30.344  24.330  16.098  1.00 42.04 ? 316 ASP A C   1 
ATOM   2100 O O   . ASP A 1 296 ? 29.865  25.013  17.024  1.00 42.04 ? 316 ASP A O   1 
ATOM   2101 C CB  . ASP A 1 296 ? 32.780  23.744  16.000  1.00 44.09 ? 316 ASP A CB  1 
ATOM   2102 C CG  . ASP A 1 296 ? 33.832  22.866  16.664  1.00 44.09 ? 316 ASP A CG  1 
ATOM   2103 O OD1 . ASP A 1 296 ? 33.592  22.418  17.820  1.00 44.09 ? 316 ASP A OD1 1 
ATOM   2104 O OD2 . ASP A 1 296 ? 34.878  22.634  16.013  1.00 44.09 ? 316 ASP A OD2 1 
ATOM   2105 N N   . TYR A 1 297 ? 29.944  24.447  14.825  1.00 42.66 ? 317 TYR A N   1 
ATOM   2106 C CA  . TYR A 1 297 ? 28.884  25.391  14.484  1.00 42.66 ? 317 TYR A CA  1 
ATOM   2107 C C   . TYR A 1 297 ? 27.621  25.184  15.288  1.00 42.66 ? 317 TYR A C   1 
ATOM   2108 O O   . TYR A 1 297 ? 27.147  26.106  15.953  1.00 42.66 ? 317 TYR A O   1 
ATOM   2109 C CB  . TYR A 1 297 ? 28.481  25.212  13.044  1.00 49.57 ? 317 TYR A CB  1 
ATOM   2110 C CG  . TYR A 1 297 ? 29.463  25.715  12.046  1.00 49.57 ? 317 TYR A CG  1 
ATOM   2111 C CD1 . TYR A 1 297 ? 29.927  27.014  12.134  1.00 49.57 ? 317 TYR A CD1 1 
ATOM   2112 C CD2 . TYR A 1 297 ? 29.914  24.922  11.014  1.00 49.57 ? 317 TYR A CD2 1 
ATOM   2113 C CE1 . TYR A 1 297 ? 30.820  27.516  11.215  1.00 49.57 ? 317 TYR A CE1 1 
ATOM   2114 C CE2 . TYR A 1 297 ? 30.816  25.400  10.079  1.00 49.57 ? 317 TYR A CE2 1 
ATOM   2115 C CZ  . TYR A 1 297 ? 31.264  26.710  10.188  1.00 49.57 ? 317 TYR A CZ  1 
ATOM   2116 O OH  . TYR A 1 297 ? 32.145  27.246  9.239   1.00 49.57 ? 317 TYR A OH  1 
ATOM   2117 N N   . ILE A 1 298 ? 27.096  23.946  15.262  1.00 38.40 ? 318 ILE A N   1 
ATOM   2118 C CA  . ILE A 1 298 ? 25.862  23.631  15.971  1.00 38.40 ? 318 ILE A CA  1 
ATOM   2119 C C   . ILE A 1 298 ? 25.987  23.934  17.440  1.00 38.40 ? 318 ILE A C   1 
ATOM   2120 O O   . ILE A 1 298 ? 25.140  24.587  18.037  1.00 38.40 ? 318 ILE A O   1 
ATOM   2121 C CB  . ILE A 1 298 ? 25.506  22.145  15.789  1.00 35.54 ? 318 ILE A CB  1 
ATOM   2122 C CG1 . ILE A 1 298 ? 25.473  21.824  14.317  1.00 35.54 ? 318 ILE A CG1 1 
ATOM   2123 C CG2 . ILE A 1 298 ? 24.159  21.874  16.419  1.00 35.54 ? 318 ILE A CG2 1 
ATOM   2124 C CD1 . ILE A 1 298 ? 25.401  20.388  13.917  1.00 35.54 ? 318 ILE A CD1 1 
ATOM   2125 N N   . GLN A 1 299 ? 27.083  23.457  17.986  1.00 41.32 ? 319 GLN A N   1 
ATOM   2126 C CA  . GLN A 1 299 ? 27.381  23.610  19.413  1.00 41.32 ? 319 GLN A CA  1 
ATOM   2127 C C   . GLN A 1 299 ? 27.331  25.058  19.866  1.00 41.32 ? 319 GLN A C   1 
ATOM   2128 O O   . GLN A 1 299 ? 26.700  25.385  20.880  1.00 41.32 ? 319 GLN A O   1 
ATOM   2129 C CB  . GLN A 1 299 ? 28.761  23.007  19.662  1.00 43.77 ? 319 GLN A CB  1 
ATOM   2130 C CG  . GLN A 1 299 ? 29.206  22.878  21.078  1.00 43.77 ? 319 GLN A CG  1 
ATOM   2131 C CD  . GLN A 1 299 ? 28.246  22.245  22.043  1.00 43.77 ? 319 GLN A CD  1 
ATOM   2132 O OE1 . GLN A 1 299 ? 28.170  20.998  22.118  1.00 43.77 ? 319 GLN A OE1 1 
ATOM   2133 N NE2 . GLN A 1 299 ? 27.512  23.038  22.843  1.00 43.77 ? 319 GLN A NE2 1 
ATOM   2134 N N   . GLN A 1 300 ? 27.941  25.969  19.156  1.00 45.09 ? 320 GLN A N   1 
ATOM   2135 C CA  . GLN A 1 300 ? 27.981  27.397  19.489  1.00 45.09 ? 320 GLN A CA  1 
ATOM   2136 C C   . GLN A 1 300 ? 26.631  28.082  19.432  1.00 45.09 ? 320 GLN A C   1 
ATOM   2137 O O   . GLN A 1 300 ? 26.215  28.835  20.329  1.00 45.09 ? 320 GLN A O   1 
ATOM   2138 C CB  . GLN A 1 300 ? 28.944  28.055  18.520  1.00 51.81 ? 320 GLN A CB  1 
ATOM   2139 C CG  . GLN A 1 300 ? 29.289  29.516  18.756  1.00 51.81 ? 320 GLN A CG  1 
ATOM   2140 C CD  . GLN A 1 300 ? 29.953  30.100  17.496  1.00 51.81 ? 320 GLN A CD  1 
ATOM   2141 O OE1 . GLN A 1 300 ? 29.851  29.509  16.394  1.00 51.81 ? 320 GLN A OE1 1 
ATOM   2142 N NE2 . GLN A 1 300 ? 30.623  31.240  17.648  1.00 51.81 ? 320 GLN A NE2 1 
ATOM   2143 N N   . ARG A 1 301 ? 25.876  27.811  18.360  1.00 44.11 ? 321 ARG A N   1 
ATOM   2144 C CA  . ARG A 1 301 ? 24.538  28.399  18.190  1.00 44.11 ? 321 ARG A CA  1 
ATOM   2145 C C   . ARG A 1 301 ? 23.677  27.852  19.325  1.00 44.11 ? 321 ARG A C   1 
ATOM   2146 O O   . ARG A 1 301 ? 22.984  28.575  20.018  1.00 44.11 ? 321 ARG A O   1 
ATOM   2147 C CB  . ARG A 1 301 ? 23.894  28.066  16.873  1.00 51.58 ? 321 ARG A CB  1 
ATOM   2148 C CG  . ARG A 1 301 ? 24.780  28.061  15.674  1.00 51.58 ? 321 ARG A CG  1 
ATOM   2149 C CD  . ARG A 1 301 ? 25.268  29.367  15.122  1.00 51.58 ? 321 ARG A CD  1 
ATOM   2150 N NE  . ARG A 1 301 ? 24.206  30.286  14.707  1.00 51.58 ? 321 ARG A NE  1 
ATOM   2151 C CZ  . ARG A 1 301 ? 23.614  31.183  15.492  1.00 51.58 ? 321 ARG A CZ  1 
ATOM   2152 N NH1 . ARG A 1 301 ? 24.009  31.325  16.767  1.00 51.58 ? 321 ARG A NH1 1 
ATOM   2153 N NH2 . ARG A 1 301 ? 22.624  31.927  15.032  1.00 51.58 ? 321 ARG A NH2 1 
ATOM   2154 N N   . PHE A 1 302 ? 23.805  26.534  19.575  1.00 43.18 ? 322 PHE A N   1 
ATOM   2155 C CA  . PHE A 1 302 ? 23.039  25.960  20.689  1.00 43.18 ? 322 PHE A CA  1 
ATOM   2156 C C   . PHE A 1 302 ? 23.415  26.681  21.971  1.00 43.18 ? 322 PHE A C   1 
ATOM   2157 O O   . PHE A 1 302 ? 22.569  27.078  22.768  1.00 43.18 ? 322 PHE A O   1 
ATOM   2158 C CB  . PHE A 1 302 ? 23.277  24.457  20.816  1.00 40.04 ? 322 PHE A CB  1 
ATOM   2159 C CG  . PHE A 1 302 ? 22.727  23.875  22.092  1.00 40.04 ? 322 PHE A CG  1 
ATOM   2160 C CD1 . PHE A 1 302 ? 21.390  23.531  22.190  1.00 40.04 ? 322 PHE A CD1 1 
ATOM   2161 C CD2 . PHE A 1 302 ? 23.535  23.688  23.203  1.00 40.04 ? 322 PHE A CD2 1 
ATOM   2162 C CE1 . PHE A 1 302 ? 20.875  23.006  23.369  1.00 40.04 ? 322 PHE A CE1 1 
ATOM   2163 C CE2 . PHE A 1 302 ? 23.010  23.180  24.384  1.00 40.04 ? 322 PHE A CE2 1 
ATOM   2164 C CZ  . PHE A 1 302 ? 21.683  22.817  24.464  1.00 40.04 ? 322 PHE A CZ  1 
ATOM   2165 N N   . ASP A 1 303 ? 24.717  26.828  22.182  1.00 48.92 ? 323 ASP A N   1 
ATOM   2166 C CA  . ASP A 1 303 ? 25.195  27.496  23.388  1.00 48.92 ? 323 ASP A CA  1 
ATOM   2167 C C   . ASP A 1 303 ? 24.578  28.869  23.551  1.00 48.92 ? 323 ASP A C   1 
ATOM   2168 O O   . ASP A 1 303 ? 24.038  29.195  24.623  1.00 48.92 ? 323 ASP A O   1 
ATOM   2169 C CB  . ASP A 1 303 ? 26.726  27.636  23.365  1.00 50.19 ? 323 ASP A CB  1 
ATOM   2170 C CG  . ASP A 1 303 ? 27.411  26.344  23.795  1.00 50.19 ? 323 ASP A CG  1 
ATOM   2171 O OD1 . ASP A 1 303 ? 26.871  25.584  24.638  1.00 50.19 ? 323 ASP A OD1 1 
ATOM   2172 O OD2 . ASP A 1 303 ? 28.524  26.133  23.252  1.00 50.19 ? 323 ASP A OD2 1 
ATOM   2173 N N   . GLU A 1 304 ? 24.619  29.677  22.494  1.00 54.55 ? 324 GLU A N   1 
ATOM   2174 C CA  . GLU A 1 304 ? 24.020  30.993  22.637  1.00 54.55 ? 324 GLU A CA  1 
ATOM   2175 C C   . GLU A 1 304 ? 22.552  30.929  23.029  1.00 54.55 ? 324 GLU A C   1 
ATOM   2176 O O   . GLU A 1 304 ? 22.126  31.685  23.916  1.00 54.55 ? 324 GLU A O   1 
ATOM   2177 C CB  . GLU A 1 304 ? 24.142  31.721  21.308  1.00 60.00 ? 324 GLU A CB  1 
ATOM   2178 C CG  . GLU A 1 304 ? 25.531  31.845  20.710  1.00 60.00 ? 324 GLU A CG  1 
ATOM   2179 C CD  . GLU A 1 304 ? 25.456  32.496  19.332  1.00 60.00 ? 324 GLU A CD  1 
ATOM   2180 O OE1 . GLU A 1 304 ? 24.527  33.334  19.136  1.00 60.00 ? 324 GLU A OE1 1 
ATOM   2181 O OE2 . GLU A 1 304 ? 26.272  32.187  18.425  1.00 60.00 ? 324 GLU A OE2 1 
ATOM   2182 N N   . ILE A 1 305 ? 21.765  30.059  22.415  1.00 56.17 ? 325 ILE A N   1 
ATOM   2183 C CA  . ILE A 1 305 ? 20.321  30.048  22.709  1.00 56.17 ? 325 ILE A CA  1 
ATOM   2184 C C   . ILE A 1 305 ? 19.855  29.232  23.857  1.00 56.17 ? 325 ILE A C   1 
ATOM   2185 O O   . ILE A 1 305 ? 18.811  29.649  24.431  1.00 56.17 ? 325 ILE A O   1 
ATOM   2186 C CB  . ILE A 1 305 ? 19.614  29.647  21.369  1.00 56.81 ? 325 ILE A CB  1 
ATOM   2187 C CG1 . ILE A 1 305 ? 18.112  29.781  21.448  1.00 56.81 ? 325 ILE A CG1 1 
ATOM   2188 C CG2 . ILE A 1 305 ? 19.972  28.209  21.012  1.00 56.81 ? 325 ILE A CG2 1 
ATOM   2189 C CD1 . ILE A 1 305 ? 17.581  31.195  21.566  1.00 56.81 ? 325 ILE A CD1 1 
ATOM   2190 N N   . VAL A 1 306 ? 20.473  28.190  24.360  1.00 57.79 ? 326 VAL A N   1 
ATOM   2191 C CA  . VAL A 1 306 ? 19.918  27.405  25.471  1.00 57.79 ? 326 VAL A CA  1 
ATOM   2192 C C   . VAL A 1 306 ? 19.606  28.120  26.756  1.00 57.79 ? 326 VAL A C   1 
ATOM   2193 O O   . VAL A 1 306 ? 18.698  27.656  27.527  1.00 57.79 ? 326 VAL A O   1 
ATOM   2194 C CB  . VAL A 1 306 ? 20.888  26.218  25.743  1.00 57.45 ? 326 VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 306 ? 22.143  26.715  26.431  1.00 57.45 ? 326 VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 306 ? 20.164  25.165  26.565  1.00 57.45 ? 326 VAL A CG2 1 
ATOM   2197 N N   . ASP A 1 307 ? 20.248  29.222  27.090  1.00 60.83 ? 327 ASP A N   1 
ATOM   2198 C CA  . ASP A 1 307 ? 19.984  29.952  28.338  1.00 60.83 ? 327 ASP A CA  1 
ATOM   2199 C C   . ASP A 1 307 ? 18.712  30.776  28.292  1.00 60.83 ? 327 ASP A C   1 
ATOM   2200 O O   . ASP A 1 307 ? 17.997  30.992  29.277  1.00 60.83 ? 327 ASP A O   1 
ATOM   2201 C CB  . ASP A 1 307 ? 21.206  30.855  28.646  1.00 60.65 ? 327 ASP A CB  1 
ATOM   2202 N N   . THR A 1 308 ? 18.363  31.265  27.119  1.00 62.42 ? 328 THR A N   1 
ATOM   2203 C CA  . THR A 1 308 ? 17.238  32.076  26.717  1.00 62.42 ? 328 THR A CA  1 
ATOM   2204 C C   . THR A 1 308 ? 15.904  31.394  26.912  1.00 62.42 ? 328 THR A C   1 
ATOM   2205 O O   . THR A 1 308 ? 14.905  32.059  27.213  1.00 62.42 ? 328 THR A O   1 
ATOM   2206 C CB  . THR A 1 308 ? 17.432  32.413  25.208  1.00 62.26 ? 328 THR A CB  1 
ATOM   2207 O OG1 . THR A 1 308 ? 18.419  33.478  25.171  1.00 62.26 ? 328 THR A OG1 1 
ATOM   2208 C CG2 . THR A 1 308 ? 16.195  32.855  24.471  1.00 62.26 ? 328 THR A CG2 1 
ATOM   2209 N N   . LEU A 1 309 ? 15.832  30.076  26.751  1.00 63.38 ? 329 LEU A N   1 
ATOM   2210 C CA  . LEU A 1 309 ? 14.566  29.368  26.925  1.00 63.38 ? 329 LEU A CA  1 
ATOM   2211 C C   . LEU A 1 309 ? 14.041  29.731  28.317  1.00 63.38 ? 329 LEU A C   1 
ATOM   2212 O O   . LEU A 1 309 ? 14.869  29.442  29.236  1.00 63.38 ? 329 LEU A O   1 
ATOM   2213 C CB  . LEU A 1 309 ? 14.766  27.870  26.776  1.00 62.08 ? 329 LEU A CB  1 
ATOM   2214 C CG  . LEU A 1 309 ? 15.207  27.405  25.381  1.00 62.08 ? 329 LEU A CG  1 
ATOM   2215 C CD1 . LEU A 1 309 ? 15.700  25.985  25.409  1.00 62.08 ? 329 LEU A CD1 1 
ATOM   2216 C CD2 . LEU A 1 309 ? 14.022  27.536  24.430  1.00 62.08 ? 329 LEU A CD2 1 
ATOM   2217 O OXT . LEU A 1 309 ? 12.448  29.821  28.569  1.00 62.08 ? 329 LEU A OXT 1 
ATOM   2218 N N   . ALA B 1 1   ? -2.178  0.619   -18.319 1.00 20.84 ? 21  ALA B N   1 
ATOM   2219 C CA  . ALA B 1 1   ? -2.506  -0.283  -17.177 1.00 20.84 ? 21  ALA B CA  1 
ATOM   2220 C C   . ALA B 1 1   ? -1.390  -1.279  -16.985 1.00 20.84 ? 21  ALA B C   1 
ATOM   2221 O O   . ALA B 1 1   ? -0.484  -1.399  -17.825 1.00 20.84 ? 21  ALA B O   1 
ATOM   2222 C CB  . ALA B 1 1   ? -3.836  -0.938  -17.445 1.00 20.76 ? 21  ALA B CB  1 
ATOM   2223 N N   . ARG B 1 2   ? -1.385  -1.974  -15.842 1.00 18.98 ? 22  ARG B N   1 
ATOM   2224 C CA  . ARG B 1 2   ? -0.288  -2.950  -15.589 1.00 18.98 ? 22  ARG B CA  1 
ATOM   2225 C C   . ARG B 1 2   ? -0.868  -4.322  -15.808 1.00 18.98 ? 22  ARG B C   1 
ATOM   2226 O O   . ARG B 1 2   ? -2.013  -4.478  -15.426 1.00 18.98 ? 22  ARG B O   1 
ATOM   2227 C CB  . ARG B 1 2   ? 0.150   -2.749  -14.184 1.00 15.75 ? 22  ARG B CB  1 
ATOM   2228 C CG  . ARG B 1 2   ? 1.155   -1.694  -13.855 1.00 15.75 ? 22  ARG B CG  1 
ATOM   2229 C CD  . ARG B 1 2   ? 1.131   -1.328  -12.417 1.00 15.75 ? 22  ARG B CD  1 
ATOM   2230 N NE  . ARG B 1 2   ? 2.147   -0.384  -11.981 1.00 15.75 ? 22  ARG B NE  1 
ATOM   2231 C CZ  . ARG B 1 2   ? 2.205   -0.002  -10.703 1.00 15.75 ? 22  ARG B CZ  1 
ATOM   2232 N NH1 . ARG B 1 2   ? 1.407   -0.486  -9.770  1.00 15.75 ? 22  ARG B NH1 1 
ATOM   2233 N NH2 . ARG B 1 2   ? 3.098   0.918   -10.308 1.00 15.75 ? 22  ARG B NH2 1 
ATOM   2234 N N   . LYS B 1 3   ? -0.196  -5.231  -16.455 1.00 20.24 ? 23  LYS B N   1 
ATOM   2235 C CA  . LYS B 1 3   ? -0.700  -6.558  -16.722 1.00 20.24 ? 23  LYS B CA  1 
ATOM   2236 C C   . LYS B 1 3   ? 0.426   -7.545  -16.471 1.00 20.24 ? 23  LYS B C   1 
ATOM   2237 O O   . LYS B 1 3   ? 1.510   -7.404  -17.038 1.00 20.24 ? 23  LYS B O   1 
ATOM   2238 C CB  . LYS B 1 3   ? -1.187  -6.676  -18.171 1.00 22.17 ? 23  LYS B CB  1 
ATOM   2239 C CG  . LYS B 1 3   ? -1.461  -8.142  -18.511 1.00 22.17 ? 23  LYS B CG  1 
ATOM   2240 C CD  . LYS B 1 3   ? -2.023  -8.385  -19.862 1.00 22.17 ? 23  LYS B CD  1 
ATOM   2241 C CE  . LYS B 1 3   ? -3.442  -7.853  -19.983 1.00 22.17 ? 23  LYS B CE  1 
ATOM   2242 N NZ  . LYS B 1 3   ? -4.087  -8.477  -21.200 1.00 22.17 ? 23  LYS B NZ  1 
ATOM   2243 N N   . ILE B 1 4   ? 0.177   -8.515  -15.607 1.00 19.94 ? 24  ILE B N   1 
ATOM   2244 C CA  . ILE B 1 4   ? 1.196   -9.517  -15.281 1.00 19.94 ? 24  ILE B CA  1 
ATOM   2245 C C   . ILE B 1 4   ? 0.664   -10.891 -15.612 1.00 19.94 ? 24  ILE B C   1 
ATOM   2246 O O   . ILE B 1 4   ? -0.499  -11.220 -15.394 1.00 19.94 ? 24  ILE B O   1 
ATOM   2247 C CB  . ILE B 1 4   ? 1.594   -9.472  -13.804 1.00 19.35 ? 24  ILE B CB  1 
ATOM   2248 C CG1 . ILE B 1 4   ? 2.338   -8.171  -13.512 1.00 19.35 ? 24  ILE B CG1 1 
ATOM   2249 C CG2 . ILE B 1 4   ? 2.521   -10.631 -13.430 1.00 19.35 ? 24  ILE B CG2 1 
ATOM   2250 C CD1 . ILE B 1 4   ? 2.565   -7.891  -12.065 1.00 19.35 ? 24  ILE B CD1 1 
ATOM   2251 N N   . GLY B 1 5   ? 1.549   -11.709 -16.180 1.00 19.48 ? 25  GLY B N   1 
ATOM   2252 C CA  . GLY B 1 5   ? 1.150   -13.091 -16.495 1.00 19.48 ? 25  GLY B CA  1 
ATOM   2253 C C   . GLY B 1 5   ? 1.961   -14.030 -15.624 1.00 19.48 ? 25  GLY B C   1 
ATOM   2254 O O   . GLY B 1 5   ? 3.145   -13.772 -15.339 1.00 19.48 ? 25  GLY B O   1 
ATOM   2255 N N   . ILE B 1 6   ? 1.334   -15.081 -15.156 1.00 22.16 ? 26  ILE B N   1 
ATOM   2256 C CA  . ILE B 1 6   ? 2.047   -16.044 -14.318 1.00 22.16 ? 26  ILE B CA  1 
ATOM   2257 C C   . ILE B 1 6   ? 1.829   -17.408 -14.963 1.00 22.16 ? 26  ILE B C   1 
ATOM   2258 O O   . ILE B 1 6   ? 0.681   -17.780 -15.212 1.00 22.16 ? 26  ILE B O   1 
ATOM   2259 C CB  . ILE B 1 6   ? 1.570   -16.032 -12.873 1.00 21.06 ? 26  ILE B CB  1 
ATOM   2260 C CG1 . ILE B 1 6   ? 1.870   -14.684 -12.181 1.00 21.06 ? 26  ILE B CG1 1 
ATOM   2261 C CG2 . ILE B 1 6   ? 2.281   -17.098 -12.030 1.00 21.06 ? 26  ILE B CG2 1 
ATOM   2262 C CD1 . ILE B 1 6   ? 0.865   -14.315 -11.141 1.00 21.06 ? 26  ILE B CD1 1 
ATOM   2263 N N   . ILE B 1 7   ? 2.945   -18.072 -15.238 1.00 25.81 ? 27  ILE B N   1 
ATOM   2264 C CA  . ILE B 1 7   ? 2.916   -19.426 -15.826 1.00 25.81 ? 27  ILE B CA  1 
ATOM   2265 C C   . ILE B 1 7   ? 3.304   -20.460 -14.746 1.00 25.81 ? 27  ILE B C   1 
ATOM   2266 O O   . ILE B 1 7   ? 4.454   -20.494 -14.349 1.00 25.81 ? 27  ILE B O   1 
ATOM   2267 C CB  . ILE B 1 7   ? 3.841   -19.583 -17.036 1.00 27.48 ? 27  ILE B CB  1 
ATOM   2268 C CG1 . ILE B 1 7   ? 3.519   -18.567 -18.151 1.00 27.48 ? 27  ILE B CG1 1 
ATOM   2269 C CG2 . ILE B 1 7   ? 3.718   -21.011 -17.604 1.00 27.48 ? 27  ILE B CG2 1 
ATOM   2270 C CD1 . ILE B 1 7   ? 4.723   -18.319 -19.070 1.00 27.48 ? 27  ILE B CD1 1 
ATOM   2271 N N   . GLY B 1 8   ? 2.310   -21.218 -14.322 1.00 24.16 ? 28  GLY B N   1 
ATOM   2272 C CA  . GLY B 1 8   ? 2.530   -22.226 -13.302 1.00 24.16 ? 28  GLY B CA  1 
ATOM   2273 C C   . GLY B 1 8   ? 1.991   -21.724 -11.976 1.00 24.16 ? 28  GLY B C   1 
ATOM   2274 O O   . GLY B 1 8   ? 2.718   -21.048 -11.287 1.00 24.16 ? 28  GLY B O   1 
ATOM   2275 N N   . LEU B 1 9   ? 0.748   -22.041 -11.652 1.00 24.41 ? 29  LEU B N   1 
ATOM   2276 C CA  . LEU B 1 9   ? 0.191   -21.581 -10.376 1.00 24.41 ? 29  LEU B CA  1 
ATOM   2277 C C   . LEU B 1 9   ? 0.359   -22.611 -9.248  1.00 24.41 ? 29  LEU B C   1 
ATOM   2278 O O   . LEU B 1 9   ? -0.623  -23.053 -8.647  1.00 24.41 ? 29  LEU B O   1 
ATOM   2279 C CB  . LEU B 1 9   ? -1.290  -21.214 -10.546 1.00 24.73 ? 29  LEU B CB  1 
ATOM   2280 C CG  . LEU B 1 9   ? -1.616  -19.740 -10.727 1.00 24.73 ? 29  LEU B CG  1 
ATOM   2281 C CD1 . LEU B 1 9   ? -1.647  -18.980 -9.423  1.00 24.73 ? 29  LEU B CD1 1 
ATOM   2282 C CD2 . LEU B 1 9   ? -0.569  -19.061 -11.600 1.00 24.73 ? 29  LEU B CD2 1 
ATOM   2283 N N   . GLY B 1 10  ? 1.606   -22.925 -8.910  1.00 23.11 ? 30  GLY B N   1 
ATOM   2284 C CA  . GLY B 1 10  ? 1.895   -23.859 -7.836  1.00 23.11 ? 30  GLY B CA  1 
ATOM   2285 C C   . GLY B 1 10  ? 2.097   -23.108 -6.548  1.00 23.11 ? 30  GLY B C   1 
ATOM   2286 O O   . GLY B 1 10  ? 1.413   -22.129 -6.317  1.00 23.11 ? 30  GLY B O   1 
ATOM   2287 N N   . ASN B 1 11  ? 3.034   -23.512 -5.716  1.00 22.51 ? 31  ASN B N   1 
ATOM   2288 C CA  . ASN B 1 11  ? 3.309   -22.864 -4.450  1.00 22.51 ? 31  ASN B CA  1 
ATOM   2289 C C   . ASN B 1 11  ? 3.877   -21.483 -4.668  1.00 22.51 ? 31  ASN B C   1 
ATOM   2290 O O   . ASN B 1 11  ? 3.406   -20.517 -4.084  1.00 22.51 ? 31  ASN B O   1 
ATOM   2291 C CB  . ASN B 1 11  ? 4.314   -23.656 -3.621  1.00 23.50 ? 31  ASN B CB  1 
ATOM   2292 C CG  . ASN B 1 11  ? 3.681   -24.954 -3.114  1.00 23.50 ? 31  ASN B CG  1 
ATOM   2293 O OD1 . ASN B 1 11  ? 2.532   -24.974 -2.618  1.00 23.50 ? 31  ASN B OD1 1 
ATOM   2294 N ND2 . ASN B 1 11  ? 4.425   -26.028 -3.236  1.00 23.50 ? 31  ASN B ND2 1 
ATOM   2295 N N   . VAL B 1 12  ? 4.906   -21.405 -5.518  1.00 23.57 ? 32  VAL B N   1 
ATOM   2296 C CA  . VAL B 1 12  ? 5.522   -20.111 -5.821  1.00 23.57 ? 32  VAL B CA  1 
ATOM   2297 C C   . VAL B 1 12  ? 4.587   -19.259 -6.654  1.00 23.57 ? 32  VAL B C   1 
ATOM   2298 O O   . VAL B 1 12  ? 4.352   -18.085 -6.297  1.00 23.57 ? 32  VAL B O   1 
ATOM   2299 C CB  . VAL B 1 12  ? 6.862   -20.338 -6.522  1.00 22.91 ? 32  VAL B CB  1 
ATOM   2300 C CG1 . VAL B 1 12  ? 7.553   -19.031 -6.825  1.00 22.91 ? 32  VAL B CG1 1 
ATOM   2301 C CG2 . VAL B 1 12  ? 7.781   -21.145 -5.612  1.00 22.91 ? 32  VAL B CG2 1 
ATOM   2302 N N   . GLY B 1 13  ? 3.970   -19.818 -7.671  1.00 22.37 ? 33  GLY B N   1 
ATOM   2303 C CA  . GLY B 1 13  ? 3.036   -19.091 -8.516  1.00 22.37 ? 33  GLY B CA  1 
ATOM   2304 C C   . GLY B 1 13  ? 1.945   -18.372 -7.775  1.00 22.37 ? 33  GLY B C   1 
ATOM   2305 O O   . GLY B 1 13  ? 1.809   -17.141 -7.861  1.00 22.37 ? 33  GLY B O   1 
ATOM   2306 N N   . ALA B 1 14  ? 1.135   -19.083 -7.014  1.00 20.48 ? 34  ALA B N   1 
ATOM   2307 C CA  . ALA B 1 14  ? 0.045   -18.548 -6.215  1.00 20.48 ? 34  ALA B CA  1 
ATOM   2308 C C   . ALA B 1 14  ? 0.573   -17.571 -5.164  1.00 20.48 ? 34  ALA B C   1 
ATOM   2309 O O   . ALA B 1 14  ? -0.132  -16.597 -4.852  1.00 20.48 ? 34  ALA B O   1 
ATOM   2310 C CB  . ALA B 1 14  ? -0.699  -19.685 -5.548  1.00 20.76 ? 34  ALA B CB  1 
ATOM   2311 N N   . ALA B 1 15  ? 1.800   -17.747 -4.658  1.00 19.29 ? 35  ALA B N   1 
ATOM   2312 C CA  . ALA B 1 15  ? 2.379   -16.814 -3.681  1.00 19.29 ? 35  ALA B CA  1 
ATOM   2313 C C   . ALA B 1 15  ? 2.685   -15.489 -4.380  1.00 19.29 ? 35  ALA B C   1 
ATOM   2314 O O   . ALA B 1 15  ? 2.439   -14.411 -3.826  1.00 19.29 ? 35  ALA B O   1 
ATOM   2315 C CB  . ALA B 1 15  ? 3.631   -17.358 -3.045  1.00 17.97 ? 35  ALA B CB  1 
ATOM   2316 N N   . VAL B 1 16  ? 3.196   -15.555 -5.610  1.00 18.64 ? 36  VAL B N   1 
ATOM   2317 C CA  . VAL B 1 16  ? 3.494   -14.357 -6.398  1.00 18.64 ? 36  VAL B CA  1 
ATOM   2318 C C   . VAL B 1 16  ? 2.160   -13.664 -6.630  1.00 18.64 ? 36  VAL B C   1 
ATOM   2319 O O   . VAL B 1 16  ? 1.965   -12.479 -6.310  1.00 18.64 ? 36  VAL B O   1 
ATOM   2320 C CB  . VAL B 1 16  ? 4.207   -14.713 -7.705  1.00 18.42 ? 36  VAL B CB  1 
ATOM   2321 C CG1 . VAL B 1 16  ? 4.232   -13.534 -8.690  1.00 18.42 ? 36  VAL B CG1 1 
ATOM   2322 C CG2 . VAL B 1 16  ? 5.666   -15.125 -7.483  1.00 18.42 ? 36  VAL B CG2 1 
ATOM   2323 N N   . ALA B 1 17  ? 1.146   -14.407 -7.074  1.00 17.01 ? 37  ALA B N   1 
ATOM   2324 C CA  . ALA B 1 17  ? -0.179  -13.827 -7.296  1.00 17.01 ? 37  ALA B CA  1 
ATOM   2325 C C   . ALA B 1 17  ? -0.765  -13.179 -6.054  1.00 17.01 ? 37  ALA B C   1 
ATOM   2326 O O   . ALA B 1 17  ? -1.359  -12.099 -6.148  1.00 17.01 ? 37  ALA B O   1 
ATOM   2327 C CB  . ALA B 1 17  ? -1.196  -14.844 -7.762  1.00 15.11 ? 37  ALA B CB  1 
ATOM   2328 N N   . HIS B 1 18  ? -0.605  -13.821 -4.874  1.00 16.42 ? 38  HIS B N   1 
ATOM   2329 C CA  . HIS B 1 18  ? -1.185  -13.224 -3.682  1.00 16.42 ? 38  HIS B CA  1 
ATOM   2330 C C   . HIS B 1 18  ? -0.420  -11.999 -3.254  1.00 16.42 ? 38  HIS B C   1 
ATOM   2331 O O   . HIS B 1 18  ? -1.001  -11.021 -2.736  1.00 16.42 ? 38  HIS B O   1 
ATOM   2332 C CB  . HIS B 1 18  ? -1.239  -14.274 -2.544  1.00 17.30 ? 38  HIS B CB  1 
ATOM   2333 C CG  . HIS B 1 18  ? -2.109  -13.866 -1.394  1.00 17.30 ? 38  HIS B CG  1 
ATOM   2334 N ND1 . HIS B 1 18  ? -2.042  -14.478 -0.151  1.00 17.30 ? 38  HIS B ND1 1 
ATOM   2335 C CD2 . HIS B 1 18  ? -3.076  -12.930 -1.277  1.00 17.30 ? 38  HIS B CD2 1 
ATOM   2336 C CE1 . HIS B 1 18  ? -2.909  -13.918 0.671   1.00 17.30 ? 38  HIS B CE1 1 
ATOM   2337 N NE2 . HIS B 1 18  ? -3.550  -12.959 0.011   1.00 17.30 ? 38  HIS B NE2 1 
ATOM   2338 N N   . GLY B 1 19  ? 0.881   -11.970 -3.412  1.00 15.44 ? 39  GLY B N   1 
ATOM   2339 C CA  . GLY B 1 19  ? 1.668   -10.801 -3.024  1.00 15.44 ? 39  GLY B CA  1 
ATOM   2340 C C   . GLY B 1 19  ? 1.274   -9.593  -3.875  1.00 15.44 ? 39  GLY B C   1 
ATOM   2341 O O   . GLY B 1 19  ? 1.318   -8.453  -3.387  1.00 15.44 ? 39  GLY B O   1 
ATOM   2342 N N   . LEU B 1 20  ? 0.965   -9.789  -5.136  1.00 14.72 ? 40  LEU B N   1 
ATOM   2343 C CA  . LEU B 1 20  ? 0.593   -8.714  -6.048  1.00 14.72 ? 40  LEU B CA  1 
ATOM   2344 C C   . LEU B 1 20  ? -0.821  -8.254  -5.792  1.00 14.72 ? 40  LEU B C   1 
ATOM   2345 O O   . LEU B 1 20  ? -1.096  -7.060  -5.648  1.00 14.72 ? 40  LEU B O   1 
ATOM   2346 C CB  . LEU B 1 20  ? 0.704   -9.208  -7.514  1.00 11.77 ? 40  LEU B CB  1 
ATOM   2347 C CG  . LEU B 1 20  ? 2.095   -9.517  -8.006  1.00 11.77 ? 40  LEU B CG  1 
ATOM   2348 C CD1 . LEU B 1 20  ? 2.029   -10.273 -9.313  1.00 11.77 ? 40  LEU B CD1 1 
ATOM   2349 C CD2 . LEU B 1 20  ? 2.879   -8.231  -8.258  1.00 11.77 ? 40  LEU B CD2 1 
ATOM   2350 N N   . ILE B 1 21  ? -1.737  -9.206  -5.677  1.00 16.86 ? 41  ILE B N   1 
ATOM   2351 C CA  . ILE B 1 21  ? -3.160  -8.881  -5.451  1.00 16.86 ? 41  ILE B CA  1 
ATOM   2352 C C   . ILE B 1 21  ? -3.402  -8.267  -4.106  1.00 16.86 ? 41  ILE B C   1 
ATOM   2353 O O   . ILE B 1 21  ? -4.241  -7.345  -3.970  1.00 16.86 ? 41  ILE B O   1 
ATOM   2354 C CB  . ILE B 1 21  ? -3.999  -10.157 -5.677  1.00 14.76 ? 41  ILE B CB  1 
ATOM   2355 C CG1 . ILE B 1 21  ? -3.896  -10.583 -7.141  1.00 14.76 ? 41  ILE B CG1 1 
ATOM   2356 C CG2 . ILE B 1 21  ? -5.443  -9.947  -5.330  1.00 14.76 ? 41  ILE B CG2 1 
ATOM   2357 C CD1 . ILE B 1 21  ? -4.668  -11.795 -7.563  1.00 14.76 ? 41  ILE B CD1 1 
ATOM   2358 N N   . ALA B 1 22  ? -2.696  -8.696  -3.050  1.00 20.12 ? 42  ALA B N   1 
ATOM   2359 C CA  . ALA B 1 22  ? -2.854  -8.114  -1.723  1.00 20.12 ? 42  ALA B CA  1 
ATOM   2360 C C   . ALA B 1 22  ? -2.466  -6.630  -1.742  1.00 20.12 ? 42  ALA B C   1 
ATOM   2361 O O   . ALA B 1 22  ? -3.057  -5.817  -1.027  1.00 20.12 ? 42  ALA B O   1 
ATOM   2362 C CB  . ALA B 1 22  ? -1.958  -8.807  -0.694  1.00 19.43 ? 42  ALA B CB  1 
ATOM   2363 N N   . GLN B 1 23  ? -1.447  -6.277  -2.535  1.00 23.60 ? 43  GLN B N   1 
ATOM   2364 C CA  . GLN B 1 23  ? -0.993  -4.898  -2.655  1.00 23.60 ? 43  GLN B CA  1 
ATOM   2365 C C   . GLN B 1 23  ? -1.736  -4.148  -3.766  1.00 23.60 ? 43  GLN B C   1 
ATOM   2366 O O   . GLN B 1 23  ? -1.703  -2.930  -3.799  1.00 23.60 ? 43  GLN B O   1 
ATOM   2367 C CB  . GLN B 1 23  ? 0.481   -4.785  -2.961  1.00 27.84 ? 43  GLN B CB  1 
ATOM   2368 C CG  . GLN B 1 23  ? 1.419   -5.252  -1.896  1.00 27.84 ? 43  GLN B CG  1 
ATOM   2369 C CD  . GLN B 1 23  ? 2.856   -5.340  -2.340  1.00 27.84 ? 43  GLN B CD  1 
ATOM   2370 O OE1 . GLN B 1 23  ? 3.633   -4.482  -1.970  1.00 27.84 ? 43  GLN B OE1 1 
ATOM   2371 N NE2 . GLN B 1 23  ? 3.220   -6.380  -3.104  1.00 27.84 ? 43  GLN B NE2 1 
ATOM   2372 N N   . GLY B 1 24  ? -2.359  -4.893  -4.693  1.00 22.49 ? 44  GLY B N   1 
ATOM   2373 C CA  . GLY B 1 24  ? -3.109  -4.237  -5.777  1.00 22.49 ? 44  GLY B CA  1 
ATOM   2374 C C   . GLY B 1 24  ? -2.106  -3.675  -6.769  1.00 22.49 ? 44  GLY B C   1 
ATOM   2375 O O   . GLY B 1 24  ? -2.275  -2.622  -7.370  1.00 22.49 ? 44  GLY B O   1 
ATOM   2376 N N   . VAL B 1 25  ? -1.005  -4.408  -6.955  1.00 20.86 ? 45  VAL B N   1 
ATOM   2377 C CA  . VAL B 1 25  ? 0.061   -3.993  -7.831  1.00 20.86 ? 45  VAL B CA  1 
ATOM   2378 C C   . VAL B 1 25  ? -0.411  -3.903  -9.259  1.00 20.86 ? 45  VAL B C   1 
ATOM   2379 O O   . VAL B 1 25  ? -0.132  -2.839  -9.853  1.00 20.86 ? 45  VAL B O   1 
ATOM   2380 C CB  . VAL B 1 25  ? 1.251   -4.938  -7.723  1.00 20.38 ? 45  VAL B CB  1 
ATOM   2381 C CG1 . VAL B 1 25  ? 2.294   -4.654  -8.781  1.00 20.38 ? 45  VAL B CG1 1 
ATOM   2382 C CG2 . VAL B 1 25  ? 1.890   -4.757  -6.337  1.00 20.38 ? 45  VAL B CG2 1 
ATOM   2383 N N   . ALA B 1 26  ? -1.057  -4.877  -9.864  1.00 17.63 ? 46  ALA B N   1 
ATOM   2384 C CA  . ALA B 1 26  ? -1.469  -4.806  -11.255 1.00 17.63 ? 46  ALA B CA  1 
ATOM   2385 C C   . ALA B 1 26  ? -2.958  -4.712  -11.420 1.00 17.63 ? 46  ALA B C   1 
ATOM   2386 O O   . ALA B 1 26  ? -3.766  -4.850  -10.502 1.00 17.63 ? 46  ALA B O   1 
ATOM   2387 C CB  . ALA B 1 26  ? -0.970  -6.025  -12.018 1.00 16.41 ? 46  ALA B CB  1 
ATOM   2388 N N   . ASP B 1 27  ? -3.364  -4.410  -12.664 1.00 17.59 ? 47  ASP B N   1 
ATOM   2389 C CA  . ASP B 1 27  ? -4.774  -4.242  -12.993 1.00 17.59 ? 47  ASP B CA  1 
ATOM   2390 C C   . ASP B 1 27  ? -5.331  -5.496  -13.575 1.00 17.59 ? 47  ASP B C   1 
ATOM   2391 O O   . ASP B 1 27  ? -6.473  -5.872  -13.315 1.00 17.59 ? 47  ASP B O   1 
ATOM   2392 C CB  . ASP B 1 27  ? -4.950  -3.091  -14.012 1.00 17.24 ? 47  ASP B CB  1 
ATOM   2393 C CG  . ASP B 1 27  ? -4.439  -1.796  -13.439 1.00 17.24 ? 47  ASP B CG  1 
ATOM   2394 O OD1 . ASP B 1 27  ? -5.065  -1.246  -12.497 1.00 17.24 ? 47  ASP B OD1 1 
ATOM   2395 O OD2 . ASP B 1 27  ? -3.374  -1.315  -13.906 1.00 17.24 ? 47  ASP B OD2 1 
ATOM   2396 N N   . ASP B 1 28  ? -4.527  -6.158  -14.429 1.00 18.86 ? 48  ASP B N   1 
ATOM   2397 C CA  . ASP B 1 28  ? -4.934  -7.399  -15.091 1.00 18.86 ? 48  ASP B CA  1 
ATOM   2398 C C   . ASP B 1 28  ? -3.932  -8.507  -14.844 1.00 18.86 ? 48  ASP B C   1 
ATOM   2399 O O   . ASP B 1 28  ? -2.744  -8.257  -14.735 1.00 18.86 ? 48  ASP B O   1 
ATOM   2400 C CB  . ASP B 1 28  ? -5.032  -7.218  -16.607 1.00 22.66 ? 48  ASP B CB  1 
ATOM   2401 C CG  . ASP B 1 28  ? -5.961  -6.095  -17.011 1.00 22.66 ? 48  ASP B CG  1 
ATOM   2402 O OD1 . ASP B 1 28  ? -7.112  -6.038  -16.502 1.00 22.66 ? 48  ASP B OD1 1 
ATOM   2403 O OD2 . ASP B 1 28  ? -5.526  -5.240  -17.814 1.00 22.66 ? 48  ASP B OD2 1 
ATOM   2404 N N   . TYR B 1 29  ? -4.453  -9.732  -14.670 1.00 17.68 ? 49  TYR B N   1 
ATOM   2405 C CA  . TYR B 1 29  ? -3.621  -10.894 -14.412 1.00 17.68 ? 49  TYR B CA  1 
ATOM   2406 C C   . TYR B 1 29  ? -4.040  -12.003 -15.366 1.00 17.68 ? 49  TYR B C   1 
ATOM   2407 O O   . TYR B 1 29  ? -5.226  -12.122 -15.669 1.00 17.68 ? 49  TYR B O   1 
ATOM   2408 C CB  . TYR B 1 29  ? -3.810  -11.408 -12.980 1.00 16.35 ? 49  TYR B CB  1 
ATOM   2409 C CG  . TYR B 1 29  ? -3.365  -10.438 -11.899 1.00 16.35 ? 49  TYR B CG  1 
ATOM   2410 C CD1 . TYR B 1 29  ? -2.043  -10.408 -11.468 1.00 16.35 ? 49  TYR B CD1 1 
ATOM   2411 C CD2 . TYR B 1 29  ? -4.265  -9.542  -11.346 1.00 16.35 ? 49  TYR B CD2 1 
ATOM   2412 C CE1 . TYR B 1 29  ? -1.633  -9.532  -10.489 1.00 16.35 ? 49  TYR B CE1 1 
ATOM   2413 C CE2 . TYR B 1 29  ? -3.869  -8.624  -10.385 1.00 16.35 ? 49  TYR B CE2 1 
ATOM   2414 C CZ  . TYR B 1 29  ? -2.539  -8.661  -9.951  1.00 16.35 ? 49  TYR B CZ  1 
ATOM   2415 O OH  . TYR B 1 29  ? -2.178  -7.695  -8.999  1.00 16.35 ? 49  TYR B OH  1 
ATOM   2416 N N   . VAL B 1 30  ? -3.060  -12.719 -15.856 1.00 19.26 ? 50  VAL B N   1 
ATOM   2417 C CA  . VAL B 1 30  ? -3.260  -13.867 -16.721 1.00 19.26 ? 50  VAL B CA  1 
ATOM   2418 C C   . VAL B 1 30  ? -2.653  -15.081 -16.001 1.00 19.26 ? 50  VAL B C   1 
ATOM   2419 O O   . VAL B 1 30  ? -1.438  -15.083 -15.769 1.00 19.26 ? 50  VAL B O   1 
ATOM   2420 C CB  . VAL B 1 30  ? -2.571  -13.737 -18.090 1.00 19.67 ? 50  VAL B CB  1 
ATOM   2421 C CG1 . VAL B 1 30  ? -2.886  -14.957 -18.971 1.00 19.67 ? 50  VAL B CG1 1 
ATOM   2422 C CG2 . VAL B 1 30  ? -2.993  -12.481 -18.811 1.00 19.67 ? 50  VAL B CG2 1 
ATOM   2423 N N   . PHE B 1 31  ? -3.504  -16.022 -15.602 1.00 22.67 ? 51  PHE B N   1 
ATOM   2424 C CA  . PHE B 1 31  ? -2.977  -17.223 -14.897 1.00 22.67 ? 51  PHE B CA  1 
ATOM   2425 C C   . PHE B 1 31  ? -2.940  -18.382 -15.887 1.00 22.67 ? 51  PHE B C   1 
ATOM   2426 O O   . PHE B 1 31  ? -3.970  -18.718 -16.464 1.00 22.67 ? 51  PHE B O   1 
ATOM   2427 C CB  . PHE B 1 31  ? -3.816  -17.604 -13.696 1.00 20.24 ? 51  PHE B CB  1 
ATOM   2428 C CG  . PHE B 1 31  ? -3.832  -16.702 -12.503 1.00 20.24 ? 51  PHE B CG  1 
ATOM   2429 C CD1 . PHE B 1 31  ? -2.882  -15.711 -12.308 1.00 20.24 ? 51  PHE B CD1 1 
ATOM   2430 C CD2 . PHE B 1 31  ? -4.792  -16.862 -11.506 1.00 20.24 ? 51  PHE B CD2 1 
ATOM   2431 C CE1 . PHE B 1 31  ? -2.924  -14.868 -11.218 1.00 20.24 ? 51  PHE B CE1 1 
ATOM   2432 C CE2 . PHE B 1 31  ? -4.826  -16.060 -10.395 1.00 20.24 ? 51  PHE B CE2 1 
ATOM   2433 C CZ  . PHE B 1 31  ? -3.903  -15.043 -10.251 1.00 20.24 ? 51  PHE B CZ  1 
ATOM   2434 N N   . ILE B 1 32  ? -1.757  -18.952 -16.098 1.00 27.32 ? 52  ILE B N   1 
ATOM   2435 C CA  . ILE B 1 32  ? -1.615  -20.104 -17.005 1.00 27.32 ? 52  ILE B CA  1 
ATOM   2436 C C   . ILE B 1 32  ? -1.001  -21.303 -16.279 1.00 27.32 ? 52  ILE B C   1 
ATOM   2437 O O   . ILE B 1 32  ? 0.095   -21.233 -15.696 1.00 27.32 ? 52  ILE B O   1 
ATOM   2438 C CB  . ILE B 1 32  ? -0.791  -19.731 -18.249 1.00 27.75 ? 52  ILE B CB  1 
ATOM   2439 C CG1 . ILE B 1 32  ? -1.664  -18.909 -19.229 1.00 27.75 ? 52  ILE B CG1 1 
ATOM   2440 C CG2 . ILE B 1 32  ? -0.274  -20.970 -18.979 1.00 27.75 ? 52  ILE B CG2 1 
ATOM   2441 C CD1 . ILE B 1 32  ? -0.937  -18.290 -20.370 1.00 27.75 ? 52  ILE B CD1 1 
ATOM   2442 N N   . ASP B 1 33  ? -1.716  -22.422 -16.324 1.00 31.68 ? 53  ASP B N   1 
ATOM   2443 C CA  . ASP B 1 33  ? -1.258  -23.652 -15.697 1.00 31.68 ? 53  ASP B CA  1 
ATOM   2444 C C   . ASP B 1 33  ? -1.776  -24.882 -16.427 1.00 31.68 ? 53  ASP B C   1 
ATOM   2445 O O   . ASP B 1 33  ? -2.953  -24.936 -16.804 1.00 31.68 ? 53  ASP B O   1 
ATOM   2446 C CB  . ASP B 1 33  ? -1.768  -23.748 -14.225 1.00 31.74 ? 53  ASP B CB  1 
ATOM   2447 C CG  . ASP B 1 33  ? -0.954  -24.766 -13.448 1.00 31.74 ? 53  ASP B CG  1 
ATOM   2448 O OD1 . ASP B 1 33  ? -1.233  -25.968 -13.648 1.00 31.74 ? 53  ASP B OD1 1 
ATOM   2449 O OD2 . ASP B 1 33  ? -0.076  -24.388 -12.669 1.00 31.74 ? 53  ASP B OD2 1 
ATOM   2450 N N   . ALA B 1 34  ? -0.895  -25.870 -16.596 1.00 34.05 ? 54  ALA B N   1 
ATOM   2451 C CA  . ALA B 1 34  ? -1.260  -27.140 -17.237 1.00 34.05 ? 54  ALA B CA  1 
ATOM   2452 C C   . ALA B 1 34  ? -2.393  -27.803 -16.461 1.00 34.05 ? 54  ALA B C   1 
ATOM   2453 O O   . ALA B 1 34  ? -3.381  -28.227 -17.045 1.00 34.05 ? 54  ALA B O   1 
ATOM   2454 C CB  . ALA B 1 34  ? -0.050  -28.043 -17.331 1.00 33.15 ? 54  ALA B CB  1 
ATOM   2455 N N   . ASN B 1 35  ? -2.321  -27.848 -15.152 1.00 37.50 ? 55  ASN B N   1 
ATOM   2456 C CA  . ASN B 1 35  ? -3.414  -28.420 -14.350 1.00 37.50 ? 55  ASN B CA  1 
ATOM   2457 C C   . ASN B 1 35  ? -4.520  -27.391 -14.334 1.00 37.50 ? 55  ASN B C   1 
ATOM   2458 O O   . ASN B 1 35  ? -4.543  -26.436 -13.547 1.00 37.50 ? 55  ASN B O   1 
ATOM   2459 C CB  . ASN B 1 35  ? -2.879  -28.731 -12.981 1.00 37.88 ? 55  ASN B CB  1 
ATOM   2460 C CG  . ASN B 1 35  ? -3.852  -29.210 -11.940 1.00 37.88 ? 55  ASN B CG  1 
ATOM   2461 O OD1 . ASN B 1 35  ? -5.005  -29.526 -12.185 1.00 37.88 ? 55  ASN B OD1 1 
ATOM   2462 N ND2 . ASN B 1 35  ? -3.368  -29.277 -10.687 1.00 37.88 ? 55  ASN B ND2 1 
ATOM   2463 N N   . GLU B 1 36  ? -5.492  -27.547 -15.208 1.00 40.66 ? 56  GLU B N   1 
ATOM   2464 C CA  . GLU B 1 36  ? -6.589  -26.606 -15.301 1.00 40.66 ? 56  GLU B CA  1 
ATOM   2465 C C   . GLU B 1 36  ? -7.437  -26.447 -14.079 1.00 40.66 ? 56  GLU B C   1 
ATOM   2466 O O   . GLU B 1 36  ? -7.903  -25.318 -13.800 1.00 40.66 ? 56  GLU B O   1 
ATOM   2467 C CB  . GLU B 1 36  ? -7.495  -27.064 -16.490 1.00 49.58 ? 56  GLU B CB  1 
ATOM   2468 C CG  . GLU B 1 36  ? -8.269  -25.858 -17.017 1.00 49.58 ? 56  GLU B CG  1 
ATOM   2469 C CD  . GLU B 1 36  ? -9.635  -26.288 -17.549 1.00 49.58 ? 56  GLU B CD  1 
ATOM   2470 O OE1 . GLU B 1 36  ? -10.543 -26.528 -16.697 1.00 49.58 ? 56  GLU B OE1 1 
ATOM   2471 O OE2 . GLU B 1 36  ? -9.768  -26.400 -18.799 1.00 49.58 ? 56  GLU B OE2 1 
ATOM   2472 N N   . ALA B 1 37  ? -7.698  -27.490 -13.307 1.00 37.67 ? 57  ALA B N   1 
ATOM   2473 C CA  . ALA B 1 37  ? -8.563  -27.375 -12.124 1.00 37.67 ? 57  ALA B CA  1 
ATOM   2474 C C   . ALA B 1 37  ? -7.905  -26.605 -10.980 1.00 37.67 ? 57  ALA B C   1 
ATOM   2475 O O   . ALA B 1 37  ? -8.666  -26.046 -10.185 1.00 37.67 ? 57  ALA B O   1 
ATOM   2476 C CB  . ALA B 1 37  ? -8.975  -28.734 -11.596 1.00 38.38 ? 57  ALA B CB  1 
ATOM   2477 N N   . LYS B 1 38  ? -6.593  -26.631 -10.924 1.00 34.92 ? 58  LYS B N   1 
ATOM   2478 C CA  . LYS B 1 38  ? -5.884  -25.902 -9.870  1.00 34.92 ? 58  LYS B CA  1 
ATOM   2479 C C   . LYS B 1 38  ? -5.887  -24.428 -10.235 1.00 34.92 ? 58  LYS B C   1 
ATOM   2480 O O   . LYS B 1 38  ? -6.118  -23.623 -9.339  1.00 34.92 ? 58  LYS B O   1 
ATOM   2481 C CB  . LYS B 1 38  ? -4.472  -26.387 -9.659  1.00 35.69 ? 58  LYS B CB  1 
ATOM   2482 C CG  . LYS B 1 38  ? -3.563  -25.465 -8.858  1.00 35.69 ? 58  LYS B CG  1 
ATOM   2483 C CD  . LYS B 1 38  ? -4.148  -25.164 -7.476  1.00 35.69 ? 58  LYS B CD  1 
ATOM   2484 C CE  . LYS B 1 38  ? -3.142  -24.663 -6.472  1.00 35.69 ? 58  LYS B CE  1 
ATOM   2485 N NZ  . LYS B 1 38  ? -2.414  -23.446 -6.831  1.00 35.69 ? 58  LYS B NZ  1 
ATOM   2486 N N   . VAL B 1 39  ? -5.674  -24.098 -11.525 1.00 32.52 ? 59  VAL B N   1 
ATOM   2487 C CA  . VAL B 1 39  ? -5.682  -22.658 -11.913 1.00 32.52 ? 59  VAL B CA  1 
ATOM   2488 C C   . VAL B 1 39  ? -7.068  -22.085 -11.791 1.00 32.52 ? 59  VAL B C   1 
ATOM   2489 O O   . VAL B 1 39  ? -7.276  -20.998 -11.213 1.00 32.52 ? 59  VAL B O   1 
ATOM   2490 C CB  . VAL B 1 39  ? -5.011  -22.503 -13.292 1.00 31.03 ? 59  VAL B CB  1 
ATOM   2491 C CG1 . VAL B 1 39  ? -5.913  -22.937 -14.431 1.00 31.03 ? 59  VAL B CG1 1 
ATOM   2492 C CG2 . VAL B 1 39  ? -4.601  -21.066 -13.452 1.00 31.03 ? 59  VAL B CG2 1 
ATOM   2493 N N   . LYS B 1 40  ? -8.105  -22.795 -12.224 1.00 30.80 ? 60  LYS B N   1 
ATOM   2494 C CA  . LYS B 1 40  ? -9.482  -22.351 -12.119 1.00 30.80 ? 60  LYS B CA  1 
ATOM   2495 C C   . LYS B 1 40  ? -9.891  -22.160 -10.672 1.00 30.80 ? 60  LYS B C   1 
ATOM   2496 O O   . LYS B 1 40  ? -10.645 -21.264 -10.312 1.00 30.80 ? 60  LYS B O   1 
ATOM   2497 C CB  . LYS B 1 40  ? -10.333 -23.392 -12.830 1.00 37.75 ? 60  LYS B CB  1 
ATOM   2498 C CG  . LYS B 1 40  ? -11.810 -23.138 -12.899 1.00 37.75 ? 60  LYS B CG  1 
ATOM   2499 C CD  . LYS B 1 40  ? -12.153 -21.883 -13.649 1.00 37.75 ? 60  LYS B CD  1 
ATOM   2500 C CE  . LYS B 1 40  ? -13.624 -21.484 -13.438 1.00 37.75 ? 60  LYS B CE  1 
ATOM   2501 N NZ  . LYS B 1 40  ? -13.795 -20.020 -13.824 1.00 37.75 ? 60  LYS B NZ  1 
ATOM   2502 N N   . ALA B 1 41  ? -9.396  -22.931 -9.712  1.00 26.67 ? 61  ALA B N   1 
ATOM   2503 C CA  . ALA B 1 41  ? -9.651  -22.854 -8.294  1.00 26.67 ? 61  ALA B CA  1 
ATOM   2504 C C   . ALA B 1 41  ? -9.068  -21.583 -7.701  1.00 26.67 ? 61  ALA B C   1 
ATOM   2505 O O   . ALA B 1 41  ? -9.763  -20.850 -6.986  1.00 26.67 ? 61  ALA B O   1 
ATOM   2506 C CB  . ALA B 1 41  ? -9.035  -24.075 -7.594  1.00 26.65 ? 61  ALA B CB  1 
ATOM   2507 N N   . ASP B 1 42  ? -7.821  -21.280 -8.014  1.00 25.56 ? 62  ASP B N   1 
ATOM   2508 C CA  . ASP B 1 42  ? -7.171  -20.052 -7.506  1.00 25.56 ? 62  ASP B CA  1 
ATOM   2509 C C   . ASP B 1 42  ? -7.844  -18.828 -8.080  1.00 25.56 ? 62  ASP B C   1 
ATOM   2510 O O   . ASP B 1 42  ? -8.086  -17.867 -7.353  1.00 25.56 ? 62  ASP B O   1 
ATOM   2511 C CB  . ASP B 1 42  ? -5.698  -20.049 -7.805  1.00 26.87 ? 62  ASP B CB  1 
ATOM   2512 C CG  . ASP B 1 42  ? -4.920  -21.040 -6.974  1.00 26.87 ? 62  ASP B CG  1 
ATOM   2513 O OD1 . ASP B 1 42  ? -5.209  -21.203 -5.773  1.00 26.87 ? 62  ASP B OD1 1 
ATOM   2514 O OD2 . ASP B 1 42  ? -3.952  -21.625 -7.530  1.00 26.87 ? 62  ASP B OD2 1 
ATOM   2515 N N   . GLN B 1 43  ? -8.245  -18.880 -9.341  1.00 24.84 ? 63  GLN B N   1 
ATOM   2516 C CA  . GLN B 1 43  ? -8.925  -17.761 -9.974  1.00 24.84 ? 63  GLN B CA  1 
ATOM   2517 C C   . GLN B 1 43  ? -10.138 -17.376 -9.163  1.00 24.84 ? 63  GLN B C   1 
ATOM   2518 O O   . GLN B 1 43  ? -10.257 -16.245 -8.711  1.00 24.84 ? 63  GLN B O   1 
ATOM   2519 C CB  . GLN B 1 43  ? -9.345  -18.120 -11.405 1.00 25.65 ? 63  GLN B CB  1 
ATOM   2520 C CG  . GLN B 1 43  ? -10.364 -17.102 -11.951 1.00 25.65 ? 63  GLN B CG  1 
ATOM   2521 C CD  . GLN B 1 43  ? -10.852 -17.468 -13.335 1.00 25.65 ? 63  GLN B CD  1 
ATOM   2522 O OE1 . GLN B 1 43  ? -11.399 -18.559 -13.538 1.00 25.65 ? 63  GLN B OE1 1 
ATOM   2523 N NE2 . GLN B 1 43  ? -10.661 -16.563 -14.271 1.00 25.65 ? 63  GLN B NE2 1 
ATOM   2524 N N   . ILE B 1 44  ? -11.042 -18.342 -8.954  1.00 22.39 ? 64  ILE B N   1 
ATOM   2525 C CA  . ILE B 1 44  ? -12.272 -18.100 -8.203  1.00 22.39 ? 64  ILE B CA  1 
ATOM   2526 C C   . ILE B 1 44  ? -11.984 -17.742 -6.766  1.00 22.39 ? 64  ILE B C   1 
ATOM   2527 O O   . ILE B 1 44  ? -12.653 -16.879 -6.179  1.00 22.39 ? 64  ILE B O   1 
ATOM   2528 C CB  . ILE B 1 44  ? -13.231 -19.321 -8.271  1.00 23.09 ? 64  ILE B CB  1 
ATOM   2529 C CG1 . ILE B 1 44  ? -13.762 -19.376 -9.702  1.00 23.09 ? 64  ILE B CG1 1 
ATOM   2530 C CG2 . ILE B 1 44  ? -14.401 -19.235 -7.338  1.00 23.09 ? 64  ILE B CG2 1 
ATOM   2531 C CD1 . ILE B 1 44  ? -14.776 -20.403 -10.016 1.00 23.09 ? 64  ILE B CD1 1 
ATOM   2532 N N   . ASP B 1 45  ? -10.950 -18.336 -6.195  1.00 21.27 ? 65  ASP B N   1 
ATOM   2533 C CA  . ASP B 1 45  ? -10.598 -18.033 -4.784  1.00 21.27 ? 65  ASP B CA  1 
ATOM   2534 C C   . ASP B 1 45  ? -10.190 -16.579 -4.645  1.00 21.27 ? 65  ASP B C   1 
ATOM   2535 O O   . ASP B 1 45  ? -10.595 -15.913 -3.673  1.00 21.27 ? 65  ASP B O   1 
ATOM   2536 C CB  . ASP B 1 45  ? -9.539  -19.000 -4.289  1.00 21.88 ? 65  ASP B CB  1 
ATOM   2537 C CG  . ASP B 1 45  ? -9.560  -19.217 -2.780  1.00 21.88 ? 65  ASP B CG  1 
ATOM   2538 O OD1 . ASP B 1 45  ? -10.541 -18.938 -2.048  1.00 21.88 ? 65  ASP B OD1 1 
ATOM   2539 O OD2 . ASP B 1 45  ? -8.479  -19.672 -2.307  1.00 21.88 ? 65  ASP B OD2 1 
ATOM   2540 N N   . PHE B 1 46  ? -9.433  -16.054 -5.602  1.00 19.92 ? 66  PHE B N   1 
ATOM   2541 C CA  . PHE B 1 46  ? -9.018  -14.646 -5.583  1.00 19.92 ? 66  PHE B CA  1 
ATOM   2542 C C   . PHE B 1 46  ? -10.185 -13.742 -5.940  1.00 19.92 ? 66  PHE B C   1 
ATOM   2543 O O   . PHE B 1 46  ? -10.352 -12.653 -5.347  1.00 19.92 ? 66  PHE B O   1 
ATOM   2544 C CB  . PHE B 1 46  ? -7.878  -14.466 -6.558  1.00 15.66 ? 66  PHE B CB  1 
ATOM   2545 C CG  . PHE B 1 46  ? -6.522  -14.820 -6.085  1.00 15.66 ? 66  PHE B CG  1 
ATOM   2546 C CD1 . PHE B 1 46  ? -6.017  -14.236 -4.926  1.00 15.66 ? 66  PHE B CD1 1 
ATOM   2547 C CD2 . PHE B 1 46  ? -5.729  -15.710 -6.793  1.00 15.66 ? 66  PHE B CD2 1 
ATOM   2548 C CE1 . PHE B 1 46  ? -4.739  -14.528 -4.488  1.00 15.66 ? 66  PHE B CE1 1 
ATOM   2549 C CE2 . PHE B 1 46  ? -4.442  -16.009 -6.355  1.00 15.66 ? 66  PHE B CE2 1 
ATOM   2550 C CZ  . PHE B 1 46  ? -3.956  -15.408 -5.209  1.00 15.66 ? 66  PHE B CZ  1 
ATOM   2551 N N   . GLN B 1 47  ? -11.097 -14.170 -6.803  1.00 21.40 ? 67  GLN B N   1 
ATOM   2552 C CA  . GLN B 1 47  ? -12.281 -13.391 -7.116  1.00 21.40 ? 67  GLN B CA  1 
ATOM   2553 C C   . GLN B 1 47  ? -13.235 -13.306 -5.948  1.00 21.40 ? 67  GLN B C   1 
ATOM   2554 O O   . GLN B 1 47  ? -14.028 -12.361 -5.782  1.00 21.40 ? 67  GLN B O   1 
ATOM   2555 C CB  . GLN B 1 47  ? -13.023 -14.021 -8.313  1.00 25.53 ? 67  GLN B CB  1 
ATOM   2556 C CG  . GLN B 1 47  ? -12.130 -14.035 -9.549  1.00 25.53 ? 67  GLN B CG  1 
ATOM   2557 C CD  . GLN B 1 47  ? -12.758 -14.583 -10.789 1.00 25.53 ? 67  GLN B CD  1 
ATOM   2558 O OE1 . GLN B 1 47  ? -12.570 -13.980 -11.904 1.00 25.53 ? 67  GLN B OE1 1 
ATOM   2559 N NE2 . GLN B 1 47  ? -13.509 -15.668 -10.756 1.00 25.53 ? 67  GLN B NE2 1 
ATOM   2560 N N   . ASP B 1 48  ? -13.182 -14.304 -5.051  1.00 21.05 ? 68  ASP B N   1 
ATOM   2561 C CA  . ASP B 1 48  ? -14.000 -14.330 -3.826  1.00 21.05 ? 68  ASP B CA  1 
ATOM   2562 C C   . ASP B 1 48  ? -13.410 -13.357 -2.826  1.00 21.05 ? 68  ASP B C   1 
ATOM   2563 O O   . ASP B 1 48  ? -14.089 -12.807 -1.967  1.00 21.05 ? 68  ASP B O   1 
ATOM   2564 C CB  . ASP B 1 48  ? -14.065 -15.717 -3.204  1.00 24.68 ? 68  ASP B CB  1 
ATOM   2565 C CG  . ASP B 1 48  ? -14.999 -16.641 -3.929  1.00 24.68 ? 68  ASP B CG  1 
ATOM   2566 O OD1 . ASP B 1 48  ? -15.902 -16.206 -4.671  1.00 24.68 ? 68  ASP B OD1 1 
ATOM   2567 O OD2 . ASP B 1 48  ? -14.845 -17.882 -3.750  1.00 24.68 ? 68  ASP B OD2 1 
ATOM   2568 N N   . ALA B 1 49  ? -12.111 -13.133 -2.921  1.00 16.59 ? 69  ALA B N   1 
ATOM   2569 C CA  . ALA B 1 49  ? -11.408 -12.199 -2.063  1.00 16.59 ? 69  ALA B CA  1 
ATOM   2570 C C   . ALA B 1 49  ? -11.692 -10.762 -2.451  1.00 16.59 ? 69  ALA B C   1 
ATOM   2571 O O   . ALA B 1 49  ? -11.712 -9.842  -1.632  1.00 16.59 ? 69  ALA B O   1 
ATOM   2572 C CB  . ALA B 1 49  ? -9.904  -12.393 -2.245  1.00 15.10 ? 69  ALA B CB  1 
ATOM   2573 N N   . MET B 1 50  ? -11.890 -10.532 -3.778  1.00 16.70 ? 70  MET B N   1 
ATOM   2574 C CA  . MET B 1 50  ? -12.105 -9.203  -4.328  1.00 16.70 ? 70  MET B CA  1 
ATOM   2575 C C   . MET B 1 50  ? -13.100 -8.356  -3.598  1.00 16.70 ? 70  MET B C   1 
ATOM   2576 O O   . MET B 1 50  ? -12.754 -7.193  -3.306  1.00 16.70 ? 70  MET B O   1 
ATOM   2577 C CB  . MET B 1 50  ? -12.595 -9.204  -5.798  1.00 17.47 ? 70  MET B CB  1 
ATOM   2578 C CG  . MET B 1 50  ? -11.506 -9.601  -6.755  1.00 17.47 ? 70  MET B CG  1 
ATOM   2579 S SD  . MET B 1 50  ? -10.113 -8.416  -6.671  1.00 17.47 ? 70  MET B SD  1 
ATOM   2580 C CE  . MET B 1 50  ? -8.825  -9.596  -7.211  1.00 17.47 ? 70  MET B CE  1 
ATOM   2581 N N   . ALA B 1 51  ? -14.273 -8.810  -3.179  1.00 14.99 ? 71  ALA B N   1 
ATOM   2582 C CA  . ALA B 1 51  ? -15.153 -7.862  -2.462  1.00 14.99 ? 71  ALA B CA  1 
ATOM   2583 C C   . ALA B 1 51  ? -14.595 -7.366  -1.155  1.00 14.99 ? 71  ALA B C   1 
ATOM   2584 O O   . ALA B 1 51  ? -15.083 -6.354  -0.646  1.00 14.99 ? 71  ALA B O   1 
ATOM   2585 C CB  . ALA B 1 51  ? -16.487 -8.524  -2.170  1.00 15.85 ? 71  ALA B CB  1 
ATOM   2586 N N   . ASN B 1 52  ? -13.597 -7.983  -0.556  1.00 15.27 ? 72  ASN B N   1 
ATOM   2587 C CA  . ASN B 1 52  ? -13.024 -7.556  0.722   1.00 15.27 ? 72  ASN B CA  1 
ATOM   2588 C C   . ASN B 1 52  ? -11.598 -7.048  0.626   1.00 15.27 ? 72  ASN B C   1 
ATOM   2589 O O   . ASN B 1 52  ? -10.950 -6.820  1.661   1.00 15.27 ? 72  ASN B O   1 
ATOM   2590 C CB  . ASN B 1 52  ? -13.068 -8.737  1.701   1.00 14.01 ? 72  ASN B CB  1 
ATOM   2591 C CG  . ASN B 1 52  ? -14.491 -9.049  2.097   1.00 14.01 ? 72  ASN B CG  1 
ATOM   2592 O OD1 . ASN B 1 52  ? -15.223 -8.122  2.467   1.00 14.01 ? 72  ASN B OD1 1 
ATOM   2593 N ND2 . ASN B 1 52  ? -14.874 -10.300 1.961   1.00 14.01 ? 72  ASN B ND2 1 
ATOM   2594 N N   . LEU B 1 53  ? -11.131 -6.842  -0.616  1.00 17.35 ? 73  LEU B N   1 
ATOM   2595 C CA  . LEU B 1 53  ? -9.819  -6.279  -0.892  1.00 17.35 ? 73  LEU B CA  1 
ATOM   2596 C C   . LEU B 1 53  ? -9.965  -4.773  -1.114  1.00 17.35 ? 73  LEU B C   1 
ATOM   2597 O O   . LEU B 1 53  ? -11.062 -4.309  -1.400  1.00 17.35 ? 73  LEU B O   1 
ATOM   2598 C CB  . LEU B 1 53  ? -9.218  -6.902  -2.146  1.00 17.50 ? 73  LEU B CB  1 
ATOM   2599 C CG  . LEU B 1 53  ? -8.567  -8.249  -2.017  1.00 17.50 ? 73  LEU B CG  1 
ATOM   2600 C CD1 . LEU B 1 53  ? -8.155  -8.821  -3.364  1.00 17.50 ? 73  LEU B CD1 1 
ATOM   2601 C CD2 . LEU B 1 53  ? -7.299  -8.158  -1.171  1.00 17.50 ? 73  LEU B CD2 1 
ATOM   2602 N N   . GLU B 1 54  ? -8.888  -4.007  -0.944  1.00 20.82 ? 74  GLU B N   1 
ATOM   2603 C CA  . GLU B 1 54  ? -8.938  -2.577  -1.140  1.00 20.82 ? 74  GLU B CA  1 
ATOM   2604 C C   . GLU B 1 54  ? -8.818  -2.155  -2.617  1.00 20.82 ? 74  GLU B C   1 
ATOM   2605 O O   . GLU B 1 54  ? -9.406  -1.116  -2.960  1.00 20.82 ? 74  GLU B O   1 
ATOM   2606 C CB  . GLU B 1 54  ? -7.809  -1.864  -0.422  1.00 27.35 ? 74  GLU B CB  1 
ATOM   2607 C CG  . GLU B 1 54  ? -8.038  -1.703  1.050   1.00 27.35 ? 74  GLU B CG  1 
ATOM   2608 C CD  . GLU B 1 54  ? -7.497  -2.891  1.818   1.00 27.35 ? 74  GLU B CD  1 
ATOM   2609 O OE1 . GLU B 1 54  ? -7.112  -3.949  1.215   1.00 27.35 ? 74  GLU B OE1 1 
ATOM   2610 O OE2 . GLU B 1 54  ? -7.412  -2.714  3.065   1.00 27.35 ? 74  GLU B OE2 1 
ATOM   2611 N N   . ALA B 1 55  ? -8.078  -2.855  -3.422  1.00 18.43 ? 75  ALA B N   1 
ATOM   2612 C CA  . ALA B 1 55  ? -7.858  -2.615  -4.803  1.00 18.43 ? 75  ALA B CA  1 
ATOM   2613 C C   . ALA B 1 55  ? -8.469  -3.695  -5.672  1.00 18.43 ? 75  ALA B C   1 
ATOM   2614 O O   . ALA B 1 55  ? -8.625  -4.835  -5.214  1.00 18.43 ? 75  ALA B O   1 
ATOM   2615 C CB  . ALA B 1 55  ? -6.359  -2.605  -5.101  1.00 17.37 ? 75  ALA B CB  1 
ATOM   2616 N N   . HIS B 1 56  ? -8.761  -3.353  -6.921  1.00 18.57 ? 76  HIS B N   1 
ATOM   2617 C CA  . HIS B 1 56  ? -9.343  -4.297  -7.852  1.00 18.57 ? 76  HIS B CA  1 
ATOM   2618 C C   . HIS B 1 56  ? -8.307  -4.889  -8.803  1.00 18.57 ? 76  HIS B C   1 
ATOM   2619 O O   . HIS B 1 56  ? -7.272  -4.252  -9.096  1.00 18.57 ? 76  HIS B O   1 
ATOM   2620 C CB  . HIS B 1 56  ? -10.440 -3.558  -8.628  1.00 18.65 ? 76  HIS B CB  1 
ATOM   2621 C CG  . HIS B 1 56  ? -11.101 -4.430  -9.641  1.00 18.65 ? 76  HIS B CG  1 
ATOM   2622 N ND1 . HIS B 1 56  ? -12.184 -5.244  -9.383  1.00 18.65 ? 76  HIS B ND1 1 
ATOM   2623 C CD2 . HIS B 1 56  ? -10.789 -4.641  -10.946 1.00 18.65 ? 76  HIS B CD2 1 
ATOM   2624 C CE1 . HIS B 1 56  ? -12.519 -5.910  -10.476 1.00 18.65 ? 76  HIS B CE1 1 
ATOM   2625 N NE2 . HIS B 1 56  ? -11.689 -5.562  -11.435 1.00 18.65 ? 76  HIS B NE2 1 
ATOM   2626 N N   . GLY B 1 57  ? -8.529  -6.091  -9.287  1.00 17.94 ? 77  GLY B N   1 
ATOM   2627 C CA  . GLY B 1 57  ? -7.626  -6.759  -10.208 1.00 17.94 ? 77  GLY B CA  1 
ATOM   2628 C C   . GLY B 1 57  ? -8.477  -7.661  -11.088 1.00 17.94 ? 77  GLY B C   1 
ATOM   2629 O O   . GLY B 1 57  ? -9.498  -8.146  -10.608 1.00 17.94 ? 77  GLY B O   1 
ATOM   2630 N N   . ASN B 1 58  ? -8.155  -7.859  -12.342 1.00 20.49 ? 78  ASN B N   1 
ATOM   2631 C CA  . ASN B 1 58  ? -8.945  -8.752  -13.210 1.00 20.49 ? 78  ASN B CA  1 
ATOM   2632 C C   . ASN B 1 58  ? -8.122  -9.995  -13.469 1.00 20.49 ? 78  ASN B C   1 
ATOM   2633 O O   . ASN B 1 58  ? -6.893  -9.916  -13.630 1.00 20.49 ? 78  ASN B O   1 
ATOM   2634 C CB  . ASN B 1 58  ? -9.284  -8.097  -14.517 1.00 21.22 ? 78  ASN B CB  1 
ATOM   2635 C CG  . ASN B 1 58  ? -9.983  -6.767  -14.355 1.00 21.22 ? 78  ASN B CG  1 
ATOM   2636 O OD1 . ASN B 1 58  ? -11.156 -6.753  -13.975 1.00 21.22 ? 78  ASN B OD1 1 
ATOM   2637 N ND2 . ASN B 1 58  ? -9.308  -5.658  -14.613 1.00 21.22 ? 78  ASN B ND2 1 
ATOM   2638 N N   . ILE B 1 59  ? -8.773  -11.174 -13.443 1.00 22.83 ? 79  ILE B N   1 
ATOM   2639 C CA  . ILE B 1 59  ? -8.037  -12.429 -13.642 1.00 22.83 ? 79  ILE B CA  1 
ATOM   2640 C C   . ILE B 1 59  ? -8.590  -13.270 -14.765 1.00 22.83 ? 79  ILE B C   1 
ATOM   2641 O O   . ILE B 1 59  ? -9.794  -13.577 -14.782 1.00 22.83 ? 79  ILE B O   1 
ATOM   2642 C CB  . ILE B 1 59  ? -8.053  -13.286 -12.319 1.00 22.32 ? 79  ILE B CB  1 
ATOM   2643 C CG1 . ILE B 1 59  ? -7.532  -12.535 -11.122 1.00 22.32 ? 79  ILE B CG1 1 
ATOM   2644 C CG2 . ILE B 1 59  ? -7.181  -14.536 -12.503 1.00 22.32 ? 79  ILE B CG2 1 
ATOM   2645 C CD1 . ILE B 1 59  ? -7.618  -13.168 -9.774  1.00 22.32 ? 79  ILE B CD1 1 
ATOM   2646 N N   . VAL B 1 60  ? -7.778  -13.664 -15.732 1.00 25.33 ? 80  VAL B N   1 
ATOM   2647 C CA  . VAL B 1 60  ? -8.229  -14.560 -16.801 1.00 25.33 ? 80  VAL B CA  1 
ATOM   2648 C C   . VAL B 1 60  ? -7.272  -15.752 -16.763 1.00 25.33 ? 80  VAL B C   1 
ATOM   2649 O O   . VAL B 1 60  ? -6.099  -15.555 -16.399 1.00 25.33 ? 80  VAL B O   1 
ATOM   2650 C CB  . VAL B 1 60  ? -8.239  -14.013 -18.217 1.00 25.23 ? 80  VAL B CB  1 
ATOM   2651 C CG1 . VAL B 1 60  ? -9.079  -12.735 -18.255 1.00 25.23 ? 80  VAL B CG1 1 
ATOM   2652 C CG2 . VAL B 1 60  ? -6.837  -13.744 -18.732 1.00 25.23 ? 80  VAL B CG2 1 
ATOM   2653 N N   . ILE B 1 61  ? -7.783  -16.934 -17.107 1.00 30.57 ? 81  ILE B N   1 
ATOM   2654 C CA  . ILE B 1 61  ? -6.873  -18.086 -17.039 1.00 30.57 ? 81  ILE B CA  1 
ATOM   2655 C C   . ILE B 1 61  ? -6.686  -18.749 -18.397 1.00 30.57 ? 81  ILE B C   1 
ATOM   2656 O O   . ILE B 1 61  ? -7.528  -18.708 -19.279 1.00 30.57 ? 81  ILE B O   1 
ATOM   2657 C CB  . ILE B 1 61  ? -7.395  -19.139 -16.062 1.00 31.17 ? 81  ILE B CB  1 
ATOM   2658 C CG1 . ILE B 1 61  ? -8.738  -19.711 -16.544 1.00 31.17 ? 81  ILE B CG1 1 
ATOM   2659 C CG2 . ILE B 1 61  ? -7.632  -18.575 -14.661 1.00 31.17 ? 81  ILE B CG2 1 
ATOM   2660 C CD1 . ILE B 1 61  ? -8.997  -21.119 -16.112 1.00 31.17 ? 81  ILE B CD1 1 
ATOM   2661 N N   . ASN B 1 62  ? -5.523  -19.370 -18.532 1.00 35.80 ? 82  ASN B N   1 
ATOM   2662 C CA  . ASN B 1 62  ? -5.112  -20.114 -19.707 1.00 35.80 ? 82  ASN B CA  1 
ATOM   2663 C C   . ASN B 1 62  ? -5.497  -19.535 -21.057 1.00 35.80 ? 82  ASN B C   1 
ATOM   2664 O O   . ASN B 1 62  ? -6.018  -20.198 -21.976 1.00 35.80 ? 82  ASN B O   1 
ATOM   2665 C CB  . ASN B 1 62  ? -5.679  -21.541 -19.572 1.00 35.98 ? 82  ASN B CB  1 
ATOM   2666 C CG  . ASN B 1 62  ? -5.016  -22.316 -18.455 1.00 35.98 ? 82  ASN B CG  1 
ATOM   2667 O OD1 . ASN B 1 62  ? -3.963  -21.962 -17.935 1.00 35.98 ? 82  ASN B OD1 1 
ATOM   2668 N ND2 . ASN B 1 62  ? -5.676  -23.392 -18.027 1.00 35.98 ? 82  ASN B ND2 1 
ATOM   2669 N N   . ASP B 1 63  ? -5.199  -18.275 -21.306 1.00 36.31 ? 83  ASP B N   1 
ATOM   2670 C CA  . ASP B 1 63  ? -5.419  -17.520 -22.496 1.00 36.31 ? 83  ASP B CA  1 
ATOM   2671 C C   . ASP B 1 63  ? -4.058  -16.958 -22.889 1.00 36.31 ? 83  ASP B C   1 
ATOM   2672 O O   . ASP B 1 63  ? -3.639  -15.902 -22.401 1.00 36.31 ? 83  ASP B O   1 
ATOM   2673 C CB  . ASP B 1 63  ? -6.400  -16.401 -22.231 1.00 39.22 ? 83  ASP B CB  1 
ATOM   2674 C CG  . ASP B 1 63  ? -6.918  -15.666 -23.430 1.00 39.22 ? 83  ASP B CG  1 
ATOM   2675 O OD1 . ASP B 1 63  ? -6.332  -15.718 -24.536 1.00 39.22 ? 83  ASP B OD1 1 
ATOM   2676 O OD2 . ASP B 1 63  ? -7.977  -14.972 -23.291 1.00 39.22 ? 83  ASP B OD2 1 
ATOM   2677 N N   . TRP B 1 64  ? -3.335  -17.662 -23.759 1.00 35.60 ? 84  TRP B N   1 
ATOM   2678 C CA  . TRP B 1 64  ? -2.003  -17.195 -24.169 1.00 35.60 ? 84  TRP B CA  1 
ATOM   2679 C C   . TRP B 1 64  ? -2.123  -15.873 -24.901 1.00 35.60 ? 84  TRP B C   1 
ATOM   2680 O O   . TRP B 1 64  ? -1.291  -14.955 -24.769 1.00 35.60 ? 84  TRP B O   1 
ATOM   2681 C CB  . TRP B 1 64  ? -1.305  -18.232 -25.040 1.00 35.84 ? 84  TRP B CB  1 
ATOM   2682 C CG  . TRP B 1 64  ? -0.793  -19.419 -24.301 1.00 35.84 ? 84  TRP B CG  1 
ATOM   2683 C CD1 . TRP B 1 64  ? -1.442  -20.609 -24.091 1.00 35.84 ? 84  TRP B CD1 1 
ATOM   2684 C CD2 . TRP B 1 64  ? 0.480   -19.552 -23.652 1.00 35.84 ? 84  TRP B CD2 1 
ATOM   2685 N NE1 . TRP B 1 64  ? -0.653  -21.466 -23.357 1.00 35.84 ? 84  TRP B NE1 1 
ATOM   2686 C CE2 . TRP B 1 64  ? 0.529   -20.844 -23.074 1.00 35.84 ? 84  TRP B CE2 1 
ATOM   2687 C CE3 . TRP B 1 64  ? 1.585   -18.705 -23.494 1.00 35.84 ? 84  TRP B CE3 1 
ATOM   2688 C CZ2 . TRP B 1 64  ? 1.629   -21.301 -22.355 1.00 35.84 ? 84  TRP B CZ2 1 
ATOM   2689 C CZ3 . TRP B 1 64  ? 2.679   -19.156 -22.783 1.00 35.84 ? 84  TRP B CZ3 1 
ATOM   2690 C CH2 . TRP B 1 64  ? 2.697   -20.444 -22.226 1.00 35.84 ? 84  TRP B CH2 1 
ATOM   2691 N N   . ALA B 1 65  ? -3.177  -15.638 -25.696 1.00 33.17 ? 85  ALA B N   1 
ATOM   2692 C CA  . ALA B 1 65  ? -3.330  -14.388 -26.436 1.00 33.17 ? 85  ALA B CA  1 
ATOM   2693 C C   . ALA B 1 65  ? -3.413  -13.185 -25.535 1.00 33.17 ? 85  ALA B C   1 
ATOM   2694 O O   . ALA B 1 65  ? -2.949  -12.090 -25.897 1.00 33.17 ? 85  ALA B O   1 
ATOM   2695 C CB  . ALA B 1 65  ? -4.593  -14.385 -27.320 1.00 32.85 ? 85  ALA B CB  1 
ATOM   2696 N N   . ALA B 1 66  ? -3.945  -13.350 -24.332 1.00 29.69 ? 86  ALA B N   1 
ATOM   2697 C CA  . ALA B 1 66  ? -4.040  -12.270 -23.365 1.00 29.69 ? 86  ALA B CA  1 
ATOM   2698 C C   . ALA B 1 66  ? -2.666  -11.809 -22.926 1.00 29.69 ? 86  ALA B C   1 
ATOM   2699 O O   . ALA B 1 66  ? -2.626  -10.697 -22.381 1.00 29.69 ? 86  ALA B O   1 
ATOM   2700 C CB  . ALA B 1 66  ? -4.837  -12.723 -22.156 1.00 29.00 ? 86  ALA B CB  1 
ATOM   2701 N N   . LEU B 1 67  ? -1.602  -12.530 -23.173 1.00 29.26 ? 87  LEU B N   1 
ATOM   2702 C CA  . LEU B 1 67  ? -0.245  -12.139 -22.836 1.00 29.26 ? 87  LEU B CA  1 
ATOM   2703 C C   . LEU B 1 67  ? 0.396   -11.176 -23.814 1.00 29.26 ? 87  LEU B C   1 
ATOM   2704 O O   . LEU B 1 67  ? 1.472   -10.632 -23.546 1.00 29.26 ? 87  LEU B O   1 
ATOM   2705 C CB  . LEU B 1 67  ? 0.610   -13.407 -22.753 1.00 28.61 ? 87  LEU B CB  1 
ATOM   2706 C CG  . LEU B 1 67  ? 0.368   -14.385 -21.582 1.00 28.61 ? 87  LEU B CG  1 
ATOM   2707 C CD1 . LEU B 1 67  ? 1.480   -15.451 -21.595 1.00 28.61 ? 87  LEU B CD1 1 
ATOM   2708 C CD2 . LEU B 1 67  ? 0.354   -13.695 -20.244 1.00 28.61 ? 87  LEU B CD2 1 
ATOM   2709 N N   . ALA B 1 68  ? -0.267  -10.912 -24.925 1.00 30.12 ? 88  ALA B N   1 
ATOM   2710 C CA  . ALA B 1 68  ? 0.228   -10.021 -25.968 1.00 30.12 ? 88  ALA B CA  1 
ATOM   2711 C C   . ALA B 1 68  ? 0.706   -8.700  -25.412 1.00 30.12 ? 88  ALA B C   1 
ATOM   2712 O O   . ALA B 1 68  ? 1.809   -8.255  -25.757 1.00 30.12 ? 88  ALA B O   1 
ATOM   2713 C CB  . ALA B 1 68  ? -0.877  -9.731  -26.986 1.00 30.04 ? 88  ALA B CB  1 
ATOM   2714 N N   . ASP B 1 69  ? -0.088  -8.062  -24.570 1.00 30.41 ? 89  ASP B N   1 
ATOM   2715 C CA  . ASP B 1 69  ? 0.319   -6.788  -23.975 1.00 30.41 ? 89  ASP B CA  1 
ATOM   2716 C C   . ASP B 1 69  ? 0.629   -6.888  -22.493 1.00 30.41 ? 89  ASP B C   1 
ATOM   2717 O O   . ASP B 1 69  ? 0.440   -5.912  -21.737 1.00 30.41 ? 89  ASP B O   1 
ATOM   2718 C CB  . ASP B 1 69  ? -0.773  -5.752  -24.236 1.00 32.86 ? 89  ASP B CB  1 
ATOM   2719 C CG  . ASP B 1 69  ? -2.064  -6.007  -23.526 1.00 32.86 ? 89  ASP B CG  1 
ATOM   2720 O OD1 . ASP B 1 69  ? -2.526  -7.175  -23.501 1.00 32.86 ? 89  ASP B OD1 1 
ATOM   2721 O OD2 . ASP B 1 69  ? -2.618  -5.022  -22.971 1.00 32.86 ? 89  ASP B OD2 1 
ATOM   2722 N N   . ALA B 1 70  ? 1.171   -8.027  -22.041 1.00 26.38 ? 90  ALA B N   1 
ATOM   2723 C CA  . ALA B 1 70  ? 1.538   -8.105  -20.612 1.00 26.38 ? 90  ALA B CA  1 
ATOM   2724 C C   . ALA B 1 70  ? 2.867   -7.376  -20.465 1.00 26.38 ? 90  ALA B C   1 
ATOM   2725 O O   . ALA B 1 70  ? 3.693   -7.457  -21.351 1.00 26.38 ? 90  ALA B O   1 
ATOM   2726 C CB  . ALA B 1 70  ? 1.649   -9.530  -20.139 1.00 26.48 ? 90  ALA B CB  1 
ATOM   2727 N N   . ASP B 1 71  ? 3.047   -6.675  -19.379 1.00 23.01 ? 91  ASP B N   1 
ATOM   2728 C CA  . ASP B 1 71  ? 4.269   -5.962  -19.070 1.00 23.01 ? 91  ASP B CA  1 
ATOM   2729 C C   . ASP B 1 71  ? 5.397   -6.910  -18.704 1.00 23.01 ? 91  ASP B C   1 
ATOM   2730 O O   . ASP B 1 71  ? 6.549   -6.726  -19.118 1.00 23.01 ? 91  ASP B O   1 
ATOM   2731 C CB  . ASP B 1 71  ? 4.066   -5.048  -17.856 1.00 22.73 ? 91  ASP B CB  1 
ATOM   2732 C CG  . ASP B 1 71  ? 3.182   -3.876  -18.140 1.00 22.73 ? 91  ASP B CG  1 
ATOM   2733 O OD1 . ASP B 1 71  ? 1.947   -4.000  -18.190 1.00 22.73 ? 91  ASP B OD1 1 
ATOM   2734 O OD2 . ASP B 1 71  ? 3.753   -2.777  -18.307 1.00 22.73 ? 91  ASP B OD2 1 
ATOM   2735 N N   . VAL B 1 72  ? 5.099   -7.867  -17.834 1.00 21.59 ? 92  VAL B N   1 
ATOM   2736 C CA  . VAL B 1 72  ? 6.028   -8.843  -17.336 1.00 21.59 ? 92  VAL B CA  1 
ATOM   2737 C C   . VAL B 1 72  ? 5.327   -10.179 -17.348 1.00 21.59 ? 92  VAL B C   1 
ATOM   2738 O O   . VAL B 1 72  ? 4.099   -10.267 -17.125 1.00 21.59 ? 92  VAL B O   1 
ATOM   2739 C CB  . VAL B 1 72  ? 6.419   -8.529  -15.880 1.00 19.53 ? 92  VAL B CB  1 
ATOM   2740 C CG1 . VAL B 1 72  ? 7.342   -9.595  -15.334 1.00 19.53 ? 92  VAL B CG1 1 
ATOM   2741 C CG2 . VAL B 1 72  ? 7.187   -7.240  -15.702 1.00 19.53 ? 92  VAL B CG2 1 
ATOM   2742 N N   . VAL B 1 73  ? 6.066   -11.252 -17.597 1.00 21.97 ? 93  VAL B N   1 
ATOM   2743 C CA  . VAL B 1 73  ? 5.515   -12.618 -17.537 1.00 21.97 ? 93  VAL B CA  1 
ATOM   2744 C C   . VAL B 1 73  ? 6.474   -13.367 -16.599 1.00 21.97 ? 93  VAL B C   1 
ATOM   2745 O O   . VAL B 1 73  ? 7.669   -13.256 -16.816 1.00 21.97 ? 93  VAL B O   1 
ATOM   2746 C CB  . VAL B 1 73  ? 5.394   -13.337 -18.856 1.00 22.71 ? 93  VAL B CB  1 
ATOM   2747 C CG1 . VAL B 1 73  ? 5.313   -14.848 -18.734 1.00 22.71 ? 93  VAL B CG1 1 
ATOM   2748 C CG2 . VAL B 1 73  ? 4.079   -12.890 -19.550 1.00 22.71 ? 93  VAL B CG2 1 
ATOM   2749 N N   . ILE B 1 74  ? 5.922   -14.002 -15.560 1.00 23.25 ? 94  ILE B N   1 
ATOM   2750 C CA  . ILE B 1 74  ? 6.778   -14.728 -14.587 1.00 23.25 ? 94  ILE B CA  1 
ATOM   2751 C C   . ILE B 1 74  ? 6.566   -16.235 -14.761 1.00 23.25 ? 94  ILE B C   1 
ATOM   2752 O O   . ILE B 1 74  ? 5.437   -16.712 -14.769 1.00 23.25 ? 94  ILE B O   1 
ATOM   2753 C CB  . ILE B 1 74  ? 6.480   -14.312 -13.144 1.00 21.55 ? 94  ILE B CB  1 
ATOM   2754 C CG1 . ILE B 1 74  ? 6.934   -12.867 -12.876 1.00 21.55 ? 94  ILE B CG1 1 
ATOM   2755 C CG2 . ILE B 1 74  ? 7.168   -15.234 -12.139 1.00 21.55 ? 94  ILE B CG2 1 
ATOM   2756 C CD1 . ILE B 1 74  ? 6.080   -12.144 -11.876 1.00 21.55 ? 94  ILE B CD1 1 
ATOM   2757 N N   . SER B 1 75  ? 7.647   -16.967 -14.943 1.00 26.10 ? 95  SER B N   1 
ATOM   2758 C CA  . SER B 1 75  ? 7.553   -18.425 -15.138 1.00 26.10 ? 95  SER B CA  1 
ATOM   2759 C C   . SER B 1 75  ? 7.900   -19.118 -13.813 1.00 26.10 ? 95  SER B C   1 
ATOM   2760 O O   . SER B 1 75  ? 9.031   -18.980 -13.309 1.00 26.10 ? 95  SER B O   1 
ATOM   2761 C CB  . SER B 1 75  ? 8.466   -18.847 -16.256 1.00 26.81 ? 95  SER B CB  1 
ATOM   2762 O OG  . SER B 1 75  ? 8.588   -20.265 -16.386 1.00 26.81 ? 95  SER B OG  1 
ATOM   2763 N N   . THR B 1 76  ? 6.918   -19.824 -13.247 1.00 29.84 ? 96  THR B N   1 
ATOM   2764 C CA  . THR B 1 76  ? 7.062   -20.545 -11.985 1.00 29.84 ? 96  THR B CA  1 
ATOM   2765 C C   . THR B 1 76  ? 6.603   -22.002 -12.136 1.00 29.84 ? 96  THR B C   1 
ATOM   2766 O O   . THR B 1 76  ? 6.126   -22.608 -11.176 1.00 29.84 ? 96  THR B O   1 
ATOM   2767 C CB  . THR B 1 76  ? 6.239   -19.920 -10.849 1.00 27.11 ? 96  THR B CB  1 
ATOM   2768 O OG1 . THR B 1 76  ? 4.939   -19.624 -11.353 1.00 27.11 ? 96  THR B OG1 1 
ATOM   2769 C CG2 . THR B 1 76  ? 6.867   -18.651 -10.351 1.00 27.11 ? 96  THR B CG2 1 
ATOM   2770 N N   . LEU B 1 77  ? 6.735   -22.538 -13.346 1.00 36.97 ? 97  LEU B N   1 
ATOM   2771 C CA  . LEU B 1 77  ? 6.337   -23.921 -13.636 1.00 36.97 ? 97  LEU B CA  1 
ATOM   2772 C C   . LEU B 1 77  ? 7.434   -24.872 -13.146 1.00 36.97 ? 97  LEU B C   1 
ATOM   2773 O O   . LEU B 1 77  ? 8.587   -24.452 -12.978 1.00 36.97 ? 97  LEU B O   1 
ATOM   2774 C CB  . LEU B 1 77  ? 6.026   -24.187 -15.094 1.00 36.24 ? 97  LEU B CB  1 
ATOM   2775 C CG  . LEU B 1 77  ? 7.078   -24.027 -16.172 1.00 36.24 ? 97  LEU B CG  1 
ATOM   2776 C CD1 . LEU B 1 77  ? 8.094   -25.152 -16.159 1.00 36.24 ? 97  LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 1 77  ? 6.451   -23.984 -17.569 1.00 36.24 ? 97  LEU B CD2 1 
ATOM   2778 N N   . GLY B 1 78  ? 7.050   -26.113 -12.910 1.00 41.82 ? 98  GLY B N   1 
ATOM   2779 C CA  . GLY B 1 78  ? 7.950   -27.146 -12.447 1.00 41.82 ? 98  GLY B CA  1 
ATOM   2780 C C   . GLY B 1 78  ? 7.204   -28.202 -11.630 1.00 41.82 ? 98  GLY B C   1 
ATOM   2781 O O   . GLY B 1 78  ? 5.987   -28.421 -11.685 1.00 41.82 ? 98  GLY B O   1 
ATOM   2782 N N   . ASN B 1 79  ? 8.022   -28.949 -10.879 1.00 46.44 ? 99  ASN B N   1 
ATOM   2783 C CA  . ASN B 1 79  ? 7.434   -30.029 -10.039 1.00 46.44 ? 99  ASN B CA  1 
ATOM   2784 C C   . ASN B 1 79  ? 8.233   -30.169 -8.772  1.00 46.44 ? 99  ASN B C   1 
ATOM   2785 O O   . ASN B 1 79  ? 9.269   -30.850 -8.712  1.00 46.44 ? 99  ASN B O   1 
ATOM   2786 C CB  . ASN B 1 79  ? 7.430   -31.312 -10.837 1.00 49.36 ? 99  ASN B CB  1 
ATOM   2787 C CG  . ASN B 1 79  ? 6.715   -32.428 -10.095 1.00 49.36 ? 99  ASN B CG  1 
ATOM   2788 O OD1 . ASN B 1 79  ? 6.082   -32.239 -9.054  1.00 49.36 ? 99  ASN B OD1 1 
ATOM   2789 N ND2 . ASN B 1 79  ? 6.843   -33.627 -10.662 1.00 49.36 ? 99  ASN B ND2 1 
ATOM   2790 N N   . ILE B 1 80  ? 7.724   -29.522 -7.716  1.00 48.93 ? 100 ILE B N   1 
ATOM   2791 C CA  . ILE B 1 80  ? 8.422   -29.532 -6.422  1.00 48.93 ? 100 ILE B CA  1 
ATOM   2792 C C   . ILE B 1 80  ? 8.538   -30.929 -5.837  1.00 48.93 ? 100 ILE B C   1 
ATOM   2793 O O   . ILE B 1 80  ? 9.505   -31.257 -5.150  1.00 48.93 ? 100 ILE B O   1 
ATOM   2794 C CB  . ILE B 1 80  ? 7.762   -28.559 -5.424  1.00 47.22 ? 100 ILE B CB  1 
ATOM   2795 C CG1 . ILE B 1 80  ? 8.699   -28.304 -4.241  1.00 47.22 ? 100 ILE B CG1 1 
ATOM   2796 C CG2 . ILE B 1 80  ? 6.438   -29.085 -4.909  1.00 47.22 ? 100 ILE B CG2 1 
ATOM   2797 C CD1 . ILE B 1 80  ? 10.018  -27.686 -4.646  1.00 47.22 ? 100 ILE B CD1 1 
ATOM   2798 N N   . LYS B 1 81  ? 7.603   -31.816 -6.170  1.00 55.22 ? 101 LYS B N   1 
ATOM   2799 C CA  . LYS B 1 81  ? 7.636   -33.202 -5.764  1.00 55.22 ? 101 LYS B CA  1 
ATOM   2800 C C   . LYS B 1 81  ? 8.974   -33.819 -6.161  1.00 55.22 ? 101 LYS B C   1 
ATOM   2801 O O   . LYS B 1 81  ? 9.537   -34.580 -5.375  1.00 55.22 ? 101 LYS B O   1 
ATOM   2802 C CB  . LYS B 1 81  ? 6.547   -34.072 -6.388  1.00 55.41 ? 101 LYS B CB  1 
ATOM   2803 C CG  . LYS B 1 81  ? 5.136   -33.514 -6.357  1.00 55.41 ? 101 LYS B CG  1 
ATOM   2804 N N   . LEU B 1 82  ? 9.531   -33.475 -7.340  1.00 60.68 ? 102 LEU B N   1 
ATOM   2805 C CA  . LEU B 1 82  ? 10.827  -33.999 -7.716  1.00 60.68 ? 102 LEU B CA  1 
ATOM   2806 C C   . LEU B 1 82  ? 11.920  -33.448 -6.807  1.00 60.68 ? 102 LEU B C   1 
ATOM   2807 O O   . LEU B 1 82  ? 12.964  -34.096 -6.654  1.00 60.68 ? 102 LEU B O   1 
ATOM   2808 C CB  . LEU B 1 82  ? 11.225  -33.629 -9.142  1.00 59.53 ? 102 LEU B CB  1 
ATOM   2809 C CG  . LEU B 1 82  ? 10.197  -33.855 -10.245 1.00 59.53 ? 102 LEU B CG  1 
ATOM   2810 C CD1 . LEU B 1 82  ? 10.849  -33.667 -11.611 1.00 59.53 ? 102 LEU B CD1 1 
ATOM   2811 C CD2 . LEU B 1 82  ? 9.570   -35.247 -10.164 1.00 59.53 ? 102 LEU B CD2 1 
ATOM   2812 N N   . GLN B 1 83  ? 11.736  -32.300 -6.167  1.00 66.62 ? 103 GLN B N   1 
ATOM   2813 C CA  . GLN B 1 83  ? 12.763  -31.791 -5.264  1.00 66.62 ? 103 GLN B CA  1 
ATOM   2814 C C   . GLN B 1 83  ? 12.637  -32.362 -3.856  1.00 66.62 ? 103 GLN B C   1 
ATOM   2815 O O   . GLN B 1 83  ? 13.379  -31.985 -2.926  1.00 66.62 ? 103 GLN B O   1 
ATOM   2816 C CB  . GLN B 1 83  ? 12.701  -30.255 -5.227  1.00 69.85 ? 103 GLN B CB  1 
ATOM   2817 C CG  . GLN B 1 83  ? 14.066  -29.607 -5.032  1.00 69.85 ? 103 GLN B CG  1 
ATOM   2818 C CD  . GLN B 1 83  ? 15.119  -30.136 -5.995  1.00 69.85 ? 103 GLN B CD  1 
ATOM   2819 O OE1 . GLN B 1 83  ? 15.882  -31.146 -5.562  1.00 69.85 ? 103 GLN B OE1 1 
ATOM   2820 N NE2 . GLN B 1 83  ? 15.243  -29.638 -7.139  1.00 69.85 ? 103 GLN B NE2 1 
ATOM   2821 N N   . GLN B 1 84  ? 11.748  -33.322 -3.612  1.00 69.38 ? 104 GLN B N   1 
ATOM   2822 C CA  . GLN B 1 84  ? 11.569  -33.944 -2.307  1.00 69.38 ? 104 GLN B CA  1 
ATOM   2823 C C   . GLN B 1 84  ? 11.202  -35.433 -2.402  1.00 69.38 ? 104 GLN B C   1 
ATOM   2824 O O   . GLN B 1 84  ? 11.917  -36.265 -2.983  1.00 69.38 ? 104 GLN B O   1 
ATOM   2825 C CB  . GLN B 1 84  ? 10.468  -33.192 -1.550  1.00 71.06 ? 104 GLN B CB  1 
ATOM   2826 C CG  . GLN B 1 84  ? 9.225   -32.904 -2.365  1.00 71.06 ? 104 GLN B CG  1 
ATOM   2827 C CD  . GLN B 1 84  ? 8.115   -32.267 -1.562  1.00 71.06 ? 104 GLN B CD  1 
ATOM   2828 O OE1 . GLN B 1 84  ? 8.142   -32.498 -0.241  1.00 71.06 ? 104 GLN B OE1 1 
ATOM   2829 N NE2 . GLN B 1 84  ? 7.227   -31.585 -2.074  1.00 71.06 ? 104 GLN B NE2 1 
ATOM   2830 N N   . PHE B 1 92  ? 18.884  -30.465 -8.444  1.00 76.63 ? 112 PHE B N   1 
ATOM   2831 C CA  . PHE B 1 92  ? 18.951  -30.452 -9.894  1.00 76.63 ? 112 PHE B CA  1 
ATOM   2832 C C   . PHE B 1 92  ? 17.953  -31.396 -10.559 1.00 76.63 ? 112 PHE B C   1 
ATOM   2833 O O   . PHE B 1 92  ? 17.839  -31.493 -11.783 1.00 76.63 ? 112 PHE B O   1 
ATOM   2834 C CB  . PHE B 1 92  ? 20.368  -30.844 -10.368 1.00 79.88 ? 112 PHE B CB  1 
ATOM   2835 C CG  . PHE B 1 92  ? 21.075  -29.683 -11.013 1.00 79.88 ? 112 PHE B CG  1 
ATOM   2836 C CD1 . PHE B 1 92  ? 21.752  -28.746 -10.250 1.00 79.88 ? 112 PHE B CD1 1 
ATOM   2837 C CD2 . PHE B 1 92  ? 21.031  -29.547 -12.390 1.00 79.88 ? 112 PHE B CD2 1 
ATOM   2838 C CE1 . PHE B 1 92  ? 22.385  -27.670 -10.870 1.00 79.88 ? 112 PHE B CE1 1 
ATOM   2839 C CE2 . PHE B 1 92  ? 21.673  -28.485 -13.002 1.00 79.88 ? 112 PHE B CE2 1 
ATOM   2840 C CZ  . PHE B 1 92  ? 22.353  -27.540 -12.250 1.00 79.88 ? 112 PHE B CZ  1 
ATOM   2841 N N   . ALA B 1 93  ? 17.219  -32.085 -9.710  1.00 73.08 ? 113 ALA B N   1 
ATOM   2842 C CA  . ALA B 1 93  ? 16.209  -33.060 -9.967  1.00 73.08 ? 113 ALA B CA  1 
ATOM   2843 C C   . ALA B 1 93  ? 15.149  -32.724 -11.001 1.00 73.08 ? 113 ALA B C   1 
ATOM   2844 O O   . ALA B 1 93  ? 14.793  -33.571 -11.839 1.00 73.08 ? 113 ALA B O   1 
ATOM   2845 C CB  . ALA B 1 93  ? 15.447  -33.314 -8.610  1.00 73.49 ? 113 ALA B CB  1 
ATOM   2846 N N   . GLU B 1 94  ? 14.644  -31.503 -10.945 1.00 66.89 ? 114 GLU B N   1 
ATOM   2847 C CA  . GLU B 1 94  ? 13.620  -31.029 -11.872 1.00 66.89 ? 114 GLU B CA  1 
ATOM   2848 C C   . GLU B 1 94  ? 14.153  -30.716 -13.248 1.00 66.89 ? 114 GLU B C   1 
ATOM   2849 O O   . GLU B 1 94  ? 13.347  -30.622 -14.181 1.00 66.89 ? 114 GLU B O   1 
ATOM   2850 C CB  . GLU B 1 94  ? 12.973  -29.767 -11.277 1.00 67.43 ? 114 GLU B CB  1 
ATOM   2851 C CG  . GLU B 1 94  ? 12.326  -30.016 -9.927  1.00 67.43 ? 114 GLU B CG  1 
ATOM   2852 C CD  . GLU B 1 94  ? 11.652  -28.755 -9.431  1.00 67.43 ? 114 GLU B CD  1 
ATOM   2853 O OE1 . GLU B 1 94  ? 10.760  -28.260 -10.146 1.00 67.43 ? 114 GLU B OE1 1 
ATOM   2854 O OE2 . GLU B 1 94  ? 12.028  -28.288 -8.342  1.00 67.43 ? 114 GLU B OE2 1 
ATOM   2855 N N   . LEU B 1 95  ? 15.460  -30.578 -13.450 1.00 62.22 ? 115 LEU B N   1 
ATOM   2856 C CA  . LEU B 1 95  ? 16.015  -30.234 -14.756 1.00 62.22 ? 115 LEU B CA  1 
ATOM   2857 C C   . LEU B 1 95  ? 15.427  -31.030 -15.905 1.00 62.22 ? 115 LEU B C   1 
ATOM   2858 O O   . LEU B 1 95  ? 15.077  -30.427 -16.935 1.00 62.22 ? 115 LEU B O   1 
ATOM   2859 C CB  . LEU B 1 95  ? 17.546  -30.396 -14.762 1.00 60.56 ? 115 LEU B CB  1 
ATOM   2860 C CG  . LEU B 1 95  ? 18.262  -29.969 -16.042 1.00 60.56 ? 115 LEU B CG  1 
ATOM   2861 C CD1 . LEU B 1 95  ? 17.873  -28.561 -16.462 1.00 60.56 ? 115 LEU B CD1 1 
ATOM   2862 C CD2 . LEU B 1 95  ? 19.783  -30.018 -15.877 1.00 60.56 ? 115 LEU B CD2 1 
ATOM   2863 N N   . LYS B 1 96  ? 15.302  -32.345 -15.776 1.00 60.57 ? 116 LYS B N   1 
ATOM   2864 C CA  . LYS B 1 96  ? 14.696  -33.159 -16.842 1.00 60.57 ? 116 LYS B CA  1 
ATOM   2865 C C   . LYS B 1 96  ? 13.264  -32.695 -17.128 1.00 60.57 ? 116 LYS B C   1 
ATOM   2866 O O   . LYS B 1 96  ? 12.958  -32.377 -18.286 1.00 60.57 ? 116 LYS B O   1 
ATOM   2867 N N   . PHE B 1 97  ? 12.414  -32.642 -16.120 1.00 57.04 ? 117 PHE B N   1 
ATOM   2868 C CA  . PHE B 1 97  ? 11.038  -32.211 -16.231 1.00 57.04 ? 117 PHE B CA  1 
ATOM   2869 C C   . PHE B 1 97  ? 10.892  -30.772 -16.745 1.00 57.04 ? 117 PHE B C   1 
ATOM   2870 O O   . PHE B 1 97  ? 10.217  -30.547 -17.745 1.00 57.04 ? 117 PHE B O   1 
ATOM   2871 C CB  . PHE B 1 97  ? 10.349  -32.251 -14.841 1.00 56.55 ? 117 PHE B CB  1 
ATOM   2872 C CG  . PHE B 1 97  ? 8.923   -31.779 -14.879 1.00 56.55 ? 117 PHE B CG  1 
ATOM   2873 C CD1 . PHE B 1 97  ? 7.899   -32.666 -15.168 1.00 56.55 ? 117 PHE B CD1 1 
ATOM   2874 C CD2 . PHE B 1 97  ? 8.595   -30.460 -14.627 1.00 56.55 ? 117 PHE B CD2 1 
ATOM   2875 C CE1 . PHE B 1 97  ? 6.584   -32.250 -15.216 1.00 56.55 ? 117 PHE B CE1 1 
ATOM   2876 C CE2 . PHE B 1 97  ? 7.280   -30.040 -14.689 1.00 56.55 ? 117 PHE B CE2 1 
ATOM   2877 C CZ  . PHE B 1 97  ? 6.271   -30.929 -14.973 1.00 56.55 ? 117 PHE B CZ  1 
ATOM   2878 N N   . THR B 1 98  ? 11.526  -29.823 -16.031 1.00 55.89 ? 118 THR B N   1 
ATOM   2879 C CA  . THR B 1 98  ? 11.435  -28.405 -16.410 1.00 55.89 ? 118 THR B CA  1 
ATOM   2880 C C   . THR B 1 98  ? 12.015  -28.216 -17.805 1.00 55.89 ? 118 THR B C   1 
ATOM   2881 O O   . THR B 1 98  ? 11.390  -27.407 -18.532 1.00 55.89 ? 118 THR B O   1 
ATOM   2882 C CB  . THR B 1 98  ? 12.030  -27.432 -15.389 1.00 56.26 ? 118 THR B CB  1 
ATOM   2883 O OG1 . THR B 1 98  ? 13.396  -27.691 -15.140 1.00 56.26 ? 118 THR B OG1 1 
ATOM   2884 C CG2 . THR B 1 98  ? 11.269  -27.529 -14.049 1.00 56.26 ? 118 THR B CG2 1 
ATOM   2885 N N   . SER B 1 99  ? 13.033  -28.893 -18.291 1.00 54.03 ? 119 SER B N   1 
ATOM   2886 C CA  . SER B 1 99  ? 13.507  -28.737 -19.669 1.00 54.03 ? 119 SER B CA  1 
ATOM   2887 C C   . SER B 1 99  ? 12.506  -29.166 -20.725 1.00 54.03 ? 119 SER B C   1 
ATOM   2888 O O   . SER B 1 99  ? 12.459  -28.615 -21.838 1.00 54.03 ? 119 SER B O   1 
ATOM   2889 C CB  . SER B 1 99  ? 14.799  -29.560 -19.864 1.00 53.42 ? 119 SER B CB  1 
ATOM   2890 O OG  . SER B 1 99  ? 15.749  -29.122 -18.908 1.00 53.42 ? 119 SER B OG  1 
ATOM   2891 N N   . SER B 1 100 ? 11.657  -30.145 -20.429 1.00 52.99 ? 120 SER B N   1 
ATOM   2892 C CA  . SER B 1 100 ? 10.647  -30.615 -21.340 1.00 52.99 ? 120 SER B CA  1 
ATOM   2893 C C   . SER B 1 100 ? 9.640   -29.526 -21.690 1.00 52.99 ? 120 SER B C   1 
ATOM   2894 O O   . SER B 1 100 ? 9.196   -29.319 -22.829 1.00 52.99 ? 120 SER B O   1 
ATOM   2895 C CB  . SER B 1 100 ? 9.847   -31.755 -20.662 1.00 52.93 ? 120 SER B CB  1 
ATOM   2896 O OG  . SER B 1 100 ? 10.645  -32.904 -20.520 1.00 52.93 ? 120 SER B OG  1 
ATOM   2897 N N   . MET B 1 101 ? 9.217   -28.829 -20.642 1.00 51.28 ? 121 MET B N   1 
ATOM   2898 C CA  . MET B 1 101 ? 8.233   -27.789 -20.702 1.00 51.28 ? 121 MET B CA  1 
ATOM   2899 C C   . MET B 1 101 ? 8.628   -26.527 -21.437 1.00 51.28 ? 121 MET B C   1 
ATOM   2900 O O   . MET B 1 101 ? 7.801   -25.905 -22.082 1.00 51.28 ? 121 MET B O   1 
ATOM   2901 C CB  . MET B 1 101 ? 7.905   -27.377 -19.234 1.00 53.55 ? 121 MET B CB  1 
ATOM   2902 C CG  . MET B 1 101 ? 7.570   -28.584 -18.369 1.00 53.55 ? 121 MET B CG  1 
ATOM   2903 S SD  . MET B 1 101 ? 6.229   -29.539 -19.085 1.00 53.55 ? 121 MET B SD  1 
ATOM   2904 C CE  . MET B 1 101 ? 6.721   -31.191 -18.538 1.00 53.55 ? 121 MET B CE  1 
ATOM   2905 N N   . VAL B 1 102 ? 9.887   -26.157 -21.306 1.00 49.17 ? 122 VAL B N   1 
ATOM   2906 C CA  . VAL B 1 102 ? 10.432  -24.967 -21.922 1.00 49.17 ? 122 VAL B CA  1 
ATOM   2907 C C   . VAL B 1 102 ? 10.162  -24.930 -23.409 1.00 49.17 ? 122 VAL B C   1 
ATOM   2908 O O   . VAL B 1 102 ? 9.772   -23.826 -23.818 1.00 49.17 ? 122 VAL B O   1 
ATOM   2909 C CB  . VAL B 1 102 ? 11.930  -24.877 -21.609 1.00 49.03 ? 122 VAL B CB  1 
ATOM   2910 C CG1 . VAL B 1 102 ? 12.675  -23.905 -22.491 1.00 49.03 ? 122 VAL B CG1 1 
ATOM   2911 C CG2 . VAL B 1 102 ? 12.095  -24.420 -20.153 1.00 49.03 ? 122 VAL B CG2 1 
ATOM   2912 N N   . GLN B 1 103 ? 10.310  -25.959 -24.221 1.00 49.71 ? 123 GLN B N   1 
ATOM   2913 C CA  . GLN B 1 103 ? 10.030  -25.823 -25.648 1.00 49.71 ? 123 GLN B CA  1 
ATOM   2914 C C   . GLN B 1 103 ? 8.601   -25.363 -25.948 1.00 49.71 ? 123 GLN B C   1 
ATOM   2915 O O   . GLN B 1 103 ? 8.413   -24.370 -26.682 1.00 49.71 ? 123 GLN B O   1 
ATOM   2916 C CB  . GLN B 1 103 ? 10.321  -27.138 -26.384 1.00 55.79 ? 123 GLN B CB  1 
ATOM   2917 C CG  . GLN B 1 103 ? 10.022  -27.027 -27.881 1.00 55.79 ? 123 GLN B CG  1 
ATOM   2918 C CD  . GLN B 1 103 ? 10.827  -25.972 -28.598 1.00 55.79 ? 123 GLN B CD  1 
ATOM   2919 O OE1 . GLN B 1 103 ? 10.336  -25.164 -29.398 1.00 55.79 ? 123 GLN B OE1 1 
ATOM   2920 N NE2 . GLN B 1 103 ? 12.138  -25.962 -28.321 1.00 55.79 ? 123 GLN B NE2 1 
ATOM   2921 N N   . SER B 1 104 ? 7.595   -26.045 -25.479 1.00 47.63 ? 124 SER B N   1 
ATOM   2922 C CA  . SER B 1 104 ? 6.216   -25.674 -25.778 1.00 47.63 ? 124 SER B CA  1 
ATOM   2923 C C   . SER B 1 104 ? 5.808   -24.368 -25.143 1.00 47.63 ? 124 SER B C   1 
ATOM   2924 O O   . SER B 1 104 ? 5.158   -23.537 -25.787 1.00 47.63 ? 124 SER B O   1 
ATOM   2925 C CB  . SER B 1 104 ? 5.253   -26.770 -25.290 1.00 48.64 ? 124 SER B CB  1 
ATOM   2926 O OG  . SER B 1 104 ? 5.698   -27.333 -24.044 1.00 48.64 ? 124 SER B OG  1 
ATOM   2927 N N   . VAL B 1 105 ? 6.137   -24.177 -23.875 1.00 43.23 ? 125 VAL B N   1 
ATOM   2928 C CA  . VAL B 1 105 ? 5.781   -22.954 -23.157 1.00 43.23 ? 125 VAL B CA  1 
ATOM   2929 C C   . VAL B 1 105 ? 6.453   -21.801 -23.859 1.00 43.23 ? 125 VAL B C   1 
ATOM   2930 O O   . VAL B 1 105 ? 5.790   -20.800 -24.169 1.00 43.23 ? 125 VAL B O   1 
ATOM   2931 C CB  . VAL B 1 105 ? 6.205   -23.078 -21.683 1.00 42.72 ? 125 VAL B CB  1 
ATOM   2932 C CG1 . VAL B 1 105 ? 6.301   -21.763 -20.948 1.00 42.72 ? 125 VAL B CG1 1 
ATOM   2933 C CG2 . VAL B 1 105 ? 5.168   -23.920 -20.936 1.00 42.72 ? 125 VAL B CG2 1 
ATOM   2934 N N   . GLY B 1 106 ? 7.732   -21.927 -24.204 1.00 42.23 ? 126 GLY B N   1 
ATOM   2935 C CA  . GLY B 1 106 ? 8.490   -20.900 -24.906 1.00 42.23 ? 126 GLY B CA  1 
ATOM   2936 C C   . GLY B 1 106 ? 7.920   -20.536 -26.260 1.00 42.23 ? 126 GLY B C   1 
ATOM   2937 O O   . GLY B 1 106 ? 7.829   -19.351 -26.630 1.00 42.23 ? 126 GLY B O   1 
ATOM   2938 N N   . THR B 1 107 ? 7.531   -21.550 -27.013 1.00 42.73 ? 127 THR B N   1 
ATOM   2939 C CA  . THR B 1 107 ? 6.950   -21.351 -28.332 1.00 42.73 ? 127 THR B CA  1 
ATOM   2940 C C   . THR B 1 107 ? 5.632   -20.646 -28.234 1.00 42.73 ? 127 THR B C   1 
ATOM   2941 O O   . THR B 1 107 ? 5.413   -19.662 -28.959 1.00 42.73 ? 127 THR B O   1 
ATOM   2942 C CB  . THR B 1 107 ? 6.762   -22.732 -29.003 1.00 43.27 ? 127 THR B CB  1 
ATOM   2943 O OG1 . THR B 1 107 ? 8.087   -23.223 -29.277 1.00 43.27 ? 127 THR B OG1 1 
ATOM   2944 C CG2 . THR B 1 107 ? 5.942   -22.674 -30.263 1.00 43.27 ? 127 THR B CG2 1 
ATOM   2945 N N   . ASN B 1 108 ? 4.730   -21.065 -27.377 1.00 42.74 ? 128 ASN B N   1 
ATOM   2946 C CA  . ASN B 1 108 ? 3.434   -20.448 -27.175 1.00 42.74 ? 128 ASN B CA  1 
ATOM   2947 C C   . ASN B 1 108 ? 3.524   -18.977 -26.779 1.00 42.74 ? 128 ASN B C   1 
ATOM   2948 O O   . ASN B 1 108 ? 2.726   -18.148 -27.151 1.00 42.74 ? 128 ASN B O   1 
ATOM   2949 C CB  . ASN B 1 108 ? 2.702   -21.135 -26.016 1.00 44.31 ? 128 ASN B CB  1 
ATOM   2950 C CG  . ASN B 1 108 ? 2.011   -22.361 -26.589 1.00 44.31 ? 128 ASN B CG  1 
ATOM   2951 O OD1 . ASN B 1 108 ? 1.286   -22.195 -27.573 1.00 44.31 ? 128 ASN B OD1 1 
ATOM   2952 N ND2 . ASN B 1 108 ? 2.295   -23.486 -25.960 1.00 44.31 ? 128 ASN B ND2 1 
ATOM   2953 N N   . LEU B 1 109 ? 4.505   -18.717 -25.924 1.00 42.67 ? 129 LEU B N   1 
ATOM   2954 C CA  . LEU B 1 109 ? 4.828   -17.438 -25.370 1.00 42.67 ? 129 LEU B CA  1 
ATOM   2955 C C   . LEU B 1 109 ? 5.293   -16.560 -26.518 1.00 42.67 ? 129 LEU B C   1 
ATOM   2956 O O   . LEU B 1 109 ? 4.753   -15.484 -26.734 1.00 42.67 ? 129 LEU B O   1 
ATOM   2957 C CB  . LEU B 1 109 ? 5.940   -17.540 -24.324 1.00 40.43 ? 129 LEU B CB  1 
ATOM   2958 C CG  . LEU B 1 109 ? 6.074   -16.295 -23.435 1.00 40.43 ? 129 LEU B CG  1 
ATOM   2959 C CD1 . LEU B 1 109 ? 4.763   -15.982 -22.739 1.00 40.43 ? 129 LEU B CD1 1 
ATOM   2960 C CD2 . LEU B 1 109 ? 7.168   -16.516 -22.424 1.00 40.43 ? 129 LEU B CD2 1 
ATOM   2961 N N   . LYS B 1 110 ? 6.255   -17.111 -27.271 1.00 44.89 ? 130 LYS B N   1 
ATOM   2962 C CA  . LYS B 1 110 ? 6.755   -16.416 -28.456 1.00 44.89 ? 130 LYS B CA  1 
ATOM   2963 C C   . LYS B 1 110 ? 5.633   -16.072 -29.424 1.00 44.89 ? 130 LYS B C   1 
ATOM   2964 O O   . LYS B 1 110 ? 5.604   -14.925 -29.901 1.00 44.89 ? 130 LYS B O   1 
ATOM   2965 C CB  . LYS B 1 110 ? 7.759   -17.314 -29.164 1.00 47.73 ? 130 LYS B CB  1 
ATOM   2966 C CG  . LYS B 1 110 ? 8.623   -16.597 -30.177 1.00 47.73 ? 130 LYS B CG  1 
ATOM   2967 C CD  . LYS B 1 110 ? 9.084   -17.572 -31.287 1.00 47.73 ? 130 LYS B CD  1 
ATOM   2968 C CE  . LYS B 1 110 ? 9.608   -16.728 -32.457 1.00 47.73 ? 130 LYS B CE  1 
ATOM   2969 N NZ  . LYS B 1 110 ? 9.947   -17.528 -33.657 1.00 47.73 ? 130 LYS B NZ  1 
ATOM   2970 N N   . GLU B 1 111 ? 4.690   -16.936 -29.724 1.00 44.25 ? 131 GLU B N   1 
ATOM   2971 C CA  . GLU B 1 111 ? 3.585   -16.730 -30.619 1.00 44.25 ? 131 GLU B CA  1 
ATOM   2972 C C   . GLU B 1 111 ? 2.429   -15.905 -30.079 1.00 44.25 ? 131 GLU B C   1 
ATOM   2973 O O   . GLU B 1 111 ? 1.545   -15.544 -30.876 1.00 44.25 ? 131 GLU B O   1 
ATOM   2974 C CB  . GLU B 1 111 ? 2.940   -18.086 -31.003 1.00 51.52 ? 131 GLU B CB  1 
ATOM   2975 C CG  . GLU B 1 111 ? 3.783   -18.905 -31.954 1.00 51.52 ? 131 GLU B CG  1 
ATOM   2976 C CD  . GLU B 1 111 ? 3.238   -20.306 -32.166 1.00 51.52 ? 131 GLU B CD  1 
ATOM   2977 O OE1 . GLU B 1 111 ? 2.149   -20.631 -31.590 1.00 51.52 ? 131 GLU B OE1 1 
ATOM   2978 O OE2 . GLU B 1 111 ? 3.902   -21.091 -32.912 1.00 51.52 ? 131 GLU B OE2 1 
ATOM   2979 N N   . SER B 1 112 ? 2.359   -15.609 -28.804 1.00 39.67 ? 132 SER B N   1 
ATOM   2980 C CA  . SER B 1 112 ? 1.266   -14.814 -28.213 1.00 39.67 ? 132 SER B CA  1 
ATOM   2981 C C   . SER B 1 112 ? 1.315   -13.356 -28.625 1.00 39.67 ? 132 SER B C   1 
ATOM   2982 O O   . SER B 1 112 ? 0.309   -12.635 -28.668 1.00 39.67 ? 132 SER B O   1 
ATOM   2983 C CB  . SER B 1 112 ? 1.310   -14.889 -26.685 1.00 38.00 ? 132 SER B CB  1 
ATOM   2984 O OG  . SER B 1 112 ? 2.554   -14.364 -26.227 1.00 38.00 ? 132 SER B OG  1 
ATOM   2985 N N   . GLY B 1 113 ? 2.510   -12.887 -28.920 1.00 34.88 ? 133 GLY B N   1 
ATOM   2986 C CA  . GLY B 1 113 ? 2.868   -11.554 -29.306 1.00 34.88 ? 133 GLY B CA  1 
ATOM   2987 C C   . GLY B 1 113 ? 3.538   -10.808 -28.150 1.00 34.88 ? 133 GLY B C   1 
ATOM   2988 O O   . GLY B 1 113 ? 3.916   -9.658  -28.268 1.00 34.88 ? 133 GLY B O   1 
ATOM   2989 N N   . PHE B 1 114 ? 3.657   -11.496 -27.022 1.00 30.53 ? 134 PHE B N   1 
ATOM   2990 C CA  . PHE B 1 114 ? 4.237   -10.918 -25.819 1.00 30.53 ? 134 PHE B CA  1 
ATOM   2991 C C   . PHE B 1 114 ? 5.585   -10.315 -26.126 1.00 30.53 ? 134 PHE B C   1 
ATOM   2992 O O   . PHE B 1 114 ? 6.350   -10.978 -26.832 1.00 30.53 ? 134 PHE B O   1 
ATOM   2993 C CB  . PHE B 1 114 ? 4.412   -11.988 -24.755 1.00 26.47 ? 134 PHE B CB  1 
ATOM   2994 C CG  . PHE B 1 114 ? 5.240   -11.540 -23.579 1.00 26.47 ? 134 PHE B CG  1 
ATOM   2995 C CD1 . PHE B 1 114 ? 4.708   -10.673 -22.640 1.00 26.47 ? 134 PHE B CD1 1 
ATOM   2996 C CD2 . PHE B 1 114 ? 6.530   -12.015 -23.437 1.00 26.47 ? 134 PHE B CD2 1 
ATOM   2997 C CE1 . PHE B 1 114 ? 5.478   -10.275 -21.557 1.00 26.47 ? 134 PHE B CE1 1 
ATOM   2998 C CE2 . PHE B 1 114 ? 7.305   -11.643 -22.345 1.00 26.47 ? 134 PHE B CE2 1 
ATOM   2999 C CZ  . PHE B 1 114 ? 6.753   -10.787 -21.409 1.00 26.47 ? 134 PHE B CZ  1 
ATOM   3000 N N   . HIS B 1 115 ? 5.891   -9.145  -25.597 1.00 29.16 ? 135 HIS B N   1 
ATOM   3001 C CA  . HIS B 1 115 ? 7.210   -8.573  -25.882 1.00 29.16 ? 135 HIS B CA  1 
ATOM   3002 C C   . HIS B 1 115 ? 7.678   -7.751  -24.704 1.00 29.16 ? 135 HIS B C   1 
ATOM   3003 O O   . HIS B 1 115 ? 8.327   -6.697  -24.880 1.00 29.16 ? 135 HIS B O   1 
ATOM   3004 C CB  . HIS B 1 115 ? 7.145   -7.731  -27.170 1.00 29.38 ? 135 HIS B CB  1 
ATOM   3005 C CG  . HIS B 1 115 ? 6.153   -6.618  -27.102 1.00 29.38 ? 135 HIS B CG  1 
ATOM   3006 N ND1 . HIS B 1 115 ? 4.805   -6.867  -27.296 1.00 29.38 ? 135 HIS B ND1 1 
ATOM   3007 C CD2 . HIS B 1 115 ? 6.260   -5.303  -26.795 1.00 29.38 ? 135 HIS B CD2 1 
ATOM   3008 C CE1 . HIS B 1 115 ? 4.120   -5.732  -27.147 1.00 29.38 ? 135 HIS B CE1 1 
ATOM   3009 N NE2 . HIS B 1 115 ? 4.978   -4.788  -26.826 1.00 29.38 ? 135 HIS B NE2 1 
ATOM   3010 N N   . GLY B 1 116 ? 7.372   -8.215  -23.497 1.00 26.08 ? 136 GLY B N   1 
ATOM   3011 C CA  . GLY B 1 116 ? 7.781   -7.516  -22.275 1.00 26.08 ? 136 GLY B CA  1 
ATOM   3012 C C   . GLY B 1 116 ? 9.011   -8.221  -21.711 1.00 26.08 ? 136 GLY B C   1 
ATOM   3013 O O   . GLY B 1 116 ? 9.743   -8.852  -22.468 1.00 26.08 ? 136 GLY B O   1 
ATOM   3014 N N   . VAL B 1 117 ? 9.175   -8.185  -20.398 1.00 23.76 ? 137 VAL B N   1 
ATOM   3015 C CA  . VAL B 1 117 ? 10.285  -8.885  -19.757 1.00 23.76 ? 137 VAL B CA  1 
ATOM   3016 C C   . VAL B 1 117 ? 9.813   -10.217 -19.202 1.00 23.76 ? 137 VAL B C   1 
ATOM   3017 O O   . VAL B 1 117 ? 8.727   -10.287 -18.601 1.00 23.76 ? 137 VAL B O   1 
ATOM   3018 C CB  . VAL B 1 117 ? 10.905  -8.062  -18.614 1.00 23.31 ? 137 VAL B CB  1 
ATOM   3019 C CG1 . VAL B 1 117 ? 12.008  -8.732  -17.861 1.00 23.31 ? 137 VAL B CG1 1 
ATOM   3020 C CG2 . VAL B 1 117 ? 11.496  -6.801  -19.306 1.00 23.31 ? 137 VAL B CG2 1 
ATOM   3021 N N   . LEU B 1 118 ? 10.620  -11.258 -19.412 1.00 23.62 ? 138 LEU B N   1 
ATOM   3022 C CA  . LEU B 1 118 ? 10.300  -12.597 -18.864 1.00 23.62 ? 138 LEU B CA  1 
ATOM   3023 C C   . LEU B 1 118 ? 11.158  -12.854 -17.627 1.00 23.62 ? 138 LEU B C   1 
ATOM   3024 O O   . LEU B 1 118 ? 12.382  -12.777 -17.710 1.00 23.62 ? 138 LEU B O   1 
ATOM   3025 C CB  . LEU B 1 118 ? 10.547  -13.689 -19.874 1.00 23.47 ? 138 LEU B CB  1 
ATOM   3026 C CG  . LEU B 1 118 ? 10.378  -15.138 -19.409 1.00 23.47 ? 138 LEU B CG  1 
ATOM   3027 C CD1 . LEU B 1 118 ? 8.913   -15.508 -19.278 1.00 23.47 ? 138 LEU B CD1 1 
ATOM   3028 C CD2 . LEU B 1 118 ? 11.024  -16.093 -20.416 1.00 23.47 ? 138 LEU B CD2 1 
ATOM   3029 N N   . VAL B 1 119 ? 10.487  -13.137 -16.489 1.00 23.54 ? 139 VAL B N   1 
ATOM   3030 C CA  . VAL B 1 119 ? 11.227  -13.421 -15.258 1.00 23.54 ? 139 VAL B CA  1 
ATOM   3031 C C   . VAL B 1 119 ? 11.078  -14.905 -14.974 1.00 23.54 ? 139 VAL B C   1 
ATOM   3032 O O   . VAL B 1 119 ? 9.963   -15.413 -14.886 1.00 23.54 ? 139 VAL B O   1 
ATOM   3033 C CB  . VAL B 1 119 ? 10.739  -12.568 -14.094 1.00 22.19 ? 139 VAL B CB  1 
ATOM   3034 C CG1 . VAL B 1 119 ? 11.504  -12.879 -12.809 1.00 22.19 ? 139 VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 1 119 ? 10.915  -11.083 -14.408 1.00 22.19 ? 139 VAL B CG2 1 
ATOM   3036 N N   . VAL B 1 120 ? 12.213  -15.603 -14.901 1.00 25.17 ? 140 VAL B N   1 
ATOM   3037 C CA  . VAL B 1 120 ? 12.224  -17.048 -14.664 1.00 25.17 ? 140 VAL B CA  1 
ATOM   3038 C C   . VAL B 1 120 ? 12.588  -17.402 -13.229 1.00 25.17 ? 140 VAL B C   1 
ATOM   3039 O O   . VAL B 1 120 ? 13.574  -16.900 -12.670 1.00 25.17 ? 140 VAL B O   1 
ATOM   3040 C CB  . VAL B 1 120 ? 13.200  -17.737 -15.649 1.00 26.00 ? 140 VAL B CB  1 
ATOM   3041 C CG1 . VAL B 1 120 ? 13.107  -19.256 -15.618 1.00 26.00 ? 140 VAL B CG1 1 
ATOM   3042 C CG2 . VAL B 1 120 ? 12.914  -17.294 -17.092 1.00 26.00 ? 140 VAL B CG2 1 
ATOM   3043 N N   . ILE B 1 121 ? 11.744  -18.254 -12.640 1.00 27.80 ? 141 ILE B N   1 
ATOM   3044 C CA  . ILE B 1 121 ? 11.950  -18.755 -11.274 1.00 27.80 ? 141 ILE B CA  1 
ATOM   3045 C C   . ILE B 1 121 ? 12.288  -20.244 -11.321 1.00 27.80 ? 141 ILE B C   1 
ATOM   3046 O O   . ILE B 1 121 ? 13.164  -20.696 -10.590 1.00 27.80 ? 141 ILE B O   1 
ATOM   3047 C CB  . ILE B 1 121 ? 10.749  -18.519 -10.340 1.00 27.54 ? 141 ILE B CB  1 
ATOM   3048 C CG1 . ILE B 1 121 ? 10.674  -17.027 -9.997  1.00 27.54 ? 141 ILE B CG1 1 
ATOM   3049 C CG2 . ILE B 1 121 ? 10.847  -19.303 -9.029  1.00 27.54 ? 141 ILE B CG2 1 
ATOM   3050 C CD1 . ILE B 1 121 ? 9.432   -16.541 -9.324  1.00 27.54 ? 141 ILE B CD1 1 
ATOM   3051 N N   . SER B 1 122 ? 11.620  -20.979 -12.194 1.00 31.89 ? 142 SER B N   1 
ATOM   3052 C CA  . SER B 1 122 ? 11.793  -22.395 -12.417 1.00 31.89 ? 142 SER B CA  1 
ATOM   3053 C C   . SER B 1 122 ? 13.201  -22.902 -12.266 1.00 31.89 ? 142 SER B C   1 
ATOM   3054 O O   . SER B 1 122 ? 14.075  -22.408 -12.989 1.00 31.89 ? 142 SER B O   1 
ATOM   3055 C CB  . SER B 1 122 ? 11.390  -22.682 -13.887 1.00 32.71 ? 142 SER B CB  1 
ATOM   3056 O OG  . SER B 1 122 ? 10.040  -22.252 -14.078 1.00 32.71 ? 142 SER B OG  1 
ATOM   3057 N N   . ASN B 1 123 ? 13.473  -23.870 -11.413 1.00 35.92 ? 143 ASN B N   1 
ATOM   3058 C CA  . ASN B 1 123 ? 14.840  -24.403 -11.238 1.00 35.92 ? 143 ASN B CA  1 
ATOM   3059 C C   . ASN B 1 123 ? 15.184  -25.529 -12.195 1.00 35.92 ? 143 ASN B C   1 
ATOM   3060 O O   . ASN B 1 123 ? 14.310  -26.294 -12.652 1.00 35.92 ? 143 ASN B O   1 
ATOM   3061 C CB  . ASN B 1 123 ? 14.962  -24.922 -9.797  1.00 37.96 ? 143 ASN B CB  1 
ATOM   3062 C CG  . ASN B 1 123 ? 15.386  -23.854 -8.828  1.00 37.96 ? 143 ASN B CG  1 
ATOM   3063 O OD1 . ASN B 1 123 ? 16.031  -22.848 -9.178  1.00 37.96 ? 143 ASN B OD1 1 
ATOM   3064 N ND2 . ASN B 1 123 ? 15.012  -24.026 -7.558  1.00 37.96 ? 143 ASN B ND2 1 
ATOM   3065 N N   . PRO B 1 124 ? 16.479  -25.698 -12.539 1.00 36.61 ? 144 PRO B N   1 
ATOM   3066 C CA  . PRO B 1 124 ? 17.571  -24.837 -12.122 1.00 36.61 ? 144 PRO B CA  1 
ATOM   3067 C C   . PRO B 1 124 ? 17.520  -23.497 -12.869 1.00 36.61 ? 144 PRO B C   1 
ATOM   3068 O O   . PRO B 1 124 ? 17.769  -23.366 -14.076 1.00 36.61 ? 144 PRO B O   1 
ATOM   3069 C CB  . PRO B 1 124 ? 18.866  -25.616 -12.391 1.00 36.05 ? 144 PRO B CB  1 
ATOM   3070 C CG  . PRO B 1 124 ? 18.447  -26.667 -13.376 1.00 36.05 ? 144 PRO B CG  1 
ATOM   3071 C CD  . PRO B 1 124 ? 16.949  -26.742 -13.457 1.00 36.05 ? 144 PRO B CD  1 
ATOM   3072 N N   . VAL B 1 125 ? 17.168  -22.447 -12.134 1.00 36.36 ? 145 VAL B N   1 
ATOM   3073 C CA  . VAL B 1 125 ? 16.979  -21.104 -12.646 1.00 36.36 ? 145 VAL B CA  1 
ATOM   3074 C C   . VAL B 1 125 ? 18.013  -20.669 -13.628 1.00 36.36 ? 145 VAL B C   1 
ATOM   3075 O O   . VAL B 1 125 ? 17.566  -20.277 -14.757 1.00 36.36 ? 145 VAL B O   1 
ATOM   3076 C CB  . VAL B 1 125 ? 16.843  -20.169 -11.404 1.00 35.84 ? 145 VAL B CB  1 
ATOM   3077 C CG1 . VAL B 1 125 ? 18.151  -19.736 -10.802 1.00 35.84 ? 145 VAL B CG1 1 
ATOM   3078 C CG2 . VAL B 1 125 ? 16.001  -18.969 -11.850 1.00 35.84 ? 145 VAL B CG2 1 
ATOM   3079 N N   . ASP B 1 126 ? 19.325  -20.694 -13.481 1.00 37.78 ? 146 ASP B N   1 
ATOM   3080 C CA  . ASP B 1 126 ? 20.171  -20.167 -14.567 1.00 37.78 ? 146 ASP B CA  1 
ATOM   3081 C C   . ASP B 1 126 ? 20.047  -20.903 -15.885 1.00 37.78 ? 146 ASP B C   1 
ATOM   3082 O O   . ASP B 1 126 ? 19.947  -20.239 -16.939 1.00 37.78 ? 146 ASP B O   1 
ATOM   3083 C CB  . ASP B 1 126 ? 21.654  -20.154 -14.159 1.00 39.16 ? 146 ASP B CB  1 
ATOM   3084 C CG  . ASP B 1 126 ? 21.802  -19.447 -12.821 1.00 39.16 ? 146 ASP B CG  1 
ATOM   3085 O OD1 . ASP B 1 126 ? 21.800  -18.211 -12.792 1.00 39.16 ? 146 ASP B OD1 1 
ATOM   3086 O OD2 . ASP B 1 126 ? 21.903  -20.171 -11.787 1.00 39.16 ? 146 ASP B OD2 1 
ATOM   3087 N N   . VAL B 1 127 ? 20.052  -22.227 -15.885 1.00 35.35 ? 147 VAL B N   1 
ATOM   3088 C CA  . VAL B 1 127 ? 19.932  -23.018 -17.107 1.00 35.35 ? 147 VAL B CA  1 
ATOM   3089 C C   . VAL B 1 127 ? 18.577  -22.889 -17.734 1.00 35.35 ? 147 VAL B C   1 
ATOM   3090 O O   . VAL B 1 127 ? 18.495  -22.850 -18.956 1.00 35.35 ? 147 VAL B O   1 
ATOM   3091 C CB  . VAL B 1 127 ? 20.236  -24.517 -16.842 1.00 35.30 ? 147 VAL B CB  1 
ATOM   3092 C CG1 . VAL B 1 127 ? 20.052  -25.390 -18.061 1.00 35.30 ? 147 VAL B CG1 1 
ATOM   3093 C CG2 . VAL B 1 127 ? 21.671  -24.640 -16.353 1.00 35.30 ? 147 VAL B CG2 1 
ATOM   3094 N N   . ILE B 1 128 ? 17.504  -22.826 -16.928 1.00 33.58 ? 148 ILE B N   1 
ATOM   3095 C CA  . ILE B 1 128 ? 16.177  -22.704 -17.550 1.00 33.58 ? 148 ILE B CA  1 
ATOM   3096 C C   . ILE B 1 128 ? 16.037  -21.320 -18.112 1.00 33.58 ? 148 ILE B C   1 
ATOM   3097 O O   . ILE B 1 128 ? 15.337  -21.117 -19.123 1.00 33.58 ? 148 ILE B O   1 
ATOM   3098 C CB  . ILE B 1 128 ? 15.042  -23.018 -16.585 1.00 32.21 ? 148 ILE B CB  1 
ATOM   3099 C CG1 . ILE B 1 128 ? 15.167  -24.442 -16.048 1.00 32.21 ? 148 ILE B CG1 1 
ATOM   3100 C CG2 . ILE B 1 128 ? 13.672  -22.881 -17.242 1.00 32.21 ? 148 ILE B CG2 1 
ATOM   3101 C CD1 . ILE B 1 128 ? 15.395  -25.579 -17.002 1.00 32.21 ? 148 ILE B CD1 1 
ATOM   3102 N N   . THR B 1 129 ? 16.707  -20.339 -17.496 1.00 33.78 ? 149 THR B N   1 
ATOM   3103 C CA  . THR B 1 129 ? 16.624  -18.966 -18.047 1.00 33.78 ? 149 THR B CA  1 
ATOM   3104 C C   . THR B 1 129 ? 17.263  -18.999 -19.422 1.00 33.78 ? 149 THR B C   1 
ATOM   3105 O O   . THR B 1 129 ? 16.648  -18.544 -20.406 1.00 33.78 ? 149 THR B O   1 
ATOM   3106 C CB  . THR B 1 129 ? 17.265  -17.943 -17.113 1.00 33.10 ? 149 THR B CB  1 
ATOM   3107 O OG1 . THR B 1 129 ? 16.480  -17.851 -15.899 1.00 33.10 ? 149 THR B OG1 1 
ATOM   3108 C CG2 . THR B 1 129 ? 17.324  -16.555 -17.701 1.00 33.10 ? 149 THR B CG2 1 
ATOM   3109 N N   . ALA B 1 130 ? 18.456  -19.589 -19.542 1.00 34.16 ? 150 ALA B N   1 
ATOM   3110 C CA  . ALA B 1 130 ? 19.148  -19.733 -20.822 1.00 34.16 ? 150 ALA B CA  1 
ATOM   3111 C C   . ALA B 1 130 ? 18.350  -20.483 -21.865 1.00 34.16 ? 150 ALA B C   1 
ATOM   3112 O O   . ALA B 1 130 ? 18.314  -20.074 -23.039 1.00 34.16 ? 150 ALA B O   1 
ATOM   3113 C CB  . ALA B 1 130 ? 20.447  -20.483 -20.604 1.00 33.65 ? 150 ALA B CB  1 
ATOM   3114 N N   . LEU B 1 131 ? 17.671  -21.570 -21.493 1.00 34.91 ? 151 LEU B N   1 
ATOM   3115 C CA  . LEU B 1 131 ? 16.870  -22.280 -22.485 1.00 34.91 ? 151 LEU B CA  1 
ATOM   3116 C C   . LEU B 1 131 ? 15.682  -21.429 -22.886 1.00 34.91 ? 151 LEU B C   1 
ATOM   3117 O O   . LEU B 1 131 ? 15.327  -21.486 -24.053 1.00 34.91 ? 151 LEU B O   1 
ATOM   3118 C CB  . LEU B 1 131 ? 16.338  -23.626 -22.003 1.00 37.42 ? 151 LEU B CB  1 
ATOM   3119 C CG  . LEU B 1 131 ? 17.424  -24.691 -21.785 1.00 37.42 ? 151 LEU B CG  1 
ATOM   3120 C CD1 . LEU B 1 131 ? 16.939  -25.690 -20.757 1.00 37.42 ? 151 LEU B CD1 1 
ATOM   3121 C CD2 . LEU B 1 131 ? 17.760  -25.365 -23.105 1.00 37.42 ? 151 LEU B CD2 1 
ATOM   3122 N N   . PHE B 1 132 ? 15.077  -20.696 -21.955 1.00 33.92 ? 152 PHE B N   1 
ATOM   3123 C CA  . PHE B 1 132 ? 13.934  -19.874 -22.311 1.00 33.92 ? 152 PHE B CA  1 
ATOM   3124 C C   . PHE B 1 132 ? 14.317  -18.801 -23.336 1.00 33.92 ? 152 PHE B C   1 
ATOM   3125 O O   . PHE B 1 132 ? 13.587  -18.593 -24.305 1.00 33.92 ? 152 PHE B O   1 
ATOM   3126 C CB  . PHE B 1 132 ? 13.341  -19.200 -21.079 1.00 31.67 ? 152 PHE B CB  1 
ATOM   3127 C CG  . PHE B 1 132 ? 12.087  -19.854 -20.573 1.00 31.67 ? 152 PHE B CG  1 
ATOM   3128 C CD1 . PHE B 1 132 ? 11.008  -20.035 -21.418 1.00 31.67 ? 152 PHE B CD1 1 
ATOM   3129 C CD2 . PHE B 1 132 ? 11.964  -20.260 -19.264 1.00 31.67 ? 152 PHE B CD2 1 
ATOM   3130 C CE1 . PHE B 1 132 ? 9.840   -20.641 -20.965 1.00 31.67 ? 152 PHE B CE1 1 
ATOM   3131 C CE2 . PHE B 1 132 ? 10.805  -20.849 -18.812 1.00 31.67 ? 152 PHE B CE2 1 
ATOM   3132 C CZ  . PHE B 1 132 ? 9.738   -21.062 -19.651 1.00 31.67 ? 152 PHE B CZ  1 
ATOM   3133 N N   . GLN B 1 133 ? 15.449  -18.151 -23.141 1.00 38.41 ? 153 GLN B N   1 
ATOM   3134 C CA  . GLN B 1 133 ? 15.961  -17.110 -24.022 1.00 38.41 ? 153 GLN B CA  1 
ATOM   3135 C C   . GLN B 1 133 ? 16.244  -17.707 -25.393 1.00 38.41 ? 153 GLN B C   1 
ATOM   3136 O O   . GLN B 1 133 ? 15.923  -17.187 -26.462 1.00 38.41 ? 153 GLN B O   1 
ATOM   3137 C CB  . GLN B 1 133 ? 17.245  -16.538 -23.425 1.00 38.94 ? 153 GLN B CB  1 
ATOM   3138 C CG  . GLN B 1 133 ? 17.780  -15.272 -24.072 1.00 38.94 ? 153 GLN B CG  1 
ATOM   3139 C CD  . GLN B 1 133 ? 18.522  -15.645 -25.352 1.00 38.94 ? 153 GLN B CD  1 
ATOM   3140 O OE1 . GLN B 1 133 ? 19.438  -16.451 -25.291 1.00 38.94 ? 153 GLN B OE1 1 
ATOM   3141 N NE2 . GLN B 1 133 ? 18.048  -15.102 -26.457 1.00 38.94 ? 153 GLN B NE2 1 
ATOM   3142 N N   . HIS B 1 134 ? 16.909  -18.859 -25.332 1.00 41.26 ? 154 HIS B N   1 
ATOM   3143 C CA  . HIS B 1 134 ? 17.274  -19.672 -26.473 1.00 41.26 ? 154 HIS B CA  1 
ATOM   3144 C C   . HIS B 1 134 ? 16.050  -20.178 -27.221 1.00 41.26 ? 154 HIS B C   1 
ATOM   3145 O O   . HIS B 1 134 ? 16.029  -20.155 -28.463 1.00 41.26 ? 154 HIS B O   1 
ATOM   3146 C CB  . HIS B 1 134 ? 18.143  -20.833 -25.983 1.00 46.98 ? 154 HIS B CB  1 
ATOM   3147 C CG  . HIS B 1 134 ? 18.401  -21.895 -26.985 1.00 46.98 ? 154 HIS B CG  1 
ATOM   3148 N ND1 . HIS B 1 134 ? 18.255  -21.699 -28.357 1.00 46.98 ? 154 HIS B ND1 1 
ATOM   3149 C CD2 . HIS B 1 134 ? 18.807  -23.175 -26.841 1.00 46.98 ? 154 HIS B CD2 1 
ATOM   3150 C CE1 . HIS B 1 134 ? 18.526  -22.820 -29.000 1.00 46.98 ? 154 HIS B CE1 1 
ATOM   3151 N NE2 . HIS B 1 134 ? 18.877  -23.731 -28.114 1.00 46.98 ? 154 HIS B NE2 1 
ATOM   3152 N N   . VAL B 1 135 ? 14.971  -20.622 -26.632 1.00 38.76 ? 155 VAL B N   1 
ATOM   3153 C CA  . VAL B 1 135 ? 13.817  -21.108 -27.373 1.00 38.76 ? 155 VAL B CA  1 
ATOM   3154 C C   . VAL B 1 135 ? 12.898  -20.034 -27.894 1.00 38.76 ? 155 VAL B C   1 
ATOM   3155 O O   . VAL B 1 135 ? 12.290  -20.236 -28.961 1.00 38.76 ? 155 VAL B O   1 
ATOM   3156 C CB  . VAL B 1 135 ? 12.982  -22.035 -26.466 1.00 38.35 ? 155 VAL B CB  1 
ATOM   3157 C CG1 . VAL B 1 135 ? 11.737  -22.574 -27.135 1.00 38.35 ? 155 VAL B CG1 1 
ATOM   3158 C CG2 . VAL B 1 135 ? 13.848  -23.207 -26.035 1.00 38.35 ? 155 VAL B CG2 1 
ATOM   3159 N N   . THR B 1 136 ? 12.694  -18.932 -27.189 1.00 36.98 ? 156 THR B N   1 
ATOM   3160 C CA  . THR B 1 136 ? 11.800  -17.867 -27.619 1.00 36.98 ? 156 THR B CA  1 
ATOM   3161 C C   . THR B 1 136 ? 12.427  -16.960 -28.663 1.00 36.98 ? 156 THR B C   1 
ATOM   3162 O O   . THR B 1 136 ? 11.826  -16.305 -29.514 1.00 36.98 ? 156 THR B O   1 
ATOM   3163 C CB  . THR B 1 136 ? 11.397  -17.009 -26.388 1.00 35.48 ? 156 THR B CB  1 
ATOM   3164 O OG1 . THR B 1 136 ? 12.588  -16.693 -25.674 1.00 35.48 ? 156 THR B OG1 1 
ATOM   3165 C CG2 . THR B 1 136 ? 10.445  -17.748 -25.489 1.00 35.48 ? 156 THR B CG2 1 
ATOM   3166 N N   . GLY B 1 137 ? 13.753  -16.832 -28.531 1.00 36.07 ? 157 GLY B N   1 
ATOM   3167 C CA  . GLY B 1 137 ? 14.527  -15.970 -29.379 1.00 36.07 ? 157 GLY B CA  1 
ATOM   3168 C C   . GLY B 1 137 ? 14.466  -14.526 -28.915 1.00 36.07 ? 157 GLY B C   1 
ATOM   3169 O O   . GLY B 1 137 ? 14.933  -13.601 -29.632 1.00 36.07 ? 157 GLY B O   1 
ATOM   3170 N N   . PHE B 1 138 ? 13.904  -14.276 -27.757 1.00 32.88 ? 158 PHE B N   1 
ATOM   3171 C CA  . PHE B 1 138 ? 13.793  -12.970 -27.149 1.00 32.88 ? 158 PHE B CA  1 
ATOM   3172 C C   . PHE B 1 138 ? 15.204  -12.502 -26.856 1.00 32.88 ? 158 PHE B C   1 
ATOM   3173 O O   . PHE B 1 138 ? 16.070  -13.332 -26.585 1.00 32.88 ? 158 PHE B O   1 
ATOM   3174 C CB  . PHE B 1 138 ? 12.993  -13.029 -25.862 1.00 32.05 ? 158 PHE B CB  1 
ATOM   3175 C CG  . PHE B 1 138 ? 11.542  -13.387 -25.978 1.00 32.05 ? 158 PHE B CG  1 
ATOM   3176 C CD1 . PHE B 1 138 ? 10.835  -13.244 -27.165 1.00 32.05 ? 158 PHE B CD1 1 
ATOM   3177 C CD2 . PHE B 1 138 ? 10.847  -13.827 -24.843 1.00 32.05 ? 158 PHE B CD2 1 
ATOM   3178 C CE1 . PHE B 1 138 ? 9.493   -13.550 -27.242 1.00 32.05 ? 158 PHE B CE1 1 
ATOM   3179 C CE2 . PHE B 1 138 ? 9.503   -14.136 -24.926 1.00 32.05 ? 158 PHE B CE2 1 
ATOM   3180 C CZ  . PHE B 1 138 ? 8.818   -13.981 -26.118 1.00 32.05 ? 158 PHE B CZ  1 
ATOM   3181 N N   . PRO B 1 139 ? 15.467  -11.222 -26.959 1.00 30.83 ? 159 PRO B N   1 
ATOM   3182 C CA  . PRO B 1 139 ? 16.791  -10.690 -26.683 1.00 30.83 ? 159 PRO B CA  1 
ATOM   3183 C C   . PRO B 1 139 ? 17.168  -11.099 -25.278 1.00 30.83 ? 159 PRO B C   1 
ATOM   3184 O O   . PRO B 1 139 ? 16.329  -11.031 -24.385 1.00 30.83 ? 159 PRO B O   1 
ATOM   3185 C CB  . PRO B 1 139 ? 16.711  -9.193  -26.855 1.00 30.79 ? 159 PRO B CB  1 
ATOM   3186 C CG  . PRO B 1 139 ? 15.382  -8.957  -27.497 1.00 30.79 ? 159 PRO B CG  1 
ATOM   3187 C CD  . PRO B 1 139 ? 14.512  -10.182 -27.314 1.00 30.79 ? 159 PRO B CD  1 
ATOM   3188 N N   . ALA B 1 140 ? 18.428  -11.450 -25.053 1.00 31.09 ? 160 ALA B N   1 
ATOM   3189 C CA  . ALA B 1 140 ? 18.909  -11.872 -23.753 1.00 31.09 ? 160 ALA B CA  1 
ATOM   3190 C C   . ALA B 1 140 ? 18.579  -10.885 -22.650 1.00 31.09 ? 160 ALA B C   1 
ATOM   3191 O O   . ALA B 1 140 ? 18.307  -11.357 -21.513 1.00 31.09 ? 160 ALA B O   1 
ATOM   3192 C CB  . ALA B 1 140 ? 20.439  -12.024 -23.780 1.00 30.23 ? 160 ALA B CB  1 
ATOM   3193 N N   . HIS B 1 141 ? 18.566  -9.567  -22.891 1.00 29.43 ? 161 HIS B N   1 
ATOM   3194 C CA  . HIS B 1 141 ? 18.275  -8.576  -21.862 1.00 29.43 ? 161 HIS B CA  1 
ATOM   3195 C C   . HIS B 1 141 ? 16.800  -8.539  -21.446 1.00 29.43 ? 161 HIS B C   1 
ATOM   3196 O O   . HIS B 1 141 ? 16.470  -7.935  -20.414 1.00 29.43 ? 161 HIS B O   1 
ATOM   3197 C CB  . HIS B 1 141 ? 18.746  -7.184  -22.307 1.00 30.86 ? 161 HIS B CB  1 
ATOM   3198 C CG  . HIS B 1 141 ? 17.969  -6.591  -23.438 1.00 30.86 ? 161 HIS B CG  1 
ATOM   3199 N ND1 . HIS B 1 141 ? 16.913  -5.716  -23.244 1.00 30.86 ? 161 HIS B ND1 1 
ATOM   3200 C CD2 . HIS B 1 141 ? 18.084  -6.738  -24.792 1.00 30.86 ? 161 HIS B CD2 1 
ATOM   3201 C CE1 . HIS B 1 141 ? 16.408  -5.372  -24.434 1.00 30.86 ? 161 HIS B CE1 1 
ATOM   3202 N NE2 . HIS B 1 141 ? 17.102  -5.967  -25.374 1.00 30.86 ? 161 HIS B NE2 1 
ATOM   3203 N N   . LYS B 1 142 ? 15.916  -9.139  -22.190 1.00 26.91 ? 162 LYS B N   1 
ATOM   3204 C CA  . LYS B 1 142 ? 14.492  -9.183  -21.892 1.00 26.91 ? 162 LYS B CA  1 
ATOM   3205 C C   . LYS B 1 142 ? 14.090  -10.516 -21.269 1.00 26.91 ? 162 LYS B C   1 
ATOM   3206 O O   . LYS B 1 142 ? 12.903  -10.786 -21.057 1.00 26.91 ? 162 LYS B O   1 
ATOM   3207 C CB  . LYS B 1 142 ? 13.681  -8.983  -23.158 1.00 29.44 ? 162 LYS B CB  1 
ATOM   3208 C CG  . LYS B 1 142 ? 13.596  -7.530  -23.626 1.00 29.44 ? 162 LYS B CG  1 
ATOM   3209 C CD  . LYS B 1 142 ? 12.548  -7.515  -24.746 1.00 29.44 ? 162 LYS B CD  1 
ATOM   3210 C CE  . LYS B 1 142 ? 12.050  -6.118  -25.047 1.00 29.44 ? 162 LYS B CE  1 
ATOM   3211 N NZ  . LYS B 1 142 ? 11.444  -5.519  -23.811 1.00 29.44 ? 162 LYS B NZ  1 
ATOM   3212 N N   . VAL B 1 143 ? 15.069  -11.376 -20.995 1.00 25.67 ? 163 VAL B N   1 
ATOM   3213 C CA  . VAL B 1 143 ? 14.846  -12.689 -20.395 1.00 25.67 ? 163 VAL B CA  1 
ATOM   3214 C C   . VAL B 1 143 ? 15.835  -12.817 -19.254 1.00 25.67 ? 163 VAL B C   1 
ATOM   3215 O O   . VAL B 1 143 ? 17.051  -12.930 -19.459 1.00 25.67 ? 163 VAL B O   1 
ATOM   3216 C CB  . VAL B 1 143 ? 15.038  -13.784 -21.442 1.00 23.33 ? 163 VAL B CB  1 
ATOM   3217 C CG1 . VAL B 1 143 ? 15.043  -15.167 -20.821 1.00 23.33 ? 163 VAL B CG1 1 
ATOM   3218 C CG2 . VAL B 1 143 ? 13.912  -13.784 -22.497 1.00 23.33 ? 163 VAL B CG2 1 
ATOM   3219 N N   . ILE B 1 144 ? 15.355  -12.720 -17.992 1.00 25.40 ? 164 ILE B N   1 
ATOM   3220 C CA  . ILE B 1 144 ? 16.204  -12.793 -16.813 1.00 25.40 ? 164 ILE B CA  1 
ATOM   3221 C C   . ILE B 1 144 ? 15.602  -13.739 -15.765 1.00 25.40 ? 164 ILE B C   1 
ATOM   3222 O O   . ILE B 1 144 ? 14.413  -14.053 -15.829 1.00 25.40 ? 164 ILE B O   1 
ATOM   3223 C CB  . ILE B 1 144 ? 16.402  -11.433 -16.125 1.00 26.71 ? 164 ILE B CB  1 
ATOM   3224 C CG1 . ILE B 1 144 ? 15.028  -10.818 -15.802 1.00 26.71 ? 164 ILE B CG1 1 
ATOM   3225 C CG2 . ILE B 1 144 ? 17.216  -10.465 -16.971 1.00 26.71 ? 164 ILE B CG2 1 
ATOM   3226 C CD1 . ILE B 1 144 ? 15.086  -9.515  -15.044 1.00 26.71 ? 164 ILE B CD1 1 
ATOM   3227 N N   . GLY B 1 145 ? 16.437  -14.165 -14.828 1.00 22.43 ? 165 GLY B N   1 
ATOM   3228 C CA  . GLY B 1 145 ? 15.929  -15.076 -13.777 1.00 22.43 ? 165 GLY B CA  1 
ATOM   3229 C C   . GLY B 1 145 ? 16.168  -14.492 -12.399 1.00 22.43 ? 165 GLY B C   1 
ATOM   3230 O O   . GLY B 1 145 ? 17.048  -13.638 -12.258 1.00 22.43 ? 165 GLY B O   1 
ATOM   3231 N N   . THR B 1 146 ? 15.439  -14.975 -11.391 1.00 20.34 ? 166 THR B N   1 
ATOM   3232 C CA  . THR B 1 146 ? 15.660  -14.466 -10.031 1.00 20.34 ? 166 THR B CA  1 
ATOM   3233 C C   . THR B 1 146 ? 17.064  -14.748 -9.547  1.00 20.34 ? 166 THR B C   1 
ATOM   3234 O O   . THR B 1 146 ? 17.634  -13.915 -8.821  1.00 20.34 ? 166 THR B O   1 
ATOM   3235 C CB  . THR B 1 146 ? 14.618  -15.063 -9.087  1.00 19.80 ? 166 THR B CB  1 
ATOM   3236 O OG1 . THR B 1 146 ? 14.473  -16.480 -9.357  1.00 19.80 ? 166 THR B OG1 1 
ATOM   3237 C CG2 . THR B 1 146 ? 13.293  -14.370 -9.300  1.00 19.80 ? 166 THR B CG2 1 
ATOM   3238 N N   . GLY B 1 147 ? 17.670  -15.878 -9.924  1.00 19.94 ? 167 GLY B N   1 
ATOM   3239 C CA  . GLY B 1 147 ? 19.030  -16.204 -9.604  1.00 19.94 ? 167 GLY B CA  1 
ATOM   3240 C C   . GLY B 1 147 ? 19.358  -16.121 -8.159  1.00 19.94 ? 167 GLY B C   1 
ATOM   3241 O O   . GLY B 1 147 ? 18.623  -16.679 -7.350  1.00 19.94 ? 167 GLY B O   1 
ATOM   3242 N N   . THR B 1 148 ? 20.438  -15.409 -7.807  1.00 21.48 ? 168 THR B N   1 
ATOM   3243 C CA  . THR B 1 148 ? 20.826  -15.318 -6.412  1.00 21.48 ? 168 THR B CA  1 
ATOM   3244 C C   . THR B 1 148 ? 20.274  -14.106 -5.688  1.00 21.48 ? 168 THR B C   1 
ATOM   3245 O O   . THR B 1 148 ? 20.825  -13.648 -4.647  1.00 21.48 ? 168 THR B O   1 
ATOM   3246 C CB  . THR B 1 148 ? 22.358  -15.364 -6.272  1.00 20.65 ? 168 THR B CB  1 
ATOM   3247 O OG1 . THR B 1 148 ? 22.918  -14.258 -6.935  1.00 20.65 ? 168 THR B OG1 1 
ATOM   3248 C CG2 . THR B 1 148 ? 22.929  -16.633 -6.910  1.00 20.65 ? 168 THR B CG2 1 
ATOM   3249 N N   . LEU B 1 149 ? 19.124  -13.620 -6.134  1.00 22.91 ? 169 LEU B N   1 
ATOM   3250 C CA  . LEU B 1 149 ? 18.450  -12.503 -5.461  1.00 22.91 ? 169 LEU B CA  1 
ATOM   3251 C C   . LEU B 1 149 ? 17.886  -13.095 -4.168  1.00 22.91 ? 169 LEU B C   1 
ATOM   3252 O O   . LEU B 1 149 ? 17.954  -12.467 -3.110  1.00 22.91 ? 169 LEU B O   1 
ATOM   3253 C CB  . LEU B 1 149 ? 17.362  -11.851 -6.307  1.00 21.84 ? 169 LEU B CB  1 
ATOM   3254 C CG  . LEU B 1 149 ? 16.633  -10.602 -5.777  1.00 21.84 ? 169 LEU B CG  1 
ATOM   3255 C CD1 . LEU B 1 149 ? 17.581  -9.473  -5.432  1.00 21.84 ? 169 LEU B CD1 1 
ATOM   3256 C CD2 . LEU B 1 149 ? 15.634  -10.109 -6.789  1.00 21.84 ? 169 LEU B CD2 1 
ATOM   3257 N N   . LEU B 1 150 ? 17.376  -14.320 -4.259  1.00 22.55 ? 170 LEU B N   1 
ATOM   3258 C CA  . LEU B 1 150 ? 16.839  -15.040 -3.104  1.00 22.55 ? 170 LEU B CA  1 
ATOM   3259 C C   . LEU B 1 150 ? 17.965  -15.406 -2.138  1.00 22.55 ? 170 LEU B C   1 
ATOM   3260 O O   . LEU B 1 150 ? 17.878  -15.140 -0.949  1.00 22.55 ? 170 LEU B O   1 
ATOM   3261 C CB  . LEU B 1 150 ? 16.110  -16.305 -3.562  1.00 22.28 ? 170 LEU B CB  1 
ATOM   3262 C CG  . LEU B 1 150 ? 15.680  -17.216 -2.396  1.00 22.28 ? 170 LEU B CG  1 
ATOM   3263 C CD1 . LEU B 1 150 ? 14.825  -16.492 -1.388  1.00 22.28 ? 170 LEU B CD1 1 
ATOM   3264 C CD2 . LEU B 1 150 ? 14.924  -18.427 -2.916  1.00 22.28 ? 170 LEU B CD2 1 
ATOM   3265 N N   . ASP B 1 151 ? 19.067  -15.902 -2.680  1.00 22.51 ? 171 ASP B N   1 
ATOM   3266 C CA  . ASP B 1 151 ? 20.255  -16.221 -1.891  1.00 22.51 ? 171 ASP B CA  1 
ATOM   3267 C C   . ASP B 1 151 ? 20.860  -15.001 -1.260  1.00 22.51 ? 171 ASP B C   1 
ATOM   3268 O O   . ASP B 1 151 ? 21.330  -15.089 -0.115  1.00 22.51 ? 171 ASP B O   1 
ATOM   3269 C CB  . ASP B 1 151 ? 21.313  -16.890 -2.766  1.00 27.44 ? 171 ASP B CB  1 
ATOM   3270 C CG  . ASP B 1 151 ? 20.756  -18.122 -3.458  1.00 27.44 ? 171 ASP B CG  1 
ATOM   3271 O OD1 . ASP B 1 151 ? 20.368  -19.111 -2.786  1.00 27.44 ? 171 ASP B OD1 1 
ATOM   3272 O OD2 . ASP B 1 151 ? 20.689  -18.145 -4.702  1.00 27.44 ? 171 ASP B OD2 1 
ATOM   3273 N N   . THR B 1 152 ? 20.834  -13.845 -1.941  1.00 19.35 ? 172 THR B N   1 
ATOM   3274 C CA  . THR B 1 152 ? 21.384  -12.630 -1.289  1.00 19.35 ? 172 THR B CA  1 
ATOM   3275 C C   . THR B 1 152 ? 20.517  -12.270 -0.094  1.00 19.35 ? 172 THR B C   1 
ATOM   3276 O O   . THR B 1 152 ? 21.000  -11.837 0.963   1.00 19.35 ? 172 THR B O   1 
ATOM   3277 C CB  . THR B 1 152 ? 21.468  -11.469 -2.301  1.00 18.62 ? 172 THR B CB  1 
ATOM   3278 O OG1 . THR B 1 152 ? 22.363  -11.888 -3.345  1.00 18.62 ? 172 THR B OG1 1 
ATOM   3279 C CG2 . THR B 1 152 ? 22.007  -10.198 -1.691  1.00 18.62 ? 172 THR B CG2 1 
ATOM   3280 N N   . ALA B 1 153 ? 19.203  -12.450 -0.229  1.00 19.06 ? 173 ALA B N   1 
ATOM   3281 C CA  . ALA B 1 153 ? 18.219  -12.122 0.797   1.00 19.06 ? 173 ALA B CA  1 
ATOM   3282 C C   . ALA B 1 153 ? 18.411  -12.999 2.033   1.00 19.06 ? 173 ALA B C   1 
ATOM   3283 O O   . ALA B 1 153 ? 18.219  -12.519 3.163   1.00 19.06 ? 173 ALA B O   1 
ATOM   3284 C CB  . ALA B 1 153 ? 16.821  -12.259 0.220   1.00 18.40 ? 173 ALA B CB  1 
ATOM   3285 N N   . ARG B 1 154 ? 18.862  -14.245 1.853   1.00 17.55 ? 174 ARG B N   1 
ATOM   3286 C CA  . ARG B 1 154 ? 19.144  -15.188 2.954   1.00 17.55 ? 174 ARG B CA  1 
ATOM   3287 C C   . ARG B 1 154 ? 20.419  -14.799 3.673   1.00 17.55 ? 174 ARG B C   1 
ATOM   3288 O O   . ARG B 1 154 ? 20.499  -14.876 4.909   1.00 17.55 ? 174 ARG B O   1 
ATOM   3289 C CB  . ARG B 1 154 ? 19.277  -16.599 2.408   1.00 17.04 ? 174 ARG B CB  1 
ATOM   3290 C CG  . ARG B 1 154 ? 17.992  -17.095 1.809   1.00 17.04 ? 174 ARG B CG  1 
ATOM   3291 C CD  . ARG B 1 154 ? 18.043  -18.550 1.401   1.00 17.04 ? 174 ARG B CD  1 
ATOM   3292 N NE  . ARG B 1 154 ? 16.642  -19.015 1.176   1.00 17.04 ? 174 ARG B NE  1 
ATOM   3293 C CZ  . ARG B 1 154 ? 16.339  -19.897 0.248   1.00 17.04 ? 174 ARG B CZ  1 
ATOM   3294 N NH1 . ARG B 1 154 ? 17.311  -20.377 -0.530  1.00 17.04 ? 174 ARG B NH1 1 
ATOM   3295 N NH2 . ARG B 1 154 ? 15.092  -20.286 0.095   1.00 17.04 ? 174 ARG B NH2 1 
ATOM   3296 N N   . MET B 1 155 ? 21.404  -14.343 2.946   1.00 17.44 ? 175 MET B N   1 
ATOM   3297 C CA  . MET B 1 155 ? 22.640  -13.818 3.461   1.00 17.44 ? 175 MET B CA  1 
ATOM   3298 C C   . MET B 1 155 ? 22.327  -12.587 4.300   1.00 17.44 ? 175 MET B C   1 
ATOM   3299 O O   . MET B 1 155 ? 22.837  -12.427 5.419   1.00 17.44 ? 175 MET B O   1 
ATOM   3300 C CB  . MET B 1 155 ? 23.571  -13.406 2.322   1.00 17.66 ? 175 MET B CB  1 
ATOM   3301 C CG  . MET B 1 155 ? 24.922  -12.911 2.761   1.00 17.66 ? 175 MET B CG  1 
ATOM   3302 S SD  . MET B 1 155 ? 24.947  -11.119 3.052   1.00 17.66 ? 175 MET B SD  1 
ATOM   3303 C CE  . MET B 1 155 ? 24.864  -10.587 1.286   1.00 17.66 ? 175 MET B CE  1 
ATOM   3304 N N   . GLN B 1 156 ? 21.460  -11.703 3.780   1.00 18.22 ? 176 GLN B N   1 
ATOM   3305 C CA  . GLN B 1 156 ? 21.076  -10.470 4.505   1.00 18.22 ? 176 GLN B CA  1 
ATOM   3306 C C   . GLN B 1 156 ? 20.286  -10.827 5.753   1.00 18.22 ? 176 GLN B C   1 
ATOM   3307 O O   . GLN B 1 156 ? 20.440  -10.132 6.780   1.00 18.22 ? 176 GLN B O   1 
ATOM   3308 C CB  . GLN B 1 156 ? 20.306  -9.480  3.649   1.00 17.91 ? 176 GLN B CB  1 
ATOM   3309 C CG  . GLN B 1 156 ? 20.994  -8.975  2.402   1.00 17.91 ? 176 GLN B CG  1 
ATOM   3310 C CD  . GLN B 1 156 ? 20.035  -8.225  1.490   1.00 17.91 ? 176 GLN B CD  1 
ATOM   3311 O OE1 . GLN B 1 156 ? 19.389  -8.794  0.606   1.00 17.91 ? 176 GLN B OE1 1 
ATOM   3312 N NE2 . GLN B 1 156 ? 19.946  -6.925  1.709   1.00 17.91 ? 176 GLN B NE2 1 
ATOM   3313 N N   . ARG B 1 157 ? 19.471  -11.883 5.720   1.00 19.91 ? 177 ARG B N   1 
ATOM   3314 C CA  . ARG B 1 157 ? 18.754  -12.355 6.905   1.00 19.91 ? 177 ARG B CA  1 
ATOM   3315 C C   . ARG B 1 157 ? 19.734  -12.864 7.965   1.00 19.91 ? 177 ARG B C   1 
ATOM   3316 O O   . ARG B 1 157 ? 19.722  -12.419 9.132   1.00 19.91 ? 177 ARG B O   1 
ATOM   3317 C CB  . ARG B 1 157 ? 17.783  -13.482 6.537   1.00 19.44 ? 177 ARG B CB  1 
ATOM   3318 C CG  . ARG B 1 157 ? 17.149  -14.065 7.789   1.00 19.44 ? 177 ARG B CG  1 
ATOM   3319 C CD  . ARG B 1 157 ? 16.273  -15.254 7.561   1.00 19.44 ? 177 ARG B CD  1 
ATOM   3320 N NE  . ARG B 1 157 ? 16.916  -16.371 6.924   1.00 19.44 ? 177 ARG B NE  1 
ATOM   3321 C CZ  . ARG B 1 157 ? 17.652  -17.300 7.533   1.00 19.44 ? 177 ARG B CZ  1 
ATOM   3322 N NH1 . ARG B 1 157 ? 17.863  -17.206 8.830   1.00 19.44 ? 177 ARG B NH1 1 
ATOM   3323 N NH2 . ARG B 1 157 ? 18.156  -18.305 6.814   1.00 19.44 ? 177 ARG B NH2 1 
ATOM   3324 N N   . ALA B 1 158 ? 20.642  -13.771 7.528   1.00 20.31 ? 178 ALA B N   1 
ATOM   3325 C CA  . ALA B 1 158 ? 21.635  -14.300 8.465   1.00 20.31 ? 178 ALA B CA  1 
ATOM   3326 C C   . ALA B 1 158 ? 22.477  -13.222 9.099   1.00 20.31 ? 178 ALA B C   1 
ATOM   3327 O O   . ALA B 1 158 ? 22.594  -13.086 10.306  1.00 20.31 ? 178 ALA B O   1 
ATOM   3328 C CB  . ALA B 1 158 ? 22.535  -15.271 7.712   1.00 20.02 ? 178 ALA B CB  1 
ATOM   3329 N N   . VAL B 1 159 ? 23.076  -12.368 8.273   1.00 22.66 ? 179 VAL B N   1 
ATOM   3330 C CA  . VAL B 1 159 ? 23.896  -11.248 8.749   1.00 22.66 ? 179 VAL B CA  1 
ATOM   3331 C C   . VAL B 1 159 ? 23.066  -10.300 9.604   1.00 22.66 ? 179 VAL B C   1 
ATOM   3332 O O   . VAL B 1 159 ? 23.512  -9.837  10.656  1.00 22.66 ? 179 VAL B O   1 
ATOM   3333 C CB  . VAL B 1 159 ? 24.518  -10.490 7.566   1.00 21.96 ? 179 VAL B CB  1 
ATOM   3334 C CG1 . VAL B 1 159 ? 25.381  -9.357  8.091   1.00 21.96 ? 179 VAL B CG1 1 
ATOM   3335 C CG2 . VAL B 1 159 ? 25.386  -11.407 6.710   1.00 21.96 ? 179 VAL B CG2 1 
ATOM   3336 N N   . GLY B 1 160 ? 21.841  -9.994  9.187   1.00 23.74 ? 180 GLY B N   1 
ATOM   3337 C CA  . GLY B 1 160 ? 20.963  -9.109  9.951   1.00 23.74 ? 180 GLY B CA  1 
ATOM   3338 C C   . GLY B 1 160 ? 20.727  -9.717  11.303  1.00 23.74 ? 180 GLY B C   1 
ATOM   3339 O O   . GLY B 1 160 ? 20.852  -9.095  12.375  1.00 23.74 ? 180 GLY B O   1 
ATOM   3340 N N   . GLU B 1 161 ? 20.406  -11.015 11.338  1.00 27.31 ? 181 GLU B N   1 
ATOM   3341 C CA  . GLU B 1 161 ? 20.166  -11.689 12.625  1.00 27.31 ? 181 GLU B CA  1 
ATOM   3342 C C   . GLU B 1 161 ? 21.386  -11.629 13.517  1.00 27.31 ? 181 GLU B C   1 
ATOM   3343 O O   . GLU B 1 161 ? 21.197  -11.369 14.732  1.00 27.31 ? 181 GLU B O   1 
ATOM   3344 C CB  . GLU B 1 161 ? 19.764  -13.143 12.423  1.00 31.73 ? 181 GLU B CB  1 
ATOM   3345 C CG  . GLU B 1 161 ? 18.298  -13.362 12.113  1.00 31.73 ? 181 GLU B CG  1 
ATOM   3346 C CD  . GLU B 1 161 ? 17.938  -14.820 11.895  1.00 31.73 ? 181 GLU B CD  1 
ATOM   3347 O OE1 . GLU B 1 161 ? 18.694  -15.691 12.460  1.00 31.73 ? 181 GLU B OE1 1 
ATOM   3348 O OE2 . GLU B 1 161 ? 16.970  -15.178 11.184  1.00 31.73 ? 181 GLU B OE2 1 
ATOM   3349 N N   . ALA B 1 162 ? 22.570  -11.836 12.960  1.00 26.26 ? 182 ALA B N   1 
ATOM   3350 C CA  . ALA B 1 162 ? 23.790  -11.799 13.745  1.00 26.26 ? 182 ALA B CA  1 
ATOM   3351 C C   . ALA B 1 162 ? 24.091  -10.431 14.306  1.00 26.26 ? 182 ALA B C   1 
ATOM   3352 O O   . ALA B 1 162 ? 24.590  -10.334 15.438  1.00 26.26 ? 182 ALA B O   1 
ATOM   3353 C CB  . ALA B 1 162 ? 24.973  -12.232 12.891  1.00 25.04 ? 182 ALA B CB  1 
ATOM   3354 N N   . PHE B 1 163 ? 23.840  -9.334  13.538  1.00 25.76 ? 183 PHE B N   1 
ATOM   3355 C CA  . PHE B 1 163 ? 24.137  -7.999  14.062  1.00 25.76 ? 183 PHE B CA  1 
ATOM   3356 C C   . PHE B 1 163 ? 22.910  -7.265  14.588  1.00 25.76 ? 183 PHE B C   1 
ATOM   3357 O O   . PHE B 1 163 ? 22.970  -6.095  14.980  1.00 25.76 ? 183 PHE B O   1 
ATOM   3358 C CB  . PHE B 1 163 ? 24.793  -7.149  12.972  1.00 24.03 ? 183 PHE B CB  1 
ATOM   3359 C CG  . PHE B 1 163 ? 26.220  -7.548  12.666  1.00 24.03 ? 183 PHE B CG  1 
ATOM   3360 C CD1 . PHE B 1 163 ? 26.475  -8.603  11.801  1.00 24.03 ? 183 PHE B CD1 1 
ATOM   3361 C CD2 . PHE B 1 163 ? 27.271  -6.862  13.233  1.00 24.03 ? 183 PHE B CD2 1 
ATOM   3362 C CE1 . PHE B 1 163 ? 27.791  -8.963  11.510  1.00 24.03 ? 183 PHE B CE1 1 
ATOM   3363 C CE2 . PHE B 1 163 ? 28.589  -7.220  12.940  1.00 24.03 ? 183 PHE B CE2 1 
ATOM   3364 C CZ  . PHE B 1 163 ? 28.840  -8.267  12.082  1.00 24.03 ? 183 PHE B CZ  1 
ATOM   3365 N N   . ASP B 1 164 ? 21.772  -7.949  14.596  1.00 26.01 ? 184 ASP B N   1 
ATOM   3366 C CA  . ASP B 1 164 ? 20.522  -7.364  15.091  1.00 26.01 ? 184 ASP B CA  1 
ATOM   3367 C C   . ASP B 1 164 ? 20.178  -6.083  14.321  1.00 26.01 ? 184 ASP B C   1 
ATOM   3368 O O   . ASP B 1 164 ? 19.834  -5.019  14.845  1.00 26.01 ? 184 ASP B O   1 
ATOM   3369 C CB  . ASP B 1 164 ? 20.652  -7.060  16.580  1.00 31.68 ? 184 ASP B CB  1 
ATOM   3370 C CG  . ASP B 1 164 ? 19.327  -7.056  17.310  1.00 31.68 ? 184 ASP B CG  1 
ATOM   3371 O OD1 . ASP B 1 164 ? 18.317  -7.697  16.871  1.00 31.68 ? 184 ASP B OD1 1 
ATOM   3372 O OD2 . ASP B 1 164 ? 19.267  -6.376  18.384  1.00 31.68 ? 184 ASP B OD2 1 
ATOM   3373 N N   . LEU B 1 165 ? 20.264  -6.212  12.990  1.00 22.88 ? 185 LEU B N   1 
ATOM   3374 C CA  . LEU B 1 165 ? 19.999  -5.185  12.058  1.00 22.88 ? 185 LEU B CA  1 
ATOM   3375 C C   . LEU B 1 165 ? 18.847  -5.567  11.102  1.00 22.88 ? 185 LEU B C   1 
ATOM   3376 O O   . LEU B 1 165 ? 18.483  -6.702  10.908  1.00 22.88 ? 185 LEU B O   1 
ATOM   3377 C CB  . LEU B 1 165 ? 21.155  -4.997  11.079  1.00 25.82 ? 185 LEU B CB  1 
ATOM   3378 C CG  . LEU B 1 165 ? 22.403  -4.318  11.505  1.00 25.82 ? 185 LEU B CG  1 
ATOM   3379 C CD1 . LEU B 1 165 ? 23.466  -4.433  10.410  1.00 25.82 ? 185 LEU B CD1 1 
ATOM   3380 C CD2 . LEU B 1 165 ? 22.105  -2.844  11.789  1.00 25.82 ? 185 LEU B CD2 1 
ATOM   3381 N N   . ASP B 1 166 ? 18.328  -4.522  10.470  1.00 17.98 ? 186 ASP B N   1 
ATOM   3382 C CA  . ASP B 1 166 ? 17.285  -4.728  9.444   1.00 17.98 ? 186 ASP B CA  1 
ATOM   3383 C C   . ASP B 1 166 ? 18.028  -5.401  8.308   1.00 17.98 ? 186 ASP B C   1 
ATOM   3384 O O   . ASP B 1 166 ? 19.098  -4.898  7.876   1.00 17.98 ? 186 ASP B O   1 
ATOM   3385 C CB  . ASP B 1 166 ? 16.761  -3.374  9.054   1.00 16.15 ? 186 ASP B CB  1 
ATOM   3386 C CG  . ASP B 1 166 ? 15.799  -3.275  7.923   1.00 16.15 ? 186 ASP B CG  1 
ATOM   3387 O OD1 . ASP B 1 166 ? 15.533  -4.266  7.205   1.00 16.15 ? 186 ASP B OD1 1 
ATOM   3388 O OD2 . ASP B 1 166 ? 15.212  -2.180  7.690   1.00 16.15 ? 186 ASP B OD2 1 
ATOM   3389 N N   . PRO B 1 167 ? 17.528  -6.467  7.722   1.00 16.60 ? 187 PRO B N   1 
ATOM   3390 C CA  . PRO B 1 167 ? 18.215  -7.141  6.614   1.00 16.60 ? 187 PRO B CA  1 
ATOM   3391 C C   . PRO B 1 167 ? 18.425  -6.208  5.434   1.00 16.60 ? 187 PRO B C   1 
ATOM   3392 O O   . PRO B 1 167 ? 19.354  -6.333  4.623   1.00 16.60 ? 187 PRO B O   1 
ATOM   3393 C CB  . PRO B 1 167 ? 17.315  -8.324  6.221   1.00 15.04 ? 187 PRO B CB  1 
ATOM   3394 C CG  . PRO B 1 167 ? 16.001  -8.021  6.883   1.00 15.04 ? 187 PRO B CG  1 
ATOM   3395 C CD  . PRO B 1 167 ? 16.293  -7.122  8.070   1.00 15.04 ? 187 PRO B CD  1 
ATOM   3396 N N   . ARG B 1 168 ? 17.562  -5.216  5.260   1.00 18.41 ? 188 ARG B N   1 
ATOM   3397 C CA  . ARG B 1 168 ? 17.657  -4.242  4.196   1.00 18.41 ? 188 ARG B CA  1 
ATOM   3398 C C   . ARG B 1 168 ? 18.857  -3.335  4.406   1.00 18.41 ? 188 ARG B C   1 
ATOM   3399 O O   . ARG B 1 168 ? 19.317  -2.735  3.444   1.00 18.41 ? 188 ARG B O   1 
ATOM   3400 C CB  . ARG B 1 168 ? 16.361  -3.388  4.125   1.00 21.50 ? 188 ARG B CB  1 
ATOM   3401 C CG  . ARG B 1 168 ? 15.161  -4.091  3.575   1.00 21.50 ? 188 ARG B CG  1 
ATOM   3402 C CD  . ARG B 1 168 ? 13.838  -3.385  3.786   1.00 21.50 ? 188 ARG B CD  1 
ATOM   3403 N NE  . ARG B 1 168 ? 13.609  -2.868  5.113   1.00 21.50 ? 188 ARG B NE  1 
ATOM   3404 C CZ  . ARG B 1 168 ? 12.758  -1.957  5.570   1.00 21.50 ? 188 ARG B CZ  1 
ATOM   3405 N NH1 . ARG B 1 168 ? 11.832  -1.320  4.797   1.00 21.50 ? 188 ARG B NH1 1 
ATOM   3406 N NH2 . ARG B 1 168 ? 12.750  -1.555  6.860   1.00 21.50 ? 188 ARG B NH2 1 
ATOM   3407 N N   . SER B 1 169 ? 19.418  -3.212  5.591   1.00 18.71 ? 189 SER B N   1 
ATOM   3408 C CA  . SER B 1 169 ? 20.573  -2.394  5.858   1.00 18.71 ? 189 SER B CA  1 
ATOM   3409 C C   . SER B 1 169 ? 21.910  -3.130  5.665   1.00 18.71 ? 189 SER B C   1 
ATOM   3410 O O   . SER B 1 169 ? 22.995  -2.617  6.034   1.00 18.71 ? 189 SER B O   1 
ATOM   3411 C CB  . SER B 1 169 ? 20.526  -1.859  7.300   1.00 19.03 ? 189 SER B CB  1 
ATOM   3412 O OG  . SER B 1 169 ? 19.402  -0.998  7.434   1.00 19.03 ? 189 SER B OG  1 
ATOM   3413 N N   . VAL B 1 170 ? 21.855  -4.342  5.142   1.00 21.82 ? 190 VAL B N   1 
ATOM   3414 C CA  . VAL B 1 170 ? 23.029  -5.144  4.877   1.00 21.82 ? 190 VAL B CA  1 
ATOM   3415 C C   . VAL B 1 170 ? 23.270  -5.117  3.378   1.00 21.82 ? 190 VAL B C   1 
ATOM   3416 O O   . VAL B 1 170 ? 22.410  -5.540  2.593   1.00 21.82 ? 190 VAL B O   1 
ATOM   3417 C CB  . VAL B 1 170 ? 22.836  -6.614  5.327   1.00 20.17 ? 190 VAL B CB  1 
ATOM   3418 C CG1 . VAL B 1 170 ? 23.972  -7.498  4.842   1.00 20.17 ? 190 VAL B CG1 1 
ATOM   3419 C CG2 . VAL B 1 170 ? 22.719  -6.725  6.847   1.00 20.17 ? 190 VAL B CG2 1 
ATOM   3420 N N   . SER B 1 171 ? 24.435  -4.618  2.988   1.00 25.65 ? 191 SER B N   1 
ATOM   3421 C CA  . SER B 1 171 ? 24.724  -4.571  1.537   1.00 25.65 ? 191 SER B CA  1 
ATOM   3422 C C   . SER B 1 171 ? 25.669  -5.688  1.147   1.00 25.65 ? 191 SER B C   1 
ATOM   3423 O O   . SER B 1 171 ? 26.301  -6.279  2.038   1.00 25.65 ? 191 SER B O   1 
ATOM   3424 C CB  . SER B 1 171 ? 25.283  -3.189  1.195   1.00 28.31 ? 191 SER B CB  1 
ATOM   3425 O OG  . SER B 1 171 ? 26.479  -3.083  1.935   1.00 28.31 ? 191 SER B OG  1 
ATOM   3426 N N   . GLY B 1 172 ? 25.729  -5.975  -0.140  1.00 25.54 ? 192 GLY B N   1 
ATOM   3427 C CA  . GLY B 1 172 ? 26.562  -7.045  -0.672  1.00 25.54 ? 192 GLY B CA  1 
ATOM   3428 C C   . GLY B 1 172 ? 25.681  -7.986  -1.465  1.00 25.54 ? 192 GLY B C   1 
ATOM   3429 O O   . GLY B 1 172 ? 24.447  -7.879  -1.497  1.00 25.54 ? 192 GLY B O   1 
ATOM   3430 N N   . TYR B 1 173 ? 26.349  -8.924  -2.168  1.00 27.45 ? 193 TYR B N   1 
ATOM   3431 C CA  . TYR B 1 173 ? 25.699  -9.902  -3.004  1.00 27.45 ? 193 TYR B CA  1 
ATOM   3432 C C   . TYR B 1 173 ? 26.290  -11.322 -2.886  1.00 27.45 ? 193 TYR B C   1 
ATOM   3433 O O   . TYR B 1 173 ? 27.421  -11.499 -2.442  1.00 27.45 ? 193 TYR B O   1 
ATOM   3434 C CB  . TYR B 1 173 ? 25.831  -9.556  -4.535  1.00 31.43 ? 193 TYR B CB  1 
ATOM   3435 C CG  . TYR B 1 173 ? 25.824  -8.069  -4.808  1.00 31.43 ? 193 TYR B CG  1 
ATOM   3436 C CD1 . TYR B 1 173 ? 27.028  -7.362  -4.704  1.00 31.43 ? 193 TYR B CD1 1 
ATOM   3437 C CD2 . TYR B 1 173 ? 24.658  -7.356  -5.066  1.00 31.43 ? 193 TYR B CD2 1 
ATOM   3438 C CE1 . TYR B 1 173 ? 27.065  -6.008  -4.879  1.00 31.43 ? 193 TYR B CE1 1 
ATOM   3439 C CE2 . TYR B 1 173 ? 24.690  -5.981  -5.258  1.00 31.43 ? 193 TYR B CE2 1 
ATOM   3440 C CZ  . TYR B 1 173 ? 25.891  -5.319  -5.159  1.00 31.43 ? 193 TYR B CZ  1 
ATOM   3441 O OH  . TYR B 1 173 ? 25.966  -3.943  -5.346  1.00 31.43 ? 193 TYR B OH  1 
ATOM   3442 N N   . ASN B 1 174 ? 25.535  -12.289 -3.291  1.00 28.59 ? 194 ASN B N   1 
ATOM   3443 C CA  . ASN B 1 174 ? 25.805  -13.684 -3.435  1.00 28.59 ? 194 ASN B CA  1 
ATOM   3444 C C   . ASN B 1 174 ? 25.840  -13.869 -4.968  1.00 28.59 ? 194 ASN B C   1 
ATOM   3445 O O   . ASN B 1 174 ? 24.855  -13.423 -5.588  1.00 28.59 ? 194 ASN B O   1 
ATOM   3446 C CB  . ASN B 1 174 ? 24.706  -14.627 -2.984  1.00 30.16 ? 194 ASN B CB  1 
ATOM   3447 C CG  . ASN B 1 174 ? 24.870  -15.018 -1.539  1.00 30.16 ? 194 ASN B CG  1 
ATOM   3448 O OD1 . ASN B 1 174 ? 25.067  -14.000 -0.685  1.00 30.16 ? 194 ASN B OD1 1 
ATOM   3449 N ND2 . ASN B 1 174 ? 24.829  -16.224 -1.189  1.00 30.16 ? 194 ASN B ND2 1 
ATOM   3450 N N   . LEU B 1 175 ? 26.895  -14.410 -5.517  1.00 30.40 ? 195 LEU B N   1 
ATOM   3451 C CA  . LEU B 1 175 ? 26.972  -14.535 -6.989  1.00 30.40 ? 195 LEU B CA  1 
ATOM   3452 C C   . LEU B 1 175 ? 26.996  -15.980 -7.432  1.00 30.40 ? 195 LEU B C   1 
ATOM   3453 O O   . LEU B 1 175 ? 26.998  -16.910 -6.599  1.00 30.40 ? 195 LEU B O   1 
ATOM   3454 C CB  . LEU B 1 175 ? 28.221  -13.802 -7.506  1.00 28.52 ? 195 LEU B CB  1 
ATOM   3455 C CG  . LEU B 1 175 ? 28.407  -12.386 -6.900  1.00 28.52 ? 195 LEU B CG  1 
ATOM   3456 C CD1 . LEU B 1 175 ? 29.843  -11.926 -6.944  1.00 28.52 ? 195 LEU B CD1 1 
ATOM   3457 C CD2 . LEU B 1 175 ? 27.486  -11.428 -7.642  1.00 28.52 ? 195 LEU B CD2 1 
ATOM   3458 N N   . GLY B 1 176 ? 27.010  -16.226 -8.721  1.00 32.24 ? 196 GLY B N   1 
ATOM   3459 C CA  . GLY B 1 176 ? 27.091  -17.504 -9.312  1.00 32.24 ? 196 GLY B CA  1 
ATOM   3460 C C   . GLY B 1 176 ? 25.823  -18.209 -9.695  1.00 32.24 ? 196 GLY B C   1 
ATOM   3461 O O   . GLY B 1 176 ? 24.884  -17.658 -10.193 1.00 32.24 ? 196 GLY B O   1 
ATOM   3462 N N   . GLU B 1 177 ? 25.845  -19.523 -9.443  1.00 37.54 ? 197 GLU B N   1 
ATOM   3463 C CA  . GLU B 1 177 ? 24.728  -20.371 -9.788  1.00 37.54 ? 197 GLU B CA  1 
ATOM   3464 C C   . GLU B 1 177 ? 23.845  -20.680 -8.606  1.00 37.54 ? 197 GLU B C   1 
ATOM   3465 O O   . GLU B 1 177 ? 24.349  -21.240 -7.634  1.00 37.54 ? 197 GLU B O   1 
ATOM   3466 C CB  . GLU B 1 177 ? 25.330  -21.685 -10.341 1.00 42.44 ? 197 GLU B CB  1 
ATOM   3467 C CG  . GLU B 1 177 ? 24.328  -22.822 -10.349 1.00 42.44 ? 197 GLU B CG  1 
ATOM   3468 C CD  . GLU B 1 177 ? 24.910  -24.105 -10.902 1.00 42.44 ? 197 GLU B CD  1 
ATOM   3469 O OE1 . GLU B 1 177 ? 26.043  -24.446 -10.492 1.00 42.44 ? 197 GLU B OE1 1 
ATOM   3470 O OE2 . GLU B 1 177 ? 24.200  -24.728 -11.741 1.00 42.44 ? 197 GLU B OE2 1 
ATOM   3471 N N   . HIS B 1 178 ? 22.561  -20.357 -8.689  1.00 39.97 ? 198 HIS B N   1 
ATOM   3472 C CA  . HIS B 1 178 ? 21.635  -20.641 -7.598  1.00 39.97 ? 198 HIS B CA  1 
ATOM   3473 C C   . HIS B 1 178 ? 21.546  -22.162 -7.400  1.00 39.97 ? 198 HIS B C   1 
ATOM   3474 O O   . HIS B 1 178 ? 21.507  -22.933 -8.362  1.00 39.97 ? 198 HIS B O   1 
ATOM   3475 C CB  . HIS B 1 178 ? 20.259  -20.083 -7.891  1.00 35.03 ? 198 HIS B CB  1 
ATOM   3476 C CG  . HIS B 1 178 ? 19.199  -20.391 -6.884  1.00 35.03 ? 198 HIS B CG  1 
ATOM   3477 N ND1 . HIS B 1 178 ? 19.042  -19.674 -5.712  1.00 35.03 ? 198 HIS B ND1 1 
ATOM   3478 C CD2 . HIS B 1 178 ? 18.235  -21.356 -6.870  1.00 35.03 ? 198 HIS B CD2 1 
ATOM   3479 C CE1 . HIS B 1 178 ? 18.041  -20.176 -5.022  1.00 35.03 ? 198 HIS B CE1 1 
ATOM   3480 N NE2 . HIS B 1 178 ? 17.531  -21.202 -5.713  1.00 35.03 ? 198 HIS B NE2 1 
ATOM   3481 N N   . GLY B 1 179 ? 21.550  -22.560 -6.143  1.00 46.00 ? 199 GLY B N   1 
ATOM   3482 C CA  . GLY B 1 179 ? 21.445  -23.944 -5.713  1.00 46.00 ? 199 GLY B CA  1 
ATOM   3483 C C   . GLY B 1 179 ? 22.597  -24.852 -6.084  1.00 46.00 ? 199 GLY B C   1 
ATOM   3484 O O   . GLY B 1 179 ? 22.395  -26.025 -6.400  1.00 46.00 ? 199 GLY B O   1 
ATOM   3485 N N   . ASN B 1 180 ? 23.828  -24.352 -6.043  1.00 48.08 ? 200 ASN B N   1 
ATOM   3486 C CA  . ASN B 1 180 ? 24.980  -25.172 -6.398  1.00 48.08 ? 200 ASN B CA  1 
ATOM   3487 C C   . ASN B 1 180 ? 26.248  -24.394 -6.149  1.00 48.08 ? 200 ASN B C   1 
ATOM   3488 O O   . ASN B 1 180 ? 26.651  -24.266 -4.980  1.00 48.08 ? 200 ASN B O   1 
ATOM   3489 C CB  . ASN B 1 180 ? 24.893  -25.620 -7.865  1.00 51.79 ? 200 ASN B CB  1 
ATOM   3490 C CG  . ASN B 1 180 ? 25.934  -26.679 -8.187  1.00 51.79 ? 200 ASN B CG  1 
ATOM   3491 O OD1 . ASN B 1 180 ? 25.789  -27.827 -7.779  1.00 51.79 ? 200 ASN B OD1 1 
ATOM   3492 N ND2 . ASN B 1 180 ? 26.985  -26.295 -8.895  1.00 51.79 ? 200 ASN B ND2 1 
ATOM   3493 N N   . SER B 1 181 ? 26.864  -23.829 -7.162  1.00 44.50 ? 201 SER B N   1 
ATOM   3494 C CA  . SER B 1 181 ? 28.091  -23.058 -6.967  1.00 44.50 ? 201 SER B CA  1 
ATOM   3495 C C   . SER B 1 181 ? 27.944  -21.622 -6.485  1.00 44.50 ? 201 SER B C   1 
ATOM   3496 O O   . SER B 1 181 ? 28.994  -20.951 -6.396  1.00 44.50 ? 201 SER B O   1 
ATOM   3497 C CB  . SER B 1 181 ? 28.849  -23.044 -8.323  1.00 44.96 ? 201 SER B CB  1 
ATOM   3498 O OG  . SER B 1 181 ? 27.863  -22.986 -9.363  1.00 44.96 ? 201 SER B OG  1 
ATOM   3499 N N   . GLN B 1 182 ? 26.763  -21.131 -6.143  1.00 38.31 ? 202 GLN B N   1 
ATOM   3500 C CA  . GLN B 1 182 ? 26.579  -19.756 -5.661  1.00 38.31 ? 202 GLN B CA  1 
ATOM   3501 C C   . GLN B 1 182 ? 27.393  -19.509 -4.401  1.00 38.31 ? 202 GLN B C   1 
ATOM   3502 O O   . GLN B 1 182 ? 27.491  -20.415 -3.566  1.00 38.31 ? 202 GLN B O   1 
ATOM   3503 C CB  . GLN B 1 182 ? 25.118  -19.453 -5.403  1.00 40.49 ? 202 GLN B CB  1 
ATOM   3504 C CG  . GLN B 1 182 ? 24.371  -20.005 -4.223  1.00 40.49 ? 202 GLN B CG  1 
ATOM   3505 C CD  . GLN B 1 182 ? 24.544  -19.111 -3.008  1.00 40.49 ? 202 GLN B CD  1 
ATOM   3506 O OE1 . GLN B 1 182 ? 24.682  -17.792 -3.154  1.00 40.49 ? 202 GLN B OE1 1 
ATOM   3507 N NE2 . GLN B 1 182 ? 24.594  -19.623 -1.880  1.00 40.49 ? 202 GLN B NE2 1 
ATOM   3508 N N   . PHE B 1 183 ? 27.941  -18.339 -4.211  1.00 29.83 ? 203 PHE B N   1 
ATOM   3509 C CA  . PHE B 1 183 ? 28.739  -18.028 -3.040  1.00 29.83 ? 203 PHE B CA  1 
ATOM   3510 C C   . PHE B 1 183 ? 28.499  -16.602 -2.618  1.00 29.83 ? 203 PHE B C   1 
ATOM   3511 O O   . PHE B 1 183 ? 27.976  -15.834 -3.406  1.00 29.83 ? 203 PHE B O   1 
ATOM   3512 C CB  . PHE B 1 183 ? 30.226  -18.211 -3.383  1.00 26.46 ? 203 PHE B CB  1 
ATOM   3513 C CG  . PHE B 1 183 ? 30.710  -17.278 -4.446  1.00 26.46 ? 203 PHE B CG  1 
ATOM   3514 C CD1 . PHE B 1 183 ? 30.461  -17.564 -5.775  1.00 26.46 ? 203 PHE B CD1 1 
ATOM   3515 C CD2 . PHE B 1 183 ? 31.395  -16.116 -4.124  1.00 26.46 ? 203 PHE B CD2 1 
ATOM   3516 C CE1 . PHE B 1 183 ? 30.893  -16.711 -6.756  1.00 26.46 ? 203 PHE B CE1 1 
ATOM   3517 C CE2 . PHE B 1 183 ? 31.824  -15.243 -5.120  1.00 26.46 ? 203 PHE B CE2 1 
ATOM   3518 C CZ  . PHE B 1 183 ? 31.574  -15.544 -6.437  1.00 26.46 ? 203 PHE B CZ  1 
ATOM   3519 N N   . VAL B 1 184 ? 28.912  -16.234 -1.437  1.00 28.65 ? 204 VAL B N   1 
ATOM   3520 C CA  . VAL B 1 184 ? 28.798  -14.911 -0.875  1.00 28.65 ? 204 VAL B CA  1 
ATOM   3521 C C   . VAL B 1 184 ? 30.077  -14.152 -1.198  1.00 28.65 ? 204 VAL B C   1 
ATOM   3522 O O   . VAL B 1 184 ? 31.170  -14.537 -0.790  1.00 28.65 ? 204 VAL B O   1 
ATOM   3523 C CB  . VAL B 1 184 ? 28.608  -14.901 0.665   1.00 27.40 ? 204 VAL B CB  1 
ATOM   3524 C CG1 . VAL B 1 184 ? 28.394  -13.497 1.208   1.00 27.40 ? 204 VAL B CG1 1 
ATOM   3525 C CG2 . VAL B 1 184 ? 27.405  -15.746 1.102   1.00 27.40 ? 204 VAL B CG2 1 
ATOM   3526 N N   . ALA B 1 185 ? 29.967  -13.076 -1.960  1.00 28.92 ? 205 ALA B N   1 
ATOM   3527 C CA  . ALA B 1 185 ? 31.152  -12.244 -2.255  1.00 28.92 ? 205 ALA B CA  1 
ATOM   3528 C C   . ALA B 1 185 ? 31.352  -11.380 -1.033  1.00 28.92 ? 205 ALA B C   1 
ATOM   3529 O O   . ALA B 1 185 ? 30.978  -10.175 -1.009  1.00 28.92 ? 205 ALA B O   1 
ATOM   3530 C CB  . ALA B 1 185 ? 30.869  -11.500 -3.529  1.00 27.96 ? 205 ALA B CB  1 
ATOM   3531 N N   . TRP B 1 186 ? 32.005  -11.865 0.018   1.00 29.01 ? 206 TRP B N   1 
ATOM   3532 C CA  . TRP B 1 186 ? 32.197  -11.207 1.304   1.00 29.01 ? 206 TRP B CA  1 
ATOM   3533 C C   . TRP B 1 186 ? 32.905  -9.884  1.233   1.00 29.01 ? 206 TRP B C   1 
ATOM   3534 O O   . TRP B 1 186 ? 32.832  -9.085  2.207   1.00 29.01 ? 206 TRP B O   1 
ATOM   3535 C CB  . TRP B 1 186 ? 32.941  -12.104 2.343   1.00 28.19 ? 206 TRP B CB  1 
ATOM   3536 C CG  . TRP B 1 186 ? 32.086  -13.233 2.849   1.00 28.19 ? 206 TRP B CG  1 
ATOM   3537 C CD1 . TRP B 1 186 ? 32.263  -14.565 2.583   1.00 28.19 ? 206 TRP B CD1 1 
ATOM   3538 C CD2 . TRP B 1 186 ? 30.921  -13.165 3.672   1.00 28.19 ? 206 TRP B CD2 1 
ATOM   3539 N NE1 . TRP B 1 186 ? 31.289  -15.342 3.204   1.00 28.19 ? 206 TRP B NE1 1 
ATOM   3540 C CE2 . TRP B 1 186 ? 30.450  -14.483 3.867   1.00 28.19 ? 206 TRP B CE2 1 
ATOM   3541 C CE3 . TRP B 1 186 ? 30.227  -12.115 4.268   1.00 28.19 ? 206 TRP B CE3 1 
ATOM   3542 C CZ2 . TRP B 1 186 ? 29.320  -14.775 4.616   1.00 28.19 ? 206 TRP B CZ2 1 
ATOM   3543 C CZ3 . TRP B 1 186 ? 29.110  -12.410 5.017   1.00 28.19 ? 206 TRP B CZ3 1 
ATOM   3544 C CH2 . TRP B 1 186 ? 28.659  -13.725 5.193   1.00 28.19 ? 206 TRP B CH2 1 
ATOM   3545 N N   . SER B 1 187 ? 33.564  -9.587  0.133   1.00 30.30 ? 207 SER B N   1 
ATOM   3546 C CA  . SER B 1 187 ? 34.221  -8.300  -0.092  1.00 30.30 ? 207 SER B CA  1 
ATOM   3547 C C   . SER B 1 187 ? 33.180  -7.217  -0.380  1.00 30.30 ? 207 SER B C   1 
ATOM   3548 O O   . SER B 1 187 ? 33.415  -6.039  -0.058  1.00 30.30 ? 207 SER B O   1 
ATOM   3549 C CB  . SER B 1 187 ? 35.232  -8.411  -1.238  1.00 29.80 ? 207 SER B CB  1 
ATOM   3550 O OG  . SER B 1 187 ? 34.630  -8.636  -2.506  1.00 29.80 ? 207 SER B OG  1 
ATOM   3551 N N   . THR B 1 188 ? 32.007  -7.566  -0.921  1.00 30.54 ? 208 THR B N   1 
ATOM   3552 C CA  . THR B 1 188 ? 30.952  -6.629  -1.215  1.00 30.54 ? 208 THR B CA  1 
ATOM   3553 C C   . THR B 1 188 ? 30.013  -6.356  -0.052  1.00 30.54 ? 208 THR B C   1 
ATOM   3554 O O   . THR B 1 188 ? 29.230  -5.402  -0.086  1.00 30.54 ? 208 THR B O   1 
ATOM   3555 C CB  . THR B 1 188 ? 30.040  -7.155  -2.361  1.00 29.94 ? 208 THR B CB  1 
ATOM   3556 O OG1 . THR B 1 188 ? 29.357  -8.301  -1.833  1.00 29.94 ? 208 THR B OG1 1 
ATOM   3557 C CG2 . THR B 1 188 ? 30.806  -7.523  -3.598  1.00 29.94 ? 208 THR B CG2 1 
ATOM   3558 N N   . VAL B 1 189 ? 30.034  -7.170  0.980   1.00 28.34 ? 209 VAL B N   1 
ATOM   3559 C CA  . VAL B 1 189 ? 29.165  -7.073  2.132   1.00 28.34 ? 209 VAL B CA  1 
ATOM   3560 C C   . VAL B 1 189 ? 29.675  -6.101  3.161   1.00 28.34 ? 209 VAL B C   1 
ATOM   3561 O O   . VAL B 1 189 ? 30.833  -6.134  3.564   1.00 28.34 ? 209 VAL B O   1 
ATOM   3562 C CB  . VAL B 1 189 ? 29.007  -8.471  2.814   1.00 25.02 ? 209 VAL B CB  1 
ATOM   3563 C CG1 . VAL B 1 189 ? 28.103  -8.421  4.034   1.00 25.02 ? 209 VAL B CG1 1 
ATOM   3564 C CG2 . VAL B 1 189 ? 28.429  -9.461  1.818   1.00 25.02 ? 209 VAL B CG2 1 
ATOM   3565 N N   . ARG B 1 190 ? 28.780  -5.209  3.609   1.00 31.13 ? 210 ARG B N   1 
ATOM   3566 C CA  . ARG B 1 190 ? 29.201  -4.268  4.673   1.00 31.13 ? 210 ARG B CA  1 
ATOM   3567 C C   . ARG B 1 190 ? 28.002  -4.014  5.594   1.00 31.13 ? 210 ARG B C   1 
ATOM   3568 O O   . ARG B 1 190 ? 26.859  -4.174  5.173   1.00 31.13 ? 210 ARG B O   1 
ATOM   3569 C CB  . ARG B 1 190 ? 29.740  -2.951  4.164   1.00 39.74 ? 210 ARG B CB  1 
ATOM   3570 C CG  . ARG B 1 190 ? 29.126  -2.475  2.897   1.00 39.74 ? 210 ARG B CG  1 
ATOM   3571 C CD  . ARG B 1 190 ? 29.480  -1.067  2.511   1.00 39.74 ? 210 ARG B CD  1 
ATOM   3572 N NE  . ARG B 1 190 ? 30.891  -1.027  2.090   1.00 39.74 ? 210 ARG B NE  1 
ATOM   3573 C CZ  . ARG B 1 190 ? 31.833  -0.386  2.782   1.00 39.74 ? 210 ARG B CZ  1 
ATOM   3574 N NH1 . ARG B 1 190 ? 31.562  0.246   3.919   1.00 39.74 ? 210 ARG B NH1 1 
ATOM   3575 N NH2 . ARG B 1 190 ? 33.066  -0.401  2.264   1.00 39.74 ? 210 ARG B NH2 1 
ATOM   3576 N N   . VAL B 1 191 ? 28.278  -3.744  6.852   1.00 31.51 ? 211 VAL B N   1 
ATOM   3577 C CA  . VAL B 1 191 ? 27.275  -3.509  7.832   1.00 31.51 ? 211 VAL B CA  1 
ATOM   3578 C C   . VAL B 1 191 ? 27.781  -2.439  8.814   1.00 31.51 ? 211 VAL B C   1 
ATOM   3579 O O   . VAL B 1 191 ? 28.913  -2.456  9.292   1.00 31.51 ? 211 VAL B O   1 
ATOM   3580 C CB  . VAL B 1 191 ? 26.883  -4.674  8.764   1.00 31.36 ? 211 VAL B CB  1 
ATOM   3581 C CG1 . VAL B 1 191 ? 26.129  -5.786  8.029   1.00 31.36 ? 211 VAL B CG1 1 
ATOM   3582 C CG2 . VAL B 1 191 ? 28.091  -5.307  9.433   1.00 31.36 ? 211 VAL B CG2 1 
ATOM   3583 N N   . MET B 1 192 ? 26.878  -1.520  9.099   1.00 32.82 ? 212 MET B N   1 
ATOM   3584 C CA  . MET B 1 192 ? 27.137  -0.417  10.003  1.00 32.82 ? 212 MET B CA  1 
ATOM   3585 C C   . MET B 1 192 ? 28.373  0.407   9.694   1.00 32.82 ? 212 MET B C   1 
ATOM   3586 O O   . MET B 1 192 ? 29.136  0.788   10.591  1.00 32.82 ? 212 MET B O   1 
ATOM   3587 C CB  . MET B 1 192 ? 27.268  -0.969  11.428  1.00 36.65 ? 212 MET B CB  1 
ATOM   3588 C CG  . MET B 1 192 ? 25.918  -1.651  11.797  1.00 36.65 ? 212 MET B CG  1 
ATOM   3589 S SD  . MET B 1 192 ? 25.859  -1.905  13.550  1.00 36.65 ? 212 MET B SD  1 
ATOM   3590 C CE  . MET B 1 192 ? 24.963  -3.467  13.637  1.00 36.65 ? 212 MET B CE  1 
ATOM   3591 N N   . GLY B 1 193 ? 28.541  0.724   8.423   1.00 35.07 ? 213 GLY B N   1 
ATOM   3592 C CA  . GLY B 1 193 ? 29.544  1.493   7.824   1.00 35.07 ? 213 GLY B CA  1 
ATOM   3593 C C   . GLY B 1 193 ? 30.882  0.863   7.574   1.00 35.07 ? 213 GLY B C   1 
ATOM   3594 O O   . GLY B 1 193 ? 31.775  1.520   7.017   1.00 35.07 ? 213 GLY B O   1 
ATOM   3595 N N   . GLN B 1 194 ? 31.067  -0.375  7.969   1.00 36.13 ? 214 GLN B N   1 
ATOM   3596 C CA  . GLN B 1 194 ? 32.266  -1.133  7.897   1.00 36.13 ? 214 GLN B CA  1 
ATOM   3597 C C   . GLN B 1 194 ? 32.132  -2.394  7.058   1.00 36.13 ? 214 GLN B C   1 
ATOM   3598 O O   . GLN B 1 194 ? 31.090  -3.027  6.963   1.00 36.13 ? 214 GLN B O   1 
ATOM   3599 C CB  . GLN B 1 194 ? 32.653  -1.674  9.286   1.00 39.10 ? 214 GLN B CB  1 
ATOM   3600 C CG  . GLN B 1 194 ? 33.186  -0.745  10.339  1.00 39.10 ? 214 GLN B CG  1 
ATOM   3601 C CD  . GLN B 1 194 ? 34.346  0.086   9.802   1.00 39.10 ? 214 GLN B CD  1 
ATOM   3602 O OE1 . GLN B 1 194 ? 35.376  -0.480  9.396   1.00 39.10 ? 214 GLN B OE1 1 
ATOM   3603 N NE2 . GLN B 1 194 ? 34.134  1.408   9.739   1.00 39.10 ? 214 GLN B NE2 1 
ATOM   3604 N N   . PRO B 1 195 ? 33.253  -2.806  6.487   1.00 36.07 ? 215 PRO B N   1 
ATOM   3605 C CA  . PRO B 1 195 ? 33.309  -4.043  5.721   1.00 36.07 ? 215 PRO B CA  1 
ATOM   3606 C C   . PRO B 1 195 ? 33.109  -5.204  6.684   1.00 36.07 ? 215 PRO B C   1 
ATOM   3607 O O   . PRO B 1 195 ? 33.731  -5.292  7.750   1.00 36.07 ? 215 PRO B O   1 
ATOM   3608 C CB  . PRO B 1 195 ? 34.643  -4.035  5.010   1.00 36.02 ? 215 PRO B CB  1 
ATOM   3609 C CG  . PRO B 1 195 ? 35.389  -2.874  5.587   1.00 36.02 ? 215 PRO B CG  1 
ATOM   3610 C CD  . PRO B 1 195 ? 34.540  -2.143  6.586   1.00 36.02 ? 215 PRO B CD  1 
ATOM   3611 N N   . ILE B 1 196 ? 32.247  -6.141  6.302   1.00 37.07 ? 216 ILE B N   1 
ATOM   3612 C CA  . ILE B 1 196 ? 31.963  -7.299  7.155   1.00 37.07 ? 216 ILE B CA  1 
ATOM   3613 C C   . ILE B 1 196 ? 33.259  -8.031  7.434   1.00 37.07 ? 216 ILE B C   1 
ATOM   3614 O O   . ILE B 1 196 ? 33.473  -8.310  8.610   1.00 37.07 ? 216 ILE B O   1 
ATOM   3615 C CB  . ILE B 1 196 ? 30.943  -8.289  6.615   1.00 34.81 ? 216 ILE B CB  1 
ATOM   3616 C CG1 . ILE B 1 196 ? 30.476  -9.176  7.798   1.00 34.81 ? 216 ILE B CG1 1 
ATOM   3617 C CG2 . ILE B 1 196 ? 31.453  -9.182  5.504   1.00 34.81 ? 216 ILE B CG2 1 
ATOM   3618 C CD1 . ILE B 1 196 ? 29.031  -9.114  8.104   1.00 34.81 ? 216 ILE B CD1 1 
ATOM   3619 N N   . VAL B 1 197 ? 34.158  -8.265  6.498   1.00 42.07 ? 217 VAL B N   1 
ATOM   3620 C CA  . VAL B 1 197 ? 35.405  -8.962  6.738   1.00 42.07 ? 217 VAL B CA  1 
ATOM   3621 C C   . VAL B 1 197 ? 36.419  -8.211  7.581   1.00 42.07 ? 217 VAL B C   1 
ATOM   3622 O O   . VAL B 1 197 ? 37.545  -8.704  7.689   1.00 42.07 ? 217 VAL B O   1 
ATOM   3623 C CB  . VAL B 1 197 ? 36.124  -9.331  5.415   1.00 41.92 ? 217 VAL B CB  1 
ATOM   3624 C CG1 . VAL B 1 197 ? 35.163  -10.084 4.508   1.00 41.92 ? 217 VAL B CG1 1 
ATOM   3625 C CG2 . VAL B 1 197 ? 36.649  -8.115  4.699   1.00 41.92 ? 217 VAL B CG2 1 
ATOM   3626 N N   . THR B 1 198 ? 36.116  -7.094  8.160   1.00 44.91 ? 218 THR B N   1 
ATOM   3627 C CA  . THR B 1 198 ? 36.932  -6.267  9.012   1.00 44.91 ? 218 THR B CA  1 
ATOM   3628 C C   . THR B 1 198 ? 36.360  -6.366  10.422  1.00 44.91 ? 218 THR B C   1 
ATOM   3629 O O   . THR B 1 198 ? 36.949  -5.961  11.396  1.00 44.91 ? 218 THR B O   1 
ATOM   3630 C CB  . THR B 1 198 ? 36.916  -4.813  8.544   1.00 44.53 ? 218 THR B CB  1 
ATOM   3631 O OG1 . THR B 1 198 ? 37.821  -4.776  7.397   1.00 44.53 ? 218 THR B OG1 1 
ATOM   3632 C CG2 . THR B 1 198 ? 37.363  -3.767  9.521   1.00 44.53 ? 218 THR B CG2 1 
ATOM   3633 N N   . LEU B 1 199 ? 35.146  -6.927  10.491  1.00 47.53 ? 219 LEU B N   1 
ATOM   3634 C CA  . LEU B 1 199 ? 34.517  -7.087  11.816  1.00 47.53 ? 219 LEU B CA  1 
ATOM   3635 C C   . LEU B 1 199 ? 34.655  -8.537  12.270  1.00 47.53 ? 219 LEU B C   1 
ATOM   3636 O O   . LEU B 1 199 ? 35.487  -9.328  11.772  1.00 47.53 ? 219 LEU B O   1 
ATOM   3637 C CB  . LEU B 1 199 ? 33.063  -6.662  11.753  1.00 48.40 ? 219 LEU B CB  1 
ATOM   3638 C CG  . LEU B 1 199 ? 32.684  -5.380  11.001  1.00 48.40 ? 219 LEU B CG  1 
ATOM   3639 C CD1 . LEU B 1 199 ? 31.181  -5.175  11.050  1.00 48.40 ? 219 LEU B CD1 1 
ATOM   3640 C CD2 . LEU B 1 199 ? 33.399  -4.177  11.578  1.00 48.40 ? 219 LEU B CD2 1 
ATOM   3641 N N   . ILE B 1 205 ? 33.226  -12.422 14.869  1.00 62.25 ? 225 ILE B N   1 
ATOM   3642 C CA  . ILE B 1 205 ? 32.137  -13.153 14.234  1.00 62.25 ? 225 ILE B CA  1 
ATOM   3643 C C   . ILE B 1 205 ? 32.615  -14.226 13.279  1.00 62.25 ? 225 ILE B C   1 
ATOM   3644 O O   . ILE B 1 205 ? 33.640  -14.046 12.609  1.00 62.25 ? 225 ILE B O   1 
ATOM   3645 C CB  . ILE B 1 205 ? 31.237  -12.150 13.412  1.00 62.73 ? 225 ILE B CB  1 
ATOM   3646 N N   . ASP B 1 206 ? 31.896  -15.349 13.190  1.00 57.86 ? 226 ASP B N   1 
ATOM   3647 C CA  . ASP B 1 206 ? 32.334  -16.395 12.229  1.00 57.86 ? 226 ASP B CA  1 
ATOM   3648 C C   . ASP B 1 206 ? 31.557  -16.254 10.930  1.00 57.86 ? 226 ASP B C   1 
ATOM   3649 O O   . ASP B 1 206 ? 30.381  -16.623 10.914  1.00 57.86 ? 226 ASP B O   1 
ATOM   3650 N N   . LEU B 1 207 ? 32.180  -15.806 9.831   1.00 52.78 ? 227 LEU B N   1 
ATOM   3651 C CA  . LEU B 1 207 ? 31.412  -15.679 8.592   1.00 52.78 ? 227 LEU B CA  1 
ATOM   3652 C C   . LEU B 1 207 ? 30.993  -17.017 8.019   1.00 52.78 ? 227 LEU B C   1 
ATOM   3653 O O   . LEU B 1 207 ? 29.995  -17.073 7.271   1.00 52.78 ? 227 LEU B O   1 
ATOM   3654 C CB  . LEU B 1 207 ? 32.188  -14.920 7.523   1.00 51.61 ? 227 LEU B CB  1 
ATOM   3655 C CG  . LEU B 1 207 ? 32.740  -13.551 7.903   1.00 51.61 ? 227 LEU B CG  1 
ATOM   3656 C CD1 . LEU B 1 207 ? 33.407  -12.916 6.682   1.00 51.61 ? 227 LEU B CD1 1 
ATOM   3657 C CD2 . LEU B 1 207 ? 31.660  -12.624 8.428   1.00 51.61 ? 227 LEU B CD2 1 
ATOM   3658 N N   . ALA B 1 208 ? 31.704  -18.100 8.341   1.00 49.41 ? 228 ALA B N   1 
ATOM   3659 C CA  . ALA B 1 208 ? 31.340  -19.436 7.813   1.00 49.41 ? 228 ALA B CA  1 
ATOM   3660 C C   . ALA B 1 208 ? 30.045  -19.903 8.480   1.00 49.41 ? 228 ALA B C   1 
ATOM   3661 O O   . ALA B 1 208 ? 29.171  -20.477 7.811   1.00 49.41 ? 228 ALA B O   1 
ATOM   3662 C CB  . ALA B 1 208 ? 32.463  -20.415 7.991   1.00 49.89 ? 228 ALA B CB  1 
ATOM   3663 N N   . ALA B 1 209 ? 29.883  -19.611 9.770   1.00 44.26 ? 229 ALA B N   1 
ATOM   3664 C CA  . ALA B 1 209 ? 28.626  -19.947 10.445  1.00 44.26 ? 229 ALA B CA  1 
ATOM   3665 C C   . ALA B 1 209 ? 27.470  -19.239 9.728   1.00 44.26 ? 229 ALA B C   1 
ATOM   3666 O O   . ALA B 1 209 ? 26.473  -19.880 9.371   1.00 44.26 ? 229 ALA B O   1 
ATOM   3667 C CB  . ALA B 1 209 ? 28.700  -19.495 11.895  1.00 45.16 ? 229 ALA B CB  1 
ATOM   3668 N N   . ILE B 1 210 ? 27.627  -17.938 9.489   1.00 40.61 ? 230 ILE B N   1 
ATOM   3669 C CA  . ILE B 1 210 ? 26.690  -17.072 8.794   1.00 40.61 ? 230 ILE B CA  1 
ATOM   3670 C C   . ILE B 1 210 ? 26.519  -17.593 7.380   1.00 40.61 ? 230 ILE B C   1 
ATOM   3671 O O   . ILE B 1 210 ? 25.399  -17.791 6.874   1.00 40.61 ? 230 ILE B O   1 
ATOM   3672 C CB  . ILE B 1 210 ? 27.161  -15.602 8.795   1.00 39.22 ? 230 ILE B CB  1 
ATOM   3673 C CG1 . ILE B 1 210 ? 27.278  -15.086 10.233  1.00 39.22 ? 230 ILE B CG1 1 
ATOM   3674 C CG2 . ILE B 1 210 ? 26.186  -14.719 8.061   1.00 39.22 ? 230 ILE B CG2 1 
ATOM   3675 C CD1 . ILE B 1 210 ? 27.953  -13.739 10.383  1.00 39.22 ? 230 ILE B CD1 1 
ATOM   3676 N N   . GLU B 1 211 ? 27.664  -17.916 6.740   1.00 38.26 ? 231 GLU B N   1 
ATOM   3677 C CA  . GLU B 1 211 ? 27.626  -18.445 5.394   1.00 38.26 ? 231 GLU B CA  1 
ATOM   3678 C C   . GLU B 1 211 ? 26.771  -19.690 5.328   1.00 38.26 ? 231 GLU B C   1 
ATOM   3679 O O   . GLU B 1 211 ? 25.955  -19.878 4.425   1.00 38.26 ? 231 GLU B O   1 
ATOM   3680 C CB  . GLU B 1 211 ? 29.047  -18.771 4.906   1.00 41.89 ? 231 GLU B CB  1 
ATOM   3681 C CG  . GLU B 1 211 ? 29.086  -19.023 3.405   1.00 41.89 ? 231 GLU B CG  1 
ATOM   3682 C CD  . GLU B 1 211 ? 30.348  -18.540 2.717   1.00 41.89 ? 231 GLU B CD  1 
ATOM   3683 O OE1 . GLU B 1 211 ? 31.444  -18.545 3.335   1.00 41.89 ? 231 GLU B OE1 1 
ATOM   3684 O OE2 . GLU B 1 211 ? 30.241  -18.164 1.477   1.00 41.89 ? 231 GLU B OE2 1 
ATOM   3685 N N   . GLU B 1 212 ? 26.940  -20.571 6.312   1.00 35.00 ? 232 GLU B N   1 
ATOM   3686 C CA  . GLU B 1 212 ? 26.194  -21.815 6.331   1.00 35.00 ? 232 GLU B CA  1 
ATOM   3687 C C   . GLU B 1 212 ? 24.711  -21.653 6.582   1.00 35.00 ? 232 GLU B C   1 
ATOM   3688 O O   . GLU B 1 212 ? 23.871  -22.319 5.998   1.00 35.00 ? 232 GLU B O   1 
ATOM   3689 C CB  . GLU B 1 212 ? 26.765  -22.661 7.460   1.00 41.04 ? 232 GLU B CB  1 
ATOM   3690 C CG  . GLU B 1 212 ? 26.086  -24.060 7.341   1.00 41.04 ? 232 GLU B CG  1 
ATOM   3691 C CD  . GLU B 1 212 ? 26.672  -24.893 8.458   1.00 41.04 ? 232 GLU B CD  1 
ATOM   3692 O OE1 . GLU B 1 212 ? 27.079  -24.315 9.501   1.00 41.04 ? 232 GLU B OE1 1 
ATOM   3693 O OE2 . GLU B 1 212 ? 26.720  -26.120 8.242   1.00 41.04 ? 232 GLU B OE2 1 
ATOM   3694 N N   . GLU B 1 213 ? 24.398  -20.728 7.479   1.00 33.41 ? 233 GLU B N   1 
ATOM   3695 C CA  . GLU B 1 213 ? 22.989  -20.425 7.770   1.00 33.41 ? 233 GLU B CA  1 
ATOM   3696 C C   . GLU B 1 213 ? 22.313  -20.023 6.463   1.00 33.41 ? 233 GLU B C   1 
ATOM   3697 O O   . GLU B 1 213 ? 21.266  -20.534 6.080   1.00 33.41 ? 233 GLU B O   1 
ATOM   3698 C CB  . GLU B 1 213 ? 22.875  -19.298 8.769   1.00 34.02 ? 233 GLU B CB  1 
ATOM   3699 C CG  . GLU B 1 213 ? 21.471  -18.780 9.001   1.00 34.02 ? 233 GLU B CG  1 
ATOM   3700 C CD  . GLU B 1 213 ? 20.511  -19.770 9.603   1.00 34.02 ? 233 GLU B CD  1 
ATOM   3701 O OE1 . GLU B 1 213 ? 20.907  -20.427 10.595  1.00 34.02 ? 233 GLU B OE1 1 
ATOM   3702 O OE2 . GLU B 1 213 ? 19.377  -19.888 9.097   1.00 34.02 ? 233 GLU B OE2 1 
ATOM   3703 N N   . ALA B 1 214 ? 22.976  -19.096 5.784   1.00 35.65 ? 234 ALA B N   1 
ATOM   3704 C CA  . ALA B 1 214 ? 22.503  -18.561 4.506   1.00 35.65 ? 234 ALA B CA  1 
ATOM   3705 C C   . ALA B 1 214 ? 22.423  -19.649 3.445   1.00 35.65 ? 234 ALA B C   1 
ATOM   3706 O O   . ALA B 1 214 ? 21.400  -19.770 2.764   1.00 35.65 ? 234 ALA B O   1 
ATOM   3707 C CB  . ALA B 1 214 ? 23.462  -17.476 4.040   1.00 35.76 ? 234 ALA B CB  1 
ATOM   3708 N N   . ARG B 1 215 ? 23.442  -20.488 3.332   1.00 37.13 ? 235 ARG B N   1 
ATOM   3709 C CA  . ARG B 1 215 ? 23.441  -21.565 2.330   1.00 37.13 ? 235 ARG B CA  1 
ATOM   3710 C C   . ARG B 1 215 ? 22.473  -22.690 2.609   1.00 37.13 ? 235 ARG B C   1 
ATOM   3711 O O   . ARG B 1 215 ? 21.787  -23.168 1.707   1.00 37.13 ? 235 ARG B O   1 
ATOM   3712 C CB  . ARG B 1 215 ? 24.869  -22.115 2.230   1.00 39.96 ? 235 ARG B CB  1 
ATOM   3713 C CG  . ARG B 1 215 ? 25.124  -23.085 1.073   1.00 39.96 ? 235 ARG B CG  1 
ATOM   3714 C CD  . ARG B 1 215 ? 26.636  -23.297 0.914   1.00 39.96 ? 235 ARG B CD  1 
ATOM   3715 N N   . LYS B 1 216 ? 22.408  -23.121 3.879   1.00 38.35 ? 236 LYS B N   1 
ATOM   3716 C CA  . LYS B 1 216 ? 21.513  -24.222 4.212   1.00 38.35 ? 236 LYS B CA  1 
ATOM   3717 C C   . LYS B 1 216 ? 20.104  -23.742 4.481   1.00 38.35 ? 236 LYS B C   1 
ATOM   3718 O O   . LYS B 1 216 ? 19.216  -24.634 4.467   1.00 38.35 ? 236 LYS B O   1 
ATOM   3719 C CB  . LYS B 1 216 ? 22.002  -24.943 5.445   1.00 39.59 ? 236 LYS B CB  1 
ATOM   3720 C CG  . LYS B 1 216 ? 23.447  -25.353 5.393   1.00 39.59 ? 236 LYS B CG  1 
ATOM   3721 C CD  . LYS B 1 216 ? 23.621  -26.497 4.409   1.00 39.59 ? 236 LYS B CD  1 
ATOM   3722 C CE  . LYS B 1 216 ? 24.839  -27.324 4.814   1.00 39.59 ? 236 LYS B CE  1 
ATOM   3723 N NZ  . LYS B 1 216 ? 25.937  -26.470 5.363   1.00 39.59 ? 236 LYS B NZ  1 
ATOM   3724 N N   . GLY B 1 217 ? 19.878  -22.473 4.743   1.00 37.30 ? 237 GLY B N   1 
ATOM   3725 C CA  . GLY B 1 217 ? 18.586  -21.908 5.005   1.00 37.30 ? 237 GLY B CA  1 
ATOM   3726 C C   . GLY B 1 217 ? 17.475  -22.321 4.071   1.00 37.30 ? 237 GLY B C   1 
ATOM   3727 O O   . GLY B 1 217 ? 16.300  -22.417 4.499   1.00 37.30 ? 237 GLY B O   1 
ATOM   3728 N N   . GLY B 1 218 ? 17.685  -22.621 2.799   1.00 37.47 ? 238 GLY B N   1 
ATOM   3729 C CA  . GLY B 1 218 ? 16.648  -23.104 1.908   1.00 37.47 ? 238 GLY B CA  1 
ATOM   3730 C C   . GLY B 1 218 ? 16.264  -24.548 2.210   1.00 37.47 ? 238 GLY B C   1 
ATOM   3731 O O   . GLY B 1 218 ? 15.112  -24.953 1.983   1.00 37.47 ? 238 GLY B O   1 
ATOM   3732 N N   . PHE B 1 219 ? 17.181  -25.393 2.721   1.00 36.85 ? 239 PHE B N   1 
ATOM   3733 C CA  . PHE B 1 219 ? 16.895  -26.775 3.088   1.00 36.85 ? 239 PHE B CA  1 
ATOM   3734 C C   . PHE B 1 219 ? 15.959  -26.837 4.265   1.00 36.85 ? 239 PHE B C   1 
ATOM   3735 O O   . PHE B 1 219 ? 14.984  -27.564 4.245   1.00 36.85 ? 239 PHE B O   1 
ATOM   3736 C CB  . PHE B 1 219 ? 18.178  -27.540 3.515   1.00 43.24 ? 239 PHE B CB  1 
ATOM   3737 C CG  . PHE B 1 219 ? 19.106  -27.439 2.329   1.00 43.24 ? 239 PHE B CG  1 
ATOM   3738 C CD1 . PHE B 1 219 ? 18.644  -27.877 1.095   1.00 43.24 ? 239 PHE B CD1 1 
ATOM   3739 C CD2 . PHE B 1 219 ? 20.348  -26.864 2.443   1.00 43.24 ? 239 PHE B CD2 1 
ATOM   3740 C CE1 . PHE B 1 219 ? 19.434  -27.757 -0.030  1.00 43.24 ? 239 PHE B CE1 1 
ATOM   3741 C CE2 . PHE B 1 219 ? 21.152  -26.739 1.309   1.00 43.24 ? 239 PHE B CE2 1 
ATOM   3742 C CZ  . PHE B 1 219 ? 20.700  -27.188 0.074   1.00 43.24 ? 239 PHE B CZ  1 
ATOM   3743 N N   . THR B 1 220 ? 16.280  -26.047 5.279   1.00 31.32 ? 240 THR B N   1 
ATOM   3744 C CA  . THR B 1 220 ? 15.454  -25.964 6.486   1.00 31.32 ? 240 THR B CA  1 
ATOM   3745 C C   . THR B 1 220 ? 14.009  -25.666 6.193   1.00 31.32 ? 240 THR B C   1 
ATOM   3746 O O   . THR B 1 220 ? 13.087  -26.290 6.695   1.00 31.32 ? 240 THR B O   1 
ATOM   3747 C CB  . THR B 1 220 ? 16.007  -24.844 7.386   1.00 32.65 ? 240 THR B CB  1 
ATOM   3748 O OG1 . THR B 1 220 ? 17.444  -24.988 7.464   1.00 32.65 ? 240 THR B OG1 1 
ATOM   3749 C CG2 . THR B 1 220 ? 15.355  -24.901 8.745   1.00 32.65 ? 240 THR B CG2 1 
ATOM   3750 N N   . VAL B 1 221 ? 13.774  -24.671 5.316   1.00 27.54 ? 241 VAL B N   1 
ATOM   3751 C CA  . VAL B 1 221 ? 12.479  -24.223 4.880   1.00 27.54 ? 241 VAL B CA  1 
ATOM   3752 C C   . VAL B 1 221 ? 11.822  -25.350 4.110   1.00 27.54 ? 241 VAL B C   1 
ATOM   3753 O O   . VAL B 1 221 ? 10.690  -25.717 4.376   1.00 27.54 ? 241 VAL B O   1 
ATOM   3754 C CB  . VAL B 1 221 ? 12.508  -22.973 3.945   1.00 24.00 ? 241 VAL B CB  1 
ATOM   3755 C CG1 . VAL B 1 221 ? 11.133  -22.638 3.444   1.00 24.00 ? 241 VAL B CG1 1 
ATOM   3756 C CG2 . VAL B 1 221 ? 13.081  -21.789 4.700   1.00 24.00 ? 241 VAL B CG2 1 
ATOM   3757 N N   . LEU B 1 222 ? 12.614  -25.919 3.198   1.00 29.17 ? 242 LEU B N   1 
ATOM   3758 C CA  . LEU B 1 222 ? 12.097  -27.016 2.358   1.00 29.17 ? 242 LEU B CA  1 
ATOM   3759 C C   . LEU B 1 222 ? 11.807  -28.261 3.179   1.00 29.17 ? 242 LEU B C   1 
ATOM   3760 O O   . LEU B 1 222 ? 10.778  -28.926 2.945   1.00 29.17 ? 242 LEU B O   1 
ATOM   3761 C CB  . LEU B 1 222 ? 13.084  -27.227 1.234   1.00 31.08 ? 242 LEU B CB  1 
ATOM   3762 C CG  . LEU B 1 222 ? 12.948  -28.322 0.236   1.00 31.08 ? 242 LEU B CG  1 
ATOM   3763 C CD1 . LEU B 1 222 ? 11.641  -28.340 -0.513  1.00 31.08 ? 242 LEU B CD1 1 
ATOM   3764 C CD2 . LEU B 1 222 ? 14.100  -28.139 -0.796  1.00 31.08 ? 242 LEU B CD2 1 
ATOM   3765 N N   . ASN B 1 223 ? 12.663  -28.559 4.154   1.00 29.71 ? 243 ASN B N   1 
ATOM   3766 C CA  . ASN B 1 223 ? 12.433  -29.712 5.014   1.00 29.71 ? 243 ASN B CA  1 
ATOM   3767 C C   . ASN B 1 223 ? 11.302  -29.421 5.958   1.00 29.71 ? 243 ASN B C   1 
ATOM   3768 O O   . ASN B 1 223 ? 10.573  -30.359 6.260   1.00 29.71 ? 243 ASN B O   1 
ATOM   3769 C CB  . ASN B 1 223 ? 13.687  -30.117 5.808   1.00 32.20 ? 243 ASN B CB  1 
ATOM   3770 C CG  . ASN B 1 223 ? 14.746  -30.701 4.898   1.00 32.20 ? 243 ASN B CG  1 
ATOM   3771 O OD1 . ASN B 1 223 ? 15.818  -31.218 5.472   1.00 32.20 ? 243 ASN B OD1 1 
ATOM   3772 N ND2 . ASN B 1 223 ? 14.668  -30.707 3.661   1.00 32.20 ? 243 ASN B ND2 1 
ATOM   3773 N N   . GLY B 1 224 ? 11.114  -28.193 6.416   1.00 27.97 ? 244 GLY B N   1 
ATOM   3774 C CA  . GLY B 1 224 ? 10.038  -27.866 7.327   1.00 27.97 ? 244 GLY B CA  1 
ATOM   3775 C C   . GLY B 1 224 ? 8.665   -27.894 6.746   1.00 27.97 ? 244 GLY B C   1 
ATOM   3776 O O   . GLY B 1 224 ? 7.686   -28.214 7.448   1.00 27.97 ? 244 GLY B O   1 
ATOM   3777 N N   . LYS B 1 225 ? 8.478   -27.529 5.467   1.00 25.47 ? 245 LYS B N   1 
ATOM   3778 C CA  . LYS B 1 225 ? 7.079   -27.530 4.939   1.00 25.47 ? 245 LYS B CA  1 
ATOM   3779 C C   . LYS B 1 225 ? 6.953   -28.154 3.577   1.00 25.47 ? 245 LYS B C   1 
ATOM   3780 O O   . LYS B 1 225 ? 5.810   -28.308 3.132   1.00 25.47 ? 245 LYS B O   1 
ATOM   3781 C CB  . LYS B 1 225 ? 6.535   -26.098 4.941   1.00 25.57 ? 245 LYS B CB  1 
ATOM   3782 C CG  . LYS B 1 225 ? 7.280   -25.119 4.025   1.00 25.57 ? 245 LYS B CG  1 
ATOM   3783 C CD  . LYS B 1 225 ? 6.846   -23.694 4.326   1.00 25.57 ? 245 LYS B CD  1 
ATOM   3784 C CE  . LYS B 1 225 ? 7.233   -22.708 3.219   1.00 25.57 ? 245 LYS B CE  1 
ATOM   3785 N NZ  . LYS B 1 225 ? 6.654   -21.353 3.501   1.00 25.57 ? 245 LYS B NZ  1 
ATOM   3786 N N   . GLY B 1 226 ? 8.059   -28.531 2.949   1.00 24.14 ? 246 GLY B N   1 
ATOM   3787 C CA  . GLY B 1 226 ? 7.999   -29.201 1.660   1.00 24.14 ? 246 GLY B CA  1 
ATOM   3788 C C   . GLY B 1 226 ? 8.223   -28.386 0.424   1.00 24.14 ? 246 GLY B C   1 
ATOM   3789 O O   . GLY B 1 226 ? 8.186   -28.876 -0.713  1.00 24.14 ? 246 GLY B O   1 
ATOM   3790 N N   . TYR B 1 227 ? 8.455   -27.095 0.561   1.00 24.05 ? 247 TYR B N   1 
ATOM   3791 C CA  . TYR B 1 227 ? 8.684   -26.192 -0.541  1.00 24.05 ? 247 TYR B CA  1 
ATOM   3792 C C   . TYR B 1 227 ? 9.070   -24.862 0.066   1.00 24.05 ? 247 TYR B C   1 
ATOM   3793 O O   . TYR B 1 227 ? 9.050   -24.734 1.288   1.00 24.05 ? 247 TYR B O   1 
ATOM   3794 C CB  . TYR B 1 227 ? 7.408   -26.020 -1.402  1.00 23.82 ? 247 TYR B CB  1 
ATOM   3795 C CG  . TYR B 1 227 ? 6.276   -25.449 -0.562  1.00 23.82 ? 247 TYR B CG  1 
ATOM   3796 C CD1 . TYR B 1 227 ? 5.450   -26.294 0.155   1.00 23.82 ? 247 TYR B CD1 1 
ATOM   3797 C CD2 . TYR B 1 227 ? 6.059   -24.089 -0.469  1.00 23.82 ? 247 TYR B CD2 1 
ATOM   3798 C CE1 . TYR B 1 227 ? 4.462   -25.811 0.981   1.00 23.82 ? 247 TYR B CE1 1 
ATOM   3799 C CE2 . TYR B 1 227 ? 5.054   -23.566 0.336   1.00 23.82 ? 247 TYR B CE2 1 
ATOM   3800 C CZ  . TYR B 1 227 ? 4.272   -24.443 1.052   1.00 23.82 ? 247 TYR B CZ  1 
ATOM   3801 O OH  . TYR B 1 227 ? 3.280   -23.952 1.890   1.00 23.82 ? 247 TYR B OH  1 
ATOM   3802 N N   . THR B 1 228 ? 9.450   -23.901 -0.764  1.00 24.19 ? 248 THR B N   1 
ATOM   3803 C CA  . THR B 1 228 ? 9.793   -22.563 -0.304  1.00 24.19 ? 248 THR B CA  1 
ATOM   3804 C C   . THR B 1 228 ? 8.907   -21.635 -1.157  1.00 24.19 ? 248 THR B C   1 
ATOM   3805 O O   . THR B 1 228 ? 8.587   -22.044 -2.297  1.00 24.19 ? 248 THR B O   1 
ATOM   3806 C CB  . THR B 1 228 ? 11.243  -22.121 -0.435  1.00 23.21 ? 248 THR B CB  1 
ATOM   3807 O OG1 . THR B 1 228 ? 11.515  -21.820 -1.826  1.00 23.21 ? 248 THR B OG1 1 
ATOM   3808 C CG2 . THR B 1 228 ? 12.235  -23.166 0.016   1.00 23.21 ? 248 THR B CG2 1 
ATOM   3809 N N   . SER B 1 229 ? 8.477   -20.519 -0.593  1.00 23.52 ? 249 SER B N   1 
ATOM   3810 C CA  . SER B 1 229 ? 7.618   -19.681 -1.410  1.00 23.52 ? 249 SER B CA  1 
ATOM   3811 C C   . SER B 1 229 ? 7.695   -18.216 -1.114  1.00 23.52 ? 249 SER B C   1 
ATOM   3812 O O   . SER B 1 229 ? 7.966   -17.501 -2.113  1.00 23.52 ? 249 SER B O   1 
ATOM   3813 C CB  . SER B 1 229 ? 6.164   -20.163 -1.284  1.00 23.43 ? 249 SER B CB  1 
ATOM   3814 O OG  . SER B 1 229 ? 5.643   -19.851 -0.032  1.00 23.43 ? 249 SER B OG  1 
ATOM   3815 N N   . TYR B 1 230 ? 7.498   -17.698 0.068   1.00 22.00 ? 250 TYR B N   1 
ATOM   3816 C CA  . TYR B 1 230 ? 7.529   -16.247 0.259   1.00 22.00 ? 250 TYR B CA  1 
ATOM   3817 C C   . TYR B 1 230 ? 8.817   -15.556 -0.134  1.00 22.00 ? 250 TYR B C   1 
ATOM   3818 O O   . TYR B 1 230 ? 8.739   -14.435 -0.707  1.00 22.00 ? 250 TYR B O   1 
ATOM   3819 C CB  . TYR B 1 230 ? 7.178   -15.930 1.747   1.00 20.04 ? 250 TYR B CB  1 
ATOM   3820 C CG  . TYR B 1 230 ? 5.902   -16.675 2.102   1.00 20.04 ? 250 TYR B CG  1 
ATOM   3821 C CD1 . TYR B 1 230 ? 4.722   -16.554 1.428   1.00 20.04 ? 250 TYR B CD1 1 
ATOM   3822 C CD2 . TYR B 1 230 ? 5.965   -17.590 3.173   1.00 20.04 ? 250 TYR B CD2 1 
ATOM   3823 C CE1 . TYR B 1 230 ? 3.596   -17.289 1.772   1.00 20.04 ? 250 TYR B CE1 1 
ATOM   3824 C CE2 . TYR B 1 230 ? 4.849   -18.327 3.548   1.00 20.04 ? 250 TYR B CE2 1 
ATOM   3825 C CZ  . TYR B 1 230 ? 3.667   -18.173 2.850   1.00 20.04 ? 250 TYR B CZ  1 
ATOM   3826 O OH  . TYR B 1 230 ? 2.562   -18.935 3.219   1.00 20.04 ? 250 TYR B OH  1 
ATOM   3827 N N   . GLY B 1 231 ? 9.955   -16.111 0.121   1.00 21.26 ? 251 GLY B N   1 
ATOM   3828 C CA  . GLY B 1 231 ? 11.254  -15.566 -0.197  1.00 21.26 ? 251 GLY B CA  1 
ATOM   3829 C C   . GLY B 1 231 ? 11.428  -15.317 -1.692  1.00 21.26 ? 251 GLY B C   1 
ATOM   3830 O O   . GLY B 1 231 ? 11.699  -14.173 -2.093  1.00 21.26 ? 251 GLY B O   1 
ATOM   3831 N N   . VAL B 1 232 ? 11.280  -16.354 -2.497  1.00 21.25 ? 252 VAL B N   1 
ATOM   3832 C CA  . VAL B 1 232 ? 11.440  -16.277 -3.920  1.00 21.25 ? 252 VAL B CA  1 
ATOM   3833 C C   . VAL B 1 232 ? 10.294  -15.546 -4.570  1.00 21.25 ? 252 VAL B C   1 
ATOM   3834 O O   . VAL B 1 232 ? 10.475  -14.806 -5.570  1.00 21.25 ? 252 VAL B O   1 
ATOM   3835 C CB  . VAL B 1 232 ? 11.608  -17.705 -4.520  1.00 19.86 ? 252 VAL B CB  1 
ATOM   3836 C CG1 . VAL B 1 232 ? 10.309  -18.453 -4.723  1.00 19.86 ? 252 VAL B CG1 1 
ATOM   3837 C CG2 . VAL B 1 232 ? 12.291  -17.567 -5.869  1.00 19.86 ? 252 VAL B CG2 1 
ATOM   3838 N N   . ALA B 1 233 ? 9.077   -15.654 -4.037  1.00 20.75 ? 253 ALA B N   1 
ATOM   3839 C CA  . ALA B 1 233 ? 7.941   -14.949 -4.616  1.00 20.75 ? 253 ALA B CA  1 
ATOM   3840 C C   . ALA B 1 233 ? 8.150   -13.439 -4.503  1.00 20.75 ? 253 ALA B C   1 
ATOM   3841 O O   . ALA B 1 233 ? 7.782   -12.682 -5.400  1.00 20.75 ? 253 ALA B O   1 
ATOM   3842 C CB  . ALA B 1 233 ? 6.639   -15.314 -3.952  1.00 19.91 ? 253 ALA B CB  1 
ATOM   3843 N N   . THR B 1 234 ? 8.731   -12.983 -3.423  1.00 19.61 ? 254 THR B N   1 
ATOM   3844 C CA  . THR B 1 234 ? 8.975   -11.579 -3.151  1.00 19.61 ? 254 THR B CA  1 
ATOM   3845 C C   . THR B 1 234 ? 10.139  -11.065 -3.982  1.00 19.61 ? 254 THR B C   1 
ATOM   3846 O O   . THR B 1 234 ? 10.135  -9.887  -4.425  1.00 19.61 ? 254 THR B O   1 
ATOM   3847 C CB  . THR B 1 234 ? 9.223   -11.352 -1.652  1.00 19.35 ? 254 THR B CB  1 
ATOM   3848 O OG1 . THR B 1 234 ? 8.025   -11.802 -0.949  1.00 19.35 ? 254 THR B OG1 1 
ATOM   3849 C CG2 . THR B 1 234 ? 9.445   -9.904  -1.291  1.00 19.35 ? 254 THR B CG2 1 
ATOM   3850 N N   . SER B 1 235 ? 11.121  -11.878 -4.281  1.00 18.72 ? 255 SER B N   1 
ATOM   3851 C CA  . SER B 1 235 ? 12.241  -11.501 -5.117  1.00 18.72 ? 255 SER B CA  1 
ATOM   3852 C C   . SER B 1 235 ? 11.688  -11.284 -6.531  1.00 18.72 ? 255 SER B C   1 
ATOM   3853 O O   . SER B 1 235 ? 12.016  -10.303 -7.174  1.00 18.72 ? 255 SER B O   1 
ATOM   3854 C CB  . SER B 1 235 ? 13.307  -12.596 -5.078  1.00 17.51 ? 255 SER B CB  1 
ATOM   3855 O OG  A SER B 1 235 ? 13.627  -12.554 -3.590  0.50 17.51 ? 255 SER B OG  1 
ATOM   3856 O OG  B SER B 1 235 ? 12.787  -13.620 -5.959  0.50 17.51 ? 255 SER B OG  1 
ATOM   3857 N N   . ALA B 1 236 ? 10.824  -12.151 -7.058  1.00 18.59 ? 256 ALA B N   1 
ATOM   3858 C CA  . ALA B 1 236 ? 10.235  -12.027 -8.376  1.00 18.59 ? 256 ALA B CA  1 
ATOM   3859 C C   . ALA B 1 236 ? 9.421   -10.727 -8.462  1.00 18.59 ? 256 ALA B C   1 
ATOM   3860 O O   . ALA B 1 236 ? 9.462   -10.024 -9.470  1.00 18.59 ? 256 ALA B O   1 
ATOM   3861 C CB  . ALA B 1 236 ? 9.258   -13.159 -8.662  1.00 17.69 ? 256 ALA B CB  1 
ATOM   3862 N N   . ILE B 1 237 ? 8.661   -10.399 -7.436  1.00 17.83 ? 257 ILE B N   1 
ATOM   3863 C CA  . ILE B 1 237 ? 7.846   -9.218  -7.346  1.00 17.83 ? 257 ILE B CA  1 
ATOM   3864 C C   . ILE B 1 237 ? 8.686   -7.952  -7.320  1.00 17.83 ? 257 ILE B C   1 
ATOM   3865 O O   . ILE B 1 237 ? 8.260   -6.929  -7.894  1.00 17.83 ? 257 ILE B O   1 
ATOM   3866 C CB  . ILE B 1 237 ? 6.943   -9.257  -6.082  1.00 16.01 ? 257 ILE B CB  1 
ATOM   3867 C CG1 . ILE B 1 237 ? 5.919   -10.369 -6.278  1.00 16.01 ? 257 ILE B CG1 1 
ATOM   3868 C CG2 . ILE B 1 237 ? 6.245   -7.924  -5.856  1.00 16.01 ? 257 ILE B CG2 1 
ATOM   3869 C CD1 . ILE B 1 237 ? 4.918   -10.571 -5.198  1.00 16.01 ? 257 ILE B CD1 1 
ATOM   3870 N N   . ARG B 1 238 ? 9.833   -7.955  -6.708  1.00 19.34 ? 258 ARG B N   1 
ATOM   3871 C CA  . ARG B 1 238 ? 10.690  -6.789  -6.655  1.00 19.34 ? 258 ARG B CA  1 
ATOM   3872 C C   . ARG B 1 238 ? 11.183  -6.483  -8.059  1.00 19.34 ? 258 ARG B C   1 
ATOM   3873 O O   . ARG B 1 238 ? 11.188  -5.309  -8.502  1.00 19.34 ? 258 ARG B O   1 
ATOM   3874 C CB  . ARG B 1 238 ? 11.879  -7.014  -5.760  1.00 19.60 ? 258 ARG B CB  1 
ATOM   3875 C CG  . ARG B 1 238 ? 12.658  -5.773  -5.457  1.00 19.60 ? 258 ARG B CG  1 
ATOM   3876 C CD  . ARG B 1 238 ? 13.851  -5.967  -4.592  1.00 19.60 ? 258 ARG B CD  1 
ATOM   3877 N NE  . ARG B 1 238 ? 14.529  -4.701  -4.308  1.00 19.60 ? 258 ARG B NE  1 
ATOM   3878 C CZ  . ARG B 1 238 ? 15.690  -4.629  -3.667  1.00 19.60 ? 258 ARG B CZ  1 
ATOM   3879 N NH1 . ARG B 1 238 ? 16.274  -5.775  -3.279  1.00 19.60 ? 258 ARG B NH1 1 
ATOM   3880 N NH2 . ARG B 1 238 ? 16.244  -3.443  -3.426  1.00 19.60 ? 258 ARG B NH2 1 
ATOM   3881 N N   . ILE B 1 239 ? 11.568  -7.511  -8.798  1.00 20.01 ? 259 ILE B N   1 
ATOM   3882 C CA  . ILE B 1 239 ? 12.035  -7.360  -10.185 1.00 20.01 ? 259 ILE B CA  1 
ATOM   3883 C C   . ILE B 1 239 ? 10.928  -6.814  -11.041 1.00 20.01 ? 259 ILE B C   1 
ATOM   3884 O O   . ILE B 1 239 ? 11.117  -5.805  -11.725 1.00 20.01 ? 259 ILE B O   1 
ATOM   3885 C CB  . ILE B 1 239 ? 12.548  -8.726  -10.737 1.00 17.44 ? 259 ILE B CB  1 
ATOM   3886 C CG1 . ILE B 1 239 ? 13.832  -9.137  -10.009 1.00 17.44 ? 259 ILE B CG1 1 
ATOM   3887 C CG2 . ILE B 1 239 ? 12.856  -8.650  -12.224 1.00 17.44 ? 259 ILE B CG2 1 
ATOM   3888 C CD1 . ILE B 1 239 ? 14.244  -10.539 -10.311 1.00 17.44 ? 259 ILE B CD1 1 
ATOM   3889 N N   . ALA B 1 240 ? 9.747   -7.445  -10.981 1.00 19.76 ? 260 ALA B N   1 
ATOM   3890 C CA  . ALA B 1 240 ? 8.581   -7.065  -11.749 1.00 19.76 ? 260 ALA B CA  1 
ATOM   3891 C C   . ALA B 1 240 ? 8.267   -5.604  -11.538 1.00 19.76 ? 260 ALA B C   1 
ATOM   3892 O O   . ALA B 1 240 ? 7.910   -4.919  -12.520 1.00 19.76 ? 260 ALA B O   1 
ATOM   3893 C CB  . ALA B 1 240 ? 7.319   -7.833  -11.396 1.00 18.11 ? 260 ALA B CB  1 
ATOM   3894 N N   . LYS B 1 241 ? 8.345   -5.085  -10.345 1.00 19.00 ? 261 LYS B N   1 
ATOM   3895 C CA  . LYS B 1 241 ? 8.089   -3.683  -10.061 1.00 19.00 ? 261 LYS B CA  1 
ATOM   3896 C C   . LYS B 1 241 ? 9.111   -2.742  -10.670 1.00 19.00 ? 261 LYS B C   1 
ATOM   3897 O O   . LYS B 1 241 ? 8.761   -1.618  -11.079 1.00 19.00 ? 261 LYS B O   1 
ATOM   3898 C CB  . LYS B 1 241 ? 8.076   -3.514  -8.530  1.00 16.97 ? 261 LYS B CB  1 
ATOM   3899 C CG  . LYS B 1 241 ? 6.721   -3.930  -7.981  1.00 16.97 ? 261 LYS B CG  1 
ATOM   3900 C CD  . LYS B 1 241 ? 6.768   -3.626  -6.465  1.00 16.97 ? 261 LYS B CD  1 
ATOM   3901 C CE  . LYS B 1 241 ? 5.391   -4.026  -5.915  1.00 16.97 ? 261 LYS B CE  1 
ATOM   3902 N NZ  . LYS B 1 241 ? 5.335   -3.744  -4.459  1.00 16.97 ? 261 LYS B NZ  1 
ATOM   3903 N N   . ALA B 1 242 ? 10.365  -3.151  -10.765 1.00 18.47 ? 262 ALA B N   1 
ATOM   3904 C CA  . ALA B 1 242 ? 11.433  -2.336  -11.331 1.00 18.47 ? 262 ALA B CA  1 
ATOM   3905 C C   . ALA B 1 242 ? 11.226  -2.223  -12.837 1.00 18.47 ? 262 ALA B C   1 
ATOM   3906 O O   . ALA B 1 242 ? 11.477  -1.186  -13.435 1.00 18.47 ? 262 ALA B O   1 
ATOM   3907 C CB  . ALA B 1 242 ? 12.795  -2.919  -10.997 1.00 17.34 ? 262 ALA B CB  1 
ATOM   3908 N N   . VAL B 1 243 ? 10.727  -3.258  -13.467 1.00 17.34 ? 263 VAL B N   1 
ATOM   3909 C CA  . VAL B 1 243 ? 10.425  -3.342  -14.873 1.00 17.34 ? 263 VAL B CA  1 
ATOM   3910 C C   . VAL B 1 243 ? 9.283   -2.400  -15.195 1.00 17.34 ? 263 VAL B C   1 
ATOM   3911 O O   . VAL B 1 243 ? 9.538   -1.403  -15.846 1.00 17.34 ? 263 VAL B O   1 
ATOM   3912 C CB  . VAL B 1 243 ? 10.040  -4.765  -15.294 1.00 15.92 ? 263 VAL B CB  1 
ATOM   3913 C CG1 . VAL B 1 243 ? 9.513   -4.833  -16.694 1.00 15.92 ? 263 VAL B CG1 1 
ATOM   3914 C CG2 . VAL B 1 243 ? 11.270  -5.680  -15.202 1.00 15.92 ? 263 VAL B CG2 1 
ATOM   3915 N N   . MET B 1 244 ? 8.089   -2.622  -14.657 1.00 17.01 ? 264 MET B N   1 
ATOM   3916 C CA  . MET B 1 244 ? 6.947   -1.769  -14.935 1.00 17.01 ? 264 MET B CA  1 
ATOM   3917 C C   . MET B 1 244 ? 7.163   -0.319  -14.641 1.00 17.01 ? 264 MET B C   1 
ATOM   3918 O O   . MET B 1 244 ? 6.563   0.570   -15.323 1.00 17.01 ? 264 MET B O   1 
ATOM   3919 C CB  . MET B 1 244 ? 5.710   -2.238  -14.127 1.00 16.42 ? 264 MET B CB  1 
ATOM   3920 C CG  . MET B 1 244 ? 5.264   -3.622  -14.602 1.00 16.42 ? 264 MET B CG  1 
ATOM   3921 S SD  . MET B 1 244 ? 3.830   -4.223  -13.681 1.00 16.42 ? 264 MET B SD  1 
ATOM   3922 C CE  . MET B 1 244 ? 4.452   -4.075  -11.982 1.00 16.42 ? 264 MET B CE  1 
ATOM   3923 N N   . ALA B 1 245 ? 7.931   0.067   -13.673 1.00 18.00 ? 265 ALA B N   1 
ATOM   3924 C CA  . ALA B 1 245 ? 8.171   1.437   -13.267 1.00 18.00 ? 265 ALA B CA  1 
ATOM   3925 C C   . ALA B 1 245 ? 9.401   2.025   -13.916 1.00 18.00 ? 265 ALA B C   1 
ATOM   3926 O O   . ALA B 1 245 ? 9.770   3.177   -13.626 1.00 18.00 ? 265 ALA B O   1 
ATOM   3927 C CB  . ALA B 1 245 ? 8.471   1.447   -11.743 1.00 16.40 ? 265 ALA B CB  1 
ATOM   3928 N N   . ASP B 1 246 ? 10.083  1.173   -14.675 1.00 20.98 ? 266 ASP B N   1 
ATOM   3929 C CA  . ASP B 1 246 ? 11.302  1.514   -15.367 1.00 20.98 ? 266 ASP B CA  1 
ATOM   3930 C C   . ASP B 1 246 ? 12.247  2.204   -14.406 1.00 20.98 ? 266 ASP B C   1 
ATOM   3931 O O   . ASP B 1 246 ? 12.757  3.286   -14.640 1.00 20.98 ? 266 ASP B O   1 
ATOM   3932 C CB  . ASP B 1 246 ? 10.910  2.442   -16.519 1.00 24.79 ? 266 ASP B CB  1 
ATOM   3933 C CG  . ASP B 1 246 ? 12.049  2.604   -17.474 1.00 24.79 ? 266 ASP B CG  1 
ATOM   3934 O OD1 . ASP B 1 246 ? 12.939  1.739   -17.618 1.00 24.79 ? 266 ASP B OD1 1 
ATOM   3935 O OD2 . ASP B 1 246 ? 12.062  3.682   -18.098 1.00 24.79 ? 266 ASP B OD2 1 
ATOM   3936 N N   . ALA B 1 247 ? 12.550  1.552   -13.261 1.00 20.38 ? 267 ALA B N   1 
ATOM   3937 C CA  . ALA B 1 247 ? 13.365  2.159   -12.234 1.00 20.38 ? 267 ALA B CA  1 
ATOM   3938 C C   . ALA B 1 247 ? 14.816  2.260   -12.498 1.00 20.38 ? 267 ALA B C   1 
ATOM   3939 O O   . ALA B 1 247 ? 15.446  3.181   -11.925 1.00 20.38 ? 267 ALA B O   1 
ATOM   3940 C CB  . ALA B 1 247 ? 13.217  1.352   -10.914 1.00 19.54 ? 267 ALA B CB  1 
ATOM   3941 N N   . HIS B 1 248 ? 15.438  1.428   -13.313 1.00 20.24 ? 268 HIS B N   1 
ATOM   3942 C CA  . HIS B 1 248 ? 16.894  1.510   -13.519 1.00 20.24 ? 268 HIS B CA  1 
ATOM   3943 C C   . HIS B 1 248 ? 17.517  1.170   -12.174 1.00 20.24 ? 268 HIS B C   1 
ATOM   3944 O O   . HIS B 1 248 ? 18.456  1.819   -11.724 1.00 20.24 ? 268 HIS B O   1 
ATOM   3945 C CB  . HIS B 1 248 ? 17.360  2.882   -13.935 1.00 21.32 ? 268 HIS B CB  1 
ATOM   3946 C CG  . HIS B 1 248 ? 16.914  3.320   -15.297 1.00 21.32 ? 268 HIS B CG  1 
ATOM   3947 N ND1 . HIS B 1 248 ? 17.787  3.883   -16.179 1.00 21.32 ? 268 HIS B ND1 1 
ATOM   3948 C CD2 . HIS B 1 248 ? 15.710  3.262   -15.912 1.00 21.32 ? 268 HIS B CD2 1 
ATOM   3949 C CE1 . HIS B 1 248 ? 17.117  4.138   -17.293 1.00 21.32 ? 268 HIS B CE1 1 
ATOM   3950 N NE2 . HIS B 1 248 ? 15.853  3.776   -17.161 1.00 21.32 ? 268 HIS B NE2 1 
ATOM   3951 N N   . ALA B 1 249 ? 16.951  0.132   -11.553 1.00 19.81 ? 269 ALA B N   1 
ATOM   3952 C CA  . ALA B 1 249 ? 17.392  -0.269  -10.222 1.00 19.81 ? 269 ALA B CA  1 
ATOM   3953 C C   . ALA B 1 249 ? 18.492  -1.309  -10.314 1.00 19.81 ? 269 ALA B C   1 
ATOM   3954 O O   . ALA B 1 249 ? 18.405  -2.196  -11.169 1.00 19.81 ? 269 ALA B O   1 
ATOM   3955 C CB  . ALA B 1 249 ? 16.197  -0.871  -9.462  1.00 19.04 ? 269 ALA B CB  1 
ATOM   3956 N N   . GLU B 1 250 ? 19.479  -1.223  -9.437  1.00 22.02 ? 270 GLU B N   1 
ATOM   3957 C CA  . GLU B 1 250 ? 20.533  -2.222  -9.429  1.00 22.02 ? 270 GLU B CA  1 
ATOM   3958 C C   . GLU B 1 250 ? 20.061  -3.459  -8.690  1.00 22.02 ? 270 GLU B C   1 
ATOM   3959 O O   . GLU B 1 250 ? 19.873  -3.373  -7.440  1.00 22.02 ? 270 GLU B O   1 
ATOM   3960 C CB  . GLU B 1 250 ? 21.765  -1.663  -8.717  1.00 23.55 ? 270 GLU B CB  1 
ATOM   3961 C CG  . GLU B 1 250 ? 22.939  -2.628  -8.879  1.00 23.55 ? 270 GLU B CG  1 
ATOM   3962 C CD  . GLU B 1 250 ? 24.013  -2.280  -7.884  1.00 23.55 ? 270 GLU B CD  1 
ATOM   3963 O OE1 . GLU B 1 250 ? 24.744  -1.272  -8.134  1.00 23.55 ? 270 GLU B OE1 1 
ATOM   3964 O OE2 . GLU B 1 250 ? 24.055  -3.010  -6.860  1.00 23.55 ? 270 GLU B OE2 1 
ATOM   3965 N N   . LEU B 1 251 ? 19.850  -4.581  -9.338  1.00 23.02 ? 271 LEU B N   1 
ATOM   3966 C CA  . LEU B 1 251 ? 19.386  -5.805  -8.683  1.00 23.02 ? 271 LEU B CA  1 
ATOM   3967 C C   . LEU B 1 251 ? 20.243  -6.995  -9.100  1.00 23.02 ? 271 LEU B C   1 
ATOM   3968 O O   . LEU B 1 251 ? 20.663  -7.096  -10.266 1.00 23.02 ? 271 LEU B O   1 
ATOM   3969 C CB  . LEU B 1 251 ? 17.945  -6.088  -9.080  1.00 20.80 ? 271 LEU B CB  1 
ATOM   3970 C CG  . LEU B 1 251 ? 16.816  -5.176  -8.627  1.00 20.80 ? 271 LEU B CG  1 
ATOM   3971 C CD1 . LEU B 1 251 ? 15.531  -5.573  -9.345  1.00 20.80 ? 271 LEU B CD1 1 
ATOM   3972 C CD2 . LEU B 1 251 ? 16.579  -5.233  -7.148  1.00 20.80 ? 271 LEU B CD2 1 
ATOM   3973 N N   . VAL B 1 252 ? 20.518  -7.920  -8.180  1.00 24.11 ? 272 VAL B N   1 
ATOM   3974 C CA  . VAL B 1 252 ? 21.327  -9.090  -8.615  1.00 24.11 ? 272 VAL B CA  1 
ATOM   3975 C C   . VAL B 1 252 ? 20.338  -10.092 -9.168  1.00 24.11 ? 272 VAL B C   1 
ATOM   3976 O O   . VAL B 1 252 ? 19.415  -10.560 -8.520  1.00 24.11 ? 272 VAL B O   1 
ATOM   3977 C CB  . VAL B 1 252 ? 22.235  -9.627  -7.519  1.00 23.77 ? 272 VAL B CB  1 
ATOM   3978 C CG1 . VAL B 1 252 ? 21.447  -10.014 -6.293  1.00 23.77 ? 272 VAL B CG1 1 
ATOM   3979 C CG2 . VAL B 1 252 ? 23.013  -10.867 -7.974  1.00 23.77 ? 272 VAL B CG2 1 
ATOM   3980 N N   . VAL B 1 253 ? 20.447  -10.397 -10.451 1.00 25.58 ? 273 VAL B N   1 
ATOM   3981 C CA  . VAL B 1 253 ? 19.566  -11.319 -11.143 1.00 25.58 ? 273 VAL B CA  1 
ATOM   3982 C C   . VAL B 1 253 ? 20.412  -12.175 -12.094 1.00 25.58 ? 273 VAL B C   1 
ATOM   3983 O O   . VAL B 1 253 ? 21.572  -11.835 -12.346 1.00 25.58 ? 273 VAL B O   1 
ATOM   3984 C CB  . VAL B 1 253 ? 18.507  -10.609 -11.976 1.00 25.64 ? 273 VAL B CB  1 
ATOM   3985 C CG1 . VAL B 1 253 ? 17.523  -9.764  -11.166 1.00 25.64 ? 273 VAL B CG1 1 
ATOM   3986 C CG2 . VAL B 1 253 ? 19.170  -9.677  -12.993 1.00 25.64 ? 273 VAL B CG2 1 
ATOM   3987 N N   . SER B 1 254 ? 19.814  -13.200 -12.652 1.00 29.03 ? 274 SER B N   1 
ATOM   3988 C CA  . SER B 1 254 ? 20.488  -14.073 -13.592 1.00 29.03 ? 274 SER B CA  1 
ATOM   3989 C C   . SER B 1 254 ? 20.382  -13.405 -14.961 1.00 29.03 ? 274 SER B C   1 
ATOM   3990 O O   . SER B 1 254 ? 19.279  -13.403 -15.510 1.00 29.03 ? 274 SER B O   1 
ATOM   3991 C CB  . SER B 1 254 ? 19.811  -15.423 -13.641 1.00 29.60 ? 274 SER B CB  1 
ATOM   3992 O OG  . SER B 1 254 ? 20.555  -16.381 -14.360 1.00 29.60 ? 274 SER B OG  1 
ATOM   3993 N N   . ASN B 1 255 ? 21.471  -12.841 -15.413 1.00 34.09 ? 275 ASN B N   1 
ATOM   3994 C CA  . ASN B 1 255 ? 21.489  -12.163 -16.725 1.00 34.09 ? 275 ASN B CA  1 
ATOM   3995 C C   . ASN B 1 255 ? 22.668  -12.652 -17.553 1.00 34.09 ? 275 ASN B C   1 
ATOM   3996 O O   . ASN B 1 255 ? 23.593  -13.249 -16.988 1.00 34.09 ? 275 ASN B O   1 
ATOM   3997 C CB  . ASN B 1 255 ? 21.582  -10.650 -16.517 1.00 32.08 ? 275 ASN B CB  1 
ATOM   3998 C CG  . ASN B 1 255 ? 22.809  -10.180 -15.773 1.00 32.08 ? 275 ASN B CG  1 
ATOM   3999 O OD1 . ASN B 1 255 ? 23.659  -9.465  -16.290 1.00 32.08 ? 275 ASN B OD1 1 
ATOM   4000 N ND2 . ASN B 1 255 ? 22.939  -10.537 -14.511 1.00 32.08 ? 275 ASN B ND2 1 
ATOM   4001 N N   . ARG B 1 256 ? 22.644  -12.460 -18.884 1.00 40.89 ? 276 ARG B N   1 
ATOM   4002 C CA  . ARG B 1 256 ? 23.787  -12.922 -19.680 1.00 40.89 ? 276 ARG B CA  1 
ATOM   4003 C C   . ARG B 1 256 ? 24.766  -11.794 -20.003 1.00 40.89 ? 276 ARG B C   1 
ATOM   4004 O O   . ARG B 1 256 ? 24.549  -11.033 -20.937 1.00 40.89 ? 276 ARG B O   1 
ATOM   4005 C CB  . ARG B 1 256 ? 23.370  -13.604 -20.988 1.00 50.68 ? 276 ARG B CB  1 
ATOM   4006 C CG  . ARG B 1 256 ? 24.588  -14.387 -21.511 1.00 50.68 ? 276 ARG B CG  1 
ATOM   4007 C CD  . ARG B 1 256 ? 24.250  -15.341 -22.645 1.00 50.68 ? 276 ARG B CD  1 
ATOM   4008 N NE  . ARG B 1 256 ? 23.628  -14.579 -23.699 1.00 50.68 ? 276 ARG B NE  1 
ATOM   4009 C CZ  . ARG B 1 256 ? 24.080  -13.628 -24.493 1.00 50.68 ? 276 ARG B CZ  1 
ATOM   4010 N NH1 . ARG B 1 256 ? 25.334  -13.168 -24.524 1.00 50.68 ? 276 ARG B NH1 1 
ATOM   4011 N NH2 . ARG B 1 256 ? 23.230  -13.037 -25.380 1.00 50.68 ? 276 ARG B NH2 1 
ATOM   4012 N N   . ARG B 1 257 ? 25.817  -11.667 -19.206 1.00 43.85 ? 277 ARG B N   1 
ATOM   4013 C CA  . ARG B 1 257 ? 26.824  -10.647 -19.418 1.00 43.85 ? 277 ARG B CA  1 
ATOM   4014 C C   . ARG B 1 257 ? 27.723  -11.074 -20.583 1.00 43.85 ? 277 ARG B C   1 
ATOM   4015 O O   . ARG B 1 257 ? 27.963  -12.262 -20.833 1.00 43.85 ? 277 ARG B O   1 
ATOM   4016 C CB  . ARG B 1 257 ? 27.746  -10.462 -18.250 1.00 41.47 ? 277 ARG B CB  1 
ATOM   4017 C CG  . ARG B 1 257 ? 27.074  -9.964  -16.989 1.00 41.47 ? 277 ARG B CG  1 
ATOM   4018 C CD  . ARG B 1 257 ? 27.954  -10.284 -15.791 1.00 41.47 ? 277 ARG B CD  1 
ATOM   4019 N NE  . ARG B 1 257 ? 29.237  -9.603  -15.916 1.00 41.47 ? 277 ARG B NE  1 
ATOM   4020 C CZ  . ARG B 1 257 ? 29.400  -8.315  -15.648 1.00 41.47 ? 277 ARG B CZ  1 
ATOM   4021 N NH1 . ARG B 1 257 ? 28.377  -7.557  -15.263 1.00 41.47 ? 277 ARG B NH1 1 
ATOM   4022 N NH2 . ARG B 1 257 ? 30.613  -7.780  -15.728 1.00 41.47 ? 277 ARG B NH2 1 
ATOM   4023 N N   . ASP B 1 258 ? 28.238  -10.064 -21.273 1.00 49.43 ? 278 ASP B N   1 
ATOM   4024 C CA  . ASP B 1 258 ? 29.115  -10.389 -22.452 1.00 49.43 ? 278 ASP B CA  1 
ATOM   4025 C C   . ASP B 1 258 ? 30.353  -11.050 -21.965 1.00 49.43 ? 278 ASP B C   1 
ATOM   4026 O O   . ASP B 1 258 ? 30.618  -12.208 -22.410 1.00 49.43 ? 278 ASP B O   1 
ATOM   4027 C CB  . ASP B 1 258 ? 29.289  -9.091  -23.233 1.00 53.41 ? 278 ASP B CB  1 
ATOM   4028 C CG  . ASP B 1 258 ? 27.923  -8.849  -23.934 1.00 53.41 ? 278 ASP B CG  1 
ATOM   4029 O OD1 . ASP B 1 258 ? 27.179  -9.868  -24.067 1.00 53.41 ? 278 ASP B OD1 1 
ATOM   4030 O OD2 . ASP B 1 258 ? 27.677  -7.676  -24.279 1.00 53.41 ? 278 ASP B OD2 1 
ATOM   4031 N N   . ASP B 1 259 ? 31.094  -10.564 -20.995 1.00 48.74 ? 279 ASP B N   1 
ATOM   4032 C CA  . ASP B 1 259 ? 32.279  -11.260 -20.489 1.00 48.74 ? 279 ASP B CA  1 
ATOM   4033 C C   . ASP B 1 259 ? 32.077  -12.680 -20.010 1.00 48.74 ? 279 ASP B C   1 
ATOM   4034 O O   . ASP B 1 259 ? 33.087  -13.420 -19.860 1.00 48.74 ? 279 ASP B O   1 
ATOM   4035 C CB  . ASP B 1 259 ? 32.900  -10.485 -19.313 1.00 50.89 ? 279 ASP B CB  1 
ATOM   4036 C CG  . ASP B 1 259 ? 31.955  -10.218 -18.192 1.00 50.89 ? 279 ASP B CG  1 
ATOM   4037 O OD1 . ASP B 1 259 ? 30.719  -10.306 -18.325 1.00 50.89 ? 279 ASP B OD1 1 
ATOM   4038 O OD2 . ASP B 1 259 ? 32.495  -9.879  -17.108 1.00 50.89 ? 279 ASP B OD2 1 
ATOM   4039 N N   . MET B 1 260 ? 30.885  -13.130 -19.710 1.00 44.39 ? 280 MET B N   1 
ATOM   4040 C CA  . MET B 1 260 ? 30.625  -14.477 -19.271 1.00 44.39 ? 280 MET B CA  1 
ATOM   4041 C C   . MET B 1 260 ? 30.038  -15.273 -20.426 1.00 44.39 ? 280 MET B C   1 
ATOM   4042 O O   . MET B 1 260 ? 30.244  -16.482 -20.510 1.00 44.39 ? 280 MET B O   1 
ATOM   4043 C CB  . MET B 1 260 ? 29.637  -14.510 -18.096 1.00 44.42 ? 280 MET B CB  1 
ATOM   4044 C CG  . MET B 1 260 ? 30.141  -13.729 -16.887 1.00 44.42 ? 280 MET B CG  1 
ATOM   4045 S SD  . MET B 1 260 ? 31.492  -14.606 -16.084 1.00 44.42 ? 280 MET B SD  1 
ATOM   4046 C CE  . MET B 1 260 ? 32.646  -13.277 -15.764 1.00 44.42 ? 280 MET B CE  1 
ATOM   4047 N N   . GLY B 1 261 ? 29.257  -14.672 -21.310 1.00 41.46 ? 281 GLY B N   1 
ATOM   4048 C CA  . GLY B 1 261 ? 28.635  -15.387 -22.421 1.00 41.46 ? 281 GLY B CA  1 
ATOM   4049 C C   . GLY B 1 261 ? 27.683  -16.492 -22.043 1.00 41.46 ? 281 GLY B C   1 
ATOM   4050 O O   . GLY B 1 261 ? 27.324  -17.365 -22.858 1.00 41.46 ? 281 GLY B O   1 
ATOM   4051 N N   . MET B 1 262 ? 27.156  -16.515 -20.841 1.00 38.07 ? 282 MET B N   1 
ATOM   4052 C CA  . MET B 1 262 ? 26.267  -17.460 -20.245 1.00 38.07 ? 282 MET B CA  1 
ATOM   4053 C C   . MET B 1 262 ? 25.573  -16.859 -19.034 1.00 38.07 ? 282 MET B C   1 
ATOM   4054 O O   . MET B 1 262 ? 26.166  -16.115 -18.246 1.00 38.07 ? 282 MET B O   1 
ATOM   4055 C CB  . MET B 1 262 ? 27.077  -18.690 -19.771 1.00 40.28 ? 282 MET B CB  1 
ATOM   4056 C CG  . MET B 1 262 ? 26.174  -19.789 -19.281 1.00 40.28 ? 282 MET B CG  1 
ATOM   4057 S SD  . MET B 1 262 ? 24.933  -20.256 -20.496 1.00 40.28 ? 282 MET B SD  1 
ATOM   4058 C CE  . MET B 1 262 ? 23.492  -20.259 -19.449 1.00 40.28 ? 282 MET B CE  1 
ATOM   4059 N N   . TYR B 1 263 ? 24.302  -17.163 -18.896 1.00 33.96 ? 283 TYR B N   1 
ATOM   4060 C CA  . TYR B 1 263 ? 23.544  -16.641 -17.750 1.00 33.96 ? 283 TYR B CA  1 
ATOM   4061 C C   . TYR B 1 263 ? 24.125  -17.040 -16.409 1.00 33.96 ? 283 TYR B C   1 
ATOM   4062 O O   . TYR B 1 263 ? 24.496  -18.200 -16.168 1.00 33.96 ? 283 TYR B O   1 
ATOM   4063 C CB  . TYR B 1 263 ? 22.120  -17.158 -17.828 1.00 31.86 ? 283 TYR B CB  1 
ATOM   4064 C CG  . TYR B 1 263 ? 21.234  -16.382 -18.763 1.00 31.86 ? 283 TYR B CG  1 
ATOM   4065 C CD1 . TYR B 1 263 ? 21.149  -16.699 -20.100 1.00 31.86 ? 283 TYR B CD1 1 
ATOM   4066 C CD2 . TYR B 1 263 ? 20.443  -15.335 -18.307 1.00 31.86 ? 283 TYR B CD2 1 
ATOM   4067 C CE1 . TYR B 1 263 ? 20.306  -16.002 -20.959 1.00 31.86 ? 283 TYR B CE1 1 
ATOM   4068 C CE2 . TYR B 1 263 ? 19.594  -14.631 -19.146 1.00 31.86 ? 283 TYR B CE2 1 
ATOM   4069 C CZ  . TYR B 1 263 ? 19.530  -14.975 -20.474 1.00 31.86 ? 283 TYR B CZ  1 
ATOM   4070 O OH  . TYR B 1 263 ? 18.693  -14.296 -21.332 1.00 31.86 ? 283 TYR B OH  1 
ATOM   4071 N N   . LEU B 1 264 ? 24.236  -16.079 -15.519 1.00 30.80 ? 284 LEU B N   1 
ATOM   4072 C CA  . LEU B 1 264 ? 24.692  -16.285 -14.138 1.00 30.80 ? 284 LEU B CA  1 
ATOM   4073 C C   . LEU B 1 264 ? 24.234  -15.020 -13.347 1.00 30.80 ? 284 LEU B C   1 
ATOM   4074 O O   . LEU B 1 264 ? 23.850  -14.025 -13.981 1.00 30.80 ? 284 LEU B O   1 
ATOM   4075 C CB  . LEU B 1 264 ? 26.143  -16.554 -13.943 1.00 32.12 ? 284 LEU B CB  1 
ATOM   4076 C CG  . LEU B 1 264 ? 27.315  -15.720 -14.358 1.00 32.12 ? 284 LEU B CG  1 
ATOM   4077 C CD1 . LEU B 1 264 ? 27.420  -14.358 -13.700 1.00 32.12 ? 284 LEU B CD1 1 
ATOM   4078 C CD2 . LEU B 1 264 ? 28.619  -16.452 -13.964 1.00 32.12 ? 284 LEU B CD2 1 
ATOM   4079 N N   . SER B 1 265 ? 24.239  -15.088 -12.033 1.00 25.86 ? 285 SER B N   1 
ATOM   4080 C CA  . SER B 1 265 ? 23.788  -13.972 -11.234 1.00 25.86 ? 285 SER B CA  1 
ATOM   4081 C C   . SER B 1 265 ? 24.939  -13.039 -10.936 1.00 25.86 ? 285 SER B C   1 
ATOM   4082 O O   . SER B 1 265 ? 25.992  -13.412 -10.442 1.00 25.86 ? 285 SER B O   1 
ATOM   4083 C CB  . SER B 1 265 ? 23.164  -14.429 -9.913  1.00 25.33 ? 285 SER B CB  1 
ATOM   4084 O OG  . SER B 1 265 ? 21.892  -14.983 -10.196 1.00 25.33 ? 285 SER B OG  1 
ATOM   4085 N N   . TYR B 1 266 ? 24.693  -11.788 -11.249 1.00 24.09 ? 286 TYR B N   1 
ATOM   4086 C CA  . TYR B 1 266 ? 25.658  -10.716 -11.050 1.00 24.09 ? 286 TYR B CA  1 
ATOM   4087 C C   . TYR B 1 266 ? 24.788  -9.488  -11.072 1.00 24.09 ? 286 TYR B C   1 
ATOM   4088 O O   . TYR B 1 266 ? 23.829  -9.539  -11.858 1.00 24.09 ? 286 TYR B O   1 
ATOM   4089 C CB  . TYR B 1 266 ? 26.645  -10.770 -12.202 1.00 26.69 ? 286 TYR B CB  1 
ATOM   4090 C CG  . TYR B 1 266 ? 27.895  -9.938  -12.066 1.00 26.69 ? 286 TYR B CG  1 
ATOM   4091 C CD1 . TYR B 1 266 ? 27.945  -8.585  -12.330 1.00 26.69 ? 286 TYR B CD1 1 
ATOM   4092 C CD2 . TYR B 1 266 ? 29.057  -10.562 -11.633 1.00 26.69 ? 286 TYR B CD2 1 
ATOM   4093 C CE1 . TYR B 1 266 ? 29.126  -7.868  -12.155 1.00 26.69 ? 286 TYR B CE1 1 
ATOM   4094 C CE2 . TYR B 1 266 ? 30.233  -9.851  -11.470 1.00 26.69 ? 286 TYR B CE2 1 
ATOM   4095 C CZ  . TYR B 1 266 ? 30.267  -8.505  -11.734 1.00 26.69 ? 286 TYR B CZ  1 
ATOM   4096 O OH  . TYR B 1 266 ? 31.433  -7.793  -11.560 1.00 26.69 ? 286 TYR B OH  1 
ATOM   4097 N N   . PRO B 1 267 ? 24.997  -8.455  -10.310 1.00 22.49 ? 287 PRO B N   1 
ATOM   4098 C CA  . PRO B 1 267 ? 24.160  -7.255  -10.340 1.00 22.49 ? 287 PRO B CA  1 
ATOM   4099 C C   . PRO B 1 267 ? 24.089  -6.589  -11.715 1.00 22.49 ? 287 PRO B C   1 
ATOM   4100 O O   . PRO B 1 267 ? 25.082  -6.462  -12.440 1.00 22.49 ? 287 PRO B O   1 
ATOM   4101 C CB  . PRO B 1 267 ? 24.776  -6.306  -9.300  1.00 21.95 ? 287 PRO B CB  1 
ATOM   4102 C CG  . PRO B 1 267 ? 26.131  -6.884  -9.018  1.00 21.95 ? 287 PRO B CG  1 
ATOM   4103 C CD  . PRO B 1 267 ? 26.109  -8.356  -9.358  1.00 21.95 ? 287 PRO B CD  1 
ATOM   4104 N N   . ALA B 1 268 ? 22.919  -6.127  -12.123 1.00 21.27 ? 288 ALA B N   1 
ATOM   4105 C CA  . ALA B 1 268 ? 22.593  -5.492  -13.378 1.00 21.27 ? 288 ALA B CA  1 
ATOM   4106 C C   . ALA B 1 268 ? 21.640  -4.332  -13.132 1.00 21.27 ? 288 ALA B C   1 
ATOM   4107 O O   . ALA B 1 268 ? 21.106  -4.254  -12.023 1.00 21.27 ? 288 ALA B O   1 
ATOM   4108 C CB  . ALA B 1 268 ? 21.878  -6.458  -14.313 1.00 20.33 ? 288 ALA B CB  1 
ATOM   4109 N N   . ILE B 1 269 ? 21.446  -3.453  -14.112 1.00 18.58 ? 289 ILE B N   1 
ATOM   4110 C CA  . ILE B 1 269 ? 20.526  -2.307  -13.929 1.00 18.58 ? 289 ILE B CA  1 
ATOM   4111 C C   . ILE B 1 269 ? 19.266  -2.682  -14.669 1.00 18.58 ? 289 ILE B C   1 
ATOM   4112 O O   . ILE B 1 269 ? 19.394  -2.967  -15.850 1.00 18.58 ? 289 ILE B O   1 
ATOM   4113 C CB  . ILE B 1 269 ? 21.180  -1.055  -14.435 1.00 18.01 ? 289 ILE B CB  1 
ATOM   4114 C CG1 . ILE B 1 269 ? 22.568  -0.901  -13.762 1.00 18.01 ? 289 ILE B CG1 1 
ATOM   4115 C CG2 . ILE B 1 269 ? 20.378  0.182   -14.131 1.00 18.01 ? 289 ILE B CG2 1 
ATOM   4116 C CD1 . ILE B 1 269 ? 22.598  -0.713  -12.287 1.00 18.01 ? 289 ILE B CD1 1 
ATOM   4117 N N   . ILE B 1 270 ? 18.148  -2.791  -13.950 1.00 18.88 ? 290 ILE B N   1 
ATOM   4118 C CA  . ILE B 1 270 ? 16.878  -3.246  -14.484 1.00 18.88 ? 290 ILE B CA  1 
ATOM   4119 C C   . ILE B 1 270 ? 15.871  -2.121  -14.713 1.00 18.88 ? 290 ILE B C   1 
ATOM   4120 O O   . ILE B 1 270 ? 15.661  -1.232  -13.871 1.00 18.88 ? 290 ILE B O   1 
ATOM   4121 C CB  . ILE B 1 270 ? 16.210  -4.265  -13.522 1.00 18.17 ? 290 ILE B CB  1 
ATOM   4122 C CG1 . ILE B 1 270 ? 17.158  -5.413  -13.197 1.00 18.17 ? 290 ILE B CG1 1 
ATOM   4123 C CG2 . ILE B 1 270 ? 14.895  -4.838  -14.057 1.00 18.17 ? 290 ILE B CG2 1 
ATOM   4124 C CD1 . ILE B 1 270 ? 17.668  -6.257  -14.341 1.00 18.17 ? 290 ILE B CD1 1 
ATOM   4125 N N   . GLY B 1 271 ? 15.208  -2.202  -15.870 1.00 19.40 ? 291 GLY B N   1 
ATOM   4126 C CA  . GLY B 1 271 ? 14.208  -1.212  -16.250 1.00 19.40 ? 291 GLY B CA  1 
ATOM   4127 C C   . GLY B 1 271 ? 13.137  -1.837  -17.107 1.00 19.40 ? 291 GLY B C   1 
ATOM   4128 O O   . GLY B 1 271 ? 13.120  -3.080  -17.239 1.00 19.40 ? 291 GLY B O   1 
ATOM   4129 N N   . ARG B 1 272 ? 12.290  -1.044  -17.738 1.00 22.28 ? 292 ARG B N   1 
ATOM   4130 C CA  . ARG B 1 272 ? 11.182  -1.581  -18.526 1.00 22.28 ? 292 ARG B CA  1 
ATOM   4131 C C   . ARG B 1 272 ? 11.604  -2.435  -19.698 1.00 22.28 ? 292 ARG B C   1 
ATOM   4132 O O   . ARG B 1 272 ? 10.844  -3.330  -20.160 1.00 22.28 ? 292 ARG B O   1 
ATOM   4133 C CB  . ARG B 1 272 ? 10.314  -0.395  -18.986 1.00 21.65 ? 292 ARG B CB  1 
ATOM   4134 C CG  . ARG B 1 272 ? 8.971   -0.782  -19.553 1.00 21.65 ? 292 ARG B CG  1 
ATOM   4135 C CD  . ARG B 1 272 ? 7.966   0.308   -19.641 1.00 21.65 ? 292 ARG B CD  1 
ATOM   4136 N NE  . ARG B 1 272 ? 7.613   0.979   -18.398 1.00 21.65 ? 292 ARG B NE  1 
ATOM   4137 C CZ  . ARG B 1 272 ? 7.388   2.263   -18.220 1.00 21.65 ? 292 ARG B CZ  1 
ATOM   4138 N NH1 . ARG B 1 272 ? 7.475   3.088   -19.282 1.00 21.65 ? 292 ARG B NH1 1 
ATOM   4139 N NH2 . ARG B 1 272 ? 7.045   2.805   -17.064 1.00 21.65 ? 292 ARG B NH2 1 
ATOM   4140 N N   . ASP B 1 273 ? 12.800  -2.240  -20.235 1.00 28.00 ? 293 ASP B N   1 
ATOM   4141 C CA  . ASP B 1 273 ? 13.272  -3.037  -21.359 1.00 28.00 ? 293 ASP B CA  1 
ATOM   4142 C C   . ASP B 1 273 ? 14.191  -4.129  -20.892 1.00 28.00 ? 293 ASP B C   1 
ATOM   4143 O O   . ASP B 1 273 ? 14.952  -4.666  -21.681 1.00 28.00 ? 293 ASP B O   1 
ATOM   4144 C CB  . ASP B 1 273 ? 14.014  -2.110  -22.367 1.00 34.63 ? 293 ASP B CB  1 
ATOM   4145 C CG  . ASP B 1 273 ? 12.971  -1.270  -23.119 1.00 34.63 ? 293 ASP B CG  1 
ATOM   4146 O OD1 . ASP B 1 273 ? 11.973  -1.921  -23.559 1.00 34.63 ? 293 ASP B OD1 1 
ATOM   4147 O OD2 . ASP B 1 273 ? 13.087  -0.021  -23.233 1.00 34.63 ? 293 ASP B OD2 1 
ATOM   4148 N N   . GLY B 1 274 ? 14.133  -4.494  -19.612 1.00 25.76 ? 294 GLY B N   1 
ATOM   4149 C CA  . GLY B 1 274 ? 14.979  -5.542  -19.080 1.00 25.76 ? 294 GLY B CA  1 
ATOM   4150 C C   . GLY B 1 274 ? 16.310  -5.016  -18.572 1.00 25.76 ? 294 GLY B C   1 
ATOM   4151 O O   . GLY B 1 274 ? 16.342  -3.974  -17.939 1.00 25.76 ? 294 GLY B O   1 
ATOM   4152 N N   . VAL B 1 275 ? 17.376  -5.793  -18.846 1.00 25.60 ? 295 VAL B N   1 
ATOM   4153 C CA  . VAL B 1 275 ? 18.701  -5.360  -18.366 1.00 25.60 ? 295 VAL B CA  1 
ATOM   4154 C C   . VAL B 1 275 ? 19.124  -4.145  -19.157 1.00 25.60 ? 295 VAL B C   1 
ATOM   4155 O O   . VAL B 1 275 ? 19.148  -4.268  -20.387 1.00 25.60 ? 295 VAL B O   1 
ATOM   4156 C CB  . VAL B 1 275 ? 19.708  -6.505  -18.502 1.00 24.45 ? 295 VAL B CB  1 
ATOM   4157 C CG1 . VAL B 1 275 ? 21.042  -6.185  -17.848 1.00 24.45 ? 295 VAL B CG1 1 
ATOM   4158 C CG2 . VAL B 1 275 ? 19.180  -7.812  -17.858 1.00 24.45 ? 295 VAL B CG2 1 
ATOM   4159 N N   . LEU B 1 276 ? 19.387  -3.008  -18.532 1.00 29.55 ? 296 LEU B N   1 
ATOM   4160 C CA  . LEU B 1 276 ? 19.797  -1.809  -19.246 1.00 29.55 ? 296 LEU B CA  1 
ATOM   4161 C C   . LEU B 1 276 ? 21.310  -1.588  -19.171 1.00 29.55 ? 296 LEU B C   1 
ATOM   4162 O O   . LEU B 1 276 ? 21.854  -0.819  -20.005 1.00 29.55 ? 296 LEU B O   1 
ATOM   4163 C CB  . LEU B 1 276 ? 19.097  -0.535  -18.745 1.00 27.97 ? 296 LEU B CB  1 
ATOM   4164 C CG  . LEU B 1 276 ? 17.582  -0.595  -18.597 1.00 27.97 ? 296 LEU B CG  1 
ATOM   4165 C CD1 . LEU B 1 276 ? 17.025  0.755   -18.144 1.00 27.97 ? 296 LEU B CD1 1 
ATOM   4166 C CD2 . LEU B 1 276 ? 16.905  -1.001  -19.894 1.00 27.97 ? 296 LEU B CD2 1 
ATOM   4167 N N   . ALA B 1 277 ? 21.980  -2.201  -18.240 1.00 31.77 ? 297 ALA B N   1 
ATOM   4168 C CA  . ALA B 1 277 ? 23.433  -2.013  -18.140 1.00 31.77 ? 297 ALA B CA  1 
ATOM   4169 C C   . ALA B 1 277 ? 23.975  -3.050  -17.175 1.00 31.77 ? 297 ALA B C   1 
ATOM   4170 O O   . ALA B 1 277 ? 23.219  -3.673  -16.398 1.00 31.77 ? 297 ALA B O   1 
ATOM   4171 C CB  . ALA B 1 277 ? 23.756  -0.603  -17.702 1.00 29.55 ? 297 ALA B CB  1 
ATOM   4172 N N   . GLU B 1 278 ? 25.275  -3.269  -17.207 1.00 35.02 ? 298 GLU B N   1 
ATOM   4173 C CA  . GLU B 1 278 ? 25.941  -4.237  -16.355 1.00 35.02 ? 298 GLU B CA  1 
ATOM   4174 C C   . GLU B 1 278 ? 26.718  -3.467  -15.293 1.00 35.02 ? 298 GLU B C   1 
ATOM   4175 O O   . GLU B 1 278 ? 27.113  -2.333  -15.565 1.00 35.02 ? 298 GLU B O   1 
ATOM   4176 C CB  . GLU B 1 278 ? 26.933  -5.057  -17.135 1.00 38.06 ? 298 GLU B CB  1 
ATOM   4177 C CG  . GLU B 1 278 ? 26.459  -5.739  -18.379 1.00 38.06 ? 298 GLU B CG  1 
ATOM   4178 C CD  . GLU B 1 278 ? 27.553  -6.516  -19.094 1.00 38.06 ? 298 GLU B CD  1 
ATOM   4179 O OE1 . GLU B 1 278 ? 28.767  -6.237  -18.890 1.00 38.06 ? 298 GLU B OE1 1 
ATOM   4180 O OE2 . GLU B 1 278 ? 27.207  -7.454  -19.871 1.00 38.06 ? 298 GLU B OE2 1 
ATOM   4181 N N   . THR B 1 279 ? 26.919  -4.020  -14.137 1.00 33.70 ? 299 THR B N   1 
ATOM   4182 C CA  . THR B 1 279 ? 27.718  -3.301  -13.130 1.00 33.70 ? 299 THR B CA  1 
ATOM   4183 C C   . THR B 1 279 ? 29.078  -3.950  -13.161 1.00 33.70 ? 299 THR B C   1 
ATOM   4184 O O   . THR B 1 279 ? 29.180  -4.978  -13.889 1.00 33.70 ? 299 THR B O   1 
ATOM   4185 C CB  . THR B 1 279 ? 27.055  -3.428  -11.759 1.00 33.36 ? 299 THR B CB  1 
ATOM   4186 O OG1 . THR B 1 279 ? 27.022  -4.819  -11.412 1.00 33.36 ? 299 THR B OG1 1 
ATOM   4187 C CG2 . THR B 1 279 ? 25.602  -2.986  -11.741 1.00 33.36 ? 299 THR B CG2 1 
ATOM   4188 N N   . THR B 1 280 ? 30.091  -3.442  -12.486 1.00 35.22 ? 300 THR B N   1 
ATOM   4189 C CA  . THR B 1 280 ? 31.399  -4.115  -12.446 1.00 35.22 ? 300 THR B CA  1 
ATOM   4190 C C   . THR B 1 280 ? 31.831  -4.081  -10.959 1.00 35.22 ? 300 THR B C   1 
ATOM   4191 O O   . THR B 1 280 ? 31.935  -3.039  -10.326 1.00 35.22 ? 300 THR B O   1 
ATOM   4192 C CB  . THR B 1 280 ? 32.531  -3.590  -13.318 1.00 37.67 ? 300 THR B CB  1 
ATOM   4193 O OG1 . THR B 1 280 ? 32.873  -2.228  -13.032 1.00 37.67 ? 300 THR B OG1 1 
ATOM   4194 C CG2 . THR B 1 280 ? 32.185  -3.646  -14.826 1.00 37.67 ? 300 THR B CG2 1 
ATOM   4195 N N   . LEU B 1 281 ? 31.989  -5.300  -10.446 1.00 37.90 ? 301 LEU B N   1 
ATOM   4196 C CA  . LEU B 1 281 ? 32.367  -5.369  -9.034  1.00 37.90 ? 301 LEU B CA  1 
ATOM   4197 C C   . LEU B 1 281 ? 33.858  -5.576  -8.906  1.00 37.90 ? 301 LEU B C   1 
ATOM   4198 O O   . LEU B 1 281 ? 34.421  -6.293  -9.756  1.00 37.90 ? 301 LEU B O   1 
ATOM   4199 C CB  . LEU B 1 281 ? 31.633  -6.550  -8.379  1.00 35.54 ? 301 LEU B CB  1 
ATOM   4200 C CG  . LEU B 1 281 ? 30.116  -6.466  -8.284  1.00 35.54 ? 301 LEU B CG  1 
ATOM   4201 C CD1 . LEU B 1 281 ? 29.524  -7.743  -7.714  1.00 35.54 ? 301 LEU B CD1 1 
ATOM   4202 C CD2 . LEU B 1 281 ? 29.728  -5.284  -7.412  1.00 35.54 ? 301 LEU B CD2 1 
ATOM   4203 N N   . ASP B 1 282 ? 34.475  -5.011  -7.872  1.00 43.53 ? 302 ASP B N   1 
ATOM   4204 C CA  . ASP B 1 282 ? 35.916  -5.221  -7.658  1.00 43.53 ? 302 ASP B CA  1 
ATOM   4205 C C   . ASP B 1 282 ? 36.076  -6.443  -6.727  1.00 43.53 ? 302 ASP B C   1 
ATOM   4206 O O   . ASP B 1 282 ? 36.367  -6.339  -5.552  1.00 43.53 ? 302 ASP B O   1 
ATOM   4207 C CB  . ASP B 1 282 ? 36.616  -4.027  -7.057  1.00 49.06 ? 302 ASP B CB  1 
ATOM   4208 C CG  . ASP B 1 282 ? 36.500  -2.739  -7.840  1.00 49.06 ? 302 ASP B CG  1 
ATOM   4209 O OD1 . ASP B 1 282 ? 36.816  -2.692  -9.070  1.00 49.06 ? 302 ASP B OD1 1 
ATOM   4210 O OD2 . ASP B 1 282 ? 36.097  -1.715  -7.176  1.00 49.06 ? 302 ASP B OD2 1 
ATOM   4211 N N   . LEU B 1 283 ? 35.851  -7.605  -7.304  1.00 43.27 ? 303 LEU B N   1 
ATOM   4212 C CA  . LEU B 1 283 ? 35.918  -8.878  -6.662  1.00 43.27 ? 303 LEU B CA  1 
ATOM   4213 C C   . LEU B 1 283 ? 37.371  -9.266  -6.366  1.00 43.27 ? 303 LEU B C   1 
ATOM   4214 O O   . LEU B 1 283 ? 38.301  -8.781  -7.010  1.00 43.27 ? 303 LEU B O   1 
ATOM   4215 C CB  . LEU B 1 283 ? 35.321  -9.951  -7.590  1.00 39.90 ? 303 LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 283 ? 33.818  -9.935  -7.823  1.00 39.90 ? 303 LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 283 ? 33.371  -11.196 -8.547  1.00 39.90 ? 303 LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 283 ? 33.039  -9.831  -6.515  1.00 39.90 ? 303 LEU B CD2 1 
ATOM   4219 N N   . THR B 1 284 ? 37.544  -10.109 -5.352  1.00 45.40 ? 304 THR B N   1 
ATOM   4220 C CA  . THR B 1 284 ? 38.900  -10.565 -5.029  1.00 45.40 ? 304 THR B CA  1 
ATOM   4221 C C   . THR B 1 284 ? 39.243  -11.670 -6.028  1.00 45.40 ? 304 THR B C   1 
ATOM   4222 O O   . THR B 1 284 ? 38.367  -12.258 -6.684  1.00 45.40 ? 304 THR B O   1 
ATOM   4223 C CB  . THR B 1 284 ? 39.084  -11.141 -3.622  1.00 45.27 ? 304 THR B CB  1 
ATOM   4224 O OG1 . THR B 1 284 ? 38.378  -12.404 -3.492  1.00 45.27 ? 304 THR B OG1 1 
ATOM   4225 C CG2 . THR B 1 284 ? 38.573  -10.187 -2.557  1.00 45.27 ? 304 THR B CG2 1 
ATOM   4226 N N   . THR B 1 285 ? 40.523  -11.967 -6.084  1.00 46.53 ? 305 THR B N   1 
ATOM   4227 C CA  . THR B 1 285 ? 40.988  -13.046 -6.993  1.00 46.53 ? 305 THR B CA  1 
ATOM   4228 C C   . THR B 1 285 ? 40.170  -14.291 -6.822  1.00 46.53 ? 305 THR B C   1 
ATOM   4229 O O   . THR B 1 285 ? 39.623  -14.847 -7.781  1.00 46.53 ? 305 THR B O   1 
ATOM   4230 C CB  . THR B 1 285 ? 42.476  -13.230 -6.704  1.00 49.73 ? 305 THR B CB  1 
ATOM   4231 O OG1 . THR B 1 285 ? 43.060  -11.894 -6.584  1.00 49.73 ? 305 THR B OG1 1 
ATOM   4232 C CG2 . THR B 1 285 ? 43.148  -13.970 -7.833  1.00 49.73 ? 305 THR B CG2 1 
ATOM   4233 N N   . ASP B 1 286 ? 40.013  -14.760 -5.591  1.00 46.13 ? 306 ASP B N   1 
ATOM   4234 C CA  . ASP B 1 286 ? 39.275  -15.952 -5.238  1.00 46.13 ? 306 ASP B CA  1 
ATOM   4235 C C   . ASP B 1 286 ? 37.834  -15.861 -5.707  1.00 46.13 ? 306 ASP B C   1 
ATOM   4236 O O   . ASP B 1 286 ? 37.335  -16.751 -6.373  1.00 46.13 ? 306 ASP B O   1 
ATOM   4237 C CB  . ASP B 1 286 ? 39.213  -16.204 -3.712  1.00 51.85 ? 306 ASP B CB  1 
ATOM   4238 C CG  . ASP B 1 286 ? 40.580  -16.048 -3.067  1.00 51.85 ? 306 ASP B CG  1 
ATOM   4239 O OD1 . ASP B 1 286 ? 41.206  -14.959 -3.285  1.00 51.85 ? 306 ASP B OD1 1 
ATOM   4240 O OD2 . ASP B 1 286 ? 41.009  -16.991 -2.348  1.00 51.85 ? 306 ASP B OD2 1 
ATOM   4241 N N   . GLU B 1 287 ? 37.230  -14.715 -5.372  1.00 44.08 ? 307 GLU B N   1 
ATOM   4242 C CA  . GLU B 1 287 ? 35.855  -14.440 -5.776  1.00 44.08 ? 307 GLU B CA  1 
ATOM   4243 C C   . GLU B 1 287 ? 35.739  -14.526 -7.271  1.00 44.08 ? 307 GLU B C   1 
ATOM   4244 O O   . GLU B 1 287 ? 34.821  -15.188 -7.787  1.00 44.08 ? 307 GLU B O   1 
ATOM   4245 C CB  . GLU B 1 287 ? 35.480  -13.053 -5.223  1.00 42.60 ? 307 GLU B CB  1 
ATOM   4246 C CG  . GLU B 1 287 ? 34.962  -13.159 -3.805  1.00 42.60 ? 307 GLU B CG  1 
ATOM   4247 C CD  . GLU B 1 287 ? 34.869  -11.875 -3.046  1.00 42.60 ? 307 GLU B CD  1 
ATOM   4248 O OE1 . GLU B 1 287 ? 35.091  -10.798 -3.642  1.00 42.60 ? 307 GLU B OE1 1 
ATOM   4249 O OE2 . GLU B 1 287 ? 34.573  -11.890 -1.810  1.00 42.60 ? 307 GLU B OE2 1 
ATOM   4250 N N   . GLN B 1 288 ? 36.694  -13.942 -8.002  1.00 46.01 ? 308 GLN B N   1 
ATOM   4251 C CA  . GLN B 1 288 ? 36.712  -13.999 -9.463  1.00 46.01 ? 308 GLN B CA  1 
ATOM   4252 C C   . GLN B 1 288 ? 36.736  -15.462 -9.903  1.00 46.01 ? 308 GLN B C   1 
ATOM   4253 O O   . GLN B 1 288 ? 35.930  -15.906 -10.705 1.00 46.01 ? 308 GLN B O   1 
ATOM   4254 C CB  . GLN B 1 288 ? 37.922  -13.276 -10.029 1.00 51.88 ? 308 GLN B CB  1 
ATOM   4255 C CG  . GLN B 1 288 ? 37.966  -11.817 -9.638  1.00 51.88 ? 308 GLN B CG  1 
ATOM   4256 C CD  . GLN B 1 288 ? 39.303  -11.135 -9.858  1.00 51.88 ? 308 GLN B CD  1 
ATOM   4257 O OE1 . GLN B 1 288 ? 40.188  -11.661 -10.564 1.00 51.88 ? 308 GLN B OE1 1 
ATOM   4258 N NE2 . GLN B 1 288 ? 39.491  -9.951  -9.246  1.00 51.88 ? 308 GLN B NE2 1 
ATOM   4259 N N   . GLU B 1 289 ? 37.658  -16.203 -9.308  1.00 46.63 ? 309 GLU B N   1 
ATOM   4260 C CA  . GLU B 1 289 ? 37.782  -17.646 -9.604  1.00 46.63 ? 309 GLU B CA  1 
ATOM   4261 C C   . GLU B 1 289 ? 36.494  -18.408 -9.402  1.00 46.63 ? 309 GLU B C   1 
ATOM   4262 O O   . GLU B 1 289 ? 36.005  -19.098 -10.335 1.00 46.63 ? 309 GLU B O   1 
ATOM   4263 C CB  . GLU B 1 289 ? 38.924  -18.214 -8.744  1.00 47.25 ? 309 GLU B CB  1 
ATOM   4264 N N   . LYS B 1 290 ? 35.842  -18.277 -8.240  1.00 45.69 ? 310 LYS B N   1 
ATOM   4265 C CA  . LYS B 1 290 ? 34.572  -18.969 -7.994  1.00 45.69 ? 310 LYS B CA  1 
ATOM   4266 C C   . LYS B 1 290 ? 33.480  -18.623 -8.989  1.00 45.69 ? 310 LYS B C   1 
ATOM   4267 O O   . LYS B 1 290 ? 32.685  -19.501 -9.297  1.00 45.69 ? 310 LYS B O   1 
ATOM   4268 C CB  . LYS B 1 290 ? 34.028  -18.659 -6.593  1.00 49.40 ? 310 LYS B CB  1 
ATOM   4269 C CG  . LYS B 1 290 ? 35.094  -18.734 -5.514  1.00 49.40 ? 310 LYS B CG  1 
ATOM   4270 C CD  . LYS B 1 290 ? 34.495  -18.915 -4.121  1.00 49.40 ? 310 LYS B CD  1 
ATOM   4271 C CE  . LYS B 1 290 ? 35.620  -18.875 -3.084  1.00 49.40 ? 310 LYS B CE  1 
ATOM   4272 N NZ  . LYS B 1 290 ? 35.158  -18.259 -1.798  1.00 49.40 ? 310 LYS B NZ  1 
ATOM   4273 N N   . LEU B 1 291 ? 33.460  -17.382 -9.456  1.00 45.21 ? 311 LEU B N   1 
ATOM   4274 C CA  . LEU B 1 291 ? 32.427  -16.969 -10.404 1.00 45.21 ? 311 LEU B CA  1 
ATOM   4275 C C   . LEU B 1 291 ? 32.602  -17.654 -11.730 1.00 45.21 ? 311 LEU B C   1 
ATOM   4276 O O   . LEU B 1 291 ? 31.622  -18.144 -12.308 1.00 45.21 ? 311 LEU B O   1 
ATOM   4277 C CB  . LEU B 1 291 ? 32.455  -15.458 -10.568 1.00 43.32 ? 311 LEU B CB  1 
ATOM   4278 C CG  . LEU B 1 291 ? 31.322  -14.912 -11.452 1.00 43.32 ? 311 LEU B CG  1 
ATOM   4279 C CD1 . LEU B 1 291 ? 29.963  -15.127 -10.840 1.00 43.32 ? 311 LEU B CD1 1 
ATOM   4280 C CD2 . LEU B 1 291 ? 31.576  -13.430 -11.683 1.00 43.32 ? 311 LEU B CD2 1 
ATOM   4281 N N   . LEU B 1 292 ? 33.840  -17.777 -12.192 1.00 49.02 ? 312 LEU B N   1 
ATOM   4282 C CA  . LEU B 1 292 ? 34.104  -18.467 -13.471 1.00 49.02 ? 312 LEU B CA  1 
ATOM   4283 C C   . LEU B 1 292 ? 33.781  -19.942 -13.353 1.00 49.02 ? 312 LEU B C   1 
ATOM   4284 O O   . LEU B 1 292 ? 33.240  -20.565 -14.263 1.00 49.02 ? 312 LEU B O   1 
ATOM   4285 C CB  . LEU B 1 292 ? 35.573  -18.337 -13.857 1.00 50.82 ? 312 LEU B CB  1 
ATOM   4286 C CG  . LEU B 1 292 ? 35.972  -16.859 -14.125 1.00 50.82 ? 312 LEU B CG  1 
ATOM   4287 C CD1 . LEU B 1 292 ? 37.488  -16.772 -14.144 1.00 50.82 ? 312 LEU B CD1 1 
ATOM   4288 C CD2 . LEU B 1 292 ? 35.335  -16.395 -15.413 1.00 50.82 ? 312 LEU B CD2 1 
ATOM   4289 N N   . GLN B 1 293 ? 34.095  -20.481 -12.172 1.00 51.30 ? 313 GLN B N   1 
ATOM   4290 C CA  . GLN B 1 293 ? 33.789  -21.879 -11.881 1.00 51.30 ? 313 GLN B CA  1 
ATOM   4291 C C   . GLN B 1 293 ? 32.284  -22.064 -12.048 1.00 51.30 ? 313 GLN B C   1 
ATOM   4292 O O   . GLN B 1 293 ? 31.853  -23.015 -12.698 1.00 51.30 ? 313 GLN B O   1 
ATOM   4293 C CB  . GLN B 1 293 ? 34.228  -22.201 -10.502 1.00 56.16 ? 313 GLN B CB  1 
ATOM   4294 C CG  . GLN B 1 293 ? 34.102  -23.646 -10.064 1.00 56.16 ? 313 GLN B CG  1 
ATOM   4295 C CD  . GLN B 1 293 ? 34.327  -23.718 -8.553  1.00 56.16 ? 313 GLN B CD  1 
ATOM   4296 O OE1 . GLN B 1 293 ? 35.119  -22.918 -8.020  1.00 56.16 ? 313 GLN B OE1 1 
ATOM   4297 N NE2 . GLN B 1 293 ? 33.644  -24.633 -7.878  1.00 56.16 ? 313 GLN B NE2 1 
ATOM   4298 N N   . SER B 1 294 ? 31.470  -21.145 -11.508 1.00 51.19 ? 314 SER B N   1 
ATOM   4299 C CA  . SER B 1 294 ? 30.027  -21.208 -11.623 1.00 51.19 ? 314 SER B CA  1 
ATOM   4300 C C   . SER B 1 294 ? 29.611  -21.171 -13.089 1.00 51.19 ? 314 SER B C   1 
ATOM   4301 O O   . SER B 1 294 ? 28.765  -21.927 -13.585 1.00 51.19 ? 314 SER B O   1 
ATOM   4302 C CB  . SER B 1 294 ? 29.334  -20.016 -10.972 1.00 50.67 ? 314 SER B CB  1 
ATOM   4303 O OG  . SER B 1 294 ? 29.504  -19.928 -9.585  1.00 50.67 ? 314 SER B OG  1 
ATOM   4304 N N   . ARG B 1 295 ? 30.230  -20.255 -13.841 1.00 53.13 ? 315 ARG B N   1 
ATOM   4305 C CA  . ARG B 1 295 ? 29.942  -20.113 -15.252 1.00 53.13 ? 315 ARG B CA  1 
ATOM   4306 C C   . ARG B 1 295 ? 30.121  -21.412 -16.037 1.00 53.13 ? 315 ARG B C   1 
ATOM   4307 O O   . ARG B 1 295 ? 29.341  -21.716 -16.940 1.00 53.13 ? 315 ARG B O   1 
ATOM   4308 C CB  . ARG B 1 295 ? 30.823  -19.028 -15.908 1.00 57.88 ? 315 ARG B CB  1 
ATOM   4309 C CG  . ARG B 1 295 ? 30.171  -18.688 -17.253 1.00 57.88 ? 315 ARG B CG  1 
ATOM   4310 C CD  . ARG B 1 295 ? 31.152  -18.133 -18.211 1.00 57.88 ? 315 ARG B CD  1 
ATOM   4311 N NE  . ARG B 1 295 ? 32.043  -19.066 -18.861 1.00 57.88 ? 315 ARG B NE  1 
ATOM   4312 C CZ  . ARG B 1 295 ? 33.346  -19.152 -18.644 1.00 57.88 ? 315 ARG B CZ  1 
ATOM   4313 N NH1 . ARG B 1 295 ? 33.962  -18.380 -17.755 1.00 57.88 ? 315 ARG B NH1 1 
ATOM   4314 N NH2 . ARG B 1 295 ? 34.061  -20.045 -19.327 1.00 57.88 ? 315 ARG B NH2 1 
ATOM   4315 N N   . ASP B 1 296 ? 31.171  -22.163 -15.716 1.00 53.87 ? 316 ASP B N   1 
ATOM   4316 C CA  . ASP B 1 296 ? 31.465  -23.442 -16.356 1.00 53.87 ? 316 ASP B CA  1 
ATOM   4317 C C   . ASP B 1 296 ? 30.393  -24.459 -16.053 1.00 53.87 ? 316 ASP B C   1 
ATOM   4318 O O   . ASP B 1 296 ? 29.911  -25.128 -16.974 1.00 53.87 ? 316 ASP B O   1 
ATOM   4319 C CB  . ASP B 1 296 ? 32.835  -23.940 -15.906 1.00 55.17 ? 316 ASP B CB  1 
ATOM   4320 C CG  . ASP B 1 296 ? 33.911  -22.997 -16.442 1.00 55.17 ? 316 ASP B CG  1 
ATOM   4321 O OD1 . ASP B 1 296 ? 33.600  -22.298 -17.437 1.00 55.17 ? 316 ASP B OD1 1 
ATOM   4322 O OD2 . ASP B 1 296 ? 35.031  -22.955 -15.889 1.00 55.17 ? 316 ASP B OD2 1 
ATOM   4323 N N   . TYR B 1 297 ? 29.966  -24.562 -14.777 1.00 53.40 ? 317 TYR B N   1 
ATOM   4324 C CA  . TYR B 1 297 ? 28.895  -25.508 -14.462 1.00 53.40 ? 317 TYR B CA  1 
ATOM   4325 C C   . TYR B 1 297 ? 27.629  -25.107 -15.222 1.00 53.40 ? 317 TYR B C   1 
ATOM   4326 O O   . TYR B 1 297 ? 26.920  -25.968 -15.746 1.00 53.40 ? 317 TYR B O   1 
ATOM   4327 C CB  . TYR B 1 297 ? 28.546  -25.512 -12.993 1.00 59.98 ? 317 TYR B CB  1 
ATOM   4328 C CG  . TYR B 1 297 ? 29.685  -25.864 -12.085 1.00 59.98 ? 317 TYR B CG  1 
ATOM   4329 C CD1 . TYR B 1 297 ? 30.518  -26.942 -12.351 1.00 59.98 ? 317 TYR B CD1 1 
ATOM   4330 C CD2 . TYR B 1 297 ? 29.946  -25.113 -10.948 1.00 59.98 ? 317 TYR B CD2 1 
ATOM   4331 C CE1 . TYR B 1 297 ? 31.556  -27.278 -11.513 1.00 59.98 ? 317 TYR B CE1 1 
ATOM   4332 C CE2 . TYR B 1 297 ? 30.976  -25.430 -10.086 1.00 59.98 ? 317 TYR B CE2 1 
ATOM   4333 C CZ  . TYR B 1 297 ? 31.782  -26.518 -10.382 1.00 59.98 ? 317 TYR B CZ  1 
ATOM   4334 O OH  . TYR B 1 297 ? 32.830  -26.842 -9.539  1.00 59.98 ? 317 TYR B OH  1 
ATOM   4335 N N   . ILE B 1 298 ? 27.338  -23.809 -15.268 1.00 49.78 ? 318 ILE B N   1 
ATOM   4336 C CA  . ILE B 1 298 ? 26.121  -23.419 -15.994 1.00 49.78 ? 318 ILE B CA  1 
ATOM   4337 C C   . ILE B 1 298 ? 26.301  -23.706 -17.464 1.00 49.78 ? 318 ILE B C   1 
ATOM   4338 O O   . ILE B 1 298 ? 25.465  -24.326 -18.130 1.00 49.78 ? 318 ILE B O   1 
ATOM   4339 C CB  . ILE B 1 298 ? 25.801  -21.938 -15.697 1.00 48.35 ? 318 ILE B CB  1 
ATOM   4340 C CG1 . ILE B 1 298 ? 25.576  -21.795 -14.183 1.00 48.35 ? 318 ILE B CG1 1 
ATOM   4341 C CG2 . ILE B 1 298 ? 24.574  -21.473 -16.430 1.00 48.35 ? 318 ILE B CG2 1 
ATOM   4342 C CD1 . ILE B 1 298 ? 25.514  -20.395 -13.648 1.00 48.35 ? 318 ILE B CD1 1 
ATOM   4343 N N   . GLN B 1 299 ? 27.431  -23.265 -18.003 1.00 51.25 ? 319 GLN B N   1 
ATOM   4344 C CA  . GLN B 1 299 ? 27.706  -23.486 -19.425 1.00 51.25 ? 319 GLN B CA  1 
ATOM   4345 C C   . GLN B 1 299 ? 27.582  -24.953 -19.790 1.00 51.25 ? 319 GLN B C   1 
ATOM   4346 O O   . GLN B 1 299 ? 26.822  -25.351 -20.661 1.00 51.25 ? 319 GLN B O   1 
ATOM   4347 C CB  . GLN B 1 299 ? 29.115  -22.968 -19.693 1.00 52.75 ? 319 GLN B CB  1 
ATOM   4348 C CG  . GLN B 1 299 ? 29.609  -22.996 -21.098 1.00 52.75 ? 319 GLN B CG  1 
ATOM   4349 C CD  . GLN B 1 299 ? 28.687  -22.488 -22.177 1.00 52.75 ? 319 GLN B CD  1 
ATOM   4350 O OE1 . GLN B 1 299 ? 28.741  -21.301 -22.572 1.00 52.75 ? 319 GLN B OE1 1 
ATOM   4351 N NE2 . GLN B 1 299 ? 27.837  -23.362 -22.704 1.00 52.75 ? 319 GLN B NE2 1 
ATOM   4352 N N   . GLN B 1 300 ? 28.339  -25.789 -19.077 1.00 53.71 ? 320 GLN B N   1 
ATOM   4353 C CA  . GLN B 1 300 ? 28.364  -27.224 -19.311 1.00 53.71 ? 320 GLN B CA  1 
ATOM   4354 C C   . GLN B 1 300 ? 27.008  -27.881 -19.235 1.00 53.71 ? 320 GLN B C   1 
ATOM   4355 O O   . GLN B 1 300 ? 26.587  -28.552 -20.194 1.00 53.71 ? 320 GLN B O   1 
ATOM   4356 C CB  . GLN B 1 300 ? 29.306  -27.918 -18.302 1.00 53.93 ? 320 GLN B CB  1 
ATOM   4357 N N   . ARG B 1 301 ? 26.239  -27.695 -18.153 1.00 54.73 ? 321 ARG B N   1 
ATOM   4358 C CA  . ARG B 1 301 ? 24.922  -28.325 -18.007 1.00 54.73 ? 321 ARG B CA  1 
ATOM   4359 C C   . ARG B 1 301 ? 23.932  -27.816 -19.048 1.00 54.73 ? 321 ARG B C   1 
ATOM   4360 O O   . ARG B 1 301 ? 22.981  -28.497 -19.451 1.00 54.73 ? 321 ARG B O   1 
ATOM   4361 C CB  . ARG B 1 301 ? 24.349  -28.087 -16.602 1.00 54.69 ? 321 ARG B CB  1 
ATOM   4362 N N   . PHE B 1 302 ? 24.141  -26.585 -19.499 1.00 57.32 ? 322 PHE B N   1 
ATOM   4363 C CA  . PHE B 1 302 ? 23.325  -25.986 -20.516 1.00 57.32 ? 322 PHE B CA  1 
ATOM   4364 C C   . PHE B 1 302 ? 23.570  -26.691 -21.837 1.00 57.32 ? 322 PHE B C   1 
ATOM   4365 O O   . PHE B 1 302 ? 22.605  -27.171 -22.440 1.00 57.32 ? 322 PHE B O   1 
ATOM   4366 C CB  . PHE B 1 302 ? 23.647  -24.498 -20.609 1.00 57.25 ? 322 PHE B CB  1 
ATOM   4367 C CG  . PHE B 1 302 ? 22.895  -23.910 -21.766 1.00 57.25 ? 322 PHE B CG  1 
ATOM   4368 C CD1 . PHE B 1 302 ? 21.520  -23.877 -21.748 1.00 57.25 ? 322 PHE B CD1 1 
ATOM   4369 C CD2 . PHE B 1 302 ? 23.580  -23.475 -22.883 1.00 57.25 ? 322 PHE B CD2 1 
ATOM   4370 C CE1 . PHE B 1 302 ? 20.818  -23.362 -22.817 1.00 57.25 ? 322 PHE B CE1 1 
ATOM   4371 C CE2 . PHE B 1 302 ? 22.880  -22.970 -23.972 1.00 57.25 ? 322 PHE B CE2 1 
ATOM   4372 C CZ  . PHE B 1 302 ? 21.490  -22.917 -23.935 1.00 57.25 ? 322 PHE B CZ  1 
ATOM   4373 N N   . ASP B 1 303 ? 24.821  -26.827 -22.274 1.00 62.63 ? 323 ASP B N   1 
ATOM   4374 C CA  . ASP B 1 303 ? 25.148  -27.518 -23.520 1.00 62.63 ? 323 ASP B CA  1 
ATOM   4375 C C   . ASP B 1 303 ? 24.660  -28.960 -23.498 1.00 62.63 ? 323 ASP B C   1 
ATOM   4376 O O   . ASP B 1 303 ? 24.088  -29.538 -24.423 1.00 62.63 ? 323 ASP B O   1 
ATOM   4377 C CB  . ASP B 1 303 ? 26.652  -27.637 -23.744 1.00 63.38 ? 323 ASP B CB  1 
ATOM   4378 C CG  . ASP B 1 303 ? 27.422  -26.355 -23.729 1.00 63.38 ? 323 ASP B CG  1 
ATOM   4379 O OD1 . ASP B 1 303 ? 26.895  -25.344 -24.240 1.00 63.38 ? 323 ASP B OD1 1 
ATOM   4380 O OD2 . ASP B 1 303 ? 28.564  -26.372 -23.201 1.00 63.38 ? 323 ASP B OD2 1 
ATOM   4381 N N   . GLU B 1 304 ? 24.880  -29.596 -22.350 1.00 67.43 ? 324 GLU B N   1 
ATOM   4382 C CA  . GLU B 1 304 ? 24.465  -30.960 -22.091 1.00 67.43 ? 324 GLU B CA  1 
ATOM   4383 C C   . GLU B 1 304 ? 22.977  -31.154 -22.324 1.00 67.43 ? 324 GLU B C   1 
ATOM   4384 O O   . GLU B 1 304 ? 22.545  -32.204 -22.818 1.00 67.43 ? 324 GLU B O   1 
ATOM   4385 C CB  . GLU B 1 304 ? 24.797  -31.272 -20.626 1.00 72.23 ? 324 GLU B CB  1 
ATOM   4386 C CG  . GLU B 1 304 ? 24.898  -32.731 -20.304 1.00 72.23 ? 324 GLU B CG  1 
ATOM   4387 C CD  . GLU B 1 304 ? 23.589  -33.325 -19.800 1.00 72.23 ? 324 GLU B CD  1 
ATOM   4388 O OE1 . GLU B 1 304 ? 22.917  -32.646 -18.976 1.00 72.23 ? 324 GLU B OE1 1 
ATOM   4389 O OE2 . GLU B 1 304 ? 23.279  -34.474 -20.221 1.00 72.23 ? 324 GLU B OE2 1 
ATOM   4390 N N   . ILE B 1 305 ? 22.168  -30.156 -21.993 1.00 69.59 ? 325 ILE B N   1 
ATOM   4391 C CA  . ILE B 1 305 ? 20.718  -30.238 -22.147 1.00 69.59 ? 325 ILE B CA  1 
ATOM   4392 C C   . ILE B 1 305 ? 20.229  -29.751 -23.497 1.00 69.59 ? 325 ILE B C   1 
ATOM   4393 O O   . ILE B 1 305 ? 19.175  -30.261 -23.966 1.00 69.59 ? 325 ILE B O   1 
ATOM   4394 C CB  . ILE B 1 305 ? 20.070  -29.478 -20.966 1.00 69.84 ? 325 ILE B CB  1 
ATOM   4395 C CG1 . ILE B 1 305 ? 18.622  -29.954 -20.780 1.00 69.84 ? 325 ILE B CG1 1 
ATOM   4396 C CG2 . ILE B 1 305 ? 20.079  -27.978 -21.138 1.00 69.84 ? 325 ILE B CG2 1 
ATOM   4397 C CD1 . ILE B 1 305 ? 18.500  -31.396 -20.282 1.00 69.84 ? 325 ILE B CD1 1 
ATOM   4398 N N   . VAL B 1 306 ? 20.910  -28.856 -24.204 1.00 71.01 ? 326 VAL B N   1 
ATOM   4399 C CA  . VAL B 1 306 ? 20.371  -28.481 -25.513 1.00 71.01 ? 326 VAL B CA  1 
ATOM   4400 C C   . VAL B 1 306 ? 20.721  -27.113 -26.013 1.00 71.01 ? 326 VAL B C   1 
ATOM   4401 O O   . VAL B 1 306 ? 19.864  -26.485 -26.710 1.00 71.01 ? 326 VAL B O   1 
ATOM   4402 N N   . ALA C 1 1   ? 2.072   -0.541  -18.442 1.00 15.38 ? 21  ALA C N   1 
ATOM   4403 C CA  . ALA C 1 1   ? 2.383   0.258   -17.231 1.00 15.38 ? 21  ALA C CA  1 
ATOM   4404 C C   . ALA C 1 1   ? 1.302   1.297   -17.041 1.00 15.38 ? 21  ALA C C   1 
ATOM   4405 O O   . ALA C 1 1   ? 0.416   1.398   -17.888 1.00 15.38 ? 21  ALA C O   1 
ATOM   4406 C CB  . ALA C 1 1   ? 3.760   0.857   -17.317 1.00 15.30 ? 21  ALA C CB  1 
ATOM   4407 N N   . ARG C 1 2   ? 1.292   1.950   -15.879 1.00 15.65 ? 22  ARG C N   1 
ATOM   4408 C CA  . ARG C 1 2   ? 0.278   2.966   -15.590 1.00 15.65 ? 22  ARG C CA  1 
ATOM   4409 C C   . ARG C 1 2   ? 0.892   4.352   -15.801 1.00 15.65 ? 22  ARG C C   1 
ATOM   4410 O O   . ARG C 1 2   ? 1.981   4.621   -15.277 1.00 15.65 ? 22  ARG C O   1 
ATOM   4411 C CB  . ARG C 1 2   ? -0.245  2.869   -14.178 1.00 15.33 ? 22  ARG C CB  1 
ATOM   4412 C CG  . ARG C 1 2   ? -1.178  1.688   -13.907 1.00 15.33 ? 22  ARG C CG  1 
ATOM   4413 C CD  . ARG C 1 2   ? -1.359  1.522   -12.397 1.00 15.33 ? 22  ARG C CD  1 
ATOM   4414 N NE  . ARG C 1 2   ? -2.219  0.380   -12.040 1.00 15.33 ? 22  ARG C NE  1 
ATOM   4415 C CZ  . ARG C 1 2   ? -2.345  -0.009  -10.738 1.00 15.33 ? 22  ARG C CZ  1 
ATOM   4416 N NH1 . ARG C 1 2   ? -1.662  0.579   -9.773  1.00 15.33 ? 22  ARG C NH1 1 
ATOM   4417 N NH2 . ARG C 1 2   ? -3.181  -0.992  -10.485 1.00 15.33 ? 22  ARG C NH2 1 
ATOM   4418 N N   . LYS C 1 3   ? 0.214   5.193   -16.572 1.00 15.95 ? 23  LYS C N   1 
ATOM   4419 C CA  . LYS C 1 3   ? 0.718   6.543   -16.826 1.00 15.95 ? 23  LYS C CA  1 
ATOM   4420 C C   . LYS C 1 3   ? -0.404  7.526   -16.547 1.00 15.95 ? 23  LYS C C   1 
ATOM   4421 O O   . LYS C 1 3   ? -1.526  7.334   -17.032 1.00 15.95 ? 23  LYS C O   1 
ATOM   4422 C CB  . LYS C 1 3   ? 1.215   6.721   -18.278 1.00 18.07 ? 23  LYS C CB  1 
ATOM   4423 C CG  . LYS C 1 3   ? 1.451   8.204   -18.625 1.00 18.07 ? 23  LYS C CG  1 
ATOM   4424 C CD  . LYS C 1 3   ? 2.001   8.415   -20.014 1.00 18.07 ? 23  LYS C CD  1 
ATOM   4425 C CE  . LYS C 1 3   ? 3.517   8.347   -19.998 1.00 18.07 ? 23  LYS C CE  1 
ATOM   4426 N NZ  . LYS C 1 3   ? 4.051   8.559   -21.385 1.00 18.07 ? 23  LYS C NZ  1 
ATOM   4427 N N   . ILE C 1 4   ? -0.124  8.532   -15.742 1.00 15.62 ? 24  ILE C N   1 
ATOM   4428 C CA  . ILE C 1 4   ? -1.141  9.512   -15.399 1.00 15.62 ? 24  ILE C CA  1 
ATOM   4429 C C   . ILE C 1 4   ? -0.616  10.914  -15.715 1.00 15.62 ? 24  ILE C C   1 
ATOM   4430 O O   . ILE C 1 4   ? 0.530   11.225  -15.414 1.00 15.62 ? 24  ILE C O   1 
ATOM   4431 C CB  . ILE C 1 4   ? -1.530  9.424   -13.929 1.00 18.14 ? 24  ILE C CB  1 
ATOM   4432 C CG1 . ILE C 1 4   ? -2.318  8.135   -13.650 1.00 18.14 ? 24  ILE C CG1 1 
ATOM   4433 C CG2 . ILE C 1 4   ? -2.433  10.579  -13.502 1.00 18.14 ? 24  ILE C CG2 1 
ATOM   4434 C CD1 . ILE C 1 4   ? -2.367  7.853   -12.144 1.00 18.14 ? 24  ILE C CD1 1 
ATOM   4435 N N   . GLY C 1 5   ? -1.514  11.701  -16.305 1.00 13.35 ? 25  GLY C N   1 
ATOM   4436 C CA  . GLY C 1 5   ? -1.175  13.103  -16.618 1.00 13.35 ? 25  GLY C CA  1 
ATOM   4437 C C   . GLY C 1 5   ? -1.999  13.997  -15.713 1.00 13.35 ? 25  GLY C C   1 
ATOM   4438 O O   . GLY C 1 5   ? -3.159  13.703  -15.434 1.00 13.35 ? 25  GLY C O   1 
ATOM   4439 N N   . ILE C 1 6   ? -1.383  15.028  -15.177 1.00 12.19 ? 26  ILE C N   1 
ATOM   4440 C CA  . ILE C 1 6   ? -2.096  15.980  -14.338 1.00 12.19 ? 26  ILE C CA  1 
ATOM   4441 C C   . ILE C 1 6   ? -1.881  17.371  -14.935 1.00 12.19 ? 26  ILE C C   1 
ATOM   4442 O O   . ILE C 1 6   ? -0.735  17.817  -15.100 1.00 12.19 ? 26  ILE C O   1 
ATOM   4443 C CB  . ILE C 1 6   ? -1.572  15.963  -12.914 1.00 11.53 ? 26  ILE C CB  1 
ATOM   4444 C CG1 . ILE C 1 6   ? -1.795  14.561  -12.272 1.00 11.53 ? 26  ILE C CG1 1 
ATOM   4445 C CG2 . ILE C 1 6   ? -2.255  17.004  -12.022 1.00 11.53 ? 26  ILE C CG2 1 
ATOM   4446 C CD1 . ILE C 1 6   ? -1.096  14.390  -10.980 1.00 11.53 ? 26  ILE C CD1 1 
ATOM   4447 N N   . ILE C 1 7   ? -2.947  18.042  -15.283 1.00 13.02 ? 27  ILE C N   1 
ATOM   4448 C CA  . ILE C 1 7   ? -2.891  19.405  -15.879 1.00 13.02 ? 27  ILE C CA  1 
ATOM   4449 C C   . ILE C 1 7   ? -3.291  20.415  -14.826 1.00 13.02 ? 27  ILE C C   1 
ATOM   4450 O O   . ILE C 1 7   ? -4.449  20.374  -14.405 1.00 13.02 ? 27  ILE C O   1 
ATOM   4451 C CB  . ILE C 1 7   ? -3.840  19.549  -17.096 1.00 13.14 ? 27  ILE C CB  1 
ATOM   4452 C CG1 . ILE C 1 7   ? -3.496  18.520  -18.179 1.00 13.14 ? 27  ILE C CG1 1 
ATOM   4453 C CG2 . ILE C 1 7   ? -3.720  20.968  -17.667 1.00 13.14 ? 27  ILE C CG2 1 
ATOM   4454 C CD1 . ILE C 1 7   ? -4.498  18.394  -19.281 1.00 13.14 ? 27  ILE C CD1 1 
ATOM   4455 N N   . GLY C 1 8   ? -2.351  21.232  -14.400 1.00 14.20 ? 28  GLY C N   1 
ATOM   4456 C CA  . GLY C 1 8   ? -2.584  22.206  -13.354 1.00 14.20 ? 28  GLY C CA  1 
ATOM   4457 C C   . GLY C 1 8   ? -2.041  21.698  -12.027 1.00 14.20 ? 28  GLY C C   1 
ATOM   4458 O O   . GLY C 1 8   ? -2.746  20.984  -11.306 1.00 14.20 ? 28  GLY C O   1 
ATOM   4459 N N   . LEU C 1 9   ? -0.801  22.017  -11.688 1.00 15.16 ? 29  LEU C N   1 
ATOM   4460 C CA  . LEU C 1 9   ? -0.182  21.585  -10.441 1.00 15.16 ? 29  LEU C CA  1 
ATOM   4461 C C   . LEU C 1 9   ? -0.299  22.625  -9.350  1.00 15.16 ? 29  LEU C C   1 
ATOM   4462 O O   . LEU C 1 9   ? 0.702   23.124  -8.856  1.00 15.16 ? 29  LEU C O   1 
ATOM   4463 C CB  . LEU C 1 9   ? 1.307   21.280  -10.624 1.00 13.52 ? 29  LEU C CB  1 
ATOM   4464 C CG  . LEU C 1 9   ? 1.618   19.842  -11.008 1.00 13.52 ? 29  LEU C CG  1 
ATOM   4465 C CD1 . LEU C 1 9   ? 1.285   18.857  -9.899  1.00 13.52 ? 29  LEU C CD1 1 
ATOM   4466 C CD2 . LEU C 1 9   ? 0.827   19.405  -12.237 1.00 13.52 ? 29  LEU C CD2 1 
ATOM   4467 N N   . GLY C 1 10  ? -1.519  22.956  -8.989  1.00 18.01 ? 30  GLY C N   1 
ATOM   4468 C CA  . GLY C 1 10  ? -1.761  23.921  -7.921  1.00 18.01 ? 30  GLY C CA  1 
ATOM   4469 C C   . GLY C 1 10  ? -2.070  23.192  -6.645  1.00 18.01 ? 30  GLY C C   1 
ATOM   4470 O O   . GLY C 1 10  ? -1.603  22.045  -6.433  1.00 18.01 ? 30  GLY C O   1 
ATOM   4471 N N   . ASN C 1 11  ? -2.867  23.775  -5.778  1.00 18.84 ? 31  ASN C N   1 
ATOM   4472 C CA  . ASN C 1 11  ? -3.234  23.164  -4.498  1.00 18.84 ? 31  ASN C CA  1 
ATOM   4473 C C   . ASN C 1 11  ? -3.857  21.813  -4.731  1.00 18.84 ? 31  ASN C C   1 
ATOM   4474 O O   . ASN C 1 11  ? -3.409  20.860  -4.115  1.00 18.84 ? 31  ASN C O   1 
ATOM   4475 C CB  . ASN C 1 11  ? -4.243  24.023  -3.728  1.00 19.67 ? 31  ASN C CB  1 
ATOM   4476 C CG  . ASN C 1 11  ? -3.567  25.244  -3.153  1.00 19.67 ? 31  ASN C CG  1 
ATOM   4477 O OD1 . ASN C 1 11  ? -2.396  25.142  -2.816  1.00 19.67 ? 31  ASN C OD1 1 
ATOM   4478 N ND2 . ASN C 1 11  ? -4.299  26.367  -3.094  1.00 19.67 ? 31  ASN C ND2 1 
ATOM   4479 N N   . VAL C 1 12  ? -4.848  21.673  -5.570  1.00 15.68 ? 32  VAL C N   1 
ATOM   4480 C CA  . VAL C 1 12  ? -5.476  20.383  -5.803  1.00 15.68 ? 32  VAL C CA  1 
ATOM   4481 C C   . VAL C 1 12  ? -4.578  19.472  -6.571  1.00 15.68 ? 32  VAL C C   1 
ATOM   4482 O O   . VAL C 1 12  ? -4.451  18.279  -6.244  1.00 15.68 ? 32  VAL C O   1 
ATOM   4483 C CB  . VAL C 1 12  ? -6.804  20.543  -6.573  1.00 13.43 ? 32  VAL C CB  1 
ATOM   4484 C CG1 . VAL C 1 12  ? -7.416  19.178  -6.910  1.00 13.43 ? 32  VAL C CG1 1 
ATOM   4485 C CG2 . VAL C 1 12  ? -7.754  21.350  -5.742  1.00 13.43 ? 32  VAL C CG2 1 
ATOM   4486 N N   . GLY C 1 13  ? -3.946  19.980  -7.616  1.00 13.57 ? 33  GLY C N   1 
ATOM   4487 C CA  . GLY C 1 13  ? -3.094  19.212  -8.493  1.00 13.57 ? 33  GLY C CA  1 
ATOM   4488 C C   . GLY C 1 13  ? -1.904  18.591  -7.828  1.00 13.57 ? 33  GLY C C   1 
ATOM   4489 O O   . GLY C 1 13  ? -1.589  17.441  -8.111  1.00 13.57 ? 33  GLY C O   1 
ATOM   4490 N N   . ALA C 1 14  ? -1.247  19.325  -6.944  1.00 13.77 ? 34  ALA C N   1 
ATOM   4491 C CA  . ALA C 1 14  ? -0.093  18.765  -6.223  1.00 13.77 ? 34  ALA C CA  1 
ATOM   4492 C C   . ALA C 1 14  ? -0.550  17.722  -5.219  1.00 13.77 ? 34  ALA C C   1 
ATOM   4493 O O   . ALA C 1 14  ? 0.140   16.687  -5.000  1.00 13.77 ? 34  ALA C O   1 
ATOM   4494 C CB  . ALA C 1 14  ? 0.652   19.886  -5.541  1.00 11.88 ? 34  ALA C CB  1 
ATOM   4495 N N   . ALA C 1 15  ? -1.705  17.865  -4.580  1.00 14.40 ? 35  ALA C N   1 
ATOM   4496 C CA  . ALA C 1 15  ? -2.274  16.921  -3.633  1.00 14.40 ? 35  ALA C CA  1 
ATOM   4497 C C   . ALA C 1 15  ? -2.661  15.653  -4.364  1.00 14.40 ? 35  ALA C C   1 
ATOM   4498 O O   . ALA C 1 15  ? -2.435  14.536  -3.788  1.00 14.40 ? 35  ALA C O   1 
ATOM   4499 C CB  . ALA C 1 15  ? -3.487  17.505  -2.923  1.00 11.32 ? 35  ALA C CB  1 
ATOM   4500 N N   . VAL C 1 16  ? -3.172  15.716  -5.569  1.00 13.57 ? 36  VAL C N   1 
ATOM   4501 C CA  . VAL C 1 16  ? -3.507  14.536  -6.358  1.00 13.57 ? 36  VAL C CA  1 
ATOM   4502 C C   . VAL C 1 16  ? -2.222  13.809  -6.654  1.00 13.57 ? 36  VAL C C   1 
ATOM   4503 O O   . VAL C 1 16  ? -2.146  12.596  -6.549  1.00 13.57 ? 36  VAL C O   1 
ATOM   4504 C CB  . VAL C 1 16  ? -4.212  14.898  -7.689  1.00 11.17 ? 36  VAL C CB  1 
ATOM   4505 C CG1 . VAL C 1 16  ? -4.315  13.671  -8.581  1.00 11.17 ? 36  VAL C CG1 1 
ATOM   4506 C CG2 . VAL C 1 16  ? -5.604  15.434  -7.440  1.00 11.17 ? 36  VAL C CG2 1 
ATOM   4507 N N   . ALA C 1 17  ? -1.191  14.544  -7.052  1.00 13.64 ? 37  ALA C N   1 
ATOM   4508 C CA  . ALA C 1 17  ? 0.105   13.968  -7.367  1.00 13.64 ? 37  ALA C CA  1 
ATOM   4509 C C   . ALA C 1 17  ? 0.678   13.288  -6.144  1.00 13.64 ? 37  ALA C C   1 
ATOM   4510 O O   . ALA C 1 17  ? 1.123   12.157  -6.292  1.00 13.64 ? 37  ALA C O   1 
ATOM   4511 C CB  . ALA C 1 17  ? 1.080   15.036  -7.839  1.00 12.17 ? 37  ALA C CB  1 
ATOM   4512 N N   . HIS C 1 18  ? 0.676   13.925  -4.998  1.00 14.09 ? 38  HIS C N   1 
ATOM   4513 C CA  . HIS C 1 18  ? 1.249   13.338  -3.785  1.00 14.09 ? 38  HIS C CA  1 
ATOM   4514 C C   . HIS C 1 18  ? 0.461   12.114  -3.356  1.00 14.09 ? 38  HIS C C   1 
ATOM   4515 O O   . HIS C 1 18  ? 1.057   11.096  -2.965  1.00 14.09 ? 38  HIS C O   1 
ATOM   4516 C CB  . HIS C 1 18  ? 1.317   14.368  -2.665  1.00 12.51 ? 38  HIS C CB  1 
ATOM   4517 C CG  . HIS C 1 18  ? 2.108   13.918  -1.471  1.00 12.51 ? 38  HIS C CG  1 
ATOM   4518 N ND1 . HIS C 1 18  ? 2.063   14.557  -0.252  1.00 12.51 ? 38  HIS C ND1 1 
ATOM   4519 C CD2 . HIS C 1 18  ? 2.980   12.880  -1.314  1.00 12.51 ? 38  HIS C CD2 1 
ATOM   4520 C CE1 . HIS C 1 18  ? 2.882   13.950  0.592   1.00 12.51 ? 38  HIS C CE1 1 
ATOM   4521 N NE2 . HIS C 1 18  ? 3.444   12.934  -0.035  1.00 12.51 ? 38  HIS C NE2 1 
ATOM   4522 N N   . GLY C 1 19  ? -0.838  12.111  -3.446  1.00 15.65 ? 39  GLY C N   1 
ATOM   4523 C CA  . GLY C 1 19  ? -1.681  10.989  -3.140  1.00 15.65 ? 39  GLY C CA  1 
ATOM   4524 C C   . GLY C 1 19  ? -1.324  9.792   -3.982  1.00 15.65 ? 39  GLY C C   1 
ATOM   4525 O O   . GLY C 1 19  ? -1.325  8.642   -3.461  1.00 15.65 ? 39  GLY C O   1 
ATOM   4526 N N   . LEU C 1 20  ? -1.027  9.957   -5.245  1.00 14.80 ? 40  LEU C N   1 
ATOM   4527 C CA  . LEU C 1 20  ? -0.661  8.868   -6.136  1.00 14.80 ? 40  LEU C CA  1 
ATOM   4528 C C   . LEU C 1 20  ? 0.770   8.428   -5.878  1.00 14.80 ? 40  LEU C C   1 
ATOM   4529 O O   . LEU C 1 20  ? 1.060   7.240   -5.806  1.00 14.80 ? 40  LEU C O   1 
ATOM   4530 C CB  . LEU C 1 20  ? -0.784  9.302   -7.587  1.00 12.18 ? 40  LEU C CB  1 
ATOM   4531 C CG  . LEU C 1 20  ? -2.148  9.669   -8.142  1.00 12.18 ? 40  LEU C CG  1 
ATOM   4532 C CD1 . LEU C 1 20  ? -2.011  10.510  -9.406  1.00 12.18 ? 40  LEU C CD1 1 
ATOM   4533 C CD2 . LEU C 1 20  ? -2.968  8.444   -8.493  1.00 12.18 ? 40  LEU C CD2 1 
ATOM   4534 N N   . ILE C 1 21  ? 1.703   9.346   -5.754  1.00 15.16 ? 41  ILE C N   1 
ATOM   4535 C CA  . ILE C 1 21  ? 3.103   9.000   -5.549  1.00 15.16 ? 41  ILE C CA  1 
ATOM   4536 C C   . ILE C 1 21  ? 3.352   8.327   -4.199  1.00 15.16 ? 41  ILE C C   1 
ATOM   4537 O O   . ILE C 1 21  ? 4.119   7.333   -4.159  1.00 15.16 ? 41  ILE C O   1 
ATOM   4538 C CB  . ILE C 1 21  ? 3.970   10.260  -5.736  1.00 13.76 ? 41  ILE C CB  1 
ATOM   4539 C CG1 . ILE C 1 21  ? 3.965   10.616  -7.251  1.00 13.76 ? 41  ILE C CG1 1 
ATOM   4540 C CG2 . ILE C 1 21  ? 5.389   10.075  -5.274  1.00 13.76 ? 41  ILE C CG2 1 
ATOM   4541 C CD1 . ILE C 1 21  ? 4.665   11.941  -7.521  1.00 13.76 ? 41  ILE C CD1 1 
ATOM   4542 N N   . ALA C 1 22  ? 2.695   8.741   -3.114  1.00 16.09 ? 42  ALA C N   1 
ATOM   4543 C CA  . ALA C 1 22  ? 2.837   8.137   -1.790  1.00 16.09 ? 42  ALA C CA  1 
ATOM   4544 C C   . ALA C 1 22  ? 2.455   6.682   -1.859  1.00 16.09 ? 42  ALA C C   1 
ATOM   4545 O O   . ALA C 1 22  ? 3.097   5.864   -1.187  1.00 16.09 ? 42  ALA C O   1 
ATOM   4546 C CB  . ALA C 1 22  ? 1.937   8.838   -0.764  1.00 14.21 ? 42  ALA C CB  1 
ATOM   4547 N N   . GLN C 1 23  ? 1.448   6.333   -2.630  1.00 18.17 ? 43  GLN C N   1 
ATOM   4548 C CA  . GLN C 1 23  ? 1.045   4.946   -2.760  1.00 18.17 ? 43  GLN C CA  1 
ATOM   4549 C C   . GLN C 1 23  ? 1.748   4.268   -3.912  1.00 18.17 ? 43  GLN C C   1 
ATOM   4550 O O   . GLN C 1 23  ? 1.567   3.056   -4.006  1.00 18.17 ? 43  GLN C O   1 
ATOM   4551 C CB  . GLN C 1 23  ? -0.447  4.738   -3.005  1.00 21.40 ? 43  GLN C CB  1 
ATOM   4552 C CG  . GLN C 1 23  ? -1.373  5.435   -2.064  1.00 21.40 ? 43  GLN C CG  1 
ATOM   4553 C CD  . GLN C 1 23  ? -2.813  5.390   -2.557  1.00 21.40 ? 43  GLN C CD  1 
ATOM   4554 O OE1 . GLN C 1 23  ? -3.406  4.310   -2.455  1.00 21.40 ? 43  GLN C OE1 1 
ATOM   4555 N NE2 . GLN C 1 23  ? -3.343  6.519   -3.089  1.00 21.40 ? 43  GLN C NE2 1 
ATOM   4556 N N   . GLY C 1 24  ? 2.442   4.957   -4.806  1.00 16.90 ? 44  GLY C N   1 
ATOM   4557 C CA  . GLY C 1 24  ? 3.098   4.211   -5.927  1.00 16.90 ? 44  GLY C CA  1 
ATOM   4558 C C   . GLY C 1 24  ? 2.030   3.727   -6.866  1.00 16.90 ? 44  GLY C C   1 
ATOM   4559 O O   . GLY C 1 24  ? 2.144   2.656   -7.487  1.00 16.90 ? 44  GLY C O   1 
ATOM   4560 N N   . VAL C 1 25  ? 0.945   4.490   -7.075  1.00 15.32 ? 45  VAL C N   1 
ATOM   4561 C CA  . VAL C 1 25  ? -0.127  4.045   -7.964  1.00 15.32 ? 45  VAL C CA  1 
ATOM   4562 C C   . VAL C 1 25  ? 0.274   3.955   -9.430  1.00 15.32 ? 45  VAL C C   1 
ATOM   4563 O O   . VAL C 1 25  ? -0.058  2.950   -10.083 1.00 15.32 ? 45  VAL C O   1 
ATOM   4564 C CB  . VAL C 1 25  ? -1.344  4.987   -7.851  1.00 13.91 ? 45  VAL C CB  1 
ATOM   4565 C CG1 . VAL C 1 25  ? -2.459  4.520   -8.780  1.00 13.91 ? 45  VAL C CG1 1 
ATOM   4566 C CG2 . VAL C 1 25  ? -1.867  5.036   -6.435  1.00 13.91 ? 45  VAL C CG2 1 
ATOM   4567 N N   . ALA C 1 26  ? 0.939   4.960   -9.964  1.00 15.28 ? 46  ALA C N   1 
ATOM   4568 C CA  . ALA C 1 26  ? 1.347   4.951   -11.356 1.00 15.28 ? 46  ALA C CA  1 
ATOM   4569 C C   . ALA C 1 26  ? 2.856   4.830   -11.499 1.00 15.28 ? 46  ALA C C   1 
ATOM   4570 O O   . ALA C 1 26  ? 3.619   5.123   -10.596 1.00 15.28 ? 46  ALA C O   1 
ATOM   4571 C CB  . ALA C 1 26  ? 0.876   6.234   -12.032 1.00 15.74 ? 46  ALA C CB  1 
ATOM   4572 N N   . ASP C 1 27  ? 3.291   4.374   -12.664 1.00 15.21 ? 47  ASP C N   1 
ATOM   4573 C CA  . ASP C 1 27  ? 4.691   4.216   -12.982 1.00 15.21 ? 47  ASP C CA  1 
ATOM   4574 C C   . ASP C 1 27  ? 5.238   5.505   -13.598 1.00 15.21 ? 47  ASP C C   1 
ATOM   4575 O O   . ASP C 1 27  ? 6.347   5.965   -13.321 1.00 15.21 ? 47  ASP C O   1 
ATOM   4576 C CB  . ASP C 1 27  ? 4.823   3.069   -13.985 1.00 17.73 ? 47  ASP C CB  1 
ATOM   4577 C CG  . ASP C 1 27  ? 4.308   1.744   -13.445 1.00 17.73 ? 47  ASP C CG  1 
ATOM   4578 O OD1 . ASP C 1 27  ? 4.933   1.228   -12.500 1.00 17.73 ? 47  ASP C OD1 1 
ATOM   4579 O OD2 . ASP C 1 27  ? 3.303   1.183   -13.929 1.00 17.73 ? 47  ASP C OD2 1 
ATOM   4580 N N   . ASP C 1 28  ? 4.420   6.131   -14.484 1.00 15.72 ? 48  ASP C N   1 
ATOM   4581 C CA  . ASP C 1 28  ? 4.828   7.363   -15.160 1.00 15.72 ? 48  ASP C CA  1 
ATOM   4582 C C   . ASP C 1 28  ? 3.827   8.492   -14.935 1.00 15.72 ? 48  ASP C C   1 
ATOM   4583 O O   . ASP C 1 28  ? 2.632   8.292   -15.083 1.00 15.72 ? 48  ASP C O   1 
ATOM   4584 C CB  . ASP C 1 28  ? 4.937   7.160   -16.664 1.00 18.21 ? 48  ASP C CB  1 
ATOM   4585 C CG  . ASP C 1 28  ? 5.967   6.170   -17.091 1.00 18.21 ? 48  ASP C CG  1 
ATOM   4586 O OD1 . ASP C 1 28  ? 7.142   6.277   -16.677 1.00 18.21 ? 48  ASP C OD1 1 
ATOM   4587 O OD2 . ASP C 1 28  ? 5.639   5.237   -17.869 1.00 18.21 ? 48  ASP C OD2 1 
ATOM   4588 N N   . TYR C 1 29  ? 4.336   9.670   -14.609 1.00 16.38 ? 49  TYR C N   1 
ATOM   4589 C CA  . TYR C 1 29  ? 3.553   10.873  -14.373 1.00 16.38 ? 49  TYR C CA  1 
ATOM   4590 C C   . TYR C 1 29  ? 3.979   11.986  -15.320 1.00 16.38 ? 49  TYR C C   1 
ATOM   4591 O O   . TYR C 1 29  ? 5.162   12.142  -15.658 1.00 16.38 ? 49  TYR C O   1 
ATOM   4592 C CB  . TYR C 1 29  ? 3.755   11.443  -12.954 1.00 17.17 ? 49  TYR C CB  1 
ATOM   4593 C CG  . TYR C 1 29  ? 3.388   10.443  -11.871 1.00 17.17 ? 49  TYR C CG  1 
ATOM   4594 C CD1 . TYR C 1 29  ? 4.323   9.490   -11.439 1.00 17.17 ? 49  TYR C CD1 1 
ATOM   4595 C CD2 . TYR C 1 29  ? 2.108   10.430  -11.373 1.00 17.17 ? 49  TYR C CD2 1 
ATOM   4596 C CE1 . TYR C 1 29  ? 3.981   8.581   -10.472 1.00 17.17 ? 49  TYR C CE1 1 
ATOM   4597 C CE2 . TYR C 1 29  ? 1.758   9.504   -10.402 1.00 17.17 ? 49  TYR C CE2 1 
ATOM   4598 C CZ  . TYR C 1 29  ? 2.690   8.607   -9.958  1.00 17.17 ? 49  TYR C CZ  1 
ATOM   4599 O OH  . TYR C 1 29  ? 2.351   7.683   -8.969  1.00 17.17 ? 49  TYR C OH  1 
ATOM   4600 N N   . VAL C 1 30  ? 2.987   12.751  -15.770 1.00 15.42 ? 50  VAL C N   1 
ATOM   4601 C CA  . VAL C 1 30  ? 3.213   13.887  -16.673 1.00 15.42 ? 50  VAL C CA  1 
ATOM   4602 C C   . VAL C 1 30  ? 2.571   15.109  -16.015 1.00 15.42 ? 50  VAL C C   1 
ATOM   4603 O O   . VAL C 1 30  ? 1.356   15.098  -15.818 1.00 15.42 ? 50  VAL C O   1 
ATOM   4604 C CB  . VAL C 1 30  ? 2.603   13.661  -18.060 1.00 15.89 ? 50  VAL C CB  1 
ATOM   4605 C CG1 . VAL C 1 30  ? 2.947   14.838  -18.994 1.00 15.89 ? 50  VAL C CG1 1 
ATOM   4606 C CG2 . VAL C 1 30  ? 3.100   12.401  -18.744 1.00 15.89 ? 50  VAL C CG2 1 
ATOM   4607 N N   . PHE C 1 31  ? 3.390   16.096  -15.627 1.00 14.70 ? 51  PHE C N   1 
ATOM   4608 C CA  . PHE C 1 31  ? 2.816   17.277  -14.973 1.00 14.70 ? 51  PHE C CA  1 
ATOM   4609 C C   . PHE C 1 31  ? 2.799   18.438  -15.942 1.00 14.70 ? 51  PHE C C   1 
ATOM   4610 O O   . PHE C 1 31  ? 3.840   18.757  -16.517 1.00 14.70 ? 51  PHE C O   1 
ATOM   4611 C CB  . PHE C 1 31  ? 3.606   17.739  -13.784 1.00 12.57 ? 51  PHE C CB  1 
ATOM   4612 C CG  . PHE C 1 31  ? 3.684   16.815  -12.605 1.00 12.57 ? 51  PHE C CG  1 
ATOM   4613 C CD1 . PHE C 1 31  ? 2.857   15.699  -12.499 1.00 12.57 ? 51  PHE C CD1 1 
ATOM   4614 C CD2 . PHE C 1 31  ? 4.589   17.083  -11.583 1.00 12.57 ? 51  PHE C CD2 1 
ATOM   4615 C CE1 . PHE C 1 31  ? 2.921   14.835  -11.425 1.00 12.57 ? 51  PHE C CE1 1 
ATOM   4616 C CE2 . PHE C 1 31  ? 4.659   16.219  -10.487 1.00 12.57 ? 51  PHE C CE2 1 
ATOM   4617 C CZ  . PHE C 1 31  ? 3.821   15.110  -10.428 1.00 12.57 ? 51  PHE C CZ  1 
ATOM   4618 N N   . ILE C 1 32  ? 1.633   19.048  -16.088 1.00 16.35 ? 52  ILE C N   1 
ATOM   4619 C CA  . ILE C 1 32  ? 1.572   20.181  -17.008 1.00 16.35 ? 52  ILE C CA  1 
ATOM   4620 C C   . ILE C 1 32  ? 1.051   21.402  -16.307 1.00 16.35 ? 52  ILE C C   1 
ATOM   4621 O O   . ILE C 1 32  ? -0.025  21.363  -15.723 1.00 16.35 ? 52  ILE C O   1 
ATOM   4622 C CB  . ILE C 1 32  ? 0.679   19.831  -18.217 1.00 16.49 ? 52  ILE C CB  1 
ATOM   4623 C CG1 . ILE C 1 32  ? 1.438   18.861  -19.134 1.00 16.49 ? 52  ILE C CG1 1 
ATOM   4624 C CG2 . ILE C 1 32  ? 0.286   21.073  -19.017 1.00 16.49 ? 52  ILE C CG2 1 
ATOM   4625 C CD1 . ILE C 1 32  ? 0.681   18.281  -20.266 1.00 16.49 ? 52  ILE C CD1 1 
ATOM   4626 N N   . ASP C 1 33  ? 1.796   22.485  -16.371 1.00 17.06 ? 53  ASP C N   1 
ATOM   4627 C CA  . ASP C 1 33  ? 1.412   23.697  -15.722 1.00 17.06 ? 53  ASP C CA  1 
ATOM   4628 C C   . ASP C 1 33  ? 2.065   24.874  -16.466 1.00 17.06 ? 53  ASP C C   1 
ATOM   4629 O O   . ASP C 1 33  ? 3.198   24.694  -16.904 1.00 17.06 ? 53  ASP C O   1 
ATOM   4630 C CB  . ASP C 1 33  ? 1.899   23.677  -14.295 1.00 15.52 ? 53  ASP C CB  1 
ATOM   4631 C CG  . ASP C 1 33  ? 1.188   24.672  -13.425 1.00 15.52 ? 53  ASP C CG  1 
ATOM   4632 O OD1 . ASP C 1 33  ? 1.629   25.854  -13.327 1.00 15.52 ? 53  ASP C OD1 1 
ATOM   4633 O OD2 . ASP C 1 33  ? 0.156   24.352  -12.820 1.00 15.52 ? 53  ASP C OD2 1 
ATOM   4634 N N   . ALA C 1 34  ? 1.314   25.968  -16.512 1.00 19.18 ? 54  ALA C N   1 
ATOM   4635 C CA  . ALA C 1 34  ? 1.721   27.203  -17.158 1.00 19.18 ? 54  ALA C CA  1 
ATOM   4636 C C   . ALA C 1 34  ? 2.905   27.848  -16.435 1.00 19.18 ? 54  ALA C C   1 
ATOM   4637 O O   . ALA C 1 34  ? 3.769   28.453  -17.107 1.00 19.18 ? 54  ALA C O   1 
ATOM   4638 C CB  . ALA C 1 34  ? 0.571   28.222  -17.182 1.00 18.05 ? 54  ALA C CB  1 
ATOM   4639 N N   . ASN C 1 35  ? 2.993   27.708  -15.132 1.00 18.74 ? 55  ASN C N   1 
ATOM   4640 C CA  . ASN C 1 35  ? 4.114   28.251  -14.390 1.00 18.74 ? 55  ASN C CA  1 
ATOM   4641 C C   . ASN C 1 35  ? 5.259   27.283  -14.383 1.00 18.74 ? 55  ASN C C   1 
ATOM   4642 O O   . ASN C 1 35  ? 5.243   26.364  -13.576 1.00 18.74 ? 55  ASN C O   1 
ATOM   4643 C CB  . ASN C 1 35  ? 3.646   28.598  -12.974 1.00 19.01 ? 55  ASN C CB  1 
ATOM   4644 C CG  . ASN C 1 35  ? 4.716   29.280  -12.155 1.00 19.01 ? 55  ASN C CG  1 
ATOM   4645 O OD1 . ASN C 1 35  ? 5.916   29.210  -12.473 1.00 19.01 ? 55  ASN C OD1 1 
ATOM   4646 N ND2 . ASN C 1 35  ? 4.318   29.980  -11.103 1.00 19.01 ? 55  ASN C ND2 1 
ATOM   4647 N N   . GLU C 1 36  ? 6.296   27.442  -15.181 1.00 19.43 ? 56  GLU C N   1 
ATOM   4648 C CA  . GLU C 1 36  ? 7.409   26.515  -15.248 1.00 19.43 ? 56  GLU C CA  1 
ATOM   4649 C C   . GLU C 1 36  ? 8.140   26.414  -13.929 1.00 19.43 ? 56  GLU C C   1 
ATOM   4650 O O   . GLU C 1 36  ? 8.575   25.287  -13.598 1.00 19.43 ? 56  GLU C O   1 
ATOM   4651 C CB  . GLU C 1 36  ? 8.378   26.902  -16.358 1.00 18.13 ? 56  GLU C CB  1 
ATOM   4652 C CG  . GLU C 1 36  ? 9.474   25.914  -16.682 1.00 18.13 ? 56  GLU C CG  1 
ATOM   4653 C CD  . GLU C 1 36  ? 9.067   24.848  -17.643 1.00 18.13 ? 56  GLU C CD  1 
ATOM   4654 O OE1 . GLU C 1 36  ? 8.030   24.931  -18.324 1.00 18.13 ? 56  GLU C OE1 1 
ATOM   4655 O OE2 . GLU C 1 36  ? 9.772   23.822  -17.822 1.00 18.13 ? 56  GLU C OE2 1 
ATOM   4656 N N   . ALA C 1 37  ? 8.313   27.467  -13.185 1.00 21.08 ? 57  ALA C N   1 
ATOM   4657 C CA  . ALA C 1 37  ? 9.027   27.421  -11.919 1.00 21.08 ? 57  ALA C CA  1 
ATOM   4658 C C   . ALA C 1 37  ? 8.330   26.528  -10.905 1.00 21.08 ? 57  ALA C C   1 
ATOM   4659 O O   . ALA C 1 37  ? 9.002   25.689  -10.308 1.00 21.08 ? 57  ALA C O   1 
ATOM   4660 C CB  . ALA C 1 37  ? 9.163   28.801  -11.304 1.00 20.02 ? 57  ALA C CB  1 
ATOM   4661 N N   . LYS C 1 38  ? 7.049   26.696  -10.682 1.00 20.38 ? 58  LYS C N   1 
ATOM   4662 C CA  . LYS C 1 38  ? 6.265   25.916  -9.757  1.00 20.38 ? 58  LYS C CA  1 
ATOM   4663 C C   . LYS C 1 38  ? 6.287   24.434  -10.151 1.00 20.38 ? 58  LYS C C   1 
ATOM   4664 O O   . LYS C 1 38  ? 6.707   23.618  -9.300  1.00 20.38 ? 58  LYS C O   1 
ATOM   4665 C CB  . LYS C 1 38  ? 4.819   26.391  -9.714  1.00 22.49 ? 58  LYS C CB  1 
ATOM   4666 C CG  . LYS C 1 38  ? 3.817   25.560  -8.906  1.00 22.49 ? 58  LYS C CG  1 
ATOM   4667 C CD  . LYS C 1 38  ? 4.179   25.296  -7.498  1.00 22.49 ? 58  LYS C CD  1 
ATOM   4668 C CE  . LYS C 1 38  ? 3.072   24.771  -6.572  1.00 22.49 ? 58  LYS C CE  1 
ATOM   4669 N NZ  . LYS C 1 38  ? 2.673   23.342  -6.766  1.00 22.49 ? 58  LYS C NZ  1 
ATOM   4670 N N   . VAL C 1 39  ? 5.944   24.067  -11.355 1.00 17.05 ? 59  VAL C N   1 
ATOM   4671 C CA  . VAL C 1 39  ? 5.918   22.665  -11.760 1.00 17.05 ? 59  VAL C CA  1 
ATOM   4672 C C   . VAL C 1 39  ? 7.295   22.068  -11.699 1.00 17.05 ? 59  VAL C C   1 
ATOM   4673 O O   . VAL C 1 39  ? 7.462   20.890  -11.284 1.00 17.05 ? 59  VAL C O   1 
ATOM   4674 C CB  . VAL C 1 39  ? 5.244   22.505  -13.137 1.00 15.41 ? 59  VAL C CB  1 
ATOM   4675 C CG1 . VAL C 1 39  ? 6.176   22.899  -14.274 1.00 15.41 ? 59  VAL C CG1 1 
ATOM   4676 C CG2 . VAL C 1 39  ? 4.756   21.086  -13.361 1.00 15.41 ? 59  VAL C CG2 1 
ATOM   4677 N N   . LYS C 1 40  ? 8.344   22.803  -12.018 1.00 15.57 ? 60  LYS C N   1 
ATOM   4678 C CA  . LYS C 1 40  ? 9.716   22.306  -11.957 1.00 15.57 ? 60  LYS C CA  1 
ATOM   4679 C C   . LYS C 1 40  ? 10.112  22.133  -10.504 1.00 15.57 ? 60  LYS C C   1 
ATOM   4680 O O   . LYS C 1 40  ? 10.805  21.160  -10.197 1.00 15.57 ? 60  LYS C O   1 
ATOM   4681 C CB  . LYS C 1 40  ? 10.690  23.227  -12.620 1.00 13.42 ? 60  LYS C CB  1 
ATOM   4682 C CG  . LYS C 1 40  ? 12.130  22.817  -12.617 1.00 13.42 ? 60  LYS C CG  1 
ATOM   4683 C CD  . LYS C 1 40  ? 12.233  21.460  -13.344 1.00 13.42 ? 60  LYS C CD  1 
ATOM   4684 C CE  . LYS C 1 40  ? 13.712  21.066  -13.474 1.00 13.42 ? 60  LYS C CE  1 
ATOM   4685 N NZ  . LYS C 1 40  ? 13.780  19.822  -14.310 1.00 13.42 ? 60  LYS C NZ  1 
ATOM   4686 N N   . ALA C 1 41  ? 9.683   22.986  -9.595  1.00 14.63 ? 61  ALA C N   1 
ATOM   4687 C CA  . ALA C 1 41  ? 9.951   22.881  -8.167  1.00 14.63 ? 61  ALA C CA  1 
ATOM   4688 C C   . ALA C 1 41  ? 9.260   21.642  -7.607  1.00 14.63 ? 61  ALA C C   1 
ATOM   4689 O O   . ALA C 1 41  ? 9.871   20.899  -6.827  1.00 14.63 ? 61  ALA C O   1 
ATOM   4690 C CB  . ALA C 1 41  ? 9.422   24.095  -7.426  1.00 11.97 ? 61  ALA C CB  1 
ATOM   4691 N N   . ASP C 1 42  ? 8.043   21.363  -7.981  1.00 16.57 ? 62  ASP C N   1 
ATOM   4692 C CA  . ASP C 1 42  ? 7.314   20.180  -7.551  1.00 16.57 ? 62  ASP C CA  1 
ATOM   4693 C C   . ASP C 1 42  ? 7.979   18.924  -8.077  1.00 16.57 ? 62  ASP C C   1 
ATOM   4694 O O   . ASP C 1 42  ? 8.154   17.914  -7.324  1.00 16.57 ? 62  ASP C O   1 
ATOM   4695 C CB  . ASP C 1 42  ? 5.872   20.208  -8.022  1.00 16.18 ? 62  ASP C CB  1 
ATOM   4696 C CG  . ASP C 1 42  ? 4.955   20.984  -7.140  1.00 16.18 ? 62  ASP C CG  1 
ATOM   4697 O OD1 . ASP C 1 42  ? 5.336   21.240  -5.959  1.00 16.18 ? 62  ASP C OD1 1 
ATOM   4698 O OD2 . ASP C 1 42  ? 3.836   21.329  -7.573  1.00 16.18 ? 62  ASP C OD2 1 
ATOM   4699 N N   . GLN C 1 43  ? 8.415   18.894  -9.309  1.00 16.42 ? 63  GLN C N   1 
ATOM   4700 C CA  . GLN C 1 43  ? 9.077   17.722  -9.875  1.00 16.42 ? 63  GLN C CA  1 
ATOM   4701 C C   . GLN C 1 43  ? 10.312  17.380  -9.104  1.00 16.42 ? 63  GLN C C   1 
ATOM   4702 O O   . GLN C 1 43  ? 10.492  16.233  -8.722  1.00 16.42 ? 63  GLN C O   1 
ATOM   4703 C CB  . GLN C 1 43  ? 9.495   17.978  -11.327 1.00 14.92 ? 63  GLN C CB  1 
ATOM   4704 C CG  . GLN C 1 43  ? 10.147  16.775  -11.975 1.00 14.92 ? 63  GLN C CG  1 
ATOM   4705 C CD  . GLN C 1 43  ? 10.900  17.167  -13.219 1.00 14.92 ? 63  GLN C CD  1 
ATOM   4706 O OE1 . GLN C 1 43  ? 11.458  18.263  -13.276 1.00 14.92 ? 63  GLN C OE1 1 
ATOM   4707 N NE2 . GLN C 1 43  ? 10.897  16.307  -14.224 1.00 14.92 ? 63  GLN C NE2 1 
ATOM   4708 N N   . ILE C 1 44  ? 11.191  18.345  -8.876  1.00 18.03 ? 64  ILE C N   1 
ATOM   4709 C CA  . ILE C 1 44  ? 12.419  18.125  -8.130  1.00 18.03 ? 64  ILE C CA  1 
ATOM   4710 C C   . ILE C 1 44  ? 12.092  17.685  -6.716  1.00 18.03 ? 64  ILE C C   1 
ATOM   4711 O O   . ILE C 1 44  ? 12.729  16.779  -6.169  1.00 18.03 ? 64  ILE C O   1 
ATOM   4712 C CB  . ILE C 1 44  ? 13.275  19.396  -8.087  1.00 18.72 ? 64  ILE C CB  1 
ATOM   4713 C CG1 . ILE C 1 44  ? 13.938  19.593  -9.487  1.00 18.72 ? 64  ILE C CG1 1 
ATOM   4714 C CG2 . ILE C 1 44  ? 14.367  19.392  -7.057  1.00 18.72 ? 64  ILE C CG2 1 
ATOM   4715 C CD1 . ILE C 1 44  ? 14.652  20.979  -9.475  1.00 18.72 ? 64  ILE C CD1 1 
ATOM   4716 N N   . ASP C 1 45  ? 11.092  18.284  -6.083  1.00 16.01 ? 65  ASP C N   1 
ATOM   4717 C CA  . ASP C 1 45  ? 10.708  17.923  -4.711  1.00 16.01 ? 65  ASP C CA  1 
ATOM   4718 C C   . ASP C 1 45  ? 10.234  16.501  -4.678  1.00 16.01 ? 65  ASP C C   1 
ATOM   4719 O O   . ASP C 1 45  ? 10.594  15.775  -3.746  1.00 16.01 ? 65  ASP C O   1 
ATOM   4720 C CB  . ASP C 1 45  ? 9.602   18.860  -4.228  1.00 15.48 ? 65  ASP C CB  1 
ATOM   4721 C CG  . ASP C 1 45  ? 9.590   19.058  -2.740  1.00 15.48 ? 65  ASP C CG  1 
ATOM   4722 O OD1 . ASP C 1 45  ? 10.502  18.547  -2.057  1.00 15.48 ? 65  ASP C OD1 1 
ATOM   4723 O OD2 . ASP C 1 45  ? 8.671   19.736  -2.235  1.00 15.48 ? 65  ASP C OD2 1 
ATOM   4724 N N   . PHE C 1 46  ? 9.470   16.013  -5.631  1.00 15.03 ? 66  PHE C N   1 
ATOM   4725 C CA  . PHE C 1 46  ? 9.040   14.649  -5.683  1.00 15.03 ? 66  PHE C CA  1 
ATOM   4726 C C   . PHE C 1 46  ? 10.211  13.744  -5.967  1.00 15.03 ? 66  PHE C C   1 
ATOM   4727 O O   . PHE C 1 46  ? 10.309  12.643  -5.427  1.00 15.03 ? 66  PHE C O   1 
ATOM   4728 C CB  . PHE C 1 46  ? 7.980   14.427  -6.738  1.00 13.87 ? 66  PHE C CB  1 
ATOM   4729 C CG  . PHE C 1 46  ? 6.602   14.820  -6.306  1.00 13.87 ? 66  PHE C CG  1 
ATOM   4730 C CD1 . PHE C 1 46  ? 6.005   14.215  -5.209  1.00 13.87 ? 66  PHE C CD1 1 
ATOM   4731 C CD2 . PHE C 1 46  ? 5.877   15.772  -7.007  1.00 13.87 ? 66  PHE C CD2 1 
ATOM   4732 C CE1 . PHE C 1 46  ? 4.708   14.553  -4.815  1.00 13.87 ? 66  PHE C CE1 1 
ATOM   4733 C CE2 . PHE C 1 46  ? 4.587   16.123  -6.632  1.00 13.87 ? 66  PHE C CE2 1 
ATOM   4734 C CZ  . PHE C 1 46  ? 4.000   15.506  -5.527  1.00 13.87 ? 66  PHE C CZ  1 
ATOM   4735 N N   . GLN C 1 47  ? 11.182  14.159  -6.783  1.00 15.61 ? 67  GLN C N   1 
ATOM   4736 C CA  . GLN C 1 47  ? 12.346  13.349  -7.101  1.00 15.61 ? 67  GLN C CA  1 
ATOM   4737 C C   . GLN C 1 47  ? 13.264  13.230  -5.906  1.00 15.61 ? 67  GLN C C   1 
ATOM   4738 O O   . GLN C 1 47  ? 14.031  12.246  -5.792  1.00 15.61 ? 67  GLN C O   1 
ATOM   4739 C CB  . GLN C 1 47  ? 13.114  13.934  -8.294  1.00 16.75 ? 67  GLN C CB  1 
ATOM   4740 C CG  . GLN C 1 47  ? 12.348  13.819  -9.608  1.00 16.75 ? 67  GLN C CG  1 
ATOM   4741 C CD  . GLN C 1 47  ? 12.959  14.594  -10.774 1.00 16.75 ? 67  GLN C CD  1 
ATOM   4742 O OE1 . GLN C 1 47  ? 12.739  14.218  -11.967 1.00 16.75 ? 67  GLN C OE1 1 
ATOM   4743 N NE2 . GLN C 1 47  ? 13.704  15.655  -10.578 1.00 16.75 ? 67  GLN C NE2 1 
ATOM   4744 N N   . ASP C 1 48  ? 13.211  14.197  -5.023  1.00 16.39 ? 68  ASP C N   1 
ATOM   4745 C CA  . ASP C 1 48  ? 13.988  14.184  -3.796  1.00 16.39 ? 68  ASP C CA  1 
ATOM   4746 C C   . ASP C 1 48  ? 13.443  13.133  -2.815  1.00 16.39 ? 68  ASP C C   1 
ATOM   4747 O O   . ASP C 1 48  ? 14.148  12.516  -1.994  1.00 16.39 ? 68  ASP C O   1 
ATOM   4748 C CB  . ASP C 1 48  ? 13.976  15.542  -3.110  1.00 16.71 ? 68  ASP C CB  1 
ATOM   4749 C CG  . ASP C 1 48  ? 14.963  16.525  -3.665  1.00 16.71 ? 68  ASP C CG  1 
ATOM   4750 O OD1 . ASP C 1 48  ? 15.828  16.124  -4.468  1.00 16.71 ? 68  ASP C OD1 1 
ATOM   4751 O OD2 . ASP C 1 48  ? 14.906  17.732  -3.314  1.00 16.71 ? 68  ASP C OD2 1 
ATOM   4752 N N   . ALA C 1 49  ? 12.150  12.884  -2.874  1.00 15.76 ? 69  ALA C N   1 
ATOM   4753 C CA  . ALA C 1 49  ? 11.420  11.958  -2.063  1.00 15.76 ? 69  ALA C CA  1 
ATOM   4754 C C   . ALA C 1 49  ? 11.672  10.554  -2.543  1.00 15.76 ? 69  ALA C C   1 
ATOM   4755 O O   . ALA C 1 49  ? 11.607  9.640   -1.724  1.00 15.76 ? 69  ALA C O   1 
ATOM   4756 C CB  . ALA C 1 49  ? 9.919   12.306  -2.179  1.00 13.24 ? 69  ALA C CB  1 
ATOM   4757 N N   . MET C 1 50  ? 12.003  10.350  -3.809  1.00 16.25 ? 70  MET C N   1 
ATOM   4758 C CA  . MET C 1 50  ? 12.210  8.991   -4.345  1.00 16.25 ? 70  MET C CA  1 
ATOM   4759 C C   . MET C 1 50  ? 13.218  8.137   -3.623  1.00 16.25 ? 70  MET C C   1 
ATOM   4760 O O   . MET C 1 50  ? 12.975  6.910   -3.480  1.00 16.25 ? 70  MET C O   1 
ATOM   4761 C CB  . MET C 1 50  ? 12.621  9.046   -5.842  1.00 14.66 ? 70  MET C CB  1 
ATOM   4762 C CG  . MET C 1 50  ? 11.488  9.431   -6.766  1.00 14.66 ? 70  MET C CG  1 
ATOM   4763 S SD  . MET C 1 50  ? 10.123  8.261   -6.741  1.00 14.66 ? 70  MET C SD  1 
ATOM   4764 C CE  . MET C 1 50  ? 8.722   9.326   -6.997  1.00 14.66 ? 70  MET C CE  1 
ATOM   4765 N N   . ALA C 1 51  ? 14.305  8.672   -3.118  1.00 17.18 ? 71  ALA C N   1 
ATOM   4766 C CA  . ALA C 1 51  ? 15.288  7.868   -2.421  1.00 17.18 ? 71  ALA C CA  1 
ATOM   4767 C C   . ALA C 1 51  ? 14.701  7.277   -1.137  1.00 17.18 ? 71  ALA C C   1 
ATOM   4768 O O   . ALA C 1 51  ? 15.182  6.230   -0.698  1.00 17.18 ? 71  ALA C O   1 
ATOM   4769 C CB  . ALA C 1 51  ? 16.513  8.671   -2.034  1.00 16.11 ? 71  ALA C CB  1 
ATOM   4770 N N   . ASN C 1 52  ? 13.714  7.870   -0.507  1.00 16.09 ? 72  ASN C N   1 
ATOM   4771 C CA  . ASN C 1 52  ? 13.089  7.423   0.728   1.00 16.09 ? 72  ASN C CA  1 
ATOM   4772 C C   . ASN C 1 52  ? 11.654  6.947   0.552   1.00 16.09 ? 72  ASN C C   1 
ATOM   4773 O O   . ASN C 1 52  ? 10.938  6.759   1.565   1.00 16.09 ? 72  ASN C O   1 
ATOM   4774 C CB  . ASN C 1 52  ? 13.079  8.603   1.698   1.00 14.84 ? 72  ASN C CB  1 
ATOM   4775 C CG  . ASN C 1 52  ? 14.463  9.022   2.066   1.00 14.84 ? 72  ASN C CG  1 
ATOM   4776 O OD1 . ASN C 1 52  ? 15.318  8.140   2.306   1.00 14.84 ? 72  ASN C OD1 1 
ATOM   4777 N ND2 . ASN C 1 52  ? 14.734  10.297  2.143   1.00 14.84 ? 72  ASN C ND2 1 
ATOM   4778 N N   . LEU C 1 53  ? 11.218  6.711   -0.651  1.00 17.35 ? 73  LEU C N   1 
ATOM   4779 C CA  . LEU C 1 53  ? 9.859   6.218   -0.900  1.00 17.35 ? 73  LEU C CA  1 
ATOM   4780 C C   . LEU C 1 53  ? 9.937   4.716   -1.221  1.00 17.35 ? 73  LEU C C   1 
ATOM   4781 O O   . LEU C 1 53  ? 11.007  4.249   -1.633  1.00 17.35 ? 73  LEU C O   1 
ATOM   4782 C CB  . LEU C 1 53  ? 9.219   6.929   -2.089  1.00 18.10 ? 73  LEU C CB  1 
ATOM   4783 C CG  . LEU C 1 53  ? 8.404   8.160   -1.971  1.00 18.10 ? 73  LEU C CG  1 
ATOM   4784 C CD1 . LEU C 1 53  ? 8.104   8.751   -3.357  1.00 18.10 ? 73  LEU C CD1 1 
ATOM   4785 C CD2 . LEU C 1 53  ? 7.047   7.911   -1.336  1.00 18.10 ? 73  LEU C CD2 1 
ATOM   4786 N N   . GLU C 1 54  ? 8.841   4.000   -1.089  1.00 18.93 ? 74  GLU C N   1 
ATOM   4787 C CA  . GLU C 1 54  ? 8.787   2.585   -1.328  1.00 18.93 ? 74  GLU C CA  1 
ATOM   4788 C C   . GLU C 1 54  ? 8.615   2.220   -2.787  1.00 18.93 ? 74  GLU C C   1 
ATOM   4789 O O   . GLU C 1 54  ? 9.150   1.207   -3.210  1.00 18.93 ? 74  GLU C O   1 
ATOM   4790 C CB  . GLU C 1 54  ? 7.584   1.960   -0.595  1.00 25.74 ? 74  GLU C CB  1 
ATOM   4791 C CG  . GLU C 1 54  ? 7.714   1.819   0.885   1.00 25.74 ? 74  GLU C CG  1 
ATOM   4792 C CD  . GLU C 1 54  ? 7.383   3.035   1.689   1.00 25.74 ? 74  GLU C CD  1 
ATOM   4793 O OE1 . GLU C 1 54  ? 6.902   4.084   1.095   1.00 25.74 ? 74  GLU C OE1 1 
ATOM   4794 O OE2 . GLU C 1 54  ? 7.600   2.951   2.944   1.00 25.74 ? 74  GLU C OE2 1 
ATOM   4795 N N   . ALA C 1 55  ? 7.828   3.009   -3.509  1.00 17.01 ? 75  ALA C N   1 
ATOM   4796 C CA  . ALA C 1 55  ? 7.635   2.719   -4.955  1.00 17.01 ? 75  ALA C CA  1 
ATOM   4797 C C   . ALA C 1 55  ? 8.247   3.833   -5.766  1.00 17.01 ? 75  ALA C C   1 
ATOM   4798 O O   . ALA C 1 55  ? 8.375   4.956   -5.295  1.00 17.01 ? 75  ALA C O   1 
ATOM   4799 C CB  . ALA C 1 55  ? 6.147   2.558   -5.188  1.00 16.94 ? 75  ALA C CB  1 
ATOM   4800 N N   . HIS C 1 56  ? 8.655   3.536   -6.990  1.00 15.43 ? 76  HIS C N   1 
ATOM   4801 C CA  . HIS C 1 56  ? 9.269   4.483   -7.894  1.00 15.43 ? 76  HIS C CA  1 
ATOM   4802 C C   . HIS C 1 56  ? 8.272   5.001   -8.916  1.00 15.43 ? 76  HIS C C   1 
ATOM   4803 O O   . HIS C 1 56  ? 7.335   4.310   -9.321  1.00 15.43 ? 76  HIS C O   1 
ATOM   4804 C CB  . HIS C 1 56  ? 10.434  3.780   -8.597  1.00 14.98 ? 76  HIS C CB  1 
ATOM   4805 C CG  . HIS C 1 56  ? 11.144  4.605   -9.596  1.00 14.98 ? 76  HIS C CG  1 
ATOM   4806 N ND1 . HIS C 1 56  ? 12.079  5.571   -9.262  1.00 14.98 ? 76  HIS C ND1 1 
ATOM   4807 C CD2 . HIS C 1 56  ? 11.002  4.631   -10.956 1.00 14.98 ? 76  HIS C CD2 1 
ATOM   4808 C CE1 . HIS C 1 56  ? 12.493  6.149   -10.373 1.00 14.98 ? 76  HIS C CE1 1 
ATOM   4809 N NE2 . HIS C 1 56  ? 11.861  5.598   -11.422 1.00 14.98 ? 76  HIS C NE2 1 
ATOM   4810 N N   . GLY C 1 57  ? 8.413   6.239   -9.307  1.00 15.01 ? 77  GLY C N   1 
ATOM   4811 C CA  . GLY C 1 57  ? 7.566   6.888   -10.326 1.00 15.01 ? 77  GLY C CA  1 
ATOM   4812 C C   . GLY C 1 57  ? 8.480   7.817   -11.116 1.00 15.01 ? 77  GLY C C   1 
ATOM   4813 O O   . GLY C 1 57  ? 9.400   8.417   -10.572 1.00 15.01 ? 77  GLY C O   1 
ATOM   4814 N N   . ASN C 1 58  ? 8.234   7.898   -12.428 1.00 15.64 ? 78  ASN C N   1 
ATOM   4815 C CA  . ASN C 1 58  ? 9.012   8.769   -13.319 1.00 15.64 ? 78  ASN C CA  1 
ATOM   4816 C C   . ASN C 1 58  ? 8.194   9.997   -13.585 1.00 15.64 ? 78  ASN C C   1 
ATOM   4817 O O   . ASN C 1 58  ? 6.979   9.866   -13.796 1.00 15.64 ? 78  ASN C O   1 
ATOM   4818 C CB  . ASN C 1 58  ? 9.284   8.097   -14.642 1.00 14.84 ? 78  ASN C CB  1 
ATOM   4819 C CG  . ASN C 1 58  ? 10.015  6.784   -14.447 1.00 14.84 ? 78  ASN C CG  1 
ATOM   4820 O OD1 . ASN C 1 58  ? 11.135  6.788   -13.963 1.00 14.84 ? 78  ASN C OD1 1 
ATOM   4821 N ND2 . ASN C 1 58  ? 9.357   5.699   -14.835 1.00 14.84 ? 78  ASN C ND2 1 
ATOM   4822 N N   . ILE C 1 59  ? 8.785   11.161  -13.503 1.00 16.89 ? 79  ILE C N   1 
ATOM   4823 C CA  . ILE C 1 59  ? 8.031   12.404  -13.694 1.00 16.89 ? 79  ILE C CA  1 
ATOM   4824 C C   . ILE C 1 59  ? 8.567   13.280  -14.827 1.00 16.89 ? 79  ILE C C   1 
ATOM   4825 O O   . ILE C 1 59  ? 9.727   13.647  -14.831 1.00 16.89 ? 79  ILE C O   1 
ATOM   4826 C CB  . ILE C 1 59  ? 8.067   13.242  -12.396 1.00 16.63 ? 79  ILE C CB  1 
ATOM   4827 C CG1 . ILE C 1 59  ? 7.469   12.443  -11.217 1.00 16.63 ? 79  ILE C CG1 1 
ATOM   4828 C CG2 . ILE C 1 59  ? 7.286   14.511  -12.543 1.00 16.63 ? 79  ILE C CG2 1 
ATOM   4829 C CD1 . ILE C 1 59  ? 7.669   13.141  -9.911  1.00 16.63 ? 79  ILE C CD1 1 
ATOM   4830 N N   . VAL C 1 60  ? 7.691   13.554  -15.813 1.00 16.93 ? 80  VAL C N   1 
ATOM   4831 C CA  . VAL C 1 60  ? 8.052   14.467  -16.900 1.00 16.93 ? 80  VAL C CA  1 
ATOM   4832 C C   . VAL C 1 60  ? 7.120   15.668  -16.775 1.00 16.93 ? 80  VAL C C   1 
ATOM   4833 O O   . VAL C 1 60  ? 6.024   15.578  -16.255 1.00 16.93 ? 80  VAL C O   1 
ATOM   4834 C CB  . VAL C 1 60  ? 7.991   13.956  -18.333 1.00 18.25 ? 80  VAL C CB  1 
ATOM   4835 C CG1 . VAL C 1 60  ? 8.703   12.616  -18.458 1.00 18.25 ? 80  VAL C CG1 1 
ATOM   4836 C CG2 . VAL C 1 60  ? 6.588   13.763  -18.889 1.00 18.25 ? 80  VAL C CG2 1 
ATOM   4837 N N   . ILE C 1 61  ? 7.626   16.841  -17.177 1.00 17.51 ? 81  ILE C N   1 
ATOM   4838 C CA  . ILE C 1 61  ? 6.827   18.067  -17.110 1.00 17.51 ? 81  ILE C CA  1 
ATOM   4839 C C   . ILE C 1 61  ? 6.700   18.794  -18.460 1.00 17.51 ? 81  ILE C C   1 
ATOM   4840 O O   . ILE C 1 61  ? 7.602   18.759  -19.288 1.00 17.51 ? 81  ILE C O   1 
ATOM   4841 C CB  . ILE C 1 61  ? 7.371   19.106  -16.098 1.00 16.49 ? 81  ILE C CB  1 
ATOM   4842 C CG1 . ILE C 1 61  ? 8.741   19.657  -16.488 1.00 16.49 ? 81  ILE C CG1 1 
ATOM   4843 C CG2 . ILE C 1 61  ? 7.442   18.488  -14.702 1.00 16.49 ? 81  ILE C CG2 1 
ATOM   4844 C CD1 . ILE C 1 61  ? 9.204   20.833  -15.654 1.00 16.49 ? 81  ILE C CD1 1 
ATOM   4845 N N   . ASN C 1 62  ? 5.549   19.413  -18.661 1.00 18.99 ? 82  ASN C N   1 
ATOM   4846 C CA  . ASN C 1 62  ? 5.189   20.218  -19.805 1.00 18.99 ? 82  ASN C CA  1 
ATOM   4847 C C   . ASN C 1 62  ? 5.571   19.614  -21.121 1.00 18.99 ? 82  ASN C C   1 
ATOM   4848 O O   . ASN C 1 62  ? 6.138   20.272  -22.007 1.00 18.99 ? 82  ASN C O   1 
ATOM   4849 C CB  . ASN C 1 62  ? 5.913   21.586  -19.599 1.00 16.68 ? 82  ASN C CB  1 
ATOM   4850 C CG  . ASN C 1 62  ? 5.226   22.368  -18.500 1.00 16.68 ? 82  ASN C CG  1 
ATOM   4851 O OD1 . ASN C 1 62  ? 4.045   22.088  -18.237 1.00 16.68 ? 82  ASN C OD1 1 
ATOM   4852 N ND2 . ASN C 1 62  ? 5.864   23.325  -17.888 1.00 16.68 ? 82  ASN C ND2 1 
ATOM   4853 N N   . ASP C 1 63  ? 5.217   18.368  -21.332 1.00 18.73 ? 83  ASP C N   1 
ATOM   4854 C CA  . ASP C 1 63  ? 5.514   17.623  -22.540 1.00 18.73 ? 83  ASP C CA  1 
ATOM   4855 C C   . ASP C 1 63  ? 4.177   17.079  -22.987 1.00 18.73 ? 83  ASP C C   1 
ATOM   4856 O O   . ASP C 1 63  ? 3.719   16.016  -22.572 1.00 18.73 ? 83  ASP C O   1 
ATOM   4857 C CB  . ASP C 1 63  ? 6.524   16.563  -22.245 1.00 22.35 ? 83  ASP C CB  1 
ATOM   4858 C CG  . ASP C 1 63  ? 6.973   15.769  -23.434 1.00 22.35 ? 83  ASP C CG  1 
ATOM   4859 O OD1 . ASP C 1 63  ? 6.307   15.809  -24.505 1.00 22.35 ? 83  ASP C OD1 1 
ATOM   4860 O OD2 . ASP C 1 63  ? 8.038   15.085  -23.375 1.00 22.35 ? 83  ASP C OD2 1 
ATOM   4861 N N   . TRP C 1 64  ? 3.482   17.832  -23.849 1.00 15.90 ? 84  TRP C N   1 
ATOM   4862 C CA  . TRP C 1 64  ? 2.166   17.389  -24.289 1.00 15.90 ? 84  TRP C CA  1 
ATOM   4863 C C   . TRP C 1 64  ? 2.181   16.080  -24.999 1.00 15.90 ? 84  TRP C C   1 
ATOM   4864 O O   . TRP C 1 64  ? 1.200   15.324  -24.916 1.00 15.90 ? 84  TRP C O   1 
ATOM   4865 C CB  . TRP C 1 64  ? 1.557   18.422  -25.248 1.00 12.55 ? 84  TRP C CB  1 
ATOM   4866 C CG  . TRP C 1 64  ? 1.139   19.676  -24.538 1.00 12.55 ? 84  TRP C CG  1 
ATOM   4867 C CD1 . TRP C 1 64  ? 1.784   20.857  -24.426 1.00 12.55 ? 84  TRP C CD1 1 
ATOM   4868 C CD2 . TRP C 1 64  ? -0.116  19.818  -23.865 1.00 12.55 ? 84  TRP C CD2 1 
ATOM   4869 N NE1 . TRP C 1 64  ? 0.999   21.758  -23.700 1.00 12.55 ? 84  TRP C NE1 1 
ATOM   4870 C CE2 . TRP C 1 64  ? -0.164  21.126  -23.344 1.00 12.55 ? 84  TRP C CE2 1 
ATOM   4871 C CE3 . TRP C 1 64  ? -1.207  18.956  -23.650 1.00 12.55 ? 84  TRP C CE3 1 
ATOM   4872 C CZ2 . TRP C 1 64  ? -1.254  21.599  -22.607 1.00 12.55 ? 84  TRP C CZ2 1 
ATOM   4873 C CZ3 . TRP C 1 64  ? -2.278  19.432  -22.937 1.00 12.55 ? 84  TRP C CZ3 1 
ATOM   4874 C CH2 . TRP C 1 64  ? -2.298  20.723  -22.421 1.00 12.55 ? 84  TRP C CH2 1 
ATOM   4875 N N   . ALA C 1 65  ? 3.252   15.756  -25.693 1.00 17.17 ? 85  ALA C N   1 
ATOM   4876 C CA  . ALA C 1 65  ? 3.297   14.495  -26.455 1.00 17.17 ? 85  ALA C CA  1 
ATOM   4877 C C   . ALA C 1 65  ? 3.366   13.299  -25.546 1.00 17.17 ? 85  ALA C C   1 
ATOM   4878 O O   . ALA C 1 65  ? 2.915   12.216  -25.960 1.00 17.17 ? 85  ALA C O   1 
ATOM   4879 C CB  . ALA C 1 65  ? 4.492   14.515  -27.397 1.00 16.42 ? 85  ALA C CB  1 
ATOM   4880 N N   . ALA C 1 66  ? 3.845   13.468  -24.327 1.00 19.62 ? 86  ALA C N   1 
ATOM   4881 C CA  . ALA C 1 66  ? 3.963   12.389  -23.345 1.00 19.62 ? 86  ALA C CA  1 
ATOM   4882 C C   . ALA C 1 66  ? 2.611   11.867  -22.924 1.00 19.62 ? 86  ALA C C   1 
ATOM   4883 O O   . ALA C 1 66  ? 2.543   10.713  -22.468 1.00 19.62 ? 86  ALA C O   1 
ATOM   4884 C CB  . ALA C 1 66  ? 4.765   12.928  -22.159 1.00 18.42 ? 86  ALA C CB  1 
ATOM   4885 N N   . LEU C 1 67  ? 1.545   12.584  -23.121 1.00 19.64 ? 87  LEU C N   1 
ATOM   4886 C CA  . LEU C 1 67  ? 0.194   12.184  -22.800 1.00 19.64 ? 87  LEU C CA  1 
ATOM   4887 C C   . LEU C 1 67  ? -0.409  11.205  -23.767 1.00 19.64 ? 87  LEU C C   1 
ATOM   4888 O O   . LEU C 1 67  ? -1.496  10.644  -23.543 1.00 19.64 ? 87  LEU C O   1 
ATOM   4889 C CB  . LEU C 1 67  ? -0.667  13.465  -22.811 1.00 19.42 ? 87  LEU C CB  1 
ATOM   4890 C CG  . LEU C 1 67  ? -0.359  14.489  -21.727 1.00 19.42 ? 87  LEU C CG  1 
ATOM   4891 C CD1 . LEU C 1 67  ? -1.308  15.672  -21.763 1.00 19.42 ? 87  LEU C CD1 1 
ATOM   4892 C CD2 . LEU C 1 67  ? -0.456  13.829  -20.338 1.00 19.42 ? 87  LEU C CD2 1 
ATOM   4893 N N   . ALA C 1 68  ? 0.244   10.916  -24.865 1.00 20.10 ? 88  ALA C N   1 
ATOM   4894 C CA  . ALA C 1 68  ? -0.317  10.025  -25.895 1.00 20.10 ? 88  ALA C CA  1 
ATOM   4895 C C   . ALA C 1 68  ? -0.796  8.701   -25.388 1.00 20.10 ? 88  ALA C C   1 
ATOM   4896 O O   . ALA C 1 68  ? -1.839  8.183   -25.793 1.00 20.10 ? 88  ALA C O   1 
ATOM   4897 C CB  . ALA C 1 68  ? 0.763   9.818   -26.958 1.00 20.31 ? 88  ALA C CB  1 
ATOM   4898 N N   . ASP C 1 69  ? -0.024  8.079   -24.513 1.00 21.76 ? 89  ASP C N   1 
ATOM   4899 C CA  . ASP C 1 69  ? -0.398  6.763   -23.964 1.00 21.76 ? 89  ASP C CA  1 
ATOM   4900 C C   . ASP C 1 69  ? -0.773  6.799   -22.490 1.00 21.76 ? 89  ASP C C   1 
ATOM   4901 O O   . ASP C 1 69  ? -0.770  5.789   -21.775 1.00 21.76 ? 89  ASP C O   1 
ATOM   4902 C CB  . ASP C 1 69  ? 0.739   5.778   -24.233 1.00 24.74 ? 89  ASP C CB  1 
ATOM   4903 C CG  . ASP C 1 69  ? 2.065   6.197   -23.667 1.00 24.74 ? 89  ASP C CG  1 
ATOM   4904 O OD1 . ASP C 1 69  ? 2.247   7.414   -23.319 1.00 24.74 ? 89  ASP C OD1 1 
ATOM   4905 O OD2 . ASP C 1 69  ? 2.990   5.359   -23.568 1.00 24.74 ? 89  ASP C OD2 1 
ATOM   4906 N N   . ALA C 1 70  ? -1.131  7.940   -21.956 1.00 19.14 ? 90  ALA C N   1 
ATOM   4907 C CA  . ALA C 1 70  ? -1.550  8.121   -20.584 1.00 19.14 ? 90  ALA C CA  1 
ATOM   4908 C C   . ALA C 1 70  ? -2.878  7.369   -20.444 1.00 19.14 ? 90  ALA C C   1 
ATOM   4909 O O   . ALA C 1 70  ? -3.645  7.326   -21.409 1.00 19.14 ? 90  ALA C O   1 
ATOM   4910 C CB  . ALA C 1 70  ? -1.706  9.558   -20.213 1.00 16.74 ? 90  ALA C CB  1 
ATOM   4911 N N   . ASP C 1 71  ? -3.061  6.718   -19.298 1.00 16.17 ? 91  ASP C N   1 
ATOM   4912 C CA  . ASP C 1 71  ? -4.283  5.970   -19.020 1.00 16.17 ? 91  ASP C CA  1 
ATOM   4913 C C   . ASP C 1 71  ? -5.405  6.918   -18.643 1.00 16.17 ? 91  ASP C C   1 
ATOM   4914 O O   . ASP C 1 71  ? -6.561  6.732   -18.984 1.00 16.17 ? 91  ASP C O   1 
ATOM   4915 C CB  . ASP C 1 71  ? -4.046  5.010   -17.845 1.00 16.55 ? 91  ASP C CB  1 
ATOM   4916 C CG  . ASP C 1 71  ? -3.177  3.860   -18.220 1.00 16.55 ? 91  ASP C CG  1 
ATOM   4917 O OD1 . ASP C 1 71  ? -1.941  3.997   -18.301 1.00 16.55 ? 91  ASP C OD1 1 
ATOM   4918 O OD2 . ASP C 1 71  ? -3.721  2.772   -18.448 1.00 16.55 ? 91  ASP C OD2 1 
ATOM   4919 N N   . VAL C 1 72  ? -5.104  7.898   -17.812 1.00 14.78 ? 92  VAL C N   1 
ATOM   4920 C CA  . VAL C 1 72  ? -6.024  8.867   -17.289 1.00 14.78 ? 92  VAL C CA  1 
ATOM   4921 C C   . VAL C 1 72  ? -5.330  10.220  -17.285 1.00 14.78 ? 92  VAL C C   1 
ATOM   4922 O O   . VAL C 1 72  ? -4.089  10.294  -17.116 1.00 14.78 ? 92  VAL C O   1 
ATOM   4923 C CB  . VAL C 1 72  ? -6.398  8.566   -15.819 1.00 15.25 ? 92  VAL C CB  1 
ATOM   4924 C CG1 . VAL C 1 72  ? -7.413  9.574   -15.293 1.00 15.25 ? 92  VAL C CG1 1 
ATOM   4925 C CG2 . VAL C 1 72  ? -7.068  7.240   -15.572 1.00 15.25 ? 92  VAL C CG2 1 
ATOM   4926 N N   . VAL C 1 73  ? -6.087  11.288  -17.459 1.00 12.89 ? 93  VAL C N   1 
ATOM   4927 C CA  . VAL C 1 73  ? -5.538  12.640  -17.398 1.00 12.89 ? 93  VAL C CA  1 
ATOM   4928 C C   . VAL C 1 73  ? -6.486  13.375  -16.445 1.00 12.89 ? 93  VAL C C   1 
ATOM   4929 O O   . VAL C 1 73  ? -7.692  13.269  -16.640 1.00 12.89 ? 93  VAL C O   1 
ATOM   4930 C CB  . VAL C 1 73  ? -5.440  13.407  -18.732 1.00 11.44 ? 93  VAL C CB  1 
ATOM   4931 C CG1 . VAL C 1 73  ? -5.186  14.895  -18.549 1.00 11.44 ? 93  VAL C CG1 1 
ATOM   4932 C CG2 . VAL C 1 73  ? -4.264  12.904  -19.571 1.00 11.44 ? 93  VAL C CG2 1 
ATOM   4933 N N   . ILE C 1 74  ? -5.909  14.065  -15.463 1.00 14.11 ? 94  ILE C N   1 
ATOM   4934 C CA  . ILE C 1 74  ? -6.742  14.787  -14.500 1.00 14.11 ? 94  ILE C CA  1 
ATOM   4935 C C   . ILE C 1 74  ? -6.486  16.263  -14.712 1.00 14.11 ? 94  ILE C C   1 
ATOM   4936 O O   . ILE C 1 74  ? -5.328  16.691  -14.714 1.00 14.11 ? 94  ILE C O   1 
ATOM   4937 C CB  . ILE C 1 74  ? -6.372  14.375  -13.070 1.00 13.06 ? 94  ILE C CB  1 
ATOM   4938 C CG1 . ILE C 1 74  ? -6.718  12.881  -12.827 1.00 13.06 ? 94  ILE C CG1 1 
ATOM   4939 C CG2 . ILE C 1 74  ? -7.081  15.222  -12.035 1.00 13.06 ? 94  ILE C CG2 1 
ATOM   4940 C CD1 . ILE C 1 74  ? -5.956  12.261  -11.678 1.00 13.06 ? 94  ILE C CD1 1 
ATOM   4941 N N   . SER C 1 75  ? -7.537  17.031  -14.944 1.00 16.86 ? 95  SER C N   1 
ATOM   4942 C CA  . SER C 1 75  ? -7.391  18.459  -15.154 1.00 16.86 ? 95  SER C CA  1 
ATOM   4943 C C   . SER C 1 75  ? -7.883  19.209  -13.952 1.00 16.86 ? 95  SER C C   1 
ATOM   4944 O O   . SER C 1 75  ? -8.991  18.914  -13.484 1.00 16.86 ? 95  SER C O   1 
ATOM   4945 C CB  . SER C 1 75  ? -8.210  18.857  -16.402 1.00 18.69 ? 95  SER C CB  1 
ATOM   4946 O OG  . SER C 1 75  ? -8.270  20.298  -16.475 1.00 18.69 ? 95  SER C OG  1 
ATOM   4947 N N   . THR C 1 76  ? -7.072  20.112  -13.399 1.00 21.34 ? 96  THR C N   1 
ATOM   4948 C CA  . THR C 1 76  ? -7.581  20.837  -12.230 1.00 21.34 ? 96  THR C CA  1 
ATOM   4949 C C   . THR C 1 76  ? -7.759  22.309  -12.545 1.00 21.34 ? 96  THR C C   1 
ATOM   4950 O O   . THR C 1 76  ? -7.856  23.114  -11.620 1.00 21.34 ? 96  THR C O   1 
ATOM   4951 C CB  . THR C 1 76  ? -6.662  20.665  -11.014 1.00 21.01 ? 96  THR C CB  1 
ATOM   4952 O OG1 . THR C 1 76  ? -5.459  21.427  -11.224 1.00 21.01 ? 96  THR C OG1 1 
ATOM   4953 C CG2 . THR C 1 76  ? -6.265  19.223  -10.800 1.00 21.01 ? 96  THR C CG2 1 
ATOM   4954 N N   . LEU C 1 77  ? -7.837  22.704  -13.807 1.00 27.59 ? 97  LEU C N   1 
ATOM   4955 C CA  . LEU C 1 77  ? -8.055  24.103  -14.198 1.00 27.59 ? 97  LEU C CA  1 
ATOM   4956 C C   . LEU C 1 77  ? -9.507  24.486  -13.989 1.00 27.59 ? 97  LEU C C   1 
ATOM   4957 O O   . LEU C 1 77  ? -10.394 23.605  -14.160 1.00 27.59 ? 97  LEU C O   1 
ATOM   4958 C CB  . LEU C 1 77  ? -7.684  24.294  -15.650 1.00 26.26 ? 97  LEU C CB  1 
ATOM   4959 C CG  . LEU C 1 77  ? -6.302  23.995  -16.172 1.00 26.26 ? 97  LEU C CG  1 
ATOM   4960 C CD1 . LEU C 1 77  ? -6.109  24.353  -17.619 1.00 26.26 ? 97  LEU C CD1 1 
ATOM   4961 C CD2 . LEU C 1 77  ? -5.320  24.763  -15.298 1.00 26.26 ? 97  LEU C CD2 1 
ATOM   4962 N N   . GLY C 1 78  ? -9.781  25.744  -13.661 1.00 33.38 ? 98  GLY C N   1 
ATOM   4963 C CA  . GLY C 1 78  ? -11.188 26.156  -13.458 1.00 33.38 ? 98  GLY C CA  1 
ATOM   4964 C C   . GLY C 1 78  ? -11.310 27.494  -12.735 1.00 33.38 ? 98  GLY C C   1 
ATOM   4965 O O   . GLY C 1 78  ? -10.783 28.479  -13.314 1.00 33.38 ? 98  GLY C O   1 
ATOM   4966 N N   . GLY C 1 89  ? -18.958 42.758  -18.254 1.00 50.38 ? 109 GLY C N   1 
ATOM   4967 C CA  . GLY C 1 89  ? -17.628 43.477  -18.241 1.00 50.38 ? 109 GLY C CA  1 
ATOM   4968 C C   . GLY C 1 89  ? -16.678 42.380  -17.711 1.00 50.38 ? 109 GLY C C   1 
ATOM   4969 O O   . GLY C 1 89  ? -16.418 41.451  -18.480 1.00 50.38 ? 109 GLY C O   1 
ATOM   4970 N N   . ASP C 1 90  ? -16.284 42.497  -16.456 1.00 46.60 ? 110 ASP C N   1 
ATOM   4971 C CA  . ASP C 1 90  ? -15.385 41.524  -15.808 1.00 46.60 ? 110 ASP C CA  1 
ATOM   4972 C C   . ASP C 1 90  ? -15.984 40.121  -15.755 1.00 46.60 ? 110 ASP C C   1 
ATOM   4973 O O   . ASP C 1 90  ? -15.256 39.149  -15.969 1.00 46.60 ? 110 ASP C O   1 
ATOM   4974 C CB  . ASP C 1 90  ? -15.020 42.006  -14.397 1.00 46.92 ? 110 ASP C CB  1 
ATOM   4975 N N   . ARG C 1 91  ? -17.281 39.961  -15.543 1.00 41.02 ? 111 ARG C N   1 
ATOM   4976 C CA  . ARG C 1 91  ? -17.890 38.632  -15.528 1.00 41.02 ? 111 ARG C CA  1 
ATOM   4977 C C   . ARG C 1 91  ? -17.750 38.031  -16.922 1.00 41.02 ? 111 ARG C C   1 
ATOM   4978 O O   . ARG C 1 91  ? -17.370 36.882  -17.085 1.00 41.02 ? 111 ARG C O   1 
ATOM   4979 C CB  . ARG C 1 91  ? -19.370 38.687  -15.173 1.00 49.24 ? 111 ARG C CB  1 
ATOM   4980 C CG  . ARG C 1 91  ? -19.753 37.823  -13.984 1.00 49.24 ? 111 ARG C CG  1 
ATOM   4981 C CD  . ARG C 1 91  ? -19.937 36.372  -14.349 1.00 49.24 ? 111 ARG C CD  1 
ATOM   4982 N NE  . ARG C 1 91  ? -21.024 36.163  -15.324 1.00 49.24 ? 111 ARG C NE  1 
ATOM   4983 C CZ  . ARG C 1 91  ? -21.741 35.036  -15.418 1.00 49.24 ? 111 ARG C CZ  1 
ATOM   4984 N NH1 . ARG C 1 91  ? -21.548 33.984  -14.599 1.00 49.24 ? 111 ARG C NH1 1 
ATOM   4985 N NH2 . ARG C 1 91  ? -22.659 34.967  -16.388 1.00 49.24 ? 111 ARG C NH2 1 
ATOM   4986 N N   . PHE C 1 92  ? -18.038 38.873  -17.915 1.00 31.59 ? 112 PHE C N   1 
ATOM   4987 C CA  . PHE C 1 92  ? -17.911 38.481  -19.322 1.00 31.59 ? 112 PHE C CA  1 
ATOM   4988 C C   . PHE C 1 92  ? -16.459 38.132  -19.641 1.00 31.59 ? 112 PHE C C   1 
ATOM   4989 O O   . PHE C 1 92  ? -16.149 37.135  -20.282 1.00 31.59 ? 112 PHE C O   1 
ATOM   4990 C CB  . PHE C 1 92  ? -18.343 39.614  -20.280 1.00 27.44 ? 112 PHE C CB  1 
ATOM   4991 C CG  . PHE C 1 92  ? -18.338 39.169  -21.721 1.00 27.44 ? 112 PHE C CG  1 
ATOM   4992 C CD1 . PHE C 1 92  ? -19.370 38.406  -22.241 1.00 27.44 ? 112 PHE C CD1 1 
ATOM   4993 C CD2 . PHE C 1 92  ? -17.293 39.542  -22.551 1.00 27.44 ? 112 PHE C CD2 1 
ATOM   4994 C CE1 . PHE C 1 92  ? -19.342 38.014  -23.577 1.00 27.44 ? 112 PHE C CE1 1 
ATOM   4995 C CE2 . PHE C 1 92  ? -17.251 39.126  -23.857 1.00 27.44 ? 112 PHE C CE2 1 
ATOM   4996 C CZ  . PHE C 1 92  ? -18.284 38.356  -24.382 1.00 27.44 ? 112 PHE C CZ  1 
ATOM   4997 N N   . ALA C 1 93  ? -15.552 38.973  -19.164 1.00 27.94 ? 113 ALA C N   1 
ATOM   4998 C CA  . ALA C 1 93  ? -14.129 38.749  -19.392 1.00 27.94 ? 113 ALA C CA  1 
ATOM   4999 C C   . ALA C 1 93  ? -13.747 37.400  -18.801 1.00 27.94 ? 113 ALA C C   1 
ATOM   5000 O O   . ALA C 1 93  ? -13.136 36.569  -19.477 1.00 27.94 ? 113 ALA C O   1 
ATOM   5001 C CB  . ALA C 1 93  ? -13.305 39.838  -18.755 1.00 27.37 ? 113 ALA C CB  1 
ATOM   5002 N N   . GLU C 1 94  ? -14.138 37.142  -17.562 1.00 26.56 ? 114 GLU C N   1 
ATOM   5003 C CA  . GLU C 1 94  ? -13.823 35.888  -16.892 1.00 26.56 ? 114 GLU C CA  1 
ATOM   5004 C C   . GLU C 1 94  ? -14.322 34.712  -17.683 1.00 26.56 ? 114 GLU C C   1 
ATOM   5005 O O   . GLU C 1 94  ? -13.576 33.749  -17.845 1.00 26.56 ? 114 GLU C O   1 
ATOM   5006 C CB  . GLU C 1 94  ? -14.416 35.816  -15.497 1.00 28.79 ? 114 GLU C CB  1 
ATOM   5007 C CG  . GLU C 1 94  ? -13.750 36.809  -14.507 1.00 28.79 ? 114 GLU C CG  1 
ATOM   5008 N N   . LEU C 1 95  ? -15.535 34.763  -18.193 1.00 25.78 ? 115 LEU C N   1 
ATOM   5009 C CA  . LEU C 1 95  ? -16.066 33.674  -18.978 1.00 25.78 ? 115 LEU C CA  1 
ATOM   5010 C C   . LEU C 1 95  ? -15.247 33.468  -20.240 1.00 25.78 ? 115 LEU C C   1 
ATOM   5011 O O   . LEU C 1 95  ? -14.943 32.358  -20.636 1.00 25.78 ? 115 LEU C O   1 
ATOM   5012 C CB  . LEU C 1 95  ? -17.488 33.944  -19.445 1.00 28.25 ? 115 LEU C CB  1 
ATOM   5013 C CG  . LEU C 1 95  ? -18.566 33.975  -18.386 1.00 28.25 ? 115 LEU C CG  1 
ATOM   5014 C CD1 . LEU C 1 95  ? -19.946 34.086  -19.059 1.00 28.25 ? 115 LEU C CD1 1 
ATOM   5015 C CD2 . LEU C 1 95  ? -18.582 32.718  -17.523 1.00 28.25 ? 115 LEU C CD2 1 
ATOM   5016 N N   . LYS C 1 96  ? -14.918 34.574  -20.890 1.00 24.37 ? 116 LYS C N   1 
ATOM   5017 C CA  . LYS C 1 96  ? -14.163 34.562  -22.155 1.00 24.37 ? 116 LYS C CA  1 
ATOM   5018 C C   . LYS C 1 96  ? -12.820 33.916  -21.938 1.00 24.37 ? 116 LYS C C   1 
ATOM   5019 O O   . LYS C 1 96  ? -12.428 33.089  -22.761 1.00 24.37 ? 116 LYS C O   1 
ATOM   5020 C CB  . LYS C 1 96  ? -14.030 35.995  -22.664 1.00 25.47 ? 116 LYS C CB  1 
ATOM   5021 C CG  . LYS C 1 96  ? -13.556 36.164  -24.072 1.00 25.47 ? 116 LYS C CG  1 
ATOM   5022 C CD  . LYS C 1 96  ? -14.756 36.097  -25.046 1.00 25.47 ? 116 LYS C CD  1 
ATOM   5023 C CE  . LYS C 1 96  ? -14.187 35.859  -26.432 1.00 25.47 ? 116 LYS C CE  1 
ATOM   5024 N NZ  . LYS C 1 96  ? -15.197 35.403  -27.417 1.00 25.47 ? 116 LYS C NZ  1 
ATOM   5025 N N   . PHE C 1 97  ? -12.129 34.297  -20.870 1.00 22.10 ? 117 PHE C N   1 
ATOM   5026 C CA  . PHE C 1 97  ? -10.808 33.742  -20.572 1.00 22.10 ? 117 PHE C CA  1 
ATOM   5027 C C   . PHE C 1 97  ? -10.857 32.297  -20.133 1.00 22.10 ? 117 PHE C C   1 
ATOM   5028 O O   . PHE C 1 97  ? -9.915  31.532  -20.463 1.00 22.10 ? 117 PHE C O   1 
ATOM   5029 C CB  . PHE C 1 97  ? -10.109 34.587  -19.514 1.00 24.72 ? 117 PHE C CB  1 
ATOM   5030 C CG  . PHE C 1 97  ? -9.821  35.994  -19.919 1.00 24.72 ? 117 PHE C CG  1 
ATOM   5031 C CD1 . PHE C 1 97  ? -9.359  36.286  -21.202 1.00 24.72 ? 117 PHE C CD1 1 
ATOM   5032 C CD2 . PHE C 1 97  ? -9.982  37.047  -19.033 1.00 24.72 ? 117 PHE C CD2 1 
ATOM   5033 C CE1 . PHE C 1 97  ? -9.115  37.588  -21.588 1.00 24.72 ? 117 PHE C CE1 1 
ATOM   5034 C CE2 . PHE C 1 97  ? -9.722  38.350  -19.428 1.00 24.72 ? 117 PHE C CE2 1 
ATOM   5035 C CZ  . PHE C 1 97  ? -9.279  38.620  -20.696 1.00 24.72 ? 117 PHE C CZ  1 
ATOM   5036 N N   . THR C 1 98  ? -11.876 31.841  -19.405 1.00 19.83 ? 118 THR C N   1 
ATOM   5037 C CA  . THR C 1 98  ? -12.052 30.461  -18.983 1.00 19.83 ? 118 THR C CA  1 
ATOM   5038 C C   . THR C 1 98  ? -12.335 29.580  -20.181 1.00 19.83 ? 118 THR C C   1 
ATOM   5039 O O   . THR C 1 98  ? -11.659 28.538  -20.322 1.00 19.83 ? 118 THR C O   1 
ATOM   5040 C CB  . THR C 1 98  ? -13.215 30.278  -17.943 1.00 17.89 ? 118 THR C CB  1 
ATOM   5041 O OG1 . THR C 1 98  ? -12.966 31.172  -16.875 1.00 17.89 ? 118 THR C OG1 1 
ATOM   5042 C CG2 . THR C 1 98  ? -13.322 28.857  -17.440 1.00 17.89 ? 118 THR C CG2 1 
ATOM   5043 N N   . SER C 1 99  ? -13.213 30.010  -21.094 1.00 18.58 ? 119 SER C N   1 
ATOM   5044 C CA  . SER C 1 99  ? -13.505 29.198  -22.294 1.00 18.58 ? 119 SER C CA  1 
ATOM   5045 C C   . SER C 1 99  ? -12.292 29.147  -23.194 1.00 18.58 ? 119 SER C C   1 
ATOM   5046 O O   . SER C 1 99  ? -11.959 28.121  -23.833 1.00 18.58 ? 119 SER C O   1 
ATOM   5047 C CB  . SER C 1 99  ? -14.716 29.739  -23.035 1.00 18.80 ? 119 SER C CB  1 
ATOM   5048 O OG  . SER C 1 99  ? -14.449 31.060  -23.552 1.00 18.80 ? 119 SER C OG  1 
ATOM   5049 N N   . SER C 1 100 ? -11.524 30.230  -23.234 1.00 18.17 ? 120 SER C N   1 
ATOM   5050 C CA  . SER C 1 100 ? -10.305 30.231  -24.056 1.00 18.17 ? 120 SER C CA  1 
ATOM   5051 C C   . SER C 1 100 ? -9.347  29.188  -23.522 1.00 18.17 ? 120 SER C C   1 
ATOM   5052 O O   . SER C 1 100 ? -8.783  28.396  -24.294 1.00 18.17 ? 120 SER C O   1 
ATOM   5053 C CB  . SER C 1 100 ? -9.669  31.613  -24.015 1.00 17.87 ? 120 SER C CB  1 
ATOM   5054 O OG  . SER C 1 100 ? -8.503  31.674  -24.837 1.00 17.87 ? 120 SER C OG  1 
ATOM   5055 N N   . MET C 1 101 ? -9.133  29.201  -22.210 1.00 18.03 ? 121 MET C N   1 
ATOM   5056 C CA  . MET C 1 101 ? -8.204  28.230  -21.583 1.00 18.03 ? 121 MET C CA  1 
ATOM   5057 C C   . MET C 1 101 ? -8.631  26.816  -21.829 1.00 18.03 ? 121 MET C C   1 
ATOM   5058 O O   . MET C 1 101 ? -7.823  25.963  -22.192 1.00 18.03 ? 121 MET C O   1 
ATOM   5059 C CB  . MET C 1 101 ? -8.164  28.502  -20.092 1.00 21.63 ? 121 MET C CB  1 
ATOM   5060 C CG  . MET C 1 101 ? -7.302  27.510  -19.311 1.00 21.63 ? 121 MET C CG  1 
ATOM   5061 S SD  . MET C 1 101 ? -7.469  27.876  -17.528 1.00 21.63 ? 121 MET C SD  1 
ATOM   5062 C CE  . MET C 1 101 ? -9.164  27.211  -17.318 1.00 21.63 ? 121 MET C CE  1 
ATOM   5063 N N   . VAL C 1 102 ? -9.903  26.498  -21.691 1.00 17.26 ? 122 VAL C N   1 
ATOM   5064 C CA  . VAL C 1 102 ? -10.395 25.135  -21.951 1.00 17.26 ? 122 VAL C CA  1 
ATOM   5065 C C   . VAL C 1 102 ? -10.196 24.743  -23.397 1.00 17.26 ? 122 VAL C C   1 
ATOM   5066 O O   . VAL C 1 102 ? -9.940  23.577  -23.785 1.00 17.26 ? 122 VAL C O   1 
ATOM   5067 C CB  . VAL C 1 102 ? -11.866 25.076  -21.550 1.00 14.32 ? 122 VAL C CB  1 
ATOM   5068 C CG1 . VAL C 1 102 ? -12.460 23.759  -21.950 1.00 14.32 ? 122 VAL C CG1 1 
ATOM   5069 C CG2 . VAL C 1 102 ? -11.955 25.339  -20.056 1.00 14.32 ? 122 VAL C CG2 1 
ATOM   5070 N N   . GLN C 1 103 ? -10.312 25.704  -24.297 1.00 20.89 ? 123 GLN C N   1 
ATOM   5071 C CA  . GLN C 1 103 ? -10.122 25.444  -25.728 1.00 20.89 ? 123 GLN C CA  1 
ATOM   5072 C C   . GLN C 1 103 ? -8.663  25.164  -26.028 1.00 20.89 ? 123 GLN C C   1 
ATOM   5073 O O   . GLN C 1 103 ? -8.373  24.221  -26.782 1.00 20.89 ? 123 GLN C O   1 
ATOM   5074 C CB  . GLN C 1 103 ? -10.675 26.646  -26.478 1.00 28.47 ? 123 GLN C CB  1 
ATOM   5075 C CG  . GLN C 1 103 ? -10.438 26.520  -27.994 1.00 28.47 ? 123 GLN C CG  1 
ATOM   5076 C CD  . GLN C 1 103 ? -11.696 26.972  -28.732 1.00 28.47 ? 123 GLN C CD  1 
ATOM   5077 O OE1 . GLN C 1 103 ? -12.436 26.054  -29.113 1.00 28.47 ? 123 GLN C OE1 1 
ATOM   5078 N NE2 . GLN C 1 103 ? -11.863 28.276  -28.854 1.00 28.47 ? 123 GLN C NE2 1 
ATOM   5079 N N   . SER C 1 104 ? -7.727  25.939  -25.509 1.00 18.68 ? 124 SER C N   1 
ATOM   5080 C CA  . SER C 1 104 ? -6.292  25.727  -25.716 1.00 18.68 ? 124 SER C CA  1 
ATOM   5081 C C   . SER C 1 104 ? -5.797  24.397  -25.147 1.00 18.68 ? 124 SER C C   1 
ATOM   5082 O O   . SER C 1 104 ? -5.106  23.591  -25.814 1.00 18.68 ? 124 SER C O   1 
ATOM   5083 C CB  . SER C 1 104 ? -5.528  26.850  -25.028 1.00 19.34 ? 124 SER C CB  1 
ATOM   5084 O OG  . SER C 1 104 ? -6.037  28.121  -25.569 1.00 19.34 ? 124 SER C OG  1 
ATOM   5085 N N   . VAL C 1 105 ? -6.121  24.173  -23.877 1.00 17.10 ? 125 VAL C N   1 
ATOM   5086 C CA  . VAL C 1 105 ? -5.736  22.916  -23.186 1.00 17.10 ? 125 VAL C CA  1 
ATOM   5087 C C   . VAL C 1 105 ? -6.390  21.738  -23.880 1.00 17.10 ? 125 VAL C C   1 
ATOM   5088 O O   . VAL C 1 105 ? -5.722  20.752  -24.227 1.00 17.10 ? 125 VAL C O   1 
ATOM   5089 C CB  . VAL C 1 105 ? -6.145  23.035  -21.721 1.00 16.41 ? 125 VAL C CB  1 
ATOM   5090 C CG1 . VAL C 1 105 ? -5.970  21.717  -20.952 1.00 16.41 ? 125 VAL C CG1 1 
ATOM   5091 C CG2 . VAL C 1 105 ? -5.337  24.089  -20.989 1.00 16.41 ? 125 VAL C CG2 1 
ATOM   5092 N N   . GLY C 1 106 ? -7.686  21.828  -24.159 1.00 15.65 ? 126 GLY C N   1 
ATOM   5093 C CA  . GLY C 1 106 ? -8.411  20.768  -24.843 1.00 15.65 ? 126 GLY C CA  1 
ATOM   5094 C C   . GLY C 1 106 ? -7.886  20.438  -26.212 1.00 15.65 ? 126 GLY C C   1 
ATOM   5095 O O   . GLY C 1 106 ? -7.858  19.270  -26.645 1.00 15.65 ? 126 GLY C O   1 
ATOM   5096 N N   . THR C 1 107 ? -7.488  21.461  -26.987 1.00 16.56 ? 127 THR C N   1 
ATOM   5097 C CA  . THR C 1 107 ? -6.976  21.245  -28.350 1.00 16.56 ? 127 THR C CA  1 
ATOM   5098 C C   . THR C 1 107 ? -5.634  20.564  -28.313 1.00 16.56 ? 127 THR C C   1 
ATOM   5099 O O   . THR C 1 107 ? -5.400  19.596  -29.042 1.00 16.56 ? 127 THR C O   1 
ATOM   5100 C CB  . THR C 1 107 ? -6.880  22.571  -29.158 1.00 17.05 ? 127 THR C CB  1 
ATOM   5101 O OG1 . THR C 1 107 ? -8.197  23.083  -29.355 1.00 17.05 ? 127 THR C OG1 1 
ATOM   5102 C CG2 . THR C 1 107 ? -6.223  22.319  -30.506 1.00 17.05 ? 127 THR C CG2 1 
ATOM   5103 N N   . ASN C 1 108 ? -4.770  21.076  -27.432 1.00 17.66 ? 128 ASN C N   1 
ATOM   5104 C CA  . ASN C 1 108 ? -3.440  20.450  -27.292 1.00 17.66 ? 128 ASN C CA  1 
ATOM   5105 C C   . ASN C 1 108 ? -3.572  19.011  -26.769 1.00 17.66 ? 128 ASN C C   1 
ATOM   5106 O O   . ASN C 1 108 ? -2.853  18.106  -27.183 1.00 17.66 ? 128 ASN C O   1 
ATOM   5107 C CB  . ASN C 1 108 ? -2.596  21.252  -26.342 1.00 16.85 ? 128 ASN C CB  1 
ATOM   5108 C CG  . ASN C 1 108 ? -2.059  22.519  -26.970 1.00 16.85 ? 128 ASN C CG  1 
ATOM   5109 O OD1 . ASN C 1 108 ? -1.579  22.452  -28.082 1.00 16.85 ? 128 ASN C OD1 1 
ATOM   5110 N ND2 . ASN C 1 108 ? -2.156  23.602  -26.248 1.00 16.85 ? 128 ASN C ND2 1 
ATOM   5111 N N   . LEU C 1 109 ? -4.532  18.785  -25.867 1.00 20.09 ? 129 LEU C N   1 
ATOM   5112 C CA  . LEU C 1 109 ? -4.803  17.463  -25.340 1.00 20.09 ? 129 LEU C CA  1 
ATOM   5113 C C   . LEU C 1 109 ? -5.247  16.560  -26.475 1.00 20.09 ? 129 LEU C C   1 
ATOM   5114 O O   . LEU C 1 109 ? -4.720  15.433  -26.607 1.00 20.09 ? 129 LEU C O   1 
ATOM   5115 C CB  . LEU C 1 109 ? -5.862  17.535  -24.225 1.00 19.44 ? 129 LEU C CB  1 
ATOM   5116 C CG  . LEU C 1 109 ? -6.106  16.223  -23.418 1.00 19.44 ? 129 LEU C CG  1 
ATOM   5117 C CD1 . LEU C 1 109 ? -4.871  15.695  -22.736 1.00 19.44 ? 129 LEU C CD1 1 
ATOM   5118 C CD2 . LEU C 1 109 ? -7.181  16.481  -22.351 1.00 19.44 ? 129 LEU C CD2 1 
ATOM   5119 N N   . LYS C 1 110 ? -6.173  17.020  -27.304 1.00 22.10 ? 130 LYS C N   1 
ATOM   5120 C CA  . LYS C 1 110 ? -6.678  16.230  -28.420 1.00 22.10 ? 130 LYS C CA  1 
ATOM   5121 C C   . LYS C 1 110 ? -5.580  15.902  -29.406 1.00 22.10 ? 130 LYS C C   1 
ATOM   5122 O O   . LYS C 1 110 ? -5.408  14.795  -29.890 1.00 22.10 ? 130 LYS C O   1 
ATOM   5123 C CB  . LYS C 1 110 ? -7.734  17.064  -29.144 1.00 30.00 ? 130 LYS C CB  1 
ATOM   5124 C CG  . LYS C 1 110 ? -8.519  16.232  -30.138 1.00 30.00 ? 130 LYS C CG  1 
ATOM   5125 C CD  . LYS C 1 110 ? -8.684  16.865  -31.490 1.00 30.00 ? 130 LYS C CD  1 
ATOM   5126 C CE  . LYS C 1 110 ? -9.462  18.200  -31.410 1.00 30.00 ? 130 LYS C CE  1 
ATOM   5127 N NZ  . LYS C 1 110 ? -9.057  19.086  -32.606 1.00 30.00 ? 130 LYS C NZ  1 
ATOM   5128 N N   . GLU C 1 111 ? -4.741  16.904  -29.699 1.00 21.98 ? 131 GLU C N   1 
ATOM   5129 C CA  . GLU C 1 111 ? -3.653  16.778  -30.652 1.00 21.98 ? 131 GLU C CA  1 
ATOM   5130 C C   . GLU C 1 111 ? -2.537  15.894  -30.188 1.00 21.98 ? 131 GLU C C   1 
ATOM   5131 O O   . GLU C 1 111 ? -1.814  15.371  -31.048 1.00 21.98 ? 131 GLU C O   1 
ATOM   5132 C CB  . GLU C 1 111 ? -3.064  18.160  -30.965 1.00 25.50 ? 131 GLU C CB  1 
ATOM   5133 C CG  . GLU C 1 111 ? -4.005  19.087  -31.689 1.00 25.50 ? 131 GLU C CG  1 
ATOM   5134 C CD  . GLU C 1 111 ? -4.330  18.671  -33.098 1.00 25.50 ? 131 GLU C CD  1 
ATOM   5135 O OE1 . GLU C 1 111 ? -3.658  17.814  -33.737 1.00 25.50 ? 131 GLU C OE1 1 
ATOM   5136 O OE2 . GLU C 1 111 ? -5.314  19.260  -33.680 1.00 25.50 ? 131 GLU C OE2 1 
ATOM   5137 N N   . SER C 1 112 ? -2.372  15.651  -28.877 1.00 20.59 ? 132 SER C N   1 
ATOM   5138 C CA  . SER C 1 112 ? -1.318  14.798  -28.358 1.00 20.59 ? 132 SER C CA  1 
ATOM   5139 C C   . SER C 1 112 ? -1.550  13.341  -28.723 1.00 20.59 ? 132 SER C C   1 
ATOM   5140 O O   . SER C 1 112 ? -0.593  12.553  -28.765 1.00 20.59 ? 132 SER C O   1 
ATOM   5141 C CB  . SER C 1 112 ? -1.203  14.885  -26.825 1.00 20.04 ? 132 SER C CB  1 
ATOM   5142 O OG  . SER C 1 112 ? -2.425  14.373  -26.278 1.00 20.04 ? 132 SER C OG  1 
ATOM   5143 N N   . GLY C 1 113 ? -2.781  12.977  -29.010 1.00 20.24 ? 133 GLY C N   1 
ATOM   5144 C CA  . GLY C 1 113 ? -3.099  11.602  -29.365 1.00 20.24 ? 133 GLY C CA  1 
ATOM   5145 C C   . GLY C 1 113 ? -3.703  10.859  -28.154 1.00 20.24 ? 133 GLY C C   1 
ATOM   5146 O O   . GLY C 1 113 ? -4.047  9.680   -28.220 1.00 20.24 ? 133 GLY C O   1 
ATOM   5147 N N   . PHE C 1 114 ? -3.821  11.587  -27.033 1.00 20.74 ? 134 PHE C N   1 
ATOM   5148 C CA  . PHE C 1 114 ? -4.360  10.990  -25.839 1.00 20.74 ? 134 PHE C CA  1 
ATOM   5149 C C   . PHE C 1 114 ? -5.729  10.422  -26.201 1.00 20.74 ? 134 PHE C C   1 
ATOM   5150 O O   . PHE C 1 114 ? -6.443  11.095  -26.894 1.00 20.74 ? 134 PHE C O   1 
ATOM   5151 C CB  . PHE C 1 114 ? -4.500  12.028  -24.756 1.00 19.43 ? 134 PHE C CB  1 
ATOM   5152 C CG  . PHE C 1 114 ? -5.294  11.561  -23.555 1.00 19.43 ? 134 PHE C CG  1 
ATOM   5153 C CD1 . PHE C 1 114 ? -4.768  10.635  -22.659 1.00 19.43 ? 134 PHE C CD1 1 
ATOM   5154 C CD2 . PHE C 1 114 ? -6.551  12.045  -23.343 1.00 19.43 ? 134 PHE C CD2 1 
ATOM   5155 C CE1 . PHE C 1 114 ? -5.512  10.236  -21.566 1.00 19.43 ? 134 PHE C CE1 1 
ATOM   5156 C CE2 . PHE C 1 114 ? -7.317  11.680  -22.287 1.00 19.43 ? 134 PHE C CE2 1 
ATOM   5157 C CZ  . PHE C 1 114 ? -6.755  10.797  -21.387 1.00 19.43 ? 134 PHE C CZ  1 
ATOM   5158 N N   . HIS C 1 115 ? -5.992  9.209   -25.723 1.00 23.15 ? 135 HIS C N   1 
ATOM   5159 C CA  . HIS C 1 115 ? -7.278  8.571   -25.980 1.00 23.15 ? 135 HIS C CA  1 
ATOM   5160 C C   . HIS C 1 115 ? -7.756  7.832   -24.742 1.00 23.15 ? 135 HIS C C   1 
ATOM   5161 O O   . HIS C 1 115 ? -8.488  6.823   -24.870 1.00 23.15 ? 135 HIS C O   1 
ATOM   5162 C CB  . HIS C 1 115 ? -7.191  7.626   -27.177 1.00 27.71 ? 135 HIS C CB  1 
ATOM   5163 C CG  . HIS C 1 115 ? -6.054  6.680   -27.169 1.00 27.71 ? 135 HIS C CG  1 
ATOM   5164 N ND1 . HIS C 1 115 ? -4.741  7.103   -27.310 1.00 27.71 ? 135 HIS C ND1 1 
ATOM   5165 C CD2 . HIS C 1 115 ? -5.994  5.323   -27.041 1.00 27.71 ? 135 HIS C CD2 1 
ATOM   5166 C CE1 . HIS C 1 115 ? -3.932  6.053   -27.274 1.00 27.71 ? 135 HIS C CE1 1 
ATOM   5167 N NE2 . HIS C 1 115 ? -4.670  4.946   -27.097 1.00 27.71 ? 135 HIS C NE2 1 
ATOM   5168 N N   . GLY C 1 116 ? -7.369  8.239   -23.555 1.00 18.57 ? 136 GLY C N   1 
ATOM   5169 C CA  . GLY C 1 116 ? -7.786  7.565   -22.321 1.00 18.57 ? 136 GLY C CA  1 
ATOM   5170 C C   . GLY C 1 116 ? -9.024  8.287   -21.810 1.00 18.57 ? 136 GLY C C   1 
ATOM   5171 O O   . GLY C 1 116 ? -9.808  8.855   -22.544 1.00 18.57 ? 136 GLY C O   1 
ATOM   5172 N N   . VAL C 1 117 ? -9.119  8.348   -20.506 1.00 15.41 ? 137 VAL C N   1 
ATOM   5173 C CA  . VAL C 1 117 ? -10.220 8.988   -19.806 1.00 15.41 ? 137 VAL C CA  1 
ATOM   5174 C C   . VAL C 1 117 ? -9.731  10.268  -19.168 1.00 15.41 ? 137 VAL C C   1 
ATOM   5175 O O   . VAL C 1 117 ? -8.645  10.296  -18.583 1.00 15.41 ? 137 VAL C O   1 
ATOM   5176 C CB  . VAL C 1 117 ? -10.808 8.063   -18.719 1.00 14.23 ? 137 VAL C CB  1 
ATOM   5177 C CG1 . VAL C 1 117 ? -11.911 8.744   -17.926 1.00 14.23 ? 137 VAL C CG1 1 
ATOM   5178 C CG2 . VAL C 1 117 ? -11.373 6.816   -19.370 1.00 14.23 ? 137 VAL C CG2 1 
ATOM   5179 N N   . LEU C 1 118 ? -10.523 11.303  -19.338 1.00 15.24 ? 138 LEU C N   1 
ATOM   5180 C CA  . LEU C 1 118 ? -10.215 12.625  -18.804 1.00 15.24 ? 138 LEU C CA  1 
ATOM   5181 C C   . LEU C 1 118 ? -11.116 12.897  -17.605 1.00 15.24 ? 138 LEU C C   1 
ATOM   5182 O O   . LEU C 1 118 ? -12.350 12.824  -17.725 1.00 15.24 ? 138 LEU C O   1 
ATOM   5183 C CB  . LEU C 1 118 ? -10.426 13.702  -19.910 1.00 14.89 ? 138 LEU C CB  1 
ATOM   5184 C CG  . LEU C 1 118 ? -10.383 15.155  -19.478 1.00 14.89 ? 138 LEU C CG  1 
ATOM   5185 C CD1 . LEU C 1 118 ? -8.952  15.586  -19.084 1.00 14.89 ? 138 LEU C CD1 1 
ATOM   5186 C CD2 . LEU C 1 118 ? -10.864 16.090  -20.571 1.00 14.89 ? 138 LEU C CD2 1 
ATOM   5187 N N   . VAL C 1 119 ? -10.487 13.199  -16.458 1.00 14.26 ? 139 VAL C N   1 
ATOM   5188 C CA  . VAL C 1 119 ? -11.257 13.471  -15.245 1.00 14.26 ? 139 VAL C CA  1 
ATOM   5189 C C   . VAL C 1 119 ? -11.079 14.921  -14.929 1.00 14.26 ? 139 VAL C C   1 
ATOM   5190 O O   . VAL C 1 119 ? -9.960  15.374  -14.816 1.00 14.26 ? 139 VAL C O   1 
ATOM   5191 C CB  . VAL C 1 119 ? -10.758 12.630  -14.055 1.00 13.93 ? 139 VAL C CB  1 
ATOM   5192 C CG1 . VAL C 1 119 ? -11.584 12.889  -12.809 1.00 13.93 ? 139 VAL C CG1 1 
ATOM   5193 C CG2 . VAL C 1 119 ? -10.807 11.122  -14.401 1.00 13.93 ? 139 VAL C CG2 1 
ATOM   5194 N N   . VAL C 1 120 ? -12.143 15.681  -14.806 1.00 14.58 ? 140 VAL C N   1 
ATOM   5195 C CA  . VAL C 1 120 ? -12.053 17.112  -14.548 1.00 14.58 ? 140 VAL C CA  1 
ATOM   5196 C C   . VAL C 1 120 ? -12.446 17.497  -13.155 1.00 14.58 ? 140 VAL C C   1 
ATOM   5197 O O   . VAL C 1 120 ? -13.484 17.079  -12.622 1.00 14.58 ? 140 VAL C O   1 
ATOM   5198 C CB  . VAL C 1 120 ? -13.035 17.808  -15.542 1.00 12.80 ? 140 VAL C CB  1 
ATOM   5199 C CG1 . VAL C 1 120 ? -13.184 19.274  -15.262 1.00 12.80 ? 140 VAL C CG1 1 
ATOM   5200 C CG2 . VAL C 1 120 ? -12.558 17.566  -16.987 1.00 12.80 ? 140 VAL C CG2 1 
ATOM   5201 N N   . ILE C 1 121 ? -11.655 18.313  -12.499 1.00 20.29 ? 141 ILE C N   1 
ATOM   5202 C CA  . ILE C 1 121 ? -11.881 18.906  -11.197 1.00 20.29 ? 141 ILE C CA  1 
ATOM   5203 C C   . ILE C 1 121 ? -11.983 20.402  -11.557 1.00 20.29 ? 141 ILE C C   1 
ATOM   5204 O O   . ILE C 1 121 ? -11.038 20.907  -12.247 1.00 20.29 ? 141 ILE C O   1 
ATOM   5205 C CB  . ILE C 1 121 ? -10.774 18.721  -10.153 1.00 18.99 ? 141 ILE C CB  1 
ATOM   5206 C CG1 . ILE C 1 121 ? -10.525 17.264  -9.842  1.00 18.99 ? 141 ILE C CG1 1 
ATOM   5207 C CG2 . ILE C 1 121 ? -11.142 19.454  -8.853  1.00 18.99 ? 141 ILE C CG2 1 
ATOM   5208 C CD1 . ILE C 1 121 ? -9.264  16.967  -9.086  1.00 18.99 ? 141 ILE C CD1 1 
ATOM   5209 N N   . SER C 1 122 ? -13.020 21.119  -11.214 1.00 27.07 ? 142 SER C N   1 
ATOM   5210 C CA  . SER C 1 122 ? -13.052 22.539  -11.600 1.00 27.07 ? 142 SER C CA  1 
ATOM   5211 C C   . SER C 1 122 ? -14.226 23.222  -10.989 1.00 27.07 ? 142 SER C C   1 
ATOM   5212 O O   . SER C 1 122 ? -14.862 22.615  -10.129 1.00 27.07 ? 142 SER C O   1 
ATOM   5213 C CB  . SER C 1 122 ? -13.183 22.619  -13.131 1.00 26.50 ? 142 SER C CB  1 
ATOM   5214 O OG  . SER C 1 122 ? -13.220 23.967  -13.557 1.00 26.50 ? 142 SER C OG  1 
ATOM   5215 N N   . ASN C 1 123 ? -14.567 24.420  -11.396 1.00 32.32 ? 143 ASN C N   1 
ATOM   5216 C CA  . ASN C 1 123 ? -15.764 25.014  -10.774 1.00 32.32 ? 143 ASN C CA  1 
ATOM   5217 C C   . ASN C 1 123 ? -16.304 26.045  -11.733 1.00 32.32 ? 143 ASN C C   1 
ATOM   5218 O O   . ASN C 1 123 ? -15.578 26.994  -12.079 1.00 32.32 ? 143 ASN C O   1 
ATOM   5219 C CB  . ASN C 1 123 ? -15.352 25.604  -9.450  1.00 39.09 ? 143 ASN C CB  1 
ATOM   5220 C CG  . ASN C 1 123 ? -16.545 26.144  -8.688  1.00 39.09 ? 143 ASN C CG  1 
ATOM   5221 O OD1 . ASN C 1 123 ? -17.628 25.564  -8.702  1.00 39.09 ? 143 ASN C OD1 1 
ATOM   5222 N ND2 . ASN C 1 123 ? -16.323 27.276  -8.002  1.00 39.09 ? 143 ASN C ND2 1 
ATOM   5223 N N   . PRO C 1 124 ? -17.521 25.867  -12.215 1.00 29.52 ? 144 PRO C N   1 
ATOM   5224 C CA  . PRO C 1 124 ? -18.438 24.787  -11.930 1.00 29.52 ? 144 PRO C CA  1 
ATOM   5225 C C   . PRO C 1 124 ? -18.014 23.541  -12.671 1.00 29.52 ? 144 PRO C C   1 
ATOM   5226 O O   . PRO C 1 124 ? -17.870 23.637  -13.892 1.00 29.52 ? 144 PRO C O   1 
ATOM   5227 C CB  . PRO C 1 124 ? -19.819 25.269  -12.399 1.00 30.03 ? 144 PRO C CB  1 
ATOM   5228 C CG  . PRO C 1 124 ? -19.590 26.648  -12.946 1.00 30.03 ? 144 PRO C CG  1 
ATOM   5229 C CD  . PRO C 1 124 ? -18.120 26.809  -13.207 1.00 30.03 ? 144 PRO C CD  1 
ATOM   5230 N N   . VAL C 1 125 ? -17.837 22.407  -11.992 1.00 24.29 ? 145 VAL C N   1 
ATOM   5231 C CA  . VAL C 1 125 ? -17.362 21.178  -12.632 1.00 24.29 ? 145 VAL C CA  1 
ATOM   5232 C C   . VAL C 1 125 ? -18.206 20.629  -13.743 1.00 24.29 ? 145 VAL C C   1 
ATOM   5233 O O   . VAL C 1 125 ? -17.654 20.186  -14.782 1.00 24.29 ? 145 VAL C O   1 
ATOM   5234 C CB  . VAL C 1 125 ? -17.155 20.113  -11.507 1.00 22.83 ? 145 VAL C CB  1 
ATOM   5235 C CG1 . VAL C 1 125 ? -18.435 19.824  -10.774 1.00 22.83 ? 145 VAL C CG1 1 
ATOM   5236 C CG2 . VAL C 1 125 ? -16.542 18.873  -12.111 1.00 22.83 ? 145 VAL C CG2 1 
ATOM   5237 N N   . ASP C 1 126 ? -19.528 20.642  -13.650 1.00 23.90 ? 146 ASP C N   1 
ATOM   5238 C CA  . ASP C 1 126 ? -20.397 20.070  -14.687 1.00 23.90 ? 146 ASP C CA  1 
ATOM   5239 C C   . ASP C 1 126 ? -20.308 20.853  -15.993 1.00 23.90 ? 146 ASP C C   1 
ATOM   5240 O O   . ASP C 1 126 ? -20.327 20.208  -17.035 1.00 23.90 ? 146 ASP C O   1 
ATOM   5241 C CB  . ASP C 1 126 ? -21.854 20.036  -14.286 1.00 23.94 ? 146 ASP C CB  1 
ATOM   5242 C CG  . ASP C 1 126 ? -22.024 19.269  -12.962 1.00 23.94 ? 146 ASP C CG  1 
ATOM   5243 O OD1 . ASP C 1 126 ? -21.864 18.026  -12.920 1.00 23.94 ? 146 ASP C OD1 1 
ATOM   5244 O OD2 . ASP C 1 126 ? -22.311 20.015  -12.011 1.00 23.94 ? 146 ASP C OD2 1 
ATOM   5245 N N   . VAL C 1 127 ? -20.275 22.181  -15.890 1.00 23.99 ? 147 VAL C N   1 
ATOM   5246 C CA  . VAL C 1 127 ? -20.174 23.056  -17.056 1.00 23.99 ? 147 VAL C CA  1 
ATOM   5247 C C   . VAL C 1 127 ? -18.810 22.871  -17.724 1.00 23.99 ? 147 VAL C C   1 
ATOM   5248 O O   . VAL C 1 127 ? -18.716 22.568  -18.912 1.00 23.99 ? 147 VAL C O   1 
ATOM   5249 C CB  . VAL C 1 127 ? -20.363 24.536  -16.663 1.00 23.30 ? 147 VAL C CB  1 
ATOM   5250 C CG1 . VAL C 1 127 ? -20.230 25.459  -17.872 1.00 23.30 ? 147 VAL C CG1 1 
ATOM   5251 C CG2 . VAL C 1 127 ? -21.732 24.803  -16.055 1.00 23.30 ? 147 VAL C CG2 1 
ATOM   5252 N N   . ILE C 1 128 ? -17.738 22.997  -16.945 1.00 22.38 ? 148 ILE C N   1 
ATOM   5253 C CA  . ILE C 1 128 ? -16.386 22.861  -17.467 1.00 22.38 ? 148 ILE C CA  1 
ATOM   5254 C C   . ILE C 1 128 ? -16.164 21.472  -17.998 1.00 22.38 ? 148 ILE C C   1 
ATOM   5255 O O   . ILE C 1 128 ? -15.409 21.278  -18.943 1.00 22.38 ? 148 ILE C O   1 
ATOM   5256 C CB  . ILE C 1 128 ? -15.331 23.174  -16.398 1.00 22.26 ? 148 ILE C CB  1 
ATOM   5257 C CG1 . ILE C 1 128 ? -15.465 24.632  -15.941 1.00 22.26 ? 148 ILE C CG1 1 
ATOM   5258 C CG2 . ILE C 1 128 ? -13.907 22.921  -16.879 1.00 22.26 ? 148 ILE C CG2 1 
ATOM   5259 C CD1 . ILE C 1 128 ? -15.297 25.705  -16.953 1.00 22.26 ? 148 ILE C CD1 1 
ATOM   5260 N N   . THR C 1 129 ? -16.788 20.442  -17.414 1.00 20.81 ? 149 THR C N   1 
ATOM   5261 C CA  . THR C 1 129 ? -16.622 19.105  -17.981 1.00 20.81 ? 149 THR C CA  1 
ATOM   5262 C C   . THR C 1 129 ? -17.258 19.053  -19.351 1.00 20.81 ? 149 THR C C   1 
ATOM   5263 O O   . THR C 1 129 ? -16.662 18.506  -20.298 1.00 20.81 ? 149 THR C O   1 
ATOM   5264 C CB  . THR C 1 129 ? -17.282 18.059  -17.041 1.00 18.59 ? 149 THR C CB  1 
ATOM   5265 O OG1 . THR C 1 129 ? -16.598 18.053  -15.782 1.00 18.59 ? 149 THR C OG1 1 
ATOM   5266 C CG2 . THR C 1 129 ? -17.275 16.672  -17.640 1.00 18.59 ? 149 THR C CG2 1 
ATOM   5267 N N   . ALA C 1 130 ? -18.469 19.561  -19.496 1.00 20.10 ? 150 ALA C N   1 
ATOM   5268 C CA  . ALA C 1 130 ? -19.205 19.566  -20.764 1.00 20.10 ? 150 ALA C CA  1 
ATOM   5269 C C   . ALA C 1 130 ? -18.461 20.391  -21.824 1.00 20.10 ? 150 ALA C C   1 
ATOM   5270 O O   . ALA C 1 130 ? -18.451 20.023  -22.986 1.00 20.10 ? 150 ALA C O   1 
ATOM   5271 C CB  . ALA C 1 130 ? -20.598 20.152  -20.555 1.00 20.42 ? 150 ALA C CB  1 
ATOM   5272 N N   . LEU C 1 131 ? -17.815 21.466  -21.407 1.00 19.59 ? 151 LEU C N   1 
ATOM   5273 C CA  . LEU C 1 131 ? -16.996 22.281  -22.287 1.00 19.59 ? 151 LEU C CA  1 
ATOM   5274 C C   . LEU C 1 131 ? -15.802 21.506  -22.791 1.00 19.59 ? 151 LEU C C   1 
ATOM   5275 O O   . LEU C 1 131 ? -15.504 21.556  -24.020 1.00 19.59 ? 151 LEU C O   1 
ATOM   5276 C CB  . LEU C 1 131 ? -16.552 23.563  -21.572 1.00 18.90 ? 151 LEU C CB  1 
ATOM   5277 C CG  . LEU C 1 131 ? -16.168 24.727  -22.516 1.00 18.90 ? 151 LEU C CG  1 
ATOM   5278 C CD1 . LEU C 1 131 ? -17.282 25.052  -23.493 1.00 18.90 ? 151 LEU C CD1 1 
ATOM   5279 C CD2 . LEU C 1 131 ? -15.836 25.944  -21.692 1.00 18.90 ? 151 LEU C CD2 1 
ATOM   5280 N N   . PHE C 1 132 ? -15.096 20.727  -21.977 1.00 18.54 ? 152 PHE C N   1 
ATOM   5281 C CA  . PHE C 1 132 ? -13.951 19.919  -22.415 1.00 18.54 ? 152 PHE C CA  1 
ATOM   5282 C C   . PHE C 1 132 ? -14.419 18.853  -23.380 1.00 18.54 ? 152 PHE C C   1 
ATOM   5283 O O   . PHE C 1 132 ? -13.736 18.430  -24.332 1.00 18.54 ? 152 PHE C O   1 
ATOM   5284 C CB  . PHE C 1 132 ? -13.230 19.200  -21.295 1.00 15.43 ? 152 PHE C CB  1 
ATOM   5285 C CG  . PHE C 1 132 ? -12.064 19.917  -20.703 1.00 15.43 ? 152 PHE C CG  1 
ATOM   5286 C CD1 . PHE C 1 132 ? -10.884 19.980  -21.403 1.00 15.43 ? 152 PHE C CD1 1 
ATOM   5287 C CD2 . PHE C 1 132 ? -12.105 20.524  -19.464 1.00 15.43 ? 152 PHE C CD2 1 
ATOM   5288 C CE1 . PHE C 1 132 ? -9.779  20.621  -20.877 1.00 15.43 ? 152 PHE C CE1 1 
ATOM   5289 C CE2 . PHE C 1 132 ? -11.018 21.179  -18.933 1.00 15.43 ? 152 PHE C CE2 1 
ATOM   5290 C CZ  . PHE C 1 132 ? -9.851  21.242  -19.648 1.00 15.43 ? 152 PHE C CZ  1 
ATOM   5291 N N   . GLN C 1 133 ? -15.621 18.318  -23.127 1.00 21.99 ? 153 GLN C N   1 
ATOM   5292 C CA  . GLN C 1 133 ? -16.167 17.311  -24.021 1.00 21.99 ? 153 GLN C CA  1 
ATOM   5293 C C   . GLN C 1 133 ? -16.400 17.961  -25.395 1.00 21.99 ? 153 GLN C C   1 
ATOM   5294 O O   . GLN C 1 133 ? -16.094 17.385  -26.451 1.00 21.99 ? 153 GLN C O   1 
ATOM   5295 C CB  . GLN C 1 133 ? -17.466 16.726  -23.518 1.00 20.94 ? 153 GLN C CB  1 
ATOM   5296 C CG  . GLN C 1 133 ? -17.814 15.422  -24.250 1.00 20.94 ? 153 GLN C CG  1 
ATOM   5297 C CD  . GLN C 1 133 ? -18.632 15.686  -25.497 1.00 20.94 ? 153 GLN C CD  1 
ATOM   5298 O OE1 . GLN C 1 133 ? -19.454 16.622  -25.493 1.00 20.94 ? 153 GLN C OE1 1 
ATOM   5299 N NE2 . GLN C 1 133 ? -18.391 14.926  -26.539 1.00 20.94 ? 153 GLN C NE2 1 
ATOM   5300 N N   . HIS C 1 134 ? -16.965 19.163  -25.383 1.00 25.35 ? 154 HIS C N   1 
ATOM   5301 C CA  . HIS C 1 134 ? -17.283 19.935  -26.576 1.00 25.35 ? 154 HIS C CA  1 
ATOM   5302 C C   . HIS C 1 134 ? -16.082 20.305  -27.408 1.00 25.35 ? 154 HIS C C   1 
ATOM   5303 O O   . HIS C 1 134 ? -16.071 20.100  -28.625 1.00 25.35 ? 154 HIS C O   1 
ATOM   5304 C CB  . HIS C 1 134 ? -17.955 21.244  -26.122 1.00 29.91 ? 154 HIS C CB  1 
ATOM   5305 C CG  . HIS C 1 134 ? -18.275 22.109  -27.286 1.00 29.91 ? 154 HIS C CG  1 
ATOM   5306 N ND1 . HIS C 1 134 ? -19.452 21.996  -27.992 1.00 29.91 ? 154 HIS C ND1 1 
ATOM   5307 C CD2 . HIS C 1 134 ? -17.580 23.114  -27.858 1.00 29.91 ? 154 HIS C CD2 1 
ATOM   5308 C CE1 . HIS C 1 134 ? -19.464 22.881  -28.968 1.00 29.91 ? 154 HIS C CE1 1 
ATOM   5309 N NE2 . HIS C 1 134 ? -18.343 23.577  -28.899 1.00 29.91 ? 154 HIS C NE2 1 
ATOM   5310 N N   . VAL C 1 135 ? -15.059 20.864  -26.818 1.00 24.33 ? 155 VAL C N   1 
ATOM   5311 C CA  . VAL C 1 135 ? -13.823 21.273  -27.427 1.00 24.33 ? 155 VAL C CA  1 
ATOM   5312 C C   . VAL C 1 135 ? -12.938 20.143  -27.886 1.00 24.33 ? 155 VAL C C   1 
ATOM   5313 O O   . VAL C 1 135 ? -12.284 20.255  -28.962 1.00 24.33 ? 155 VAL C O   1 
ATOM   5314 C CB  . VAL C 1 135 ? -13.021 22.137  -26.416 1.00 22.93 ? 155 VAL C CB  1 
ATOM   5315 C CG1 . VAL C 1 135 ? -11.654 22.515  -26.912 1.00 22.93 ? 155 VAL C CG1 1 
ATOM   5316 C CG2 . VAL C 1 135 ? -13.814 23.417  -26.138 1.00 22.93 ? 155 VAL C CG2 1 
ATOM   5317 N N   . THR C 1 136 ? -12.820 19.042  -27.158 1.00 21.99 ? 156 THR C N   1 
ATOM   5318 C CA  . THR C 1 136 ? -11.919 17.961  -27.575 1.00 21.99 ? 156 THR C CA  1 
ATOM   5319 C C   . THR C 1 136 ? -12.493 17.054  -28.623 1.00 21.99 ? 156 THR C C   1 
ATOM   5320 O O   . THR C 1 136 ? -11.776 16.448  -29.416 1.00 21.99 ? 156 THR C O   1 
ATOM   5321 C CB  . THR C 1 136 ? -11.525 17.073  -26.357 1.00 20.91 ? 156 THR C CB  1 
ATOM   5322 O OG1 . THR C 1 136 ? -12.703 16.550  -25.728 1.00 20.91 ? 156 THR C OG1 1 
ATOM   5323 C CG2 . THR C 1 136 ? -10.708 17.893  -25.389 1.00 20.91 ? 156 THR C CG2 1 
ATOM   5324 N N   . GLY C 1 137 ? -13.804 16.852  -28.566 1.00 21.56 ? 157 GLY C N   1 
ATOM   5325 C CA  . GLY C 1 137 ? -14.466 15.920  -29.476 1.00 21.56 ? 157 GLY C CA  1 
ATOM   5326 C C   . GLY C 1 137 ? -14.368 14.491  -28.982 1.00 21.56 ? 157 GLY C C   1 
ATOM   5327 O O   . GLY C 1 137 ? -14.677 13.520  -29.698 1.00 21.56 ? 157 GLY C O   1 
ATOM   5328 N N   . PHE C 1 138 ? -13.902 14.336  -27.727 1.00 21.72 ? 158 PHE C N   1 
ATOM   5329 C CA  . PHE C 1 138 ? -13.798 12.978  -27.156 1.00 21.72 ? 158 PHE C CA  1 
ATOM   5330 C C   . PHE C 1 138 ? -15.230 12.542  -26.886 1.00 21.72 ? 158 PHE C C   1 
ATOM   5331 O O   . PHE C 1 138 ? -16.101 13.375  -26.572 1.00 21.72 ? 158 PHE C O   1 
ATOM   5332 C CB  . PHE C 1 138 ? -13.014 12.990  -25.864 1.00 20.33 ? 158 PHE C CB  1 
ATOM   5333 C CG  . PHE C 1 138 ? -11.567 13.358  -25.930 1.00 20.33 ? 158 PHE C CG  1 
ATOM   5334 C CD1 . PHE C 1 138 ? -10.837 13.083  -27.087 1.00 20.33 ? 158 PHE C CD1 1 
ATOM   5335 C CD2 . PHE C 1 138 ? -10.914 13.934  -24.865 1.00 20.33 ? 158 PHE C CD2 1 
ATOM   5336 C CE1 . PHE C 1 138 ? -9.493  13.391  -27.188 1.00 20.33 ? 158 PHE C CE1 1 
ATOM   5337 C CE2 . PHE C 1 138 ? -9.555  14.243  -24.955 1.00 20.33 ? 158 PHE C CE2 1 
ATOM   5338 C CZ  . PHE C 1 138 ? -8.840  13.980  -26.107 1.00 20.33 ? 158 PHE C CZ  1 
ATOM   5339 N N   . PRO C 1 139 ? -15.505 11.273  -27.048 1.00 21.22 ? 159 PRO C N   1 
ATOM   5340 C CA  . PRO C 1 139 ? -16.840 10.738  -26.783 1.00 21.22 ? 159 PRO C CA  1 
ATOM   5341 C C   . PRO C 1 139 ? -17.182 11.073  -25.348 1.00 21.22 ? 159 PRO C C   1 
ATOM   5342 O O   . PRO C 1 139 ? -16.327 10.890  -24.465 1.00 21.22 ? 159 PRO C O   1 
ATOM   5343 C CB  . PRO C 1 139 ? -16.770 9.261   -27.017 1.00 20.17 ? 159 PRO C CB  1 
ATOM   5344 C CG  . PRO C 1 139 ? -15.339 8.971   -27.312 1.00 20.17 ? 159 PRO C CG  1 
ATOM   5345 C CD  . PRO C 1 139 ? -14.558 10.262  -27.443 1.00 20.17 ? 159 PRO C CD  1 
ATOM   5346 N N   . ALA C 1 140 ? -18.377 11.499  -25.034 1.00 21.06 ? 160 ALA C N   1 
ATOM   5347 C CA  . ALA C 1 140 ? -18.796 11.914  -23.718 1.00 21.06 ? 160 ALA C CA  1 
ATOM   5348 C C   . ALA C 1 140 ? -18.533 10.920  -22.607 1.00 21.06 ? 160 ALA C C   1 
ATOM   5349 O O   . ALA C 1 140 ? -18.356 11.332  -21.453 1.00 21.06 ? 160 ALA C O   1 
ATOM   5350 C CB  . ALA C 1 140 ? -20.286 12.249  -23.767 1.00 20.28 ? 160 ALA C CB  1 
ATOM   5351 N N   . HIS C 1 141 ? -18.473 9.625   -22.893 1.00 21.43 ? 161 HIS C N   1 
ATOM   5352 C CA  . HIS C 1 141 ? -18.231 8.618   -21.868 1.00 21.43 ? 161 HIS C CA  1 
ATOM   5353 C C   . HIS C 1 141 ? -16.777 8.594   -21.471 1.00 21.43 ? 161 HIS C C   1 
ATOM   5354 O O   . HIS C 1 141 ? -16.440 7.918   -20.478 1.00 21.43 ? 161 HIS C O   1 
ATOM   5355 C CB  . HIS C 1 141 ? -18.657 7.203   -22.304 1.00 21.59 ? 161 HIS C CB  1 
ATOM   5356 C CG  . HIS C 1 141 ? -17.991 6.629   -23.507 1.00 21.59 ? 161 HIS C CG  1 
ATOM   5357 N ND1 . HIS C 1 141 ? -16.834 5.878   -23.429 1.00 21.59 ? 161 HIS C ND1 1 
ATOM   5358 C CD2 . HIS C 1 141 ? -18.305 6.701   -24.825 1.00 21.59 ? 161 HIS C CD2 1 
ATOM   5359 C CE1 . HIS C 1 141 ? -16.448 5.509   -24.651 1.00 21.59 ? 161 HIS C CE1 1 
ATOM   5360 N NE2 . HIS C 1 141 ? -17.340 5.985   -25.512 1.00 21.59 ? 161 HIS C NE2 1 
ATOM   5361 N N   . LYS C 1 142 ? -15.898 9.311   -22.174 1.00 19.49 ? 162 LYS C N   1 
ATOM   5362 C CA  . LYS C 1 142 ? -14.483 9.313   -21.761 1.00 19.49 ? 162 LYS C CA  1 
ATOM   5363 C C   . LYS C 1 142 ? -14.128 10.611  -21.091 1.00 19.49 ? 162 LYS C C   1 
ATOM   5364 O O   . LYS C 1 142 ? -12.968 10.874  -20.780 1.00 19.49 ? 162 LYS C O   1 
ATOM   5365 C CB  . LYS C 1 142 ? -13.595 9.083   -22.950 1.00 24.58 ? 162 LYS C CB  1 
ATOM   5366 C CG  . LYS C 1 142 ? -13.669 7.632   -23.435 1.00 24.58 ? 162 LYS C CG  1 
ATOM   5367 C CD  . LYS C 1 142 ? -12.295 7.357   -24.020 1.00 24.58 ? 162 LYS C CD  1 
ATOM   5368 C CE  . LYS C 1 142 ? -12.042 5.850   -24.154 1.00 24.58 ? 162 LYS C CE  1 
ATOM   5369 N NZ  . LYS C 1 142 ? -11.500 5.762   -25.603 1.00 24.58 ? 162 LYS C NZ  1 
ATOM   5370 N N   . VAL C 1 143 ? -15.113 11.477  -20.907 1.00 18.30 ? 163 VAL C N   1 
ATOM   5371 C CA  . VAL C 1 143 ? -14.902 12.778  -20.280 1.00 18.30 ? 163 VAL C CA  1 
ATOM   5372 C C   . VAL C 1 143 ? -15.858 12.875  -19.097 1.00 18.30 ? 163 VAL C C   1 
ATOM   5373 O O   . VAL C 1 143 ? -17.070 12.975  -19.252 1.00 18.30 ? 163 VAL C O   1 
ATOM   5374 C CB  . VAL C 1 143 ? -15.125 13.930  -21.261 1.00 15.99 ? 163 VAL C CB  1 
ATOM   5375 C CG1 . VAL C 1 143 ? -14.709 15.245  -20.582 1.00 15.99 ? 163 VAL C CG1 1 
ATOM   5376 C CG2 . VAL C 1 143 ? -14.337 13.813  -22.566 1.00 15.99 ? 163 VAL C CG2 1 
ATOM   5377 N N   . ILE C 1 144 ? -15.336 12.765  -17.864 1.00 18.48 ? 164 ILE C N   1 
ATOM   5378 C CA  . ILE C 1 144 ? -16.170 12.826  -16.662 1.00 18.48 ? 164 ILE C CA  1 
ATOM   5379 C C   . ILE C 1 144 ? -15.599 13.792  -15.644 1.00 18.48 ? 164 ILE C C   1 
ATOM   5380 O O   . ILE C 1 144 ? -14.390 14.050  -15.677 1.00 18.48 ? 164 ILE C O   1 
ATOM   5381 C CB  . ILE C 1 144 ? -16.316 11.425  -15.993 1.00 18.90 ? 164 ILE C CB  1 
ATOM   5382 C CG1 . ILE C 1 144 ? -14.986 10.870  -15.560 1.00 18.90 ? 164 ILE C CG1 1 
ATOM   5383 C CG2 . ILE C 1 144 ? -16.997 10.426  -16.946 1.00 18.90 ? 164 ILE C CG2 1 
ATOM   5384 C CD1 . ILE C 1 144 ? -14.796 9.385   -15.481 1.00 18.90 ? 164 ILE C CD1 1 
ATOM   5385 N N   . GLY C 1 145 ? -16.432 14.320  -14.783 1.00 18.42 ? 165 GLY C N   1 
ATOM   5386 C CA  . GLY C 1 145 ? -15.971 15.259  -13.761 1.00 18.42 ? 165 GLY C CA  1 
ATOM   5387 C C   . GLY C 1 145 ? -16.215 14.654  -12.399 1.00 18.42 ? 165 GLY C C   1 
ATOM   5388 O O   . GLY C 1 145 ? -17.112 13.804  -12.292 1.00 18.42 ? 165 GLY C O   1 
ATOM   5389 N N   . THR C 1 146 ? -15.460 15.082  -11.388 1.00 19.60 ? 166 THR C N   1 
ATOM   5390 C CA  . THR C 1 146 ? -15.631 14.547  -10.035 1.00 19.60 ? 166 THR C CA  1 
ATOM   5391 C C   . THR C 1 146 ? -17.019 14.854  -9.542  1.00 19.60 ? 166 THR C C   1 
ATOM   5392 O O   . THR C 1 146 ? -17.571 14.009  -8.775  1.00 19.60 ? 166 THR C O   1 
ATOM   5393 C CB  . THR C 1 146 ? -14.552 15.086  -9.078  1.00 19.45 ? 166 THR C CB  1 
ATOM   5394 O OG1 . THR C 1 146 ? -14.559 16.507  -9.090  1.00 19.45 ? 166 THR C OG1 1 
ATOM   5395 C CG2 . THR C 1 146 ? -13.160 14.621  -9.494  1.00 19.45 ? 166 THR C CG2 1 
ATOM   5396 N N   . GLY C 1 147 ? -17.663 15.943  -9.843  1.00 20.80 ? 167 GLY C N   1 
ATOM   5397 C CA  . GLY C 1 147 ? -19.014 16.230  -9.429  1.00 20.80 ? 167 GLY C CA  1 
ATOM   5398 C C   . GLY C 1 147 ? -19.289 16.240  -7.948  1.00 20.80 ? 167 GLY C C   1 
ATOM   5399 O O   . GLY C 1 147 ? -18.609 16.900  -7.151  1.00 20.80 ? 167 GLY C O   1 
ATOM   5400 N N   . THR C 1 148 ? -20.345 15.519  -7.530  1.00 20.76 ? 168 THR C N   1 
ATOM   5401 C CA  . THR C 1 148 ? -20.749 15.446  -6.146  1.00 20.76 ? 168 THR C CA  1 
ATOM   5402 C C   . THR C 1 148 ? -20.131 14.278  -5.372  1.00 20.76 ? 168 THR C C   1 
ATOM   5403 O O   . THR C 1 148 ? -20.557 14.025  -4.232  1.00 20.76 ? 168 THR C O   1 
ATOM   5404 C CB  . THR C 1 148 ? -22.298 15.320  -6.000  1.00 21.64 ? 168 THR C CB  1 
ATOM   5405 O OG1 . THR C 1 148 ? -22.709 14.234  -6.836  1.00 21.64 ? 168 THR C OG1 1 
ATOM   5406 C CG2 . THR C 1 148 ? -23.012 16.591  -6.396  1.00 21.64 ? 168 THR C CG2 1 
ATOM   5407 N N   . LEU C 1 149 ? -19.085 13.636  -5.889  1.00 19.64 ? 169 LEU C N   1 
ATOM   5408 C CA  . LEU C 1 149 ? -18.353 12.583  -5.182  1.00 19.64 ? 169 LEU C CA  1 
ATOM   5409 C C   . LEU C 1 149 ? -17.815 13.205  -3.896  1.00 19.64 ? 169 LEU C C   1 
ATOM   5410 O O   . LEU C 1 149 ? -17.919 12.576  -2.834  1.00 19.64 ? 169 LEU C O   1 
ATOM   5411 C CB  . LEU C 1 149 ? -17.233 11.986  -5.999  1.00 18.69 ? 169 LEU C CB  1 
ATOM   5412 C CG  . LEU C 1 149 ? -16.653 10.650  -5.565  1.00 18.69 ? 169 LEU C CG  1 
ATOM   5413 C CD1 . LEU C 1 149 ? -17.747 9.591   -5.373  1.00 18.69 ? 169 LEU C CD1 1 
ATOM   5414 C CD2 . LEU C 1 149 ? -15.686 10.096  -6.588  1.00 18.69 ? 169 LEU C CD2 1 
ATOM   5415 N N   . LEU C 1 150 ? -17.299 14.407  -3.949  1.00 20.08 ? 170 LEU C N   1 
ATOM   5416 C CA  . LEU C 1 150 ? -16.852 15.119  -2.796  1.00 20.08 ? 170 LEU C CA  1 
ATOM   5417 C C   . LEU C 1 150 ? -18.034 15.477  -1.910  1.00 20.08 ? 170 LEU C C   1 
ATOM   5418 O O   . LEU C 1 150 ? -17.977 15.320  -0.675  1.00 20.08 ? 170 LEU C O   1 
ATOM   5419 C CB  . LEU C 1 150 ? -16.142 16.440  -3.161  1.00 18.44 ? 170 LEU C CB  1 
ATOM   5420 C CG  . LEU C 1 150 ? -15.716 17.300  -1.963  1.00 18.44 ? 170 LEU C CG  1 
ATOM   5421 C CD1 . LEU C 1 150 ? -14.934 16.514  -0.939  1.00 18.44 ? 170 LEU C CD1 1 
ATOM   5422 C CD2 . LEU C 1 150 ? -14.833 18.439  -2.427  1.00 18.44 ? 170 LEU C CD2 1 
ATOM   5423 N N   . ASP C 1 151 ? -19.133 15.961  -2.463  1.00 20.74 ? 171 ASP C N   1 
ATOM   5424 C CA  . ASP C 1 151 ? -20.296 16.335  -1.680  1.00 20.74 ? 171 ASP C CA  1 
ATOM   5425 C C   . ASP C 1 151 ? -20.902 15.131  -0.956  1.00 20.74 ? 171 ASP C C   1 
ATOM   5426 O O   . ASP C 1 151 ? -21.353 15.310  0.166   1.00 20.74 ? 171 ASP C O   1 
ATOM   5427 C CB  . ASP C 1 151 ? -21.380 16.933  -2.585  1.00 24.89 ? 171 ASP C CB  1 
ATOM   5428 C CG  . ASP C 1 151 ? -20.908 18.205  -3.271  1.00 24.89 ? 171 ASP C CG  1 
ATOM   5429 O OD1 . ASP C 1 151 ? -20.547 19.176  -2.582  1.00 24.89 ? 171 ASP C OD1 1 
ATOM   5430 O OD2 . ASP C 1 151 ? -20.911 18.215  -4.533  1.00 24.89 ? 171 ASP C OD2 1 
ATOM   5431 N N   . THR C 1 152 ? -20.924 13.993  -1.611  1.00 19.69 ? 172 THR C N   1 
ATOM   5432 C CA  . THR C 1 152 ? -21.414 12.741  -1.067  1.00 19.69 ? 172 THR C CA  1 
ATOM   5433 C C   . THR C 1 152 ? -20.522 12.343  0.099   1.00 19.69 ? 172 THR C C   1 
ATOM   5434 O O   . THR C 1 152 ? -21.036 12.100  1.201   1.00 19.69 ? 172 THR C O   1 
ATOM   5435 C CB  . THR C 1 152 ? -21.361 11.627  -2.102  1.00 19.32 ? 172 THR C CB  1 
ATOM   5436 O OG1 . THR C 1 152 ? -22.243 12.007  -3.184  1.00 19.32 ? 172 THR C OG1 1 
ATOM   5437 C CG2 . THR C 1 152 ? -21.821 10.279  -1.574  1.00 19.32 ? 172 THR C CG2 1 
ATOM   5438 N N   . ALA C 1 153 ? -19.203 12.404  -0.060  1.00 18.64 ? 173 ALA C N   1 
ATOM   5439 C CA  . ALA C 1 153 ? -18.257 12.088  1.003   1.00 18.64 ? 173 ALA C CA  1 
ATOM   5440 C C   . ALA C 1 153 ? -18.431 13.000  2.207   1.00 18.64 ? 173 ALA C C   1 
ATOM   5441 O O   . ALA C 1 153 ? -18.164 12.566  3.349   1.00 18.64 ? 173 ALA C O   1 
ATOM   5442 C CB  . ALA C 1 153 ? -16.849 12.192  0.452   1.00 18.72 ? 173 ALA C CB  1 
ATOM   5443 N N   . ARG C 1 154 ? -18.882 14.233  2.047   1.00 17.44 ? 174 ARG C N   1 
ATOM   5444 C CA  . ARG C 1 154 ? -19.138 15.142  3.135   1.00 17.44 ? 174 ARG C CA  1 
ATOM   5445 C C   . ARG C 1 154 ? -20.439 14.790  3.844   1.00 17.44 ? 174 ARG C C   1 
ATOM   5446 O O   . ARG C 1 154 ? -20.564 14.997  5.053   1.00 17.44 ? 174 ARG C O   1 
ATOM   5447 C CB  . ARG C 1 154 ? -19.260 16.588  2.659   1.00 17.38 ? 174 ARG C CB  1 
ATOM   5448 C CG  . ARG C 1 154 ? -17.984 17.058  1.958   1.00 17.38 ? 174 ARG C CG  1 
ATOM   5449 C CD  . ARG C 1 154 ? -17.970 18.555  1.751   1.00 17.38 ? 174 ARG C CD  1 
ATOM   5450 N NE  . ARG C 1 154 ? -16.644 19.115  1.524   1.00 17.38 ? 174 ARG C NE  1 
ATOM   5451 C CZ  . ARG C 1 154 ? -16.383 20.194  0.799   1.00 17.38 ? 174 ARG C CZ  1 
ATOM   5452 N NH1 . ARG C 1 154 ? -17.341 20.789  0.164   1.00 17.38 ? 174 ARG C NH1 1 
ATOM   5453 N NH2 . ARG C 1 154 ? -15.151 20.653  0.691   1.00 17.38 ? 174 ARG C NH2 1 
ATOM   5454 N N   . MET C 1 155 ? -21.419 14.298  3.112   1.00 17.82 ? 175 MET C N   1 
ATOM   5455 C CA  . MET C 1 155 ? -22.687 13.857  3.664   1.00 17.82 ? 175 MET C CA  1 
ATOM   5456 C C   . MET C 1 155 ? -22.351 12.606  4.517   1.00 17.82 ? 175 MET C C   1 
ATOM   5457 O O   . MET C 1 155 ? -22.731 12.480  5.675   1.00 17.82 ? 175 MET C O   1 
ATOM   5458 C CB  . MET C 1 155 ? -23.649 13.489  2.571   1.00 15.18 ? 175 MET C CB  1 
ATOM   5459 C CG  . MET C 1 155 ? -24.965 12.845  2.959   1.00 15.18 ? 175 MET C CG  1 
ATOM   5460 S SD  . MET C 1 155 ? -24.906 11.065  3.108   1.00 15.18 ? 175 MET C SD  1 
ATOM   5461 C CE  . MET C 1 155 ? -24.485 10.435  1.532   1.00 15.18 ? 175 MET C CE  1 
ATOM   5462 N N   . GLN C 1 156 ? -21.548 11.694  3.952   1.00 18.84 ? 176 GLN C N   1 
ATOM   5463 C CA  . GLN C 1 156 ? -21.093 10.495  4.634   1.00 18.84 ? 176 GLN C CA  1 
ATOM   5464 C C   . GLN C 1 156 ? -20.359 10.828  5.915   1.00 18.84 ? 176 GLN C C   1 
ATOM   5465 O O   . GLN C 1 156 ? -20.584 10.154  6.940   1.00 18.84 ? 176 GLN C O   1 
ATOM   5466 C CB  . GLN C 1 156 ? -20.191 9.676   3.716   1.00 18.77 ? 176 GLN C CB  1 
ATOM   5467 C CG  . GLN C 1 156 ? -20.981 9.115   2.501   1.00 18.77 ? 176 GLN C CG  1 
ATOM   5468 C CD  . GLN C 1 156 ? -20.116 8.356   1.549   1.00 18.77 ? 176 GLN C CD  1 
ATOM   5469 O OE1 . GLN C 1 156 ? -19.400 8.869   0.720   1.00 18.77 ? 176 GLN C OE1 1 
ATOM   5470 N NE2 . GLN C 1 156 ? -20.116 7.037   1.648   1.00 18.77 ? 176 GLN C NE2 1 
ATOM   5471 N N   . ARG C 1 157 ? -19.529 11.848  5.962   1.00 19.15 ? 177 ARG C N   1 
ATOM   5472 C CA  . ARG C 1 157 ? -18.830 12.282  7.132   1.00 19.15 ? 177 ARG C CA  1 
ATOM   5473 C C   . ARG C 1 157 ? -19.809 12.807  8.182   1.00 19.15 ? 177 ARG C C   1 
ATOM   5474 O O   . ARG C 1 157 ? -19.667 12.441  9.357   1.00 19.15 ? 177 ARG C O   1 
ATOM   5475 C CB  . ARG C 1 157 ? -17.826 13.409  6.809   1.00 17.61 ? 177 ARG C CB  1 
ATOM   5476 C CG  . ARG C 1 157 ? -17.091 13.885  8.023   1.00 17.61 ? 177 ARG C CG  1 
ATOM   5477 C CD  . ARG C 1 157 ? -16.266 15.119  7.845   1.00 17.61 ? 177 ARG C CD  1 
ATOM   5478 N NE  . ARG C 1 157 ? -17.012 16.213  7.262   1.00 17.61 ? 177 ARG C NE  1 
ATOM   5479 C CZ  . ARG C 1 157 ? -17.832 17.020  7.933   1.00 17.61 ? 177 ARG C CZ  1 
ATOM   5480 N NH1 . ARG C 1 157 ? -17.935 16.872  9.231   1.00 17.61 ? 177 ARG C NH1 1 
ATOM   5481 N NH2 . ARG C 1 157 ? -18.524 18.010  7.326   1.00 17.61 ? 177 ARG C NH2 1 
ATOM   5482 N N   . ALA C 1 158 ? -20.766 13.641  7.789   1.00 19.92 ? 178 ALA C N   1 
ATOM   5483 C CA  . ALA C 1 158 ? -21.721 14.234  8.705   1.00 19.92 ? 178 ALA C CA  1 
ATOM   5484 C C   . ALA C 1 158 ? -22.616 13.168  9.317   1.00 19.92 ? 178 ALA C C   1 
ATOM   5485 O O   . ALA C 1 158 ? -22.806 13.141  10.533  1.00 19.92 ? 178 ALA C O   1 
ATOM   5486 C CB  . ALA C 1 158 ? -22.573 15.288  7.999   1.00 19.19 ? 178 ALA C CB  1 
ATOM   5487 N N   . VAL C 1 159 ? -23.162 12.298  8.482   1.00 22.15 ? 179 VAL C N   1 
ATOM   5488 C CA  . VAL C 1 159 ? -24.013 11.192  8.942   1.00 22.15 ? 179 VAL C CA  1 
ATOM   5489 C C   . VAL C 1 159 ? -23.202 10.249  9.830   1.00 22.15 ? 179 VAL C C   1 
ATOM   5490 O O   . VAL C 1 159 ? -23.608 9.823   10.937  1.00 22.15 ? 179 VAL C O   1 
ATOM   5491 C CB  . VAL C 1 159 ? -24.615 10.407  7.766   1.00 21.89 ? 179 VAL C CB  1 
ATOM   5492 C CG1 . VAL C 1 159 ? -25.282 9.108   8.227   1.00 21.89 ? 179 VAL C CG1 1 
ATOM   5493 C CG2 . VAL C 1 159 ? -25.693 11.224  7.079   1.00 21.89 ? 179 VAL C CG2 1 
ATOM   5494 N N   . GLY C 1 160 ? -21.995 9.895   9.390   1.00 24.01 ? 180 GLY C N   1 
ATOM   5495 C CA  . GLY C 1 160 ? -21.086 9.053   10.122  1.00 24.01 ? 180 GLY C CA  1 
ATOM   5496 C C   . GLY C 1 160 ? -20.840 9.633   11.502  1.00 24.01 ? 180 GLY C C   1 
ATOM   5497 O O   . GLY C 1 160 ? -20.901 8.901   12.464  1.00 24.01 ? 180 GLY C O   1 
ATOM   5498 N N   . GLU C 1 161 ? -20.582 10.934  11.605  1.00 27.09 ? 181 GLU C N   1 
ATOM   5499 C CA  . GLU C 1 161 ? -20.373 11.545  12.903  1.00 27.09 ? 181 GLU C CA  1 
ATOM   5500 C C   . GLU C 1 161 ? -21.643 11.503  13.734  1.00 27.09 ? 181 GLU C C   1 
ATOM   5501 O O   . GLU C 1 161 ? -21.571 11.171  14.916  1.00 27.09 ? 181 GLU C O   1 
ATOM   5502 C CB  . GLU C 1 161 ? -19.922 13.008  12.797  1.00 34.51 ? 181 GLU C CB  1 
ATOM   5503 C CG  . GLU C 1 161 ? -18.425 13.052  12.503  1.00 34.51 ? 181 GLU C CG  1 
ATOM   5504 C CD  . GLU C 1 161 ? -17.868 14.436  12.393  1.00 34.51 ? 181 GLU C CD  1 
ATOM   5505 O OE1 . GLU C 1 161 ? -18.421 15.347  13.108  1.00 34.51 ? 181 GLU C OE1 1 
ATOM   5506 O OE2 . GLU C 1 161 ? -16.893 14.665  11.583  1.00 34.51 ? 181 GLU C OE2 1 
ATOM   5507 N N   . ALA C 1 162 ? -22.771 11.739  13.142  1.00 26.60 ? 182 ALA C N   1 
ATOM   5508 C CA  . ALA C 1 162 ? -24.043 11.684  13.846  1.00 26.60 ? 182 ALA C CA  1 
ATOM   5509 C C   . ALA C 1 162 ? -24.317 10.297  14.408  1.00 26.60 ? 182 ALA C C   1 
ATOM   5510 O O   . ALA C 1 162 ? -24.996 10.221  15.451  1.00 26.60 ? 182 ALA C O   1 
ATOM   5511 C CB  . ALA C 1 162 ? -25.202 12.022  12.907  1.00 25.65 ? 182 ALA C CB  1 
ATOM   5512 N N   . PHE C 1 163 ? -23.916 9.209   13.782  1.00 27.25 ? 183 PHE C N   1 
ATOM   5513 C CA  . PHE C 1 163 ? -24.195 7.872   14.272  1.00 27.25 ? 183 PHE C CA  1 
ATOM   5514 C C   . PHE C 1 163 ? -22.973 7.088   14.695  1.00 27.25 ? 183 PHE C C   1 
ATOM   5515 O O   . PHE C 1 163 ? -23.012 5.876   14.860  1.00 27.25 ? 183 PHE C O   1 
ATOM   5516 C CB  . PHE C 1 163 ? -24.857 7.034   13.153  1.00 29.83 ? 183 PHE C CB  1 
ATOM   5517 C CG  . PHE C 1 163 ? -26.247 7.518   12.832  1.00 29.83 ? 183 PHE C CG  1 
ATOM   5518 C CD1 . PHE C 1 163 ? -26.450 8.503   11.867  1.00 29.83 ? 183 PHE C CD1 1 
ATOM   5519 C CD2 . PHE C 1 163 ? -27.337 6.977   13.500  1.00 29.83 ? 183 PHE C CD2 1 
ATOM   5520 C CE1 . PHE C 1 163 ? -27.738 8.943   11.579  1.00 29.83 ? 183 PHE C CE1 1 
ATOM   5521 C CE2 . PHE C 1 163 ? -28.621 7.415   13.216  1.00 29.83 ? 183 PHE C CE2 1 
ATOM   5522 C CZ  . PHE C 1 163 ? -28.812 8.400   12.255  1.00 29.83 ? 183 PHE C CZ  1 
ATOM   5523 N N   . ASP C 1 164 ? -21.852 7.760   14.870  1.00 29.16 ? 184 ASP C N   1 
ATOM   5524 C CA  . ASP C 1 164 ? -20.573 7.168   15.266  1.00 29.16 ? 184 ASP C CA  1 
ATOM   5525 C C   . ASP C 1 164 ? -20.239 5.962   14.432  1.00 29.16 ? 184 ASP C C   1 
ATOM   5526 O O   . ASP C 1 164 ? -19.917 4.891   14.936  1.00 29.16 ? 184 ASP C O   1 
ATOM   5527 C CB  . ASP C 1 164 ? -20.704 6.876   16.764  1.00 37.03 ? 184 ASP C CB  1 
ATOM   5528 C CG  . ASP C 1 164 ? -19.359 6.974   17.427  1.00 37.03 ? 184 ASP C CG  1 
ATOM   5529 O OD1 . ASP C 1 164 ? -18.342 7.319   16.772  1.00 37.03 ? 184 ASP C OD1 1 
ATOM   5530 O OD2 . ASP C 1 164 ? -19.311 6.686   18.639  1.00 37.03 ? 184 ASP C OD2 1 
ATOM   5531 N N   . LEU C 1 165 ? -20.306 6.110   13.100  1.00 24.73 ? 185 LEU C N   1 
ATOM   5532 C CA  . LEU C 1 165 ? -20.119 5.181   12.058  1.00 24.73 ? 185 LEU C CA  1 
ATOM   5533 C C   . LEU C 1 165 ? -18.988 5.581   11.072  1.00 24.73 ? 185 LEU C C   1 
ATOM   5534 O O   . LEU C 1 165 ? -18.659 6.750   10.894  1.00 24.73 ? 185 LEU C O   1 
ATOM   5535 C CB  . LEU C 1 165 ? -21.330 5.178   11.184  1.00 26.18 ? 185 LEU C CB  1 
ATOM   5536 C CG  . LEU C 1 165 ? -22.555 4.348   11.231  1.00 26.18 ? 185 LEU C CG  1 
ATOM   5537 C CD1 . LEU C 1 165 ? -23.334 4.491   9.906   1.00 26.18 ? 185 LEU C CD1 1 
ATOM   5538 C CD2 . LEU C 1 165 ? -22.227 2.881   11.441  1.00 26.18 ? 185 LEU C CD2 1 
ATOM   5539 N N   . ASP C 1 166 ? -18.443 4.555   10.456  1.00 20.72 ? 186 ASP C N   1 
ATOM   5540 C CA  . ASP C 1 166 ? -17.403 4.707   9.439   1.00 20.72 ? 186 ASP C CA  1 
ATOM   5541 C C   . ASP C 1 166 ? -18.146 5.318   8.259   1.00 20.72 ? 186 ASP C C   1 
ATOM   5542 O O   . ASP C 1 166 ? -19.196 4.802   7.826   1.00 20.72 ? 186 ASP C O   1 
ATOM   5543 C CB  . ASP C 1 166 ? -16.859 3.345   9.091   1.00 20.17 ? 186 ASP C CB  1 
ATOM   5544 C CG  . ASP C 1 166 ? -15.885 3.164   8.008   1.00 20.17 ? 186 ASP C CG  1 
ATOM   5545 O OD1 . ASP C 1 166 ? -15.598 4.122   7.221   1.00 20.17 ? 186 ASP C OD1 1 
ATOM   5546 O OD2 . ASP C 1 166 ? -15.299 2.039   7.805   1.00 20.17 ? 186 ASP C OD2 1 
ATOM   5547 N N   . PRO C 1 167 ? -17.650 6.359   7.620   1.00 18.95 ? 187 PRO C N   1 
ATOM   5548 C CA  . PRO C 1 167 ? -18.289 7.035   6.490   1.00 18.95 ? 187 PRO C CA  1 
ATOM   5549 C C   . PRO C 1 167 ? -18.476 6.124   5.329   1.00 18.95 ? 187 PRO C C   1 
ATOM   5550 O O   . PRO C 1 167 ? -19.465 6.207   4.575   1.00 18.95 ? 187 PRO C O   1 
ATOM   5551 C CB  . PRO C 1 167 ? -17.435 8.235   6.186   1.00 18.66 ? 187 PRO C CB  1 
ATOM   5552 C CG  . PRO C 1 167 ? -16.218 8.097   6.991   1.00 18.66 ? 187 PRO C CG  1 
ATOM   5553 C CD  . PRO C 1 167 ? -16.404 7.010   8.032   1.00 18.66 ? 187 PRO C CD  1 
ATOM   5554 N N   . ARG C 1 168 ? -17.560 5.182   5.181   1.00 19.56 ? 188 ARG C N   1 
ATOM   5555 C CA  . ARG C 1 168 ? -17.701 4.208   4.116   1.00 19.56 ? 188 ARG C CA  1 
ATOM   5556 C C   . ARG C 1 168 ? -18.939 3.360   4.371   1.00 19.56 ? 188 ARG C C   1 
ATOM   5557 O O   . ARG C 1 168 ? -19.460 2.780   3.409   1.00 19.56 ? 188 ARG C O   1 
ATOM   5558 C CB  . ARG C 1 168 ? -16.421 3.370   4.039   1.00 22.10 ? 188 ARG C CB  1 
ATOM   5559 C CG  . ARG C 1 168 ? -15.174 4.199   3.837   1.00 22.10 ? 188 ARG C CG  1 
ATOM   5560 C CD  . ARG C 1 168 ? -13.858 3.439   3.780   1.00 22.10 ? 188 ARG C CD  1 
ATOM   5561 N NE  . ARG C 1 168 ? -13.578 2.840   5.052   1.00 22.10 ? 188 ARG C NE  1 
ATOM   5562 C CZ  . ARG C 1 168 ? -12.772 1.896   5.517   1.00 22.10 ? 188 ARG C CZ  1 
ATOM   5563 N NH1 . ARG C 1 168 ? -11.900 1.325   4.682   1.00 22.10 ? 188 ARG C NH1 1 
ATOM   5564 N NH2 . ARG C 1 168 ? -12.767 1.461   6.792   1.00 22.10 ? 188 ARG C NH2 1 
ATOM   5565 N N   . SER C 1 169 ? -19.448 3.227   5.596   1.00 20.76 ? 189 SER C N   1 
ATOM   5566 C CA  . SER C 1 169 ? -20.599 2.384   5.864   1.00 20.76 ? 189 SER C CA  1 
ATOM   5567 C C   . SER C 1 169 ? -21.934 3.064   5.702   1.00 20.76 ? 189 SER C C   1 
ATOM   5568 O O   . SER C 1 169 ? -22.990 2.461   5.927   1.00 20.76 ? 189 SER C O   1 
ATOM   5569 C CB  . SER C 1 169 ? -20.532 1.815   7.307   1.00 20.86 ? 189 SER C CB  1 
ATOM   5570 O OG  . SER C 1 169 ? -19.311 1.081   7.471   1.00 20.86 ? 189 SER C OG  1 
ATOM   5571 N N   . VAL C 1 170 ? -21.942 4.335   5.309   1.00 23.18 ? 190 VAL C N   1 
ATOM   5572 C CA  . VAL C 1 170 ? -23.108 5.133   5.014   1.00 23.18 ? 190 VAL C CA  1 
ATOM   5573 C C   . VAL C 1 170 ? -23.377 5.100   3.510   1.00 23.18 ? 190 VAL C C   1 
ATOM   5574 O O   . VAL C 1 170 ? -22.474 5.449   2.705   1.00 23.18 ? 190 VAL C O   1 
ATOM   5575 C CB  . VAL C 1 170 ? -22.882 6.592   5.408   1.00 21.35 ? 190 VAL C CB  1 
ATOM   5576 C CG1 . VAL C 1 170 ? -24.147 7.390   5.134   1.00 21.35 ? 190 VAL C CG1 1 
ATOM   5577 C CG2 . VAL C 1 170 ? -22.488 6.672   6.870   1.00 21.35 ? 190 VAL C CG2 1 
ATOM   5578 N N   . SER C 1 171 ? -24.557 4.637   3.085   1.00 24.34 ? 191 SER C N   1 
ATOM   5579 C CA  . SER C 1 171 ? -24.800 4.594   1.647   1.00 24.34 ? 191 SER C CA  1 
ATOM   5580 C C   . SER C 1 171 ? -25.639 5.772   1.211   1.00 24.34 ? 191 SER C C   1 
ATOM   5581 O O   . SER C 1 171 ? -26.144 6.519   2.049   1.00 24.34 ? 191 SER C O   1 
ATOM   5582 C CB  . SER C 1 171 ? -25.475 3.264   1.300   1.00 26.70 ? 191 SER C CB  1 
ATOM   5583 O OG  . SER C 1 171 ? -26.867 3.460   1.604   1.00 26.70 ? 191 SER C OG  1 
ATOM   5584 N N   . GLY C 1 172 ? -25.776 5.984   -0.087  1.00 25.00 ? 192 GLY C N   1 
ATOM   5585 C CA  . GLY C 1 172 ? -26.561 7.146   -0.538  1.00 25.00 ? 192 GLY C CA  1 
ATOM   5586 C C   . GLY C 1 172 ? -25.684 8.153   -1.230  1.00 25.00 ? 192 GLY C C   1 
ATOM   5587 O O   . GLY C 1 172 ? -24.463 8.033   -1.186  1.00 25.00 ? 192 GLY C O   1 
ATOM   5588 N N   . TYR C 1 173 ? -26.336 9.094   -1.942  1.00 24.72 ? 193 TYR C N   1 
ATOM   5589 C CA  . TYR C 1 173 ? -25.631 10.056  -2.725  1.00 24.72 ? 193 TYR C CA  1 
ATOM   5590 C C   . TYR C 1 173 ? -26.234 11.471  -2.705  1.00 24.72 ? 193 TYR C C   1 
ATOM   5591 O O   . TYR C 1 173 ? -27.379 11.651  -2.344  1.00 24.72 ? 193 TYR C O   1 
ATOM   5592 C CB  . TYR C 1 173 ? -25.664 9.707   -4.220  1.00 23.98 ? 193 TYR C CB  1 
ATOM   5593 C CG  . TYR C 1 173 ? -25.668 8.271   -4.614  1.00 23.98 ? 193 TYR C CG  1 
ATOM   5594 C CD1 . TYR C 1 173 ? -26.902 7.629   -4.714  1.00 23.98 ? 193 TYR C CD1 1 
ATOM   5595 C CD2 . TYR C 1 173 ? -24.519 7.531   -4.813  1.00 23.98 ? 193 TYR C CD2 1 
ATOM   5596 C CE1 . TYR C 1 173 ? -26.995 6.283   -5.018  1.00 23.98 ? 193 TYR C CE1 1 
ATOM   5597 C CE2 . TYR C 1 173 ? -24.592 6.185   -5.159  1.00 23.98 ? 193 TYR C CE2 1 
ATOM   5598 C CZ  . TYR C 1 173 ? -25.823 5.597   -5.236  1.00 23.98 ? 193 TYR C CZ  1 
ATOM   5599 O OH  . TYR C 1 173 ? -25.923 4.244   -5.571  1.00 23.98 ? 193 TYR C OH  1 
ATOM   5600 N N   . ASN C 1 174 ? -25.380 12.398  -3.126  1.00 25.94 ? 194 ASN C N   1 
ATOM   5601 C CA  . ASN C 1 174 ? -25.680 13.802  -3.333  1.00 25.94 ? 194 ASN C CA  1 
ATOM   5602 C C   . ASN C 1 174 ? -25.814 13.901  -4.877  1.00 25.94 ? 194 ASN C C   1 
ATOM   5603 O O   . ASN C 1 174 ? -24.921 13.365  -5.537  1.00 25.94 ? 194 ASN C O   1 
ATOM   5604 C CB  . ASN C 1 174 ? -24.624 14.785  -2.983  1.00 27.81 ? 194 ASN C CB  1 
ATOM   5605 C CG  . ASN C 1 174 ? -24.703 15.069  -1.506  1.00 27.81 ? 194 ASN C CG  1 
ATOM   5606 O OD1 . ASN C 1 174 ? -24.747 13.985  -0.761  1.00 27.81 ? 194 ASN C OD1 1 
ATOM   5607 N ND2 . ASN C 1 174 ? -24.757 16.229  -1.115  1.00 27.81 ? 194 ASN C ND2 1 
ATOM   5608 N N   . LEU C 1 175 ? -26.896 14.485  -5.323  1.00 26.67 ? 195 LEU C N   1 
ATOM   5609 C CA  . LEU C 1 175 ? -27.011 14.524  -6.805  1.00 26.67 ? 195 LEU C CA  1 
ATOM   5610 C C   . LEU C 1 175 ? -27.095 15.934  -7.338  1.00 26.67 ? 195 LEU C C   1 
ATOM   5611 O O   . LEU C 1 175 ? -27.167 16.909  -6.578  1.00 26.67 ? 195 LEU C O   1 
ATOM   5612 C CB  . LEU C 1 175 ? -28.239 13.710  -7.154  1.00 24.49 ? 195 LEU C CB  1 
ATOM   5613 C CG  . LEU C 1 175 ? -28.389 12.282  -6.728  1.00 24.49 ? 195 LEU C CG  1 
ATOM   5614 C CD1 . LEU C 1 175 ? -29.769 11.766  -7.112  1.00 24.49 ? 195 LEU C CD1 1 
ATOM   5615 C CD2 . LEU C 1 175 ? -27.346 11.376  -7.380  1.00 24.49 ? 195 LEU C CD2 1 
ATOM   5616 N N   . GLY C 1 176 ? -27.045 16.076  -8.682  1.00 30.44 ? 196 GLY C N   1 
ATOM   5617 C CA  . GLY C 1 176 ? -27.152 17.319  -9.337  1.00 30.44 ? 196 GLY C CA  1 
ATOM   5618 C C   . GLY C 1 176 ? -25.940 18.178  -9.637  1.00 30.44 ? 196 GLY C C   1 
ATOM   5619 O O   . GLY C 1 176 ? -24.903 17.716  -10.059 1.00 30.44 ? 196 GLY C O   1 
ATOM   5620 N N   . GLU C 1 177 ? -26.084 19.476  -9.404  1.00 35.20 ? 197 GLU C N   1 
ATOM   5621 C CA  . GLU C 1 177 ? -25.066 20.448  -9.682  1.00 35.20 ? 197 GLU C CA  1 
ATOM   5622 C C   . GLU C 1 177 ? -24.123 20.714  -8.546  1.00 35.20 ? 197 GLU C C   1 
ATOM   5623 O O   . GLU C 1 177 ? -24.541 21.300  -7.557  1.00 35.20 ? 197 GLU C O   1 
ATOM   5624 C CB  . GLU C 1 177 ? -25.831 21.730  -10.033 1.00 41.68 ? 197 GLU C CB  1 
ATOM   5625 C CG  . GLU C 1 177 ? -24.882 22.868  -10.426 1.00 41.68 ? 197 GLU C CG  1 
ATOM   5626 C CD  . GLU C 1 177 ? -25.642 24.189  -10.315 1.00 41.68 ? 197 GLU C CD  1 
ATOM   5627 O OE1 . GLU C 1 177 ? -26.341 24.352  -9.281  1.00 41.68 ? 197 GLU C OE1 1 
ATOM   5628 O OE2 . GLU C 1 177 ? -25.566 25.027  -11.237 1.00 41.68 ? 197 GLU C OE2 1 
ATOM   5629 N N   . HIS C 1 178 ? -22.884 20.320  -8.669  1.00 41.14 ? 198 HIS C N   1 
ATOM   5630 C CA  . HIS C 1 178 ? -21.901 20.573  -7.620  1.00 41.14 ? 198 HIS C CA  1 
ATOM   5631 C C   . HIS C 1 178 ? -21.625 22.068  -7.533  1.00 41.14 ? 198 HIS C C   1 
ATOM   5632 O O   . HIS C 1 178 ? -21.496 22.709  -8.597  1.00 41.14 ? 198 HIS C O   1 
ATOM   5633 C CB  . HIS C 1 178 ? -20.583 19.872  -7.912  1.00 41.01 ? 198 HIS C CB  1 
ATOM   5634 C CG  . HIS C 1 178 ? -19.430 20.335  -7.070  1.00 41.01 ? 198 HIS C CG  1 
ATOM   5635 N ND1 . HIS C 1 178 ? -19.332 20.012  -5.740  1.00 41.01 ? 198 HIS C ND1 1 
ATOM   5636 C CD2 . HIS C 1 178 ? -18.357 21.093  -7.385  1.00 41.01 ? 198 HIS C CD2 1 
ATOM   5637 C CE1 . HIS C 1 178 ? -18.240 20.535  -5.221  1.00 41.01 ? 198 HIS C CE1 1 
ATOM   5638 N NE2 . HIS C 1 178 ? -17.628 21.199  -6.211  1.00 41.01 ? 198 HIS C NE2 1 
ATOM   5639 N N   . GLY C 1 179 ? -21.519 22.595  -6.319  1.00 45.50 ? 199 GLY C N   1 
ATOM   5640 C CA  . GLY C 1 179 ? -21.231 24.021  -6.172  1.00 45.50 ? 199 GLY C CA  1 
ATOM   5641 C C   . GLY C 1 179 ? -22.469 24.864  -5.980  1.00 45.50 ? 199 GLY C C   1 
ATOM   5642 O O   . GLY C 1 179 ? -22.354 26.009  -5.532  1.00 45.50 ? 199 GLY C O   1 
ATOM   5643 N N   . ASN C 1 180 ? -23.658 24.350  -6.294  1.00 46.03 ? 200 ASN C N   1 
ATOM   5644 C CA  . ASN C 1 180 ? -24.853 25.185  -6.085  1.00 46.03 ? 200 ASN C CA  1 
ATOM   5645 C C   . ASN C 1 180 ? -26.060 24.324  -5.817  1.00 46.03 ? 200 ASN C C   1 
ATOM   5646 O O   . ASN C 1 180 ? -26.132 23.794  -4.676  1.00 46.03 ? 200 ASN C O   1 
ATOM   5647 C CB  . ASN C 1 180 ? -25.075 26.129  -7.274  1.00 50.73 ? 200 ASN C CB  1 
ATOM   5648 C CG  . ASN C 1 180 ? -26.000 27.280  -6.914  1.00 50.73 ? 200 ASN C CG  1 
ATOM   5649 O OD1 . ASN C 1 180 ? -27.086 27.449  -7.524  1.00 50.73 ? 200 ASN C OD1 1 
ATOM   5650 N ND2 . ASN C 1 180 ? -25.602 28.095  -5.939  1.00 50.73 ? 200 ASN C ND2 1 
ATOM   5651 N N   . SER C 1 181 ? -26.927 24.072  -6.773  1.00 40.95 ? 201 SER C N   1 
ATOM   5652 C CA  . SER C 1 181 ? -28.122 23.276  -6.539  1.00 40.95 ? 201 SER C CA  1 
ATOM   5653 C C   . SER C 1 181 ? -27.958 21.801  -6.274  1.00 40.95 ? 201 SER C C   1 
ATOM   5654 O O   . SER C 1 181 ? -28.995 21.080  -6.363  1.00 40.95 ? 201 SER C O   1 
ATOM   5655 C CB  . SER C 1 181 ? -29.049 23.474  -7.786  1.00 40.80 ? 201 SER C CB  1 
ATOM   5656 O OG  . SER C 1 181 ? -28.539 22.787  -8.911  1.00 40.80 ? 201 SER C OG  1 
ATOM   5657 N N   . GLN C 1 182 ? -26.832 21.226  -5.897  1.00 36.18 ? 202 GLN C N   1 
ATOM   5658 C CA  . GLN C 1 182 ? -26.784 19.771  -5.631  1.00 36.18 ? 202 GLN C CA  1 
ATOM   5659 C C   . GLN C 1 182 ? -27.522 19.541  -4.312  1.00 36.18 ? 202 GLN C C   1 
ATOM   5660 O O   . GLN C 1 182 ? -27.587 20.433  -3.464  1.00 36.18 ? 202 GLN C O   1 
ATOM   5661 C CB  . GLN C 1 182 ? -25.431 19.149  -5.629  1.00 38.69 ? 202 GLN C CB  1 
ATOM   5662 C CG  . GLN C 1 182 ? -24.337 19.744  -4.803  1.00 38.69 ? 202 GLN C CG  1 
ATOM   5663 C CD  . GLN C 1 182 ? -24.633 19.449  -3.343  1.00 38.69 ? 202 GLN C CD  1 
ATOM   5664 O OE1 . GLN C 1 182 ? -24.841 18.176  -3.011  1.00 38.69 ? 202 GLN C OE1 1 
ATOM   5665 N NE2 . GLN C 1 182 ? -24.716 20.398  -2.582  1.00 38.69 ? 202 GLN C NE2 1 
ATOM   5666 N N   . PHE C 1 183 ? -28.064 18.341  -4.140  1.00 27.41 ? 203 PHE C N   1 
ATOM   5667 C CA  . PHE C 1 183 ? -28.830 18.009  -2.947  1.00 27.41 ? 203 PHE C CA  1 
ATOM   5668 C C   . PHE C 1 183 ? -28.572 16.580  -2.521  1.00 27.41 ? 203 PHE C C   1 
ATOM   5669 O O   . PHE C 1 183 ? -28.202 15.703  -3.320  1.00 27.41 ? 203 PHE C O   1 
ATOM   5670 C CB  . PHE C 1 183 ? -30.320 18.181  -3.263  1.00 22.97 ? 203 PHE C CB  1 
ATOM   5671 C CG  . PHE C 1 183 ? -30.796 17.281  -4.367  1.00 22.97 ? 203 PHE C CG  1 
ATOM   5672 C CD1 . PHE C 1 183 ? -30.480 17.517  -5.689  1.00 22.97 ? 203 PHE C CD1 1 
ATOM   5673 C CD2 . PHE C 1 183 ? -31.572 16.169  -4.075  1.00 22.97 ? 203 PHE C CD2 1 
ATOM   5674 C CE1 . PHE C 1 183 ? -30.907 16.673  -6.691  1.00 22.97 ? 203 PHE C CE1 1 
ATOM   5675 C CE2 . PHE C 1 183 ? -31.990 15.315  -5.074  1.00 22.97 ? 203 PHE C CE2 1 
ATOM   5676 C CZ  . PHE C 1 183 ? -31.677 15.552  -6.393  1.00 22.97 ? 203 PHE C CZ  1 
ATOM   5677 N N   . VAL C 1 184 ? -28.792 16.350  -1.201  1.00 23.55 ? 204 VAL C N   1 
ATOM   5678 C CA  . VAL C 1 184 ? -28.668 14.991  -0.700  1.00 23.55 ? 204 VAL C CA  1 
ATOM   5679 C C   . VAL C 1 184 ? -29.939 14.233  -1.100  1.00 23.55 ? 204 VAL C C   1 
ATOM   5680 O O   . VAL C 1 184 ? -31.035 14.735  -0.780  1.00 23.55 ? 204 VAL C O   1 
ATOM   5681 C CB  . VAL C 1 184 ? -28.576 14.859  0.828   1.00 22.37 ? 204 VAL C CB  1 
ATOM   5682 C CG1 . VAL C 1 184 ? -28.338 13.362  1.202   1.00 22.37 ? 204 VAL C CG1 1 
ATOM   5683 C CG2 . VAL C 1 184 ? -27.461 15.638  1.469   1.00 22.37 ? 204 VAL C CG2 1 
ATOM   5684 N N   . ALA C 1 185 ? -29.841 13.133  -1.806  1.00 22.51 ? 205 ALA C N   1 
ATOM   5685 C CA  . ALA C 1 185 ? -31.018 12.336  -2.136  1.00 22.51 ? 205 ALA C CA  1 
ATOM   5686 C C   . ALA C 1 185 ? -31.219 11.427  -0.919  1.00 22.51 ? 205 ALA C C   1 
ATOM   5687 O O   . ALA C 1 185 ? -30.855 10.239  -0.965  1.00 22.51 ? 205 ALA C O   1 
ATOM   5688 C CB  . ALA C 1 185 ? -30.756 11.520  -3.386  1.00 21.04 ? 205 ALA C CB  1 
ATOM   5689 N N   . TRP C 1 186 ? -31.812 11.880  0.166   1.00 25.74 ? 206 TRP C N   1 
ATOM   5690 C CA  . TRP C 1 186 ? -32.038 11.203  1.433   1.00 25.74 ? 206 TRP C CA  1 
ATOM   5691 C C   . TRP C 1 186 ? -32.790 9.907   1.285   1.00 25.74 ? 206 TRP C C   1 
ATOM   5692 O O   . TRP C 1 186 ? -32.636 8.998   2.139   1.00 25.74 ? 206 TRP C O   1 
ATOM   5693 C CB  . TRP C 1 186 ? -32.795 12.067  2.427   1.00 24.88 ? 206 TRP C CB  1 
ATOM   5694 C CG  . TRP C 1 186 ? -32.004 13.192  3.009   1.00 24.88 ? 206 TRP C CG  1 
ATOM   5695 C CD1 . TRP C 1 186 ? -32.299 14.528  2.894   1.00 24.88 ? 206 TRP C CD1 1 
ATOM   5696 C CD2 . TRP C 1 186 ? -30.818 13.109  3.788   1.00 24.88 ? 206 TRP C CD2 1 
ATOM   5697 N NE1 . TRP C 1 186 ? -31.364 15.282  3.555   1.00 24.88 ? 206 TRP C NE1 1 
ATOM   5698 C CE2 . TRP C 1 186 ? -30.443 14.432  4.121   1.00 24.88 ? 206 TRP C CE2 1 
ATOM   5699 C CE3 . TRP C 1 186 ? -30.031 12.040  4.247   1.00 24.88 ? 206 TRP C CE3 1 
ATOM   5700 C CZ2 . TRP C 1 186 ? -29.319 14.721  4.883   1.00 24.88 ? 206 TRP C CZ2 1 
ATOM   5701 C CZ3 . TRP C 1 186 ? -28.913 12.361  5.007   1.00 24.88 ? 206 TRP C CZ3 1 
ATOM   5702 C CH2 . TRP C 1 186 ? -28.557 13.679  5.317   1.00 24.88 ? 206 TRP C CH2 1 
ATOM   5703 N N   . SER C 1 187 ? -33.512 9.688   0.211   1.00 27.99 ? 207 SER C N   1 
ATOM   5704 C CA  . SER C 1 187 ? -34.199 8.434   -0.035  1.00 27.99 ? 207 SER C CA  1 
ATOM   5705 C C   . SER C 1 187 ? -33.195 7.364   -0.393  1.00 27.99 ? 207 SER C C   1 
ATOM   5706 O O   . SER C 1 187 ? -33.588 6.177   -0.498  1.00 27.99 ? 207 SER C O   1 
ATOM   5707 C CB  . SER C 1 187 ? -35.233 8.595   -1.152  1.00 27.81 ? 207 SER C CB  1 
ATOM   5708 O OG  . SER C 1 187 ? -34.698 8.338   -2.436  1.00 27.81 ? 207 SER C OG  1 
ATOM   5709 N N   . THR C 1 188 ? -31.927 7.631   -0.618  1.00 28.90 ? 208 THR C N   1 
ATOM   5710 C CA  . THR C 1 188 ? -30.933 6.626   -0.978  1.00 28.90 ? 208 THR C CA  1 
ATOM   5711 C C   . THR C 1 188 ? -30.003 6.336   0.192   1.00 28.90 ? 208 THR C C   1 
ATOM   5712 O O   . THR C 1 188 ? -29.216 5.399   0.139   1.00 28.90 ? 208 THR C O   1 
ATOM   5713 C CB  . THR C 1 188 ? -30.107 7.106   -2.186  1.00 29.41 ? 208 THR C CB  1 
ATOM   5714 O OG1 . THR C 1 188 ? -29.472 8.381   -1.900  1.00 29.41 ? 208 THR C OG1 1 
ATOM   5715 C CG2 . THR C 1 188 ? -30.960 7.309   -3.443  1.00 29.41 ? 208 THR C CG2 1 
ATOM   5716 N N   . VAL C 1 189 ? -30.037 7.154   1.231   1.00 30.92 ? 209 VAL C N   1 
ATOM   5717 C CA  . VAL C 1 189 ? -29.148 7.025   2.371   1.00 30.92 ? 209 VAL C CA  1 
ATOM   5718 C C   . VAL C 1 189 ? -29.610 5.988   3.389   1.00 30.92 ? 209 VAL C C   1 
ATOM   5719 O O   . VAL C 1 189 ? -30.690 6.024   3.973   1.00 30.92 ? 209 VAL C O   1 
ATOM   5720 C CB  . VAL C 1 189 ? -29.003 8.392   3.090   1.00 28.49 ? 209 VAL C CB  1 
ATOM   5721 C CG1 . VAL C 1 189 ? -28.018 8.312   4.227   1.00 28.49 ? 209 VAL C CG1 1 
ATOM   5722 C CG2 . VAL C 1 189 ? -28.556 9.455   2.089   1.00 28.49 ? 209 VAL C CG2 1 
ATOM   5723 N N   . ARG C 1 190 ? -28.759 4.990   3.650   1.00 33.41 ? 210 ARG C N   1 
ATOM   5724 C CA  . ARG C 1 190 ? -29.030 3.956   4.629   1.00 33.41 ? 210 ARG C CA  1 
ATOM   5725 C C   . ARG C 1 190 ? -27.896 3.916   5.657   1.00 33.41 ? 210 ARG C C   1 
ATOM   5726 O O   . ARG C 1 190 ? -26.730 4.106   5.316   1.00 33.41 ? 210 ARG C O   1 
ATOM   5727 C CB  . ARG C 1 190 ? -29.119 2.587   3.978   1.00 41.70 ? 210 ARG C CB  1 
ATOM   5728 C CG  . ARG C 1 190 ? -30.370 2.489   3.099   1.00 41.70 ? 210 ARG C CG  1 
ATOM   5729 C CD  . ARG C 1 190 ? -30.295 1.195   2.286   1.00 41.70 ? 210 ARG C CD  1 
ATOM   5730 N NE  . ARG C 1 190 ? -30.770 0.116   3.189   1.00 41.70 ? 210 ARG C NE  1 
ATOM   5731 C CZ  . ARG C 1 190 ? -32.027 -0.330  3.233   1.00 41.70 ? 210 ARG C CZ  1 
ATOM   5732 N NH1 . ARG C 1 190 ? -32.932 0.165   2.375   1.00 41.70 ? 210 ARG C NH1 1 
ATOM   5733 N NH2 . ARG C 1 190 ? -32.402 -1.278  4.096   1.00 41.70 ? 210 ARG C NH2 1 
ATOM   5734 N N   . VAL C 1 191 ? -28.274 3.717   6.921   1.00 33.01 ? 211 VAL C N   1 
ATOM   5735 C CA  . VAL C 1 191 ? -27.325 3.632   8.011   1.00 33.01 ? 211 VAL C CA  1 
ATOM   5736 C C   . VAL C 1 191 ? -27.751 2.448   8.939   1.00 33.01 ? 211 VAL C C   1 
ATOM   5737 O O   . VAL C 1 191 ? -28.906 2.330   9.344   1.00 33.01 ? 211 VAL C O   1 
ATOM   5738 C CB  . VAL C 1 191 ? -27.117 4.772   8.997   1.00 34.45 ? 211 VAL C CB  1 
ATOM   5739 C CG1 . VAL C 1 191 ? -26.096 5.725   8.421   1.00 34.45 ? 211 VAL C CG1 1 
ATOM   5740 C CG2 . VAL C 1 191 ? -28.388 5.507   9.321   1.00 34.45 ? 211 VAL C CG2 1 
ATOM   5741 N N   . MET C 1 192 ? -26.781 1.576   9.210   1.00 31.01 ? 212 MET C N   1 
ATOM   5742 C CA  . MET C 1 192 ? -27.060 0.436   10.086  1.00 31.01 ? 212 MET C CA  1 
ATOM   5743 C C   . MET C 1 192 ? -28.260 -0.390  9.718   1.00 31.01 ? 212 MET C C   1 
ATOM   5744 O O   . MET C 1 192 ? -29.109 -0.755  10.525  1.00 31.01 ? 212 MET C O   1 
ATOM   5745 C CB  . MET C 1 192 ? -27.268 1.031   11.500  1.00 33.94 ? 212 MET C CB  1 
ATOM   5746 C CG  . MET C 1 192 ? -25.908 1.430   12.087  1.00 33.94 ? 212 MET C CG  1 
ATOM   5747 S SD  . MET C 1 192 ? -26.138 2.281   13.620  1.00 33.94 ? 212 MET C SD  1 
ATOM   5748 C CE  . MET C 1 192 ? -24.645 1.975   14.525  1.00 33.94 ? 212 MET C CE  1 
ATOM   5749 N N   . GLY C 1 193 ? -28.424 -0.712  8.454   1.00 31.06 ? 213 GLY C N   1 
ATOM   5750 C CA  . GLY C 1 193 ? -29.480 -1.465  7.889   1.00 31.06 ? 213 GLY C CA  1 
ATOM   5751 C C   . GLY C 1 193 ? -30.788 -0.750  7.644   1.00 31.06 ? 213 GLY C C   1 
ATOM   5752 O O   . GLY C 1 193 ? -31.623 -1.300  6.906   1.00 31.06 ? 213 GLY C O   1 
ATOM   5753 N N   . GLN C 1 194 ? -31.011 0.427   8.199   1.00 33.49 ? 214 GLN C N   1 
ATOM   5754 C CA  . GLN C 1 194 ? -32.244 1.135   8.044   1.00 33.49 ? 214 GLN C CA  1 
ATOM   5755 C C   . GLN C 1 194 ? -32.145 2.378   7.172   1.00 33.49 ? 214 GLN C C   1 
ATOM   5756 O O   . GLN C 1 194 ? -31.172 3.162   7.166   1.00 33.49 ? 214 GLN C O   1 
ATOM   5757 C CB  . GLN C 1 194 ? -32.709 1.700   9.405   1.00 34.45 ? 214 GLN C CB  1 
ATOM   5758 C CG  . GLN C 1 194 ? -33.169 0.692   10.437  1.00 34.45 ? 214 GLN C CG  1 
ATOM   5759 C CD  . GLN C 1 194 ? -34.422 -0.023  9.976   1.00 34.45 ? 214 GLN C CD  1 
ATOM   5760 O OE1 . GLN C 1 194 ? -35.517 0.534   10.104  1.00 34.45 ? 214 GLN C OE1 1 
ATOM   5761 N NE2 . GLN C 1 194 ? -34.257 -1.213  9.431   1.00 34.45 ? 214 GLN C NE2 1 
ATOM   5762 N N   . PRO C 1 195 ? -33.197 2.652   6.406   1.00 32.60 ? 215 PRO C N   1 
ATOM   5763 C CA  . PRO C 1 195 ? -33.199 3.857   5.601   1.00 32.60 ? 215 PRO C CA  1 
ATOM   5764 C C   . PRO C 1 195 ? -33.164 4.985   6.607   1.00 32.60 ? 215 PRO C C   1 
ATOM   5765 O O   . PRO C 1 195 ? -33.940 4.934   7.576   1.00 32.60 ? 215 PRO C O   1 
ATOM   5766 C CB  . PRO C 1 195 ? -34.443 3.772   4.751   1.00 32.49 ? 215 PRO C CB  1 
ATOM   5767 C CG  . PRO C 1 195 ? -34.864 2.334   4.874   1.00 32.49 ? 215 PRO C CG  1 
ATOM   5768 C CD  . PRO C 1 195 ? -34.404 1.863   6.261   1.00 32.49 ? 215 PRO C CD  1 
ATOM   5769 N N   . ILE C 1 196 ? -32.361 6.022   6.432   1.00 33.78 ? 216 ILE C N   1 
ATOM   5770 C CA  . ILE C 1 196 ? -32.268 7.113   7.400   1.00 33.78 ? 216 ILE C CA  1 
ATOM   5771 C C   . ILE C 1 196 ? -33.520 7.935   7.489   1.00 33.78 ? 216 ILE C C   1 
ATOM   5772 O O   . ILE C 1 196 ? -33.799 8.662   8.459   1.00 33.78 ? 216 ILE C O   1 
ATOM   5773 C CB  . ILE C 1 196 ? -31.011 7.965   7.064   1.00 32.78 ? 216 ILE C CB  1 
ATOM   5774 C CG1 . ILE C 1 196 ? -30.625 8.809   8.264   1.00 32.78 ? 216 ILE C CG1 1 
ATOM   5775 C CG2 . ILE C 1 196 ? -31.313 8.792   5.820   1.00 32.78 ? 216 ILE C CG2 1 
ATOM   5776 C CD1 . ILE C 1 196 ? -29.383 9.661   8.098   1.00 32.78 ? 216 ILE C CD1 1 
ATOM   5777 N N   . VAL C 1 197 ? -34.387 7.910   6.476   1.00 39.53 ? 217 VAL C N   1 
ATOM   5778 C CA  . VAL C 1 197 ? -35.654 8.640   6.479   1.00 39.53 ? 217 VAL C CA  1 
ATOM   5779 C C   . VAL C 1 197 ? -36.550 8.093   7.587   1.00 39.53 ? 217 VAL C C   1 
ATOM   5780 O O   . VAL C 1 197 ? -37.233 8.859   8.273   1.00 39.53 ? 217 VAL C O   1 
ATOM   5781 C CB  . VAL C 1 197 ? -36.299 8.523   5.095   1.00 40.63 ? 217 VAL C CB  1 
ATOM   5782 C CG1 . VAL C 1 197 ? -37.796 8.767   5.121   1.00 40.63 ? 217 VAL C CG1 1 
ATOM   5783 C CG2 . VAL C 1 197 ? -35.641 9.523   4.130   1.00 40.63 ? 217 VAL C CG2 1 
ATOM   5784 N N   . THR C 1 198 ? -36.522 6.767   7.755   1.00 45.51 ? 218 THR C N   1 
ATOM   5785 C CA  . THR C 1 198 ? -37.253 6.063   8.770   1.00 45.51 ? 218 THR C CA  1 
ATOM   5786 C C   . THR C 1 198 ? -36.751 6.471   10.144  1.00 45.51 ? 218 THR C C   1 
ATOM   5787 O O   . THR C 1 198 ? -37.550 6.817   11.014  1.00 45.51 ? 218 THR C O   1 
ATOM   5788 C CB  . THR C 1 198 ? -37.075 4.556   8.678   1.00 44.88 ? 218 THR C CB  1 
ATOM   5789 O OG1 . THR C 1 198 ? -37.540 4.105   7.405   1.00 44.88 ? 218 THR C OG1 1 
ATOM   5790 C CG2 . THR C 1 198 ? -37.870 3.888   9.783   1.00 44.88 ? 218 THR C CG2 1 
ATOM   5791 N N   . LEU C 1 199 ? -35.413 6.465   10.300  1.00 51.06 ? 219 LEU C N   1 
ATOM   5792 C CA  . LEU C 1 199 ? -34.861 6.887   11.606  1.00 51.06 ? 219 LEU C CA  1 
ATOM   5793 C C   . LEU C 1 199 ? -35.170 8.361   11.777  1.00 51.06 ? 219 LEU C C   1 
ATOM   5794 O O   . LEU C 1 199 ? -35.372 8.820   12.907  1.00 51.06 ? 219 LEU C O   1 
ATOM   5795 C CB  . LEU C 1 199 ? -33.385 6.637   11.763  1.00 48.78 ? 219 LEU C CB  1 
ATOM   5796 C CG  . LEU C 1 199 ? -32.832 5.387   11.074  1.00 48.78 ? 219 LEU C CG  1 
ATOM   5797 C CD1 . LEU C 1 199 ? -31.323 5.339   11.180  1.00 48.78 ? 219 LEU C CD1 1 
ATOM   5798 C CD2 . LEU C 1 199 ? -33.440 4.127   11.683  1.00 48.78 ? 219 LEU C CD2 1 
ATOM   5799 N N   . ALA C 1 200 ? -35.224 9.147   10.695  1.00 57.62 ? 220 ALA C N   1 
ATOM   5800 C CA  . ALA C 1 200 ? -35.578 10.560  10.837  1.00 57.62 ? 220 ALA C CA  1 
ATOM   5801 C C   . ALA C 1 200 ? -36.987 10.686  11.394  1.00 57.62 ? 220 ALA C C   1 
ATOM   5802 O O   . ALA C 1 200 ? -37.212 11.423  12.373  1.00 57.62 ? 220 ALA C O   1 
ATOM   5803 C CB  . ALA C 1 200 ? -35.448 11.246  9.484   1.00 57.09 ? 220 ALA C CB  1 
ATOM   5804 N N   . ASP C 1 201 ? -37.967 9.944   10.859  1.00 62.93 ? 221 ASP C N   1 
ATOM   5805 C CA  . ASP C 1 201 ? -39.355 10.004  11.281  1.00 62.93 ? 221 ASP C CA  1 
ATOM   5806 C C   . ASP C 1 201 ? -39.580 9.660   12.754  1.00 62.93 ? 221 ASP C C   1 
ATOM   5807 O O   . ASP C 1 201 ? -40.562 10.178  13.324  1.00 62.93 ? 221 ASP C O   1 
ATOM   5808 C CB  . ASP C 1 201 ? -40.238 9.076   10.433  1.00 65.43 ? 221 ASP C CB  1 
ATOM   5809 C CG  . ASP C 1 201 ? -40.429 9.541   8.997   1.00 65.43 ? 221 ASP C CG  1 
ATOM   5810 O OD1 . ASP C 1 201 ? -40.459 10.759  8.661   1.00 65.43 ? 221 ASP C OD1 1 
ATOM   5811 O OD2 . ASP C 1 201 ? -40.577 8.629   8.121   1.00 65.43 ? 221 ASP C OD2 1 
ATOM   5812 N N   . ALA C 1 202 ? -38.743 8.888   13.399  1.00 65.31 ? 222 ALA C N   1 
ATOM   5813 C CA  . ALA C 1 202 ? -38.831 8.536   14.804  1.00 65.31 ? 222 ALA C CA  1 
ATOM   5814 C C   . ALA C 1 202 ? -38.296 9.578   15.784  1.00 65.31 ? 222 ALA C C   1 
ATOM   5815 O O   . ALA C 1 202 ? -37.340 10.328  15.647  1.00 65.31 ? 222 ALA C O   1 
ATOM   5816 C CB  . ALA C 1 202 ? -38.034 7.218   15.036  1.00 65.22 ? 222 ALA C CB  1 
ATOM   5817 N N   . ILE C 1 205 ? -32.974 11.723  14.898  1.00 56.42 ? 225 ILE C N   1 
ATOM   5818 C CA  . ILE C 1 205 ? -32.135 12.453  13.926  1.00 56.42 ? 225 ILE C CA  1 
ATOM   5819 C C   . ILE C 1 205 ? -32.844 13.504  13.091  1.00 56.42 ? 225 ILE C C   1 
ATOM   5820 O O   . ILE C 1 205 ? -33.936 13.310  12.527  1.00 56.42 ? 225 ILE C O   1 
ATOM   5821 C CB  . ILE C 1 205 ? -31.470 11.373  13.011  1.00 57.62 ? 225 ILE C CB  1 
ATOM   5822 C CG1 . ILE C 1 205 ? -30.252 11.970  12.306  1.00 57.62 ? 225 ILE C CG1 1 
ATOM   5823 C CG2 . ILE C 1 205 ? -32.396 10.804  11.964  1.00 57.62 ? 225 ILE C CG2 1 
ATOM   5824 C CD1 . ILE C 1 205 ? -28.979 11.741  13.098  1.00 57.62 ? 225 ILE C CD1 1 
ATOM   5825 N N   . ASP C 1 206 ? -32.235 14.697  12.953  1.00 52.47 ? 226 ASP C N   1 
ATOM   5826 C CA  . ASP C 1 206 ? -32.743 15.810  12.162  1.00 52.47 ? 226 ASP C CA  1 
ATOM   5827 C C   . ASP C 1 206 ? -31.935 15.914  10.853  1.00 52.47 ? 226 ASP C C   1 
ATOM   5828 O O   . ASP C 1 206 ? -30.817 16.441  10.888  1.00 52.47 ? 226 ASP C O   1 
ATOM   5829 C CB  . ASP C 1 206 ? -32.602 17.134  12.897  1.00 56.95 ? 226 ASP C CB  1 
ATOM   5830 C CG  . ASP C 1 206 ? -33.170 18.322  12.146  1.00 56.95 ? 226 ASP C CG  1 
ATOM   5831 O OD1 . ASP C 1 206 ? -33.868 18.142  11.104  1.00 56.95 ? 226 ASP C OD1 1 
ATOM   5832 O OD2 . ASP C 1 206 ? -32.936 19.482  12.596  1.00 56.95 ? 226 ASP C OD2 1 
ATOM   5833 N N   . LEU C 1 207 ? -32.478 15.466  9.738   1.00 46.70 ? 227 LEU C N   1 
ATOM   5834 C CA  . LEU C 1 207 ? -31.769 15.452  8.466   1.00 46.70 ? 227 LEU C CA  1 
ATOM   5835 C C   . LEU C 1 207 ? -31.313 16.801  7.971   1.00 46.70 ? 227 LEU C C   1 
ATOM   5836 O O   . LEU C 1 207 ? -30.265 16.924  7.302   1.00 46.70 ? 227 LEU C O   1 
ATOM   5837 C CB  . LEU C 1 207 ? -32.688 14.819  7.412   1.00 43.29 ? 227 LEU C CB  1 
ATOM   5838 C CG  . LEU C 1 207 ? -32.983 13.344  7.701   1.00 43.29 ? 227 LEU C CG  1 
ATOM   5839 C CD1 . LEU C 1 207 ? -33.734 12.676  6.562   1.00 43.29 ? 227 LEU C CD1 1 
ATOM   5840 C CD2 . LEU C 1 207 ? -31.695 12.567  7.934   1.00 43.29 ? 227 LEU C CD2 1 
ATOM   5841 N N   . ALA C 1 208 ? -32.052 17.857  8.273   1.00 46.69 ? 228 ALA C N   1 
ATOM   5842 C CA  . ALA C 1 208 ? -31.687 19.213  7.836   1.00 46.69 ? 228 ALA C CA  1 
ATOM   5843 C C   . ALA C 1 208 ? -30.405 19.669  8.514   1.00 46.69 ? 228 ALA C C   1 
ATOM   5844 O O   . ALA C 1 208 ? -29.541 20.291  7.884   1.00 46.69 ? 228 ALA C O   1 
ATOM   5845 C CB  . ALA C 1 208 ? -32.825 20.166  8.161   1.00 46.83 ? 228 ALA C CB  1 
ATOM   5846 N N   . ALA C 1 209 ? -30.231 19.340  9.775   1.00 45.60 ? 229 ALA C N   1 
ATOM   5847 C CA  . ALA C 1 209 ? -29.035 19.636  10.534  1.00 45.60 ? 229 ALA C CA  1 
ATOM   5848 C C   . ALA C 1 209 ? -27.802 18.946  9.932   1.00 45.60 ? 229 ALA C C   1 
ATOM   5849 O O   . ALA C 1 209 ? -26.722 19.533  9.815   1.00 45.60 ? 229 ALA C O   1 
ATOM   5850 C CB  . ALA C 1 209 ? -29.196 19.171  11.981  1.00 45.78 ? 229 ALA C CB  1 
ATOM   5851 N N   . ILE C 1 210 ? -27.987 17.693  9.522   1.00 44.67 ? 230 ILE C N   1 
ATOM   5852 C CA  . ILE C 1 210 ? -26.960 16.862  8.942   1.00 44.67 ? 230 ILE C CA  1 
ATOM   5853 C C   . ILE C 1 210 ? -26.528 17.530  7.638   1.00 44.67 ? 230 ILE C C   1 
ATOM   5854 O O   . ILE C 1 210 ? -25.331 17.644  7.417   1.00 44.67 ? 230 ILE C O   1 
ATOM   5855 C CB  . ILE C 1 210 ? -27.409 15.432  8.627   1.00 43.42 ? 230 ILE C CB  1 
ATOM   5856 C CG1 . ILE C 1 210 ? -27.669 14.687  9.953   1.00 43.42 ? 230 ILE C CG1 1 
ATOM   5857 C CG2 . ILE C 1 210 ? -26.372 14.686  7.809   1.00 43.42 ? 230 ILE C CG2 1 
ATOM   5858 C CD1 . ILE C 1 210 ? -28.495 13.439  9.755   1.00 43.42 ? 230 ILE C CD1 1 
ATOM   5859 N N   . GLU C 1 211 ? -27.537 17.968  6.880   1.00 44.67 ? 231 GLU C N   1 
ATOM   5860 C CA  . GLU C 1 211 ? -27.251 18.710  5.645   1.00 44.67 ? 231 GLU C CA  1 
ATOM   5861 C C   . GLU C 1 211 ? -26.484 19.986  5.965   1.00 44.67 ? 231 GLU C C   1 
ATOM   5862 O O   . GLU C 1 211 ? -25.549 20.323  5.236   1.00 44.67 ? 231 GLU C O   1 
ATOM   5863 C CB  . GLU C 1 211 ? -28.521 19.054  4.913   1.00 47.97 ? 231 GLU C CB  1 
ATOM   5864 C CG  . GLU C 1 211 ? -28.770 18.129  3.736   1.00 47.97 ? 231 GLU C CG  1 
ATOM   5865 C CD  . GLU C 1 211 ? -30.025 18.512  2.958   1.00 47.97 ? 231 GLU C CD  1 
ATOM   5866 O OE1 . GLU C 1 211 ? -31.048 18.769  3.652   1.00 47.97 ? 231 GLU C OE1 1 
ATOM   5867 O OE2 . GLU C 1 211 ? -29.970 18.532  1.690   1.00 47.97 ? 231 GLU C OE2 1 
ATOM   5868 N N   . GLU C 1 212 ? -26.787 20.691  7.032   1.00 44.52 ? 232 GLU C N   1 
ATOM   5869 C CA  . GLU C 1 212 ? -26.090 21.887  7.456   1.00 44.52 ? 232 GLU C CA  1 
ATOM   5870 C C   . GLU C 1 212 ? -24.623 21.646  7.751   1.00 44.52 ? 232 GLU C C   1 
ATOM   5871 O O   . GLU C 1 212 ? -23.772 22.386  7.242   1.00 44.52 ? 232 GLU C O   1 
ATOM   5872 N N   . GLU C 1 213 ? -24.299 20.630  8.540   1.00 43.19 ? 233 GLU C N   1 
ATOM   5873 C CA  . GLU C 1 213 ? -22.950 20.241  8.934   1.00 43.19 ? 233 GLU C CA  1 
ATOM   5874 C C   . GLU C 1 213 ? -22.034 19.916  7.770   1.00 43.19 ? 233 GLU C C   1 
ATOM   5875 O O   . GLU C 1 213 ? -20.845 20.255  7.819   1.00 43.19 ? 233 GLU C O   1 
ATOM   5876 C CB  . GLU C 1 213 ? -23.026 19.027  9.870   1.00 50.25 ? 233 GLU C CB  1 
ATOM   5877 C CG  . GLU C 1 213 ? -21.727 18.445  10.382  1.00 50.25 ? 233 GLU C CG  1 
ATOM   5878 C CD  . GLU C 1 213 ? -20.885 19.403  11.174  1.00 50.25 ? 233 GLU C CD  1 
ATOM   5879 O OE1 . GLU C 1 213 ? -21.389 20.028  12.153  1.00 50.25 ? 233 GLU C OE1 1 
ATOM   5880 O OE2 . GLU C 1 213 ? -19.680 19.576  10.827  1.00 50.25 ? 233 GLU C OE2 1 
ATOM   5881 N N   . ALA C 1 214 ? -22.556 19.244  6.747   1.00 39.21 ? 234 ALA C N   1 
ATOM   5882 C CA  . ALA C 1 214 ? -21.774 18.880  5.578   1.00 39.21 ? 234 ALA C CA  1 
ATOM   5883 C C   . ALA C 1 214 ? -21.412 20.127  4.788   1.00 39.21 ? 234 ALA C C   1 
ATOM   5884 O O   . ALA C 1 214 ? -20.260 20.301  4.399   1.00 39.21 ? 234 ALA C O   1 
ATOM   5885 C CB  . ALA C 1 214 ? -22.516 17.888  4.725   1.00 37.59 ? 234 ALA C CB  1 
ATOM   5886 N N   . ARG C 1 215 ? -22.369 21.016  4.569   1.00 39.14 ? 235 ARG C N   1 
ATOM   5887 C CA  . ARG C 1 215 ? -22.167 22.279  3.843   1.00 39.14 ? 235 ARG C CA  1 
ATOM   5888 C C   . ARG C 1 215 ? -21.264 23.153  4.678   1.00 39.14 ? 235 ARG C C   1 
ATOM   5889 O O   . ARG C 1 215 ? -20.227 23.659  4.241   1.00 39.14 ? 235 ARG C O   1 
ATOM   5890 N N   . LYS C 1 216 ? -21.600 23.287  5.971   1.00 37.88 ? 236 LYS C N   1 
ATOM   5891 C CA  . LYS C 1 216 ? -20.807 24.065  6.924   1.00 37.88 ? 236 LYS C CA  1 
ATOM   5892 C C   . LYS C 1 216 ? -19.363 23.577  6.955   1.00 37.88 ? 236 LYS C C   1 
ATOM   5893 O O   . LYS C 1 216 ? -18.420 24.338  7.167   1.00 37.88 ? 236 LYS C O   1 
ATOM   5894 C CB  . LYS C 1 216 ? -21.420 23.954  8.309   1.00 38.39 ? 236 LYS C CB  1 
ATOM   5895 C CG  . LYS C 1 216 ? -20.713 24.711  9.419   1.00 38.39 ? 236 LYS C CG  1 
ATOM   5896 N N   . GLY C 1 217 ? -19.129 22.292  6.718   1.00 35.56 ? 237 GLY C N   1 
ATOM   5897 C CA  . GLY C 1 217 ? -17.862 21.651  6.699   1.00 35.56 ? 237 GLY C CA  1 
ATOM   5898 C C   . GLY C 1 217 ? -16.915 22.250  5.692   1.00 35.56 ? 237 GLY C C   1 
ATOM   5899 O O   . GLY C 1 217 ? -15.767 22.554  6.013   1.00 35.56 ? 237 GLY C O   1 
ATOM   5900 N N   . GLY C 1 218 ? -17.432 22.442  4.491   1.00 34.04 ? 238 GLY C N   1 
ATOM   5901 C CA  . GLY C 1 218 ? -16.683 23.022  3.369   1.00 34.04 ? 238 GLY C CA  1 
ATOM   5902 C C   . GLY C 1 218 ? -16.262 24.459  3.641   1.00 34.04 ? 238 GLY C C   1 
ATOM   5903 O O   . GLY C 1 218 ? -15.143 24.856  3.298   1.00 34.04 ? 238 GLY C O   1 
ATOM   5904 N N   . PHE C 1 219 ? -17.131 25.216  4.317   1.00 34.38 ? 239 PHE C N   1 
ATOM   5905 C CA  . PHE C 1 219 ? -16.808 26.595  4.663   1.00 34.38 ? 239 PHE C CA  1 
ATOM   5906 C C   . PHE C 1 219 ? -15.726 26.683  5.706   1.00 34.38 ? 239 PHE C C   1 
ATOM   5907 O O   . PHE C 1 219 ? -14.859 27.559  5.657   1.00 34.38 ? 239 PHE C O   1 
ATOM   5908 C CB  . PHE C 1 219 ? -18.015 27.362  5.165   1.00 42.63 ? 239 PHE C CB  1 
ATOM   5909 C CG  . PHE C 1 219 ? -19.058 27.552  4.099   1.00 42.63 ? 239 PHE C CG  1 
ATOM   5910 C CD1 . PHE C 1 219 ? -18.746 27.826  2.769   1.00 42.63 ? 239 PHE C CD1 1 
ATOM   5911 C CD2 . PHE C 1 219 ? -20.383 27.407  4.490   1.00 42.63 ? 239 PHE C CD2 1 
ATOM   5912 C CE1 . PHE C 1 219 ? -19.754 27.967  1.819   1.00 42.63 ? 239 PHE C CE1 1 
ATOM   5913 C CE2 . PHE C 1 219 ? -21.400 27.544  3.559   1.00 42.63 ? 239 PHE C CE2 1 
ATOM   5914 C CZ  . PHE C 1 219 ? -21.078 27.817  2.234   1.00 42.63 ? 239 PHE C CZ  1 
ATOM   5915 N N   . THR C 1 220 ? -15.724 25.771  6.662   1.00 30.29 ? 240 THR C N   1 
ATOM   5916 C CA  . THR C 1 220 ? -14.662 25.762  7.674   1.00 30.29 ? 240 THR C CA  1 
ATOM   5917 C C   . THR C 1 220 ? -13.317 25.504  7.000   1.00 30.29 ? 240 THR C C   1 
ATOM   5918 O O   . THR C 1 220 ? -12.314 26.128  7.344   1.00 30.29 ? 240 THR C O   1 
ATOM   5919 C CB  . THR C 1 220 ? -14.901 24.688  8.728   1.00 30.48 ? 240 THR C CB  1 
ATOM   5920 O OG1 . THR C 1 220 ? -16.258 24.778  9.211   1.00 30.48 ? 240 THR C OG1 1 
ATOM   5921 C CG2 . THR C 1 220 ? -13.909 24.860  9.866   1.00 30.48 ? 240 THR C CG2 1 
ATOM   5922 N N   . VAL C 1 221 ? -13.293 24.620  6.005   1.00 28.55 ? 241 VAL C N   1 
ATOM   5923 C CA  . VAL C 1 221 ? -12.054 24.339  5.292   1.00 28.55 ? 241 VAL C CA  1 
ATOM   5924 C C   . VAL C 1 221 ? -11.589 25.569  4.541   1.00 28.55 ? 241 VAL C C   1 
ATOM   5925 O O   . VAL C 1 221 ? -10.417 25.927  4.641   1.00 28.55 ? 241 VAL C O   1 
ATOM   5926 C CB  . VAL C 1 221 ? -12.195 23.195  4.275   1.00 26.72 ? 241 VAL C CB  1 
ATOM   5927 C CG1 . VAL C 1 221 ? -10.854 22.932  3.597   1.00 26.72 ? 241 VAL C CG1 1 
ATOM   5928 C CG2 . VAL C 1 221 ? -12.682 21.948  4.986   1.00 26.72 ? 241 VAL C CG2 1 
ATOM   5929 N N   . LEU C 1 222 ? -12.514 26.199  3.824   1.00 30.93 ? 242 LEU C N   1 
ATOM   5930 C CA  . LEU C 1 222 ? -12.209 27.413  3.071   1.00 30.93 ? 242 LEU C CA  1 
ATOM   5931 C C   . LEU C 1 222 ? -11.779 28.536  3.989   1.00 30.93 ? 242 LEU C C   1 
ATOM   5932 O O   . LEU C 1 222 ? -10.782 29.208  3.714   1.00 30.93 ? 242 LEU C O   1 
ATOM   5933 C CB  . LEU C 1 222 ? -13.415 27.877  2.250   1.00 32.37 ? 242 LEU C CB  1 
ATOM   5934 C CG  . LEU C 1 222 ? -13.596 27.081  0.954   1.00 32.37 ? 242 LEU C CG  1 
ATOM   5935 C CD1 . LEU C 1 222 ? -14.993 27.245  0.404   1.00 32.37 ? 242 LEU C CD1 1 
ATOM   5936 C CD2 . LEU C 1 222 ? -12.565 27.545  -0.087  1.00 32.37 ? 242 LEU C CD2 1 
ATOM   5937 N N   . ASN C 1 223 ? -12.498 28.726  5.082   1.00 34.19 ? 243 ASN C N   1 
ATOM   5938 C CA  . ASN C 1 223 ? -12.159 29.781  6.028   1.00 34.19 ? 243 ASN C CA  1 
ATOM   5939 C C   . ASN C 1 223 ? -10.809 29.584  6.696   1.00 34.19 ? 243 ASN C C   1 
ATOM   5940 O O   . ASN C 1 223 ? -10.059 30.564  6.909   1.00 34.19 ? 243 ASN C O   1 
ATOM   5941 C CB  . ASN C 1 223 ? -13.204 29.831  7.173   1.00 41.76 ? 243 ASN C CB  1 
ATOM   5942 C CG  . ASN C 1 223 ? -12.900 31.074  8.034   1.00 41.76 ? 243 ASN C CG  1 
ATOM   5943 O OD1 . ASN C 1 223 ? -13.057 32.203  7.523   1.00 41.76 ? 243 ASN C OD1 1 
ATOM   5944 N ND2 . ASN C 1 223 ? -12.443 30.784  9.260   1.00 41.76 ? 243 ASN C ND2 1 
ATOM   5945 N N   . GLY C 1 224 ? -10.468 28.356  7.078   1.00 30.49 ? 244 GLY C N   1 
ATOM   5946 C CA  . GLY C 1 224 ? -9.198  28.148  7.714   1.00 30.49 ? 244 GLY C CA  1 
ATOM   5947 C C   . GLY C 1 224 ? -8.049  27.909  6.793   1.00 30.49 ? 244 GLY C C   1 
ATOM   5948 O O   . GLY C 1 224 ? -6.901  28.236  7.125   1.00 30.49 ? 244 GLY C O   1 
ATOM   5949 N N   . LYS C 1 225 ? -8.281  27.404  5.604   1.00 29.01 ? 245 LYS C N   1 
ATOM   5950 C CA  . LYS C 1 225 ? -7.158  27.093  4.668   1.00 29.01 ? 245 LYS C CA  1 
ATOM   5951 C C   . LYS C 1 225 ? -7.110  27.987  3.466   1.00 29.01 ? 245 LYS C C   1 
ATOM   5952 O O   . LYS C 1 225 ? -6.053  28.149  2.855   1.00 29.01 ? 245 LYS C O   1 
ATOM   5953 C CB  . LYS C 1 225 ? -7.342  25.658  4.263   1.00 26.74 ? 245 LYS C CB  1 
ATOM   5954 C CG  . LYS C 1 225 ? -6.329  24.843  3.545   1.00 26.74 ? 245 LYS C CG  1 
ATOM   5955 C CD  . LYS C 1 225 ? -6.904  23.393  3.657   1.00 26.74 ? 245 LYS C CD  1 
ATOM   5956 C CE  . LYS C 1 225 ? -6.216  22.400  2.812   1.00 26.74 ? 245 LYS C CE  1 
ATOM   5957 N NZ  . LYS C 1 225 ? -6.776  21.033  3.081   1.00 26.74 ? 245 LYS C NZ  1 
ATOM   5958 N N   . GLY C 1 226 ? -8.244  28.516  3.024   1.00 28.90 ? 246 GLY C N   1 
ATOM   5959 C CA  . GLY C 1 226 ? -8.313  29.381  1.857   1.00 28.90 ? 246 GLY C CA  1 
ATOM   5960 C C   . GLY C 1 226 ? -8.594  28.537  0.622   1.00 28.90 ? 246 GLY C C   1 
ATOM   5961 O O   . GLY C 1 226 ? -8.617  29.052  -0.504  1.00 28.90 ? 246 GLY C O   1 
ATOM   5962 N N   . TYR C 1 227 ? -8.801  27.262  0.742   1.00 26.39 ? 247 TYR C N   1 
ATOM   5963 C CA  . TYR C 1 227 ? -9.021  26.303  -0.302  1.00 26.39 ? 247 TYR C CA  1 
ATOM   5964 C C   . TYR C 1 227 ? -9.156  24.918  0.296   1.00 26.39 ? 247 TYR C C   1 
ATOM   5965 O O   . TYR C 1 227 ? -8.840  24.676  1.482   1.00 26.39 ? 247 TYR C O   1 
ATOM   5966 C CB  . TYR C 1 227 ? -7.796  26.332  -1.273  1.00 28.24 ? 247 TYR C CB  1 
ATOM   5967 C CG  . TYR C 1 227 ? -6.498  25.824  -0.667  1.00 28.24 ? 247 TYR C CG  1 
ATOM   5968 C CD1 . TYR C 1 227 ? -5.625  26.611  0.046   1.00 28.24 ? 247 TYR C CD1 1 
ATOM   5969 C CD2 . TYR C 1 227 ? -6.184  24.476  -0.769  1.00 28.24 ? 247 TYR C CD2 1 
ATOM   5970 C CE1 . TYR C 1 227 ? -4.503  26.092  0.652   1.00 28.24 ? 247 TYR C CE1 1 
ATOM   5971 C CE2 . TYR C 1 227 ? -5.060  23.937  -0.198  1.00 28.24 ? 247 TYR C CE2 1 
ATOM   5972 C CZ  . TYR C 1 227 ? -4.214  24.755  0.519   1.00 28.24 ? 247 TYR C CZ  1 
ATOM   5973 O OH  . TYR C 1 227 ? -3.088  24.187  1.114   1.00 28.24 ? 247 TYR C OH  1 
ATOM   5974 N N   . THR C 1 228 ? -9.622  23.954  -0.464  1.00 22.62 ? 248 THR C N   1 
ATOM   5975 C CA  . THR C 1 228 ? -9.777  22.568  -0.041  1.00 22.62 ? 248 THR C CA  1 
ATOM   5976 C C   . THR C 1 228 ? -8.966  21.703  -0.991  1.00 22.62 ? 248 THR C C   1 
ATOM   5977 O O   . THR C 1 228 ? -8.826  22.090  -2.156  1.00 22.62 ? 248 THR C O   1 
ATOM   5978 C CB  . THR C 1 228 ? -11.227 22.096  0.011   1.00 24.38 ? 248 THR C CB  1 
ATOM   5979 O OG1 . THR C 1 228 ? -11.660 21.535  -1.236  1.00 24.38 ? 248 THR C OG1 1 
ATOM   5980 C CG2 . THR C 1 228 ? -12.199 23.226  0.368   1.00 24.38 ? 248 THR C CG2 1 
ATOM   5981 N N   . SER C 1 229 ? -8.385  20.598  -0.591  1.00 16.58 ? 249 SER C N   1 
ATOM   5982 C CA  . SER C 1 229 ? -7.567  19.783  -1.483  1.00 16.58 ? 249 SER C CA  1 
ATOM   5983 C C   . SER C 1 229 ? -7.682  18.294  -1.257  1.00 16.58 ? 249 SER C C   1 
ATOM   5984 O O   . SER C 1 229 ? -7.912  17.513  -2.164  1.00 16.58 ? 249 SER C O   1 
ATOM   5985 C CB  . SER C 1 229 ? -6.074  20.152  -1.321  1.00 15.65 ? 249 SER C CB  1 
ATOM   5986 O OG  . SER C 1 229 ? -5.682  20.200  0.010   1.00 15.65 ? 249 SER C OG  1 
ATOM   5987 N N   . TYR C 1 230 ? -7.518  17.847  -0.012  1.00 13.98 ? 250 TYR C N   1 
ATOM   5988 C CA  . TYR C 1 230 ? -7.566  16.394  0.283   1.00 13.98 ? 250 TYR C CA  1 
ATOM   5989 C C   . TYR C 1 230 ? -8.898  15.798  -0.057  1.00 13.98 ? 250 TYR C C   1 
ATOM   5990 O O   . TYR C 1 230 ? -8.916  14.782  -0.808  1.00 13.98 ? 250 TYR C O   1 
ATOM   5991 C CB  . TYR C 1 230 ? -7.189  16.089  1.760   1.00 9.63  ? 250 TYR C CB  1 
ATOM   5992 C CG  . TYR C 1 230 ? -5.899  16.820  2.103   1.00 9.63  ? 250 TYR C CG  1 
ATOM   5993 C CD1 . TYR C 1 230 ? -4.768  16.586  1.357   1.00 9.63  ? 250 TYR C CD1 1 
ATOM   5994 C CD2 . TYR C 1 230 ? -5.859  17.752  3.121   1.00 9.63  ? 250 TYR C CD2 1 
ATOM   5995 C CE1 . TYR C 1 230 ? -3.590  17.266  1.629   1.00 9.63  ? 250 TYR C CE1 1 
ATOM   5996 C CE2 . TYR C 1 230 ? -4.686  18.446  3.405   1.00 9.63  ? 250 TYR C CE2 1 
ATOM   5997 C CZ  . TYR C 1 230 ? -3.581  18.180  2.659   1.00 9.63  ? 250 TYR C CZ  1 
ATOM   5998 O OH  . TYR C 1 230 ? -2.398  18.904  2.871   1.00 9.63  ? 250 TYR C OH  1 
ATOM   5999 N N   . GLY C 1 231 ? -10.010 16.375  0.359   1.00 13.93 ? 251 GLY C N   1 
ATOM   6000 C CA  . GLY C 1 231 ? -11.286 15.756  -0.036  1.00 13.93 ? 251 GLY C CA  1 
ATOM   6001 C C   . GLY C 1 231 ? -11.457 15.529  -1.516  1.00 13.93 ? 251 GLY C C   1 
ATOM   6002 O O   . GLY C 1 231 ? -11.839 14.455  -1.991  1.00 13.93 ? 251 GLY C O   1 
ATOM   6003 N N   . VAL C 1 232 ? -11.234 16.605  -2.329  1.00 13.32 ? 252 VAL C N   1 
ATOM   6004 C CA  . VAL C 1 232 ? -11.428 16.498  -3.794  1.00 13.32 ? 252 VAL C CA  1 
ATOM   6005 C C   . VAL C 1 232 ? -10.359 15.730  -4.480  1.00 13.32 ? 252 VAL C C   1 
ATOM   6006 O O   . VAL C 1 232 ? -10.617 14.938  -5.391  1.00 13.32 ? 252 VAL C O   1 
ATOM   6007 C CB  . VAL C 1 232 ? -11.617 17.939  -4.405  1.00 11.58 ? 252 VAL C CB  1 
ATOM   6008 C CG1 . VAL C 1 232 ? -10.349 18.730  -4.590  1.00 11.58 ? 252 VAL C CG1 1 
ATOM   6009 C CG2 . VAL C 1 232 ? -12.299 17.783  -5.754  1.00 11.58 ? 252 VAL C CG2 1 
ATOM   6010 N N   . ALA C 1 233 ? -9.093  15.860  -4.082  1.00 12.80 ? 253 ALA C N   1 
ATOM   6011 C CA  . ALA C 1 233 ? -8.005  15.094  -4.690  1.00 12.80 ? 253 ALA C CA  1 
ATOM   6012 C C   . ALA C 1 233 ? -8.259  13.618  -4.565  1.00 12.80 ? 253 ALA C C   1 
ATOM   6013 O O   . ALA C 1 233 ? -8.001  12.831  -5.485  1.00 12.80 ? 253 ALA C O   1 
ATOM   6014 C CB  . ALA C 1 233 ? -6.699  15.419  -3.983  1.00 11.41 ? 253 ALA C CB  1 
ATOM   6015 N N   . THR C 1 234 ? -8.747  13.193  -3.385  1.00 12.68 ? 254 THR C N   1 
ATOM   6016 C CA  . THR C 1 234 ? -9.005  11.767  -3.126  1.00 12.68 ? 254 THR C CA  1 
ATOM   6017 C C   . THR C 1 234 ? -10.095 11.229  -4.009  1.00 12.68 ? 254 THR C C   1 
ATOM   6018 O O   . THR C 1 234 ? -10.058 10.061  -4.397  1.00 12.68 ? 254 THR C O   1 
ATOM   6019 C CB  . THR C 1 234 ? -9.329  11.511  -1.625  1.00 12.67 ? 254 THR C CB  1 
ATOM   6020 O OG1 . THR C 1 234 ? -8.206  11.967  -0.842  1.00 12.67 ? 254 THR C OG1 1 
ATOM   6021 C CG2 . THR C 1 234 ? -9.601  10.068  -1.376  1.00 12.67 ? 254 THR C CG2 1 
ATOM   6022 N N   . SER C 1 235 ? -11.109 12.024  -4.305  1.00 15.41 ? 255 SER C N   1 
ATOM   6023 C CA  . SER C 1 235 ? -12.149 11.690  -5.239  1.00 15.41 ? 255 SER C CA  1 
ATOM   6024 C C   . SER C 1 235 ? -11.597 11.335  -6.618  1.00 15.41 ? 255 SER C C   1 
ATOM   6025 O O   . SER C 1 235 ? -11.887 10.341  -7.237  1.00 15.41 ? 255 SER C O   1 
ATOM   6026 C CB  . SER C 1 235 ? -13.035 12.930  -5.585  1.00 18.13 ? 255 SER C CB  1 
ATOM   6027 O OG  . SER C 1 235 ? -13.786 13.316  -4.487  1.00 18.13 ? 255 SER C OG  1 
ATOM   6028 N N   . ALA C 1 236 ? -10.756 12.221  -7.172  1.00 15.65 ? 256 ALA C N   1 
ATOM   6029 C CA  . ALA C 1 236 ? -10.168 12.012  -8.493  1.00 15.65 ? 256 ALA C CA  1 
ATOM   6030 C C   . ALA C 1 236 ? -9.366  10.730  -8.460  1.00 15.65 ? 256 ALA C C   1 
ATOM   6031 O O   . ALA C 1 236 ? -9.482  9.949   -9.408  1.00 15.65 ? 256 ALA C O   1 
ATOM   6032 C CB  . ALA C 1 236 ? -9.262  13.179  -8.878  1.00 14.28 ? 256 ALA C CB  1 
ATOM   6033 N N   . ILE C 1 237 ? -8.584  10.510  -7.404  1.00 14.94 ? 257 ILE C N   1 
ATOM   6034 C CA  . ILE C 1 237 ? -7.747  9.313   -7.285  1.00 14.94 ? 257 ILE C CA  1 
ATOM   6035 C C   . ILE C 1 237 ? -8.586  8.046   -7.282  1.00 14.94 ? 257 ILE C C   1 
ATOM   6036 O O   . ILE C 1 237 ? -8.249  7.012   -7.902  1.00 14.94 ? 257 ILE C O   1 
ATOM   6037 C CB  . ILE C 1 237 ? -6.874  9.383   -6.010  1.00 13.64 ? 257 ILE C CB  1 
ATOM   6038 C CG1 . ILE C 1 237 ? -5.812  10.471  -6.170  1.00 13.64 ? 257 ILE C CG1 1 
ATOM   6039 C CG2 . ILE C 1 237 ? -6.177  8.060   -5.720  1.00 13.64 ? 257 ILE C CG2 1 
ATOM   6040 C CD1 . ILE C 1 237 ? -5.169  10.892  -4.859  1.00 13.64 ? 257 ILE C CD1 1 
ATOM   6041 N N   . ARG C 1 238 ? -9.727  8.063   -6.607  1.00 14.94 ? 258 ARG C N   1 
ATOM   6042 C CA  . ARG C 1 238 ? -10.597 6.877   -6.558  1.00 14.94 ? 258 ARG C CA  1 
ATOM   6043 C C   . ARG C 1 238 ? -11.126 6.535   -7.928  1.00 14.94 ? 258 ARG C C   1 
ATOM   6044 O O   . ARG C 1 238 ? -11.110 5.374   -8.334  1.00 14.94 ? 258 ARG C O   1 
ATOM   6045 C CB  . ARG C 1 238 ? -11.719 7.076   -5.525  1.00 13.93 ? 258 ARG C CB  1 
ATOM   6046 C CG  . ARG C 1 238 ? -12.731 5.993   -5.594  1.00 13.93 ? 258 ARG C CG  1 
ATOM   6047 C CD  . ARG C 1 238 ? -13.704 6.111   -4.452  1.00 13.93 ? 258 ARG C CD  1 
ATOM   6048 N NE  . ARG C 1 238 ? -14.510 4.869   -4.343  1.00 13.93 ? 258 ARG C NE  1 
ATOM   6049 C CZ  . ARG C 1 238 ? -15.608 4.824   -3.583  1.00 13.93 ? 258 ARG C CZ  1 
ATOM   6050 N NH1 . ARG C 1 238 ? -15.959 5.888   -2.864  1.00 13.93 ? 258 ARG C NH1 1 
ATOM   6051 N NH2 . ARG C 1 238 ? -16.312 3.697   -3.556  1.00 13.93 ? 258 ARG C NH2 1 
ATOM   6052 N N   . ILE C 1 239 ? -11.557 7.551   -8.670  1.00 16.64 ? 259 ILE C N   1 
ATOM   6053 C CA  . ILE C 1 239 ? -12.014 7.448   -10.061 1.00 16.64 ? 259 ILE C CA  1 
ATOM   6054 C C   . ILE C 1 239 ? -10.880 6.978   -10.956 1.00 16.64 ? 259 ILE C C   1 
ATOM   6055 O O   . ILE C 1 239 ? -11.085 6.059   -11.754 1.00 16.64 ? 259 ILE C O   1 
ATOM   6056 C CB  . ILE C 1 239 ? -12.500 8.791   -10.630 1.00 16.03 ? 259 ILE C CB  1 
ATOM   6057 C CG1 . ILE C 1 239 ? -13.677 9.352   -9.888  1.00 16.03 ? 259 ILE C CG1 1 
ATOM   6058 C CG2 . ILE C 1 239 ? -12.905 8.580   -12.106 1.00 16.03 ? 259 ILE C CG2 1 
ATOM   6059 C CD1 . ILE C 1 239 ? -14.016 10.787  -10.229 1.00 16.03 ? 259 ILE C CD1 1 
ATOM   6060 N N   . ALA C 1 240 ? -9.684  7.549   -10.827 1.00 14.89 ? 260 ALA C N   1 
ATOM   6061 C CA  . ALA C 1 240 ? -8.534  7.173   -11.643 1.00 14.89 ? 260 ALA C CA  1 
ATOM   6062 C C   . ALA C 1 240 ? -8.209  5.710   -11.501 1.00 14.89 ? 260 ALA C C   1 
ATOM   6063 O O   . ALA C 1 240 ? -7.848  5.037   -12.485 1.00 14.89 ? 260 ALA C O   1 
ATOM   6064 C CB  . ALA C 1 240 ? -7.320  8.015   -11.244 1.00 14.10 ? 260 ALA C CB  1 
ATOM   6065 N N   . LYS C 1 241 ? -8.303  5.172   -10.272 1.00 15.90 ? 261 LYS C N   1 
ATOM   6066 C CA  . LYS C 1 241 ? -8.001  3.729   -10.071 1.00 15.90 ? 261 LYS C CA  1 
ATOM   6067 C C   . LYS C 1 241 ? -9.078  2.846   -10.667 1.00 15.90 ? 261 LYS C C   1 
ATOM   6068 O O   . LYS C 1 241 ? -8.765  1.767   -11.192 1.00 15.90 ? 261 LYS C O   1 
ATOM   6069 C CB  . LYS C 1 241 ? -7.867  3.405   -8.584  1.00 15.52 ? 261 LYS C CB  1 
ATOM   6070 C CG  . LYS C 1 241 ? -6.624  3.958   -7.964  1.00 15.52 ? 261 LYS C CG  1 
ATOM   6071 C CD  . LYS C 1 241 ? -6.698  3.917   -6.448  1.00 15.52 ? 261 LYS C CD  1 
ATOM   6072 C CE  . LYS C 1 241 ? -5.310  4.052   -5.874  1.00 15.52 ? 261 LYS C CE  1 
ATOM   6073 N NZ  . LYS C 1 241 ? -5.268  3.894   -4.386  1.00 15.52 ? 261 LYS C NZ  1 
ATOM   6074 N N   . ALA C 1 242 ? -10.331 3.260   -10.604 1.00 15.45 ? 262 ALA C N   1 
ATOM   6075 C CA  . ALA C 1 242 ? -11.424 2.469   -11.195 1.00 15.45 ? 262 ALA C CA  1 
ATOM   6076 C C   . ALA C 1 242 ? -11.196 2.339   -12.676 1.00 15.45 ? 262 ALA C C   1 
ATOM   6077 O O   . ALA C 1 242 ? -11.395 1.330   -13.312 1.00 15.45 ? 262 ALA C O   1 
ATOM   6078 C CB  . ALA C 1 242 ? -12.762 3.149   -10.937 1.00 14.42 ? 262 ALA C CB  1 
ATOM   6079 N N   . VAL C 1 243 ? -10.757 3.446   -13.332 1.00 16.16 ? 263 VAL C N   1 
ATOM   6080 C CA  . VAL C 1 243 ? -10.459 3.436   -14.761 1.00 16.16 ? 263 VAL C CA  1 
ATOM   6081 C C   . VAL C 1 243 ? -9.325  2.516   -15.070 1.00 16.16 ? 263 VAL C C   1 
ATOM   6082 O O   . VAL C 1 243 ? -9.498  1.550   -15.845 1.00 16.16 ? 263 VAL C O   1 
ATOM   6083 C CB  . VAL C 1 243 ? -10.178 4.877   -15.279 1.00 13.30 ? 263 VAL C CB  1 
ATOM   6084 C CG1 . VAL C 1 243 ? -9.685  4.869   -16.718 1.00 13.30 ? 263 VAL C CG1 1 
ATOM   6085 C CG2 . VAL C 1 243 ? -11.427 5.739   -15.163 1.00 13.30 ? 263 VAL C CG2 1 
ATOM   6086 N N   . MET C 1 244 ? -8.113  2.688   -14.517 1.00 16.35 ? 264 MET C N   1 
ATOM   6087 C CA  . MET C 1 244 ? -7.000  1.800   -14.828 1.00 16.35 ? 264 MET C CA  1 
ATOM   6088 C C   . MET C 1 244 ? -7.234  0.352   -14.546 1.00 16.35 ? 264 MET C C   1 
ATOM   6089 O O   . MET C 1 244 ? -6.723  -0.562  -15.248 1.00 16.35 ? 264 MET C O   1 
ATOM   6090 C CB  . MET C 1 244 ? -5.741  2.234   -14.059 1.00 18.10 ? 264 MET C CB  1 
ATOM   6091 C CG  . MET C 1 244 ? -5.439  3.710   -14.276 1.00 18.10 ? 264 MET C CG  1 
ATOM   6092 S SD  . MET C 1 244 ? -3.766  4.183   -13.763 1.00 18.10 ? 264 MET C SD  1 
ATOM   6093 C CE  . MET C 1 244 ? -4.155  4.627   -12.058 1.00 18.10 ? 264 MET C CE  1 
ATOM   6094 N N   . ALA C 1 245 ? -7.974  0.001   -13.506 1.00 19.34 ? 265 ALA C N   1 
ATOM   6095 C CA  . ALA C 1 245 ? -8.228  -1.408  -13.159 1.00 19.34 ? 265 ALA C CA  1 
ATOM   6096 C C   . ALA C 1 245 ? -9.402  -2.015  -13.879 1.00 19.34 ? 265 ALA C C   1 
ATOM   6097 O O   . ALA C 1 245 ? -9.769  -3.162  -13.683 1.00 19.34 ? 265 ALA C O   1 
ATOM   6098 C CB  . ALA C 1 245 ? -8.503  -1.458  -11.654 1.00 17.87 ? 265 ALA C CB  1 
ATOM   6099 N N   . ASP C 1 246 ? -10.097 -1.215  -14.659 1.00 21.22 ? 266 ASP C N   1 
ATOM   6100 C CA  . ASP C 1 246 ? -11.315 -1.578  -15.375 1.00 21.22 ? 266 ASP C CA  1 
ATOM   6101 C C   . ASP C 1 246 ? -12.260 -2.217  -14.341 1.00 21.22 ? 266 ASP C C   1 
ATOM   6102 O O   . ASP C 1 246 ? -12.790 -3.269  -14.597 1.00 21.22 ? 266 ASP C O   1 
ATOM   6103 C CB  . ASP C 1 246 ? -11.004 -2.501  -16.522 1.00 22.78 ? 266 ASP C CB  1 
ATOM   6104 C CG  . ASP C 1 246 ? -12.156 -2.637  -17.511 1.00 22.78 ? 266 ASP C CG  1 
ATOM   6105 O OD1 . ASP C 1 246 ? -13.040 -1.742  -17.524 1.00 22.78 ? 266 ASP C OD1 1 
ATOM   6106 O OD2 . ASP C 1 246 ? -12.208 -3.620  -18.267 1.00 22.78 ? 266 ASP C OD2 1 
ATOM   6107 N N   . ALA C 1 247 ? -12.505 -1.537  -13.238 1.00 21.40 ? 267 ALA C N   1 
ATOM   6108 C CA  . ALA C 1 247 ? -13.302 -2.043  -12.167 1.00 21.40 ? 267 ALA C CA  1 
ATOM   6109 C C   . ALA C 1 247 ? -14.768 -2.207  -12.413 1.00 21.40 ? 267 ALA C C   1 
ATOM   6110 O O   . ALA C 1 247 ? -15.388 -3.099  -11.774 1.00 21.40 ? 267 ALA C O   1 
ATOM   6111 C CB  . ALA C 1 247 ? -13.145 -1.082  -10.936 1.00 19.19 ? 267 ALA C CB  1 
ATOM   6112 N N   . HIS C 1 248 ? -15.406 -1.348  -13.215 1.00 20.35 ? 268 HIS C N   1 
ATOM   6113 C CA  . HIS C 1 248 ? -16.852 -1.404  -13.441 1.00 20.35 ? 268 HIS C CA  1 
ATOM   6114 C C   . HIS C 1 248 ? -17.490 -1.058  -12.095 1.00 20.35 ? 268 HIS C C   1 
ATOM   6115 O O   . HIS C 1 248 ? -18.487 -1.626  -11.697 1.00 20.35 ? 268 HIS C O   1 
ATOM   6116 C CB  . HIS C 1 248 ? -17.335 -2.756  -13.896 1.00 22.14 ? 268 HIS C CB  1 
ATOM   6117 C CG  . HIS C 1 248 ? -16.862 -3.218  -15.228 1.00 22.14 ? 268 HIS C CG  1 
ATOM   6118 N ND1 . HIS C 1 248 ? -17.707 -3.730  -16.170 1.00 22.14 ? 268 HIS C ND1 1 
ATOM   6119 C CD2 . HIS C 1 248 ? -15.634 -3.201  -15.800 1.00 22.14 ? 268 HIS C CD2 1 
ATOM   6120 C CE1 . HIS C 1 248 ? -17.017 -4.048  -17.271 1.00 22.14 ? 268 HIS C CE1 1 
ATOM   6121 N NE2 . HIS C 1 248 ? -15.747 -3.721  -17.073 1.00 22.14 ? 268 HIS C NE2 1 
ATOM   6122 N N   . ALA C 1 249 ? -16.907 -0.108  -11.417 1.00 20.70 ? 269 ALA C N   1 
ATOM   6123 C CA  . ALA C 1 249 ? -17.325 0.320   -10.098 1.00 20.70 ? 269 ALA C CA  1 
ATOM   6124 C C   . ALA C 1 249 ? -18.383 1.375   -10.217 1.00 20.70 ? 269 ALA C C   1 
ATOM   6125 O O   . ALA C 1 249 ? -18.287 2.207   -11.124 1.00 20.70 ? 269 ALA C O   1 
ATOM   6126 C CB  . ALA C 1 249 ? -16.157 0.952   -9.330  1.00 19.38 ? 269 ALA C CB  1 
ATOM   6127 N N   . GLU C 1 250 ? -19.347 1.346   -9.333  1.00 20.78 ? 270 GLU C N   1 
ATOM   6128 C CA  . GLU C 1 250 ? -20.388 2.348   -9.333  1.00 20.78 ? 270 GLU C CA  1 
ATOM   6129 C C   . GLU C 1 250 ? -19.914 3.556   -8.534  1.00 20.78 ? 270 GLU C C   1 
ATOM   6130 O O   . GLU C 1 250 ? -19.596 3.431   -7.345  1.00 20.78 ? 270 GLU C O   1 
ATOM   6131 C CB  . GLU C 1 250 ? -21.648 1.785   -8.685  1.00 21.15 ? 270 GLU C CB  1 
ATOM   6132 C CG  . GLU C 1 250 ? -22.782 2.803   -8.689  1.00 21.15 ? 270 GLU C CG  1 
ATOM   6133 C CD  . GLU C 1 250 ? -23.904 2.314   -7.793  1.00 21.15 ? 270 GLU C CD  1 
ATOM   6134 O OE1 . GLU C 1 250 ? -24.487 1.275   -8.100  1.00 21.15 ? 270 GLU C OE1 1 
ATOM   6135 O OE2 . GLU C 1 250 ? -24.124 2.999   -6.783  1.00 21.15 ? 270 GLU C OE2 1 
ATOM   6136 N N   . LEU C 1 251 ? -19.843 4.718   -9.194  1.00 20.72 ? 271 LEU C N   1 
ATOM   6137 C CA  . LEU C 1 251 ? -19.392 5.933   -8.507  1.00 20.72 ? 271 LEU C CA  1 
ATOM   6138 C C   . LEU C 1 251 ? -20.286 7.082   -8.940  1.00 20.72 ? 271 LEU C C   1 
ATOM   6139 O O   . LEU C 1 251 ? -20.742 7.030   -10.086 1.00 20.72 ? 271 LEU C O   1 
ATOM   6140 C CB  . LEU C 1 251 ? -17.962 6.289   -8.877  1.00 19.72 ? 271 LEU C CB  1 
ATOM   6141 C CG  . LEU C 1 251 ? -16.835 5.282   -8.547  1.00 19.72 ? 271 LEU C CG  1 
ATOM   6142 C CD1 . LEU C 1 251 ? -15.640 5.524   -9.457  1.00 19.72 ? 271 LEU C CD1 1 
ATOM   6143 C CD2 . LEU C 1 251 ? -16.472 5.418   -7.096  1.00 19.72 ? 271 LEU C CD2 1 
ATOM   6144 N N   . VAL C 1 252 ? -20.551 8.039   -8.101  1.00 21.80 ? 272 VAL C N   1 
ATOM   6145 C CA  . VAL C 1 252 ? -21.373 9.179   -8.461  1.00 21.80 ? 272 VAL C CA  1 
ATOM   6146 C C   . VAL C 1 252 ? -20.416 10.227  -9.020  1.00 21.80 ? 272 VAL C C   1 
ATOM   6147 O O   . VAL C 1 252 ? -19.642 10.822  -8.290  1.00 21.80 ? 272 VAL C O   1 
ATOM   6148 C CB  . VAL C 1 252 ? -22.219 9.706   -7.298  1.00 21.15 ? 272 VAL C CB  1 
ATOM   6149 C CG1 . VAL C 1 252 ? -21.448 10.018  -6.053  1.00 21.15 ? 272 VAL C CG1 1 
ATOM   6150 C CG2 . VAL C 1 252 ? -22.912 11.024  -7.695  1.00 21.15 ? 272 VAL C CG2 1 
ATOM   6151 N N   . VAL C 1 253 ? -20.427 10.440  -10.329 1.00 21.06 ? 273 VAL C N   1 
ATOM   6152 C CA  . VAL C 1 253 ? -19.590 11.366  -11.031 1.00 21.06 ? 273 VAL C CA  1 
ATOM   6153 C C   . VAL C 1 253 ? -20.427 12.230  -11.965 1.00 21.06 ? 273 VAL C C   1 
ATOM   6154 O O   . VAL C 1 253 ? -21.598 11.938  -12.209 1.00 21.06 ? 273 VAL C O   1 
ATOM   6155 C CB  . VAL C 1 253 ? -18.546 10.672  -11.932 1.00 19.24 ? 273 VAL C CB  1 
ATOM   6156 C CG1 . VAL C 1 253 ? -17.565 9.795   -11.173 1.00 19.24 ? 273 VAL C CG1 1 
ATOM   6157 C CG2 . VAL C 1 253 ? -19.247 9.768   -12.959 1.00 19.24 ? 273 VAL C CG2 1 
ATOM   6158 N N   . SER C 1 254 ? -19.798 13.262  -12.489 1.00 22.22 ? 274 SER C N   1 
ATOM   6159 C CA  . SER C 1 254 ? -20.493 14.136  -13.470 1.00 22.22 ? 274 SER C CA  1 
ATOM   6160 C C   . SER C 1 254 ? -20.415 13.459  -14.829 1.00 22.22 ? 274 SER C C   1 
ATOM   6161 O O   . SER C 1 254 ? -19.321 13.314  -15.392 1.00 22.22 ? 274 SER C O   1 
ATOM   6162 C CB  . SER C 1 254 ? -19.858 15.514  -13.428 1.00 23.93 ? 274 SER C CB  1 
ATOM   6163 O OG  . SER C 1 254 ? -20.650 16.363  -14.254 1.00 23.93 ? 274 SER C OG  1 
ATOM   6164 N N   . ASN C 1 255 ? -21.561 12.990  -15.320 1.00 23.11 ? 275 ASN C N   1 
ATOM   6165 C CA  . ASN C 1 255 ? -21.585 12.311  -16.606 1.00 23.11 ? 275 ASN C CA  1 
ATOM   6166 C C   . ASN C 1 255 ? -22.836 12.749  -17.381 1.00 23.11 ? 275 ASN C C   1 
ATOM   6167 O O   . ASN C 1 255 ? -23.777 13.331  -16.803 1.00 23.11 ? 275 ASN C O   1 
ATOM   6168 C CB  . ASN C 1 255 ? -21.557 10.791  -16.433 1.00 22.16 ? 275 ASN C CB  1 
ATOM   6169 C CG  . ASN C 1 255 ? -22.711 10.239  -15.624 1.00 22.16 ? 275 ASN C CG  1 
ATOM   6170 O OD1 . ASN C 1 255 ? -23.506 9.429   -16.134 1.00 22.16 ? 275 ASN C OD1 1 
ATOM   6171 N ND2 . ASN C 1 255 ? -22.846 10.626  -14.360 1.00 22.16 ? 275 ASN C ND2 1 
ATOM   6172 N N   . ARG C 1 256 ? -22.809 12.523  -18.686 1.00 29.65 ? 276 ARG C N   1 
ATOM   6173 C CA  . ARG C 1 256 ? -23.937 12.936  -19.505 1.00 29.65 ? 276 ARG C CA  1 
ATOM   6174 C C   . ARG C 1 256 ? -24.881 11.781  -19.803 1.00 29.65 ? 276 ARG C C   1 
ATOM   6175 O O   . ARG C 1 256 ? -24.583 10.915  -20.630 1.00 29.65 ? 276 ARG C O   1 
ATOM   6176 C CB  . ARG C 1 256 ? -23.475 13.525  -20.863 1.00 38.27 ? 276 ARG C CB  1 
ATOM   6177 C CG  . ARG C 1 256 ? -24.737 14.168  -21.498 1.00 38.27 ? 276 ARG C CG  1 
ATOM   6178 C CD  . ARG C 1 256 ? -24.276 15.013  -22.661 1.00 38.27 ? 276 ARG C CD  1 
ATOM   6179 N NE  . ARG C 1 256 ? -23.589 14.138  -23.632 1.00 38.27 ? 276 ARG C NE  1 
ATOM   6180 C CZ  . ARG C 1 256 ? -22.992 14.706  -24.684 1.00 38.27 ? 276 ARG C CZ  1 
ATOM   6181 N NH1 . ARG C 1 256 ? -23.005 16.056  -24.799 1.00 38.27 ? 276 ARG C NH1 1 
ATOM   6182 N NH2 . ARG C 1 256 ? -22.400 13.974  -25.644 1.00 38.27 ? 276 ARG C NH2 1 
ATOM   6183 N N   . ARG C 1 257 ? -26.028 11.836  -19.156 1.00 35.49 ? 277 ARG C N   1 
ATOM   6184 C CA  . ARG C 1 257 ? -27.016 10.786  -19.363 1.00 35.49 ? 277 ARG C CA  1 
ATOM   6185 C C   . ARG C 1 257 ? -27.867 11.094  -20.590 1.00 35.49 ? 277 ARG C C   1 
ATOM   6186 O O   . ARG C 1 257 ? -28.230 12.238  -20.851 1.00 35.49 ? 277 ARG C O   1 
ATOM   6187 C CB  . ARG C 1 257 ? -27.894 10.687  -18.117 1.00 34.45 ? 277 ARG C CB  1 
ATOM   6188 C CG  . ARG C 1 257 ? -27.167 10.509  -16.791 1.00 34.45 ? 277 ARG C CG  1 
ATOM   6189 C CD  . ARG C 1 257 ? -28.144 10.591  -15.617 1.00 34.45 ? 277 ARG C CD  1 
ATOM   6190 N NE  . ARG C 1 257 ? -29.183 9.588   -15.675 1.00 34.45 ? 277 ARG C NE  1 
ATOM   6191 C CZ  . ARG C 1 257 ? -29.184 8.287   -15.454 1.00 34.45 ? 277 ARG C CZ  1 
ATOM   6192 N NH1 . ARG C 1 257 ? -28.122 7.604   -15.032 1.00 34.45 ? 277 ARG C NH1 1 
ATOM   6193 N NH2 . ARG C 1 257 ? -30.320 7.603   -15.652 1.00 34.45 ? 277 ARG C NH2 1 
ATOM   6194 N N   . ASP C 1 258 ? -28.253 10.035  -21.304 1.00 42.61 ? 278 ASP C N   1 
ATOM   6195 C CA  . ASP C 1 258 ? -29.135 10.216  -22.456 1.00 42.61 ? 278 ASP C CA  1 
ATOM   6196 C C   . ASP C 1 258 ? -30.418 10.913  -22.082 1.00 42.61 ? 278 ASP C C   1 
ATOM   6197 O O   . ASP C 1 258 ? -30.828 11.864  -22.786 1.00 42.61 ? 278 ASP C O   1 
ATOM   6198 C CB  . ASP C 1 258 ? -29.493 8.836   -23.062 1.00 48.53 ? 278 ASP C CB  1 
ATOM   6199 C CG  . ASP C 1 258 ? -28.269 8.449   -23.917 1.00 48.53 ? 278 ASP C CG  1 
ATOM   6200 O OD1 . ASP C 1 258 ? -28.157 9.028   -25.031 1.00 48.53 ? 278 ASP C OD1 1 
ATOM   6201 O OD2 . ASP C 1 258 ? -27.457 7.640   -23.432 1.00 48.53 ? 278 ASP C OD2 1 
ATOM   6202 N N   . ASP C 1 259 ? -31.068 10.554  -20.989 1.00 41.84 ? 279 ASP C N   1 
ATOM   6203 C CA  . ASP C 1 259 ? -32.297 11.172  -20.557 1.00 41.84 ? 279 ASP C CA  1 
ATOM   6204 C C   . ASP C 1 259 ? -32.145 12.590  -20.049 1.00 41.84 ? 279 ASP C C   1 
ATOM   6205 O O   . ASP C 1 259 ? -33.161 13.293  -19.963 1.00 41.84 ? 279 ASP C O   1 
ATOM   6206 C CB  . ASP C 1 259 ? -32.941 10.417  -19.387 1.00 46.18 ? 279 ASP C CB  1 
ATOM   6207 C CG  . ASP C 1 259 ? -32.017 9.817   -18.356 1.00 46.18 ? 279 ASP C CG  1 
ATOM   6208 O OD1 . ASP C 1 259 ? -31.432 8.744   -18.722 1.00 46.18 ? 279 ASP C OD1 1 
ATOM   6209 O OD2 . ASP C 1 259 ? -31.895 10.357  -17.227 1.00 46.18 ? 279 ASP C OD2 1 
ATOM   6210 N N   . MET C 1 260 ? -30.961 13.017  -19.659 1.00 36.77 ? 280 MET C N   1 
ATOM   6211 C CA  . MET C 1 260 ? -30.787 14.375  -19.136 1.00 36.77 ? 280 MET C CA  1 
ATOM   6212 C C   . MET C 1 260 ? -30.296 15.309  -20.217 1.00 36.77 ? 280 MET C C   1 
ATOM   6213 O O   . MET C 1 260 ? -30.580 16.506  -20.201 1.00 36.77 ? 280 MET C O   1 
ATOM   6214 C CB  . MET C 1 260 ? -29.833 14.335  -17.945 1.00 37.81 ? 280 MET C CB  1 
ATOM   6215 C CG  . MET C 1 260 ? -30.371 13.588  -16.723 1.00 37.81 ? 280 MET C CG  1 
ATOM   6216 S SD  . MET C 1 260 ? -31.475 14.659  -15.748 1.00 37.81 ? 280 MET C SD  1 
ATOM   6217 C CE  . MET C 1 260 ? -33.038 13.886  -16.149 1.00 37.81 ? 280 MET C CE  1 
ATOM   6218 N N   . GLY C 1 261 ? -29.496 14.799  -21.133 1.00 33.95 ? 281 GLY C N   1 
ATOM   6219 C CA  . GLY C 1 261 ? -28.883 15.484  -22.220 1.00 33.95 ? 281 GLY C CA  1 
ATOM   6220 C C   . GLY C 1 261 ? -27.749 16.457  -21.956 1.00 33.95 ? 281 GLY C C   1 
ATOM   6221 O O   . GLY C 1 261 ? -27.076 16.974  -22.915 1.00 33.95 ? 281 GLY C O   1 
ATOM   6222 N N   . MET C 1 262 ? -27.463 16.799  -20.740 1.00 29.38 ? 282 MET C N   1 
ATOM   6223 C CA  . MET C 1 262 ? -26.477 17.650  -20.150 1.00 29.38 ? 282 MET C CA  1 
ATOM   6224 C C   . MET C 1 262 ? -25.717 16.774  -19.128 1.00 29.38 ? 282 MET C C   1 
ATOM   6225 O O   . MET C 1 262 ? -26.122 15.644  -18.831 1.00 29.38 ? 282 MET C O   1 
ATOM   6226 C CB  . MET C 1 262 ? -27.128 18.834  -19.441 1.00 31.26 ? 282 MET C CB  1 
ATOM   6227 C CG  . MET C 1 262 ? -26.190 19.910  -18.948 1.00 31.26 ? 282 MET C CG  1 
ATOM   6228 S SD  . MET C 1 262 ? -24.901 20.245  -20.186 1.00 31.26 ? 282 MET C SD  1 
ATOM   6229 C CE  . MET C 1 262 ? -23.646 20.997  -19.213 1.00 31.26 ? 282 MET C CE  1 
ATOM   6230 N N   . TYR C 1 263 ? -24.620 17.229  -18.622 1.00 23.60 ? 283 TYR C N   1 
ATOM   6231 C CA  . TYR C 1 263 ? -23.743 16.673  -17.647 1.00 23.60 ? 283 TYR C CA  1 
ATOM   6232 C C   . TYR C 1 263 ? -24.239 17.048  -16.260 1.00 23.60 ? 283 TYR C C   1 
ATOM   6233 O O   . TYR C 1 263 ? -24.627 18.201  -16.032 1.00 23.60 ? 283 TYR C O   1 
ATOM   6234 C CB  . TYR C 1 263 ? -22.314 17.242  -17.808 1.00 20.19 ? 283 TYR C CB  1 
ATOM   6235 C CG  . TYR C 1 263 ? -21.443 16.460  -18.749 1.00 20.19 ? 283 TYR C CG  1 
ATOM   6236 C CD1 . TYR C 1 263 ? -21.402 16.680  -20.129 1.00 20.19 ? 283 TYR C CD1 1 
ATOM   6237 C CD2 . TYR C 1 263 ? -20.620 15.474  -18.241 1.00 20.19 ? 283 TYR C CD2 1 
ATOM   6238 C CE1 . TYR C 1 263 ? -20.577 15.939  -20.959 1.00 20.19 ? 283 TYR C CE1 1 
ATOM   6239 C CE2 . TYR C 1 263 ? -19.793 14.738  -19.081 1.00 20.19 ? 283 TYR C CE2 1 
ATOM   6240 C CZ  . TYR C 1 263 ? -19.773 14.969  -20.421 1.00 20.19 ? 283 TYR C CZ  1 
ATOM   6241 O OH  . TYR C 1 263 ? -18.923 14.182  -21.160 1.00 20.19 ? 283 TYR C OH  1 
ATOM   6242 N N   . LEU C 1 264 ? -24.278 16.105  -15.338 1.00 22.00 ? 284 LEU C N   1 
ATOM   6243 C CA  . LEU C 1 264 ? -24.656 16.334  -13.932 1.00 22.00 ? 284 LEU C CA  1 
ATOM   6244 C C   . LEU C 1 264 ? -24.233 15.071  -13.133 1.00 22.00 ? 284 LEU C C   1 
ATOM   6245 O O   . LEU C 1 264 ? -23.973 14.039  -13.773 1.00 22.00 ? 284 LEU C O   1 
ATOM   6246 C CB  . LEU C 1 264 ? -26.071 16.634  -13.586 1.00 21.72 ? 284 LEU C CB  1 
ATOM   6247 C CG  . LEU C 1 264 ? -27.283 15.959  -14.163 1.00 21.72 ? 284 LEU C CG  1 
ATOM   6248 C CD1 . LEU C 1 264 ? -27.375 14.483  -13.828 1.00 21.72 ? 284 LEU C CD1 1 
ATOM   6249 C CD2 . LEU C 1 264 ? -28.554 16.669  -13.648 1.00 21.72 ? 284 LEU C CD2 1 
ATOM   6250 N N   . SER C 1 265 ? -24.198 15.228  -11.822 1.00 21.05 ? 285 SER C N   1 
ATOM   6251 C CA  . SER C 1 265 ? -23.795 14.049  -11.033 1.00 21.05 ? 285 SER C CA  1 
ATOM   6252 C C   . SER C 1 265 ? -24.962 13.105  -10.778 1.00 21.05 ? 285 SER C C   1 
ATOM   6253 O O   . SER C 1 265 ? -26.058 13.438  -10.352 1.00 21.05 ? 285 SER C O   1 
ATOM   6254 C CB  . SER C 1 265 ? -23.224 14.476  -9.711  1.00 21.08 ? 285 SER C CB  1 
ATOM   6255 O OG  . SER C 1 265 ? -21.993 15.151  -9.863  1.00 21.08 ? 285 SER C OG  1 
ATOM   6256 N N   . TYR C 1 266 ? -24.640 11.840  -11.044 1.00 20.94 ? 286 TYR C N   1 
ATOM   6257 C CA  . TYR C 1 266 ? -25.556 10.719  -10.884 1.00 20.94 ? 286 TYR C CA  1 
ATOM   6258 C C   . TYR C 1 266 ? -24.687 9.469   -11.011 1.00 20.94 ? 286 TYR C C   1 
ATOM   6259 O O   . TYR C 1 266 ? -23.774 9.468   -11.847 1.00 20.94 ? 286 TYR C O   1 
ATOM   6260 C CB  . TYR C 1 266 ? -26.601 10.815  -11.944 1.00 22.44 ? 286 TYR C CB  1 
ATOM   6261 C CG  . TYR C 1 266 ? -27.851 9.997   -11.793 1.00 22.44 ? 286 TYR C CG  1 
ATOM   6262 C CD1 . TYR C 1 266 ? -27.875 8.633   -12.057 1.00 22.44 ? 286 TYR C CD1 1 
ATOM   6263 C CD2 . TYR C 1 266 ? -29.020 10.606  -11.362 1.00 22.44 ? 286 TYR C CD2 1 
ATOM   6264 C CE1 . TYR C 1 266 ? -29.034 7.902   -11.933 1.00 22.44 ? 286 TYR C CE1 1 
ATOM   6265 C CE2 . TYR C 1 266 ? -30.187 9.873   -11.215 1.00 22.44 ? 286 TYR C CE2 1 
ATOM   6266 C CZ  . TYR C 1 266 ? -30.179 8.542   -11.514 1.00 22.44 ? 286 TYR C CZ  1 
ATOM   6267 O OH  . TYR C 1 266 ? -31.364 7.819   -11.384 1.00 22.44 ? 286 TYR C OH  1 
ATOM   6268 N N   . PRO C 1 267 ? -24.898 8.463   -10.165 1.00 20.59 ? 287 PRO C N   1 
ATOM   6269 C CA  . PRO C 1 267 ? -24.123 7.245   -10.203 1.00 20.59 ? 287 PRO C CA  1 
ATOM   6270 C C   . PRO C 1 267 ? -24.036 6.637   -11.595 1.00 20.59 ? 287 PRO C C   1 
ATOM   6271 O O   . PRO C 1 267 ? -24.997 6.647   -12.372 1.00 20.59 ? 287 PRO C O   1 
ATOM   6272 C CB  . PRO C 1 267 ? -24.848 6.290   -9.242  1.00 20.00 ? 287 PRO C CB  1 
ATOM   6273 C CG  . PRO C 1 267 ? -26.082 7.012   -8.816  1.00 20.00 ? 287 PRO C CG  1 
ATOM   6274 C CD  . PRO C 1 267 ? -25.932 8.478   -9.137  1.00 20.00 ? 287 PRO C CD  1 
ATOM   6275 N N   . ALA C 1 268 ? -22.879 6.097   -11.933 1.00 18.69 ? 288 ALA C N   1 
ATOM   6276 C CA  . ALA C 1 268 ? -22.642 5.460   -13.215 1.00 18.69 ? 288 ALA C CA  1 
ATOM   6277 C C   . ALA C 1 268 ? -21.622 4.370   -13.024 1.00 18.69 ? 288 ALA C C   1 
ATOM   6278 O O   . ALA C 1 268 ? -20.960 4.426   -11.991 1.00 18.69 ? 288 ALA C O   1 
ATOM   6279 C CB  . ALA C 1 268 ? -22.072 6.477   -14.202 1.00 18.93 ? 288 ALA C CB  1 
ATOM   6280 N N   . ILE C 1 269 ? -21.470 3.452   -13.939 1.00 18.33 ? 289 ILE C N   1 
ATOM   6281 C CA  . ILE C 1 269 ? -20.503 2.345   -13.817 1.00 18.33 ? 289 ILE C CA  1 
ATOM   6282 C C   . ILE C 1 269 ? -19.202 2.699   -14.500 1.00 18.33 ? 289 ILE C C   1 
ATOM   6283 O O   . ILE C 1 269 ? -19.178 2.771   -15.735 1.00 18.33 ? 289 ILE C O   1 
ATOM   6284 C CB  . ILE C 1 269 ? -21.087 1.072   -14.434 1.00 17.22 ? 289 ILE C CB  1 
ATOM   6285 C CG1 . ILE C 1 269 ? -22.405 0.676   -13.763 1.00 17.22 ? 289 ILE C CG1 1 
ATOM   6286 C CG2 . ILE C 1 269 ? -20.133 -0.095  -14.307 1.00 17.22 ? 289 ILE C CG2 1 
ATOM   6287 C CD1 . ILE C 1 269 ? -22.554 0.850   -12.295 1.00 17.22 ? 289 ILE C CD1 1 
ATOM   6288 N N   . ILE C 1 270 ? -18.131 2.952   -13.768 1.00 17.86 ? 290 ILE C N   1 
ATOM   6289 C CA  . ILE C 1 270 ? -16.864 3.372   -14.359 1.00 17.86 ? 290 ILE C CA  1 
ATOM   6290 C C   . ILE C 1 270 ? -15.907 2.250   -14.635 1.00 17.86 ? 290 ILE C C   1 
ATOM   6291 O O   . ILE C 1 270 ? -15.735 1.343   -13.813 1.00 17.86 ? 290 ILE C O   1 
ATOM   6292 C CB  . ILE C 1 270 ? -16.187 4.373   -13.399 1.00 18.27 ? 290 ILE C CB  1 
ATOM   6293 C CG1 . ILE C 1 270 ? -17.170 5.474   -13.006 1.00 18.27 ? 290 ILE C CG1 1 
ATOM   6294 C CG2 . ILE C 1 270 ? -14.939 4.977   -14.019 1.00 18.27 ? 290 ILE C CG2 1 
ATOM   6295 C CD1 . ILE C 1 270 ? -17.736 6.312   -14.095 1.00 18.27 ? 290 ILE C CD1 1 
ATOM   6296 N N   . GLY C 1 271 ? -15.214 2.284   -15.768 1.00 16.91 ? 291 GLY C N   1 
ATOM   6297 C CA  . GLY C 1 271 ? -14.269 1.249   -16.134 1.00 16.91 ? 291 GLY C CA  1 
ATOM   6298 C C   . GLY C 1 271 ? -13.153 1.857   -16.933 1.00 16.91 ? 291 GLY C C   1 
ATOM   6299 O O   . GLY C 1 271 ? -13.037 3.079   -16.975 1.00 16.91 ? 291 GLY C O   1 
ATOM   6300 N N   . ARG C 1 272 ? -12.371 1.056   -17.639 1.00 21.42 ? 292 ARG C N   1 
ATOM   6301 C CA  . ARG C 1 272 ? -11.238 1.536   -18.415 1.00 21.42 ? 292 ARG C CA  1 
ATOM   6302 C C   . ARG C 1 272 ? -11.620 2.414   -19.605 1.00 21.42 ? 292 ARG C C   1 
ATOM   6303 O O   . ARG C 1 272 ? -10.810 3.224   -20.103 1.00 21.42 ? 292 ARG C O   1 
ATOM   6304 C CB  . ARG C 1 272 ? -10.432 0.356   -18.988 1.00 21.93 ? 292 ARG C CB  1 
ATOM   6305 C CG  . ARG C 1 272 ? -9.012  0.773   -19.304 1.00 21.93 ? 292 ARG C CG  1 
ATOM   6306 C CD  . ARG C 1 272 ? -8.115  -0.410  -19.528 1.00 21.93 ? 292 ARG C CD  1 
ATOM   6307 N NE  . ARG C 1 272 ? -7.797  -1.028  -18.243 1.00 21.93 ? 292 ARG C NE  1 
ATOM   6308 C CZ  . ARG C 1 272 ? -7.369  -2.249  -18.028 1.00 21.93 ? 292 ARG C CZ  1 
ATOM   6309 N NH1 . ARG C 1 272 ? -7.172  -3.103  -19.023 1.00 21.93 ? 292 ARG C NH1 1 
ATOM   6310 N NH2 . ARG C 1 272 ? -7.093  -2.631  -16.785 1.00 21.93 ? 292 ARG C NH2 1 
ATOM   6311 N N   . ASP C 1 273 ? -12.847 2.296   -20.063 1.00 27.30 ? 293 ASP C N   1 
ATOM   6312 C CA  . ASP C 1 273 ? -13.336 3.085   -21.154 1.00 27.30 ? 293 ASP C CA  1 
ATOM   6313 C C   . ASP C 1 273 ? -14.138 4.237   -20.652 1.00 27.30 ? 293 ASP C C   1 
ATOM   6314 O O   . ASP C 1 273 ? -14.732 4.932   -21.478 1.00 27.30 ? 293 ASP C O   1 
ATOM   6315 C CB  . ASP C 1 273 ? -14.227 2.215   -22.078 1.00 36.17 ? 293 ASP C CB  1 
ATOM   6316 C CG  . ASP C 1 273 ? -13.340 1.500   -23.102 1.00 36.17 ? 293 ASP C CG  1 
ATOM   6317 O OD1 . ASP C 1 273 ? -12.909 2.197   -24.089 1.00 36.17 ? 293 ASP C OD1 1 
ATOM   6318 O OD2 . ASP C 1 273 ? -13.088 0.280   -22.880 1.00 36.17 ? 293 ASP C OD2 1 
ATOM   6319 N N   . GLY C 1 274 ? -14.160 4.510   -19.369 1.00 24.56 ? 294 GLY C N   1 
ATOM   6320 C CA  . GLY C 1 274 ? -14.962 5.677   -18.913 1.00 24.56 ? 294 GLY C CA  1 
ATOM   6321 C C   . GLY C 1 274 ? -16.311 5.152   -18.477 1.00 24.56 ? 294 GLY C C   1 
ATOM   6322 O O   . GLY C 1 274 ? -16.312 4.046   -17.926 1.00 24.56 ? 294 GLY C O   1 
ATOM   6323 N N   . VAL C 1 275 ? -17.365 5.894   -18.659 1.00 23.82 ? 295 VAL C N   1 
ATOM   6324 C CA  . VAL C 1 275 ? -18.687 5.447   -18.238 1.00 23.82 ? 295 VAL C CA  1 
ATOM   6325 C C   . VAL C 1 275 ? -19.104 4.249   -19.056 1.00 23.82 ? 295 VAL C C   1 
ATOM   6326 O O   . VAL C 1 275 ? -19.257 4.326   -20.275 1.00 23.82 ? 295 VAL C O   1 
ATOM   6327 C CB  . VAL C 1 275 ? -19.733 6.550   -18.372 1.00 22.70 ? 295 VAL C CB  1 
ATOM   6328 C CG1 . VAL C 1 275 ? -21.100 6.068   -17.912 1.00 22.70 ? 295 VAL C CG1 1 
ATOM   6329 C CG2 . VAL C 1 275 ? -19.346 7.740   -17.501 1.00 22.70 ? 295 VAL C CG2 1 
ATOM   6330 N N   . LEU C 1 276 ? -19.290 3.111   -18.379 1.00 25.16 ? 296 LEU C N   1 
ATOM   6331 C CA  . LEU C 1 276 ? -19.706 1.899   -19.120 1.00 25.16 ? 296 LEU C CA  1 
ATOM   6332 C C   . LEU C 1 276 ? -21.208 1.710   -19.043 1.00 25.16 ? 296 LEU C C   1 
ATOM   6333 O O   . LEU C 1 276 ? -21.815 1.000   -19.878 1.00 25.16 ? 296 LEU C O   1 
ATOM   6334 C CB  . LEU C 1 276 ? -18.952 0.687   -18.564 1.00 24.11 ? 296 LEU C CB  1 
ATOM   6335 C CG  . LEU C 1 276 ? -17.428 0.750   -18.644 1.00 24.11 ? 296 LEU C CG  1 
ATOM   6336 C CD1 . LEU C 1 276 ? -16.864 -0.612  -18.189 1.00 24.11 ? 296 LEU C CD1 1 
ATOM   6337 C CD2 . LEU C 1 276 ? -16.869 1.064   -20.006 1.00 24.11 ? 296 LEU C CD2 1 
ATOM   6338 N N   . ALA C 1 277 ? -21.870 2.297   -18.048 1.00 26.43 ? 297 ALA C N   1 
ATOM   6339 C CA  . ALA C 1 277 ? -23.320 2.111   -17.987 1.00 26.43 ? 297 ALA C CA  1 
ATOM   6340 C C   . ALA C 1 277 ? -23.897 3.095   -17.000 1.00 26.43 ? 297 ALA C C   1 
ATOM   6341 O O   . ALA C 1 277 ? -23.133 3.651   -16.226 1.00 26.43 ? 297 ALA C O   1 
ATOM   6342 C CB  . ALA C 1 277 ? -23.686 0.704   -17.589 1.00 25.39 ? 297 ALA C CB  1 
ATOM   6343 N N   . GLU C 1 278 ? -25.186 3.330   -17.094 1.00 31.66 ? 298 GLU C N   1 
ATOM   6344 C CA  . GLU C 1 278 ? -25.862 4.292   -16.221 1.00 31.66 ? 298 GLU C CA  1 
ATOM   6345 C C   . GLU C 1 278 ? -26.590 3.495   -15.141 1.00 31.66 ? 298 GLU C C   1 
ATOM   6346 O O   . GLU C 1 278 ? -26.812 2.300   -15.305 1.00 31.66 ? 298 GLU C O   1 
ATOM   6347 C CB  . GLU C 1 278 ? -26.854 5.157   -16.978 1.00 37.08 ? 298 GLU C CB  1 
ATOM   6348 C CG  . GLU C 1 278 ? -26.246 5.996   -18.064 1.00 37.08 ? 298 GLU C CG  1 
ATOM   6349 C CD  . GLU C 1 278 ? -27.232 6.656   -19.004 1.00 37.08 ? 298 GLU C CD  1 
ATOM   6350 O OE1 . GLU C 1 278 ? -28.456 6.661   -18.699 1.00 37.08 ? 298 GLU C OE1 1 
ATOM   6351 O OE2 . GLU C 1 278 ? -26.814 7.187   -20.084 1.00 37.08 ? 298 GLU C OE2 1 
ATOM   6352 N N   . THR C 1 279 ? -26.917 4.145   -14.038 1.00 33.25 ? 299 THR C N   1 
ATOM   6353 C CA  . THR C 1 279 ? -27.633 3.452   -12.976 1.00 33.25 ? 299 THR C CA  1 
ATOM   6354 C C   . THR C 1 279 ? -29.029 4.066   -12.979 1.00 33.25 ? 299 THR C C   1 
ATOM   6355 O O   . THR C 1 279 ? -29.265 5.074   -13.669 1.00 33.25 ? 299 THR C O   1 
ATOM   6356 C CB  . THR C 1 279 ? -27.008 3.568   -11.594 1.00 33.36 ? 299 THR C CB  1 
ATOM   6357 O OG1 . THR C 1 279 ? -26.943 4.962   -11.244 1.00 33.36 ? 299 THR C OG1 1 
ATOM   6358 C CG2 . THR C 1 279 ? -25.583 2.997   -11.556 1.00 33.36 ? 299 THR C CG2 1 
ATOM   6359 N N   . THR C 1 280 ? -29.937 3.460   -12.266 1.00 34.24 ? 300 THR C N   1 
ATOM   6360 C CA  . THR C 1 280 ? -31.318 3.901   -12.214 1.00 34.24 ? 300 THR C CA  1 
ATOM   6361 C C   . THR C 1 280 ? -31.748 3.997   -10.770 1.00 34.24 ? 300 THR C C   1 
ATOM   6362 O O   . THR C 1 280 ? -31.901 2.961   -10.120 1.00 34.24 ? 300 THR C O   1 
ATOM   6363 C CB  . THR C 1 280 ? -32.224 2.888   -12.930 1.00 34.89 ? 300 THR C CB  1 
ATOM   6364 O OG1 . THR C 1 280 ? -31.803 2.738   -14.309 1.00 34.89 ? 300 THR C OG1 1 
ATOM   6365 C CG2 . THR C 1 280 ? -33.667 3.340   -12.952 1.00 34.89 ? 300 THR C CG2 1 
ATOM   6366 N N   . LEU C 1 281 ? -31.905 5.183   -10.257 1.00 34.85 ? 301 LEU C N   1 
ATOM   6367 C CA  . LEU C 1 281 ? -32.312 5.354   -8.880  1.00 34.85 ? 301 LEU C CA  1 
ATOM   6368 C C   . LEU C 1 281 ? -33.808 5.612   -8.829  1.00 34.85 ? 301 LEU C C   1 
ATOM   6369 O O   . LEU C 1 281 ? -34.324 6.372   -9.651  1.00 34.85 ? 301 LEU C O   1 
ATOM   6370 C CB  . LEU C 1 281 ? -31.594 6.549   -8.270  1.00 28.92 ? 301 LEU C CB  1 
ATOM   6371 C CG  . LEU C 1 281 ? -30.091 6.626   -8.280  1.00 28.92 ? 301 LEU C CG  1 
ATOM   6372 C CD1 . LEU C 1 281 ? -29.628 7.905   -7.557  1.00 28.92 ? 301 LEU C CD1 1 
ATOM   6373 C CD2 . LEU C 1 281 ? -29.447 5.414   -7.611  1.00 28.92 ? 301 LEU C CD2 1 
ATOM   6374 N N   . ASP C 1 282 ? -34.500 5.031   -7.865  1.00 40.71 ? 302 ASP C N   1 
ATOM   6375 C CA  . ASP C 1 282 ? -35.953 5.311   -7.746  1.00 40.71 ? 302 ASP C CA  1 
ATOM   6376 C C   . ASP C 1 282 ? -36.046 6.509   -6.806  1.00 40.71 ? 302 ASP C C   1 
ATOM   6377 O O   . ASP C 1 282 ? -36.097 6.394   -5.574  1.00 40.71 ? 302 ASP C O   1 
ATOM   6378 C CB  . ASP C 1 282 ? -36.708 4.100   -7.241  1.00 46.71 ? 302 ASP C CB  1 
ATOM   6379 C CG  . ASP C 1 282 ? -36.655 2.865   -8.126  1.00 46.71 ? 302 ASP C CG  1 
ATOM   6380 O OD1 . ASP C 1 282 ? -37.024 2.954   -9.339  1.00 46.71 ? 302 ASP C OD1 1 
ATOM   6381 O OD2 . ASP C 1 282 ? -36.224 1.777   -7.615  1.00 46.71 ? 302 ASP C OD2 1 
ATOM   6382 N N   . LEU C 1 283 ? -35.996 7.705   -7.377  1.00 38.90 ? 303 LEU C N   1 
ATOM   6383 C CA  . LEU C 1 283 ? -36.036 8.891   -6.521  1.00 38.90 ? 303 LEU C CA  1 
ATOM   6384 C C   . LEU C 1 283 ? -37.464 9.287   -6.254  1.00 38.90 ? 303 LEU C C   1 
ATOM   6385 O O   . LEU C 1 283 ? -38.382 8.987   -7.035  1.00 38.90 ? 303 LEU C O   1 
ATOM   6386 C CB  . LEU C 1 283 ? -35.313 10.060  -7.173  1.00 36.93 ? 303 LEU C CB  1 
ATOM   6387 C CG  . LEU C 1 283 ? -33.830 9.782   -7.452  1.00 36.93 ? 303 LEU C CG  1 
ATOM   6388 C CD1 . LEU C 1 283 ? -33.330 10.768  -8.478  1.00 36.93 ? 303 LEU C CD1 1 
ATOM   6389 C CD2 . LEU C 1 283 ? -33.021 9.915   -6.167  1.00 36.93 ? 303 LEU C CD2 1 
ATOM   6390 N N   . THR C 1 284 ? -37.651 10.006  -5.151  1.00 40.39 ? 304 THR C N   1 
ATOM   6391 C CA  . THR C 1 284 ? -39.019 10.491  -4.902  1.00 40.39 ? 304 THR C CA  1 
ATOM   6392 C C   . THR C 1 284 ? -39.351 11.535  -5.955  1.00 40.39 ? 304 THR C C   1 
ATOM   6393 O O   . THR C 1 284 ? -38.485 11.896  -6.765  1.00 40.39 ? 304 THR C O   1 
ATOM   6394 C CB  . THR C 1 284 ? -39.084 11.088  -3.511  1.00 37.51 ? 304 THR C CB  1 
ATOM   6395 O OG1 . THR C 1 284 ? -38.293 12.248  -3.369  1.00 37.51 ? 304 THR C OG1 1 
ATOM   6396 C CG2 . THR C 1 284 ? -38.511 10.060  -2.512  1.00 37.51 ? 304 THR C CG2 1 
ATOM   6397 N N   . THR C 1 285 ? -40.566 12.072  -5.981  1.00 45.18 ? 305 THR C N   1 
ATOM   6398 C CA  . THR C 1 285 ? -40.930 13.097  -6.952  1.00 45.18 ? 305 THR C CA  1 
ATOM   6399 C C   . THR C 1 285 ? -40.218 14.398  -6.607  1.00 45.18 ? 305 THR C C   1 
ATOM   6400 O O   . THR C 1 285 ? -39.757 15.062  -7.527  1.00 45.18 ? 305 THR C O   1 
ATOM   6401 C CB  . THR C 1 285 ? -42.432 13.420  -7.005  1.00 47.66 ? 305 THR C CB  1 
ATOM   6402 O OG1 . THR C 1 285 ? -42.969 13.377  -5.653  1.00 47.66 ? 305 THR C OG1 1 
ATOM   6403 C CG2 . THR C 1 285 ? -43.166 12.433  -7.890  1.00 47.66 ? 305 THR C CG2 1 
ATOM   6404 N N   . ASP C 1 286 ? -40.096 14.722  -5.317  1.00 46.63 ? 306 ASP C N   1 
ATOM   6405 C CA  . ASP C 1 286 ? -39.384 15.970  -5.001  1.00 46.63 ? 306 ASP C CA  1 
ATOM   6406 C C   . ASP C 1 286 ? -37.915 15.873  -5.400  1.00 46.63 ? 306 ASP C C   1 
ATOM   6407 O O   . ASP C 1 286 ? -37.344 16.835  -5.931  1.00 46.63 ? 306 ASP C O   1 
ATOM   6408 C CB  . ASP C 1 286 ? -39.476 16.355  -3.548  1.00 52.09 ? 306 ASP C CB  1 
ATOM   6409 C CG  . ASP C 1 286 ? -40.804 17.074  -3.293  1.00 52.09 ? 306 ASP C CG  1 
ATOM   6410 O OD1 . ASP C 1 286 ? -41.169 18.016  -4.049  1.00 52.09 ? 306 ASP C OD1 1 
ATOM   6411 O OD2 . ASP C 1 286 ? -41.425 16.637  -2.294  1.00 52.09 ? 306 ASP C OD2 1 
ATOM   6412 N N   . GLU C 1 287 ? -37.314 14.740  -5.167  1.00 43.81 ? 307 GLU C N   1 
ATOM   6413 C CA  . GLU C 1 287 ? -35.942 14.473  -5.527  1.00 43.81 ? 307 GLU C CA  1 
ATOM   6414 C C   . GLU C 1 287 ? -35.806 14.544  -7.033  1.00 43.81 ? 307 GLU C C   1 
ATOM   6415 O O   . GLU C 1 287 ? -34.912 15.224  -7.540  1.00 43.81 ? 307 GLU C O   1 
ATOM   6416 C CB  . GLU C 1 287 ? -35.499 13.077  -5.003  1.00 39.31 ? 307 GLU C CB  1 
ATOM   6417 C CG  . GLU C 1 287 ? -35.169 13.110  -3.533  1.00 39.31 ? 307 GLU C CG  1 
ATOM   6418 C CD  . GLU C 1 287 ? -35.012 11.785  -2.852  1.00 39.31 ? 307 GLU C CD  1 
ATOM   6419 O OE1 . GLU C 1 287 ? -35.164 10.705  -3.449  1.00 39.31 ? 307 GLU C OE1 1 
ATOM   6420 O OE2 . GLU C 1 287 ? -34.729 11.819  -1.625  1.00 39.31 ? 307 GLU C OE2 1 
ATOM   6421 N N   . GLN C 1 288 ? -36.718 13.939  -7.756  1.00 44.72 ? 308 GLN C N   1 
ATOM   6422 C CA  . GLN C 1 288 ? -36.711 13.942  -9.206  1.00 44.72 ? 308 GLN C CA  1 
ATOM   6423 C C   . GLN C 1 288 ? -36.819 15.379  -9.718  1.00 44.72 ? 308 GLN C C   1 
ATOM   6424 O O   . GLN C 1 288 ? -36.183 15.791  -10.678 1.00 44.72 ? 308 GLN C O   1 
ATOM   6425 C CB  . GLN C 1 288 ? -37.885 13.120  -9.719  1.00 50.56 ? 308 GLN C CB  1 
ATOM   6426 C CG  . GLN C 1 288 ? -37.962 12.785  -11.167 1.00 50.56 ? 308 GLN C CG  1 
ATOM   6427 C CD  . GLN C 1 288 ? -36.666 12.545  -11.903 1.00 50.56 ? 308 GLN C CD  1 
ATOM   6428 O OE1 . GLN C 1 288 ? -36.000 11.495  -11.753 1.00 50.56 ? 308 GLN C OE1 1 
ATOM   6429 N NE2 . GLN C 1 288 ? -36.254 13.532  -12.726 1.00 50.56 ? 308 GLN C NE2 1 
ATOM   6430 N N   . GLU C 1 289 ? -37.632 16.187  -9.067  1.00 44.71 ? 309 GLU C N   1 
ATOM   6431 C CA  . GLU C 1 289 ? -37.851 17.584  -9.369  1.00 44.71 ? 309 GLU C CA  1 
ATOM   6432 C C   . GLU C 1 289 ? -36.578 18.374  -9.182  1.00 44.71 ? 309 GLU C C   1 
ATOM   6433 O O   . GLU C 1 289 ? -36.192 19.165  -10.048 1.00 44.71 ? 309 GLU C O   1 
ATOM   6434 C CB  . GLU C 1 289 ? -38.950 18.128  -8.454  1.00 51.62 ? 309 GLU C CB  1 
ATOM   6435 C CG  . GLU C 1 289 ? -39.303 19.593  -8.625  1.00 51.62 ? 309 GLU C CG  1 
ATOM   6436 C CD  . GLU C 1 289 ? -40.102 20.102  -7.424  1.00 51.62 ? 309 GLU C CD  1 
ATOM   6437 O OE1 . GLU C 1 289 ? -39.528 20.123  -6.287  1.00 51.62 ? 309 GLU C OE1 1 
ATOM   6438 O OE2 . GLU C 1 289 ? -41.293 20.449  -7.633  1.00 51.62 ? 309 GLU C OE2 1 
ATOM   6439 N N   . LYS C 1 290 ? -35.895 18.172  -8.063  1.00 40.45 ? 310 LYS C N   1 
ATOM   6440 C CA  . LYS C 1 290 ? -34.631 18.894  -7.834  1.00 40.45 ? 310 LYS C CA  1 
ATOM   6441 C C   . LYS C 1 290 ? -33.559 18.498  -8.837  1.00 40.45 ? 310 LYS C C   1 
ATOM   6442 O O   . LYS C 1 290 ? -32.705 19.298  -9.228  1.00 40.45 ? 310 LYS C O   1 
ATOM   6443 C CB  . LYS C 1 290 ? -34.160 18.601  -6.419  1.00 45.05 ? 310 LYS C CB  1 
ATOM   6444 C CG  . LYS C 1 290 ? -34.977 19.437  -5.440  1.00 45.05 ? 310 LYS C CG  1 
ATOM   6445 C CD  . LYS C 1 290 ? -34.561 19.040  -4.039  1.00 45.05 ? 310 LYS C CD  1 
ATOM   6446 C CE  . LYS C 1 290 ? -35.540 19.604  -3.004  1.00 45.05 ? 310 LYS C CE  1 
ATOM   6447 N NZ  . LYS C 1 290 ? -34.842 19.711  -1.674  1.00 45.05 ? 310 LYS C NZ  1 
ATOM   6448 N N   . LEU C 1 291 ? -33.589 17.254  -9.269  1.00 36.17 ? 311 LEU C N   1 
ATOM   6449 C CA  . LEU C 1 291 ? -32.622 16.764  -10.241 1.00 36.17 ? 311 LEU C CA  1 
ATOM   6450 C C   . LEU C 1 291 ? -32.756 17.562  -11.528 1.00 36.17 ? 311 LEU C C   1 
ATOM   6451 O O   . LEU C 1 291 ? -31.770 17.985  -12.133 1.00 36.17 ? 311 LEU C O   1 
ATOM   6452 C CB  . LEU C 1 291 ? -32.835 15.280  -10.530 1.00 33.22 ? 311 LEU C CB  1 
ATOM   6453 C CG  . LEU C 1 291 ? -31.695 14.622  -11.296 1.00 33.22 ? 311 LEU C CG  1 
ATOM   6454 C CD1 . LEU C 1 291 ? -30.398 14.630  -10.508 1.00 33.22 ? 311 LEU C CD1 1 
ATOM   6455 C CD2 . LEU C 1 291 ? -32.048 13.198  -11.643 1.00 33.22 ? 311 LEU C CD2 1 
ATOM   6456 N N   . LEU C 1 292 ? -34.022 17.747  -11.960 1.00 38.31 ? 312 LEU C N   1 
ATOM   6457 C CA  . LEU C 1 292 ? -34.265 18.469  -13.211 1.00 38.31 ? 312 LEU C CA  1 
ATOM   6458 C C   . LEU C 1 292 ? -33.989 19.942  -13.068 1.00 38.31 ? 312 LEU C C   1 
ATOM   6459 O O   . LEU C 1 292 ? -33.511 20.534  -14.032 1.00 38.31 ? 312 LEU C O   1 
ATOM   6460 C CB  . LEU C 1 292 ? -35.694 18.259  -13.740 1.00 38.33 ? 312 LEU C CB  1 
ATOM   6461 C CG  . LEU C 1 292 ? -35.886 16.871  -14.368 1.00 38.33 ? 312 LEU C CG  1 
ATOM   6462 C CD1 . LEU C 1 292 ? -37.204 16.770  -15.095 1.00 38.33 ? 312 LEU C CD1 1 
ATOM   6463 C CD2 . LEU C 1 292 ? -34.769 16.565  -15.352 1.00 38.33 ? 312 LEU C CD2 1 
ATOM   6464 N N   . GLN C 1 293 ? -34.209 20.537  -11.927 1.00 41.80 ? 313 GLN C N   1 
ATOM   6465 C CA  . GLN C 1 293 ? -33.887 21.940  -11.693 1.00 41.80 ? 313 GLN C CA  1 
ATOM   6466 C C   . GLN C 1 293 ? -32.383 22.167  -11.911 1.00 41.80 ? 313 GLN C C   1 
ATOM   6467 O O   . GLN C 1 293 ? -31.925 23.112  -12.522 1.00 41.80 ? 313 GLN C O   1 
ATOM   6468 C CB  . GLN C 1 293 ? -34.228 22.272  -10.260 1.00 49.48 ? 313 GLN C CB  1 
ATOM   6469 C CG  . GLN C 1 293 ? -34.913 23.562  -9.908  1.00 49.48 ? 313 GLN C CG  1 
ATOM   6470 C CD  . GLN C 1 293 ? -35.292 23.597  -8.410  1.00 49.48 ? 313 GLN C CD  1 
ATOM   6471 O OE1 . GLN C 1 293 ? -34.401 23.865  -7.561  1.00 49.48 ? 313 GLN C OE1 1 
ATOM   6472 N NE2 . GLN C 1 293 ? -36.550 23.330  -8.052  1.00 49.48 ? 313 GLN C NE2 1 
ATOM   6473 N N   . SER C 1 294 ? -31.569 21.257  -11.371 1.00 40.43 ? 314 SER C N   1 
ATOM   6474 C CA  . SER C 1 294 ? -30.138 21.224  -11.442 1.00 40.43 ? 314 SER C CA  1 
ATOM   6475 C C   . SER C 1 294 ? -29.668 21.155  -12.900 1.00 40.43 ? 314 SER C C   1 
ATOM   6476 O O   . SER C 1 294 ? -28.767 21.869  -13.345 1.00 40.43 ? 314 SER C O   1 
ATOM   6477 C CB  . SER C 1 294 ? -29.571 19.955  -10.753 1.00 38.92 ? 314 SER C CB  1 
ATOM   6478 O OG  . SER C 1 294 ? -29.263 20.237  -9.415  1.00 38.92 ? 314 SER C OG  1 
ATOM   6479 N N   . ARG C 1 295 ? -30.298 20.262  -13.656 1.00 39.35 ? 315 ARG C N   1 
ATOM   6480 C CA  . ARG C 1 295 ? -30.013 20.046  -15.059 1.00 39.35 ? 315 ARG C CA  1 
ATOM   6481 C C   . ARG C 1 295 ? -30.257 21.307  -15.889 1.00 39.35 ? 315 ARG C C   1 
ATOM   6482 O O   . ARG C 1 295 ? -29.474 21.616  -16.787 1.00 39.35 ? 315 ARG C O   1 
ATOM   6483 C CB  . ARG C 1 295 ? -30.890 18.916  -15.592 1.00 41.45 ? 315 ARG C CB  1 
ATOM   6484 C CG  . ARG C 1 295 ? -30.376 18.258  -16.849 1.00 41.45 ? 315 ARG C CG  1 
ATOM   6485 C CD  . ARG C 1 295 ? -30.813 19.059  -18.078 1.00 41.45 ? 315 ARG C CD  1 
ATOM   6486 N NE  . ARG C 1 295 ? -32.248 19.385  -17.989 1.00 41.45 ? 315 ARG C NE  1 
ATOM   6487 C CZ  . ARG C 1 295 ? -33.180 18.640  -18.595 1.00 41.45 ? 315 ARG C CZ  1 
ATOM   6488 N NH1 . ARG C 1 295 ? -32.839 17.595  -19.354 1.00 41.45 ? 315 ARG C NH1 1 
ATOM   6489 N NH2 . ARG C 1 295 ? -34.464 18.926  -18.445 1.00 41.45 ? 315 ARG C NH2 1 
ATOM   6490 N N   . ASP C 1 296 ? -31.327 22.025  -15.624 1.00 40.28 ? 316 ASP C N   1 
ATOM   6491 C CA  . ASP C 1 296 ? -31.725 23.267  -16.260 1.00 40.28 ? 316 ASP C CA  1 
ATOM   6492 C C   . ASP C 1 296 ? -30.665 24.285  -15.875 1.00 40.28 ? 316 ASP C C   1 
ATOM   6493 O O   . ASP C 1 296 ? -30.167 24.915  -16.792 1.00 40.28 ? 316 ASP C O   1 
ATOM   6494 C CB  . ASP C 1 296 ? -33.120 23.735  -15.870 1.00 39.76 ? 316 ASP C CB  1 
ATOM   6495 C CG  . ASP C 1 296 ? -34.244 22.867  -16.421 1.00 39.76 ? 316 ASP C CG  1 
ATOM   6496 O OD1 . ASP C 1 296 ? -34.047 22.035  -17.343 1.00 39.76 ? 316 ASP C OD1 1 
ATOM   6497 O OD2 . ASP C 1 296 ? -35.408 22.997  -15.928 1.00 39.76 ? 316 ASP C OD2 1 
ATOM   6498 N N   . TYR C 1 297 ? -30.259 24.381  -14.623 1.00 41.53 ? 317 TYR C N   1 
ATOM   6499 C CA  . TYR C 1 297 ? -29.190 25.350  -14.336 1.00 41.53 ? 317 TYR C CA  1 
ATOM   6500 C C   . TYR C 1 297 ? -27.942 25.047  -15.129 1.00 41.53 ? 317 TYR C C   1 
ATOM   6501 O O   . TYR C 1 297 ? -27.444 25.937  -15.823 1.00 41.53 ? 317 TYR C O   1 
ATOM   6502 C CB  . TYR C 1 297 ? -28.811 25.394  -12.874 1.00 50.43 ? 317 TYR C CB  1 
ATOM   6503 C CG  . TYR C 1 297 ? -29.873 25.866  -11.933 1.00 50.43 ? 317 TYR C CG  1 
ATOM   6504 C CD1 . TYR C 1 297 ? -31.049 26.479  -12.355 1.00 50.43 ? 317 TYR C CD1 1 
ATOM   6505 C CD2 . TYR C 1 297 ? -29.684 25.689  -10.563 1.00 50.43 ? 317 TYR C CD2 1 
ATOM   6506 C CE1 . TYR C 1 297 ? -31.998 26.897  -11.439 1.00 50.43 ? 317 TYR C CE1 1 
ATOM   6507 C CE2 . TYR C 1 297 ? -30.625 26.106  -9.630  1.00 50.43 ? 317 TYR C CE2 1 
ATOM   6508 C CZ  . TYR C 1 297 ? -31.782 26.707  -10.089 1.00 50.43 ? 317 TYR C CZ  1 
ATOM   6509 O OH  . TYR C 1 297 ? -32.737 27.134  -9.191  1.00 50.43 ? 317 TYR C OH  1 
ATOM   6510 N N   . ILE C 1 298 ? -27.425 23.840  -15.114 1.00 37.96 ? 318 ILE C N   1 
ATOM   6511 C CA  . ILE C 1 298 ? -26.207 23.503  -15.885 1.00 37.96 ? 318 ILE C CA  1 
ATOM   6512 C C   . ILE C 1 298 ? -26.386 23.791  -17.365 1.00 37.96 ? 318 ILE C C   1 
ATOM   6513 O O   . ILE C 1 298 ? -25.430 24.264  -18.043 1.00 37.96 ? 318 ILE C O   1 
ATOM   6514 C CB  . ILE C 1 298 ? -25.828 22.037  -15.623 1.00 33.81 ? 318 ILE C CB  1 
ATOM   6515 C CG1 . ILE C 1 298 ? -25.666 21.902  -14.080 1.00 33.81 ? 318 ILE C CG1 1 
ATOM   6516 C CG2 . ILE C 1 298 ? -24.544 21.612  -16.225 1.00 33.81 ? 318 ILE C CG2 1 
ATOM   6517 C CD1 . ILE C 1 298 ? -25.693 20.472  -13.603 1.00 33.81 ? 318 ILE C CD1 1 
ATOM   6518 N N   . GLN C 1 299 ? -27.543 23.562  -17.935 1.00 38.22 ? 319 GLN C N   1 
ATOM   6519 C CA  . GLN C 1 299 ? -27.800 23.859  -19.344 1.00 38.22 ? 319 GLN C CA  1 
ATOM   6520 C C   . GLN C 1 299 ? -27.627 25.356  -19.631 1.00 38.22 ? 319 GLN C C   1 
ATOM   6521 O O   . GLN C 1 299 ? -26.911 25.685  -20.576 1.00 38.22 ? 319 GLN C O   1 
ATOM   6522 C CB  . GLN C 1 299 ? -29.222 23.451  -19.665 1.00 41.28 ? 319 GLN C CB  1 
ATOM   6523 C CG  . GLN C 1 299 ? -29.670 23.430  -21.089 1.00 41.28 ? 319 GLN C CG  1 
ATOM   6524 C CD  . GLN C 1 299 ? -28.763 22.606  -21.986 1.00 41.28 ? 319 GLN C CD  1 
ATOM   6525 O OE1 . GLN C 1 299 ? -29.015 21.400  -22.173 1.00 41.28 ? 319 GLN C OE1 1 
ATOM   6526 N NE2 . GLN C 1 299 ? -27.734 23.269  -22.531 1.00 41.28 ? 319 GLN C NE2 1 
ATOM   6527 N N   . GLN C 1 300 ? -28.266 26.211  -18.821 1.00 39.74 ? 320 GLN C N   1 
ATOM   6528 C CA  . GLN C 1 300 ? -28.212 27.645  -18.944 1.00 39.74 ? 320 GLN C CA  1 
ATOM   6529 C C   . GLN C 1 300 ? -26.755 28.108  -18.889 1.00 39.74 ? 320 GLN C C   1 
ATOM   6530 O O   . GLN C 1 300 ? -26.295 28.764  -19.829 1.00 39.74 ? 320 GLN C O   1 
ATOM   6531 C CB  . GLN C 1 300 ? -28.929 28.425  -17.846 1.00 47.82 ? 320 GLN C CB  1 
ATOM   6532 C CG  . GLN C 1 300 ? -30.426 28.170  -17.767 1.00 47.82 ? 320 GLN C CG  1 
ATOM   6533 C CD  . GLN C 1 300 ? -31.095 28.937  -16.626 1.00 47.82 ? 320 GLN C CD  1 
ATOM   6534 O OE1 . GLN C 1 300 ? -31.974 28.411  -15.902 1.00 47.82 ? 320 GLN C OE1 1 
ATOM   6535 N NE2 . GLN C 1 300 ? -30.685 30.214  -16.473 1.00 47.82 ? 320 GLN C NE2 1 
ATOM   6536 N N   . ARG C 1 301 ? -26.044 27.737  -17.832 1.00 34.40 ? 321 ARG C N   1 
ATOM   6537 C CA  . ARG C 1 301 ? -24.641 28.138  -17.681 1.00 34.40 ? 321 ARG C CA  1 
ATOM   6538 C C   . ARG C 1 301 ? -23.762 27.588  -18.782 1.00 34.40 ? 321 ARG C C   1 
ATOM   6539 O O   . ARG C 1 301 ? -22.813 28.261  -19.206 1.00 34.40 ? 321 ARG C O   1 
ATOM   6540 C CB  . ARG C 1 301 ? -24.174 27.683  -16.304 1.00 35.00 ? 321 ARG C CB  1 
ATOM   6541 C CG  . ARG C 1 301 ? -24.890 28.502  -15.222 1.00 35.00 ? 321 ARG C CG  1 
ATOM   6542 N N   . PHE C 1 302 ? -24.056 26.409  -19.311 1.00 30.51 ? 322 PHE C N   1 
ATOM   6543 C CA  . PHE C 1 302 ? -23.255 25.887  -20.409 1.00 30.51 ? 322 PHE C CA  1 
ATOM   6544 C C   . PHE C 1 302 ? -23.489 26.686  -21.698 1.00 30.51 ? 322 PHE C C   1 
ATOM   6545 O O   . PHE C 1 302 ? -22.536 27.106  -22.354 1.00 30.51 ? 322 PHE C O   1 
ATOM   6546 C CB  . PHE C 1 302 ? -23.602 24.423  -20.655 1.00 28.33 ? 322 PHE C CB  1 
ATOM   6547 C CG  . PHE C 1 302 ? -22.849 23.828  -21.810 1.00 28.33 ? 322 PHE C CG  1 
ATOM   6548 C CD1 . PHE C 1 302 ? -21.473 23.670  -21.730 1.00 28.33 ? 322 PHE C CD1 1 
ATOM   6549 C CD2 . PHE C 1 302 ? -23.502 23.444  -22.963 1.00 28.33 ? 322 PHE C CD2 1 
ATOM   6550 C CE1 . PHE C 1 302 ? -20.763 23.113  -22.790 1.00 28.33 ? 322 PHE C CE1 1 
ATOM   6551 C CE2 . PHE C 1 302 ? -22.790 22.878  -24.014 1.00 28.33 ? 322 PHE C CE2 1 
ATOM   6552 C CZ  . PHE C 1 302 ? -21.415 22.705  -23.931 1.00 28.33 ? 322 PHE C CZ  1 
ATOM   6553 N N   . ASP C 1 303 ? -24.728 26.944  -22.098 1.00 31.19 ? 323 ASP C N   1 
ATOM   6554 C CA  . ASP C 1 303 ? -25.054 27.732  -23.287 1.00 31.19 ? 323 ASP C CA  1 
ATOM   6555 C C   . ASP C 1 303 ? -24.365 29.081  -23.217 1.00 31.19 ? 323 ASP C C   1 
ATOM   6556 O O   . ASP C 1 303 ? -23.744 29.548  -24.151 1.00 31.19 ? 323 ASP C O   1 
ATOM   6557 C CB  . ASP C 1 303 ? -26.557 28.020  -23.322 1.00 32.32 ? 323 ASP C CB  1 
ATOM   6558 C CG  . ASP C 1 303 ? -27.297 26.773  -23.725 1.00 32.32 ? 323 ASP C CG  1 
ATOM   6559 O OD1 . ASP C 1 303 ? -26.691 25.921  -24.431 1.00 32.32 ? 323 ASP C OD1 1 
ATOM   6560 O OD2 . ASP C 1 303 ? -28.486 26.680  -23.320 1.00 32.32 ? 323 ASP C OD2 1 
ATOM   6561 N N   . GLU C 1 304 ? -24.493 29.686  -22.049 1.00 32.91 ? 324 GLU C N   1 
ATOM   6562 C CA  . GLU C 1 304 ? -23.869 30.962  -21.784 1.00 32.91 ? 324 GLU C CA  1 
ATOM   6563 C C   . GLU C 1 304 ? -22.375 30.917  -22.018 1.00 32.91 ? 324 GLU C C   1 
ATOM   6564 O O   . GLU C 1 304 ? -21.890 31.781  -22.779 1.00 32.91 ? 324 GLU C O   1 
ATOM   6565 C CB  . GLU C 1 304 ? -24.196 31.394  -20.364 1.00 38.51 ? 324 GLU C CB  1 
ATOM   6566 C CG  . GLU C 1 304 ? -23.617 32.742  -20.018 1.00 38.51 ? 324 GLU C CG  1 
ATOM   6567 C CD  . GLU C 1 304 ? -23.737 33.082  -18.545 1.00 38.51 ? 324 GLU C CD  1 
ATOM   6568 O OE1 . GLU C 1 304 ? -23.048 32.400  -17.726 1.00 38.51 ? 324 GLU C OE1 1 
ATOM   6569 O OE2 . GLU C 1 304 ? -24.474 34.034  -18.198 1.00 38.51 ? 324 GLU C OE2 1 
ATOM   6570 N N   . ILE C 1 305 ? -21.576 30.026  -21.500 1.00 30.59 ? 325 ILE C N   1 
ATOM   6571 C CA  . ILE C 1 305 ? -20.139 30.000  -21.695 1.00 30.59 ? 325 ILE C CA  1 
ATOM   6572 C C   . ILE C 1 305 ? -19.720 29.471  -23.033 1.00 30.59 ? 325 ILE C C   1 
ATOM   6573 O O   . ILE C 1 305 ? -18.728 29.950  -23.630 1.00 30.59 ? 325 ILE C O   1 
ATOM   6574 C CB  . ILE C 1 305 ? -19.418 29.154  -20.609 1.00 29.63 ? 325 ILE C CB  1 
ATOM   6575 C CG1 . ILE C 1 305 ? -17.923 29.378  -20.644 1.00 29.63 ? 325 ILE C CG1 1 
ATOM   6576 C CG2 . ILE C 1 305 ? -19.684 27.649  -20.791 1.00 29.63 ? 325 ILE C CG2 1 
ATOM   6577 C CD1 . ILE C 1 305 ? -17.140 29.093  -19.403 1.00 29.63 ? 325 ILE C CD1 1 
ATOM   6578 N N   . VAL C 1 306 ? -20.447 28.524  -23.618 1.00 32.15 ? 326 VAL C N   1 
ATOM   6579 C CA  . VAL C 1 306 ? -20.061 28.016  -24.934 1.00 32.15 ? 326 VAL C CA  1 
ATOM   6580 C C   . VAL C 1 306 ? -20.178 29.136  -25.971 1.00 32.15 ? 326 VAL C C   1 
ATOM   6581 O O   . VAL C 1 306 ? -19.530 29.111  -27.032 1.00 32.15 ? 326 VAL C O   1 
ATOM   6582 C CB  . VAL C 1 306 ? -20.899 26.808  -25.368 1.00 31.67 ? 326 VAL C CB  1 
ATOM   6583 C CG1 . VAL C 1 306 ? -22.243 27.207  -25.970 1.00 31.67 ? 326 VAL C CG1 1 
ATOM   6584 C CG2 . VAL C 1 306 ? -20.151 25.969  -26.398 1.00 31.67 ? 326 VAL C CG2 1 
ATOM   6585 N N   . ASP C 1 307 ? -20.998 30.164  -25.746 1.00 35.06 ? 327 ASP C N   1 
ATOM   6586 C CA  . ASP C 1 307 ? -21.213 31.286  -26.623 1.00 35.06 ? 327 ASP C CA  1 
ATOM   6587 C C   . ASP C 1 307 ? -20.054 32.268  -26.604 1.00 35.06 ? 327 ASP C C   1 
ATOM   6588 O O   . ASP C 1 307 ? -20.093 33.213  -27.407 1.00 35.06 ? 327 ASP C O   1 
ATOM   6589 C CB  . ASP C 1 307 ? -22.475 32.092  -26.237 1.00 38.23 ? 327 ASP C CB  1 
ATOM   6590 C CG  . ASP C 1 307 ? -23.780 31.551  -26.781 1.00 38.23 ? 327 ASP C CG  1 
ATOM   6591 O OD1 . ASP C 1 307 ? -23.777 30.738  -27.734 1.00 38.23 ? 327 ASP C OD1 1 
ATOM   6592 O OD2 . ASP C 1 307 ? -24.856 31.961  -26.251 1.00 38.23 ? 327 ASP C OD2 1 
ATOM   6593 N N   . THR C 1 308 ? -19.075 32.136  -25.767 1.00 31.11 ? 328 THR C N   1 
ATOM   6594 C CA  . THR C 1 308 ? -17.936 33.027  -25.692 1.00 31.11 ? 328 THR C CA  1 
ATOM   6595 C C   . THR C 1 308 ? -16.717 32.368  -26.326 1.00 31.11 ? 328 THR C C   1 
ATOM   6596 O O   . THR C 1 308 ? -15.655 32.971  -26.309 1.00 31.11 ? 328 THR C O   1 
ATOM   6597 C CB  . THR C 1 308 ? -17.597 33.384  -24.237 1.00 29.66 ? 328 THR C CB  1 
ATOM   6598 O OG1 . THR C 1 308 ? -17.046 32.222  -23.597 1.00 29.66 ? 328 THR C OG1 1 
ATOM   6599 C CG2 . THR C 1 308 ? -18.825 33.804  -23.466 1.00 29.66 ? 328 THR C CG2 1 
ATOM   6600 N N   . LEU C 1 309 ? -16.908 31.186  -26.873 1.00 32.28 ? 329 LEU C N   1 
ATOM   6601 C CA  . LEU C 1 309 ? -15.798 30.464  -27.472 1.00 32.28 ? 329 LEU C CA  1 
ATOM   6602 C C   . LEU C 1 309 ? -15.333 31.229  -28.711 1.00 32.28 ? 329 LEU C C   1 
ATOM   6603 O O   . LEU C 1 309 ? -16.234 31.423  -29.585 1.00 32.28 ? 329 LEU C O   1 
ATOM   6604 C CB  . LEU C 1 309 ? -16.168 29.055  -27.848 1.00 31.97 ? 329 LEU C CB  1 
ATOM   6605 C CG  . LEU C 1 309 ? -16.041 27.931  -26.828 1.00 31.97 ? 329 LEU C CG  1 
ATOM   6606 C CD1 . LEU C 1 309 ? -16.537 26.634  -27.439 1.00 31.97 ? 329 LEU C CD1 1 
ATOM   6607 C CD2 . LEU C 1 309 ? -14.605 27.776  -26.352 1.00 31.97 ? 329 LEU C CD2 1 
ATOM   6608 O OXT . LEU C 1 309 ? -14.072 31.564  -29.069 1.00 31.97 ? 329 LEU C OXT 1 
ATOM   6609 N N   . ALA D 1 1   ? 2.185   0.610   18.294  1.00 10.19 ? 21  ALA D N   1 
ATOM   6610 C CA  . ALA D 1 1   ? 2.486   -0.252  17.127  1.00 10.19 ? 21  ALA D CA  1 
ATOM   6611 C C   . ALA D 1 1   ? 1.373   -1.242  16.928  1.00 10.19 ? 21  ALA D C   1 
ATOM   6612 O O   . ALA D 1 1   ? 0.466   -1.333  17.772  1.00 10.19 ? 21  ALA D O   1 
ATOM   6613 C CB  . ALA D 1 1   ? 3.801   -0.919  17.403  1.00 10.14 ? 21  ALA D CB  1 
ATOM   6614 N N   . ARG D 1 2   ? 1.314   -1.957  15.824  1.00 11.59 ? 22  ARG D N   1 
ATOM   6615 C CA  . ARG D 1 2   ? 0.279   -2.943  15.575  1.00 11.59 ? 22  ARG D CA  1 
ATOM   6616 C C   . ARG D 1 2   ? 0.859   -4.342  15.770  1.00 11.59 ? 22  ARG D C   1 
ATOM   6617 O O   . ARG D 1 2   ? 1.939   -4.617  15.221  1.00 11.59 ? 22  ARG D O   1 
ATOM   6618 C CB  . ARG D 1 2   ? -0.240  -2.871  14.120  1.00 12.30 ? 22  ARG D CB  1 
ATOM   6619 C CG  . ARG D 1 2   ? -1.112  -1.675  13.812  1.00 12.30 ? 22  ARG D CG  1 
ATOM   6620 C CD  . ARG D 1 2   ? -1.418  -1.608  12.330  1.00 12.30 ? 22  ARG D CD  1 
ATOM   6621 N NE  . ARG D 1 2   ? -2.178  -0.403  11.953  1.00 12.30 ? 22  ARG D NE  1 
ATOM   6622 C CZ  . ARG D 1 2   ? -2.232  0.055   10.681  1.00 12.30 ? 22  ARG D CZ  1 
ATOM   6623 N NH1 . ARG D 1 2   ? -1.574  -0.519  9.704   1.00 12.30 ? 22  ARG D NH1 1 
ATOM   6624 N NH2 . ARG D 1 2   ? -3.008  1.079   10.454  1.00 12.30 ? 22  ARG D NH2 1 
ATOM   6625 N N   . LYS D 1 3   ? 0.187   -5.190  16.553  1.00 13.03 ? 23  LYS D N   1 
ATOM   6626 C CA  . LYS D 1 3   ? 0.673   -6.537  16.765  1.00 13.03 ? 23  LYS D CA  1 
ATOM   6627 C C   . LYS D 1 3   ? -0.485  -7.477  16.515  1.00 13.03 ? 23  LYS D C   1 
ATOM   6628 O O   . LYS D 1 3   ? -1.580  -7.279  17.069  1.00 13.03 ? 23  LYS D O   1 
ATOM   6629 C CB  . LYS D 1 3   ? 1.244   -6.707  18.191  1.00 13.31 ? 23  LYS D CB  1 
ATOM   6630 C CG  . LYS D 1 3   ? 1.545   -8.209  18.446  1.00 13.31 ? 23  LYS D CG  1 
ATOM   6631 C CD  . LYS D 1 3   ? 1.977   -8.505  19.859  1.00 13.31 ? 23  LYS D CD  1 
ATOM   6632 C CE  . LYS D 1 3   ? 3.439   -8.191  20.028  1.00 13.31 ? 23  LYS D CE  1 
ATOM   6633 N NZ  . LYS D 1 3   ? 3.931   -8.710  21.318  1.00 13.31 ? 23  LYS D NZ  1 
ATOM   6634 N N   . ILE D 1 4   ? -0.242  -8.493  15.707  1.00 14.01 ? 24  ILE D N   1 
ATOM   6635 C CA  . ILE D 1 4   ? -1.250  -9.489  15.405  1.00 14.01 ? 24  ILE D CA  1 
ATOM   6636 C C   . ILE D 1 4   ? -0.730  -10.879 15.682  1.00 14.01 ? 24  ILE D C   1 
ATOM   6637 O O   . ILE D 1 4   ? 0.407   -11.203 15.283  1.00 14.01 ? 24  ILE D O   1 
ATOM   6638 C CB  . ILE D 1 4   ? -1.644  -9.399  13.909  1.00 15.56 ? 24  ILE D CB  1 
ATOM   6639 C CG1 . ILE D 1 4   ? -2.476  -8.142  13.667  1.00 15.56 ? 24  ILE D CG1 1 
ATOM   6640 C CG2 . ILE D 1 4   ? -2.498  -10.585 13.508  1.00 15.56 ? 24  ILE D CG2 1 
ATOM   6641 C CD1 . ILE D 1 4   ? -2.875  -7.862  12.262  1.00 15.56 ? 24  ILE D CD1 1 
ATOM   6642 N N   . GLY D 1 5   ? -1.532  -11.753 16.361  1.00 11.65 ? 25  GLY D N   1 
ATOM   6643 C CA  . GLY D 1 5   ? -1.124  -13.118 16.581  1.00 11.65 ? 25  GLY D CA  1 
ATOM   6644 C C   . GLY D 1 5   ? -1.965  -14.011 15.675  1.00 11.65 ? 25  GLY D C   1 
ATOM   6645 O O   . GLY D 1 5   ? -3.140  -13.783 15.400  1.00 11.65 ? 25  GLY D O   1 
ATOM   6646 N N   . ILE D 1 6   ? -1.359  -15.078 15.167  1.00 13.79 ? 26  ILE D N   1 
ATOM   6647 C CA  . ILE D 1 6   ? -2.108  -16.019 14.320  1.00 13.79 ? 26  ILE D CA  1 
ATOM   6648 C C   . ILE D 1 6   ? -1.941  -17.409 14.908  1.00 13.79 ? 26  ILE D C   1 
ATOM   6649 O O   . ILE D 1 6   ? -0.782  -17.810 15.139  1.00 13.79 ? 26  ILE D O   1 
ATOM   6650 C CB  . ILE D 1 6   ? -1.612  -16.001 12.875  1.00 13.16 ? 26  ILE D CB  1 
ATOM   6651 C CG1 . ILE D 1 6   ? -1.770  -14.618 12.234  1.00 13.16 ? 26  ILE D CG1 1 
ATOM   6652 C CG2 . ILE D 1 6   ? -2.415  -16.998 12.035  1.00 13.16 ? 26  ILE D CG2 1 
ATOM   6653 C CD1 . ILE D 1 6   ? -1.005  -14.398 10.946  1.00 13.16 ? 26  ILE D CD1 1 
ATOM   6654 N N   . ILE D 1 7   ? -3.034  -18.082 15.222  1.00 15.01 ? 27  ILE D N   1 
ATOM   6655 C CA  . ILE D 1 7   ? -2.973  -19.434 15.785  1.00 15.01 ? 27  ILE D CA  1 
ATOM   6656 C C   . ILE D 1 7   ? -3.352  -20.437 14.720  1.00 15.01 ? 27  ILE D C   1 
ATOM   6657 O O   . ILE D 1 7   ? -4.485  -20.477 14.264  1.00 15.01 ? 27  ILE D O   1 
ATOM   6658 C CB  . ILE D 1 7   ? -3.875  -19.628 17.042  1.00 13.44 ? 27  ILE D CB  1 
ATOM   6659 C CG1 . ILE D 1 7   ? -3.409  -18.586 18.088  1.00 13.44 ? 27  ILE D CG1 1 
ATOM   6660 C CG2 . ILE D 1 7   ? -3.782  -21.047 17.616  1.00 13.44 ? 27  ILE D CG2 1 
ATOM   6661 C CD1 . ILE D 1 7   ? -4.309  -18.373 19.257  1.00 13.44 ? 27  ILE D CD1 1 
ATOM   6662 N N   . GLY D 1 8   ? -2.376  -21.247 14.298  1.00 17.95 ? 28  GLY D N   1 
ATOM   6663 C CA  . GLY D 1 8   ? -2.617  -22.234 13.260  1.00 17.95 ? 28  GLY D CA  1 
ATOM   6664 C C   . GLY D 1 8   ? -2.115  -21.660 11.934  1.00 17.95 ? 28  GLY D C   1 
ATOM   6665 O O   . GLY D 1 8   ? -2.812  -20.914 11.247  1.00 17.95 ? 28  GLY D O   1 
ATOM   6666 N N   . LEU D 1 9   ? -0.889  -21.996 11.569  1.00 18.22 ? 29  LEU D N   1 
ATOM   6667 C CA  . LEU D 1 9   ? -0.242  -21.594 10.346  1.00 18.22 ? 29  LEU D CA  1 
ATOM   6668 C C   . LEU D 1 9   ? -0.370  -22.646 9.262   1.00 18.22 ? 29  LEU D C   1 
ATOM   6669 O O   . LEU D 1 9   ? 0.620   -23.140 8.711   1.00 18.22 ? 29  LEU D O   1 
ATOM   6670 C CB  . LEU D 1 9   ? 1.255   -21.323 10.582  1.00 18.02 ? 29  LEU D CB  1 
ATOM   6671 C CG  . LEU D 1 9   ? 1.656   -19.897 10.875  1.00 18.02 ? 29  LEU D CG  1 
ATOM   6672 C CD1 . LEU D 1 9   ? 1.487   -19.011 9.650   1.00 18.02 ? 29  LEU D CD1 1 
ATOM   6673 C CD2 . LEU D 1 9   ? 0.799   -19.296 11.986  1.00 18.02 ? 29  LEU D CD2 1 
ATOM   6674 N N   . GLY D 1 10  ? -1.604  -22.994 8.932   1.00 20.59 ? 30  GLY D N   1 
ATOM   6675 C CA  . GLY D 1 10  ? -1.843  -23.963 7.851   1.00 20.59 ? 30  GLY D CA  1 
ATOM   6676 C C   . GLY D 1 10  ? -2.124  -23.158 6.577   1.00 20.59 ? 30  GLY D C   1 
ATOM   6677 O O   . GLY D 1 10  ? -1.705  -21.988 6.461   1.00 20.59 ? 30  GLY D O   1 
ATOM   6678 N N   . ASN D 1 11  ? -2.841  -23.749 5.634   1.00 21.62 ? 31  ASN D N   1 
ATOM   6679 C CA  . ASN D 1 11  ? -3.164  -23.088 4.388   1.00 21.62 ? 31  ASN D CA  1 
ATOM   6680 C C   . ASN D 1 11  ? -3.785  -21.735 4.666   1.00 21.62 ? 31  ASN D C   1 
ATOM   6681 O O   . ASN D 1 11  ? -3.322  -20.770 4.004   1.00 21.62 ? 31  ASN D O   1 
ATOM   6682 C CB  . ASN D 1 11  ? -4.159  -23.885 3.560   1.00 24.39 ? 31  ASN D CB  1 
ATOM   6683 C CG  . ASN D 1 11  ? -3.550  -25.198 3.170   1.00 24.39 ? 31  ASN D CG  1 
ATOM   6684 O OD1 . ASN D 1 11  ? -2.381  -25.349 2.800   1.00 24.39 ? 31  ASN D OD1 1 
ATOM   6685 N ND2 . ASN D 1 11  ? -4.362  -26.254 3.313   1.00 24.39 ? 31  ASN D ND2 1 
ATOM   6686 N N   . VAL D 1 12  ? -4.796  -21.643 5.466   1.00 18.53 ? 32  VAL D N   1 
ATOM   6687 C CA  . VAL D 1 12  ? -5.478  -20.400 5.772   1.00 18.53 ? 32  VAL D CA  1 
ATOM   6688 C C   . VAL D 1 12  ? -4.596  -19.479 6.581   1.00 18.53 ? 32  VAL D C   1 
ATOM   6689 O O   . VAL D 1 12  ? -4.421  -18.294 6.191   1.00 18.53 ? 32  VAL D O   1 
ATOM   6690 C CB  . VAL D 1 12  ? -6.778  -20.669 6.547   1.00 15.68 ? 32  VAL D CB  1 
ATOM   6691 C CG1 . VAL D 1 12  ? -7.458  -19.396 6.960   1.00 15.68 ? 32  VAL D CG1 1 
ATOM   6692 C CG2 . VAL D 1 12  ? -7.726  -21.495 5.677   1.00 15.68 ? 32  VAL D CG2 1 
ATOM   6693 N N   . GLY D 1 13  ? -4.005  -19.921 7.662   1.00 16.85 ? 33  GLY D N   1 
ATOM   6694 C CA  . GLY D 1 13  ? -3.164  -19.081 8.494   1.00 16.85 ? 33  GLY D CA  1 
ATOM   6695 C C   . GLY D 1 13  ? -1.990  -18.452 7.773   1.00 16.85 ? 33  GLY D C   1 
ATOM   6696 O O   . GLY D 1 13  ? -1.657  -17.316 8.042   1.00 16.85 ? 33  GLY D O   1 
ATOM   6697 N N   . ALA D 1 14  ? -1.330  -19.194 6.900   1.00 16.41 ? 34  ALA D N   1 
ATOM   6698 C CA  . ALA D 1 14  ? -0.196  -18.693 6.127   1.00 16.41 ? 34  ALA D CA  1 
ATOM   6699 C C   . ALA D 1 14  ? -0.673  -17.696 5.077   1.00 16.41 ? 34  ALA D C   1 
ATOM   6700 O O   . ALA D 1 14  ? 0.066   -16.730 4.811   1.00 16.41 ? 34  ALA D O   1 
ATOM   6701 C CB  . ALA D 1 14  ? 0.555   -19.820 5.444   1.00 15.02 ? 34  ALA D CB  1 
ATOM   6702 N N   . ALA D 1 15  ? -1.866  -17.833 4.491   1.00 15.90 ? 35  ALA D N   1 
ATOM   6703 C CA  . ALA D 1 15  ? -2.420  -16.899 3.535   1.00 15.90 ? 35  ALA D CA  1 
ATOM   6704 C C   . ALA D 1 15  ? -2.741  -15.608 4.264   1.00 15.90 ? 35  ALA D C   1 
ATOM   6705 O O   . ALA D 1 15  ? -2.540  -14.518 3.688   1.00 15.90 ? 35  ALA D O   1 
ATOM   6706 C CB  . ALA D 1 15  ? -3.667  -17.461 2.899   1.00 14.36 ? 35  ALA D CB  1 
ATOM   6707 N N   . VAL D 1 16  ? -3.222  -15.651 5.481   1.00 15.64 ? 36  VAL D N   1 
ATOM   6708 C CA  . VAL D 1 16  ? -3.519  -14.495 6.309   1.00 15.64 ? 36  VAL D CA  1 
ATOM   6709 C C   . VAL D 1 16  ? -2.224  -13.744 6.624   1.00 15.64 ? 36  VAL D C   1 
ATOM   6710 O O   . VAL D 1 16  ? -2.150  -12.517 6.516   1.00 15.64 ? 36  VAL D O   1 
ATOM   6711 C CB  . VAL D 1 16  ? -4.202  -14.869 7.641   1.00 12.44 ? 36  VAL D CB  1 
ATOM   6712 C CG1 . VAL D 1 16  ? -4.249  -13.698 8.612   1.00 12.44 ? 36  VAL D CG1 1 
ATOM   6713 C CG2 . VAL D 1 16  ? -5.643  -15.323 7.465   1.00 12.44 ? 36  VAL D CG2 1 
ATOM   6714 N N   . ALA D 1 17  ? -1.175  -14.469 7.005   1.00 16.84 ? 37  ALA D N   1 
ATOM   6715 C CA  . ALA D 1 17  ? 0.120   -13.858 7.321   1.00 16.84 ? 37  ALA D CA  1 
ATOM   6716 C C   . ALA D 1 17  ? 0.733   -13.211 6.067   1.00 16.84 ? 37  ALA D C   1 
ATOM   6717 O O   . ALA D 1 17  ? 1.271   -12.104 6.137   1.00 16.84 ? 37  ALA D O   1 
ATOM   6718 C CB  . ALA D 1 17  ? 1.049   -14.901 7.892   1.00 16.28 ? 37  ALA D CB  1 
ATOM   6719 N N   . HIS D 1 18  ? 0.692   -13.890 4.941   1.00 16.54 ? 38  HIS D N   1 
ATOM   6720 C CA  . HIS D 1 18  ? 1.258   -13.336 3.716   1.00 16.54 ? 38  HIS D CA  1 
ATOM   6721 C C   . HIS D 1 18  ? 0.509   -12.093 3.274   1.00 16.54 ? 38  HIS D C   1 
ATOM   6722 O O   . HIS D 1 18  ? 1.147   -11.097 2.946   1.00 16.54 ? 38  HIS D O   1 
ATOM   6723 C CB  . HIS D 1 18  ? 1.262   -14.358 2.586   1.00 14.85 ? 38  HIS D CB  1 
ATOM   6724 C CG  . HIS D 1 18  ? 2.068   -13.929 1.399   1.00 14.85 ? 38  HIS D CG  1 
ATOM   6725 N ND1 . HIS D 1 18  ? 1.879   -14.461 0.139   1.00 14.85 ? 38  HIS D ND1 1 
ATOM   6726 C CD2 . HIS D 1 18  ? 3.067   -13.017 1.284   1.00 14.85 ? 38  HIS D CD2 1 
ATOM   6727 C CE1 . HIS D 1 18  ? 2.730   -13.906 -0.702  1.00 14.85 ? 38  HIS D CE1 1 
ATOM   6728 N NE2 . HIS D 1 18  ? 3.466   -13.031 -0.044  1.00 14.85 ? 38  HIS D NE2 1 
ATOM   6729 N N   . GLY D 1 19  ? -0.813  -12.086 3.302   1.00 16.87 ? 39  GLY D N   1 
ATOM   6730 C CA  . GLY D 1 19  ? -1.620  -10.925 2.981   1.00 16.87 ? 39  GLY D CA  1 
ATOM   6731 C C   . GLY D 1 19  ? -1.317  -9.711  3.829   1.00 16.87 ? 39  GLY D C   1 
ATOM   6732 O O   . GLY D 1 19  ? -1.322  -8.574  3.329   1.00 16.87 ? 39  GLY D O   1 
ATOM   6733 N N   . LEU D 1 20  ? -1.068  -9.899  5.107   1.00 16.05 ? 40  LEU D N   1 
ATOM   6734 C CA  . LEU D 1 20  ? -0.764  -8.820  6.035   1.00 16.05 ? 40  LEU D CA  1 
ATOM   6735 C C   . LEU D 1 20  ? 0.663   -8.333  5.802   1.00 16.05 ? 40  LEU D C   1 
ATOM   6736 O O   . LEU D 1 20  ? 0.912   -7.157  5.758   1.00 16.05 ? 40  LEU D O   1 
ATOM   6737 C CB  . LEU D 1 20  ? -0.916  -9.273  7.473   1.00 14.64 ? 40  LEU D CB  1 
ATOM   6738 C CG  . LEU D 1 20  ? -2.331  -9.612  7.917   1.00 14.64 ? 40  LEU D CG  1 
ATOM   6739 C CD1 . LEU D 1 20  ? -2.281  -10.564 9.123   1.00 14.64 ? 40  LEU D CD1 1 
ATOM   6740 C CD2 . LEU D 1 20  ? -3.070  -8.360  8.289   1.00 14.64 ? 40  LEU D CD2 1 
ATOM   6741 N N   . ILE D 1 21  ? 1.586   -9.273  5.646   1.00 17.71 ? 41  ILE D N   1 
ATOM   6742 C CA  . ILE D 1 21  ? 3.000   -8.964  5.428   1.00 17.71 ? 41  ILE D CA  1 
ATOM   6743 C C   . ILE D 1 21  ? 3.296   -8.340  4.070   1.00 17.71 ? 41  ILE D C   1 
ATOM   6744 O O   . ILE D 1 21  ? 4.184   -7.471  4.016   1.00 17.71 ? 41  ILE D O   1 
ATOM   6745 C CB  . ILE D 1 21  ? 3.875   -10.242 5.648   1.00 16.93 ? 41  ILE D CB  1 
ATOM   6746 C CG1 . ILE D 1 21  ? 3.909   -10.489 7.168   1.00 16.93 ? 41  ILE D CG1 1 
ATOM   6747 C CG2 . ILE D 1 21  ? 5.292   -10.123 5.103   1.00 16.93 ? 41  ILE D CG2 1 
ATOM   6748 C CD1 . ILE D 1 21  ? 4.446   -11.842 7.587   1.00 16.93 ? 41  ILE D CD1 1 
ATOM   6749 N N   . ALA D 1 22  ? 2.606   -8.683  2.995   1.00 18.32 ? 42  ALA D N   1 
ATOM   6750 C CA  . ALA D 1 22  ? 2.791   -8.138  1.663   1.00 18.32 ? 42  ALA D CA  1 
ATOM   6751 C C   . ALA D 1 22  ? 2.382   -6.669  1.703   1.00 18.32 ? 42  ALA D C   1 
ATOM   6752 O O   . ALA D 1 22  ? 2.954   -5.857  0.954   1.00 18.32 ? 42  ALA D O   1 
ATOM   6753 C CB  . ALA D 1 22  ? 1.951   -8.831  0.624   1.00 15.72 ? 42  ALA D CB  1 
ATOM   6754 N N   . GLN D 1 23  ? 1.438   -6.274  2.541   1.00 20.06 ? 43  GLN D N   1 
ATOM   6755 C CA  . GLN D 1 23  ? 1.041   -4.869  2.664   1.00 20.06 ? 43  GLN D CA  1 
ATOM   6756 C C   . GLN D 1 23  ? 1.716   -4.224  3.873   1.00 20.06 ? 43  GLN D C   1 
ATOM   6757 O O   . GLN D 1 23  ? 1.430   -3.035  4.075   1.00 20.06 ? 43  GLN D O   1 
ATOM   6758 C CB  . GLN D 1 23  ? -0.451  -4.627  2.904   1.00 26.00 ? 43  GLN D CB  1 
ATOM   6759 C CG  . GLN D 1 23  ? -1.352  -5.212  1.867   1.00 26.00 ? 43  GLN D CG  1 
ATOM   6760 C CD  . GLN D 1 23  ? -2.773  -5.366  2.446   1.00 26.00 ? 43  GLN D CD  1 
ATOM   6761 O OE1 . GLN D 1 23  ? -3.467  -4.372  2.267   1.00 26.00 ? 43  GLN D OE1 1 
ATOM   6762 N NE2 . GLN D 1 23  ? -3.077  -6.534  3.077   1.00 26.00 ? 43  GLN D NE2 1 
ATOM   6763 N N   . GLY D 1 24  ? 2.513   -4.925  4.669   1.00 17.48 ? 44  GLY D N   1 
ATOM   6764 C CA  . GLY D 1 24  ? 3.108   -4.191  5.836   1.00 17.48 ? 44  GLY D CA  1 
ATOM   6765 C C   . GLY D 1 24  ? 2.036   -3.724  6.785   1.00 17.48 ? 44  GLY D C   1 
ATOM   6766 O O   . GLY D 1 24  ? 2.185   -2.637  7.382   1.00 17.48 ? 44  GLY D O   1 
ATOM   6767 N N   . VAL D 1 25  ? 0.944   -4.457  7.011   1.00 16.24 ? 45  VAL D N   1 
ATOM   6768 C CA  . VAL D 1 25  ? -0.126  -3.979  7.909   1.00 16.24 ? 45  VAL D CA  1 
ATOM   6769 C C   . VAL D 1 25  ? 0.299   -3.940  9.348   1.00 16.24 ? 45  VAL D C   1 
ATOM   6770 O O   . VAL D 1 25  ? -0.019  -2.934  10.049  1.00 16.24 ? 45  VAL D O   1 
ATOM   6771 C CB  . VAL D 1 25  ? -1.392  -4.836  7.763   1.00 15.39 ? 45  VAL D CB  1 
ATOM   6772 C CG1 . VAL D 1 25  ? -2.538  -4.262  8.598   1.00 15.39 ? 45  VAL D CG1 1 
ATOM   6773 C CG2 . VAL D 1 25  ? -1.862  -4.909  6.329   1.00 15.39 ? 45  VAL D CG2 1 
ATOM   6774 N N   . ALA D 1 26  ? 0.982   -4.936  9.874   1.00 14.41 ? 46  ALA D N   1 
ATOM   6775 C CA  . ALA D 1 26  ? 1.393   -4.917  11.292  1.00 14.41 ? 46  ALA D CA  1 
ATOM   6776 C C   . ALA D 1 26  ? 2.885   -4.811  11.455  1.00 14.41 ? 46  ALA D C   1 
ATOM   6777 O O   . ALA D 1 26  ? 3.662   -5.082  10.523  1.00 14.41 ? 46  ALA D O   1 
ATOM   6778 C CB  . ALA D 1 26  ? 0.898   -6.191  12.004  1.00 14.40 ? 46  ALA D CB  1 
ATOM   6779 N N   . ASP D 1 27  ? 3.326   -4.426  12.634  1.00 13.33 ? 47  ASP D N   1 
ATOM   6780 C CA  . ASP D 1 27  ? 4.747   -4.285  12.917  1.00 13.33 ? 47  ASP D CA  1 
ATOM   6781 C C   . ASP D 1 27  ? 5.316   -5.563  13.517  1.00 13.33 ? 47  ASP D C   1 
ATOM   6782 O O   . ASP D 1 27  ? 6.473   -5.962  13.317  1.00 13.33 ? 47  ASP D O   1 
ATOM   6783 C CB  . ASP D 1 27  ? 4.941   -3.143  13.909  1.00 14.52 ? 47  ASP D CB  1 
ATOM   6784 C CG  . ASP D 1 27  ? 4.392   -1.830  13.335  1.00 14.52 ? 47  ASP D CG  1 
ATOM   6785 O OD1 . ASP D 1 27  ? 4.943   -1.326  12.340  1.00 14.52 ? 47  ASP D OD1 1 
ATOM   6786 O OD2 . ASP D 1 27  ? 3.396   -1.306  13.882  1.00 14.52 ? 47  ASP D OD2 1 
ATOM   6787 N N   . ASP D 1 28  ? 4.506   -6.222  14.353  1.00 15.19 ? 48  ASP D N   1 
ATOM   6788 C CA  . ASP D 1 28  ? 4.900   -7.439  15.056  1.00 15.19 ? 48  ASP D CA  1 
ATOM   6789 C C   . ASP D 1 28  ? 3.890   -8.528  14.810  1.00 15.19 ? 48  ASP D C   1 
ATOM   6790 O O   . ASP D 1 28  ? 2.719   -8.248  14.747  1.00 15.19 ? 48  ASP D O   1 
ATOM   6791 C CB  . ASP D 1 28  ? 4.958   -7.129  16.533  1.00 17.60 ? 48  ASP D CB  1 
ATOM   6792 C CG  . ASP D 1 28  ? 6.054   -6.185  16.924  1.00 17.60 ? 48  ASP D CG  1 
ATOM   6793 O OD1 . ASP D 1 28  ? 7.215   -6.318  16.464  1.00 17.60 ? 48  ASP D OD1 1 
ATOM   6794 O OD2 . ASP D 1 28  ? 5.764   -5.235  17.671  1.00 17.60 ? 48  ASP D OD2 1 
ATOM   6795 N N   . TYR D 1 29  ? 4.381   -9.748  14.583  1.00 16.82 ? 49  TYR D N   1 
ATOM   6796 C CA  . TYR D 1 29  ? 3.532   -10.895 14.318  1.00 16.82 ? 49  TYR D CA  1 
ATOM   6797 C C   . TYR D 1 29  ? 3.924   -12.038 15.255  1.00 16.82 ? 49  TYR D C   1 
ATOM   6798 O O   . TYR D 1 29  ? 5.130   -12.190 15.481  1.00 16.82 ? 49  TYR D O   1 
ATOM   6799 C CB  . TYR D 1 29  ? 3.718   -11.404 12.898  1.00 19.78 ? 49  TYR D CB  1 
ATOM   6800 C CG  . TYR D 1 29  ? 3.324   -10.415 11.832  1.00 19.78 ? 49  TYR D CG  1 
ATOM   6801 C CD1 . TYR D 1 29  ? 4.260   -9.496  11.368  1.00 19.78 ? 49  TYR D CD1 1 
ATOM   6802 C CD2 . TYR D 1 29  ? 2.036   -10.389 11.299  1.00 19.78 ? 49  TYR D CD2 1 
ATOM   6803 C CE1 . TYR D 1 29  ? 3.949   -8.572  10.397  1.00 19.78 ? 49  TYR D CE1 1 
ATOM   6804 C CE2 . TYR D 1 29  ? 1.727   -9.454  10.307  1.00 19.78 ? 49  TYR D CE2 1 
ATOM   6805 C CZ  . TYR D 1 29  ? 2.678   -8.572  9.880   1.00 19.78 ? 49  TYR D CZ  1 
ATOM   6806 O OH  . TYR D 1 29  ? 2.385   -7.624  8.889   1.00 19.78 ? 49  TYR D OH  1 
ATOM   6807 N N   . VAL D 1 30  ? 2.972   -12.760 15.808  1.00 15.48 ? 50  VAL D N   1 
ATOM   6808 C CA  . VAL D 1 30  ? 3.184   -13.916 16.675  1.00 15.48 ? 50  VAL D CA  1 
ATOM   6809 C C   . VAL D 1 30  ? 2.502   -15.099 16.002  1.00 15.48 ? 50  VAL D C   1 
ATOM   6810 O O   . VAL D 1 30  ? 1.293   -15.026 15.791  1.00 15.48 ? 50  VAL D O   1 
ATOM   6811 C CB  . VAL D 1 30  ? 2.600   -13.716 18.076  1.00 14.69 ? 50  VAL D CB  1 
ATOM   6812 C CG1 . VAL D 1 30  ? 2.971   -14.922 18.984  1.00 14.69 ? 50  VAL D CG1 1 
ATOM   6813 C CG2 . VAL D 1 30  ? 3.113   -12.467 18.747  1.00 14.69 ? 50  VAL D CG2 1 
ATOM   6814 N N   . PHE D 1 31  ? 3.275   -16.087 15.561  1.00 16.32 ? 51  PHE D N   1 
ATOM   6815 C CA  . PHE D 1 31  ? 2.762   -17.272 14.910  1.00 16.32 ? 51  PHE D CA  1 
ATOM   6816 C C   . PHE D 1 31  ? 2.765   -18.426 15.922  1.00 16.32 ? 51  PHE D C   1 
ATOM   6817 O O   . PHE D 1 31  ? 3.807   -18.633 16.537  1.00 16.32 ? 51  PHE D O   1 
ATOM   6818 C CB  . PHE D 1 31  ? 3.612   -17.725 13.735  1.00 15.93 ? 51  PHE D CB  1 
ATOM   6819 C CG  . PHE D 1 31  ? 3.671   -16.796 12.549  1.00 15.93 ? 51  PHE D CG  1 
ATOM   6820 C CD1 . PHE D 1 31  ? 2.817   -15.679 12.454  1.00 15.93 ? 51  PHE D CD1 1 
ATOM   6821 C CD2 . PHE D 1 31  ? 4.552   -17.062 11.492  1.00 15.93 ? 51  PHE D CD2 1 
ATOM   6822 C CE1 . PHE D 1 31  ? 2.875   -14.849 11.375  1.00 15.93 ? 51  PHE D CE1 1 
ATOM   6823 C CE2 . PHE D 1 31  ? 4.591   -16.225 10.410  1.00 15.93 ? 51  PHE D CE2 1 
ATOM   6824 C CZ  . PHE D 1 31  ? 3.767   -15.128 10.348  1.00 15.93 ? 51  PHE D CZ  1 
ATOM   6825 N N   . ILE D 1 32  ? 1.647   -19.115 16.088  1.00 17.57 ? 52  ILE D N   1 
ATOM   6826 C CA  . ILE D 1 32  ? 1.557   -20.249 17.047  1.00 17.57 ? 52  ILE D CA  1 
ATOM   6827 C C   . ILE D 1 32  ? 1.040   -21.448 16.306  1.00 17.57 ? 52  ILE D C   1 
ATOM   6828 O O   . ILE D 1 32  ? -0.016  -21.400 15.704  1.00 17.57 ? 52  ILE D O   1 
ATOM   6829 C CB  . ILE D 1 32  ? 0.693   -19.911 18.282  1.00 17.28 ? 52  ILE D CB  1 
ATOM   6830 C CG1 . ILE D 1 32  ? 1.466   -18.904 19.162  1.00 17.28 ? 52  ILE D CG1 1 
ATOM   6831 C CG2 . ILE D 1 32  ? 0.350   -21.147 19.130  1.00 17.28 ? 52  ILE D CG2 1 
ATOM   6832 C CD1 . ILE D 1 32  ? 0.701   -18.162 20.159  1.00 17.28 ? 52  ILE D CD1 1 
ATOM   6833 N N   . ASP D 1 33  ? 1.841   -22.506 16.291  1.00 19.83 ? 53  ASP D N   1 
ATOM   6834 C CA  . ASP D 1 33  ? 1.414   -23.704 15.583  1.00 19.83 ? 53  ASP D CA  1 
ATOM   6835 C C   . ASP D 1 33  ? 1.987   -24.921 16.323  1.00 19.83 ? 53  ASP D C   1 
ATOM   6836 O O   . ASP D 1 33  ? 3.126   -24.878 16.798  1.00 19.83 ? 53  ASP D O   1 
ATOM   6837 C CB  . ASP D 1 33  ? 1.909   -23.744 14.161  1.00 20.00 ? 53  ASP D CB  1 
ATOM   6838 C CG  . ASP D 1 33  ? 1.197   -24.834 13.386  1.00 20.00 ? 53  ASP D CG  1 
ATOM   6839 O OD1 . ASP D 1 33  ? 1.572   -26.045 13.502  1.00 20.00 ? 53  ASP D OD1 1 
ATOM   6840 O OD2 . ASP D 1 33  ? 0.243   -24.506 12.660  1.00 20.00 ? 53  ASP D OD2 1 
ATOM   6841 N N   . ALA D 1 34  ? 1.205   -25.986 16.339  1.00 22.46 ? 54  ALA D N   1 
ATOM   6842 C CA  . ALA D 1 34  ? 1.596   -27.217 17.051  1.00 22.46 ? 54  ALA D CA  1 
ATOM   6843 C C   . ALA D 1 34  ? 2.823   -27.846 16.414  1.00 22.46 ? 54  ALA D C   1 
ATOM   6844 O O   . ALA D 1 34  ? 3.670   -28.469 17.093  1.00 22.46 ? 54  ALA D O   1 
ATOM   6845 C CB  . ALA D 1 34  ? 0.450   -28.215 17.070  1.00 21.60 ? 54  ALA D CB  1 
ATOM   6846 N N   . ASN D 1 35  ? 2.899   -27.739 15.103  1.00 22.34 ? 55  ASN D N   1 
ATOM   6847 C CA  . ASN D 1 35  ? 4.021   -28.261 14.333  1.00 22.34 ? 55  ASN D CA  1 
ATOM   6848 C C   . ASN D 1 35  ? 5.152   -27.237 14.290  1.00 22.34 ? 55  ASN D C   1 
ATOM   6849 O O   . ASN D 1 35  ? 5.126   -26.285 13.495  1.00 22.34 ? 55  ASN D O   1 
ATOM   6850 C CB  . ASN D 1 35  ? 3.540   -28.599 12.945  1.00 23.94 ? 55  ASN D CB  1 
ATOM   6851 C CG  . ASN D 1 35  ? 4.598   -29.324 12.150  1.00 23.94 ? 55  ASN D CG  1 
ATOM   6852 O OD1 . ASN D 1 35  ? 5.799   -29.274 12.480  1.00 23.94 ? 55  ASN D OD1 1 
ATOM   6853 N ND2 . ASN D 1 35  ? 4.201   -29.952 11.060  1.00 23.94 ? 55  ASN D ND2 1 
ATOM   6854 N N   . GLU D 1 36  ? 6.144   -27.439 15.122  1.00 22.48 ? 56  GLU D N   1 
ATOM   6855 C CA  . GLU D 1 36  ? 7.286   -26.558 15.245  1.00 22.48 ? 56  GLU D CA  1 
ATOM   6856 C C   . GLU D 1 36  ? 8.040   -26.370 13.933  1.00 22.48 ? 56  GLU D C   1 
ATOM   6857 O O   . GLU D 1 36  ? 8.490   -25.246 13.682  1.00 22.48 ? 56  GLU D O   1 
ATOM   6858 C CB  . GLU D 1 36  ? 8.235   -27.085 16.318  1.00 21.72 ? 56  GLU D CB  1 
ATOM   6859 C CG  . GLU D 1 36  ? 9.397   -26.176 16.655  1.00 21.72 ? 56  GLU D CG  1 
ATOM   6860 C CD  . GLU D 1 36  ? 9.016   -25.081 17.626  1.00 21.72 ? 56  GLU D CD  1 
ATOM   6861 O OE1 . GLU D 1 36  ? 7.999   -25.255 18.318  1.00 21.72 ? 56  GLU D OE1 1 
ATOM   6862 O OE2 . GLU D 1 36  ? 9.717   -24.040 17.725  1.00 21.72 ? 56  GLU D OE2 1 
ATOM   6863 N N   . ALA D 1 37  ? 8.214   -27.410 13.132  1.00 23.38 ? 57  ALA D N   1 
ATOM   6864 C CA  . ALA D 1 37  ? 8.961   -27.340 11.896  1.00 23.38 ? 57  ALA D CA  1 
ATOM   6865 C C   . ALA D 1 37  ? 8.195   -26.545 10.845  1.00 23.38 ? 57  ALA D C   1 
ATOM   6866 O O   . ALA D 1 37  ? 8.877   -25.804 10.150  1.00 23.38 ? 57  ALA D O   1 
ATOM   6867 C CB  . ALA D 1 37  ? 9.249   -28.710 11.308  1.00 22.69 ? 57  ALA D CB  1 
ATOM   6868 N N   . LYS D 1 38  ? 6.898   -26.684 10.745  1.00 23.58 ? 58  LYS D N   1 
ATOM   6869 C CA  . LYS D 1 38  ? 6.113   -25.944 9.755   1.00 23.58 ? 58  LYS D CA  1 
ATOM   6870 C C   . LYS D 1 38  ? 6.166   -24.473 10.145  1.00 23.58 ? 58  LYS D C   1 
ATOM   6871 O O   . LYS D 1 38  ? 6.623   -23.647 9.329   1.00 23.58 ? 58  LYS D O   1 
ATOM   6872 C CB  . LYS D 1 38  ? 4.709   -26.441 9.633   1.00 24.75 ? 58  LYS D CB  1 
ATOM   6873 C CG  . LYS D 1 38  ? 3.646   -25.695 8.882   1.00 24.75 ? 58  LYS D CG  1 
ATOM   6874 C CD  . LYS D 1 38  ? 3.942   -25.431 7.423   1.00 24.75 ? 58  LYS D CD  1 
ATOM   6875 C CE  . LYS D 1 38  ? 2.786   -24.888 6.606   1.00 24.75 ? 58  LYS D CE  1 
ATOM   6876 N NZ  . LYS D 1 38  ? 2.497   -23.439 6.664   1.00 24.75 ? 58  LYS D NZ  1 
ATOM   6877 N N   . VAL D 1 39  ? 5.837   -24.079 11.348  1.00 21.92 ? 59  VAL D N   1 
ATOM   6878 C CA  . VAL D 1 39  ? 5.880   -22.676 11.747  1.00 21.92 ? 59  VAL D CA  1 
ATOM   6879 C C   . VAL D 1 39  ? 7.263   -22.067 11.659  1.00 21.92 ? 59  VAL D C   1 
ATOM   6880 O O   . VAL D 1 39  ? 7.405   -20.845 11.361  1.00 21.92 ? 59  VAL D O   1 
ATOM   6881 C CB  . VAL D 1 39  ? 5.275   -22.533 13.157  1.00 20.85 ? 59  VAL D CB  1 
ATOM   6882 C CG1 . VAL D 1 39  ? 6.266   -22.775 14.272  1.00 20.85 ? 59  VAL D CG1 1 
ATOM   6883 C CG2 . VAL D 1 39  ? 4.722   -21.118 13.299  1.00 20.85 ? 59  VAL D CG2 1 
ATOM   6884 N N   . LYS D 1 40  ? 8.317   -22.845 11.848  1.00 20.32 ? 60  LYS D N   1 
ATOM   6885 C CA  . LYS D 1 40  ? 9.684   -22.386 11.782  1.00 20.32 ? 60  LYS D CA  1 
ATOM   6886 C C   . LYS D 1 40  ? 10.124  -22.141 10.338  1.00 20.32 ? 60  LYS D C   1 
ATOM   6887 O O   . LYS D 1 40  ? 10.909  -21.224 10.047  1.00 20.32 ? 60  LYS D O   1 
ATOM   6888 C CB  . LYS D 1 40  ? 10.626  -23.420 12.421  1.00 17.27 ? 60  LYS D CB  1 
ATOM   6889 C CG  . LYS D 1 40  ? 12.076  -22.944 12.461  1.00 17.27 ? 60  LYS D CG  1 
ATOM   6890 C CD  . LYS D 1 40  ? 12.178  -21.718 13.341  1.00 17.27 ? 60  LYS D CD  1 
ATOM   6891 C CE  . LYS D 1 40  ? 13.576  -21.155 13.277  1.00 17.27 ? 60  LYS D CE  1 
ATOM   6892 N NZ  . LYS D 1 40  ? 13.656  -20.003 14.238  1.00 17.27 ? 60  LYS D NZ  1 
ATOM   6893 N N   . ALA D 1 41  ? 9.661   -22.979 9.424   1.00 19.84 ? 61  ALA D N   1 
ATOM   6894 C CA  . ALA D 1 41  ? 9.915   -22.874 8.004   1.00 19.84 ? 61  ALA D CA  1 
ATOM   6895 C C   . ALA D 1 41  ? 9.277   -21.603 7.479   1.00 19.84 ? 61  ALA D C   1 
ATOM   6896 O O   . ALA D 1 41  ? 9.928   -20.803 6.792   1.00 19.84 ? 61  ALA D O   1 
ATOM   6897 C CB  . ALA D 1 41  ? 9.300   -24.094 7.314   1.00 18.31 ? 61  ALA D CB  1 
ATOM   6898 N N   . ASP D 1 42  ? 8.010   -21.341 7.805   1.00 19.06 ? 62  ASP D N   1 
ATOM   6899 C CA  . ASP D 1 42  ? 7.299   -20.135 7.412   1.00 19.06 ? 62  ASP D CA  1 
ATOM   6900 C C   . ASP D 1 42  ? 7.982   -18.917 7.981   1.00 19.06 ? 62  ASP D C   1 
ATOM   6901 O O   . ASP D 1 42  ? 8.195   -17.951 7.209   1.00 19.06 ? 62  ASP D O   1 
ATOM   6902 C CB  . ASP D 1 42  ? 5.860   -20.141 7.908   1.00 17.72 ? 62  ASP D CB  1 
ATOM   6903 C CG  . ASP D 1 42  ? 4.991   -20.982 7.025   1.00 17.72 ? 62  ASP D CG  1 
ATOM   6904 O OD1 . ASP D 1 42  ? 5.265   -21.115 5.825   1.00 17.72 ? 62  ASP D OD1 1 
ATOM   6905 O OD2 . ASP D 1 42  ? 3.985   -21.525 7.538   1.00 17.72 ? 62  ASP D OD2 1 
ATOM   6906 N N   . GLN D 1 43  ? 8.353   -18.906 9.232   1.00 18.40 ? 63  GLN D N   1 
ATOM   6907 C CA  . GLN D 1 43  ? 9.053   -17.766 9.809   1.00 18.40 ? 63  GLN D CA  1 
ATOM   6908 C C   . GLN D 1 43  ? 10.307  -17.457 9.026   1.00 18.40 ? 63  GLN D C   1 
ATOM   6909 O O   . GLN D 1 43  ? 10.510  -16.268 8.664   1.00 18.40 ? 63  GLN D O   1 
ATOM   6910 C CB  . GLN D 1 43  ? 9.447   -18.023 11.266  1.00 15.82 ? 63  GLN D CB  1 
ATOM   6911 C CG  . GLN D 1 43  ? 9.979   -16.788 11.955  1.00 15.82 ? 63  GLN D CG  1 
ATOM   6912 C CD  . GLN D 1 43  ? 10.746  -17.082 13.206  1.00 15.82 ? 63  GLN D CD  1 
ATOM   6913 O OE1 . GLN D 1 43  ? 11.365  -18.133 13.253  1.00 15.82 ? 63  GLN D OE1 1 
ATOM   6914 N NE2 . GLN D 1 43  ? 10.773  -16.246 14.206  1.00 15.82 ? 63  GLN D NE2 1 
ATOM   6915 N N   . ILE D 1 44  ? 11.127  -18.427 8.702   1.00 19.08 ? 64  ILE D N   1 
ATOM   6916 C CA  . ILE D 1 44  ? 12.369  -18.231 7.964   1.00 19.08 ? 64  ILE D CA  1 
ATOM   6917 C C   . ILE D 1 44  ? 12.094  -17.788 6.520   1.00 19.08 ? 64  ILE D C   1 
ATOM   6918 O O   . ILE D 1 44  ? 12.853  -16.944 6.093   1.00 19.08 ? 64  ILE D O   1 
ATOM   6919 C CB  . ILE D 1 44  ? 13.259  -19.454 7.954   1.00 19.85 ? 64  ILE D CB  1 
ATOM   6920 C CG1 . ILE D 1 44  ? 13.896  -19.530 9.364   1.00 19.85 ? 64  ILE D CG1 1 
ATOM   6921 C CG2 . ILE D 1 44  ? 14.374  -19.407 6.947   1.00 19.85 ? 64  ILE D CG2 1 
ATOM   6922 C CD1 . ILE D 1 44  ? 14.423  -20.962 9.495   1.00 19.85 ? 64  ILE D CD1 1 
ATOM   6923 N N   . ASP D 1 45  ? 11.087  -18.304 5.884   1.00 18.35 ? 65  ASP D N   1 
ATOM   6924 C CA  . ASP D 1 45  ? 10.677  -17.969 4.551   1.00 18.35 ? 65  ASP D CA  1 
ATOM   6925 C C   . ASP D 1 45  ? 10.224  -16.505 4.500   1.00 18.35 ? 65  ASP D C   1 
ATOM   6926 O O   . ASP D 1 45  ? 10.643  -15.771 3.578   1.00 18.35 ? 65  ASP D O   1 
ATOM   6927 C CB  . ASP D 1 45  ? 9.533   -18.889 4.122   1.00 17.47 ? 65  ASP D CB  1 
ATOM   6928 C CG  . ASP D 1 45  ? 9.541   -19.128 2.622   1.00 17.47 ? 65  ASP D CG  1 
ATOM   6929 O OD1 . ASP D 1 45  ? 10.494  -18.693 1.910   1.00 17.47 ? 65  ASP D OD1 1 
ATOM   6930 O OD2 . ASP D 1 45  ? 8.609   -19.808 2.157   1.00 17.47 ? 65  ASP D OD2 1 
ATOM   6931 N N   . PHE D 1 46  ? 9.400   -16.070 5.469   1.00 17.18 ? 66  PHE D N   1 
ATOM   6932 C CA  . PHE D 1 46  ? 8.999   -14.668 5.517   1.00 17.18 ? 66  PHE D CA  1 
ATOM   6933 C C   . PHE D 1 46  ? 10.194  -13.791 5.895   1.00 17.18 ? 66  PHE D C   1 
ATOM   6934 O O   . PHE D 1 46  ? 10.289  -12.658 5.468   1.00 17.18 ? 66  PHE D O   1 
ATOM   6935 C CB  . PHE D 1 46  ? 7.891   -14.414 6.521   1.00 15.01 ? 66  PHE D CB  1 
ATOM   6936 C CG  . PHE D 1 46  ? 6.522   -14.764 6.059   1.00 15.01 ? 66  PHE D CG  1 
ATOM   6937 C CD1 . PHE D 1 46  ? 5.986   -14.167 4.952   1.00 15.01 ? 66  PHE D CD1 1 
ATOM   6938 C CD2 . PHE D 1 46  ? 5.762   -15.683 6.768   1.00 15.01 ? 66  PHE D CD2 1 
ATOM   6939 C CE1 . PHE D 1 46  ? 4.706   -14.485 4.529   1.00 15.01 ? 66  PHE D CE1 1 
ATOM   6940 C CE2 . PHE D 1 46  ? 4.495   -16.029 6.368   1.00 15.01 ? 66  PHE D CE2 1 
ATOM   6941 C CZ  . PHE D 1 46  ? 3.980   -15.435 5.225   1.00 15.01 ? 66  PHE D CZ  1 
ATOM   6942 N N   . GLN D 1 47  ? 11.132  -14.263 6.703   1.00 18.09 ? 67  GLN D N   1 
ATOM   6943 C CA  . GLN D 1 47  ? 12.283  -13.430 7.043   1.00 18.09 ? 67  GLN D CA  1 
ATOM   6944 C C   . GLN D 1 47  ? 13.222  -13.340 5.832   1.00 18.09 ? 67  GLN D C   1 
ATOM   6945 O O   . GLN D 1 47  ? 13.914  -12.303 5.704   1.00 18.09 ? 67  GLN D O   1 
ATOM   6946 C CB  . GLN D 1 47  ? 13.056  -13.933 8.231   1.00 19.86 ? 67  GLN D CB  1 
ATOM   6947 C CG  . GLN D 1 47  ? 12.237  -13.993 9.528   1.00 19.86 ? 67  GLN D CG  1 
ATOM   6948 C CD  . GLN D 1 47  ? 12.944  -14.670 10.688  1.00 19.86 ? 67  GLN D CD  1 
ATOM   6949 O OE1 . GLN D 1 47  ? 12.839  -14.186 11.836  1.00 19.86 ? 67  GLN D OE1 1 
ATOM   6950 N NE2 . GLN D 1 47  ? 13.648  -15.765 10.459  1.00 19.86 ? 67  GLN D NE2 1 
ATOM   6951 N N   . ASP D 1 48  ? 13.212  -14.306 4.930   1.00 18.38 ? 68  ASP D N   1 
ATOM   6952 C CA  . ASP D 1 48  ? 13.988  -14.255 3.707   1.00 18.38 ? 68  ASP D CA  1 
ATOM   6953 C C   . ASP D 1 48  ? 13.378  -13.234 2.720   1.00 18.38 ? 68  ASP D C   1 
ATOM   6954 O O   . ASP D 1 48  ? 14.063  -12.709 1.856   1.00 18.38 ? 68  ASP D O   1 
ATOM   6955 C CB  . ASP D 1 48  ? 13.988  -15.590 2.978   1.00 17.77 ? 68  ASP D CB  1 
ATOM   6956 C CG  . ASP D 1 48  ? 14.950  -16.578 3.603   1.00 17.77 ? 68  ASP D CG  1 
ATOM   6957 O OD1 . ASP D 1 48  ? 15.770  -16.218 4.486   1.00 17.77 ? 68  ASP D OD1 1 
ATOM   6958 O OD2 . ASP D 1 48  ? 14.865  -17.748 3.185   1.00 17.77 ? 68  ASP D OD2 1 
ATOM   6959 N N   . ALA D 1 49  ? 12.072  -12.996 2.815   1.00 18.19 ? 69  ALA D N   1 
ATOM   6960 C CA  . ALA D 1 49  ? 11.368  -12.041 2.016   1.00 18.19 ? 69  ALA D CA  1 
ATOM   6961 C C   . ALA D 1 49  ? 11.637  -10.644 2.528   1.00 18.19 ? 69  ALA D C   1 
ATOM   6962 O O   . ALA D 1 49  ? 11.701  -9.711  1.689   1.00 18.19 ? 69  ALA D O   1 
ATOM   6963 C CB  . ALA D 1 49  ? 9.856   -12.303 2.065   1.00 16.79 ? 69  ALA D CB  1 
ATOM   6964 N N   . MET D 1 50  ? 11.866  -10.349 3.765   1.00 17.72 ? 70  MET D N   1 
ATOM   6965 C CA  . MET D 1 50  ? 12.098  -9.007  4.263   1.00 17.72 ? 70  MET D CA  1 
ATOM   6966 C C   . MET D 1 50  ? 13.158  -8.261  3.520   1.00 17.72 ? 70  MET D C   1 
ATOM   6967 O O   . MET D 1 50  ? 12.891  -7.035  3.315   1.00 17.72 ? 70  MET D O   1 
ATOM   6968 C CB  . MET D 1 50  ? 12.523  -8.989  5.752   1.00 16.75 ? 70  MET D CB  1 
ATOM   6969 C CG  . MET D 1 50  ? 11.378  -9.377  6.657   1.00 16.75 ? 70  MET D CG  1 
ATOM   6970 S SD  . MET D 1 50  ? 9.937   -8.322  6.626   1.00 16.75 ? 70  MET D SD  1 
ATOM   6971 C CE  . MET D 1 50  ? 8.639   -9.549  6.901   1.00 16.75 ? 70  MET D CE  1 
ATOM   6972 N N   . ALA D 1 51  ? 14.269  -8.802  3.047   1.00 17.35 ? 71  ALA D N   1 
ATOM   6973 C CA  . ALA D 1 51  ? 15.219  -7.937  2.319   1.00 17.35 ? 71  ALA D CA  1 
ATOM   6974 C C   . ALA D 1 51  ? 14.623  -7.400  1.015   1.00 17.35 ? 71  ALA D C   1 
ATOM   6975 O O   . ALA D 1 51  ? 15.122  -6.349  0.564   1.00 17.35 ? 71  ALA D O   1 
ATOM   6976 C CB  . ALA D 1 51  ? 16.515  -8.658  2.014   1.00 16.58 ? 71  ALA D CB  1 
ATOM   6977 N N   . ASN D 1 52  ? 13.650  -7.969  0.375   1.00 15.23 ? 72  ASN D N   1 
ATOM   6978 C CA  . ASN D 1 52  ? 13.086  -7.493  -0.857  1.00 15.23 ? 72  ASN D CA  1 
ATOM   6979 C C   . ASN D 1 52  ? 11.660  -6.962  -0.696  1.00 15.23 ? 72  ASN D C   1 
ATOM   6980 O O   . ASN D 1 52  ? 10.958  -6.764  -1.692  1.00 15.23 ? 72  ASN D O   1 
ATOM   6981 C CB  . ASN D 1 52  ? 13.114  -8.648  -1.869  1.00 15.79 ? 72  ASN D CB  1 
ATOM   6982 C CG  . ASN D 1 52  ? 14.525  -9.072  -2.190  1.00 15.79 ? 72  ASN D CG  1 
ATOM   6983 O OD1 . ASN D 1 52  ? 15.409  -8.245  -2.388  1.00 15.79 ? 72  ASN D OD1 1 
ATOM   6984 N ND2 . ASN D 1 52  ? 14.762  -10.366 -2.283  1.00 15.79 ? 72  ASN D ND2 1 
ATOM   6985 N N   . LEU D 1 53  ? 11.184  -6.713  0.517   1.00 15.01 ? 73  LEU D N   1 
ATOM   6986 C CA  . LEU D 1 53  ? 9.861   -6.211  0.776   1.00 15.01 ? 73  LEU D CA  1 
ATOM   6987 C C   . LEU D 1 53  ? 10.002  -4.722  1.112   1.00 15.01 ? 73  LEU D C   1 
ATOM   6988 O O   . LEU D 1 53  ? 11.069  -4.369  1.574   1.00 15.01 ? 73  LEU D O   1 
ATOM   6989 C CB  . LEU D 1 53  ? 9.122   -6.830  1.952   1.00 16.00 ? 73  LEU D CB  1 
ATOM   6990 C CG  . LEU D 1 53  ? 8.378   -8.145  1.790   1.00 16.00 ? 73  LEU D CG  1 
ATOM   6991 C CD1 . LEU D 1 53  ? 7.879   -8.631  3.164   1.00 16.00 ? 73  LEU D CD1 1 
ATOM   6992 C CD2 . LEU D 1 53  ? 7.168   -8.038  0.876   1.00 16.00 ? 73  LEU D CD2 1 
ATOM   6993 N N   . GLU D 1 54  ? 8.921   -3.998  0.913   1.00 16.67 ? 74  GLU D N   1 
ATOM   6994 C CA  . GLU D 1 54  ? 8.904   -2.574  1.180   1.00 16.67 ? 74  GLU D CA  1 
ATOM   6995 C C   . GLU D 1 54  ? 8.692   -2.269  2.638   1.00 16.67 ? 74  GLU D C   1 
ATOM   6996 O O   . GLU D 1 54  ? 9.246   -1.277  3.147   1.00 16.67 ? 74  GLU D O   1 
ATOM   6997 C CB  . GLU D 1 54  ? 7.749   -1.940  0.402   1.00 23.19 ? 74  GLU D CB  1 
ATOM   6998 C CG  . GLU D 1 54  ? 7.977   -1.928  -1.086  1.00 23.19 ? 74  GLU D CG  1 
ATOM   6999 C CD  . GLU D 1 54  ? 7.597   -3.181  -1.795  1.00 23.19 ? 74  GLU D CD  1 
ATOM   7000 O OE1 . GLU D 1 54  ? 6.858   -4.028  -1.204  1.00 23.19 ? 74  GLU D OE1 1 
ATOM   7001 O OE2 . GLU D 1 54  ? 8.051   -3.424  -2.956  1.00 23.19 ? 74  GLU D OE2 1 
ATOM   7002 N N   . ALA D 1 55  ? 7.918   -3.084  3.361   1.00 16.24 ? 75  ALA D N   1 
ATOM   7003 C CA  . ALA D 1 55  ? 7.706   -2.778  4.787   1.00 16.24 ? 75  ALA D CA  1 
ATOM   7004 C C   . ALA D 1 55  ? 8.300   -3.853  5.656   1.00 16.24 ? 75  ALA D C   1 
ATOM   7005 O O   . ALA D 1 55  ? 8.408   -5.011  5.257   1.00 16.24 ? 75  ALA D O   1 
ATOM   7006 C CB  . ALA D 1 55  ? 6.194   -2.627  4.998   1.00 15.81 ? 75  ALA D CB  1 
ATOM   7007 N N   . HIS D 1 56  ? 8.699   -3.497  6.857   1.00 16.18 ? 76  HIS D N   1 
ATOM   7008 C CA  . HIS D 1 56  ? 9.299   -4.432  7.807   1.00 16.18 ? 76  HIS D CA  1 
ATOM   7009 C C   . HIS D 1 56  ? 8.291   -4.996  8.803   1.00 16.18 ? 76  HIS D C   1 
ATOM   7010 O O   . HIS D 1 56  ? 7.318   -4.359  9.259   1.00 16.18 ? 76  HIS D O   1 
ATOM   7011 C CB  . HIS D 1 56  ? 10.401  -3.717  8.593   1.00 16.94 ? 76  HIS D CB  1 
ATOM   7012 C CG  . HIS D 1 56  ? 11.098  -4.565  9.601   1.00 16.94 ? 76  HIS D CG  1 
ATOM   7013 N ND1 . HIS D 1 56  ? 12.156  -5.394  9.276   1.00 16.94 ? 76  HIS D ND1 1 
ATOM   7014 C CD2 . HIS D 1 56  ? 10.878  -4.709  10.930  1.00 16.94 ? 76  HIS D CD2 1 
ATOM   7015 C CE1 . HIS D 1 56  ? 12.566  -6.032  10.362  1.00 16.94 ? 76  HIS D CE1 1 
ATOM   7016 N NE2 . HIS D 1 56  ? 11.798  -5.638  11.368  1.00 16.94 ? 76  HIS D NE2 1 
ATOM   7017 N N   . GLY D 1 57  ? 8.514   -6.227  9.195   1.00 16.05 ? 77  GLY D N   1 
ATOM   7018 C CA  . GLY D 1 57  ? 7.675   -6.903  10.192  1.00 16.05 ? 77  GLY D CA  1 
ATOM   7019 C C   . GLY D 1 57  ? 8.553   -7.864  10.999  1.00 16.05 ? 77  GLY D C   1 
ATOM   7020 O O   . GLY D 1 57  ? 9.452   -8.498  10.477  1.00 16.05 ? 77  GLY D O   1 
ATOM   7021 N N   . ASN D 1 58  ? 8.296   -7.929  12.294  1.00 16.93 ? 78  ASN D N   1 
ATOM   7022 C CA  . ASN D 1 58  ? 9.006   -8.829  13.193  1.00 16.93 ? 78  ASN D CA  1 
ATOM   7023 C C   . ASN D 1 58  ? 8.147   -10.056 13.435  1.00 16.93 ? 78  ASN D C   1 
ATOM   7024 O O   . ASN D 1 58  ? 6.914   -9.931  13.585  1.00 16.93 ? 78  ASN D O   1 
ATOM   7025 C CB  . ASN D 1 58  ? 9.299   -8.132  14.511  1.00 16.89 ? 78  ASN D CB  1 
ATOM   7026 C CG  . ASN D 1 58  ? 10.026  -6.806  14.332  1.00 16.89 ? 78  ASN D CG  1 
ATOM   7027 O OD1 . ASN D 1 58  ? 11.200  -6.797  13.998  1.00 16.89 ? 78  ASN D OD1 1 
ATOM   7028 N ND2 . ASN D 1 58  ? 9.376   -5.672  14.609  1.00 16.89 ? 78  ASN D ND2 1 
ATOM   7029 N N   . ILE D 1 59  ? 8.720   -11.249 13.387  1.00 18.26 ? 79  ILE D N   1 
ATOM   7030 C CA  . ILE D 1 59  ? 7.945   -12.483 13.559  1.00 18.26 ? 79  ILE D CA  1 
ATOM   7031 C C   . ILE D 1 59  ? 8.529   -13.357 14.679  1.00 18.26 ? 79  ILE D C   1 
ATOM   7032 O O   . ILE D 1 59  ? 9.707   -13.709 14.665  1.00 18.26 ? 79  ILE D O   1 
ATOM   7033 C CB  . ILE D 1 59  ? 7.936   -13.361 12.305  1.00 17.60 ? 79  ILE D CB  1 
ATOM   7034 C CG1 . ILE D 1 59  ? 7.304   -12.639 11.098  1.00 17.60 ? 79  ILE D CG1 1 
ATOM   7035 C CG2 . ILE D 1 59  ? 7.121   -14.623 12.531  1.00 17.60 ? 79  ILE D CG2 1 
ATOM   7036 C CD1 . ILE D 1 59  ? 7.716   -13.281 9.780   1.00 17.60 ? 79  ILE D CD1 1 
ATOM   7037 N N   . VAL D 1 60  ? 7.693   -13.679 15.674  1.00 19.31 ? 80  VAL D N   1 
ATOM   7038 C CA  . VAL D 1 60  ? 8.128   -14.590 16.744  1.00 19.31 ? 80  VAL D CA  1 
ATOM   7039 C C   . VAL D 1 60  ? 7.142   -15.797 16.691  1.00 19.31 ? 80  VAL D C   1 
ATOM   7040 O O   . VAL D 1 60  ? 5.976   -15.632 16.354  1.00 19.31 ? 80  VAL D O   1 
ATOM   7041 C CB  . VAL D 1 60  ? 8.152   -14.097 18.188  1.00 19.74 ? 80  VAL D CB  1 
ATOM   7042 C CG1 . VAL D 1 60  ? 9.024   -12.857 18.348  1.00 19.74 ? 80  VAL D CG1 1 
ATOM   7043 C CG2 . VAL D 1 60  ? 6.737   -13.785 18.628  1.00 19.74 ? 80  VAL D CG2 1 
ATOM   7044 N N   . ILE D 1 61  ? 7.650   -16.967 17.013  1.00 18.65 ? 81  ILE D N   1 
ATOM   7045 C CA  . ILE D 1 61  ? 6.822   -18.161 16.948  1.00 18.65 ? 81  ILE D CA  1 
ATOM   7046 C C   . ILE D 1 61  ? 6.670   -18.809 18.318  1.00 18.65 ? 81  ILE D C   1 
ATOM   7047 O O   . ILE D 1 61  ? 7.507   -18.639 19.195  1.00 18.65 ? 81  ILE D O   1 
ATOM   7048 C CB  . ILE D 1 61  ? 7.388   -19.236 16.010  1.00 17.18 ? 81  ILE D CB  1 
ATOM   7049 C CG1 . ILE D 1 61  ? 8.811   -19.657 16.439  1.00 17.18 ? 81  ILE D CG1 1 
ATOM   7050 C CG2 . ILE D 1 61  ? 7.437   -18.735 14.573  1.00 17.18 ? 81  ILE D CG2 1 
ATOM   7051 C CD1 . ILE D 1 61  ? 9.298   -20.910 15.725  1.00 17.18 ? 81  ILE D CD1 1 
ATOM   7052 N N   . ASN D 1 62  ? 5.558   -19.487 18.527  1.00 19.59 ? 82  ASN D N   1 
ATOM   7053 C CA  . ASN D 1 62  ? 5.168   -20.255 19.673  1.00 19.59 ? 82  ASN D CA  1 
ATOM   7054 C C   . ASN D 1 62  ? 5.535   -19.657 21.009  1.00 19.59 ? 82  ASN D C   1 
ATOM   7055 O O   . ASN D 1 62  ? 6.074   -20.380 21.858  1.00 19.59 ? 82  ASN D O   1 
ATOM   7056 C CB  . ASN D 1 62  ? 5.848   -21.631 19.504  1.00 16.08 ? 82  ASN D CB  1 
ATOM   7057 C CG  . ASN D 1 62  ? 5.183   -22.423 18.422  1.00 16.08 ? 82  ASN D CG  1 
ATOM   7058 O OD1 . ASN D 1 62  ? 4.004   -22.279 18.117  1.00 16.08 ? 82  ASN D OD1 1 
ATOM   7059 N ND2 . ASN D 1 62  ? 5.908   -23.343 17.804  1.00 16.08 ? 82  ASN D ND2 1 
ATOM   7060 N N   . ASP D 1 63  ? 5.205   -18.386 21.201  1.00 19.66 ? 83  ASP D N   1 
ATOM   7061 C CA  . ASP D 1 63  ? 5.501   -17.677 22.460  1.00 19.66 ? 83  ASP D CA  1 
ATOM   7062 C C   . ASP D 1 63  ? 4.186   -17.036 22.898  1.00 19.66 ? 83  ASP D C   1 
ATOM   7063 O O   . ASP D 1 63  ? 3.818   -15.948 22.472  1.00 19.66 ? 83  ASP D O   1 
ATOM   7064 C CB  . ASP D 1 63  ? 6.576   -16.661 22.239  1.00 21.24 ? 83  ASP D CB  1 
ATOM   7065 C CG  . ASP D 1 63  ? 6.945   -15.790 23.395  1.00 21.24 ? 83  ASP D CG  1 
ATOM   7066 O OD1 . ASP D 1 63  ? 6.336   -15.965 24.482  1.00 21.24 ? 83  ASP D OD1 1 
ATOM   7067 O OD2 . ASP D 1 63  ? 7.876   -14.959 23.307  1.00 21.24 ? 83  ASP D OD2 1 
ATOM   7068 N N   . TRP D 1 64  ? 3.468   -17.695 23.779  1.00 15.26 ? 84  TRP D N   1 
ATOM   7069 C CA  . TRP D 1 64  ? 2.175   -17.228 24.257  1.00 15.26 ? 84  TRP D CA  1 
ATOM   7070 C C   . TRP D 1 64  ? 2.230   -15.936 24.989  1.00 15.26 ? 84  TRP D C   1 
ATOM   7071 O O   . TRP D 1 64  ? 1.292   -15.139 24.867  1.00 15.26 ? 84  TRP D O   1 
ATOM   7072 C CB  . TRP D 1 64  ? 1.629   -18.301 25.254  1.00 10.07 ? 84  TRP D CB  1 
ATOM   7073 C CG  . TRP D 1 64  ? 1.151   -19.517 24.567  1.00 10.07 ? 84  TRP D CG  1 
ATOM   7074 C CD1 . TRP D 1 64  ? 1.818   -20.714 24.483  1.00 10.07 ? 84  TRP D CD1 1 
ATOM   7075 C CD2 . TRP D 1 64  ? -0.083  -19.675 23.859  1.00 10.07 ? 84  TRP D CD2 1 
ATOM   7076 N NE1 . TRP D 1 64  ? 1.066   -21.599 23.742  1.00 10.07 ? 84  TRP D NE1 1 
ATOM   7077 C CE2 . TRP D 1 64  ? -0.113  -20.999 23.358  1.00 10.07 ? 84  TRP D CE2 1 
ATOM   7078 C CE3 . TRP D 1 64  ? -1.178  -18.823 23.593  1.00 10.07 ? 84  TRP D CE3 1 
ATOM   7079 C CZ2 . TRP D 1 64  ? -1.173  -21.487 22.598  1.00 10.07 ? 84  TRP D CZ2 1 
ATOM   7080 C CZ3 . TRP D 1 64  ? -2.233  -19.324 22.855  1.00 10.07 ? 84  TRP D CZ3 1 
ATOM   7081 C CH2 . TRP D 1 64  ? -2.232  -20.625 22.344  1.00 10.07 ? 84  TRP D CH2 1 
ATOM   7082 N N   . ALA D 1 65  ? 3.272   -15.659 25.755  1.00 16.66 ? 85  ALA D N   1 
ATOM   7083 C CA  . ALA D 1 65  ? 3.399   -14.444 26.522  1.00 16.66 ? 85  ALA D CA  1 
ATOM   7084 C C   . ALA D 1 65  ? 3.413   -13.250 25.600  1.00 16.66 ? 85  ALA D C   1 
ATOM   7085 O O   . ALA D 1 65  ? 2.971   -12.139 25.945  1.00 16.66 ? 85  ALA D O   1 
ATOM   7086 C CB  . ALA D 1 65  ? 4.706   -14.506 27.312  1.00 16.13 ? 85  ALA D CB  1 
ATOM   7087 N N   . ALA D 1 66  ? 3.879   -13.404 24.352  1.00 17.58 ? 86  ALA D N   1 
ATOM   7088 C CA  . ALA D 1 66  ? 3.960   -12.371 23.346  1.00 17.58 ? 86  ALA D CA  1 
ATOM   7089 C C   . ALA D 1 66  ? 2.615   -11.894 22.899  1.00 17.58 ? 86  ALA D C   1 
ATOM   7090 O O   . ALA D 1 66  ? 2.528   -10.803 22.347  1.00 17.58 ? 86  ALA D O   1 
ATOM   7091 C CB  . ALA D 1 66  ? 4.724   -12.921 22.123  1.00 17.29 ? 86  ALA D CB  1 
ATOM   7092 N N   . LEU D 1 67  ? 1.536   -12.635 23.122  1.00 16.87 ? 87  LEU D N   1 
ATOM   7093 C CA  . LEU D 1 67  ? 0.184   -12.241 22.744  1.00 16.87 ? 87  LEU D CA  1 
ATOM   7094 C C   . LEU D 1 67  ? -0.451  -11.234 23.687  1.00 16.87 ? 87  LEU D C   1 
ATOM   7095 O O   . LEU D 1 67  ? -1.483  -10.632 23.333  1.00 16.87 ? 87  LEU D O   1 
ATOM   7096 C CB  . LEU D 1 67  ? -0.724  -13.467 22.694  1.00 15.48 ? 87  LEU D CB  1 
ATOM   7097 C CG  . LEU D 1 67  ? -0.423  -14.520 21.650  1.00 15.48 ? 87  LEU D CG  1 
ATOM   7098 C CD1 . LEU D 1 67  ? -1.446  -15.660 21.684  1.00 15.48 ? 87  LEU D CD1 1 
ATOM   7099 C CD2 . LEU D 1 67  ? -0.437  -13.919 20.256  1.00 15.48 ? 87  LEU D CD2 1 
ATOM   7100 N N   . ALA D 1 68  ? 0.120   -10.939 24.807  1.00 16.98 ? 88  ALA D N   1 
ATOM   7101 C CA  . ALA D 1 68  ? -0.374  -10.089 25.852  1.00 16.98 ? 88  ALA D CA  1 
ATOM   7102 C C   . ALA D 1 68  ? -0.850  -8.754  25.315  1.00 16.98 ? 88  ALA D C   1 
ATOM   7103 O O   . ALA D 1 68  ? -1.962  -8.318  25.623  1.00 16.98 ? 88  ALA D O   1 
ATOM   7104 C CB  . ALA D 1 68  ? 0.687   -9.770  26.892  1.00 15.61 ? 88  ALA D CB  1 
ATOM   7105 N N   . ASP D 1 69  ? -0.002  -8.121  24.529  1.00 19.59 ? 89  ASP D N   1 
ATOM   7106 C CA  . ASP D 1 69  ? -0.373  -6.802  23.976  1.00 19.59 ? 89  ASP D CA  1 
ATOM   7107 C C   . ASP D 1 69  ? -0.741  -6.862  22.505  1.00 19.59 ? 89  ASP D C   1 
ATOM   7108 O O   . ASP D 1 69  ? -0.678  -5.827  21.860  1.00 19.59 ? 89  ASP D O   1 
ATOM   7109 C CB  . ASP D 1 69  ? 0.791   -5.869  24.245  1.00 21.93 ? 89  ASP D CB  1 
ATOM   7110 C CG  . ASP D 1 69  ? 2.050   -6.324  23.609  1.00 21.93 ? 89  ASP D CG  1 
ATOM   7111 O OD1 . ASP D 1 69  ? 2.210   -7.463  23.119  1.00 21.93 ? 89  ASP D OD1 1 
ATOM   7112 O OD2 . ASP D 1 69  ? 2.953   -5.423  23.490  1.00 21.93 ? 89  ASP D OD2 1 
ATOM   7113 N N   . ALA D 1 70  ? -1.136  -8.021  21.967  1.00 16.17 ? 90  ALA D N   1 
ATOM   7114 C CA  . ALA D 1 70  ? -1.554  -8.115  20.595  1.00 16.17 ? 90  ALA D CA  1 
ATOM   7115 C C   . ALA D 1 70  ? -2.874  -7.366  20.421  1.00 16.17 ? 90  ALA D C   1 
ATOM   7116 O O   . ALA D 1 70  ? -3.720  -7.378  21.320  1.00 16.17 ? 90  ALA D O   1 
ATOM   7117 C CB  . ALA D 1 70  ? -1.765  -9.550  20.164  1.00 14.58 ? 90  ALA D CB  1 
ATOM   7118 N N   . ASP D 1 71  ? -3.023  -6.707  19.266  1.00 13.77 ? 91  ASP D N   1 
ATOM   7119 C CA  . ASP D 1 71  ? -4.271  -5.986  19.025  1.00 13.77 ? 91  ASP D CA  1 
ATOM   7120 C C   . ASP D 1 71  ? -5.358  -6.987  18.670  1.00 13.77 ? 91  ASP D C   1 
ATOM   7121 O O   . ASP D 1 71  ? -6.516  -6.804  19.050  1.00 13.77 ? 91  ASP D O   1 
ATOM   7122 C CB  . ASP D 1 71  ? -4.151  -4.990  17.873  1.00 14.63 ? 91  ASP D CB  1 
ATOM   7123 C CG  . ASP D 1 71  ? -3.235  -3.857  18.106  1.00 14.63 ? 91  ASP D CG  1 
ATOM   7124 O OD1 . ASP D 1 71  ? -2.003  -3.982  18.004  1.00 14.63 ? 91  ASP D OD1 1 
ATOM   7125 O OD2 . ASP D 1 71  ? -3.703  -2.718  18.382  1.00 14.63 ? 91  ASP D OD2 1 
ATOM   7126 N N   . VAL D 1 72  ? -5.017  -7.962  17.836  1.00 12.44 ? 92  VAL D N   1 
ATOM   7127 C CA  . VAL D 1 72  ? -5.968  -8.915  17.310  1.00 12.44 ? 92  VAL D CA  1 
ATOM   7128 C C   . VAL D 1 72  ? -5.372  -10.299 17.268  1.00 12.44 ? 92  VAL D C   1 
ATOM   7129 O O   . VAL D 1 72  ? -4.143  -10.379 17.020  1.00 12.44 ? 92  VAL D O   1 
ATOM   7130 C CB  . VAL D 1 72  ? -6.313  -8.544  15.832  1.00 14.14 ? 92  VAL D CB  1 
ATOM   7131 C CG1 . VAL D 1 72  ? -7.339  -9.509  15.259  1.00 14.14 ? 92  VAL D CG1 1 
ATOM   7132 C CG2 . VAL D 1 72  ? -6.918  -7.179  15.666  1.00 14.14 ? 92  VAL D CG2 1 
ATOM   7133 N N   . VAL D 1 73  ? -6.140  -11.376 17.491  1.00 11.53 ? 93  VAL D N   1 
ATOM   7134 C CA  . VAL D 1 73  ? -5.544  -12.723 17.364  1.00 11.53 ? 93  VAL D CA  1 
ATOM   7135 C C   . VAL D 1 73  ? -6.479  -13.424 16.408  1.00 11.53 ? 93  VAL D C   1 
ATOM   7136 O O   . VAL D 1 73  ? -7.688  -13.222 16.534  1.00 11.53 ? 93  VAL D O   1 
ATOM   7137 C CB  . VAL D 1 73  ? -5.374  -13.542 18.631  1.00 9.03  ? 93  VAL D CB  1 
ATOM   7138 C CG1 . VAL D 1 73  ? -4.963  -14.975 18.296  1.00 9.03  ? 93  VAL D CG1 1 
ATOM   7139 C CG2 . VAL D 1 73  ? -4.266  -12.997 19.531  1.00 9.03  ? 93  VAL D CG2 1 
ATOM   7140 N N   . ILE D 1 74  ? -5.949  -14.116 15.440  1.00 15.91 ? 94  ILE D N   1 
ATOM   7141 C CA  . ILE D 1 74  ? -6.807  -14.789 14.459  1.00 15.91 ? 94  ILE D CA  1 
ATOM   7142 C C   . ILE D 1 74  ? -6.575  -16.279 14.663  1.00 15.91 ? 94  ILE D C   1 
ATOM   7143 O O   . ILE D 1 74  ? -5.433  -16.738 14.654  1.00 15.91 ? 94  ILE D O   1 
ATOM   7144 C CB  . ILE D 1 74  ? -6.461  -14.330 13.043  1.00 15.64 ? 94  ILE D CB  1 
ATOM   7145 C CG1 . ILE D 1 74  ? -6.818  -12.827 12.896  1.00 15.64 ? 94  ILE D CG1 1 
ATOM   7146 C CG2 . ILE D 1 74  ? -7.212  -15.112 11.984  1.00 15.64 ? 94  ILE D CG2 1 
ATOM   7147 C CD1 . ILE D 1 74  ? -6.047  -12.197 11.762  1.00 15.64 ? 94  ILE D CD1 1 
ATOM   7148 N N   . SER D 1 75  ? -7.665  -17.002 14.890  1.00 21.24 ? 95  SER D N   1 
ATOM   7149 C CA  . SER D 1 75  ? -7.545  -18.435 15.103  1.00 21.24 ? 95  SER D CA  1 
ATOM   7150 C C   . SER D 1 75  ? -8.051  -19.166 13.888  1.00 21.24 ? 95  SER D C   1 
ATOM   7151 O O   . SER D 1 75  ? -9.188  -18.938 13.463  1.00 21.24 ? 95  SER D O   1 
ATOM   7152 C CB  . SER D 1 75  ? -8.356  -18.827 16.340  1.00 22.42 ? 95  SER D CB  1 
ATOM   7153 O OG  . SER D 1 75  ? -8.166  -20.231 16.579  1.00 22.42 ? 95  SER D OG  1 
ATOM   7154 N N   . THR D 1 76  ? -7.205  -20.007 13.311  1.00 27.20 ? 96  THR D N   1 
ATOM   7155 C CA  . THR D 1 76  ? -7.616  -20.755 12.113  1.00 27.20 ? 96  THR D CA  1 
ATOM   7156 C C   . THR D 1 76  ? -7.731  -22.238 12.444  1.00 27.20 ? 96  THR D C   1 
ATOM   7157 O O   . THR D 1 76  ? -7.637  -23.090 11.560  1.00 27.20 ? 96  THR D O   1 
ATOM   7158 C CB  . THR D 1 76  ? -6.628  -20.513 10.962  1.00 25.80 ? 96  THR D CB  1 
ATOM   7159 O OG1 . THR D 1 76  ? -5.469  -21.337 11.113  1.00 25.80 ? 96  THR D OG1 1 
ATOM   7160 C CG2 . THR D 1 76  ? -6.111  -19.070 10.915  1.00 25.80 ? 96  THR D CG2 1 
ATOM   7161 N N   . LEU D 1 77  ? -7.927  -22.605 13.692  1.00 33.02 ? 97  LEU D N   1 
ATOM   7162 C CA  . LEU D 1 77  ? -8.063  -23.990 14.121  1.00 33.02 ? 97  LEU D CA  1 
ATOM   7163 C C   . LEU D 1 77  ? -9.480  -24.477 13.915  1.00 33.02 ? 97  LEU D C   1 
ATOM   7164 O O   . LEU D 1 77  ? -10.465 -23.724 14.085  1.00 33.02 ? 97  LEU D O   1 
ATOM   7165 C CB  . LEU D 1 77  ? -7.780  -24.043 15.598  1.00 32.19 ? 97  LEU D CB  1 
ATOM   7166 C CG  . LEU D 1 77  ? -6.450  -23.748 16.227  1.00 32.19 ? 97  LEU D CG  1 
ATOM   7167 C CD1 . LEU D 1 77  ? -6.366  -24.000 17.705  1.00 32.19 ? 97  LEU D CD1 1 
ATOM   7168 C CD2 . LEU D 1 77  ? -5.384  -24.626 15.534  1.00 32.19 ? 97  LEU D CD2 1 
ATOM   7169 N N   . GLY D 1 78  ? -9.613  -25.755 13.606  1.00 40.60 ? 98  GLY D N   1 
ATOM   7170 C CA  . GLY D 1 78  ? -10.969 -26.337 13.406  1.00 40.60 ? 98  GLY D CA  1 
ATOM   7171 C C   . GLY D 1 78  ? -10.900 -27.867 13.310  1.00 40.60 ? 98  GLY D C   1 
ATOM   7172 O O   . GLY D 1 78  ? -9.879  -28.327 12.747  1.00 40.60 ? 98  GLY D O   1 
ATOM   7173 N N   . GLY D 1 89  ? -18.645 -43.114 18.356  1.00 55.93 ? 109 GLY D N   1 
ATOM   7174 C CA  . GLY D 1 89  ? -17.258 -43.569 18.102  1.00 55.93 ? 109 GLY D CA  1 
ATOM   7175 C C   . GLY D 1 89  ? -16.480 -42.358 17.576  1.00 55.93 ? 109 GLY D C   1 
ATOM   7176 O O   . GLY D 1 89  ? -16.046 -41.512 18.348  1.00 55.93 ? 109 GLY D O   1 
ATOM   7177 N N   . ASP D 1 90  ? -16.361 -42.276 16.269  1.00 52.75 ? 110 ASP D N   1 
ATOM   7178 C CA  . ASP D 1 90  ? -15.672 -41.226 15.548  1.00 52.75 ? 110 ASP D CA  1 
ATOM   7179 C C   . ASP D 1 90  ? -16.144 -39.814 15.828  1.00 52.75 ? 110 ASP D C   1 
ATOM   7180 O O   . ASP D 1 90  ? -15.341 -39.014 16.293  1.00 52.75 ? 110 ASP D O   1 
ATOM   7181 C CB  . ASP D 1 90  ? -15.837 -41.478 14.026  1.00 58.57 ? 110 ASP D CB  1 
ATOM   7182 C CG  . ASP D 1 90  ? -14.684 -42.288 13.456  1.00 58.57 ? 110 ASP D CG  1 
ATOM   7183 O OD1 . ASP D 1 90  ? -14.295 -43.326 14.062  1.00 58.57 ? 110 ASP D OD1 1 
ATOM   7184 O OD2 . ASP D 1 90  ? -14.179 -41.842 12.364  1.00 58.57 ? 110 ASP D OD2 1 
ATOM   7185 N N   . ARG D 1 91  ? -17.392 -39.513 15.548  1.00 45.06 ? 111 ARG D N   1 
ATOM   7186 C CA  . ARG D 1 91  ? -18.059 -38.221 15.718  1.00 45.06 ? 111 ARG D CA  1 
ATOM   7187 C C   . ARG D 1 91  ? -17.909 -37.706 17.139  1.00 45.06 ? 111 ARG D C   1 
ATOM   7188 O O   . ARG D 1 91  ? -17.566 -36.535 17.344  1.00 45.06 ? 111 ARG D O   1 
ATOM   7189 C CB  . ARG D 1 91  ? -19.523 -38.391 15.365  1.00 51.29 ? 111 ARG D CB  1 
ATOM   7190 C CG  . ARG D 1 91  ? -20.505 -37.392 15.916  1.00 51.29 ? 111 ARG D CG  1 
ATOM   7191 C CD  . ARG D 1 91  ? -20.709 -36.218 14.977  1.00 51.29 ? 111 ARG D CD  1 
ATOM   7192 N NE  . ARG D 1 91  ? -21.596 -35.199 15.579  1.00 51.29 ? 111 ARG D NE  1 
ATOM   7193 C CZ  . ARG D 1 91  ? -21.534 -33.927 15.167  1.00 51.29 ? 111 ARG D CZ  1 
ATOM   7194 N NH1 . ARG D 1 91  ? -20.652 -33.521 14.228  1.00 51.29 ? 111 ARG D NH1 1 
ATOM   7195 N NH2 . ARG D 1 91  ? -22.340 -32.988 15.639  1.00 51.29 ? 111 ARG D NH2 1 
ATOM   7196 N N   . PHE D 1 92  ? -18.157 -38.567 18.129  1.00 35.15 ? 112 PHE D N   1 
ATOM   7197 C CA  . PHE D 1 92  ? -18.012 -38.234 19.534  1.00 35.15 ? 112 PHE D CA  1 
ATOM   7198 C C   . PHE D 1 92  ? -16.522 -38.002 19.792  1.00 35.15 ? 112 PHE D C   1 
ATOM   7199 O O   . PHE D 1 92  ? -16.160 -37.017 20.408  1.00 35.15 ? 112 PHE D O   1 
ATOM   7200 C CB  . PHE D 1 92  ? -18.515 -39.319 20.478  1.00 31.59 ? 112 PHE D CB  1 
ATOM   7201 C CG  . PHE D 1 92  ? -18.391 -38.953 21.934  1.00 31.59 ? 112 PHE D CG  1 
ATOM   7202 C CD1 . PHE D 1 92  ? -19.428 -38.266 22.565  1.00 31.59 ? 112 PHE D CD1 1 
ATOM   7203 C CD2 . PHE D 1 92  ? -17.241 -39.248 22.649  1.00 31.59 ? 112 PHE D CD2 1 
ATOM   7204 C CE1 . PHE D 1 92  ? -19.320 -37.902 23.886  1.00 31.59 ? 112 PHE D CE1 1 
ATOM   7205 C CE2 . PHE D 1 92  ? -17.144 -38.870 23.971  1.00 31.59 ? 112 PHE D CE2 1 
ATOM   7206 C CZ  . PHE D 1 92  ? -18.170 -38.195 24.605  1.00 31.59 ? 112 PHE D CZ  1 
ATOM   7207 N N   . ALA D 1 93  ? -15.709 -38.922 19.293  1.00 31.49 ? 113 ALA D N   1 
ATOM   7208 C CA  . ALA D 1 93  ? -14.238 -38.796 19.441  1.00 31.49 ? 113 ALA D CA  1 
ATOM   7209 C C   . ALA D 1 93  ? -13.796 -37.437 18.899  1.00 31.49 ? 113 ALA D C   1 
ATOM   7210 O O   . ALA D 1 93  ? -13.200 -36.636 19.660  1.00 31.49 ? 113 ALA D O   1 
ATOM   7211 C CB  . ALA D 1 93  ? -13.526 -39.949 18.791  1.00 30.47 ? 113 ALA D CB  1 
ATOM   7212 N N   . GLU D 1 94  ? -14.130 -37.094 17.665  1.00 30.17 ? 114 GLU D N   1 
ATOM   7213 C CA  . GLU D 1 94  ? -13.786 -35.810 17.071  1.00 30.17 ? 114 GLU D CA  1 
ATOM   7214 C C   . GLU D 1 94  ? -14.315 -34.653 17.871  1.00 30.17 ? 114 GLU D C   1 
ATOM   7215 O O   . GLU D 1 94  ? -13.558 -33.716 18.209  1.00 30.17 ? 114 GLU D O   1 
ATOM   7216 C CB  . GLU D 1 94  ? -14.335 -35.798 15.608  1.00 41.25 ? 114 GLU D CB  1 
ATOM   7217 C CG  . GLU D 1 94  ? -13.688 -36.974 14.849  1.00 41.25 ? 114 GLU D CG  1 
ATOM   7218 C CD  . GLU D 1 94  ? -14.340 -37.320 13.537  1.00 41.25 ? 114 GLU D CD  1 
ATOM   7219 O OE1 . GLU D 1 94  ? -15.024 -36.426 12.934  1.00 41.25 ? 114 GLU D OE1 1 
ATOM   7220 O OE2 . GLU D 1 94  ? -14.202 -38.494 13.041  1.00 41.25 ? 114 GLU D OE2 1 
ATOM   7221 N N   . LEU D 1 95  ? -15.567 -34.670 18.308  1.00 25.11 ? 115 LEU D N   1 
ATOM   7222 C CA  . LEU D 1 95  ? -16.101 -33.583 19.106  1.00 25.11 ? 115 LEU D CA  1 
ATOM   7223 C C   . LEU D 1 95  ? -15.272 -33.360 20.353  1.00 25.11 ? 115 LEU D C   1 
ATOM   7224 O O   . LEU D 1 95  ? -15.026 -32.243 20.774  1.00 25.11 ? 115 LEU D O   1 
ATOM   7225 C CB  . LEU D 1 95  ? -17.522 -33.877 19.577  1.00 25.22 ? 115 LEU D CB  1 
ATOM   7226 C CG  . LEU D 1 95  ? -18.647 -33.788 18.574  1.00 25.22 ? 115 LEU D CG  1 
ATOM   7227 C CD1 . LEU D 1 95  ? -20.001 -33.848 19.270  1.00 25.22 ? 115 LEU D CD1 1 
ATOM   7228 C CD2 . LEU D 1 95  ? -18.593 -32.509 17.773  1.00 25.22 ? 115 LEU D CD2 1 
ATOM   7229 N N   . LYS D 1 96  ? -14.874 -34.474 20.982  1.00 20.90 ? 116 LYS D N   1 
ATOM   7230 C CA  . LYS D 1 96  ? -14.105 -34.477 22.206  1.00 20.90 ? 116 LYS D CA  1 
ATOM   7231 C C   . LYS D 1 96  ? -12.727 -33.872 22.011  1.00 20.90 ? 116 LYS D C   1 
ATOM   7232 O O   . LYS D 1 96  ? -12.314 -32.996 22.765  1.00 20.90 ? 116 LYS D O   1 
ATOM   7233 C CB  . LYS D 1 96  ? -13.961 -35.936 22.665  1.00 21.75 ? 116 LYS D CB  1 
ATOM   7234 C CG  . LYS D 1 96  ? -13.464 -36.064 24.073  1.00 21.75 ? 116 LYS D CG  1 
ATOM   7235 C CD  . LYS D 1 96  ? -14.637 -36.283 25.042  1.00 21.75 ? 116 LYS D CD  1 
ATOM   7236 C CE  . LYS D 1 96  ? -14.110 -35.926 26.421  1.00 21.75 ? 116 LYS D CE  1 
ATOM   7237 N NZ  . LYS D 1 96  ? -15.235 -35.611 27.341  1.00 21.75 ? 116 LYS D NZ  1 
ATOM   7238 N N   . PHE D 1 97  ? -12.023 -34.288 20.973  1.00 19.95 ? 117 PHE D N   1 
ATOM   7239 C CA  . PHE D 1 97  ? -10.700 -33.753 20.670  1.00 19.95 ? 117 PHE D CA  1 
ATOM   7240 C C   . PHE D 1 97  ? -10.785 -32.288 20.275  1.00 19.95 ? 117 PHE D C   1 
ATOM   7241 O O   . PHE D 1 97  ? -9.949  -31.455 20.652  1.00 19.95 ? 117 PHE D O   1 
ATOM   7242 C CB  . PHE D 1 97  ? -10.053 -34.585 19.563  1.00 21.49 ? 117 PHE D CB  1 
ATOM   7243 C CG  . PHE D 1 97  ? -9.811  -36.021 19.946  1.00 21.49 ? 117 PHE D CG  1 
ATOM   7244 C CD1 . PHE D 1 97  ? -9.364  -36.363 21.231  1.00 21.49 ? 117 PHE D CD1 1 
ATOM   7245 C CD2 . PHE D 1 97  ? -10.031 -37.041 19.041  1.00 21.49 ? 117 PHE D CD2 1 
ATOM   7246 C CE1 . PHE D 1 97  ? -9.167  -37.686 21.628  1.00 21.49 ? 117 PHE D CE1 1 
ATOM   7247 C CE2 . PHE D 1 97  ? -9.837  -38.372 19.427  1.00 21.49 ? 117 PHE D CE2 1 
ATOM   7248 C CZ  . PHE D 1 97  ? -9.406  -38.668 20.691  1.00 21.49 ? 117 PHE D CZ  1 
ATOM   7249 N N   . THR D 1 98  ? -11.817 -31.923 19.532  1.00 19.63 ? 118 THR D N   1 
ATOM   7250 C CA  . THR D 1 98  ? -12.057 -30.542 19.128  1.00 19.63 ? 118 THR D CA  1 
ATOM   7251 C C   . THR D 1 98  ? -12.357 -29.684 20.311  1.00 19.63 ? 118 THR D C   1 
ATOM   7252 O O   . THR D 1 98  ? -11.779 -28.599 20.451  1.00 19.63 ? 118 THR D O   1 
ATOM   7253 C CB  . THR D 1 98  ? -13.267 -30.510 18.159  1.00 19.40 ? 118 THR D CB  1 
ATOM   7254 O OG1 . THR D 1 98  ? -12.895 -31.254 16.991  1.00 19.40 ? 118 THR D OG1 1 
ATOM   7255 C CG2 . THR D 1 98  ? -13.658 -29.102 17.770  1.00 19.40 ? 118 THR D CG2 1 
ATOM   7256 N N   . SER D 1 99  ? -13.268 -30.158 21.205  1.00 19.43 ? 119 SER D N   1 
ATOM   7257 C CA  . SER D 1 99  ? -13.566 -29.280 22.349  1.00 19.43 ? 119 SER D CA  1 
ATOM   7258 C C   . SER D 1 99  ? -12.332 -29.164 23.228  1.00 19.43 ? 119 SER D C   1 
ATOM   7259 O O   . SER D 1 99  ? -12.041 -28.103 23.799  1.00 19.43 ? 119 SER D O   1 
ATOM   7260 C CB  . SER D 1 99  ? -14.776 -29.774 23.152  1.00 20.90 ? 119 SER D CB  1 
ATOM   7261 O OG  . SER D 1 99  ? -14.527 -31.072 23.639  1.00 20.90 ? 119 SER D OG  1 
ATOM   7262 N N   . SER D 1 100 ? -11.568 -30.217 23.344  1.00 19.40 ? 120 SER D N   1 
ATOM   7263 C CA  . SER D 1 100 ? -10.348 -30.201 24.154  1.00 19.40 ? 120 SER D CA  1 
ATOM   7264 C C   . SER D 1 100 ? -9.368  -29.188 23.608  1.00 19.40 ? 120 SER D C   1 
ATOM   7265 O O   . SER D 1 100 ? -8.720  -28.350 24.305  1.00 19.40 ? 120 SER D O   1 
ATOM   7266 C CB  . SER D 1 100 ? -9.701  -31.602 24.092  1.00 18.68 ? 120 SER D CB  1 
ATOM   7267 O OG  . SER D 1 100 ? -8.495  -31.497 24.841  1.00 18.68 ? 120 SER D OG  1 
ATOM   7268 N N   . MET D 1 101 ? -9.169  -29.210 22.280  1.00 18.68 ? 121 MET D N   1 
ATOM   7269 C CA  . MET D 1 101 ? -8.250  -28.291 21.609  1.00 18.68 ? 121 MET D CA  1 
ATOM   7270 C C   . MET D 1 101 ? -8.647  -26.851 21.835  1.00 18.68 ? 121 MET D C   1 
ATOM   7271 O O   . MET D 1 101 ? -7.802  -26.019 22.173  1.00 18.68 ? 121 MET D O   1 
ATOM   7272 C CB  . MET D 1 101 ? -8.185  -28.633 20.132  1.00 22.02 ? 121 MET D CB  1 
ATOM   7273 C CG  . MET D 1 101 ? -7.302  -27.687 19.335  1.00 22.02 ? 121 MET D CG  1 
ATOM   7274 S SD  . MET D 1 101 ? -7.817  -27.756 17.576  1.00 22.02 ? 121 MET D SD  1 
ATOM   7275 C CE  . MET D 1 101 ? -9.413  -26.898 17.718  1.00 22.02 ? 121 MET D CE  1 
ATOM   7276 N N   . VAL D 1 102 ? -9.939  -26.533 21.718  1.00 17.30 ? 122 VAL D N   1 
ATOM   7277 C CA  . VAL D 1 102 ? -10.404 -25.175 21.936  1.00 17.30 ? 122 VAL D CA  1 
ATOM   7278 C C   . VAL D 1 102 ? -10.178 -24.752 23.371  1.00 17.30 ? 122 VAL D C   1 
ATOM   7279 O O   . VAL D 1 102 ? -9.882  -23.559 23.646  1.00 17.30 ? 122 VAL D O   1 
ATOM   7280 C CB  . VAL D 1 102 ? -11.891 -25.028 21.599  1.00 16.18 ? 122 VAL D CB  1 
ATOM   7281 C CG1 . VAL D 1 102 ? -12.452 -23.675 22.021  1.00 16.18 ? 122 VAL D CG1 1 
ATOM   7282 C CG2 . VAL D 1 102 ? -12.081 -25.209 20.082  1.00 16.18 ? 122 VAL D CG2 1 
ATOM   7283 N N   . GLN D 1 103 ? -10.311 -25.702 24.323  1.00 18.52 ? 123 GLN D N   1 
ATOM   7284 C CA  . GLN D 1 103 ? -10.080 -25.340 25.707  1.00 18.52 ? 123 GLN D CA  1 
ATOM   7285 C C   . GLN D 1 103 ? -8.616  -25.083 26.064  1.00 18.52 ? 123 GLN D C   1 
ATOM   7286 O O   . GLN D 1 103 ? -8.269  -24.241 26.922  1.00 18.52 ? 123 GLN D O   1 
ATOM   7287 C CB  . GLN D 1 103 ? -10.541 -26.508 26.619  1.00 27.08 ? 123 GLN D CB  1 
ATOM   7288 C CG  . GLN D 1 103 ? -10.484 -25.980 28.070  1.00 27.08 ? 123 GLN D CG  1 
ATOM   7289 C CD  . GLN D 1 103 ? -11.532 -26.696 28.860  1.00 27.08 ? 123 GLN D CD  1 
ATOM   7290 O OE1 . GLN D 1 103 ? -12.448 -26.048 29.383  1.00 27.08 ? 123 GLN D OE1 1 
ATOM   7291 N NE2 . GLN D 1 103 ? -11.377 -28.029 28.902  1.00 27.08 ? 123 GLN D NE2 1 
ATOM   7292 N N   . SER D 1 104 ? -7.729  -25.873 25.451  1.00 16.68 ? 124 SER D N   1 
ATOM   7293 C CA  . SER D 1 104 ? -6.294  -25.721 25.726  1.00 16.68 ? 124 SER D CA  1 
ATOM   7294 C C   . SER D 1 104 ? -5.800  -24.402 25.160  1.00 16.68 ? 124 SER D C   1 
ATOM   7295 O O   . SER D 1 104 ? -5.103  -23.641 25.797  1.00 16.68 ? 124 SER D O   1 
ATOM   7296 C CB  . SER D 1 104 ? -5.538  -26.881 25.088  1.00 18.66 ? 124 SER D CB  1 
ATOM   7297 O OG  . SER D 1 104 ? -6.045  -28.134 25.557  1.00 18.66 ? 124 SER D OG  1 
ATOM   7298 N N   . VAL D 1 105 ? -6.198  -24.140 23.898  1.00 15.60 ? 125 VAL D N   1 
ATOM   7299 C CA  . VAL D 1 105 ? -5.818  -22.883 23.211  1.00 15.60 ? 125 VAL D CA  1 
ATOM   7300 C C   . VAL D 1 105 ? -6.461  -21.723 23.921  1.00 15.60 ? 125 VAL D C   1 
ATOM   7301 O O   . VAL D 1 105 ? -5.758  -20.762 24.299  1.00 15.60 ? 125 VAL D O   1 
ATOM   7302 C CB  . VAL D 1 105 ? -6.241  -22.949 21.742  1.00 14.79 ? 125 VAL D CB  1 
ATOM   7303 C CG1 . VAL D 1 105 ? -6.145  -21.637 21.027  1.00 14.79 ? 125 VAL D CG1 1 
ATOM   7304 C CG2 . VAL D 1 105 ? -5.313  -23.977 21.062  1.00 14.79 ? 125 VAL D CG2 1 
ATOM   7305 N N   . GLY D 1 106 ? -7.761  -21.801 24.178  1.00 15.09 ? 126 GLY D N   1 
ATOM   7306 C CA  . GLY D 1 106 ? -8.496  -20.748 24.862  1.00 15.09 ? 126 GLY D CA  1 
ATOM   7307 C C   . GLY D 1 106 ? -7.910  -20.398 26.191  1.00 15.09 ? 126 GLY D C   1 
ATOM   7308 O O   . GLY D 1 106 ? -7.773  -19.241 26.592  1.00 15.09 ? 126 GLY D O   1 
ATOM   7309 N N   . THR D 1 107 ? -7.507  -21.423 26.996  1.00 15.28 ? 127 THR D N   1 
ATOM   7310 C CA  . THR D 1 107 ? -6.928  -21.209 28.320  1.00 15.28 ? 127 THR D CA  1 
ATOM   7311 C C   . THR D 1 107 ? -5.578  -20.528 28.255  1.00 15.28 ? 127 THR D C   1 
ATOM   7312 O O   . THR D 1 107 ? -5.298  -19.612 29.025  1.00 15.28 ? 127 THR D O   1 
ATOM   7313 C CB  . THR D 1 107 ? -6.768  -22.572 29.093  1.00 14.52 ? 127 THR D CB  1 
ATOM   7314 O OG1 . THR D 1 107 ? -8.073  -23.097 29.375  1.00 14.52 ? 127 THR D OG1 1 
ATOM   7315 C CG2 . THR D 1 107 ? -5.980  -22.385 30.358  1.00 14.52 ? 127 THR D CG2 1 
ATOM   7316 N N   . ASN D 1 108 ? -4.718  -20.988 27.367  1.00 15.68 ? 128 ASN D N   1 
ATOM   7317 C CA  . ASN D 1 108 ? -3.385  -20.392 27.207  1.00 15.68 ? 128 ASN D CA  1 
ATOM   7318 C C   . ASN D 1 108 ? -3.535  -18.962 26.707  1.00 15.68 ? 128 ASN D C   1 
ATOM   7319 O O   . ASN D 1 108 ? -2.853  -18.035 27.156  1.00 15.68 ? 128 ASN D O   1 
ATOM   7320 C CB  . ASN D 1 108 ? -2.590  -21.260 26.240  1.00 12.70 ? 128 ASN D CB  1 
ATOM   7321 C CG  . ASN D 1 108 ? -2.105  -22.538 26.897  1.00 12.70 ? 128 ASN D CG  1 
ATOM   7322 O OD1 . ASN D 1 108 ? -1.599  -22.430 28.009  1.00 12.70 ? 128 ASN D OD1 1 
ATOM   7323 N ND2 . ASN D 1 108 ? -2.207  -23.688 26.258  1.00 12.70 ? 128 ASN D ND2 1 
ATOM   7324 N N   . LEU D 1 109 ? -4.493  -18.737 25.798  1.00 18.67 ? 129 LEU D N   1 
ATOM   7325 C CA  . LEU D 1 109 ? -4.748  -17.383 25.296  1.00 18.67 ? 129 LEU D CA  1 
ATOM   7326 C C   . LEU D 1 109 ? -5.201  -16.472 26.426  1.00 18.67 ? 129 LEU D C   1 
ATOM   7327 O O   . LEU D 1 109 ? -4.720  -15.356 26.587  1.00 18.67 ? 129 LEU D O   1 
ATOM   7328 C CB  . LEU D 1 109 ? -5.823  -17.390 24.232  1.00 17.94 ? 129 LEU D CB  1 
ATOM   7329 C CG  . LEU D 1 109 ? -6.130  -16.088 23.486  1.00 17.94 ? 129 LEU D CG  1 
ATOM   7330 C CD1 . LEU D 1 109 ? -4.877  -15.512 22.837  1.00 17.94 ? 129 LEU D CD1 1 
ATOM   7331 C CD2 . LEU D 1 109 ? -7.167  -16.314 22.395  1.00 17.94 ? 129 LEU D CD2 1 
ATOM   7332 N N   . LYS D 1 110 ? -6.145  -16.968 27.226  1.00 22.74 ? 130 LYS D N   1 
ATOM   7333 C CA  . LYS D 1 110 ? -6.637  -16.166 28.357  1.00 22.74 ? 130 LYS D CA  1 
ATOM   7334 C C   . LYS D 1 110 ? -5.531  -15.905 29.337  1.00 22.74 ? 130 LYS D C   1 
ATOM   7335 O O   . LYS D 1 110 ? -5.352  -14.805 29.859  1.00 22.74 ? 130 LYS D O   1 
ATOM   7336 C CB  . LYS D 1 110 ? -7.783  -16.928 28.973  1.00 31.28 ? 130 LYS D CB  1 
ATOM   7337 C CG  . LYS D 1 110 ? -8.231  -16.343 30.307  1.00 31.28 ? 130 LYS D CG  1 
ATOM   7338 C CD  . LYS D 1 110 ? -8.892  -17.482 31.079  1.00 31.28 ? 130 LYS D CD  1 
ATOM   7339 C CE  . LYS D 1 110 ? -9.282  -17.088 32.505  1.00 31.28 ? 130 LYS D CE  1 
ATOM   7340 N NZ  . LYS D 1 110 ? -9.217  -18.348 33.411  1.00 31.28 ? 130 LYS D NZ  1 
ATOM   7341 N N   . GLU D 1 111 ? -4.701  -16.896 29.643  1.00 23.00 ? 131 GLU D N   1 
ATOM   7342 C CA  . GLU D 1 111 ? -3.613  -16.733 30.602  1.00 23.00 ? 131 GLU D CA  1 
ATOM   7343 C C   . GLU D 1 111 ? -2.507  -15.824 30.119  1.00 23.00 ? 131 GLU D C   1 
ATOM   7344 O O   . GLU D 1 111 ? -1.808  -15.272 30.999  1.00 23.00 ? 131 GLU D O   1 
ATOM   7345 C CB  . GLU D 1 111 ? -2.999  -18.110 30.937  1.00 25.94 ? 131 GLU D CB  1 
ATOM   7346 C CG  . GLU D 1 111 ? -3.912  -19.045 31.700  1.00 25.94 ? 131 GLU D CG  1 
ATOM   7347 C CD  . GLU D 1 111 ? -4.289  -18.507 33.063  1.00 25.94 ? 131 GLU D CD  1 
ATOM   7348 O OE1 . GLU D 1 111 ? -3.580  -17.642 33.619  1.00 25.94 ? 131 GLU D OE1 1 
ATOM   7349 O OE2 . GLU D 1 111 ? -5.321  -18.950 33.617  1.00 25.94 ? 131 GLU D OE2 1 
ATOM   7350 N N   . SER D 1 112 ? -2.314  -15.650 28.816  1.00 20.40 ? 132 SER D N   1 
ATOM   7351 C CA  . SER D 1 112 ? -1.287  -14.764 28.246  1.00 20.40 ? 132 SER D CA  1 
ATOM   7352 C C   . SER D 1 112 ? -1.445  -13.310 28.619  1.00 20.40 ? 132 SER D C   1 
ATOM   7353 O O   . SER D 1 112 ? -0.474  -12.562 28.691  1.00 20.40 ? 132 SER D O   1 
ATOM   7354 C CB  . SER D 1 112 ? -1.311  -14.843 26.702  1.00 19.54 ? 132 SER D CB  1 
ATOM   7355 O OG  . SER D 1 112 ? -2.519  -14.272 26.216  1.00 19.54 ? 132 SER D OG  1 
ATOM   7356 N N   . GLY D 1 113 ? -2.629  -12.844 28.893  1.00 19.51 ? 133 GLY D N   1 
ATOM   7357 C CA  . GLY D 1 113 ? -2.937  -11.478 29.270  1.00 19.51 ? 133 GLY D CA  1 
ATOM   7358 C C   . GLY D 1 113 ? -3.588  -10.767 28.092  1.00 19.51 ? 133 GLY D C   1 
ATOM   7359 O O   . GLY D 1 113 ? -3.958  -9.604  28.204  1.00 19.51 ? 133 GLY D O   1 
ATOM   7360 N N   . PHE D 1 114 ? -3.698  -11.451 26.983  1.00 19.49 ? 134 PHE D N   1 
ATOM   7361 C CA  . PHE D 1 114 ? -4.276  -10.915 25.763  1.00 19.49 ? 134 PHE D CA  1 
ATOM   7362 C C   . PHE D 1 114 ? -5.605  -10.293 26.089  1.00 19.49 ? 134 PHE D C   1 
ATOM   7363 O O   . PHE D 1 114 ? -6.357  -10.875 26.860  1.00 19.49 ? 134 PHE D O   1 
ATOM   7364 C CB  . PHE D 1 114 ? -4.440  -12.027 24.727  1.00 16.70 ? 134 PHE D CB  1 
ATOM   7365 C CG  . PHE D 1 114 ? -5.328  -11.679 23.585  1.00 16.70 ? 134 PHE D CG  1 
ATOM   7366 C CD1 . PHE D 1 114 ? -4.860  -10.828 22.590  1.00 16.70 ? 134 PHE D CD1 1 
ATOM   7367 C CD2 . PHE D 1 114 ? -6.609  -12.170 23.516  1.00 16.70 ? 134 PHE D CD2 1 
ATOM   7368 C CE1 . PHE D 1 114 ? -5.695  -10.504 21.529  1.00 16.70 ? 134 PHE D CE1 1 
ATOM   7369 C CE2 . PHE D 1 114 ? -7.454  -11.867 22.460  1.00 16.70 ? 134 PHE D CE2 1 
ATOM   7370 C CZ  . PHE D 1 114 ? -6.951  -11.062 21.477  1.00 16.70 ? 134 PHE D CZ  1 
ATOM   7371 N N   . HIS D 1 115 ? -5.912  -9.119  25.530  1.00 21.51 ? 135 HIS D N   1 
ATOM   7372 C CA  . HIS D 1 115 ? -7.209  -8.512  25.843  1.00 21.51 ? 135 HIS D CA  1 
ATOM   7373 C C   . HIS D 1 115 ? -7.726  -7.701  24.673  1.00 21.51 ? 135 HIS D C   1 
ATOM   7374 O O   . HIS D 1 115 ? -8.417  -6.700  24.859  1.00 21.51 ? 135 HIS D O   1 
ATOM   7375 C CB  . HIS D 1 115 ? -7.076  -7.618  27.077  1.00 27.02 ? 135 HIS D CB  1 
ATOM   7376 C CG  . HIS D 1 115 ? -5.918  -6.673  27.022  1.00 27.02 ? 135 HIS D CG  1 
ATOM   7377 N ND1 . HIS D 1 115 ? -4.609  -7.076  27.134  1.00 27.02 ? 135 HIS D ND1 1 
ATOM   7378 C CD2 . HIS D 1 115 ? -5.894  -5.329  26.845  1.00 27.02 ? 135 HIS D CD2 1 
ATOM   7379 C CE1 . HIS D 1 115 ? -3.813  -6.016  27.043  1.00 27.02 ? 135 HIS D CE1 1 
ATOM   7380 N NE2 . HIS D 1 115 ? -4.572  -4.934  26.855  1.00 27.02 ? 135 HIS D NE2 1 
ATOM   7381 N N   . GLY D 1 116 ? -7.386  -8.099  23.475  1.00 18.41 ? 136 GLY D N   1 
ATOM   7382 C CA  . GLY D 1 116 ? -7.778  -7.528  22.230  1.00 18.41 ? 136 GLY D CA  1 
ATOM   7383 C C   . GLY D 1 116 ? -8.996  -8.259  21.684  1.00 18.41 ? 136 GLY D C   1 
ATOM   7384 O O   . GLY D 1 116 ? -9.751  -8.813  22.453  1.00 18.41 ? 136 GLY D O   1 
ATOM   7385 N N   . VAL D 1 117 ? -9.136  -8.322  20.384  1.00 16.69 ? 137 VAL D N   1 
ATOM   7386 C CA  . VAL D 1 117 ? -10.272 -8.943  19.730  1.00 16.69 ? 137 VAL D CA  1 
ATOM   7387 C C   . VAL D 1 117 ? -9.810  -10.258 19.136  1.00 16.69 ? 137 VAL D C   1 
ATOM   7388 O O   . VAL D 1 117 ? -8.716  -10.338 18.565  1.00 16.69 ? 137 VAL D O   1 
ATOM   7389 C CB  . VAL D 1 117 ? -10.879 -8.067  18.609  1.00 15.24 ? 137 VAL D CB  1 
ATOM   7390 C CG1 . VAL D 1 117 ? -12.115 -8.679  17.977  1.00 15.24 ? 137 VAL D CG1 1 
ATOM   7391 C CG2 . VAL D 1 117 ? -11.306 -6.709  19.167  1.00 15.24 ? 137 VAL D CG2 1 
ATOM   7392 N N   . LEU D 1 118 ? -10.647 -11.305 19.316  1.00 16.08 ? 138 LEU D N   1 
ATOM   7393 C CA  . LEU D 1 118 ? -10.311 -12.616 18.772  1.00 16.08 ? 138 LEU D CA  1 
ATOM   7394 C C   . LEU D 1 118 ? -11.186 -12.864 17.561  1.00 16.08 ? 138 LEU D C   1 
ATOM   7395 O O   . LEU D 1 118 ? -12.408 -12.773 17.714  1.00 16.08 ? 138 LEU D O   1 
ATOM   7396 C CB  . LEU D 1 118 ? -10.514 -13.703 19.853  1.00 14.19 ? 138 LEU D CB  1 
ATOM   7397 C CG  . LEU D 1 118 ? -10.419 -15.167 19.436  1.00 14.19 ? 138 LEU D CG  1 
ATOM   7398 C CD1 . LEU D 1 118 ? -9.001  -15.537 19.012  1.00 14.19 ? 138 LEU D CD1 1 
ATOM   7399 C CD2 . LEU D 1 118 ? -10.867 -16.045 20.601  1.00 14.19 ? 138 LEU D CD2 1 
ATOM   7400 N N   . VAL D 1 119 ? -10.558 -13.111 16.408  1.00 15.77 ? 139 VAL D N   1 
ATOM   7401 C CA  . VAL D 1 119 ? -11.296 -13.412 15.185  1.00 15.77 ? 139 VAL D CA  1 
ATOM   7402 C C   . VAL D 1 119 ? -11.136 -14.887 14.909  1.00 15.77 ? 139 VAL D C   1 
ATOM   7403 O O   . VAL D 1 119 ? -10.001 -15.406 14.916  1.00 15.77 ? 139 VAL D O   1 
ATOM   7404 C CB  . VAL D 1 119 ? -10.799 -12.607 13.960  1.00 13.96 ? 139 VAL D CB  1 
ATOM   7405 C CG1 . VAL D 1 119 ? -11.679 -12.846 12.755  1.00 13.96 ? 139 VAL D CG1 1 
ATOM   7406 C CG2 . VAL D 1 119 ? -10.834 -11.146 14.347  1.00 13.96 ? 139 VAL D CG2 1 
ATOM   7407 N N   . VAL D 1 120 ? -12.248 -15.582 14.722  1.00 17.19 ? 140 VAL D N   1 
ATOM   7408 C CA  . VAL D 1 120 ? -12.168 -17.022 14.542  1.00 17.19 ? 140 VAL D CA  1 
ATOM   7409 C C   . VAL D 1 120 ? -12.567 -17.450 13.154  1.00 17.19 ? 140 VAL D C   1 
ATOM   7410 O O   . VAL D 1 120 ? -13.615 -17.068 12.635  1.00 17.19 ? 140 VAL D O   1 
ATOM   7411 C CB  . VAL D 1 120 ? -13.096 -17.745 15.574  1.00 14.81 ? 140 VAL D CB  1 
ATOM   7412 C CG1 . VAL D 1 120 ? -13.113 -19.241 15.335  1.00 14.81 ? 140 VAL D CG1 1 
ATOM   7413 C CG2 . VAL D 1 120 ? -12.666 -17.450 17.007  1.00 14.81 ? 140 VAL D CG2 1 
ATOM   7414 N N   . ILE D 1 121 ? -11.710 -18.238 12.550  1.00 24.49 ? 141 ILE D N   1 
ATOM   7415 C CA  . ILE D 1 121 ? -11.882 -18.844 11.252  1.00 24.49 ? 141 ILE D CA  1 
ATOM   7416 C C   . ILE D 1 121 ? -11.947 -20.345 11.591  1.00 24.49 ? 141 ILE D C   1 
ATOM   7417 O O   . ILE D 1 121 ? -11.002 -20.863 12.206  1.00 24.49 ? 141 ILE D O   1 
ATOM   7418 C CB  . ILE D 1 121 ? -10.747 -18.626 10.268  1.00 22.33 ? 141 ILE D CB  1 
ATOM   7419 C CG1 . ILE D 1 121 ? -10.638 -17.160 9.823   1.00 22.33 ? 141 ILE D CG1 1 
ATOM   7420 C CG2 . ILE D 1 121 ? -10.947 -19.492 9.028   1.00 22.33 ? 141 ILE D CG2 1 
ATOM   7421 C CD1 . ILE D 1 121 ? -9.326  -16.905 9.132   1.00 22.33 ? 141 ILE D CD1 1 
ATOM   7422 N N   . SER D 1 122 ? -13.016 -21.001 11.279  1.00 32.28 ? 142 SER D N   1 
ATOM   7423 C CA  . SER D 1 122 ? -13.144 -22.415 11.620  1.00 32.28 ? 142 SER D CA  1 
ATOM   7424 C C   . SER D 1 122 ? -14.325 -23.005 10.910  1.00 32.28 ? 142 SER D C   1 
ATOM   7425 O O   . SER D 1 122 ? -14.901 -22.429 9.962   1.00 32.28 ? 142 SER D O   1 
ATOM   7426 C CB  . SER D 1 122 ? -13.358 -22.520 13.143  1.00 32.14 ? 142 SER D CB  1 
ATOM   7427 O OG  . SER D 1 122 ? -13.039 -23.812 13.608  1.00 32.14 ? 142 SER D OG  1 
ATOM   7428 N N   . ASN D 1 123 ? -14.697 -24.166 11.380  1.00 37.56 ? 143 ASN D N   1 
ATOM   7429 C CA  . ASN D 1 123 ? -15.893 -24.807 10.763  1.00 37.56 ? 143 ASN D CA  1 
ATOM   7430 C C   . ASN D 1 123 ? -16.265 -25.920 11.716  1.00 37.56 ? 143 ASN D C   1 
ATOM   7431 O O   . ASN D 1 123 ? -15.486 -26.844 11.989  1.00 37.56 ? 143 ASN D O   1 
ATOM   7432 C CB  . ASN D 1 123 ? -15.539 -25.128 9.337   1.00 44.37 ? 143 ASN D CB  1 
ATOM   7433 C CG  . ASN D 1 123 ? -16.510 -26.039 8.644   1.00 44.37 ? 143 ASN D CG  1 
ATOM   7434 O OD1 . ASN D 1 123 ? -17.742 -25.994 8.820   1.00 44.37 ? 143 ASN D OD1 1 
ATOM   7435 N ND2 . ASN D 1 123 ? -15.909 -26.921 7.824   1.00 44.37 ? 143 ASN D ND2 1 
ATOM   7436 N N   . PRO D 1 124 ? -17.441 -25.816 12.318  1.00 34.92 ? 144 PRO D N   1 
ATOM   7437 C CA  . PRO D 1 124 ? -18.395 -24.746 12.121  1.00 34.92 ? 144 PRO D CA  1 
ATOM   7438 C C   . PRO D 1 124 ? -17.960 -23.504 12.866  1.00 34.92 ? 144 PRO D C   1 
ATOM   7439 O O   . PRO D 1 124 ? -17.834 -23.500 14.101  1.00 34.92 ? 144 PRO D O   1 
ATOM   7440 C CB  . PRO D 1 124 ? -19.739 -25.281 12.672  1.00 36.43 ? 144 PRO D CB  1 
ATOM   7441 C CG  . PRO D 1 124 ? -19.259 -26.267 13.721  1.00 36.43 ? 144 PRO D CG  1 
ATOM   7442 C CD  . PRO D 1 124 ? -17.922 -26.815 13.289  1.00 36.43 ? 144 PRO D CD  1 
ATOM   7443 N N   . VAL D 1 125 ? -17.754 -22.421 12.115  1.00 28.52 ? 145 VAL D N   1 
ATOM   7444 C CA  . VAL D 1 125 ? -17.267 -21.154 12.706  1.00 28.52 ? 145 VAL D CA  1 
ATOM   7445 C C   . VAL D 1 125 ? -18.161 -20.586 13.767  1.00 28.52 ? 145 VAL D C   1 
ATOM   7446 O O   . VAL D 1 125 ? -17.646 -20.044 14.770  1.00 28.52 ? 145 VAL D O   1 
ATOM   7447 C CB  . VAL D 1 125 ? -16.952 -20.176 11.506  1.00 29.07 ? 145 VAL D CB  1 
ATOM   7448 C CG1 . VAL D 1 125 ? -18.206 -19.719 10.817  1.00 29.07 ? 145 VAL D CG1 1 
ATOM   7449 C CG2 . VAL D 1 125 ? -16.150 -18.981 11.967  1.00 29.07 ? 145 VAL D CG2 1 
ATOM   7450 N N   . ASP D 1 126 ? -19.478 -20.658 13.689  1.00 24.85 ? 146 ASP D N   1 
ATOM   7451 C CA  . ASP D 1 126 ? -20.331 -20.055 14.736  1.00 24.85 ? 146 ASP D CA  1 
ATOM   7452 C C   . ASP D 1 126 ? -20.226 -20.837 16.035  1.00 24.85 ? 146 ASP D C   1 
ATOM   7453 O O   . ASP D 1 126 ? -20.155 -20.261 17.119  1.00 24.85 ? 146 ASP D O   1 
ATOM   7454 C CB  . ASP D 1 126 ? -21.795 -19.991 14.345  1.00 26.35 ? 146 ASP D CB  1 
ATOM   7455 C CG  . ASP D 1 126 ? -21.999 -19.417 12.970  1.00 26.35 ? 146 ASP D CG  1 
ATOM   7456 O OD1 . ASP D 1 126 ? -22.052 -18.174 12.869  1.00 26.35 ? 146 ASP D OD1 1 
ATOM   7457 O OD2 . ASP D 1 126 ? -22.083 -20.187 12.000  1.00 26.35 ? 146 ASP D OD2 1 
ATOM   7458 N N   . VAL D 1 127 ? -20.244 -22.173 15.947  1.00 22.55 ? 147 VAL D N   1 
ATOM   7459 C CA  . VAL D 1 127 ? -20.140 -23.042 17.122  1.00 22.55 ? 147 VAL D CA  1 
ATOM   7460 C C   . VAL D 1 127 ? -18.799 -22.902 17.819  1.00 22.55 ? 147 VAL D C   1 
ATOM   7461 O O   . VAL D 1 127 ? -18.722 -22.691 19.027  1.00 22.55 ? 147 VAL D O   1 
ATOM   7462 C CB  . VAL D 1 127 ? -20.337 -24.485 16.606  1.00 24.11 ? 147 VAL D CB  1 
ATOM   7463 C CG1 . VAL D 1 127 ? -20.135 -25.502 17.712  1.00 24.11 ? 147 VAL D CG1 1 
ATOM   7464 C CG2 . VAL D 1 127 ? -21.740 -24.626 16.044  1.00 24.11 ? 147 VAL D CG2 1 
ATOM   7465 N N   . ILE D 1 128 ? -17.714 -22.963 17.025  1.00 18.75 ? 148 ILE D N   1 
ATOM   7466 C CA  . ILE D 1 128 ? -16.356 -22.831 17.573  1.00 18.75 ? 148 ILE D CA  1 
ATOM   7467 C C   . ILE D 1 128 ? -16.158 -21.437 18.117  1.00 18.75 ? 148 ILE D C   1 
ATOM   7468 O O   . ILE D 1 128 ? -15.493 -21.276 19.156  1.00 18.75 ? 148 ILE D O   1 
ATOM   7469 C CB  . ILE D 1 128 ? -15.271 -23.153 16.544  1.00 17.69 ? 148 ILE D CB  1 
ATOM   7470 C CG1 . ILE D 1 128 ? -15.440 -24.594 16.061  1.00 17.69 ? 148 ILE D CG1 1 
ATOM   7471 C CG2 . ILE D 1 128 ? -13.872 -22.955 17.088  1.00 17.69 ? 148 ILE D CG2 1 
ATOM   7472 C CD1 . ILE D 1 128 ? -15.270 -25.735 16.982  1.00 17.69 ? 148 ILE D CD1 1 
ATOM   7473 N N   . THR D 1 129 ? -16.719 -20.376 17.527  1.00 16.55 ? 149 THR D N   1 
ATOM   7474 C CA  . THR D 1 129 ? -16.609 -19.026 18.050  1.00 16.55 ? 149 THR D CA  1 
ATOM   7475 C C   . THR D 1 129 ? -17.258 -18.972 19.430  1.00 16.55 ? 149 THR D C   1 
ATOM   7476 O O   . THR D 1 129 ? -16.669 -18.448 20.385  1.00 16.55 ? 149 THR D O   1 
ATOM   7477 C CB  . THR D 1 129 ? -17.291 -17.968 17.132  1.00 14.04 ? 149 THR D CB  1 
ATOM   7478 O OG1 . THR D 1 129 ? -16.634 -17.988 15.848  1.00 14.04 ? 149 THR D OG1 1 
ATOM   7479 C CG2 . THR D 1 129 ? -17.184 -16.575 17.688  1.00 14.04 ? 149 THR D CG2 1 
ATOM   7480 N N   . ALA D 1 130 ? -18.461 -19.523 19.551  1.00 17.26 ? 150 ALA D N   1 
ATOM   7481 C CA  . ALA D 1 130 ? -19.181 -19.520 20.841  1.00 17.26 ? 150 ALA D CA  1 
ATOM   7482 C C   . ALA D 1 130 ? -18.466 -20.348 21.899  1.00 17.26 ? 150 ALA D C   1 
ATOM   7483 O O   . ALA D 1 130 ? -18.439 -19.995 23.109  1.00 17.26 ? 150 ALA D O   1 
ATOM   7484 C CB  . ALA D 1 130 ? -20.575 -20.044 20.557  1.00 16.26 ? 150 ALA D CB  1 
ATOM   7485 N N   . LEU D 1 131 ? -17.841 -21.453 21.531  1.00 18.90 ? 151 LEU D N   1 
ATOM   7486 C CA  . LEU D 1 131 ? -17.055 -22.328 22.383  1.00 18.90 ? 151 LEU D CA  1 
ATOM   7487 C C   . LEU D 1 131 ? -15.834 -21.615 22.932  1.00 18.90 ? 151 LEU D C   1 
ATOM   7488 O O   . LEU D 1 131 ? -15.606 -21.631 24.141  1.00 18.90 ? 151 LEU D O   1 
ATOM   7489 C CB  . LEU D 1 131 ? -16.663 -23.582 21.585  1.00 17.89 ? 151 LEU D CB  1 
ATOM   7490 C CG  . LEU D 1 131 ? -16.135 -24.749 22.461  1.00 17.89 ? 151 LEU D CG  1 
ATOM   7491 C CD1 . LEU D 1 131 ? -17.084 -25.150 23.565  1.00 17.89 ? 151 LEU D CD1 1 
ATOM   7492 C CD2 . LEU D 1 131 ? -15.936 -25.961 21.579  1.00 17.89 ? 151 LEU D CD2 1 
ATOM   7493 N N   . PHE D 1 132 ? -15.104 -20.876 22.074  1.00 17.34 ? 152 PHE D N   1 
ATOM   7494 C CA  . PHE D 1 132 ? -13.961 -20.057 22.471  1.00 17.34 ? 152 PHE D CA  1 
ATOM   7495 C C   . PHE D 1 132 ? -14.386 -18.974 23.426  1.00 17.34 ? 152 PHE D C   1 
ATOM   7496 O O   . PHE D 1 132 ? -13.702 -18.628 24.403  1.00 17.34 ? 152 PHE D O   1 
ATOM   7497 C CB  . PHE D 1 132 ? -13.369 -19.346 21.235  1.00 13.91 ? 152 PHE D CB  1 
ATOM   7498 C CG  . PHE D 1 132 ? -12.107 -19.972 20.702  1.00 13.91 ? 152 PHE D CG  1 
ATOM   7499 C CD1 . PHE D 1 132 ? -10.975 -19.955 21.509  1.00 13.91 ? 152 PHE D CD1 1 
ATOM   7500 C CD2 . PHE D 1 132 ? -12.034 -20.568 19.476  1.00 13.91 ? 152 PHE D CD2 1 
ATOM   7501 C CE1 . PHE D 1 132 ? -9.791  -20.538 21.083  1.00 13.91 ? 152 PHE D CE1 1 
ATOM   7502 C CE2 . PHE D 1 132 ? -10.845 -21.139 19.038  1.00 13.91 ? 152 PHE D CE2 1 
ATOM   7503 C CZ  . PHE D 1 132 ? -9.727  -21.128 19.839  1.00 13.91 ? 152 PHE D CZ  1 
ATOM   7504 N N   . GLN D 1 133 ? -15.584 -18.396 23.184  1.00 19.07 ? 153 GLN D N   1 
ATOM   7505 C CA  . GLN D 1 133 ? -16.087 -17.328 24.075  1.00 19.07 ? 153 GLN D CA  1 
ATOM   7506 C C   . GLN D 1 133 ? -16.326 -17.922 25.437  1.00 19.07 ? 153 GLN D C   1 
ATOM   7507 O O   . GLN D 1 133 ? -15.991 -17.380 26.490  1.00 19.07 ? 153 GLN D O   1 
ATOM   7508 C CB  . GLN D 1 133 ? -17.368 -16.742 23.531  1.00 19.73 ? 153 GLN D CB  1 
ATOM   7509 C CG  . GLN D 1 133 ? -17.811 -15.438 24.177  1.00 19.73 ? 153 GLN D CG  1 
ATOM   7510 C CD  . GLN D 1 133 ? -18.621 -15.660 25.416  1.00 19.73 ? 153 GLN D CD  1 
ATOM   7511 O OE1 . GLN D 1 133 ? -19.462 -16.601 25.489  1.00 19.73 ? 153 GLN D OE1 1 
ATOM   7512 N NE2 . GLN D 1 133 ? -18.379 -14.900 26.482  1.00 19.73 ? 153 GLN D NE2 1 
ATOM   7513 N N   . HIS D 1 134 ? -16.937 -19.100 25.393  1.00 23.18 ? 154 HIS D N   1 
ATOM   7514 C CA  . HIS D 1 134 ? -17.273 -19.884 26.588  1.00 23.18 ? 154 HIS D CA  1 
ATOM   7515 C C   . HIS D 1 134 ? -16.055 -20.249 27.415  1.00 23.18 ? 154 HIS D C   1 
ATOM   7516 O O   . HIS D 1 134 ? -15.985 -20.040 28.643  1.00 23.18 ? 154 HIS D O   1 
ATOM   7517 C CB  . HIS D 1 134 ? -18.013 -21.128 26.084  1.00 27.92 ? 154 HIS D CB  1 
ATOM   7518 C CG  . HIS D 1 134 ? -18.505 -21.998 27.188  1.00 27.92 ? 154 HIS D CG  1 
ATOM   7519 N ND1 . HIS D 1 134 ? -19.671 -21.772 27.888  1.00 27.92 ? 154 HIS D ND1 1 
ATOM   7520 C CD2 . HIS D 1 134 ? -17.950 -23.105 27.741  1.00 27.92 ? 154 HIS D CD2 1 
ATOM   7521 C CE1 . HIS D 1 134 ? -19.827 -22.693 28.807  1.00 27.92 ? 154 HIS D CE1 1 
ATOM   7522 N NE2 . HIS D 1 134 ? -18.791 -23.524 28.739  1.00 27.92 ? 154 HIS D NE2 1 
ATOM   7523 N N   . VAL D 1 135 ? -15.001 -20.774 26.794  1.00 21.94 ? 155 VAL D N   1 
ATOM   7524 C CA  . VAL D 1 135 ? -13.786 -21.191 27.463  1.00 21.94 ? 155 VAL D CA  1 
ATOM   7525 C C   . VAL D 1 135 ? -12.916 -20.045 27.936  1.00 21.94 ? 155 VAL D C   1 
ATOM   7526 O O   . VAL D 1 135 ? -12.357 -20.114 29.041  1.00 21.94 ? 155 VAL D O   1 
ATOM   7527 C CB  . VAL D 1 135 ? -12.993 -22.073 26.470  1.00 21.46 ? 155 VAL D CB  1 
ATOM   7528 C CG1 . VAL D 1 135 ? -11.691 -22.497 27.077  1.00 21.46 ? 155 VAL D CG1 1 
ATOM   7529 C CG2 . VAL D 1 135 ? -13.802 -23.311 26.116  1.00 21.46 ? 155 VAL D CG2 1 
ATOM   7530 N N   . THR D 1 136 ? -12.751 -18.987 27.142  1.00 20.72 ? 156 THR D N   1 
ATOM   7531 C CA  . THR D 1 136 ? -11.896 -17.858 27.518  1.00 20.72 ? 156 THR D CA  1 
ATOM   7532 C C   . THR D 1 136 ? -12.495 -16.977 28.572  1.00 20.72 ? 156 THR D C   1 
ATOM   7533 O O   . THR D 1 136 ? -11.824 -16.315 29.382  1.00 20.72 ? 156 THR D O   1 
ATOM   7534 C CB  . THR D 1 136 ? -11.607 -16.927 26.304  1.00 19.83 ? 156 THR D CB  1 
ATOM   7535 O OG1 . THR D 1 136 ? -12.897 -16.583 25.764  1.00 19.83 ? 156 THR D OG1 1 
ATOM   7536 C CG2 . THR D 1 136 ? -10.775 -17.630 25.280  1.00 19.83 ? 156 THR D CG2 1 
ATOM   7537 N N   . GLY D 1 137 ? -13.830 -16.815 28.469  1.00 19.90 ? 157 GLY D N   1 
ATOM   7538 C CA  . GLY D 1 137 ? -14.529 -15.932 29.410  1.00 19.90 ? 157 GLY D CA  1 
ATOM   7539 C C   . GLY D 1 137 ? -14.453 -14.501 28.925  1.00 19.90 ? 157 GLY D C   1 
ATOM   7540 O O   . GLY D 1 137 ? -14.870 -13.602 29.666  1.00 19.90 ? 157 GLY D O   1 
ATOM   7541 N N   . PHE D 1 138 ? -13.929 -14.277 27.720  1.00 18.31 ? 158 PHE D N   1 
ATOM   7542 C CA  . PHE D 1 138 ? -13.831 -12.924 27.141  1.00 18.31 ? 158 PHE D CA  1 
ATOM   7543 C C   . PHE D 1 138 ? -15.241 -12.414 26.863  1.00 18.31 ? 158 PHE D C   1 
ATOM   7544 O O   . PHE D 1 138 ? -16.136 -13.206 26.490  1.00 18.31 ? 158 PHE D O   1 
ATOM   7545 C CB  . PHE D 1 138 ? -13.042 -12.982 25.841  1.00 16.81 ? 158 PHE D CB  1 
ATOM   7546 C CG  . PHE D 1 138 ? -11.592 -13.322 25.938  1.00 16.81 ? 158 PHE D CG  1 
ATOM   7547 C CD1 . PHE D 1 138 ? -10.857 -13.063 27.080  1.00 16.81 ? 158 PHE D CD1 1 
ATOM   7548 C CD2 . PHE D 1 138 ? -10.935 -13.840 24.819  1.00 16.81 ? 158 PHE D CD2 1 
ATOM   7549 C CE1 . PHE D 1 138 ? -9.516  -13.363 27.133  1.00 16.81 ? 158 PHE D CE1 1 
ATOM   7550 C CE2 . PHE D 1 138 ? -9.591  -14.156 24.875  1.00 16.81 ? 158 PHE D CE2 1 
ATOM   7551 C CZ  . PHE D 1 138 ? -8.877  -13.904 26.029  1.00 16.81 ? 158 PHE D CZ  1 
ATOM   7552 N N   . PRO D 1 139 ? -15.479 -11.125 26.995  1.00 16.84 ? 159 PRO D N   1 
ATOM   7553 C CA  . PRO D 1 139 ? -16.762 -10.544 26.672  1.00 16.84 ? 159 PRO D CA  1 
ATOM   7554 C C   . PRO D 1 139 ? -17.164 -10.961 25.273  1.00 16.84 ? 159 PRO D C   1 
ATOM   7555 O O   . PRO D 1 139 ? -16.334 -10.944 24.338  1.00 16.84 ? 159 PRO D O   1 
ATOM   7556 C CB  . PRO D 1 139 ? -16.536 -9.045  26.782  1.00 15.89 ? 159 PRO D CB  1 
ATOM   7557 C CG  . PRO D 1 139 ? -15.290 -8.906  27.615  1.00 15.89 ? 159 PRO D CG  1 
ATOM   7558 C CD  . PRO D 1 139 ? -14.463 -10.123 27.392  1.00 15.89 ? 159 PRO D CD  1 
ATOM   7559 N N   . ALA D 1 140 ? -18.408 -11.355 25.024  1.00 17.48 ? 160 ALA D N   1 
ATOM   7560 C CA  . ALA D 1 140 ? -18.815 -11.812 23.693  1.00 17.48 ? 160 ALA D CA  1 
ATOM   7561 C C   . ALA D 1 140 ? -18.504 -10.827 22.596  1.00 17.48 ? 160 ALA D C   1 
ATOM   7562 O O   . ALA D 1 140 ? -18.097 -11.151 21.451  1.00 17.48 ? 160 ALA D O   1 
ATOM   7563 C CB  . ALA D 1 140 ? -20.305 -12.131 23.755  1.00 17.07 ? 160 ALA D CB  1 
ATOM   7564 N N   . HIS D 1 141 ? -18.592 -9.543  22.842  1.00 18.44 ? 161 HIS D N   1 
ATOM   7565 C CA  . HIS D 1 141 ? -18.296 -8.520  21.830  1.00 18.44 ? 161 HIS D CA  1 
ATOM   7566 C C   . HIS D 1 141 ? -16.829 -8.563  21.464  1.00 18.44 ? 161 HIS D C   1 
ATOM   7567 O O   . HIS D 1 141 ? -16.510 -7.929  20.421  1.00 18.44 ? 161 HIS D O   1 
ATOM   7568 C CB  . HIS D 1 141 ? -18.722 -7.159  22.333  1.00 18.44 ? 161 HIS D CB  1 
ATOM   7569 C CG  . HIS D 1 141 ? -17.959 -6.597  23.462  1.00 18.44 ? 161 HIS D CG  1 
ATOM   7570 N ND1 . HIS D 1 141 ? -16.855 -5.785  23.282  1.00 18.44 ? 161 HIS D ND1 1 
ATOM   7571 C CD2 . HIS D 1 141 ? -18.133 -6.677  24.799  1.00 18.44 ? 161 HIS D CD2 1 
ATOM   7572 C CE1 . HIS D 1 141 ? -16.357 -5.401  24.444  1.00 18.44 ? 161 HIS D CE1 1 
ATOM   7573 N NE2 . HIS D 1 141 ? -17.117 -5.942  25.384  1.00 18.44 ? 161 HIS D NE2 1 
ATOM   7574 N N   . LYS D 1 142 ? -15.943 -9.235  22.177  1.00 16.78 ? 162 LYS D N   1 
ATOM   7575 C CA  . LYS D 1 142 ? -14.541 -9.272  21.801  1.00 16.78 ? 162 LYS D CA  1 
ATOM   7576 C C   . LYS D 1 142 ? -14.200 -10.571 21.128  1.00 16.78 ? 162 LYS D C   1 
ATOM   7577 O O   . LYS D 1 142 ? -13.020 -10.818 20.847  1.00 16.78 ? 162 LYS D O   1 
ATOM   7578 C CB  . LYS D 1 142 ? -13.651 -9.090  23.013  1.00 18.85 ? 162 LYS D CB  1 
ATOM   7579 C CG  . LYS D 1 142 ? -13.559 -7.584  23.339  1.00 18.85 ? 162 LYS D CG  1 
ATOM   7580 C CD  . LYS D 1 142 ? -12.540 -7.389  24.406  1.00 18.85 ? 162 LYS D CD  1 
ATOM   7581 C CE  . LYS D 1 142 ? -12.113 -5.960  24.579  1.00 18.85 ? 162 LYS D CE  1 
ATOM   7582 N NZ  . LYS D 1 142 ? -11.022 -5.963  25.632  1.00 18.85 ? 162 LYS D NZ  1 
ATOM   7583 N N   . VAL D 1 143 ? -15.188 -11.406 20.891  1.00 15.77 ? 163 VAL D N   1 
ATOM   7584 C CA  . VAL D 1 143 ? -14.944 -12.699 20.242  1.00 15.77 ? 163 VAL D CA  1 
ATOM   7585 C C   . VAL D 1 143 ? -15.870 -12.819 19.065  1.00 15.77 ? 163 VAL D C   1 
ATOM   7586 O O   . VAL D 1 143 ? -17.104 -12.877 19.259  1.00 15.77 ? 163 VAL D O   1 
ATOM   7587 C CB  . VAL D 1 143 ? -15.172 -13.883 21.220  1.00 13.77 ? 163 VAL D CB  1 
ATOM   7588 C CG1 . VAL D 1 143 ? -14.878 -15.187 20.488  1.00 13.77 ? 163 VAL D CG1 1 
ATOM   7589 C CG2 . VAL D 1 143 ? -14.318 -13.784 22.488  1.00 13.77 ? 163 VAL D CG2 1 
ATOM   7590 N N   . ILE D 1 144 ? -15.319 -12.771 17.833  1.00 17.76 ? 164 ILE D N   1 
ATOM   7591 C CA  . ILE D 1 144 ? -16.174 -12.831 16.640  1.00 17.76 ? 164 ILE D CA  1 
ATOM   7592 C C   . ILE D 1 144 ? -15.618 -13.803 15.630  1.00 17.76 ? 164 ILE D C   1 
ATOM   7593 O O   . ILE D 1 144 ? -14.404 -14.057 15.607  1.00 17.76 ? 164 ILE D O   1 
ATOM   7594 C CB  . ILE D 1 144 ? -16.349 -11.440 15.951  1.00 18.15 ? 164 ILE D CB  1 
ATOM   7595 C CG1 . ILE D 1 144 ? -15.016 -10.861 15.473  1.00 18.15 ? 164 ILE D CG1 1 
ATOM   7596 C CG2 . ILE D 1 144 ? -16.988 -10.434 16.920  1.00 18.15 ? 164 ILE D CG2 1 
ATOM   7597 C CD1 . ILE D 1 144 ? -15.016 -9.393  15.153  1.00 18.15 ? 164 ILE D CD1 1 
ATOM   7598 N N   . GLY D 1 145 ? -16.479 -14.311 14.783  1.00 17.83 ? 165 GLY D N   1 
ATOM   7599 C CA  . GLY D 1 145 ? -16.027 -15.248 13.743  1.00 17.83 ? 165 GLY D CA  1 
ATOM   7600 C C   . GLY D 1 145 ? -16.213 -14.590 12.392  1.00 17.83 ? 165 GLY D C   1 
ATOM   7601 O O   . GLY D 1 145 ? -17.068 -13.700 12.261  1.00 17.83 ? 165 GLY D O   1 
ATOM   7602 N N   . THR D 1 146 ? -15.524 -15.066 11.372  1.00 20.27 ? 166 THR D N   1 
ATOM   7603 C CA  . THR D 1 146 ? -15.706 -14.474 10.021  1.00 20.27 ? 166 THR D CA  1 
ATOM   7604 C C   . THR D 1 146 ? -17.098 -14.769 9.540   1.00 20.27 ? 166 THR D C   1 
ATOM   7605 O O   . THR D 1 146 ? -17.712 -13.992 8.773   1.00 20.27 ? 166 THR D O   1 
ATOM   7606 C CB  . THR D 1 146 ? -14.610 -14.989 9.100   1.00 18.27 ? 166 THR D CB  1 
ATOM   7607 O OG1 . THR D 1 146 ? -14.647 -16.424 9.082   1.00 18.27 ? 166 THR D OG1 1 
ATOM   7608 C CG2 . THR D 1 146 ? -13.242 -14.558 9.619   1.00 18.27 ? 166 THR D CG2 1 
ATOM   7609 N N   . GLY D 1 147 ? -17.732 -15.876 9.944   1.00 22.10 ? 167 GLY D N   1 
ATOM   7610 C CA  . GLY D 1 147 ? -19.101 -16.161 9.564   1.00 22.10 ? 167 GLY D CA  1 
ATOM   7611 C C   . GLY D 1 147 ? -19.352 -16.140 8.090   1.00 22.10 ? 167 GLY D C   1 
ATOM   7612 O O   . GLY D 1 147 ? -18.622 -16.724 7.277   1.00 22.10 ? 167 GLY D O   1 
ATOM   7613 N N   . THR D 1 148 ? -20.424 -15.425 7.718   1.00 24.30 ? 168 THR D N   1 
ATOM   7614 C CA  . THR D 1 148 ? -20.816 -15.354 6.309   1.00 24.30 ? 168 THR D CA  1 
ATOM   7615 C C   . THR D 1 148 ? -20.214 -14.197 5.534   1.00 24.30 ? 168 THR D C   1 
ATOM   7616 O O   . THR D 1 148 ? -20.589 -13.950 4.364   1.00 24.30 ? 168 THR D O   1 
ATOM   7617 C CB  . THR D 1 148 ? -22.351 -15.295 6.167   1.00 24.72 ? 168 THR D CB  1 
ATOM   7618 O OG1 . THR D 1 148 ? -22.802 -14.183 6.919   1.00 24.72 ? 168 THR D OG1 1 
ATOM   7619 C CG2 . THR D 1 148 ? -22.968 -16.584 6.685   1.00 24.72 ? 168 THR D CG2 1 
ATOM   7620 N N   . LEU D 1 149 ? -19.159 -13.548 6.062   1.00 24.45 ? 169 LEU D N   1 
ATOM   7621 C CA  . LEU D 1 149 ? -18.441 -12.521 5.344   1.00 24.45 ? 169 LEU D CA  1 
ATOM   7622 C C   . LEU D 1 149 ? -17.877 -13.189 4.087   1.00 24.45 ? 169 LEU D C   1 
ATOM   7623 O O   . LEU D 1 149 ? -17.899 -12.550 3.015   1.00 24.45 ? 169 LEU D O   1 
ATOM   7624 C CB  . LEU D 1 149 ? -17.341 -11.878 6.144   1.00 22.06 ? 169 LEU D CB  1 
ATOM   7625 C CG  . LEU D 1 149 ? -16.624 -10.651 5.620   1.00 22.06 ? 169 LEU D CG  1 
ATOM   7626 C CD1 . LEU D 1 149 ? -17.588 -9.530  5.236   1.00 22.06 ? 169 LEU D CD1 1 
ATOM   7627 C CD2 . LEU D 1 149 ? -15.700 -10.081 6.667   1.00 22.06 ? 169 LEU D CD2 1 
ATOM   7628 N N   . LEU D 1 150 ? -17.446 -14.440 4.127   1.00 24.06 ? 170 LEU D N   1 
ATOM   7629 C CA  . LEU D 1 150 ? -16.955 -15.088 2.914   1.00 24.06 ? 170 LEU D CA  1 
ATOM   7630 C C   . LEU D 1 150 ? -18.113 -15.456 2.027   1.00 24.06 ? 170 LEU D C   1 
ATOM   7631 O O   . LEU D 1 150 ? -17.941 -15.350 0.793   1.00 24.06 ? 170 LEU D O   1 
ATOM   7632 C CB  . LEU D 1 150 ? -16.103 -16.310 3.221   1.00 20.76 ? 170 LEU D CB  1 
ATOM   7633 C CG  . LEU D 1 150 ? -15.885 -17.251 2.013   1.00 20.76 ? 170 LEU D CG  1 
ATOM   7634 C CD1 . LEU D 1 150 ? -15.069 -16.571 0.912   1.00 20.76 ? 170 LEU D CD1 1 
ATOM   7635 C CD2 . LEU D 1 150 ? -15.241 -18.549 2.465   1.00 20.76 ? 170 LEU D CD2 1 
ATOM   7636 N N   . ASP D 1 151 ? -19.266 -15.836 2.552   1.00 25.66 ? 171 ASP D N   1 
ATOM   7637 C CA  . ASP D 1 151 ? -20.372 -16.209 1.645   1.00 25.66 ? 171 ASP D CA  1 
ATOM   7638 C C   . ASP D 1 151 ? -20.969 -14.970 0.993   1.00 25.66 ? 171 ASP D C   1 
ATOM   7639 O O   . ASP D 1 151 ? -21.415 -15.078 -0.158  1.00 25.66 ? 171 ASP D O   1 
ATOM   7640 C CB  . ASP D 1 151 ? -21.465 -16.968 2.360   1.00 29.38 ? 171 ASP D CB  1 
ATOM   7641 C CG  . ASP D 1 151 ? -20.891 -18.198 3.071   1.00 29.38 ? 171 ASP D CG  1 
ATOM   7642 O OD1 . ASP D 1 151 ? -20.596 -19.188 2.389   1.00 29.38 ? 171 ASP D OD1 1 
ATOM   7643 O OD2 . ASP D 1 151 ? -20.755 -18.067 4.302   1.00 29.38 ? 171 ASP D OD2 1 
ATOM   7644 N N   . THR D 1 152 ? -20.966 -13.858 1.694   1.00 22.67 ? 172 THR D N   1 
ATOM   7645 C CA  . THR D 1 152 ? -21.432 -12.597 1.134   1.00 22.67 ? 172 THR D CA  1 
ATOM   7646 C C   . THR D 1 152 ? -20.573 -12.196 -0.046  1.00 22.67 ? 172 THR D C   1 
ATOM   7647 O O   . THR D 1 152 ? -21.061 -11.887 -1.123  1.00 22.67 ? 172 THR D O   1 
ATOM   7648 C CB  . THR D 1 152 ? -21.367 -11.518 2.218   1.00 21.22 ? 172 THR D CB  1 
ATOM   7649 O OG1 . THR D 1 152 ? -22.155 -12.108 3.297   1.00 21.22 ? 172 THR D OG1 1 
ATOM   7650 C CG2 . THR D 1 152 ? -21.895 -10.190 1.795   1.00 21.22 ? 172 THR D CG2 1 
ATOM   7651 N N   . ALA D 1 153 ? -19.267 -12.281 0.085   1.00 22.00 ? 173 ALA D N   1 
ATOM   7652 C CA  . ALA D 1 153 ? -18.288 -11.978 -0.929  1.00 22.00 ? 173 ALA D CA  1 
ATOM   7653 C C   . ALA D 1 153 ? -18.495 -12.895 -2.110  1.00 22.00 ? 173 ALA D C   1 
ATOM   7654 O O   . ALA D 1 153 ? -18.249 -12.442 -3.241  1.00 22.00 ? 173 ALA D O   1 
ATOM   7655 C CB  . ALA D 1 153 ? -16.863 -12.153 -0.409  1.00 20.64 ? 173 ALA D CB  1 
ATOM   7656 N N   . ARG D 1 154 ? -18.930 -14.119 -1.975  1.00 22.90 ? 174 ARG D N   1 
ATOM   7657 C CA  . ARG D 1 154 ? -19.179 -15.045 -3.062  1.00 22.90 ? 174 ARG D CA  1 
ATOM   7658 C C   . ARG D 1 154 ? -20.477 -14.651 -3.767  1.00 22.90 ? 174 ARG D C   1 
ATOM   7659 O O   . ARG D 1 154 ? -20.553 -14.773 -4.981  1.00 22.90 ? 174 ARG D O   1 
ATOM   7660 C CB  . ARG D 1 154 ? -19.321 -16.485 -2.612  1.00 25.17 ? 174 ARG D CB  1 
ATOM   7661 C CG  . ARG D 1 154 ? -18.004 -17.053 -2.116  1.00 25.17 ? 174 ARG D CG  1 
ATOM   7662 C CD  . ARG D 1 154 ? -18.121 -18.492 -1.653  1.00 25.17 ? 174 ARG D CD  1 
ATOM   7663 N NE  . ARG D 1 154 ? -16.773 -19.093 -1.688  1.00 25.17 ? 174 ARG D NE  1 
ATOM   7664 C CZ  . ARG D 1 154 ? -16.387 -20.006 -0.782  1.00 25.17 ? 174 ARG D CZ  1 
ATOM   7665 N NH1 . ARG D 1 154 ? -17.254 -20.344 0.158   1.00 25.17 ? 174 ARG D NH1 1 
ATOM   7666 N NH2 . ARG D 1 154 ? -15.176 -20.562 -0.792  1.00 25.17 ? 174 ARG D NH2 1 
ATOM   7667 N N   . MET D 1 155 ? -21.462 -14.205 -3.012  1.00 24.09 ? 175 MET D N   1 
ATOM   7668 C CA  . MET D 1 155 ? -22.726 -13.750 -3.582  1.00 24.09 ? 175 MET D CA  1 
ATOM   7669 C C   . MET D 1 155 ? -22.415 -12.509 -4.406  1.00 24.09 ? 175 MET D C   1 
ATOM   7670 O O   . MET D 1 155 ? -22.820 -12.330 -5.574  1.00 24.09 ? 175 MET D O   1 
ATOM   7671 C CB  . MET D 1 155 ? -23.722 -13.430 -2.497  1.00 23.18 ? 175 MET D CB  1 
ATOM   7672 C CG  . MET D 1 155 ? -25.032 -12.810 -2.887  1.00 23.18 ? 175 MET D CG  1 
ATOM   7673 S SD  . MET D 1 155 ? -24.902 -11.020 -3.034  1.00 23.18 ? 175 MET D SD  1 
ATOM   7674 C CE  . MET D 1 155 ? -25.015 -10.452 -1.377  1.00 23.18 ? 175 MET D CE  1 
ATOM   7675 N N   . GLN D 1 156 ? -21.602 -11.606 -3.864  1.00 24.32 ? 176 GLN D N   1 
ATOM   7676 C CA  . GLN D 1 156 ? -21.172 -10.412 -4.589  1.00 24.32 ? 176 GLN D CA  1 
ATOM   7677 C C   . GLN D 1 156 ? -20.404 -10.817 -5.843  1.00 24.32 ? 176 GLN D C   1 
ATOM   7678 O O   . GLN D 1 156 ? -20.614 -10.174 -6.896  1.00 24.32 ? 176 GLN D O   1 
ATOM   7679 C CB  . GLN D 1 156 ? -20.306 -9.560  -3.650  1.00 23.22 ? 176 GLN D CB  1 
ATOM   7680 C CG  . GLN D 1 156 ? -21.092 -8.900  -2.549  1.00 23.22 ? 176 GLN D CG  1 
ATOM   7681 C CD  . GLN D 1 156 ? -20.192 -8.194  -1.576  1.00 23.22 ? 176 GLN D CD  1 
ATOM   7682 O OE1 . GLN D 1 156 ? -19.428 -8.828  -0.858  1.00 23.22 ? 176 GLN D OE1 1 
ATOM   7683 N NE2 . GLN D 1 156 ? -20.197 -6.856  -1.531  1.00 23.22 ? 176 GLN D NE2 1 
ATOM   7684 N N   . ARG D 1 157 ? -19.563 -11.827 -5.870  1.00 24.63 ? 177 ARG D N   1 
ATOM   7685 C CA  . ARG D 1 157 ? -18.844 -12.254 -7.038  1.00 24.63 ? 177 ARG D CA  1 
ATOM   7686 C C   . ARG D 1 157 ? -19.795 -12.744 -8.137  1.00 24.63 ? 177 ARG D C   1 
ATOM   7687 O O   . ARG D 1 157 ? -19.666 -12.375 -9.296  1.00 24.63 ? 177 ARG D O   1 
ATOM   7688 C CB  . ARG D 1 157 ? -17.908 -13.422 -6.720  1.00 26.72 ? 177 ARG D CB  1 
ATOM   7689 C CG  . ARG D 1 157 ? -17.112 -13.848 -7.942  1.00 26.72 ? 177 ARG D CG  1 
ATOM   7690 C CD  . ARG D 1 157 ? -16.340 -15.108 -7.664  1.00 26.72 ? 177 ARG D CD  1 
ATOM   7691 N NE  . ARG D 1 157 ? -17.212 -16.185 -7.199  1.00 26.72 ? 177 ARG D NE  1 
ATOM   7692 C CZ  . ARG D 1 157 ? -17.911 -16.937 -8.038  1.00 26.72 ? 177 ARG D CZ  1 
ATOM   7693 N NH1 . ARG D 1 157 ? -17.860 -16.707 -9.353  1.00 26.72 ? 177 ARG D NH1 1 
ATOM   7694 N NH2 . ARG D 1 157 ? -18.661 -17.888 -7.553  1.00 26.72 ? 177 ARG D NH2 1 
ATOM   7695 N N   . ALA D 1 158 ? -20.725 -13.598 -7.717  1.00 25.89 ? 178 ALA D N   1 
ATOM   7696 C CA  . ALA D 1 158 ? -21.716 -14.169 -8.627  1.00 25.89 ? 178 ALA D CA  1 
ATOM   7697 C C   . ALA D 1 158 ? -22.636 -13.082 -9.145  1.00 25.89 ? 178 ALA D C   1 
ATOM   7698 O O   . ALA D 1 158 ? -22.807 -13.014 -10.373 1.00 25.89 ? 178 ALA D O   1 
ATOM   7699 C CB  . ALA D 1 158 ? -22.483 -15.266 -7.908  1.00 25.37 ? 178 ALA D CB  1 
ATOM   7700 N N   . VAL D 1 159 ? -23.200 -12.201 -8.347  1.00 28.11 ? 179 VAL D N   1 
ATOM   7701 C CA  . VAL D 1 159 ? -24.040 -11.127 -8.887  1.00 28.11 ? 179 VAL D CA  1 
ATOM   7702 C C   . VAL D 1 159 ? -23.219 -10.190 -9.762  1.00 28.11 ? 179 VAL D C   1 
ATOM   7703 O O   . VAL D 1 159 ? -23.728 -9.729  -10.798 1.00 28.11 ? 179 VAL D O   1 
ATOM   7704 C CB  . VAL D 1 159 ? -24.692 -10.271 -7.788  1.00 25.94 ? 179 VAL D CB  1 
ATOM   7705 C CG1 . VAL D 1 159 ? -25.389 -9.047  -8.366  1.00 25.94 ? 179 VAL D CG1 1 
ATOM   7706 C CG2 . VAL D 1 159 ? -25.724 -11.081 -7.019  1.00 25.94 ? 179 VAL D CG2 1 
ATOM   7707 N N   . GLY D 1 160 ? -22.014 -9.871  -9.375  1.00 32.82 ? 180 GLY D N   1 
ATOM   7708 C CA  . GLY D 1 160 ? -21.094 -9.022  -10.080 1.00 32.82 ? 180 GLY D CA  1 
ATOM   7709 C C   . GLY D 1 160 ? -20.817 -9.629  -11.435 1.00 32.82 ? 180 GLY D C   1 
ATOM   7710 O O   . GLY D 1 160 ? -20.981 -8.920  -12.432 1.00 32.82 ? 180 GLY D O   1 
ATOM   7711 N N   . GLU D 1 161 ? -20.459 -10.915 -11.516 1.00 36.49 ? 181 GLU D N   1 
ATOM   7712 C CA  . GLU D 1 161 ? -20.254 -11.543 -12.818 1.00 36.49 ? 181 GLU D CA  1 
ATOM   7713 C C   . GLU D 1 161 ? -21.576 -11.497 -13.578 1.00 36.49 ? 181 GLU D C   1 
ATOM   7714 O O   . GLU D 1 161 ? -21.534 -11.262 -14.786 1.00 36.49 ? 181 GLU D O   1 
ATOM   7715 C CB  . GLU D 1 161 ? -19.785 -12.969 -12.742 1.00 43.38 ? 181 GLU D CB  1 
ATOM   7716 C CG  . GLU D 1 161 ? -18.336 -13.158 -12.345 1.00 43.38 ? 181 GLU D CG  1 
ATOM   7717 C CD  . GLU D 1 161 ? -17.841 -14.585 -12.232 1.00 43.38 ? 181 GLU D CD  1 
ATOM   7718 O OE1 . GLU D 1 161 ? -18.145 -15.469 -13.099 1.00 43.38 ? 181 GLU D OE1 1 
ATOM   7719 O OE2 . GLU D 1 161 ? -17.098 -14.921 -11.240 1.00 43.38 ? 181 GLU D OE2 1 
ATOM   7720 N N   . ALA D 1 162 ? -22.739 -11.649 -12.987 1.00 36.41 ? 182 ALA D N   1 
ATOM   7721 C CA  . ALA D 1 162 ? -24.003 -11.587 -13.669 1.00 36.41 ? 182 ALA D CA  1 
ATOM   7722 C C   . ALA D 1 162 ? -24.253 -10.249 -14.349 1.00 36.41 ? 182 ALA D C   1 
ATOM   7723 O O   . ALA D 1 162 ? -24.698 -10.230 -15.514 1.00 36.41 ? 182 ALA D O   1 
ATOM   7724 C CB  . ALA D 1 162 ? -25.165 -11.844 -12.713 1.00 34.91 ? 182 ALA D CB  1 
ATOM   7725 N N   . PHE D 1 163 ? -24.037 -9.129  -13.670 1.00 35.28 ? 183 PHE D N   1 
ATOM   7726 C CA  . PHE D 1 163 ? -24.275 -7.803  -14.194 1.00 35.28 ? 183 PHE D CA  1 
ATOM   7727 C C   . PHE D 1 163 ? -23.023 -7.109  -14.677 1.00 35.28 ? 183 PHE D C   1 
ATOM   7728 O O   . PHE D 1 163 ? -23.033 -5.890  -14.896 1.00 35.28 ? 183 PHE D O   1 
ATOM   7729 C CB  . PHE D 1 163 ? -24.888 -6.954  -13.063 1.00 34.87 ? 183 PHE D CB  1 
ATOM   7730 C CG  . PHE D 1 163 ? -26.283 -7.360  -12.702 1.00 34.87 ? 183 PHE D CG  1 
ATOM   7731 C CD1 . PHE D 1 163 ? -26.497 -8.361  -11.774 1.00 34.87 ? 183 PHE D CD1 1 
ATOM   7732 C CD2 . PHE D 1 163 ? -27.379 -6.761  -13.265 1.00 34.87 ? 183 PHE D CD2 1 
ATOM   7733 C CE1 . PHE D 1 163 ? -27.776 -8.739  -11.402 1.00 34.87 ? 183 PHE D CE1 1 
ATOM   7734 C CE2 . PHE D 1 163 ? -28.665 -7.121  -12.886 1.00 34.87 ? 183 PHE D CE2 1 
ATOM   7735 C CZ  . PHE D 1 163 ? -28.872 -8.115  -11.962 1.00 34.87 ? 183 PHE D CZ  1 
ATOM   7736 N N   . ASP D 1 164 ? -21.933 -7.809  -14.826 1.00 35.10 ? 184 ASP D N   1 
ATOM   7737 C CA  . ASP D 1 164 ? -20.629 -7.314  -15.258 1.00 35.10 ? 184 ASP D CA  1 
ATOM   7738 C C   . ASP D 1 164 ? -20.259 -6.059  -14.459 1.00 35.10 ? 184 ASP D C   1 
ATOM   7739 O O   . ASP D 1 164 ? -19.964 -4.984  -14.994 1.00 35.10 ? 184 ASP D O   1 
ATOM   7740 C CB  . ASP D 1 164 ? -20.711 -7.035  -16.748 1.00 39.59 ? 184 ASP D CB  1 
ATOM   7741 C CG  . ASP D 1 164 ? -19.368 -6.975  -17.432 1.00 39.59 ? 184 ASP D CG  1 
ATOM   7742 O OD1 . ASP D 1 164 ? -18.313 -7.251  -16.793 1.00 39.59 ? 184 ASP D OD1 1 
ATOM   7743 O OD2 . ASP D 1 164 ? -19.363 -6.645  -18.638 1.00 39.59 ? 184 ASP D OD2 1 
ATOM   7744 N N   . LEU D 1 165 ? -20.274 -6.199  -13.130 1.00 30.43 ? 185 LEU D N   1 
ATOM   7745 C CA  . LEU D 1 165 ? -19.961 -5.188  -12.165 1.00 30.43 ? 185 LEU D CA  1 
ATOM   7746 C C   . LEU D 1 165 ? -18.826 -5.579  -11.207 1.00 30.43 ? 185 LEU D C   1 
ATOM   7747 O O   . LEU D 1 165 ? -18.387 -6.703  -11.075 1.00 30.43 ? 185 LEU D O   1 
ATOM   7748 C CB  . LEU D 1 165 ? -21.144 -4.944  -11.248 1.00 30.69 ? 185 LEU D CB  1 
ATOM   7749 C CG  . LEU D 1 165 ? -22.329 -4.107  -11.402 1.00 30.69 ? 185 LEU D CG  1 
ATOM   7750 C CD1 . LEU D 1 165 ? -23.310 -4.315  -10.234 1.00 30.69 ? 185 LEU D CD1 1 
ATOM   7751 C CD2 . LEU D 1 165 ? -21.991 -2.606  -11.447 1.00 30.69 ? 185 LEU D CD2 1 
ATOM   7752 N N   . ASP D 1 166 ? -18.412 -4.552  -10.483 1.00 24.53 ? 186 ASP D N   1 
ATOM   7753 C CA  . ASP D 1 166 ? -17.393 -4.645  -9.466  1.00 24.53 ? 186 ASP D CA  1 
ATOM   7754 C C   . ASP D 1 166 ? -18.127 -5.248  -8.277  1.00 24.53 ? 186 ASP D C   1 
ATOM   7755 O O   . ASP D 1 166 ? -19.112 -4.647  -7.801  1.00 24.53 ? 186 ASP D O   1 
ATOM   7756 C CB  . ASP D 1 166 ? -16.857 -3.292  -9.090  1.00 23.60 ? 186 ASP D CB  1 
ATOM   7757 C CG  . ASP D 1 166 ? -15.935 -3.210  -7.910  1.00 23.60 ? 186 ASP D CG  1 
ATOM   7758 O OD1 . ASP D 1 166 ? -15.598 -4.224  -7.290  1.00 23.60 ? 186 ASP D OD1 1 
ATOM   7759 O OD2 . ASP D 1 166 ? -15.496 -2.065  -7.556  1.00 23.60 ? 186 ASP D OD2 1 
ATOM   7760 N N   . PRO D 1 167 ? -17.618 -6.369  -7.791  1.00 22.40 ? 187 PRO D N   1 
ATOM   7761 C CA  . PRO D 1 167 ? -18.239 -7.042  -6.646  1.00 22.40 ? 187 PRO D CA  1 
ATOM   7762 C C   . PRO D 1 167 ? -18.440 -6.085  -5.511  1.00 22.40 ? 187 PRO D C   1 
ATOM   7763 O O   . PRO D 1 167 ? -19.481 -6.183  -4.823  1.00 22.40 ? 187 PRO D O   1 
ATOM   7764 C CB  . PRO D 1 167 ? -17.347 -8.209  -6.289  1.00 21.47 ? 187 PRO D CB  1 
ATOM   7765 C CG  . PRO D 1 167 ? -16.155 -8.064  -7.126  1.00 21.47 ? 187 PRO D CG  1 
ATOM   7766 C CD  . PRO D 1 167 ? -16.472 -7.114  -8.271  1.00 21.47 ? 187 PRO D CD  1 
ATOM   7767 N N   . ARG D 1 168 ? -17.577 -5.108  -5.237  1.00 23.27 ? 188 ARG D N   1 
ATOM   7768 C CA  . ARG D 1 168 ? -17.711 -4.120  -4.189  1.00 23.27 ? 188 ARG D CA  1 
ATOM   7769 C C   . ARG D 1 168 ? -18.916 -3.226  -4.379  1.00 23.27 ? 188 ARG D C   1 
ATOM   7770 O O   . ARG D 1 168 ? -19.361 -2.575  -3.422  1.00 23.27 ? 188 ARG D O   1 
ATOM   7771 C CB  . ARG D 1 168 ? -16.433 -3.271  -4.115  1.00 28.55 ? 188 ARG D CB  1 
ATOM   7772 C CG  . ARG D 1 168 ? -15.169 -4.076  -3.934  1.00 28.55 ? 188 ARG D CG  1 
ATOM   7773 C CD  . ARG D 1 168 ? -13.879 -3.244  -3.897  1.00 28.55 ? 188 ARG D CD  1 
ATOM   7774 N NE  . ARG D 1 168 ? -13.581 -2.720  -5.224  1.00 28.55 ? 188 ARG D NE  1 
ATOM   7775 C CZ  . ARG D 1 168 ? -12.886 -1.696  -5.684  1.00 28.55 ? 188 ARG D CZ  1 
ATOM   7776 N NH1 . ARG D 1 168 ? -12.183 -0.923  -4.835  1.00 28.55 ? 188 ARG D NH1 1 
ATOM   7777 N NH2 . ARG D 1 168 ? -12.825 -1.390  -6.997  1.00 28.55 ? 188 ARG D NH2 1 
ATOM   7778 N N   . SER D 1 169 ? -19.470 -3.149  -5.577  1.00 24.31 ? 189 SER D N   1 
ATOM   7779 C CA  . SER D 1 169 ? -20.638 -2.298  -5.850  1.00 24.31 ? 189 SER D CA  1 
ATOM   7780 C C   . SER D 1 169 ? -21.968 -2.997  -5.587  1.00 24.31 ? 189 SER D C   1 
ATOM   7781 O O   . SER D 1 169 ? -23.037 -2.386  -5.665  1.00 24.31 ? 189 SER D O   1 
ATOM   7782 C CB  . SER D 1 169 ? -20.554 -1.813  -7.311  1.00 23.76 ? 189 SER D CB  1 
ATOM   7783 O OG  . SER D 1 169 ? -19.534 -0.805  -7.432  1.00 23.76 ? 189 SER D OG  1 
ATOM   7784 N N   . VAL D 1 170 ? -21.914 -4.300  -5.289  1.00 25.30 ? 190 VAL D N   1 
ATOM   7785 C CA  . VAL D 1 170 ? -23.082 -5.112  -4.955  1.00 25.30 ? 190 VAL D CA  1 
ATOM   7786 C C   . VAL D 1 170 ? -23.290 -5.070  -3.448  1.00 25.30 ? 190 VAL D C   1 
ATOM   7787 O O   . VAL D 1 170 ? -22.394 -5.415  -2.665  1.00 25.30 ? 190 VAL D O   1 
ATOM   7788 C CB  . VAL D 1 170 ? -22.952 -6.572  -5.379  1.00 24.68 ? 190 VAL D CB  1 
ATOM   7789 C CG1 . VAL D 1 170 ? -24.260 -7.323  -5.042  1.00 24.68 ? 190 VAL D CG1 1 
ATOM   7790 C CG2 . VAL D 1 170 ? -22.692 -6.723  -6.855  1.00 24.68 ? 190 VAL D CG2 1 
ATOM   7791 N N   . SER D 1 171 ? -24.454 -4.564  -3.071  1.00 27.75 ? 191 SER D N   1 
ATOM   7792 C CA  . SER D 1 171 ? -24.710 -4.483  -1.626  1.00 27.75 ? 191 SER D CA  1 
ATOM   7793 C C   . SER D 1 171 ? -25.569 -5.685  -1.256  1.00 27.75 ? 191 SER D C   1 
ATOM   7794 O O   . SER D 1 171 ? -25.976 -6.418  -2.165  1.00 27.75 ? 191 SER D O   1 
ATOM   7795 C CB  . SER D 1 171 ? -25.385 -3.170  -1.282  1.00 29.89 ? 191 SER D CB  1 
ATOM   7796 O OG  . SER D 1 171 ? -26.743 -3.221  -1.743  1.00 29.89 ? 191 SER D OG  1 
ATOM   7797 N N   . GLY D 1 172 ? -25.783 -5.834  0.040   1.00 30.54 ? 192 GLY D N   1 
ATOM   7798 C CA  . GLY D 1 172 ? -26.578 -6.981  0.519   1.00 30.54 ? 192 GLY D CA  1 
ATOM   7799 C C   . GLY D 1 172 ? -25.755 -7.965  1.294   1.00 30.54 ? 192 GLY D C   1 
ATOM   7800 O O   . GLY D 1 172 ? -24.518 -7.852  1.406   1.00 30.54 ? 192 GLY D O   1 
ATOM   7801 N N   . TYR D 1 173 ? -26.413 -8.954  1.933   1.00 30.99 ? 193 TYR D N   1 
ATOM   7802 C CA  . TYR D 1 173 ? -25.720 -9.933  2.730   1.00 30.99 ? 193 TYR D CA  1 
ATOM   7803 C C   . TYR D 1 173 ? -26.308 -11.332 2.707   1.00 30.99 ? 193 TYR D C   1 
ATOM   7804 O O   . TYR D 1 173 ? -27.430 -11.569 2.353   1.00 30.99 ? 193 TYR D O   1 
ATOM   7805 C CB  . TYR D 1 173 ? -25.790 -9.680  4.270   1.00 31.38 ? 193 TYR D CB  1 
ATOM   7806 C CG  . TYR D 1 173 ? -25.752 -8.227  4.650   1.00 31.38 ? 193 TYR D CG  1 
ATOM   7807 C CD1 . TYR D 1 173 ? -26.976 -7.564  4.646   1.00 31.38 ? 193 TYR D CD1 1 
ATOM   7808 C CD2 . TYR D 1 173 ? -24.590 -7.537  4.908   1.00 31.38 ? 193 TYR D CD2 1 
ATOM   7809 C CE1 . TYR D 1 173 ? -27.014 -6.220  4.956   1.00 31.38 ? 193 TYR D CE1 1 
ATOM   7810 C CE2 . TYR D 1 173 ? -24.614 -6.198  5.238   1.00 31.38 ? 193 TYR D CE2 1 
ATOM   7811 C CZ  . TYR D 1 173 ? -25.824 -5.568  5.259   1.00 31.38 ? 193 TYR D CZ  1 
ATOM   7812 O OH  . TYR D 1 173 ? -25.934 -4.222  5.549   1.00 31.38 ? 193 TYR D OH  1 
ATOM   7813 N N   . ASN D 1 174 ? -25.431 -12.203 3.181   1.00 30.69 ? 194 ASN D N   1 
ATOM   7814 C CA  . ASN D 1 174 ? -25.691 -13.616 3.402   1.00 30.69 ? 194 ASN D CA  1 
ATOM   7815 C C   . ASN D 1 174 ? -25.786 -13.714 4.939   1.00 30.69 ? 194 ASN D C   1 
ATOM   7816 O O   . ASN D 1 174 ? -24.857 -13.227 5.597   1.00 30.69 ? 194 ASN D O   1 
ATOM   7817 C CB  . ASN D 1 174 ? -24.628 -14.589 2.969   1.00 31.14 ? 194 ASN D CB  1 
ATOM   7818 C CG  . ASN D 1 174 ? -24.700 -14.866 1.503   1.00 31.14 ? 194 ASN D CG  1 
ATOM   7819 O OD1 . ASN D 1 174 ? -24.816 -13.820 0.703   1.00 31.14 ? 194 ASN D OD1 1 
ATOM   7820 N ND2 . ASN D 1 174 ? -24.688 -15.999 1.031   1.00 31.14 ? 194 ASN D ND2 1 
ATOM   7821 N N   . LEU D 1 175 ? -26.890 -14.227 5.446   1.00 30.31 ? 195 LEU D N   1 
ATOM   7822 C CA  . LEU D 1 175 ? -27.035 -14.299 6.904   1.00 30.31 ? 195 LEU D CA  1 
ATOM   7823 C C   . LEU D 1 175 ? -27.103 -15.742 7.364   1.00 30.31 ? 195 LEU D C   1 
ATOM   7824 O O   . LEU D 1 175 ? -27.216 -16.698 6.580   1.00 30.31 ? 195 LEU D O   1 
ATOM   7825 C CB  . LEU D 1 175 ? -28.296 -13.564 7.342   1.00 29.16 ? 195 LEU D CB  1 
ATOM   7826 C CG  . LEU D 1 175 ? -28.456 -12.113 6.873   1.00 29.16 ? 195 LEU D CG  1 
ATOM   7827 C CD1 . LEU D 1 175 ? -29.852 -11.590 7.188   1.00 29.16 ? 195 LEU D CD1 1 
ATOM   7828 C CD2 . LEU D 1 175 ? -27.434 -11.188 7.527   1.00 29.16 ? 195 LEU D CD2 1 
ATOM   7829 N N   . GLY D 1 176 ? -26.991 -15.880 8.683   1.00 32.92 ? 196 GLY D N   1 
ATOM   7830 C CA  . GLY D 1 176 ? -27.074 -17.174 9.285   1.00 32.92 ? 196 GLY D CA  1 
ATOM   7831 C C   . GLY D 1 176 ? -25.863 -17.957 9.664   1.00 32.92 ? 196 GLY D C   1 
ATOM   7832 O O   . GLY D 1 176 ? -24.871 -17.430 10.137  1.00 32.92 ? 196 GLY D O   1 
ATOM   7833 N N   . GLU D 1 177 ? -25.955 -19.268 9.460   1.00 37.58 ? 197 GLU D N   1 
ATOM   7834 C CA  . GLU D 1 177 ? -24.952 -20.237 9.790   1.00 37.58 ? 197 GLU D CA  1 
ATOM   7835 C C   . GLU D 1 177 ? -24.016 -20.578 8.659   1.00 37.58 ? 197 GLU D C   1 
ATOM   7836 O O   . GLU D 1 177 ? -24.424 -21.223 7.696   1.00 37.58 ? 197 GLU D O   1 
ATOM   7837 C CB  . GLU D 1 177 ? -25.703 -21.536 10.172  1.00 41.38 ? 197 GLU D CB  1 
ATOM   7838 C CG  . GLU D 1 177 ? -24.849 -22.659 10.730  1.00 41.38 ? 197 GLU D CG  1 
ATOM   7839 C CD  . GLU D 1 177 ? -25.511 -24.018 10.426  1.00 41.38 ? 197 GLU D CD  1 
ATOM   7840 O OE1 . GLU D 1 177 ? -25.352 -24.470 9.278   1.00 41.38 ? 197 GLU D OE1 1 
ATOM   7841 O OE2 . GLU D 1 177 ? -26.165 -24.613 11.297  1.00 41.38 ? 197 GLU D OE2 1 
ATOM   7842 N N   . HIS D 1 178 ? -22.748 -20.175 8.794   1.00 43.75 ? 198 HIS D N   1 
ATOM   7843 C CA  . HIS D 1 178 ? -21.763 -20.475 7.779   1.00 43.75 ? 198 HIS D CA  1 
ATOM   7844 C C   . HIS D 1 178 ? -21.570 -21.991 7.681   1.00 43.75 ? 198 HIS D C   1 
ATOM   7845 O O   . HIS D 1 178 ? -21.258 -22.644 8.681   1.00 43.75 ? 198 HIS D O   1 
ATOM   7846 C CB  . HIS D 1 178 ? -20.388 -19.910 8.064   1.00 46.21 ? 198 HIS D CB  1 
ATOM   7847 C CG  . HIS D 1 178 ? -19.372 -20.248 6.996   1.00 46.21 ? 198 HIS D CG  1 
ATOM   7848 N ND1 . HIS D 1 178 ? -19.564 -19.772 5.705   1.00 46.21 ? 198 HIS D ND1 1 
ATOM   7849 C CD2 . HIS D 1 178 ? -18.224 -20.962 6.972   1.00 46.21 ? 198 HIS D CD2 1 
ATOM   7850 C CE1 . HIS D 1 178 ? -18.582 -20.152 4.910   1.00 46.21 ? 198 HIS D CE1 1 
ATOM   7851 N NE2 . HIS D 1 178 ? -17.763 -20.883 5.650   1.00 46.21 ? 198 HIS D NE2 1 
ATOM   7852 N N   . GLY D 1 179 ? -21.705 -22.492 6.462   1.00 47.20 ? 199 GLY D N   1 
ATOM   7853 C CA  . GLY D 1 179 ? -21.493 -23.924 6.313   1.00 47.20 ? 199 GLY D CA  1 
ATOM   7854 C C   . GLY D 1 179 ? -22.743 -24.709 6.070   1.00 47.20 ? 199 GLY D C   1 
ATOM   7855 O O   . GLY D 1 179 ? -22.592 -25.868 5.572   1.00 47.20 ? 199 GLY D O   1 
ATOM   7856 N N   . ASN D 1 180 ? -23.935 -24.245 6.384   1.00 46.71 ? 200 ASN D N   1 
ATOM   7857 C CA  . ASN D 1 180 ? -25.104 -25.109 6.049   1.00 46.71 ? 200 ASN D CA  1 
ATOM   7858 C C   . ASN D 1 180 ? -26.331 -24.253 5.877   1.00 46.71 ? 200 ASN D C   1 
ATOM   7859 O O   . ASN D 1 180 ? -26.594 -23.874 4.723   1.00 46.71 ? 200 ASN D O   1 
ATOM   7860 C CB  . ASN D 1 180 ? -25.337 -26.235 7.071   1.00 47.15 ? 200 ASN D CB  1 
ATOM   7861 N N   . SER D 1 181 ? -27.070 -23.881 6.906   1.00 43.61 ? 201 SER D N   1 
ATOM   7862 C CA  . SER D 1 181 ? -28.263 -23.076 6.727   1.00 43.61 ? 201 SER D CA  1 
ATOM   7863 C C   . SER D 1 181 ? -28.118 -21.594 6.449   1.00 43.61 ? 201 SER D C   1 
ATOM   7864 O O   . SER D 1 181 ? -29.133 -20.887 6.680   1.00 43.61 ? 201 SER D O   1 
ATOM   7865 C CB  . SER D 1 181 ? -29.160 -23.246 7.999   1.00 44.32 ? 201 SER D CB  1 
ATOM   7866 O OG  . SER D 1 181 ? -28.369 -23.156 9.154   1.00 44.32 ? 201 SER D OG  1 
ATOM   7867 N N   . GLN D 1 182 ? -27.022 -21.051 5.938   1.00 39.23 ? 202 GLN D N   1 
ATOM   7868 C CA  . GLN D 1 182 ? -26.959 -19.608 5.674   1.00 39.23 ? 202 GLN D CA  1 
ATOM   7869 C C   . GLN D 1 182 ? -27.666 -19.364 4.330   1.00 39.23 ? 202 GLN D C   1 
ATOM   7870 O O   . GLN D 1 182 ? -27.742 -20.234 3.474   1.00 39.23 ? 202 GLN D O   1 
ATOM   7871 C CB  . GLN D 1 182 ? -25.568 -19.043 5.678   1.00 42.41 ? 202 GLN D CB  1 
ATOM   7872 C CG  . GLN D 1 182 ? -24.548 -19.905 4.959   1.00 42.41 ? 202 GLN D CG  1 
ATOM   7873 C CD  . GLN D 1 182 ? -24.456 -19.414 3.532   1.00 42.41 ? 202 GLN D CD  1 
ATOM   7874 O OE1 . GLN D 1 182 ? -24.449 -18.083 3.424   1.00 42.41 ? 202 GLN D OE1 1 
ATOM   7875 N NE2 . GLN D 1 182 ? -24.419 -20.201 2.614   1.00 42.41 ? 202 GLN D NE2 1 
ATOM   7876 N N   . PHE D 1 183 ? -28.229 -18.178 4.224   1.00 31.67 ? 203 PHE D N   1 
ATOM   7877 C CA  . PHE D 1 183 ? -29.004 -17.812 3.049   1.00 31.67 ? 203 PHE D CA  1 
ATOM   7878 C C   . PHE D 1 183 ? -28.723 -16.389 2.583   1.00 31.67 ? 203 PHE D C   1 
ATOM   7879 O O   . PHE D 1 183 ? -28.305 -15.513 3.349   1.00 31.67 ? 203 PHE D O   1 
ATOM   7880 C CB  . PHE D 1 183 ? -30.507 -17.919 3.376   1.00 26.57 ? 203 PHE D CB  1 
ATOM   7881 C CG  . PHE D 1 183 ? -30.947 -16.980 4.460   1.00 26.57 ? 203 PHE D CG  1 
ATOM   7882 C CD1 . PHE D 1 183 ? -30.672 -17.232 5.792   1.00 26.57 ? 203 PHE D CD1 1 
ATOM   7883 C CD2 . PHE D 1 183 ? -31.653 -15.838 4.158   1.00 26.57 ? 203 PHE D CD2 1 
ATOM   7884 C CE1 . PHE D 1 183 ? -31.065 -16.353 6.788   1.00 26.57 ? 203 PHE D CE1 1 
ATOM   7885 C CE2 . PHE D 1 183 ? -32.056 -14.955 5.148   1.00 26.57 ? 203 PHE D CE2 1 
ATOM   7886 C CZ  . PHE D 1 183 ? -31.763 -15.210 6.448   1.00 26.57 ? 203 PHE D CZ  1 
ATOM   7887 N N   . VAL D 1 184 ? -29.007 -16.161 1.286   1.00 27.24 ? 204 VAL D N   1 
ATOM   7888 C CA  . VAL D 1 184 ? -28.835 -14.797 0.764   1.00 27.24 ? 204 VAL D CA  1 
ATOM   7889 C C   . VAL D 1 184 ? -30.056 -14.006 1.191   1.00 27.24 ? 204 VAL D C   1 
ATOM   7890 O O   . VAL D 1 184 ? -31.183 -14.398 0.915   1.00 27.24 ? 204 VAL D O   1 
ATOM   7891 C CB  . VAL D 1 184 ? -28.689 -14.692 -0.756  1.00 26.65 ? 204 VAL D CB  1 
ATOM   7892 C CG1 . VAL D 1 184 ? -28.540 -13.226 -1.162  1.00 26.65 ? 204 VAL D CG1 1 
ATOM   7893 C CG2 . VAL D 1 184 ? -27.478 -15.406 -1.314  1.00 26.65 ? 204 VAL D CG2 1 
ATOM   7894 N N   . ALA D 1 185 ? -29.862 -12.908 1.914   1.00 25.61 ? 205 ALA D N   1 
ATOM   7895 C CA  . ALA D 1 185 ? -31.040 -12.095 2.266   1.00 25.61 ? 205 ALA D CA  1 
ATOM   7896 C C   . ALA D 1 185 ? -31.266 -11.230 1.038   1.00 25.61 ? 205 ALA D C   1 
ATOM   7897 O O   . ALA D 1 185 ? -30.901 -10.041 1.012   1.00 25.61 ? 205 ALA D O   1 
ATOM   7898 C CB  . ALA D 1 185 ? -30.805 -11.297 3.502   1.00 23.77 ? 205 ALA D CB  1 
ATOM   7899 N N   . TRP D 1 186 ? -31.898 -11.754 -0.023  1.00 26.44 ? 206 TRP D N   1 
ATOM   7900 C CA  . TRP D 1 186 ? -32.131 -11.066 -1.283  1.00 26.44 ? 206 TRP D CA  1 
ATOM   7901 C C   . TRP D 1 186 ? -32.811 -9.761  -1.062  1.00 26.44 ? 206 TRP D C   1 
ATOM   7902 O O   . TRP D 1 186 ? -32.443 -8.774  -1.756  1.00 26.44 ? 206 TRP D O   1 
ATOM   7903 C CB  . TRP D 1 186 ? -32.971 -11.879 -2.272  1.00 24.81 ? 206 TRP D CB  1 
ATOM   7904 C CG  . TRP D 1 186 ? -32.225 -13.026 -2.870  1.00 24.81 ? 206 TRP D CG  1 
ATOM   7905 C CD1 . TRP D 1 186 ? -32.572 -14.337 -2.739  1.00 24.81 ? 206 TRP D CD1 1 
ATOM   7906 C CD2 . TRP D 1 186 ? -31.030 -12.999 -3.662  1.00 24.81 ? 206 TRP D CD2 1 
ATOM   7907 N NE1 . TRP D 1 186 ? -31.662 -15.130 -3.405  1.00 24.81 ? 206 TRP D NE1 1 
ATOM   7908 C CE2 . TRP D 1 186 ? -30.699 -14.344 -3.967  1.00 24.81 ? 206 TRP D CE2 1 
ATOM   7909 C CE3 . TRP D 1 186 ? -30.174 -11.992 -4.110  1.00 24.81 ? 206 TRP D CE3 1 
ATOM   7910 C CZ2 . TRP D 1 186 ? -29.587 -14.711 -4.708  1.00 24.81 ? 206 TRP D CZ2 1 
ATOM   7911 C CZ3 . TRP D 1 186 ? -29.070 -12.365 -4.847  1.00 24.81 ? 206 TRP D CZ3 1 
ATOM   7912 C CH2 . TRP D 1 186 ? -28.785 -13.691 -5.157  1.00 24.81 ? 206 TRP D CH2 1 
ATOM   7913 N N   . SER D 1 187 ? -33.681 -9.580  -0.090  1.00 27.67 ? 207 SER D N   1 
ATOM   7914 C CA  . SER D 1 187 ? -34.271 -8.282  0.132   1.00 27.67 ? 207 SER D CA  1 
ATOM   7915 C C   . SER D 1 187 ? -33.240 -7.242  0.505   1.00 27.67 ? 207 SER D C   1 
ATOM   7916 O O   . SER D 1 187 ? -33.720 -6.069  0.581   1.00 27.67 ? 207 SER D O   1 
ATOM   7917 C CB  . SER D 1 187 ? -35.352 -8.367  1.208   1.00 28.10 ? 207 SER D CB  1 
ATOM   7918 O OG  . SER D 1 187 ? -34.796 -8.190  2.494   1.00 28.10 ? 207 SER D OG  1 
ATOM   7919 N N   . THR D 1 188 ? -31.978 -7.495  0.748   1.00 29.24 ? 208 THR D N   1 
ATOM   7920 C CA  . THR D 1 188 ? -30.976 -6.499  1.068   1.00 29.24 ? 208 THR D CA  1 
ATOM   7921 C C   . THR D 1 188 ? -30.023 -6.246  -0.114  1.00 29.24 ? 208 THR D C   1 
ATOM   7922 O O   . THR D 1 188 ? -29.273 -5.257  -0.082  1.00 29.24 ? 208 THR D O   1 
ATOM   7923 C CB  . THR D 1 188 ? -30.139 -6.896  2.311   1.00 27.84 ? 208 THR D CB  1 
ATOM   7924 O OG1 . THR D 1 188 ? -29.444 -8.122  2.047   1.00 27.84 ? 208 THR D OG1 1 
ATOM   7925 C CG2 . THR D 1 188 ? -30.971 -7.123  3.563   1.00 27.84 ? 208 THR D CG2 1 
ATOM   7926 N N   . VAL D 1 189 ? -30.025 -7.071  -1.142  1.00 32.81 ? 209 VAL D N   1 
ATOM   7927 C CA  . VAL D 1 189 ? -29.120 -6.924  -2.275  1.00 32.81 ? 209 VAL D CA  1 
ATOM   7928 C C   . VAL D 1 189 ? -29.603 -5.909  -3.296  1.00 32.81 ? 209 VAL D C   1 
ATOM   7929 O O   . VAL D 1 189 ? -30.720 -5.948  -3.819  1.00 32.81 ? 209 VAL D O   1 
ATOM   7930 C CB  . VAL D 1 189 ? -28.934 -8.275  -2.986  1.00 31.52 ? 209 VAL D CB  1 
ATOM   7931 C CG1 . VAL D 1 189 ? -27.859 -8.201  -4.035  1.00 31.52 ? 209 VAL D CG1 1 
ATOM   7932 C CG2 . VAL D 1 189 ? -28.543 -9.316  -1.951  1.00 31.52 ? 209 VAL D CG2 1 
ATOM   7933 N N   . ARG D 1 190 ? -28.736 -4.930  -3.562  1.00 36.20 ? 210 ARG D N   1 
ATOM   7934 C CA  . ARG D 1 190 ? -28.990 -3.879  -4.519  1.00 36.20 ? 210 ARG D CA  1 
ATOM   7935 C C   . ARG D 1 190 ? -27.855 -3.837  -5.543  1.00 36.20 ? 210 ARG D C   1 
ATOM   7936 O O   . ARG D 1 190 ? -26.684 -3.974  -5.181  1.00 36.20 ? 210 ARG D O   1 
ATOM   7937 C CB  . ARG D 1 190 ? -29.071 -2.517  -3.852  1.00 46.08 ? 210 ARG D CB  1 
ATOM   7938 C CG  . ARG D 1 190 ? -30.204 -2.470  -2.827  1.00 46.08 ? 210 ARG D CG  1 
ATOM   7939 C CD  . ARG D 1 190 ? -30.232 -1.130  -2.129  1.00 46.08 ? 210 ARG D CD  1 
ATOM   7940 N NE  . ARG D 1 190 ? -30.688 -0.117  -3.129  1.00 46.08 ? 210 ARG D NE  1 
ATOM   7941 C CZ  . ARG D 1 190 ? -31.916 0.428   -3.110  1.00 46.08 ? 210 ARG D CZ  1 
ATOM   7942 N NH1 . ARG D 1 190 ? -32.790 0.077   -2.161  1.00 46.08 ? 210 ARG D NH1 1 
ATOM   7943 N NH2 . ARG D 1 190 ? -32.284 1.343   -3.988  1.00 46.08 ? 210 ARG D NH2 1 
ATOM   7944 N N   . VAL D 1 191 ? -28.237 -3.662  -6.796  1.00 36.47 ? 211 VAL D N   1 
ATOM   7945 C CA  . VAL D 1 191 ? -27.349 -3.538  -7.912  1.00 36.47 ? 211 VAL D CA  1 
ATOM   7946 C C   . VAL D 1 191 ? -27.761 -2.357  -8.805  1.00 36.47 ? 211 VAL D C   1 
ATOM   7947 O O   . VAL D 1 191 ? -28.899 -2.219  -9.240  1.00 36.47 ? 211 VAL D O   1 
ATOM   7948 C CB  . VAL D 1 191 ? -27.313 -4.759  -8.866  1.00 36.01 ? 211 VAL D CB  1 
ATOM   7949 C CG1 . VAL D 1 191 ? -26.378 -5.828  -8.331  1.00 36.01 ? 211 VAL D CG1 1 
ATOM   7950 C CG2 . VAL D 1 191 ? -28.694 -5.338  -9.083  1.00 36.01 ? 211 VAL D CG2 1 
ATOM   7951 N N   . MET D 1 192 ? -26.829 -1.456  -9.091  1.00 35.24 ? 212 MET D N   1 
ATOM   7952 C CA  . MET D 1 192 ? -27.087 -0.303  -9.935  1.00 35.24 ? 212 MET D CA  1 
ATOM   7953 C C   . MET D 1 192 ? -28.273 0.553   -9.563  1.00 35.24 ? 212 MET D C   1 
ATOM   7954 O O   . MET D 1 192 ? -29.062 1.008   -10.406 1.00 35.24 ? 212 MET D O   1 
ATOM   7955 C CB  . MET D 1 192 ? -27.319 -0.872  -11.355 1.00 37.07 ? 212 MET D CB  1 
ATOM   7956 C CG  . MET D 1 192 ? -25.940 -1.334  -11.856 1.00 37.07 ? 212 MET D CG  1 
ATOM   7957 S SD  . MET D 1 192 ? -26.172 -2.005  -13.490 1.00 37.07 ? 212 MET D SD  1 
ATOM   7958 C CE  . MET D 1 192 ? -24.547 -2.505  -13.992 1.00 37.07 ? 212 MET D CE  1 
ATOM   7959 N N   . GLY D 1 193 ? -28.428 0.839   -8.296  1.00 35.22 ? 213 GLY D N   1 
ATOM   7960 C CA  . GLY D 1 193 ? -29.466 1.629   -7.709  1.00 35.22 ? 213 GLY D CA  1 
ATOM   7961 C C   . GLY D 1 193 ? -30.804 0.971   -7.506  1.00 35.22 ? 213 GLY D C   1 
ATOM   7962 O O   . GLY D 1 193 ? -31.685 1.592   -6.867  1.00 35.22 ? 213 GLY D O   1 
ATOM   7963 N N   . GLN D 1 194 ? -30.994 -0.225  -7.987  1.00 36.74 ? 214 GLN D N   1 
ATOM   7964 C CA  . GLN D 1 194 ? -32.214 -0.989  -7.926  1.00 36.74 ? 214 GLN D CA  1 
ATOM   7965 C C   . GLN D 1 194 ? -32.101 -2.249  -7.083  1.00 36.74 ? 214 GLN D C   1 
ATOM   7966 O O   . GLN D 1 194 ? -31.156 -3.047  -7.152  1.00 36.74 ? 214 GLN D O   1 
ATOM   7967 C CB  . GLN D 1 194 ? -32.586 -1.451  -9.353  1.00 39.30 ? 214 GLN D CB  1 
ATOM   7968 C CG  . GLN D 1 194 ? -32.847 -0.284  -10.327 1.00 39.30 ? 214 GLN D CG  1 
ATOM   7969 C CD  . GLN D 1 194 ? -34.160 0.381   -9.893  1.00 39.30 ? 214 GLN D CD  1 
ATOM   7970 O OE1 . GLN D 1 194 ? -35.207 -0.167  -10.245 1.00 39.30 ? 214 GLN D OE1 1 
ATOM   7971 N NE2 . GLN D 1 194 ? -34.092 1.438   -9.134  1.00 39.30 ? 214 GLN D NE2 1 
ATOM   7972 N N   . PRO D 1 195 ? -33.131 -2.470  -6.284  1.00 37.03 ? 215 PRO D N   1 
ATOM   7973 C CA  . PRO D 1 195 ? -33.222 -3.678  -5.455  1.00 37.03 ? 215 PRO D CA  1 
ATOM   7974 C C   . PRO D 1 195 ? -33.219 -4.857  -6.401  1.00 37.03 ? 215 PRO D C   1 
ATOM   7975 O O   . PRO D 1 195 ? -34.094 -4.850  -7.298  1.00 37.03 ? 215 PRO D O   1 
ATOM   7976 C CB  . PRO D 1 195 ? -34.501 -3.531  -4.668  1.00 37.18 ? 215 PRO D CB  1 
ATOM   7977 C CG  . PRO D 1 195 ? -34.807 -2.047  -4.775  1.00 37.18 ? 215 PRO D CG  1 
ATOM   7978 C CD  . PRO D 1 195 ? -34.292 -1.618  -6.154  1.00 37.18 ? 215 PRO D CD  1 
ATOM   7979 N N   . ILE D 1 196 ? -32.335 -5.840  -6.277  1.00 37.69 ? 216 ILE D N   1 
ATOM   7980 C CA  . ILE D 1 196 ? -32.316 -6.938  -7.261  1.00 37.69 ? 216 ILE D CA  1 
ATOM   7981 C C   . ILE D 1 196 ? -33.604 -7.706  -7.343  1.00 37.69 ? 216 ILE D C   1 
ATOM   7982 O O   . ILE D 1 196 ? -33.858 -8.331  -8.397  1.00 37.69 ? 216 ILE D O   1 
ATOM   7983 C CB  . ILE D 1 196 ? -31.145 -7.898  -6.970  1.00 35.81 ? 216 ILE D CB  1 
ATOM   7984 C CG1 . ILE D 1 196 ? -30.823 -8.748  -8.193  1.00 35.81 ? 216 ILE D CG1 1 
ATOM   7985 C CG2 . ILE D 1 196 ? -31.455 -8.841  -5.797  1.00 35.81 ? 216 ILE D CG2 1 
ATOM   7986 C CD1 . ILE D 1 196 ? -29.468 -9.390  -8.219  1.00 35.81 ? 216 ILE D CD1 1 
ATOM   7987 N N   . VAL D 1 197 ? -34.471 -7.781  -6.346  1.00 42.22 ? 217 VAL D N   1 
ATOM   7988 C CA  . VAL D 1 197 ? -35.723 -8.557  -6.454  1.00 42.22 ? 217 VAL D CA  1 
ATOM   7989 C C   . VAL D 1 197 ? -36.555 -7.993  -7.602  1.00 42.22 ? 217 VAL D C   1 
ATOM   7990 O O   . VAL D 1 197 ? -37.002 -8.722  -8.488  1.00 42.22 ? 217 VAL D O   1 
ATOM   7991 C CB  . VAL D 1 197 ? -36.543 -8.553  -5.164  1.00 43.04 ? 217 VAL D CB  1 
ATOM   7992 C CG1 . VAL D 1 197 ? -36.035 -9.585  -4.164  1.00 43.04 ? 217 VAL D CG1 1 
ATOM   7993 C CG2 . VAL D 1 197 ? -36.491 -7.160  -4.514  1.00 43.04 ? 217 VAL D CG2 1 
ATOM   7994 N N   . THR D 1 198 ? -36.720 -6.648  -7.661  1.00 46.30 ? 218 THR D N   1 
ATOM   7995 C CA  . THR D 1 198 ? -37.488 -6.047  -8.754  1.00 46.30 ? 218 THR D CA  1 
ATOM   7996 C C   . THR D 1 198 ? -36.841 -6.418  -10.063 1.00 46.30 ? 218 THR D C   1 
ATOM   7997 O O   . THR D 1 198 ? -37.562 -6.860  -10.972 1.00 46.30 ? 218 THR D O   1 
ATOM   7998 C CB  . THR D 1 198 ? -37.593 -4.526  -8.636  1.00 46.02 ? 218 THR D CB  1 
ATOM   7999 O OG1 . THR D 1 198 ? -36.261 -3.988  -8.681  1.00 46.02 ? 218 THR D OG1 1 
ATOM   8000 C CG2 . THR D 1 198 ? -38.237 -4.072  -7.336  1.00 46.02 ? 218 THR D CG2 1 
ATOM   8001 N N   . LEU D 1 199 ? -35.519 -6.381  -10.236 1.00 50.23 ? 219 LEU D N   1 
ATOM   8002 C CA  . LEU D 1 199 ? -34.925 -6.771  -11.512 1.00 50.23 ? 219 LEU D CA  1 
ATOM   8003 C C   . LEU D 1 199 ? -35.226 -8.226  -11.840 1.00 50.23 ? 219 LEU D C   1 
ATOM   8004 O O   . LEU D 1 199 ? -35.183 -8.579  -13.009 1.00 50.23 ? 219 LEU D O   1 
ATOM   8005 C CB  . LEU D 1 199 ? -33.411 -6.609  -11.558 1.00 49.24 ? 219 LEU D CB  1 
ATOM   8006 C CG  . LEU D 1 199 ? -32.759 -5.342  -11.033 1.00 49.24 ? 219 LEU D CG  1 
ATOM   8007 C CD1 . LEU D 1 199 ? -31.283 -5.316  -11.438 1.00 49.24 ? 219 LEU D CD1 1 
ATOM   8008 C CD2 . LEU D 1 199 ? -33.395 -4.058  -11.524 1.00 49.24 ? 219 LEU D CD2 1 
ATOM   8009 N N   . ALA D 1 200 ? -35.476 -9.055  -10.876 1.00 57.32 ? 220 ALA D N   1 
ATOM   8010 C CA  . ALA D 1 200 ? -35.821 -10.452 -11.004 1.00 57.32 ? 220 ALA D CA  1 
ATOM   8011 C C   . ALA D 1 200 ? -37.275 -10.567 -11.448 1.00 57.32 ? 220 ALA D C   1 
ATOM   8012 O O   . ALA D 1 200 ? -37.614 -11.400 -12.296 1.00 57.32 ? 220 ALA D O   1 
ATOM   8013 C CB  . ALA D 1 200 ? -35.618 -11.161 -9.671  1.00 56.82 ? 220 ALA D CB  1 
ATOM   8014 N N   . ASP D 1 201 ? -38.142 -9.678  -10.940 1.00 62.78 ? 221 ASP D N   1 
ATOM   8015 C CA  . ASP D 1 201 ? -39.537 -9.658  -11.368 1.00 62.78 ? 221 ASP D CA  1 
ATOM   8016 C C   . ASP D 1 201 ? -39.558 -9.397  -12.898 1.00 62.78 ? 221 ASP D C   1 
ATOM   8017 O O   . ASP D 1 201 ? -40.406 -9.974  -13.583 1.00 62.78 ? 221 ASP D O   1 
ATOM   8018 C CB  . ASP D 1 201 ? -40.384 -8.593  -10.705 1.00 64.43 ? 221 ASP D CB  1 
ATOM   8019 C CG  . ASP D 1 201 ? -40.458 -8.776  -9.200  1.00 64.43 ? 221 ASP D CG  1 
ATOM   8020 O OD1 . ASP D 1 201 ? -40.463 -9.937  -8.722  1.00 64.43 ? 221 ASP D OD1 1 
ATOM   8021 O OD2 . ASP D 1 201 ? -40.499 -7.720  -8.514  1.00 64.43 ? 221 ASP D OD2 1 
ATOM   8022 N N   . ALA D 1 202 ? -38.677 -8.569  -13.421 1.00 62.97 ? 222 ALA D N   1 
ATOM   8023 C CA  . ALA D 1 202 ? -38.579 -8.318  -14.844 1.00 62.97 ? 222 ALA D CA  1 
ATOM   8024 C C   . ALA D 1 202 ? -38.043 -9.558  -15.562 1.00 62.97 ? 222 ALA D C   1 
ATOM   8025 O O   . ALA D 1 202 ? -36.847 -9.874  -15.644 1.00 62.97 ? 222 ALA D O   1 
ATOM   8026 C CB  . ALA D 1 202 ? -37.681 -7.119  -15.114 1.00 63.09 ? 222 ALA D CB  1 
ATOM   8027 N N   . ILE D 1 205 ? -33.324 -11.675 -14.697 1.00 60.59 ? 225 ILE D N   1 
ATOM   8028 C CA  . ILE D 1 205 ? -32.290 -12.315 -13.834 1.00 60.59 ? 225 ILE D CA  1 
ATOM   8029 C C   . ILE D 1 205 ? -32.875 -13.386 -12.943 1.00 60.59 ? 225 ILE D C   1 
ATOM   8030 O O   . ILE D 1 205 ? -33.931 -13.236 -12.320 1.00 60.59 ? 225 ILE D O   1 
ATOM   8031 C CB  . ILE D 1 205 ? -31.543 -11.191 -13.063 1.00 61.06 ? 225 ILE D CB  1 
ATOM   8032 C CG1 . ILE D 1 205 ? -30.220 -11.779 -12.522 1.00 61.06 ? 225 ILE D CG1 1 
ATOM   8033 C CG2 . ILE D 1 205 ? -32.349 -10.581 -11.935 1.00 61.06 ? 225 ILE D CG2 1 
ATOM   8034 C CD1 . ILE D 1 205 ? -29.217 -12.057 -13.636 1.00 61.06 ? 225 ILE D CD1 1 
ATOM   8035 N N   . ASP D 1 206 ? -32.199 -14.541 -12.857 1.00 57.45 ? 226 ASP D N   1 
ATOM   8036 C CA  . ASP D 1 206 ? -32.622 -15.684 -12.049 1.00 57.45 ? 226 ASP D CA  1 
ATOM   8037 C C   . ASP D 1 206 ? -31.802 -15.795 -10.767 1.00 57.45 ? 226 ASP D C   1 
ATOM   8038 O O   . ASP D 1 206 ? -30.712 -16.368 -10.709 1.00 57.45 ? 226 ASP D O   1 
ATOM   8039 C CB  . ASP D 1 206 ? -32.478 -16.997 -12.829 1.00 59.87 ? 226 ASP D CB  1 
ATOM   8040 C CG  . ASP D 1 206 ? -33.096 -18.201 -12.129 1.00 59.87 ? 226 ASP D CG  1 
ATOM   8041 O OD1 . ASP D 1 206 ? -33.880 -18.051 -11.153 1.00 59.87 ? 226 ASP D OD1 1 
ATOM   8042 O OD2 . ASP D 1 206 ? -32.802 -19.363 -12.541 1.00 59.87 ? 226 ASP D OD2 1 
ATOM   8043 N N   . LEU D 1 207 ? -32.360 -15.257 -9.681  1.00 53.72 ? 227 LEU D N   1 
ATOM   8044 C CA  . LEU D 1 207 ? -31.688 -15.269 -8.391  1.00 53.72 ? 227 LEU D CA  1 
ATOM   8045 C C   . LEU D 1 207 ? -31.277 -16.649 -7.953  1.00 53.72 ? 227 LEU D C   1 
ATOM   8046 O O   . LEU D 1 207 ? -30.176 -16.841 -7.427  1.00 53.72 ? 227 LEU D O   1 
ATOM   8047 C CB  . LEU D 1 207 ? -32.596 -14.684 -7.315  1.00 50.78 ? 227 LEU D CB  1 
ATOM   8048 C CG  . LEU D 1 207 ? -32.968 -13.226 -7.544  1.00 50.78 ? 227 LEU D CG  1 
ATOM   8049 C CD1 . LEU D 1 207 ? -33.695 -12.720 -6.312  1.00 50.78 ? 227 LEU D CD1 1 
ATOM   8050 C CD2 . LEU D 1 207 ? -31.752 -12.367 -7.852  1.00 50.78 ? 227 LEU D CD2 1 
ATOM   8051 N N   . ALA D 1 208 ? -32.135 -17.645 -8.158  1.00 52.88 ? 228 ALA D N   1 
ATOM   8052 C CA  . ALA D 1 208 ? -31.863 -19.037 -7.772  1.00 52.88 ? 228 ALA D CA  1 
ATOM   8053 C C   . ALA D 1 208 ? -30.587 -19.531 -8.408  1.00 52.88 ? 228 ALA D C   1 
ATOM   8054 O O   . ALA D 1 208 ? -29.758 -20.151 -7.758  1.00 52.88 ? 228 ALA D O   1 
ATOM   8055 C CB  . ALA D 1 208 ? -33.015 -19.942 -8.195  1.00 54.20 ? 228 ALA D CB  1 
ATOM   8056 N N   . ALA D 1 209 ? -30.417 -19.244 -9.700  1.00 51.08 ? 229 ALA D N   1 
ATOM   8057 C CA  . ALA D 1 209 ? -29.241 -19.606 -10.446 1.00 51.08 ? 229 ALA D CA  1 
ATOM   8058 C C   . ALA D 1 209 ? -28.035 -18.878 -9.845  1.00 51.08 ? 229 ALA D C   1 
ATOM   8059 O O   . ALA D 1 209 ? -26.994 -19.492 -9.649  1.00 51.08 ? 229 ALA D O   1 
ATOM   8060 C CB  . ALA D 1 209 ? -29.405 -19.213 -11.902 1.00 51.17 ? 229 ALA D CB  1 
ATOM   8061 N N   . ILE D 1 210 ? -28.221 -17.587 -9.534  1.00 48.72 ? 230 ILE D N   1 
ATOM   8062 C CA  . ILE D 1 210 ? -27.138 -16.805 -8.922  1.00 48.72 ? 230 ILE D CA  1 
ATOM   8063 C C   . ILE D 1 210 ? -26.755 -17.445 -7.590  1.00 48.72 ? 230 ILE D C   1 
ATOM   8064 O O   . ILE D 1 210 ? -25.580 -17.736 -7.369  1.00 48.72 ? 230 ILE D O   1 
ATOM   8065 C CB  . ILE D 1 210 ? -27.518 -15.339 -8.691  1.00 47.29 ? 230 ILE D CB  1 
ATOM   8066 C CG1 . ILE D 1 210 ? -27.599 -14.599 -10.038 1.00 47.29 ? 230 ILE D CG1 1 
ATOM   8067 C CG2 . ILE D 1 210 ? -26.489 -14.642 -7.812  1.00 47.29 ? 230 ILE D CG2 1 
ATOM   8068 C CD1 . ILE D 1 210 ? -28.391 -13.314 -9.967  1.00 47.29 ? 230 ILE D CD1 1 
ATOM   8069 N N   . GLU D 1 211 ? -27.739 -17.723 -6.738  1.00 49.87 ? 231 GLU D N   1 
ATOM   8070 C CA  . GLU D 1 211 ? -27.471 -18.347 -5.450  1.00 49.87 ? 231 GLU D CA  1 
ATOM   8071 C C   . GLU D 1 211 ? -26.690 -19.637 -5.679  1.00 49.87 ? 231 GLU D C   1 
ATOM   8072 O O   . GLU D 1 211 ? -25.698 -19.910 -4.981  1.00 49.87 ? 231 GLU D O   1 
ATOM   8073 C CB  . GLU D 1 211 ? -28.772 -18.649 -4.687  1.00 52.52 ? 231 GLU D CB  1 
ATOM   8074 C CG  . GLU D 1 211 ? -28.566 -18.750 -3.187  1.00 52.52 ? 231 GLU D CG  1 
ATOM   8075 C CD  . GLU D 1 211 ? -29.747 -18.440 -2.304  1.00 52.52 ? 231 GLU D CD  1 
ATOM   8076 O OE1 . GLU D 1 211 ? -30.835 -18.045 -2.801  1.00 52.52 ? 231 GLU D OE1 1 
ATOM   8077 O OE2 . GLU D 1 211 ? -29.609 -18.566 -1.024  1.00 52.52 ? 231 GLU D OE2 1 
ATOM   8078 N N   . GLU D 1 212 ? -27.071 -20.461 -6.657  1.00 49.28 ? 232 GLU D N   1 
ATOM   8079 C CA  . GLU D 1 212 ? -26.389 -21.706 -6.945  1.00 49.28 ? 232 GLU D CA  1 
ATOM   8080 C C   . GLU D 1 212 ? -24.984 -21.481 -7.453  1.00 49.28 ? 232 GLU D C   1 
ATOM   8081 O O   . GLU D 1 212 ? -24.029 -22.167 -7.094  1.00 49.28 ? 232 GLU D O   1 
ATOM   8082 N N   . GLU D 1 213 ? -24.804 -20.495 -8.323  1.00 47.58 ? 233 GLU D N   1 
ATOM   8083 C CA  . GLU D 1 213 ? -23.504 -20.172 -8.881  1.00 47.58 ? 233 GLU D CA  1 
ATOM   8084 C C   . GLU D 1 213 ? -22.481 -19.874 -7.795  1.00 47.58 ? 233 GLU D C   1 
ATOM   8085 O O   . GLU D 1 213 ? -21.336 -20.299 -7.798  1.00 47.58 ? 233 GLU D O   1 
ATOM   8086 C CB  . GLU D 1 213 ? -23.595 -18.957 -9.788  1.00 52.98 ? 233 GLU D CB  1 
ATOM   8087 C CG  . GLU D 1 213 ? -22.295 -18.300 -10.192 1.00 52.98 ? 233 GLU D CG  1 
ATOM   8088 C CD  . GLU D 1 213 ? -21.283 -19.299 -10.747 1.00 52.98 ? 233 GLU D CD  1 
ATOM   8089 O OE1 . GLU D 1 213 ? -21.715 -20.288 -11.384 1.00 52.98 ? 233 GLU D OE1 1 
ATOM   8090 O OE2 . GLU D 1 213 ? -20.059 -19.107 -10.517 1.00 52.98 ? 233 GLU D OE2 1 
ATOM   8091 N N   . ALA D 1 214 ? -22.906 -19.055 -6.855  1.00 46.25 ? 234 ALA D N   1 
ATOM   8092 C CA  . ALA D 1 214 ? -22.060 -18.693 -5.730  1.00 46.25 ? 234 ALA D CA  1 
ATOM   8093 C C   . ALA D 1 214 ? -21.561 -19.943 -5.031  1.00 46.25 ? 234 ALA D C   1 
ATOM   8094 O O   . ALA D 1 214 ? -20.361 -20.112 -4.825  1.00 46.25 ? 234 ALA D O   1 
ATOM   8095 C CB  . ALA D 1 214 ? -22.867 -17.835 -4.758  1.00 45.25 ? 234 ALA D CB  1 
ATOM   8096 N N   . ARG D 1 215 ? -22.468 -20.852 -4.677  1.00 46.90 ? 235 ARG D N   1 
ATOM   8097 C CA  . ARG D 1 215 ? -22.132 -22.105 -3.996  1.00 46.90 ? 235 ARG D CA  1 
ATOM   8098 C C   . ARG D 1 215 ? -21.232 -23.006 -4.819  1.00 46.90 ? 235 ARG D C   1 
ATOM   8099 O O   . ARG D 1 215 ? -20.224 -23.534 -4.345  1.00 46.90 ? 235 ARG D O   1 
ATOM   8100 C CB  . ARG D 1 215 ? -23.435 -22.847 -3.654  1.00 47.88 ? 235 ARG D CB  1 
ATOM   8101 C CG  . ARG D 1 215 ? -24.291 -22.063 -2.638  1.00 47.88 ? 235 ARG D CG  1 
ATOM   8102 N N   . LYS D 1 216 ? -21.567 -23.173 -6.080  1.00 46.06 ? 236 LYS D N   1 
ATOM   8103 C CA  . LYS D 1 216 ? -20.777 -23.996 -6.984  1.00 46.06 ? 236 LYS D CA  1 
ATOM   8104 C C   . LYS D 1 216 ? -19.311 -23.603 -6.971  1.00 46.06 ? 236 LYS D C   1 
ATOM   8105 O O   . LYS D 1 216 ? -18.380 -24.423 -6.917  1.00 46.06 ? 236 LYS D O   1 
ATOM   8106 C CB  . LYS D 1 216 ? -21.350 -23.827 -8.398  1.00 46.02 ? 236 LYS D CB  1 
ATOM   8107 C CG  . LYS D 1 216 ? -20.739 -24.772 -9.410  1.00 46.02 ? 236 LYS D CG  1 
ATOM   8108 C CD  . LYS D 1 216 ? -21.352 -24.600 -10.793 1.00 46.02 ? 236 LYS D CD  1 
ATOM   8109 N N   . GLY D 1 217 ? -19.031 -22.281 -7.004  1.00 45.55 ? 237 GLY D N   1 
ATOM   8110 C CA  . GLY D 1 217 ? -17.680 -21.781 -6.973  1.00 45.55 ? 237 GLY D CA  1 
ATOM   8111 C C   . GLY D 1 217 ? -16.872 -22.328 -5.823  1.00 45.55 ? 237 GLY D C   1 
ATOM   8112 O O   . GLY D 1 217 ? -15.738 -22.803 -5.986  1.00 45.55 ? 237 GLY D O   1 
ATOM   8113 N N   . GLY D 1 218 ? -17.458 -22.320 -4.615  1.00 45.90 ? 238 GLY D N   1 
ATOM   8114 C CA  . GLY D 1 218 ? -16.791 -22.830 -3.416  1.00 45.90 ? 238 GLY D CA  1 
ATOM   8115 C C   . GLY D 1 218 ? -16.380 -24.275 -3.638  1.00 45.90 ? 238 GLY D C   1 
ATOM   8116 O O   . GLY D 1 218 ? -15.278 -24.700 -3.326  1.00 45.90 ? 238 GLY D O   1 
ATOM   8117 N N   . PHE D 1 219 ? -17.296 -25.031 -4.268  1.00 45.70 ? 239 PHE D N   1 
ATOM   8118 C CA  . PHE D 1 219 ? -17.000 -26.418 -4.574  1.00 45.70 ? 239 PHE D CA  1 
ATOM   8119 C C   . PHE D 1 219 ? -15.985 -26.535 -5.668  1.00 45.70 ? 239 PHE D C   1 
ATOM   8120 O O   . PHE D 1 219 ? -15.200 -27.498 -5.667  1.00 45.70 ? 239 PHE D O   1 
ATOM   8121 C CB  . PHE D 1 219 ? -18.307 -27.183 -4.972  1.00 51.89 ? 239 PHE D CB  1 
ATOM   8122 C CG  . PHE D 1 219 ? -19.038 -27.440 -3.649  1.00 51.89 ? 239 PHE D CG  1 
ATOM   8123 C CD1 . PHE D 1 219 ? -18.420 -28.218 -2.677  1.00 51.89 ? 239 PHE D CD1 1 
ATOM   8124 C CD2 . PHE D 1 219 ? -20.267 -26.868 -3.400  1.00 51.89 ? 239 PHE D CD2 1 
ATOM   8125 C CE1 . PHE D 1 219 ? -19.036 -28.425 -1.461  1.00 51.89 ? 239 PHE D CE1 1 
ATOM   8126 C CE2 . PHE D 1 219 ? -20.901 -27.069 -2.187  1.00 51.89 ? 239 PHE D CE2 1 
ATOM   8127 C CZ  . PHE D 1 219 ? -20.282 -27.850 -1.213  1.00 51.89 ? 239 PHE D CZ  1 
ATOM   8128 N N   . THR D 1 220 ? -15.941 -25.565 -6.577  1.00 40.69 ? 240 THR D N   1 
ATOM   8129 C CA  . THR D 1 220 ? -14.932 -25.602 -7.641  1.00 40.69 ? 240 THR D CA  1 
ATOM   8130 C C   . THR D 1 220 ? -13.546 -25.399 -7.040  1.00 40.69 ? 240 THR D C   1 
ATOM   8131 O O   . THR D 1 220 ? -12.583 -26.038 -7.492  1.00 40.69 ? 240 THR D O   1 
ATOM   8132 C CB  . THR D 1 220 ? -15.176 -24.545 -8.716  1.00 40.49 ? 240 THR D CB  1 
ATOM   8133 O OG1 . THR D 1 220 ? -16.500 -24.729 -9.215  1.00 40.49 ? 240 THR D OG1 1 
ATOM   8134 C CG2 . THR D 1 220 ? -14.150 -24.686 -9.842  1.00 40.49 ? 240 THR D CG2 1 
ATOM   8135 N N   . VAL D 1 221 ? -13.453 -24.518 -6.050  1.00 37.26 ? 241 VAL D N   1 
ATOM   8136 C CA  . VAL D 1 221 ? -12.200 -24.242 -5.372  1.00 37.26 ? 241 VAL D CA  1 
ATOM   8137 C C   . VAL D 1 221 ? -11.754 -25.461 -4.576  1.00 37.26 ? 241 VAL D C   1 
ATOM   8138 O O   . VAL D 1 221 ? -10.620 -25.953 -4.671  1.00 37.26 ? 241 VAL D O   1 
ATOM   8139 C CB  . VAL D 1 221 ? -12.327 -23.027 -4.427  1.00 35.23 ? 241 VAL D CB  1 
ATOM   8140 C CG1 . VAL D 1 221 ? -11.036 -22.732 -3.668  1.00 35.23 ? 241 VAL D CG1 1 
ATOM   8141 C CG2 . VAL D 1 221 ? -12.711 -21.770 -5.196  1.00 35.23 ? 241 VAL D CG2 1 
ATOM   8142 N N   . LEU D 1 222 ? -12.655 -26.051 -3.787  1.00 39.51 ? 242 LEU D N   1 
ATOM   8143 C CA  . LEU D 1 222 ? -12.282 -27.229 -3.000  1.00 39.51 ? 242 LEU D CA  1 
ATOM   8144 C C   . LEU D 1 222 ? -11.805 -28.370 -3.887  1.00 39.51 ? 242 LEU D C   1 
ATOM   8145 O O   . LEU D 1 222 ? -10.834 -29.046 -3.586  1.00 39.51 ? 242 LEU D O   1 
ATOM   8146 C CB  . LEU D 1 222 ? -13.452 -27.744 -2.148  1.00 40.17 ? 242 LEU D CB  1 
ATOM   8147 C CG  . LEU D 1 222 ? -13.810 -26.812 -0.995  1.00 40.17 ? 242 LEU D CG  1 
ATOM   8148 C CD1 . LEU D 1 222 ? -15.099 -27.239 -0.310  1.00 40.17 ? 242 LEU D CD1 1 
ATOM   8149 C CD2 . LEU D 1 222 ? -12.672 -26.807 0.027   1.00 40.17 ? 242 LEU D CD2 1 
ATOM   8150 N N   . ASN D 1 223 ? -12.501 -28.605 -5.002  1.00 42.52 ? 243 ASN D N   1 
ATOM   8151 C CA  . ASN D 1 223 ? -12.089 -29.708 -5.871  1.00 42.52 ? 243 ASN D CA  1 
ATOM   8152 C C   . ASN D 1 223 ? -10.811 -29.417 -6.604  1.00 42.52 ? 243 ASN D C   1 
ATOM   8153 O O   . ASN D 1 223 ? -10.079 -30.383 -6.886  1.00 42.52 ? 243 ASN D O   1 
ATOM   8154 C CB  . ASN D 1 223 ? -13.240 -30.039 -6.848  1.00 50.61 ? 243 ASN D CB  1 
ATOM   8155 C CG  . ASN D 1 223 ? -12.776 -30.683 -8.147  1.00 50.61 ? 243 ASN D CG  1 
ATOM   8156 O OD1 . ASN D 1 223 ? -12.626 -31.931 -8.189  1.00 50.61 ? 243 ASN D OD1 1 
ATOM   8157 N ND2 . ASN D 1 223 ? -12.514 -29.865 -9.176  1.00 50.61 ? 243 ASN D ND2 1 
ATOM   8158 N N   . GLY D 1 224 ? -10.491 -28.181 -6.977  1.00 38.64 ? 244 GLY D N   1 
ATOM   8159 C CA  . GLY D 1 224 ? -9.245  -28.005 -7.692  1.00 38.64 ? 244 GLY D CA  1 
ATOM   8160 C C   . GLY D 1 224 ? -8.020  -27.873 -6.815  1.00 38.64 ? 244 GLY D C   1 
ATOM   8161 O O   . GLY D 1 224 ? -6.897  -28.159 -7.254  1.00 38.64 ? 244 GLY D O   1 
ATOM   8162 N N   . LYS D 1 225 ? -8.197  -27.433 -5.584  1.00 36.24 ? 245 LYS D N   1 
ATOM   8163 C CA  . LYS D 1 225 ? -7.040  -27.180 -4.681  1.00 36.24 ? 245 LYS D CA  1 
ATOM   8164 C C   . LYS D 1 225 ? -7.095  -28.008 -3.436  1.00 36.24 ? 245 LYS D C   1 
ATOM   8165 O O   . LYS D 1 225 ? -6.087  -28.318 -2.792  1.00 36.24 ? 245 LYS D O   1 
ATOM   8166 C CB  . LYS D 1 225 ? -7.087  -25.698 -4.417  1.00 34.24 ? 245 LYS D CB  1 
ATOM   8167 C CG  . LYS D 1 225 ? -6.164  -24.854 -3.663  1.00 34.24 ? 245 LYS D CG  1 
ATOM   8168 C CD  . LYS D 1 225 ? -6.877  -23.541 -3.352  1.00 34.24 ? 245 LYS D CD  1 
ATOM   8169 C CE  . LYS D 1 225 ? -6.011  -22.325 -3.381  1.00 34.24 ? 245 LYS D CE  1 
ATOM   8170 N NZ  . LYS D 1 225 ? -6.750  -21.089 -2.951  1.00 34.24 ? 245 LYS D NZ  1 
ATOM   8171 N N   . GLY D 1 226 ? -8.311  -28.412 -3.043  1.00 36.78 ? 246 GLY D N   1 
ATOM   8172 C CA  . GLY D 1 226 ? -8.545  -29.211 -1.853  1.00 36.78 ? 246 GLY D CA  1 
ATOM   8173 C C   . GLY D 1 226 ? -8.898  -28.347 -0.659  1.00 36.78 ? 246 GLY D C   1 
ATOM   8174 O O   . GLY D 1 226 ? -9.092  -28.870 0.449   1.00 36.78 ? 246 GLY D O   1 
ATOM   8175 N N   . TYR D 1 227 ? -8.941  -27.045 -0.750  1.00 33.88 ? 247 TYR D N   1 
ATOM   8176 C CA  . TYR D 1 227 ? -9.234  -26.149 0.334   1.00 33.88 ? 247 TYR D CA  1 
ATOM   8177 C C   . TYR D 1 227 ? -9.393  -24.751 -0.270  1.00 33.88 ? 247 TYR D C   1 
ATOM   8178 O O   . TYR D 1 227 ? -9.044  -24.603 -1.417  1.00 33.88 ? 247 TYR D O   1 
ATOM   8179 C CB  . TYR D 1 227 ? -8.077  -26.056 1.338   1.00 34.78 ? 247 TYR D CB  1 
ATOM   8180 C CG  . TYR D 1 227 ? -6.792  -25.593 0.680   1.00 34.78 ? 247 TYR D CG  1 
ATOM   8181 C CD1 . TYR D 1 227 ? -5.919  -26.513 0.123   1.00 34.78 ? 247 TYR D CD1 1 
ATOM   8182 C CD2 . TYR D 1 227 ? -6.450  -24.250 0.612   1.00 34.78 ? 247 TYR D CD2 1 
ATOM   8183 C CE1 . TYR D 1 227 ? -4.764  -26.114 -0.501  1.00 34.78 ? 247 TYR D CE1 1 
ATOM   8184 C CE2 . TYR D 1 227 ? -5.294  -23.832 -0.015  1.00 34.78 ? 247 TYR D CE2 1 
ATOM   8185 C CZ  . TYR D 1 227 ? -4.450  -24.785 -0.564  1.00 34.78 ? 247 TYR D CZ  1 
ATOM   8186 O OH  . TYR D 1 227 ? -3.296  -24.363 -1.215  1.00 34.78 ? 247 TYR D OH  1 
ATOM   8187 N N   . THR D 1 228 ? -9.861  -23.819 0.521   1.00 29.19 ? 248 THR D N   1 
ATOM   8188 C CA  . THR D 1 228 ? -10.013 -22.424 0.121   1.00 29.19 ? 248 THR D CA  1 
ATOM   8189 C C   . THR D 1 228 ? -9.123  -21.603 1.068   1.00 29.19 ? 248 THR D C   1 
ATOM   8190 O O   . THR D 1 228 ? -9.035  -21.949 2.260   1.00 29.19 ? 248 THR D O   1 
ATOM   8191 C CB  . THR D 1 228 ? -11.438 -21.879 0.174   1.00 29.04 ? 248 THR D CB  1 
ATOM   8192 O OG1 . THR D 1 228 ? -11.895 -21.652 1.509   1.00 29.04 ? 248 THR D OG1 1 
ATOM   8193 C CG2 . THR D 1 228 ? -12.413 -22.832 -0.503  1.00 29.04 ? 248 THR D CG2 1 
ATOM   8194 N N   . SER D 1 229 ? -8.436  -20.589 0.585   1.00 21.59 ? 249 SER D N   1 
ATOM   8195 C CA  . SER D 1 229 ? -7.578  -19.787 1.454   1.00 21.59 ? 249 SER D CA  1 
ATOM   8196 C C   . SER D 1 229 ? -7.714  -18.295 1.279   1.00 21.59 ? 249 SER D C   1 
ATOM   8197 O O   . SER D 1 229 ? -8.023  -17.566 2.229   1.00 21.59 ? 249 SER D O   1 
ATOM   8198 C CB  . SER D 1 229 ? -6.115  -20.177 1.248   1.00 19.58 ? 249 SER D CB  1 
ATOM   8199 O OG  . SER D 1 229 ? -5.743  -20.213 -0.083  1.00 19.58 ? 249 SER D OG  1 
ATOM   8200 N N   . TYR D 1 230 ? -7.482  -17.783 0.066   1.00 18.05 ? 250 TYR D N   1 
ATOM   8201 C CA  . TYR D 1 230 ? -7.543  -16.311 -0.182  1.00 18.05 ? 250 TYR D CA  1 
ATOM   8202 C C   . TYR D 1 230 ? -8.856  -15.691 0.142   1.00 18.05 ? 250 TYR D C   1 
ATOM   8203 O O   . TYR D 1 230 ? -8.879  -14.607 0.760   1.00 18.05 ? 250 TYR D O   1 
ATOM   8204 C CB  . TYR D 1 230 ? -7.175  -16.046 -1.652  1.00 16.06 ? 250 TYR D CB  1 
ATOM   8205 C CG  . TYR D 1 230 ? -5.902  -16.764 -2.046  1.00 16.06 ? 250 TYR D CG  1 
ATOM   8206 C CD1 . TYR D 1 230 ? -4.702  -16.506 -1.387  1.00 16.06 ? 250 TYR D CD1 1 
ATOM   8207 C CD2 . TYR D 1 230 ? -5.930  -17.735 -3.036  1.00 16.06 ? 250 TYR D CD2 1 
ATOM   8208 C CE1 . TYR D 1 230 ? -3.555  -17.185 -1.721  1.00 16.06 ? 250 TYR D CE1 1 
ATOM   8209 C CE2 . TYR D 1 230 ? -4.777  -18.440 -3.384  1.00 16.06 ? 250 TYR D CE2 1 
ATOM   8210 C CZ  . TYR D 1 230 ? -3.605  -18.132 -2.715  1.00 16.06 ? 250 TYR D CZ  1 
ATOM   8211 O OH  . TYR D 1 230 ? -2.465  -18.847 -3.060  1.00 16.06 ? 250 TYR D OH  1 
ATOM   8212 N N   . GLY D 1 231 ? -9.965  -16.307 -0.223  1.00 16.81 ? 251 GLY D N   1 
ATOM   8213 C CA  . GLY D 1 231 ? -11.290 -15.775 0.052   1.00 16.81 ? 251 GLY D CA  1 
ATOM   8214 C C   . GLY D 1 231 ? -11.565 -15.537 1.487   1.00 16.81 ? 251 GLY D C   1 
ATOM   8215 O O   . GLY D 1 231 ? -12.012 -14.455 1.908   1.00 16.81 ? 251 GLY D O   1 
ATOM   8216 N N   . VAL D 1 232 ? -11.311 -16.567 2.351   1.00 16.60 ? 252 VAL D N   1 
ATOM   8217 C CA  . VAL D 1 232 ? -11.560 -16.423 3.805   1.00 16.60 ? 252 VAL D CA  1 
ATOM   8218 C C   . VAL D 1 232 ? -10.464 -15.687 4.531   1.00 16.60 ? 252 VAL D C   1 
ATOM   8219 O O   . VAL D 1 232 ? -10.728 -14.934 5.498   1.00 16.60 ? 252 VAL D O   1 
ATOM   8220 C CB  . VAL D 1 232 ? -11.792 -17.805 4.476   1.00 15.63 ? 252 VAL D CB  1 
ATOM   8221 C CG1 . VAL D 1 232 ? -10.569 -18.667 4.584   1.00 15.63 ? 252 VAL D CG1 1 
ATOM   8222 C CG2 . VAL D 1 232 ? -12.343 -17.548 5.868   1.00 15.63 ? 252 VAL D CG2 1 
ATOM   8223 N N   . ALA D 1 233 ? -9.236  -15.755 4.026   1.00 15.63 ? 253 ALA D N   1 
ATOM   8224 C CA  . ALA D 1 233 ? -8.105  -15.049 4.668   1.00 15.63 ? 253 ALA D CA  1 
ATOM   8225 C C   . ALA D 1 233 ? -8.323  -13.564 4.577   1.00 15.63 ? 253 ALA D C   1 
ATOM   8226 O O   . ALA D 1 233 ? -8.174  -12.782 5.511   1.00 15.63 ? 253 ALA D O   1 
ATOM   8227 C CB  . ALA D 1 233 ? -6.790  -15.435 4.021   1.00 12.97 ? 253 ALA D CB  1 
ATOM   8228 N N   . THR D 1 234 ? -8.735  -13.139 3.348   1.00 16.52 ? 254 THR D N   1 
ATOM   8229 C CA  . THR D 1 234 ? -9.015  -11.705 3.129   1.00 16.52 ? 254 THR D CA  1 
ATOM   8230 C C   . THR D 1 234 ? -10.143 -11.234 3.985   1.00 16.52 ? 254 THR D C   1 
ATOM   8231 O O   . THR D 1 234 ? -10.110 -10.018 4.385   1.00 16.52 ? 254 THR D O   1 
ATOM   8232 C CB  . THR D 1 234 ? -9.297  -11.458 1.623   1.00 15.83 ? 254 THR D CB  1 
ATOM   8233 O OG1 . THR D 1 234 ? -8.153  -11.915 0.902   1.00 15.83 ? 254 THR D OG1 1 
ATOM   8234 C CG2 . THR D 1 234 ? -9.470  -9.988  1.379   1.00 15.83 ? 254 THR D CG2 1 
ATOM   8235 N N   . SER D 1 235 ? -11.164 -12.034 4.311   1.00 14.44 ? 255 SER D N   1 
ATOM   8236 C CA  . SER D 1 235 ? -12.239 -11.657 5.214   1.00 14.44 ? 255 SER D CA  1 
ATOM   8237 C C   . SER D 1 235 ? -11.699 -11.347 6.603   1.00 14.44 ? 255 SER D C   1 
ATOM   8238 O O   . SER D 1 235 ? -12.116 -10.387 7.214   1.00 14.44 ? 255 SER D O   1 
ATOM   8239 C CB  . SER D 1 235 ? -13.217 -12.804 5.483   1.00 16.32 ? 255 SER D CB  1 
ATOM   8240 O OG  . SER D 1 235 ? -13.688 -13.207 4.225   1.00 16.32 ? 255 SER D OG  1 
ATOM   8241 N N   . ALA D 1 236 ? -10.788 -12.168 7.109   1.00 13.68 ? 256 ALA D N   1 
ATOM   8242 C CA  . ALA D 1 236 ? -10.229 -11.971 8.447   1.00 13.68 ? 256 ALA D CA  1 
ATOM   8243 C C   . ALA D 1 236 ? -9.405  -10.713 8.503   1.00 13.68 ? 256 ALA D C   1 
ATOM   8244 O O   . ALA D 1 236 ? -9.505  -9.923  9.438   1.00 13.68 ? 256 ALA D O   1 
ATOM   8245 C CB  . ALA D 1 236 ? -9.353  -13.171 8.782   1.00 12.71 ? 256 ALA D CB  1 
ATOM   8246 N N   . ILE D 1 237 ? -8.612  -10.484 7.447   1.00 15.25 ? 257 ILE D N   1 
ATOM   8247 C CA  . ILE D 1 237 ? -7.764  -9.294  7.338   1.00 15.25 ? 257 ILE D CA  1 
ATOM   8248 C C   . ILE D 1 237 ? -8.588  -8.032  7.376   1.00 15.25 ? 257 ILE D C   1 
ATOM   8249 O O   . ILE D 1 237 ? -8.277  -7.062  8.068   1.00 15.25 ? 257 ILE D O   1 
ATOM   8250 C CB  . ILE D 1 237 ? -6.933  -9.343  6.037   1.00 13.15 ? 257 ILE D CB  1 
ATOM   8251 C CG1 . ILE D 1 237 ? -5.856  -10.396 6.199   1.00 13.15 ? 257 ILE D CG1 1 
ATOM   8252 C CG2 . ILE D 1 237 ? -6.306  -7.991  5.777   1.00 13.15 ? 257 ILE D CG2 1 
ATOM   8253 C CD1 . ILE D 1 237 ? -5.053  -10.796 5.004   1.00 13.15 ? 257 ILE D CD1 1 
ATOM   8254 N N   . ARG D 1 238 ? -9.688  -7.993  6.651   1.00 14.52 ? 258 ARG D N   1 
ATOM   8255 C CA  . ARG D 1 238 ? -10.577 -6.822  6.643   1.00 14.52 ? 258 ARG D CA  1 
ATOM   8256 C C   . ARG D 1 238 ? -11.135 -6.544  7.997   1.00 14.52 ? 258 ARG D C   1 
ATOM   8257 O O   . ARG D 1 238 ? -11.166 -5.402  8.469   1.00 14.52 ? 258 ARG D O   1 
ATOM   8258 C CB  . ARG D 1 238 ? -11.721 -7.091  5.642   1.00 14.95 ? 258 ARG D CB  1 
ATOM   8259 C CG  . ARG D 1 238 ? -12.561 -5.853  5.474   1.00 14.95 ? 258 ARG D CG  1 
ATOM   8260 C CD  . ARG D 1 238 ? -13.573 -6.047  4.355   1.00 14.95 ? 258 ARG D CD  1 
ATOM   8261 N NE  . ARG D 1 238 ? -14.439 -4.830  4.424   1.00 14.95 ? 258 ARG D NE  1 
ATOM   8262 C CZ  . ARG D 1 238 ? -15.552 -4.759  3.664   1.00 14.95 ? 258 ARG D CZ  1 
ATOM   8263 N NH1 . ARG D 1 238 ? -15.889 -5.838  2.934   1.00 14.95 ? 258 ARG D NH1 1 
ATOM   8264 N NH2 . ARG D 1 238 ? -16.261 -3.663  3.747   1.00 14.95 ? 258 ARG D NH2 1 
ATOM   8265 N N   . ILE D 1 239 ? -11.593 -7.544  8.743   1.00 13.69 ? 259 ILE D N   1 
ATOM   8266 C CA  . ILE D 1 239 ? -12.073 -7.390  10.108  1.00 13.69 ? 259 ILE D CA  1 
ATOM   8267 C C   . ILE D 1 239 ? -10.951 -6.909  11.002  1.00 13.69 ? 259 ILE D C   1 
ATOM   8268 O O   . ILE D 1 239 ? -11.113 -5.981  11.818  1.00 13.69 ? 259 ILE D O   1 
ATOM   8269 C CB  . ILE D 1 239 ? -12.597 -8.753  10.662  1.00 12.15 ? 259 ILE D CB  1 
ATOM   8270 C CG1 . ILE D 1 239 ? -13.780 -9.212  9.816   1.00 12.15 ? 259 ILE D CG1 1 
ATOM   8271 C CG2 . ILE D 1 239 ? -13.013 -8.651  12.119  1.00 12.15 ? 259 ILE D CG2 1 
ATOM   8272 C CD1 . ILE D 1 239 ? -14.260 -10.618 10.081  1.00 12.15 ? 259 ILE D CD1 1 
ATOM   8273 N N   . ALA D 1 240 ? -9.751  -7.480  10.859  1.00 13.59 ? 260 ALA D N   1 
ATOM   8274 C CA  . ALA D 1 240 ? -8.601  -7.087  11.679  1.00 13.59 ? 260 ALA D CA  1 
ATOM   8275 C C   . ALA D 1 240 ? -8.277  -5.625  11.513  1.00 13.59 ? 260 ALA D C   1 
ATOM   8276 O O   . ALA D 1 240 ? -8.003  -4.904  12.485  1.00 13.59 ? 260 ALA D O   1 
ATOM   8277 C CB  . ALA D 1 240 ? -7.396  -7.933  11.297  1.00 12.25 ? 260 ALA D CB  1 
ATOM   8278 N N   . LYS D 1 241 ? -8.275  -5.106  10.278  1.00 14.64 ? 261 LYS D N   1 
ATOM   8279 C CA  . LYS D 1 241 ? -8.032  -3.682  10.039  1.00 14.64 ? 261 LYS D CA  1 
ATOM   8280 C C   . LYS D 1 241 ? -9.097  -2.828  10.650  1.00 14.64 ? 261 LYS D C   1 
ATOM   8281 O O   . LYS D 1 241 ? -8.779  -1.797  11.271  1.00 14.64 ? 261 LYS D O   1 
ATOM   8282 C CB  . LYS D 1 241 ? -8.022  -3.395  8.527   1.00 17.24 ? 261 LYS D CB  1 
ATOM   8283 C CG  . LYS D 1 241 ? -6.691  -3.841  7.943   1.00 17.24 ? 261 LYS D CG  1 
ATOM   8284 C CD  . LYS D 1 241 ? -6.865  -3.830  6.413   1.00 17.24 ? 261 LYS D CD  1 
ATOM   8285 C CE  . LYS D 1 241 ? -5.448  -3.981  5.843   1.00 17.24 ? 261 LYS D CE  1 
ATOM   8286 N NZ  . LYS D 1 241 ? -5.597  -4.155  4.374   1.00 17.24 ? 261 LYS D NZ  1 
ATOM   8287 N N   . ALA D 1 242 ? -10.374 -3.201  10.550  1.00 12.48 ? 262 ALA D N   1 
ATOM   8288 C CA  . ALA D 1 242 ? -11.460 -2.413  11.143  1.00 12.48 ? 262 ALA D CA  1 
ATOM   8289 C C   . ALA D 1 242 ? -11.257 -2.340  12.625  1.00 12.48 ? 262 ALA D C   1 
ATOM   8290 O O   . ALA D 1 242 ? -11.527 -1.346  13.311  1.00 12.48 ? 262 ALA D O   1 
ATOM   8291 C CB  . ALA D 1 242 ? -12.799 -3.021  10.829  1.00 10.67 ? 262 ALA D CB  1 
ATOM   8292 N N   . VAL D 1 243 ? -10.726 -3.423  13.252  1.00 13.27 ? 263 VAL D N   1 
ATOM   8293 C CA  . VAL D 1 243 ? -10.493 -3.390  14.680  1.00 13.27 ? 263 VAL D CA  1 
ATOM   8294 C C   . VAL D 1 243 ? -9.367  -2.465  15.042  1.00 13.27 ? 263 VAL D C   1 
ATOM   8295 O O   . VAL D 1 243 ? -9.563  -1.545  15.856  1.00 13.27 ? 263 VAL D O   1 
ATOM   8296 C CB  . VAL D 1 243 ? -10.163 -4.820  15.198  1.00 12.09 ? 263 VAL D CB  1 
ATOM   8297 C CG1 . VAL D 1 243 ? -9.652  -4.797  16.624  1.00 12.09 ? 263 VAL D CG1 1 
ATOM   8298 C CG2 . VAL D 1 243 ? -11.376 -5.737  15.163  1.00 12.09 ? 263 VAL D CG2 1 
ATOM   8299 N N   . MET D 1 244 ? -8.176  -2.624  14.444  1.00 14.23 ? 264 MET D N   1 
ATOM   8300 C CA  . MET D 1 244 ? -7.046  -1.767  14.828  1.00 14.23 ? 264 MET D CA  1 
ATOM   8301 C C   . MET D 1 244 ? -7.275  -0.310  14.530  1.00 14.23 ? 264 MET D C   1 
ATOM   8302 O O   . MET D 1 244 ? -6.846  0.603   15.278  1.00 14.23 ? 264 MET D O   1 
ATOM   8303 C CB  . MET D 1 244 ? -5.756  -2.276  14.170  1.00 13.78 ? 264 MET D CB  1 
ATOM   8304 C CG  . MET D 1 244 ? -5.463  -3.751  14.447  1.00 13.78 ? 264 MET D CG  1 
ATOM   8305 S SD  . MET D 1 244 ? -3.839  -4.240  13.774  1.00 13.78 ? 264 MET D SD  1 
ATOM   8306 C CE  . MET D 1 244 ? -4.372  -4.507  12.044  1.00 13.78 ? 264 MET D CE  1 
ATOM   8307 N N   . ALA D 1 245 ? -7.990  0.002   13.433  1.00 14.85 ? 265 ALA D N   1 
ATOM   8308 C CA  . ALA D 1 245 ? -8.254  1.408   13.063  1.00 14.85 ? 265 ALA D CA  1 
ATOM   8309 C C   . ALA D 1 245 ? -9.428  1.965   13.806  1.00 14.85 ? 265 ALA D C   1 
ATOM   8310 O O   . ALA D 1 245 ? -9.733  3.133   13.715  1.00 14.85 ? 265 ALA D O   1 
ATOM   8311 C CB  . ALA D 1 245 ? -8.532  1.512   11.574  1.00 13.61 ? 265 ALA D CB  1 
ATOM   8312 N N   . ASP D 1 246 ? -10.146 1.125   14.543  1.00 15.68 ? 266 ASP D N   1 
ATOM   8313 C CA  . ASP D 1 246 ? -11.323 1.522   15.304  1.00 15.68 ? 266 ASP D CA  1 
ATOM   8314 C C   . ASP D 1 246 ? -12.281 2.201   14.353  1.00 15.68 ? 266 ASP D C   1 
ATOM   8315 O O   . ASP D 1 246 ? -12.844 3.259   14.645  1.00 15.68 ? 266 ASP D O   1 
ATOM   8316 C CB  . ASP D 1 246 ? -10.939 2.515   16.382  1.00 16.51 ? 266 ASP D CB  1 
ATOM   8317 C CG  . ASP D 1 246 ? -12.032 2.666   17.415  1.00 16.51 ? 266 ASP D CG  1 
ATOM   8318 O OD1 . ASP D 1 246 ? -12.951 1.816   17.476  1.00 16.51 ? 266 ASP D OD1 1 
ATOM   8319 O OD2 . ASP D 1 246 ? -12.011 3.651   18.144  1.00 16.51 ? 266 ASP D OD2 1 
ATOM   8320 N N   . ALA D 1 247 ? -12.504 1.545   13.221  1.00 15.62 ? 267 ALA D N   1 
ATOM   8321 C CA  . ALA D 1 247 ? -13.305 2.128   12.156  1.00 15.62 ? 267 ALA D CA  1 
ATOM   8322 C C   . ALA D 1 247 ? -14.756 2.339   12.391  1.00 15.62 ? 267 ALA D C   1 
ATOM   8323 O O   . ALA D 1 247 ? -15.351 3.301   11.838  1.00 15.62 ? 267 ALA D O   1 
ATOM   8324 C CB  . ALA D 1 247 ? -13.136 1.188   10.930  1.00 12.76 ? 267 ALA D CB  1 
ATOM   8325 N N   . HIS D 1 248 ? -15.401 1.491   13.193  1.00 16.41 ? 268 HIS D N   1 
ATOM   8326 C CA  . HIS D 1 248 ? -16.841 1.482   13.451  1.00 16.41 ? 268 HIS D CA  1 
ATOM   8327 C C   . HIS D 1 248 ? -17.497 1.151   12.105  1.00 16.41 ? 268 HIS D C   1 
ATOM   8328 O O   . HIS D 1 248 ? -18.494 1.754   11.737  1.00 16.41 ? 268 HIS D O   1 
ATOM   8329 C CB  . HIS D 1 248 ? -17.347 2.762   13.969  1.00 15.38 ? 268 HIS D CB  1 
ATOM   8330 C CG  . HIS D 1 248 ? -16.901 3.190   15.310  1.00 15.38 ? 268 HIS D CG  1 
ATOM   8331 N ND1 . HIS D 1 248 ? -17.802 3.717   16.215  1.00 15.38 ? 268 HIS D ND1 1 
ATOM   8332 C CD2 . HIS D 1 248 ? -15.681 3.190   15.905  1.00 15.38 ? 268 HIS D CD2 1 
ATOM   8333 C CE1 . HIS D 1 248 ? -17.149 4.046   17.325  1.00 15.38 ? 268 HIS D CE1 1 
ATOM   8334 N NE2 . HIS D 1 248 ? -15.877 3.745   17.159  1.00 15.38 ? 268 HIS D NE2 1 
ATOM   8335 N N   . ALA D 1 249 ? -16.921 0.179   11.424  1.00 16.35 ? 269 ALA D N   1 
ATOM   8336 C CA  . ALA D 1 249 ? -17.330 -0.292  10.125  1.00 16.35 ? 269 ALA D CA  1 
ATOM   8337 C C   . ALA D 1 249 ? -18.423 -1.338  10.214  1.00 16.35 ? 269 ALA D C   1 
ATOM   8338 O O   . ALA D 1 249 ? -18.381 -2.222  11.056  1.00 16.35 ? 269 ALA D O   1 
ATOM   8339 C CB  . ALA D 1 249 ? -16.132 -0.947  9.453   1.00 13.63 ? 269 ALA D CB  1 
ATOM   8340 N N   . GLU D 1 250 ? -19.429 -1.290  9.386   1.00 17.64 ? 270 GLU D N   1 
ATOM   8341 C CA  . GLU D 1 250 ? -20.498 -2.247  9.366   1.00 17.64 ? 270 GLU D CA  1 
ATOM   8342 C C   . GLU D 1 250 ? -20.038 -3.441  8.545   1.00 17.64 ? 270 GLU D C   1 
ATOM   8343 O O   . GLU D 1 250 ? -19.785 -3.336  7.368   1.00 17.64 ? 270 GLU D O   1 
ATOM   8344 C CB  . GLU D 1 250 ? -21.751 -1.666  8.770   1.00 20.63 ? 270 GLU D CB  1 
ATOM   8345 C CG  . GLU D 1 250 ? -22.916 -2.607  8.712   1.00 20.63 ? 270 GLU D CG  1 
ATOM   8346 C CD  . GLU D 1 250 ? -24.026 -1.989  7.876   1.00 20.63 ? 270 GLU D CD  1 
ATOM   8347 O OE1 . GLU D 1 250 ? -24.394 -0.809  8.083   1.00 20.63 ? 270 GLU D OE1 1 
ATOM   8348 O OE2 . GLU D 1 250 ? -24.495 -2.681  6.967   1.00 20.63 ? 270 GLU D OE2 1 
ATOM   8349 N N   . LEU D 1 251 ? -19.903 -4.577  9.252   1.00 18.40 ? 271 LEU D N   1 
ATOM   8350 C CA  . LEU D 1 251 ? -19.447 -5.825  8.642   1.00 18.40 ? 271 LEU D CA  1 
ATOM   8351 C C   . LEU D 1 251 ? -20.319 -6.991  9.110   1.00 18.40 ? 271 LEU D C   1 
ATOM   8352 O O   . LEU D 1 251 ? -20.829 -7.006  10.238  1.00 18.40 ? 271 LEU D O   1 
ATOM   8353 C CB  . LEU D 1 251 ? -17.992 -6.092  9.004   1.00 17.49 ? 271 LEU D CB  1 
ATOM   8354 C CG  . LEU D 1 251 ? -16.879 -5.173  8.508   1.00 17.49 ? 271 LEU D CG  1 
ATOM   8355 C CD1 . LEU D 1 251 ? -15.612 -5.292  9.338   1.00 17.49 ? 271 LEU D CD1 1 
ATOM   8356 C CD2 . LEU D 1 251 ? -16.562 -5.544  7.081   1.00 17.49 ? 271 LEU D CD2 1 
ATOM   8357 N N   . VAL D 1 252 ? -20.521 -7.943  8.211   1.00 19.81 ? 272 VAL D N   1 
ATOM   8358 C CA  . VAL D 1 252 ? -21.323 -9.106  8.567   1.00 19.81 ? 272 VAL D CA  1 
ATOM   8359 C C   . VAL D 1 252 ? -20.322 -10.116 9.094   1.00 19.81 ? 272 VAL D C   1 
ATOM   8360 O O   . VAL D 1 252 ? -19.412 -10.605 8.429   1.00 19.81 ? 272 VAL D O   1 
ATOM   8361 C CB  . VAL D 1 252 ? -22.150 -9.591  7.390   1.00 20.90 ? 272 VAL D CB  1 
ATOM   8362 C CG1 . VAL D 1 252 ? -21.254 -9.973  6.220   1.00 20.90 ? 272 VAL D CG1 1 
ATOM   8363 C CG2 . VAL D 1 252 ? -23.005 -10.800 7.766   1.00 20.90 ? 272 VAL D CG2 1 
ATOM   8364 N N   . VAL D 1 253 ? -20.370 -10.390 10.393  1.00 20.09 ? 273 VAL D N   1 
ATOM   8365 C CA  . VAL D 1 253 ? -19.507 -11.310 11.109  1.00 20.09 ? 273 VAL D CA  1 
ATOM   8366 C C   . VAL D 1 253 ? -20.332 -12.188 12.022  1.00 20.09 ? 273 VAL D C   1 
ATOM   8367 O O   . VAL D 1 253 ? -21.463 -11.829 12.399  1.00 20.09 ? 273 VAL D O   1 
ATOM   8368 C CB  . VAL D 1 253 ? -18.496 -10.589 12.032  1.00 17.38 ? 273 VAL D CB  1 
ATOM   8369 C CG1 . VAL D 1 253 ? -17.578 -9.642  11.283  1.00 17.38 ? 273 VAL D CG1 1 
ATOM   8370 C CG2 . VAL D 1 253 ? -19.229 -9.776  13.100  1.00 17.38 ? 273 VAL D CG2 1 
ATOM   8371 N N   . SER D 1 254 ? -19.770 -13.285 12.472  1.00 19.40 ? 274 SER D N   1 
ATOM   8372 C CA  . SER D 1 254 ? -20.499 -14.165 13.442  1.00 19.40 ? 274 SER D CA  1 
ATOM   8373 C C   . SER D 1 254 ? -20.446 -13.477 14.783  1.00 19.40 ? 274 SER D C   1 
ATOM   8374 O O   . SER D 1 254 ? -19.322 -13.385 15.309  1.00 19.40 ? 274 SER D O   1 
ATOM   8375 C CB  . SER D 1 254 ? -19.829 -15.520 13.445  1.00 19.94 ? 274 SER D CB  1 
ATOM   8376 O OG  . SER D 1 254 ? -20.610 -16.419 14.215  1.00 19.94 ? 274 SER D OG  1 
ATOM   8377 N N   . ASN D 1 255 ? -21.533 -12.941 15.297  1.00 20.01 ? 275 ASN D N   1 
ATOM   8378 C CA  . ASN D 1 255 ? -21.533 -12.254 16.575  1.00 20.01 ? 275 ASN D CA  1 
ATOM   8379 C C   . ASN D 1 255 ? -22.763 -12.665 17.389  1.00 20.01 ? 275 ASN D C   1 
ATOM   8380 O O   . ASN D 1 255 ? -23.662 -13.230 16.803  1.00 20.01 ? 275 ASN D O   1 
ATOM   8381 C CB  . ASN D 1 255 ? -21.599 -10.729 16.455  1.00 19.44 ? 275 ASN D CB  1 
ATOM   8382 C CG  . ASN D 1 255 ? -22.784 -10.187 15.727  1.00 19.44 ? 275 ASN D CG  1 
ATOM   8383 O OD1 . ASN D 1 255 ? -23.534 -9.354  16.266  1.00 19.44 ? 275 ASN D OD1 1 
ATOM   8384 N ND2 . ASN D 1 255 ? -23.007 -10.592 14.487  1.00 19.44 ? 275 ASN D ND2 1 
ATOM   8385 N N   . ARG D 1 256 ? -22.736 -12.400 18.674  1.00 26.86 ? 276 ARG D N   1 
ATOM   8386 C CA  . ARG D 1 256 ? -23.863 -12.807 19.499  1.00 26.86 ? 276 ARG D CA  1 
ATOM   8387 C C   . ARG D 1 256 ? -24.834 -11.683 19.830  1.00 26.86 ? 276 ARG D C   1 
ATOM   8388 O O   . ARG D 1 256 ? -24.560 -10.806 20.640  1.00 26.86 ? 276 ARG D O   1 
ATOM   8389 C CB  . ARG D 1 256 ? -23.353 -13.406 20.845  1.00 36.77 ? 276 ARG D CB  1 
ATOM   8390 C CG  . ARG D 1 256 ? -24.568 -14.174 21.396  1.00 36.77 ? 276 ARG D CG  1 
ATOM   8391 C CD  . ARG D 1 256 ? -24.167 -14.888 22.669  1.00 36.77 ? 276 ARG D CD  1 
ATOM   8392 N NE  . ARG D 1 256 ? -23.947 -13.850 23.704  1.00 36.77 ? 276 ARG D NE  1 
ATOM   8393 C CZ  . ARG D 1 256 ? -23.397 -14.197 24.878  1.00 36.77 ? 276 ARG D CZ  1 
ATOM   8394 N NH1 . ARG D 1 256 ? -23.035 -15.483 25.077  1.00 36.77 ? 276 ARG D NH1 1 
ATOM   8395 N NH2 . ARG D 1 256 ? -23.190 -13.279 25.834  1.00 36.77 ? 276 ARG D NH2 1 
ATOM   8396 N N   . ARG D 1 257 ? -26.004 -11.775 19.202  1.00 33.42 ? 277 ARG D N   1 
ATOM   8397 C CA  . ARG D 1 257 ? -27.015 -10.727 19.399  1.00 33.42 ? 277 ARG D CA  1 
ATOM   8398 C C   . ARG D 1 257 ? -27.864 -11.020 20.617  1.00 33.42 ? 277 ARG D C   1 
ATOM   8399 O O   . ARG D 1 257 ? -28.156 -12.205 20.915  1.00 33.42 ? 277 ARG D O   1 
ATOM   8400 C CB  . ARG D 1 257 ? -27.892 -10.647 18.148  1.00 32.89 ? 277 ARG D CB  1 
ATOM   8401 C CG  . ARG D 1 257 ? -27.239 -10.163 16.864  1.00 32.89 ? 277 ARG D CG  1 
ATOM   8402 C CD  . ARG D 1 257 ? -28.228 -10.297 15.697  1.00 32.89 ? 277 ARG D CD  1 
ATOM   8403 N NE  . ARG D 1 257 ? -29.412 -9.457  15.893  1.00 32.89 ? 277 ARG D NE  1 
ATOM   8404 C CZ  . ARG D 1 257 ? -29.512 -8.150  15.677  1.00 32.89 ? 277 ARG D CZ  1 
ATOM   8405 N NH1 . ARG D 1 257 ? -28.485 -7.433  15.245  1.00 32.89 ? 277 ARG D NH1 1 
ATOM   8406 N NH2 . ARG D 1 257 ? -30.662 -7.522  15.907  1.00 32.89 ? 277 ARG D NH2 1 
ATOM   8407 N N   . ASP D 1 258 ? -28.309 -9.983  21.327  1.00 40.52 ? 278 ASP D N   1 
ATOM   8408 C CA  . ASP D 1 258 ? -29.171 -10.230 22.502  1.00 40.52 ? 278 ASP D CA  1 
ATOM   8409 C C   . ASP D 1 258 ? -30.452 -10.916 22.081  1.00 40.52 ? 278 ASP D C   1 
ATOM   8410 O O   . ASP D 1 258 ? -30.829 -11.939 22.657  1.00 40.52 ? 278 ASP D O   1 
ATOM   8411 C CB  . ASP D 1 258 ? -29.510 -8.935  23.216  1.00 45.24 ? 278 ASP D CB  1 
ATOM   8412 C CG  . ASP D 1 258 ? -28.293 -8.285  23.845  1.00 45.24 ? 278 ASP D CG  1 
ATOM   8413 O OD1 . ASP D 1 258 ? -27.504 -8.962  24.543  1.00 45.24 ? 278 ASP D OD1 1 
ATOM   8414 O OD2 . ASP D 1 258 ? -28.116 -7.059  23.628  1.00 45.24 ? 278 ASP D OD2 1 
ATOM   8415 N N   . ASP D 1 259 ? -31.096 -10.461 21.028  1.00 40.81 ? 279 ASP D N   1 
ATOM   8416 C CA  . ASP D 1 259 ? -32.314 -11.066 20.522  1.00 40.81 ? 279 ASP D CA  1 
ATOM   8417 C C   . ASP D 1 259 ? -32.087 -12.483 20.042  1.00 40.81 ? 279 ASP D C   1 
ATOM   8418 O O   . ASP D 1 259 ? -33.095 -13.218 19.968  1.00 40.81 ? 279 ASP D O   1 
ATOM   8419 C CB  . ASP D 1 259 ? -32.900 -10.242 19.364  1.00 44.48 ? 279 ASP D CB  1 
ATOM   8420 C CG  . ASP D 1 259 ? -31.934 -9.901  18.267  1.00 44.48 ? 279 ASP D CG  1 
ATOM   8421 O OD1 . ASP D 1 259 ? -30.981 -9.107  18.522  1.00 44.48 ? 279 ASP D OD1 1 
ATOM   8422 O OD2 . ASP D 1 259 ? -32.128 -10.356 17.115  1.00 44.48 ? 279 ASP D OD2 1 
ATOM   8423 N N   . MET D 1 260 ? -30.895 -12.912 19.697  1.00 36.97 ? 280 MET D N   1 
ATOM   8424 C CA  . MET D 1 260 ? -30.711 -14.287 19.267  1.00 36.97 ? 280 MET D CA  1 
ATOM   8425 C C   . MET D 1 260 ? -30.166 -15.155 20.408  1.00 36.97 ? 280 MET D C   1 
ATOM   8426 O O   . MET D 1 260 ? -30.385 -16.368 20.424  1.00 36.97 ? 280 MET D O   1 
ATOM   8427 C CB  . MET D 1 260 ? -29.726 -14.429 18.127  1.00 37.92 ? 280 MET D CB  1 
ATOM   8428 C CG  . MET D 1 260 ? -30.106 -13.749 16.843  1.00 37.92 ? 280 MET D CG  1 
ATOM   8429 S SD  . MET D 1 260 ? -31.541 -14.517 16.058  1.00 37.92 ? 280 MET D SD  1 
ATOM   8430 C CE  . MET D 1 260 ? -32.747 -13.240 16.420  1.00 37.92 ? 280 MET D CE  1 
ATOM   8431 N N   . GLY D 1 261 ? -29.401 -14.573 21.325  1.00 33.31 ? 281 GLY D N   1 
ATOM   8432 C CA  . GLY D 1 261 ? -28.795 -15.257 22.419  1.00 33.31 ? 281 GLY D CA  1 
ATOM   8433 C C   . GLY D 1 261 ? -27.804 -16.337 22.042  1.00 33.31 ? 281 GLY D C   1 
ATOM   8434 O O   . GLY D 1 261 ? -27.431 -17.174 22.881  1.00 33.31 ? 281 GLY D O   1 
ATOM   8435 N N   . MET D 1 262 ? -27.296 -16.444 20.857  1.00 29.73 ? 282 MET D N   1 
ATOM   8436 C CA  . MET D 1 262 ? -26.369 -17.392 20.300  1.00 29.73 ? 282 MET D CA  1 
ATOM   8437 C C   . MET D 1 262 ? -25.714 -16.740 19.069  1.00 29.73 ? 282 MET D C   1 
ATOM   8438 O O   . MET D 1 262 ? -26.332 -15.917 18.377  1.00 29.73 ? 282 MET D O   1 
ATOM   8439 C CB  . MET D 1 262 ? -27.107 -18.628 19.833  1.00 30.53 ? 282 MET D CB  1 
ATOM   8440 C CG  . MET D 1 262 ? -26.230 -19.712 19.199  1.00 30.53 ? 282 MET D CG  1 
ATOM   8441 S SD  . MET D 1 262 ? -24.912 -20.197 20.368  1.00 30.53 ? 282 MET D SD  1 
ATOM   8442 C CE  . MET D 1 262 ? -23.647 -20.720 19.270  1.00 30.53 ? 282 MET D CE  1 
ATOM   8443 N N   . TYR D 1 263 ? -24.497 -17.129 18.792  1.00 25.58 ? 283 TYR D N   1 
ATOM   8444 C CA  . TYR D 1 263 ? -23.740 -16.627 17.667  1.00 25.58 ? 283 TYR D CA  1 
ATOM   8445 C C   . TYR D 1 263 ? -24.329 -17.056 16.338  1.00 25.58 ? 283 TYR D C   1 
ATOM   8446 O O   . TYR D 1 263 ? -24.818 -18.171 16.131  1.00 25.58 ? 283 TYR D O   1 
ATOM   8447 C CB  . TYR D 1 263 ? -22.279 -17.138 17.697  1.00 20.60 ? 283 TYR D CB  1 
ATOM   8448 C CG  . TYR D 1 263 ? -21.390 -16.396 18.653  1.00 20.60 ? 283 TYR D CG  1 
ATOM   8449 C CD1 . TYR D 1 263 ? -21.423 -16.633 20.012  1.00 20.60 ? 283 TYR D CD1 1 
ATOM   8450 C CD2 . TYR D 1 263 ? -20.521 -15.430 18.183  1.00 20.60 ? 283 TYR D CD2 1 
ATOM   8451 C CE1 . TYR D 1 263 ? -20.607 -15.904 20.872  1.00 20.60 ? 283 TYR D CE1 1 
ATOM   8452 C CE2 . TYR D 1 263 ? -19.702 -14.695 19.038  1.00 20.60 ? 283 TYR D CE2 1 
ATOM   8453 C CZ  . TYR D 1 263 ? -19.742 -14.949 20.381  1.00 20.60 ? 283 TYR D CZ  1 
ATOM   8454 O OH  . TYR D 1 263 ? -18.928 -14.246 21.246  1.00 20.60 ? 283 TYR D OH  1 
ATOM   8455 N N   . LEU D 1 264 ? -24.253 -16.131 15.398  1.00 24.99 ? 284 LEU D N   1 
ATOM   8456 C CA  . LEU D 1 264 ? -24.653 -16.366 13.998  1.00 24.99 ? 284 LEU D CA  1 
ATOM   8457 C C   . LEU D 1 264 ? -24.237 -15.102 13.201  1.00 24.99 ? 284 LEU D C   1 
ATOM   8458 O O   . LEU D 1 264 ? -23.855 -14.100 13.833  1.00 24.99 ? 284 LEU D O   1 
ATOM   8459 C CB  . LEU D 1 264 ? -26.096 -16.720 13.834  1.00 26.82 ? 284 LEU D CB  1 
ATOM   8460 C CG  . LEU D 1 264 ? -27.258 -15.938 14.379  1.00 26.82 ? 284 LEU D CG  1 
ATOM   8461 C CD1 . LEU D 1 264 ? -27.357 -14.521 13.856  1.00 26.82 ? 284 LEU D CD1 1 
ATOM   8462 C CD2 . LEU D 1 264 ? -28.548 -16.686 13.961  1.00 26.82 ? 284 LEU D CD2 1 
ATOM   8463 N N   . SER D 1 265 ? -24.245 -15.164 11.884  1.00 24.10 ? 285 SER D N   1 
ATOM   8464 C CA  . SER D 1 265 ? -23.837 -14.020 11.064  1.00 24.10 ? 285 SER D CA  1 
ATOM   8465 C C   . SER D 1 265 ? -24.977 -13.056 10.795  1.00 24.10 ? 285 SER D C   1 
ATOM   8466 O O   . SER D 1 265 ? -25.976 -13.461 10.233  1.00 24.10 ? 285 SER D O   1 
ATOM   8467 C CB  . SER D 1 265 ? -23.332 -14.525 9.736   1.00 23.56 ? 285 SER D CB  1 
ATOM   8468 O OG  . SER D 1 265 ? -21.980 -14.865 9.840   1.00 23.56 ? 285 SER D OG  1 
ATOM   8469 N N   . TYR D 1 266 ? -24.743 -11.826 11.192  1.00 23.90 ? 286 TYR D N   1 
ATOM   8470 C CA  . TYR D 1 266 ? -25.655 -10.692 11.057  1.00 23.90 ? 286 TYR D CA  1 
ATOM   8471 C C   . TYR D 1 266 ? -24.781 -9.459  11.184  1.00 23.90 ? 286 TYR D C   1 
ATOM   8472 O O   . TYR D 1 266 ? -23.945 -9.433  12.091  1.00 23.90 ? 286 TYR D O   1 
ATOM   8473 C CB  . TYR D 1 266 ? -26.677 -10.750 12.157  1.00 24.15 ? 286 TYR D CB  1 
ATOM   8474 C CG  . TYR D 1 266 ? -27.939 -9.963  11.973  1.00 24.15 ? 286 TYR D CG  1 
ATOM   8475 C CD1 . TYR D 1 266 ? -27.986 -8.633  12.300  1.00 24.15 ? 286 TYR D CD1 1 
ATOM   8476 C CD2 . TYR D 1 266 ? -29.099 -10.577 11.504  1.00 24.15 ? 286 TYR D CD2 1 
ATOM   8477 C CE1 . TYR D 1 266 ? -29.156 -7.908  12.142  1.00 24.15 ? 286 TYR D CE1 1 
ATOM   8478 C CE2 . TYR D 1 266 ? -30.277 -9.866  11.348  1.00 24.15 ? 286 TYR D CE2 1 
ATOM   8479 C CZ  . TYR D 1 266 ? -30.289 -8.544  11.675  1.00 24.15 ? 286 TYR D CZ  1 
ATOM   8480 O OH  . TYR D 1 266 ? -31.443 -7.807  11.582  1.00 24.15 ? 286 TYR D OH  1 
ATOM   8481 N N   . PRO D 1 267 ? -24.921 -8.487  10.291  1.00 22.48 ? 287 PRO D N   1 
ATOM   8482 C CA  . PRO D 1 267 ? -24.102 -7.295  10.287  1.00 22.48 ? 287 PRO D CA  1 
ATOM   8483 C C   . PRO D 1 267 ? -24.030 -6.632  11.663  1.00 22.48 ? 287 PRO D C   1 
ATOM   8484 O O   . PRO D 1 267 ? -25.010 -6.633  12.415  1.00 22.48 ? 287 PRO D O   1 
ATOM   8485 C CB  . PRO D 1 267 ? -24.719 -6.351  9.251   1.00 22.34 ? 287 PRO D CB  1 
ATOM   8486 C CG  . PRO D 1 267 ? -25.960 -7.049  8.800   1.00 22.34 ? 287 PRO D CG  1 
ATOM   8487 C CD  . PRO D 1 267 ? -25.887 -8.502  9.198   1.00 22.34 ? 287 PRO D CD  1 
ATOM   8488 N N   . ALA D 1 268 ? -22.893 -6.025  11.961  1.00 19.31 ? 288 ALA D N   1 
ATOM   8489 C CA  . ALA D 1 268 ? -22.674 -5.325  13.205  1.00 19.31 ? 288 ALA D CA  1 
ATOM   8490 C C   . ALA D 1 268 ? -21.593 -4.254  13.027  1.00 19.31 ? 288 ALA D C   1 
ATOM   8491 O O   . ALA D 1 268 ? -20.839 -4.335  12.052  1.00 19.31 ? 288 ALA D O   1 
ATOM   8492 C CB  . ALA D 1 268 ? -22.179 -6.326  14.251  1.00 19.81 ? 288 ALA D CB  1 
ATOM   8493 N N   . ILE D 1 269 ? -21.500 -3.323  13.955  1.00 17.85 ? 289 ILE D N   1 
ATOM   8494 C CA  . ILE D 1 269 ? -20.505 -2.259  13.907  1.00 17.85 ? 289 ILE D CA  1 
ATOM   8495 C C   . ILE D 1 269 ? -19.251 -2.684  14.644  1.00 17.85 ? 289 ILE D C   1 
ATOM   8496 O O   . ILE D 1 269 ? -19.278 -2.895  15.873  1.00 17.85 ? 289 ILE D O   1 
ATOM   8497 C CB  . ILE D 1 269 ? -21.081 -0.945  14.525  1.00 16.39 ? 289 ILE D CB  1 
ATOM   8498 C CG1 . ILE D 1 269 ? -22.433 -0.619  13.892  1.00 16.39 ? 289 ILE D CG1 1 
ATOM   8499 C CG2 . ILE D 1 269 ? -20.146 0.236   14.376  1.00 16.39 ? 289 ILE D CG2 1 
ATOM   8500 C CD1 . ILE D 1 269 ? -22.471 -0.660  12.378  1.00 16.39 ? 289 ILE D CD1 1 
ATOM   8501 N N   . ILE D 1 270 ? -18.143 -2.810  13.926  1.00 17.91 ? 290 ILE D N   1 
ATOM   8502 C CA  . ILE D 1 270 ? -16.874 -3.277  14.436  1.00 17.91 ? 290 ILE D CA  1 
ATOM   8503 C C   . ILE D 1 270 ? -15.875 -2.183  14.700  1.00 17.91 ? 290 ILE D C   1 
ATOM   8504 O O   . ILE D 1 270 ? -15.651 -1.325  13.849  1.00 17.91 ? 290 ILE D O   1 
ATOM   8505 C CB  . ILE D 1 270 ? -16.230 -4.253  13.412  1.00 16.40 ? 290 ILE D CB  1 
ATOM   8506 C CG1 . ILE D 1 270 ? -17.146 -5.416  13.049  1.00 16.40 ? 290 ILE D CG1 1 
ATOM   8507 C CG2 . ILE D 1 270 ? -14.932 -4.788  13.983  1.00 16.40 ? 290 ILE D CG2 1 
ATOM   8508 C CD1 . ILE D 1 270 ? -17.889 -6.049  14.181  1.00 16.40 ? 290 ILE D CD1 1 
ATOM   8509 N N   . GLY D 1 271 ? -15.243 -2.196  15.852  1.00 17.44 ? 291 GLY D N   1 
ATOM   8510 C CA  . GLY D 1 271 ? -14.282 -1.148  16.213  1.00 17.44 ? 291 GLY D CA  1 
ATOM   8511 C C   . GLY D 1 271 ? -13.173 -1.802  17.018  1.00 17.44 ? 291 GLY D C   1 
ATOM   8512 O O   . GLY D 1 271 ? -13.068 -3.046  17.060  1.00 17.44 ? 291 GLY D O   1 
ATOM   8513 N N   . ARG D 1 272 ? -12.348 -1.045  17.708  1.00 19.35 ? 292 ARG D N   1 
ATOM   8514 C CA  . ARG D 1 272 ? -11.219 -1.520  18.439  1.00 19.35 ? 292 ARG D CA  1 
ATOM   8515 C C   . ARG D 1 272 ? -11.558 -2.457  19.593  1.00 19.35 ? 292 ARG D C   1 
ATOM   8516 O O   . ARG D 1 272 ? -10.784 -3.365  19.933  1.00 19.35 ? 292 ARG D O   1 
ATOM   8517 C CB  . ARG D 1 272 ? -10.435 -0.315  19.006  1.00 16.10 ? 292 ARG D CB  1 
ATOM   8518 C CG  . ARG D 1 272 ? -8.994  -0.711  19.297  1.00 16.10 ? 292 ARG D CG  1 
ATOM   8519 C CD  . ARG D 1 272 ? -8.198  0.553   19.606  1.00 16.10 ? 292 ARG D CD  1 
ATOM   8520 N NE  . ARG D 1 272 ? -7.751  1.066   18.295  1.00 16.10 ? 292 ARG D NE  1 
ATOM   8521 C CZ  . ARG D 1 272 ? -7.461  2.349   18.149  1.00 16.10 ? 292 ARG D CZ  1 
ATOM   8522 N NH1 . ARG D 1 272 ? -7.530  3.186   19.166  1.00 16.10 ? 292 ARG D NH1 1 
ATOM   8523 N NH2 . ARG D 1 272 ? -7.077  2.814   16.959  1.00 16.10 ? 292 ARG D NH2 1 
ATOM   8524 N N   . ASP D 1 273 ? -12.721 -2.249  20.180  1.00 22.93 ? 293 ASP D N   1 
ATOM   8525 C CA  . ASP D 1 273 ? -13.256 -3.065  21.211  1.00 22.93 ? 293 ASP D CA  1 
ATOM   8526 C C   . ASP D 1 273 ? -14.139 -4.180  20.695  1.00 22.93 ? 293 ASP D C   1 
ATOM   8527 O O   . ASP D 1 273 ? -14.849 -4.746  21.538  1.00 22.93 ? 293 ASP D O   1 
ATOM   8528 C CB  . ASP D 1 273 ? -14.148 -2.241  22.166  1.00 29.87 ? 293 ASP D CB  1 
ATOM   8529 C CG  . ASP D 1 273 ? -13.283 -1.418  23.069  1.00 29.87 ? 293 ASP D CG  1 
ATOM   8530 O OD1 . ASP D 1 273 ? -12.113 -1.804  23.348  1.00 29.87 ? 293 ASP D OD1 1 
ATOM   8531 O OD2 . ASP D 1 273 ? -13.773 -0.346  23.488  1.00 29.87 ? 293 ASP D OD2 1 
ATOM   8532 N N   . GLY D 1 274 ? -14.128 -4.515  19.433  1.00 21.64 ? 294 GLY D N   1 
ATOM   8533 C CA  . GLY D 1 274 ? -14.951 -5.606  18.889  1.00 21.64 ? 294 GLY D CA  1 
ATOM   8534 C C   . GLY D 1 274 ? -16.282 -5.078  18.380  1.00 21.64 ? 294 GLY D C   1 
ATOM   8535 O O   . GLY D 1 274 ? -16.348 -4.008  17.746  1.00 21.64 ? 294 GLY D O   1 
ATOM   8536 N N   . VAL D 1 275 ? -17.344 -5.811  18.705  1.00 19.89 ? 295 VAL D N   1 
ATOM   8537 C CA  . VAL D 1 275 ? -18.683 -5.365  18.320  1.00 19.89 ? 295 VAL D CA  1 
ATOM   8538 C C   . VAL D 1 275 ? -19.115 -4.208  19.197  1.00 19.89 ? 295 VAL D C   1 
ATOM   8539 O O   . VAL D 1 275 ? -19.260 -4.311  20.394  1.00 19.89 ? 295 VAL D O   1 
ATOM   8540 C CB  . VAL D 1 275 ? -19.694 -6.508  18.416  1.00 17.62 ? 295 VAL D CB  1 
ATOM   8541 C CG1 . VAL D 1 275 ? -21.077 -6.054  17.983  1.00 17.62 ? 295 VAL D CG1 1 
ATOM   8542 C CG2 . VAL D 1 275 ? -19.230 -7.616  17.474  1.00 17.62 ? 295 VAL D CG2 1 
ATOM   8543 N N   . LEU D 1 276 ? -19.315 -3.065  18.522  1.00 22.40 ? 296 LEU D N   1 
ATOM   8544 C CA  . LEU D 1 276 ? -19.692 -1.829  19.174  1.00 22.40 ? 296 LEU D CA  1 
ATOM   8545 C C   . LEU D 1 276 ? -21.201 -1.631  19.113  1.00 22.40 ? 296 LEU D C   1 
ATOM   8546 O O   . LEU D 1 276 ? -21.750 -0.954  19.985  1.00 22.40 ? 296 LEU D O   1 
ATOM   8547 C CB  . LEU D 1 276 ? -19.018 -0.584  18.598  1.00 25.07 ? 296 LEU D CB  1 
ATOM   8548 C CG  . LEU D 1 276 ? -17.515 -0.615  18.345  1.00 25.07 ? 296 LEU D CG  1 
ATOM   8549 C CD1 . LEU D 1 276 ? -17.012 0.698   17.747  1.00 25.07 ? 296 LEU D CD1 1 
ATOM   8550 C CD2 . LEU D 1 276 ? -16.729 -0.881  19.639  1.00 25.07 ? 296 LEU D CD2 1 
ATOM   8551 N N   . ALA D 1 277 ? -21.871 -2.174  18.119  1.00 24.17 ? 297 ALA D N   1 
ATOM   8552 C CA  . ALA D 1 277 ? -23.331 -1.989  18.020  1.00 24.17 ? 297 ALA D CA  1 
ATOM   8553 C C   . ALA D 1 277 ? -23.899 -2.978  17.027  1.00 24.17 ? 297 ALA D C   1 
ATOM   8554 O O   . ALA D 1 277 ? -23.147 -3.538  16.216  1.00 24.17 ? 297 ALA D O   1 
ATOM   8555 C CB  . ALA D 1 277 ? -23.656 -0.567  17.594  1.00 22.90 ? 297 ALA D CB  1 
ATOM   8556 N N   . GLU D 1 278 ? -25.195 -3.243  17.111  1.00 30.46 ? 298 GLU D N   1 
ATOM   8557 C CA  . GLU D 1 278 ? -25.863 -4.180  16.197  1.00 30.46 ? 298 GLU D CA  1 
ATOM   8558 C C   . GLU D 1 278 ? -26.572 -3.424  15.092  1.00 30.46 ? 298 GLU D C   1 
ATOM   8559 O O   . GLU D 1 278 ? -26.775 -2.212  15.221  1.00 30.46 ? 298 GLU D O   1 
ATOM   8560 C CB  . GLU D 1 278 ? -26.914 -5.026  16.921  1.00 35.86 ? 298 GLU D CB  1 
ATOM   8561 C CG  . GLU D 1 278 ? -26.399 -5.812  18.058  1.00 35.86 ? 298 GLU D CG  1 
ATOM   8562 C CD  . GLU D 1 278 ? -27.316 -6.562  18.984  1.00 35.86 ? 298 GLU D CD  1 
ATOM   8563 O OE1 . GLU D 1 278 ? -28.575 -6.609  18.889  1.00 35.86 ? 298 GLU D OE1 1 
ATOM   8564 O OE2 . GLU D 1 278 ? -26.733 -7.203  19.943  1.00 35.86 ? 298 GLU D OE2 1 
ATOM   8565 N N   . THR D 1 279 ? -26.949 -4.077  14.005  1.00 32.95 ? 299 THR D N   1 
ATOM   8566 C CA  . THR D 1 279 ? -27.674 -3.363  12.950  1.00 32.95 ? 299 THR D CA  1 
ATOM   8567 C C   . THR D 1 279 ? -29.087 -3.959  12.963  1.00 32.95 ? 299 THR D C   1 
ATOM   8568 O O   . THR D 1 279 ? -29.236 -5.011  13.596  1.00 32.95 ? 299 THR D O   1 
ATOM   8569 C CB  . THR D 1 279 ? -27.068 -3.474  11.564  1.00 31.67 ? 299 THR D CB  1 
ATOM   8570 O OG1 . THR D 1 279 ? -27.167 -4.803  11.079  1.00 31.67 ? 299 THR D OG1 1 
ATOM   8571 C CG2 . THR D 1 279 ? -25.579 -3.106  11.603  1.00 31.67 ? 299 THR D CG2 1 
ATOM   8572 N N   . THR D 1 280 ? -30.039 -3.321  12.343  1.00 35.74 ? 300 THR D N   1 
ATOM   8573 C CA  . THR D 1 280 ? -31.415 -3.798  12.283  1.00 35.74 ? 300 THR D CA  1 
ATOM   8574 C C   . THR D 1 280 ? -31.831 -3.863  10.808  1.00 35.74 ? 300 THR D C   1 
ATOM   8575 O O   . THR D 1 280 ? -32.093 -2.831  10.192  1.00 35.74 ? 300 THR D O   1 
ATOM   8576 C CB  . THR D 1 280 ? -32.450 -2.900  12.961  1.00 37.14 ? 300 THR D CB  1 
ATOM   8577 O OG1 . THR D 1 280 ? -32.000 -2.540  14.281  1.00 37.14 ? 300 THR D OG1 1 
ATOM   8578 C CG2 . THR D 1 280 ? -33.797 -3.620  13.056  1.00 37.14 ? 300 THR D CG2 1 
ATOM   8579 N N   . LEU D 1 281 ? -31.855 -5.032  10.237  1.00 39.15 ? 301 LEU D N   1 
ATOM   8580 C CA  . LEU D 1 281 ? -32.273 -5.202  8.866   1.00 39.15 ? 301 LEU D CA  1 
ATOM   8581 C C   . LEU D 1 281 ? -33.789 -5.420  8.875   1.00 39.15 ? 301 LEU D C   1 
ATOM   8582 O O   . LEU D 1 281 ? -34.320 -5.934  9.873   1.00 39.15 ? 301 LEU D O   1 
ATOM   8583 C CB  . LEU D 1 281 ? -31.613 -6.406  8.245   1.00 36.82 ? 301 LEU D CB  1 
ATOM   8584 C CG  . LEU D 1 281 ? -30.113 -6.643  8.289   1.00 36.82 ? 301 LEU D CG  1 
ATOM   8585 C CD1 . LEU D 1 281 ? -29.686 -7.744  7.320   1.00 36.82 ? 301 LEU D CD1 1 
ATOM   8586 C CD2 . LEU D 1 281 ? -29.350 -5.379  7.931   1.00 36.82 ? 301 LEU D CD2 1 
ATOM   8587 N N   . ASP D 1 282 ? -34.489 -5.042  7.825   1.00 45.61 ? 302 ASP D N   1 
ATOM   8588 C CA  . ASP D 1 282 ? -35.939 -5.291  7.788   1.00 45.61 ? 302 ASP D CA  1 
ATOM   8589 C C   . ASP D 1 282 ? -36.094 -6.547  6.922   1.00 45.61 ? 302 ASP D C   1 
ATOM   8590 O O   . ASP D 1 282 ? -36.352 -6.434  5.717   1.00 45.61 ? 302 ASP D O   1 
ATOM   8591 C CB  . ASP D 1 282 ? -36.732 -4.167  7.193   1.00 52.56 ? 302 ASP D CB  1 
ATOM   8592 C CG  . ASP D 1 282 ? -36.597 -2.844  7.924   1.00 52.56 ? 302 ASP D CG  1 
ATOM   8593 O OD1 . ASP D 1 282 ? -36.704 -2.940  9.192   1.00 52.56 ? 302 ASP D OD1 1 
ATOM   8594 O OD2 . ASP D 1 282 ? -36.417 -1.790  7.219   1.00 52.56 ? 302 ASP D OD2 1 
ATOM   8595 N N   . LEU D 1 283 ? -35.861 -7.716  7.517   1.00 44.79 ? 303 LEU D N   1 
ATOM   8596 C CA  . LEU D 1 283 ? -35.960 -8.884  6.618   1.00 44.79 ? 303 LEU D CA  1 
ATOM   8597 C C   . LEU D 1 283 ? -37.412 -9.225  6.375   1.00 44.79 ? 303 LEU D C   1 
ATOM   8598 O O   . LEU D 1 283 ? -38.307 -8.779  7.089   1.00 44.79 ? 303 LEU D O   1 
ATOM   8599 C CB  . LEU D 1 283 ? -35.195 -10.029 7.244   1.00 44.35 ? 303 LEU D CB  1 
ATOM   8600 C CG  . LEU D 1 283 ? -33.696 -9.749  7.436   1.00 44.35 ? 303 LEU D CG  1 
ATOM   8601 C CD1 . LEU D 1 283 ? -33.173 -10.696 8.511   1.00 44.35 ? 303 LEU D CD1 1 
ATOM   8602 C CD2 . LEU D 1 283 ? -32.944 -9.905  6.124   1.00 44.35 ? 303 LEU D CD2 1 
ATOM   8603 N N   . THR D 1 284 ? -37.624 -10.012 5.335   1.00 46.09 ? 304 THR D N   1 
ATOM   8604 C CA  . THR D 1 284 ? -38.992 -10.427 5.020   1.00 46.09 ? 304 THR D CA  1 
ATOM   8605 C C   . THR D 1 284 ? -39.324 -11.584 5.941   1.00 46.09 ? 304 THR D C   1 
ATOM   8606 O O   . THR D 1 284 ? -38.426 -12.099 6.616   1.00 46.09 ? 304 THR D O   1 
ATOM   8607 C CB  . THR D 1 284 ? -39.134 -10.889 3.568   1.00 45.40 ? 304 THR D CB  1 
ATOM   8608 O OG1 . THR D 1 284 ? -38.277 -12.025 3.357   1.00 45.40 ? 304 THR D OG1 1 
ATOM   8609 C CG2 . THR D 1 284 ? -38.770 -9.758  2.622   1.00 45.40 ? 304 THR D CG2 1 
ATOM   8610 N N   . THR D 1 285 ? -40.577 -12.024 5.981   1.00 47.89 ? 305 THR D N   1 
ATOM   8611 C CA  . THR D 1 285 ? -40.948 -13.117 6.877   1.00 47.89 ? 305 THR D CA  1 
ATOM   8612 C C   . THR D 1 285 ? -40.222 -14.377 6.506   1.00 47.89 ? 305 THR D C   1 
ATOM   8613 O O   . THR D 1 285 ? -39.836 -15.027 7.473   1.00 47.89 ? 305 THR D O   1 
ATOM   8614 C CB  . THR D 1 285 ? -42.447 -13.434 6.901   1.00 49.70 ? 305 THR D CB  1 
ATOM   8615 O OG1 . THR D 1 285 ? -42.902 -13.627 5.568   1.00 49.70 ? 305 THR D OG1 1 
ATOM   8616 C CG2 . THR D 1 285 ? -43.217 -12.308 7.571   1.00 49.70 ? 305 THR D CG2 1 
ATOM   8617 N N   . ASP D 1 286 ? -39.992 -14.719 5.266   1.00 48.05 ? 306 ASP D N   1 
ATOM   8618 C CA  . ASP D 1 286 ? -39.244 -15.952 4.989   1.00 48.05 ? 306 ASP D CA  1 
ATOM   8619 C C   . ASP D 1 286 ? -37.817 -15.862 5.523   1.00 48.05 ? 306 ASP D C   1 
ATOM   8620 O O   . ASP D 1 286 ? -37.276 -16.818 6.080   1.00 48.05 ? 306 ASP D O   1 
ATOM   8621 C CB  . ASP D 1 286 ? -39.164 -16.210 3.486   1.00 53.85 ? 306 ASP D CB  1 
ATOM   8622 C CG  . ASP D 1 286 ? -40.518 -16.538 2.877   1.00 53.85 ? 306 ASP D CG  1 
ATOM   8623 O OD1 . ASP D 1 286 ? -41.544 -15.956 3.354   1.00 53.85 ? 306 ASP D OD1 1 
ATOM   8624 O OD2 . ASP D 1 286 ? -40.551 -17.381 1.927   1.00 53.85 ? 306 ASP D OD2 1 
ATOM   8625 N N   . GLU D 1 287 ? -37.202 -14.706 5.352   1.00 44.40 ? 307 GLU D N   1 
ATOM   8626 C CA  . GLU D 1 287 ? -35.866 -14.418 5.795   1.00 44.40 ? 307 GLU D CA  1 
ATOM   8627 C C   . GLU D 1 287 ? -35.727 -14.532 7.291   1.00 44.40 ? 307 GLU D C   1 
ATOM   8628 O O   . GLU D 1 287 ? -34.774 -15.116 7.786   1.00 44.40 ? 307 GLU D O   1 
ATOM   8629 C CB  . GLU D 1 287 ? -35.491 -12.961 5.374   1.00 42.96 ? 307 GLU D CB  1 
ATOM   8630 C CG  . GLU D 1 287 ? -35.285 -12.874 3.873   1.00 42.96 ? 307 GLU D CG  1 
ATOM   8631 C CD  . GLU D 1 287 ? -35.019 -11.511 3.303   1.00 42.96 ? 307 GLU D CD  1 
ATOM   8632 O OE1 . GLU D 1 287 ? -35.203 -10.453 3.934   1.00 42.96 ? 307 GLU D OE1 1 
ATOM   8633 O OE2 . GLU D 1 287 ? -34.613 -11.499 2.092   1.00 42.96 ? 307 GLU D OE2 1 
ATOM   8634 N N   . GLN D 1 288 ? -36.688 -13.995 8.022   1.00 43.17 ? 308 GLN D N   1 
ATOM   8635 C CA  . GLN D 1 288 ? -36.672 -14.060 9.485   1.00 43.17 ? 308 GLN D CA  1 
ATOM   8636 C C   . GLN D 1 288 ? -36.827 -15.512 9.936   1.00 43.17 ? 308 GLN D C   1 
ATOM   8637 O O   . GLN D 1 288 ? -36.240 -15.914 10.932  1.00 43.17 ? 308 GLN D O   1 
ATOM   8638 C CB  . GLN D 1 288 ? -37.752 -13.238 10.126  1.00 48.79 ? 308 GLN D CB  1 
ATOM   8639 C CG  . GLN D 1 288 ? -37.597 -11.734 9.925   1.00 48.79 ? 308 GLN D CG  1 
ATOM   8640 C CD  . GLN D 1 288 ? -38.878 -11.011 10.312  1.00 48.79 ? 308 GLN D CD  1 
ATOM   8641 O OE1 . GLN D 1 288 ? -39.617 -11.493 11.200  1.00 48.79 ? 308 GLN D OE1 1 
ATOM   8642 N NE2 . GLN D 1 288 ? -39.159 -9.877  9.690   1.00 48.79 ? 308 GLN D NE2 1 
ATOM   8643 N N   . GLU D 1 289 ? -37.635 -16.251 9.178   1.00 41.09 ? 309 GLU D N   1 
ATOM   8644 C CA  . GLU D 1 289 ? -37.844 -17.651 9.488   1.00 41.09 ? 309 GLU D CA  1 
ATOM   8645 C C   . GLU D 1 289 ? -36.557 -18.428 9.281   1.00 41.09 ? 309 GLU D C   1 
ATOM   8646 O O   . GLU D 1 289 ? -36.117 -19.119 10.212  1.00 41.09 ? 309 GLU D O   1 
ATOM   8647 C CB  . GLU D 1 289 ? -38.941 -18.274 8.615   1.00 41.27 ? 309 GLU D CB  1 
ATOM   8648 N N   . LYS D 1 290 ? -35.920 -18.268 8.114   1.00 38.33 ? 310 LYS D N   1 
ATOM   8649 C CA  . LYS D 1 290 ? -34.655 -19.001 7.891   1.00 38.33 ? 310 LYS D CA  1 
ATOM   8650 C C   . LYS D 1 290 ? -33.575 -18.546 8.873   1.00 38.33 ? 310 LYS D C   1 
ATOM   8651 O O   . LYS D 1 290 ? -32.675 -19.347 9.162   1.00 38.33 ? 310 LYS D O   1 
ATOM   8652 C CB  . LYS D 1 290 ? -34.139 -18.795 6.499   1.00 40.10 ? 310 LYS D CB  1 
ATOM   8653 C CG  . LYS D 1 290 ? -34.989 -19.378 5.407   1.00 40.10 ? 310 LYS D CG  1 
ATOM   8654 C CD  . LYS D 1 290 ? -34.360 -19.023 4.062   1.00 40.10 ? 310 LYS D CD  1 
ATOM   8655 C CE  . LYS D 1 290 ? -35.341 -19.193 2.921   1.00 40.10 ? 310 LYS D CE  1 
ATOM   8656 N NZ  . LYS D 1 290 ? -34.739 -18.785 1.595   1.00 40.10 ? 310 LYS D NZ  1 
ATOM   8657 N N   . LEU D 1 291 ? -33.589 -17.331 9.364   1.00 35.82 ? 311 LEU D N   1 
ATOM   8658 C CA  . LEU D 1 291 ? -32.612 -16.831 10.286  1.00 35.82 ? 311 LEU D CA  1 
ATOM   8659 C C   . LEU D 1 291 ? -32.775 -17.559 11.609  1.00 35.82 ? 311 LEU D C   1 
ATOM   8660 O O   . LEU D 1 291 ? -31.813 -18.014 12.222  1.00 35.82 ? 311 LEU D O   1 
ATOM   8661 C CB  . LEU D 1 291 ? -32.748 -15.316 10.495  1.00 32.86 ? 311 LEU D CB  1 
ATOM   8662 C CG  . LEU D 1 291 ? -31.616 -14.723 11.344  1.00 32.86 ? 311 LEU D CG  1 
ATOM   8663 C CD1 . LEU D 1 291 ? -30.285 -14.779 10.619  1.00 32.86 ? 311 LEU D CD1 1 
ATOM   8664 C CD2 . LEU D 1 291 ? -31.900 -13.283 11.727  1.00 32.86 ? 311 LEU D CD2 1 
ATOM   8665 N N   . LEU D 1 292 ? -34.032 -17.691 12.045  1.00 38.47 ? 312 LEU D N   1 
ATOM   8666 C CA  . LEU D 1 292 ? -34.297 -18.389 13.311  1.00 38.47 ? 312 LEU D CA  1 
ATOM   8667 C C   . LEU D 1 292 ? -34.008 -19.865 13.194  1.00 38.47 ? 312 LEU D C   1 
ATOM   8668 O O   . LEU D 1 292 ? -33.587 -20.480 14.158  1.00 38.47 ? 312 LEU D O   1 
ATOM   8669 C CB  . LEU D 1 292 ? -35.729 -18.118 13.776  1.00 39.00 ? 312 LEU D CB  1 
ATOM   8670 C CG  . LEU D 1 292 ? -35.879 -16.683 14.328  1.00 39.00 ? 312 LEU D CG  1 
ATOM   8671 C CD1 . LEU D 1 292 ? -37.344 -16.341 14.469  1.00 39.00 ? 312 LEU D CD1 1 
ATOM   8672 C CD2 . LEU D 1 292 ? -35.160 -16.548 15.656  1.00 39.00 ? 312 LEU D CD2 1 
ATOM   8673 N N   . GLN D 1 293 ? -34.219 -20.424 12.035  1.00 42.80 ? 313 GLN D N   1 
ATOM   8674 C CA  . GLN D 1 293 ? -33.946 -21.854 11.797  1.00 42.80 ? 313 GLN D CA  1 
ATOM   8675 C C   . GLN D 1 293 ? -32.459 -22.073 11.907  1.00 42.80 ? 313 GLN D C   1 
ATOM   8676 O O   . GLN D 1 293 ? -31.961 -23.005 12.523  1.00 42.80 ? 313 GLN D O   1 
ATOM   8677 C CB  . GLN D 1 293 ? -34.453 -22.190 10.441  1.00 50.58 ? 313 GLN D CB  1 
ATOM   8678 C CG  . GLN D 1 293 ? -34.262 -23.544 9.822   1.00 50.58 ? 313 GLN D CG  1 
ATOM   8679 C CD  . GLN D 1 293 ? -35.132 -23.574 8.537   1.00 50.58 ? 313 GLN D CD  1 
ATOM   8680 O OE1 . GLN D 1 293 ? -34.655 -23.707 7.396   1.00 50.58 ? 313 GLN D OE1 1 
ATOM   8681 N NE2 . GLN D 1 293 ? -36.443 -23.398 8.804   1.00 50.58 ? 313 GLN D NE2 1 
ATOM   8682 N N   . SER D 1 294 ? -31.665 -21.198 11.302  1.00 42.86 ? 314 SER D N   1 
ATOM   8683 C CA  . SER D 1 294 ? -30.232 -21.161 11.331  1.00 42.86 ? 314 SER D CA  1 
ATOM   8684 C C   . SER D 1 294 ? -29.722 -21.134 12.771  1.00 42.86 ? 314 SER D C   1 
ATOM   8685 O O   . SER D 1 294 ? -28.832 -21.855 13.162  1.00 42.86 ? 314 SER D O   1 
ATOM   8686 C CB  . SER D 1 294 ? -29.691 -19.847 10.719  1.00 43.36 ? 314 SER D CB  1 
ATOM   8687 O OG  . SER D 1 294 ? -28.999 -20.184 9.547   1.00 43.36 ? 314 SER D OG  1 
ATOM   8688 N N   . ARG D 1 295 ? -30.336 -20.252 13.569  1.00 42.63 ? 315 ARG D N   1 
ATOM   8689 C CA  . ARG D 1 295 ? -29.971 -20.091 14.952  1.00 42.63 ? 315 ARG D CA  1 
ATOM   8690 C C   . ARG D 1 295 ? -30.228 -21.324 15.803  1.00 42.63 ? 315 ARG D C   1 
ATOM   8691 O O   . ARG D 1 295 ? -29.482 -21.611 16.759  1.00 42.63 ? 315 ARG D O   1 
ATOM   8692 C CB  . ARG D 1 295 ? -30.750 -18.912 15.570  1.00 44.50 ? 315 ARG D CB  1 
ATOM   8693 C CG  . ARG D 1 295 ? -30.738 -18.940 17.085  1.00 44.50 ? 315 ARG D CG  1 
ATOM   8694 C CD  . ARG D 1 295 ? -31.292 -17.764 17.720  1.00 44.50 ? 315 ARG D CD  1 
ATOM   8695 N NE  . ARG D 1 295 ? -32.326 -17.885 18.712  1.00 44.50 ? 315 ARG D NE  1 
ATOM   8696 C CZ  . ARG D 1 295 ? -33.480 -18.519 18.622  1.00 44.50 ? 315 ARG D CZ  1 
ATOM   8697 N NH1 . ARG D 1 295 ? -33.851 -19.252 17.595  1.00 44.50 ? 315 ARG D NH1 1 
ATOM   8698 N NH2 . ARG D 1 295 ? -34.340 -18.388 19.636  1.00 44.50 ? 315 ARG D NH2 1 
ATOM   8699 N N   . ASP D 1 296 ? -31.311 -22.033 15.537  1.00 43.27 ? 316 ASP D N   1 
ATOM   8700 C CA  . ASP D 1 296 ? -31.674 -23.247 16.262  1.00 43.27 ? 316 ASP D CA  1 
ATOM   8701 C C   . ASP D 1 296 ? -30.648 -24.334 15.978  1.00 43.27 ? 316 ASP D C   1 
ATOM   8702 O O   . ASP D 1 296 ? -30.270 -25.042 16.892  1.00 43.27 ? 316 ASP D O   1 
ATOM   8703 C CB  . ASP D 1 296 ? -33.055 -23.750 15.888  1.00 43.17 ? 316 ASP D CB  1 
ATOM   8704 C CG  . ASP D 1 296 ? -34.181 -22.901 16.443  1.00 43.17 ? 316 ASP D CG  1 
ATOM   8705 O OD1 . ASP D 1 296 ? -33.968 -21.945 17.232  1.00 43.17 ? 316 ASP D OD1 1 
ATOM   8706 O OD2 . ASP D 1 296 ? -35.340 -23.213 16.070  1.00 43.17 ? 316 ASP D OD2 1 
ATOM   8707 N N   . TYR D 1 297 ? -30.154 -24.441 14.758  1.00 42.93 ? 317 TYR D N   1 
ATOM   8708 C CA  . TYR D 1 297 ? -29.126 -25.416 14.443  1.00 42.93 ? 317 TYR D CA  1 
ATOM   8709 C C   . TYR D 1 297 ? -27.821 -25.091 15.157  1.00 42.93 ? 317 TYR D C   1 
ATOM   8710 O O   . TYR D 1 297 ? -27.126 -25.936 15.704  1.00 42.93 ? 317 TYR D O   1 
ATOM   8711 C CB  . TYR D 1 297 ? -28.822 -25.385 12.952  1.00 49.27 ? 317 TYR D CB  1 
ATOM   8712 C CG  . TYR D 1 297 ? -29.945 -25.842 12.073  1.00 49.27 ? 317 TYR D CG  1 
ATOM   8713 C CD1 . TYR D 1 297 ? -31.191 -26.238 12.555  1.00 49.27 ? 317 TYR D CD1 1 
ATOM   8714 C CD2 . TYR D 1 297 ? -29.735 -25.905 10.693  1.00 49.27 ? 317 TYR D CD2 1 
ATOM   8715 C CE1 . TYR D 1 297 ? -32.196 -26.650 11.713  1.00 49.27 ? 317 TYR D CE1 1 
ATOM   8716 C CE2 . TYR D 1 297 ? -30.734 -26.318 9.828   1.00 49.27 ? 317 TYR D CE2 1 
ATOM   8717 C CZ  . TYR D 1 297 ? -31.954 -26.689 10.352  1.00 49.27 ? 317 TYR D CZ  1 
ATOM   8718 O OH  . TYR D 1 297 ? -32.957 -27.105 9.504   1.00 49.27 ? 317 TYR D OH  1 
ATOM   8719 N N   . ILE D 1 298 ? -27.425 -23.822 15.191  1.00 38.81 ? 318 ILE D N   1 
ATOM   8720 C CA  . ILE D 1 298 ? -26.165 -23.466 15.848  1.00 38.81 ? 318 ILE D CA  1 
ATOM   8721 C C   . ILE D 1 298 ? -26.245 -23.769 17.332  1.00 38.81 ? 318 ILE D C   1 
ATOM   8722 O O   . ILE D 1 298 ? -25.317 -24.332 17.923  1.00 38.81 ? 318 ILE D O   1 
ATOM   8723 C CB  . ILE D 1 298 ? -25.870 -21.978 15.564  1.00 37.00 ? 318 ILE D CB  1 
ATOM   8724 C CG1 . ILE D 1 298 ? -25.588 -21.819 14.057  1.00 37.00 ? 318 ILE D CG1 1 
ATOM   8725 C CG2 . ILE D 1 298 ? -24.684 -21.480 16.337  1.00 37.00 ? 318 ILE D CG2 1 
ATOM   8726 C CD1 . ILE D 1 298 ? -25.552 -20.381 13.573  1.00 37.00 ? 318 ILE D CD1 1 
ATOM   8727 N N   . GLN D 1 299 ? -27.365 -23.410 17.922  1.00 37.31 ? 319 GLN D N   1 
ATOM   8728 C CA  . GLN D 1 299 ? -27.609 -23.638 19.341  1.00 37.31 ? 319 GLN D CA  1 
ATOM   8729 C C   . GLN D 1 299 ? -27.519 -25.119 19.686  1.00 37.31 ? 319 GLN D C   1 
ATOM   8730 O O   . GLN D 1 299 ? -26.828 -25.490 20.631  1.00 37.31 ? 319 GLN D O   1 
ATOM   8731 C CB  . GLN D 1 299 ? -28.984 -23.114 19.671  1.00 38.31 ? 319 GLN D CB  1 
ATOM   8732 C CG  . GLN D 1 299 ? -29.472 -23.174 21.066  1.00 38.31 ? 319 GLN D CG  1 
ATOM   8733 C CD  . GLN D 1 299 ? -28.523 -22.561 22.079  1.00 38.31 ? 319 GLN D CD  1 
ATOM   8734 O OE1 . GLN D 1 299 ? -28.639 -21.404 22.457  1.00 38.31 ? 319 GLN D OE1 1 
ATOM   8735 N NE2 . GLN D 1 299 ? -27.562 -23.363 22.519  1.00 38.31 ? 319 GLN D NE2 1 
ATOM   8736 N N   . GLN D 1 300 ? -28.180 -25.956 18.877  1.00 36.49 ? 320 GLN D N   1 
ATOM   8737 C CA  . GLN D 1 300 ? -28.169 -27.399 19.108  1.00 36.49 ? 320 GLN D CA  1 
ATOM   8738 C C   . GLN D 1 300 ? -26.785 -27.992 18.924  1.00 36.49 ? 320 GLN D C   1 
ATOM   8739 O O   . GLN D 1 300 ? -26.349 -28.755 19.819  1.00 36.49 ? 320 GLN D O   1 
ATOM   8740 C CB  . GLN D 1 300 ? -29.153 -28.178 18.221  1.00 35.74 ? 320 GLN D CB  1 
ATOM   8741 N N   . ARG D 1 301 ? -26.061 -27.656 17.855  1.00 32.09 ? 321 ARG D N   1 
ATOM   8742 C CA  . ARG D 1 301 ? -24.711 -28.197 17.671  1.00 32.09 ? 321 ARG D CA  1 
ATOM   8743 C C   . ARG D 1 301 ? -23.745 -27.712 18.739  1.00 32.09 ? 321 ARG D C   1 
ATOM   8744 O O   . ARG D 1 301 ? -22.807 -28.418 19.124  1.00 32.09 ? 321 ARG D O   1 
ATOM   8745 C CB  . ARG D 1 301 ? -24.159 -27.802 16.305  1.00 31.94 ? 321 ARG D CB  1 
ATOM   8746 C CG  . ARG D 1 301 ? -24.569 -28.756 15.198  1.00 31.94 ? 321 ARG D CG  1 
ATOM   8747 N N   . PHE D 1 302 ? -23.982 -26.529 19.262  1.00 29.74 ? 322 PHE D N   1 
ATOM   8748 C CA  . PHE D 1 302 ? -23.162 -25.948 20.299  1.00 29.74 ? 322 PHE D CA  1 
ATOM   8749 C C   . PHE D 1 302 ? -23.419 -26.731 21.600  1.00 29.74 ? 322 PHE D C   1 
ATOM   8750 O O   . PHE D 1 302 ? -22.519 -27.085 22.368  1.00 29.74 ? 322 PHE D O   1 
ATOM   8751 C CB  . PHE D 1 302 ? -23.525 -24.508 20.537  1.00 22.90 ? 322 PHE D CB  1 
ATOM   8752 C CG  . PHE D 1 302 ? -22.871 -23.888 21.739  1.00 22.90 ? 322 PHE D CG  1 
ATOM   8753 C CD1 . PHE D 1 302 ? -21.518 -23.582 21.705  1.00 22.90 ? 322 PHE D CD1 1 
ATOM   8754 C CD2 . PHE D 1 302 ? -23.607 -23.603 22.875  1.00 22.90 ? 322 PHE D CD2 1 
ATOM   8755 C CE1 . PHE D 1 302 ? -20.908 -23.011 22.823  1.00 22.90 ? 322 PHE D CE1 1 
ATOM   8756 C CE2 . PHE D 1 302 ? -23.012 -23.005 23.967  1.00 22.90 ? 322 PHE D CE2 1 
ATOM   8757 C CZ  . PHE D 1 302 ? -21.655 -22.717 23.940  1.00 22.90 ? 322 PHE D CZ  1 
ATOM   8758 N N   . ASP D 1 303 ? -24.709 -27.019 21.807  1.00 32.83 ? 323 ASP D N   1 
ATOM   8759 C CA  . ASP D 1 303 ? -25.080 -27.772 23.024  1.00 32.83 ? 323 ASP D CA  1 
ATOM   8760 C C   . ASP D 1 303 ? -24.403 -29.117 23.085  1.00 32.83 ? 323 ASP D C   1 
ATOM   8761 O O   . ASP D 1 303 ? -23.882 -29.488 24.116  1.00 32.83 ? 323 ASP D O   1 
ATOM   8762 C CB  . ASP D 1 303 ? -26.595 -27.941 23.091  1.00 33.07 ? 323 ASP D CB  1 
ATOM   8763 C CG  . ASP D 1 303 ? -27.248 -26.728 23.745  1.00 33.07 ? 323 ASP D CG  1 
ATOM   8764 O OD1 . ASP D 1 303 ? -26.521 -25.890 24.355  1.00 33.07 ? 323 ASP D OD1 1 
ATOM   8765 O OD2 . ASP D 1 303 ? -28.482 -26.622 23.649  1.00 33.07 ? 323 ASP D OD2 1 
ATOM   8766 N N   . GLU D 1 304 ? -24.409 -29.807 21.998  1.00 34.21 ? 324 GLU D N   1 
ATOM   8767 C CA  . GLU D 1 304 ? -23.771 -31.101 21.841  1.00 34.21 ? 324 GLU D CA  1 
ATOM   8768 C C   . GLU D 1 304 ? -22.278 -31.036 22.147  1.00 34.21 ? 324 GLU D C   1 
ATOM   8769 O O   . GLU D 1 304 ? -21.755 -31.834 22.955  1.00 34.21 ? 324 GLU D O   1 
ATOM   8770 C CB  . GLU D 1 304 ? -23.990 -31.504 20.391  1.00 38.55 ? 324 GLU D CB  1 
ATOM   8771 C CG  . GLU D 1 304 ? -23.404 -32.828 19.968  1.00 38.55 ? 324 GLU D CG  1 
ATOM   8772 C CD  . GLU D 1 304 ? -23.562 -33.036 18.485  1.00 38.55 ? 324 GLU D CD  1 
ATOM   8773 O OE1 . GLU D 1 304 ? -23.314 -32.001 17.760  1.00 38.55 ? 324 GLU D OE1 1 
ATOM   8774 O OE2 . GLU D 1 304 ? -23.912 -34.106 17.977  1.00 38.55 ? 324 GLU D OE2 1 
ATOM   8775 N N   . ILE D 1 305 ? -21.526 -30.107 21.516  1.00 31.02 ? 325 ILE D N   1 
ATOM   8776 C CA  . ILE D 1 305 ? -20.081 -30.066 21.748  1.00 31.02 ? 325 ILE D CA  1 
ATOM   8777 C C   . ILE D 1 305 ? -19.687 -29.503 23.080  1.00 31.02 ? 325 ILE D C   1 
ATOM   8778 O O   . ILE D 1 305 ? -18.661 -29.866 23.664  1.00 31.02 ? 325 ILE D O   1 
ATOM   8779 C CB  . ILE D 1 305 ? -19.365 -29.278 20.616  1.00 30.18 ? 325 ILE D CB  1 
ATOM   8780 C CG1 . ILE D 1 305 ? -17.847 -29.410 20.718  1.00 30.18 ? 325 ILE D CG1 1 
ATOM   8781 C CG2 . ILE D 1 305 ? -19.719 -27.783 20.646  1.00 30.18 ? 325 ILE D CG2 1 
ATOM   8782 C CD1 . ILE D 1 305 ? -17.070 -28.994 19.509  1.00 30.18 ? 325 ILE D CD1 1 
ATOM   8783 N N   . VAL D 1 306 ? -20.467 -28.616 23.639  1.00 32.12 ? 326 VAL D N   1 
ATOM   8784 C CA  . VAL D 1 306 ? -20.083 -28.101 24.965  1.00 32.12 ? 326 VAL D CA  1 
ATOM   8785 C C   . VAL D 1 306 ? -20.301 -29.239 25.963  1.00 32.12 ? 326 VAL D C   1 
ATOM   8786 O O   . VAL D 1 306 ? -19.698 -29.264 27.041  1.00 32.12 ? 326 VAL D O   1 
ATOM   8787 C CB  . VAL D 1 306 ? -20.850 -26.826 25.308  1.00 32.47 ? 326 VAL D CB  1 
ATOM   8788 C CG1 . VAL D 1 306 ? -22.329 -27.137 25.539  1.00 32.47 ? 326 VAL D CG1 1 
ATOM   8789 C CG2 . VAL D 1 306 ? -20.358 -26.143 26.571  1.00 32.47 ? 326 VAL D CG2 1 
ATOM   8790 N N   . ASP D 1 307 ? -21.149 -30.255 25.674  1.00 34.88 ? 327 ASP D N   1 
ATOM   8791 C CA  . ASP D 1 307 ? -21.367 -31.357 26.587  1.00 34.88 ? 327 ASP D CA  1 
ATOM   8792 C C   . ASP D 1 307 ? -20.135 -32.249 26.718  1.00 34.88 ? 327 ASP D C   1 
ATOM   8793 O O   . ASP D 1 307 ? -19.930 -32.844 27.790  1.00 34.88 ? 327 ASP D O   1 
ATOM   8794 C CB  . ASP D 1 307 ? -22.499 -32.338 26.212  1.00 39.47 ? 327 ASP D CB  1 
ATOM   8795 C CG  . ASP D 1 307 ? -23.847 -31.828 26.676  1.00 39.47 ? 327 ASP D CG  1 
ATOM   8796 O OD1 . ASP D 1 307 ? -23.899 -30.990 27.619  1.00 39.47 ? 327 ASP D OD1 1 
ATOM   8797 O OD2 . ASP D 1 307 ? -24.888 -32.278 26.084  1.00 39.47 ? 327 ASP D OD2 1 
ATOM   8798 N N   . THR D 1 308 ? -19.331 -32.295 25.675  1.00 32.64 ? 328 THR D N   1 
ATOM   8799 C CA  . THR D 1 308 ? -18.110 -33.088 25.654  1.00 32.64 ? 328 THR D CA  1 
ATOM   8800 C C   . THR D 1 308 ? -16.922 -32.390 26.300  1.00 32.64 ? 328 THR D C   1 
ATOM   8801 O O   . THR D 1 308 ? -15.816 -32.933 26.292  1.00 32.64 ? 328 THR D O   1 
ATOM   8802 C CB  . THR D 1 308 ? -17.698 -33.391 24.196  1.00 30.56 ? 328 THR D CB  1 
ATOM   8803 O OG1 . THR D 1 308 ? -17.162 -32.181 23.620  1.00 30.56 ? 328 THR D OG1 1 
ATOM   8804 C CG2 . THR D 1 308 ? -18.865 -33.847 23.366  1.00 30.56 ? 328 THR D CG2 1 
ATOM   8805 N N   . LEU D 1 309 ? -17.073 -31.175 26.799  1.00 34.44 ? 329 LEU D N   1 
ATOM   8806 C CA  . LEU D 1 309 ? -15.970 -30.466 27.426  1.00 34.44 ? 329 LEU D CA  1 
ATOM   8807 C C   . LEU D 1 309 ? -15.580 -31.237 28.708  1.00 34.44 ? 329 LEU D C   1 
ATOM   8808 O O   . LEU D 1 309 ? -16.459 -31.848 29.362  1.00 34.44 ? 329 LEU D O   1 
ATOM   8809 C CB  . LEU D 1 309 ? -16.296 -29.035 27.790  1.00 34.19 ? 329 LEU D CB  1 
ATOM   8810 C CG  . LEU D 1 309 ? -15.828 -27.921 26.878  1.00 34.19 ? 329 LEU D CG  1 
ATOM   8811 C CD1 . LEU D 1 309 ? -16.311 -26.596 27.453  1.00 34.19 ? 329 LEU D CD1 1 
ATOM   8812 C CD2 . LEU D 1 309 ? -14.323 -27.926 26.754  1.00 34.19 ? 329 LEU D CD2 1 
ATOM   8813 O OXT . LEU D 1 309 ? -14.117 -31.407 28.923  1.00 34.19 ? 329 LEU D OXT 1 
HETATM 8814 S S   . SO4 E 2 .   ? 15.157  22.811  3.130   1.00 82.53 ? 331 SO4 A S   1 
HETATM 8815 O O1  . SO4 E 2 .   ? 14.303  21.739  2.512   1.00 82.53 ? 331 SO4 A O1  1 
HETATM 8816 O O2  . SO4 E 2 .   ? 15.322  22.651  4.594   1.00 82.53 ? 331 SO4 A O2  1 
HETATM 8817 O O3  . SO4 E 2 .   ? 14.539  24.160  2.851   1.00 82.53 ? 331 SO4 A O3  1 
HETATM 8818 O O4  . SO4 E 2 .   ? 16.497  22.779  2.424   1.00 82.53 ? 331 SO4 A O4  1 
HETATM 8819 P PA  . NAD F 3 .   ? 4.903   26.825  7.628   1.00 14.39 ? 330 NAD A PA  1 
HETATM 8820 O O1A . NAD F 3 .   ? 5.227   28.193  8.043   1.00 14.39 ? 330 NAD A O1A 1 
HETATM 8821 O O2A . NAD F 3 .   ? 4.083   26.595  6.422   1.00 14.39 ? 330 NAD A O2A 1 
HETATM 8822 O O5B . NAD F 3 .   ? 4.181   26.016  8.784   1.00 14.39 ? 330 NAD A O5B 1 
HETATM 8823 C C5B . NAD F 3 .   ? 4.538   26.126  10.173  1.00 14.39 ? 330 NAD A C5B 1 
HETATM 8824 C C4B . NAD F 3 .   ? 3.257   25.651  10.894  1.00 14.39 ? 330 NAD A C4B 1 
HETATM 8825 O O4B . NAD F 3 .   ? 3.696   25.577  12.307  1.00 14.39 ? 330 NAD A O4B 1 
HETATM 8826 C C3B . NAD F 3 .   ? 2.193   26.774  10.897  1.00 14.39 ? 330 NAD A C3B 1 
HETATM 8827 O O3B . NAD F 3 .   ? 0.868   26.262  10.618  1.00 14.39 ? 330 NAD A O3B 1 
HETATM 8828 C C2B . NAD F 3 .   ? 2.219   27.386  12.281  1.00 14.39 ? 330 NAD A C2B 1 
HETATM 8829 O O2B . NAD F 3 .   ? 0.983   27.752  12.742  1.00 14.39 ? 330 NAD A O2B 1 
HETATM 8830 C C1B . NAD F 3 .   ? 2.666   26.095  13.066  1.00 14.39 ? 330 NAD A C1B 1 
HETATM 8831 N N9A . NAD F 3 .   ? 3.215   26.508  14.319  1.00 14.39 ? 330 NAD A N9A 1 
HETATM 8832 C C8A . NAD F 3 .   ? 4.047   27.530  14.671  1.00 14.39 ? 330 NAD A C8A 1 
HETATM 8833 N N7A . NAD F 3 .   ? 4.335   27.638  15.954  1.00 14.39 ? 330 NAD A N7A 1 
HETATM 8834 C C5A . NAD F 3 .   ? 3.667   26.609  16.529  1.00 14.39 ? 330 NAD A C5A 1 
HETATM 8835 C C6A . NAD F 3 .   ? 3.593   26.213  17.924  1.00 14.39 ? 330 NAD A C6A 1 
HETATM 8836 N N6A . NAD F 3 .   ? 4.202   26.824  18.920  1.00 14.39 ? 330 NAD A N6A 1 
HETATM 8837 N N1A . NAD F 3 .   ? 2.827   25.130  18.111  1.00 14.39 ? 330 NAD A N1A 1 
HETATM 8838 C C2A . NAD F 3 .   ? 2.161   24.459  17.146  1.00 14.39 ? 330 NAD A C2A 1 
HETATM 8839 N N3A . NAD F 3 .   ? 2.181   24.799  15.833  1.00 14.39 ? 330 NAD A N3A 1 
HETATM 8840 C C4A . NAD F 3 .   ? 2.958   25.906  15.555  1.00 14.39 ? 330 NAD A C4A 1 
HETATM 8841 O O3  . NAD F 3 .   ? 6.296   26.071  7.504   1.00 14.39 ? 330 NAD A O3  1 
HETATM 8842 P PN  . NAD F 3 .   ? 6.719   24.785  6.663   1.00 14.39 ? 330 NAD A PN  1 
HETATM 8843 O O1N . NAD F 3 .   ? 7.063   25.124  5.240   1.00 14.39 ? 330 NAD A O1N 1 
HETATM 8844 O O2N . NAD F 3 .   ? 5.655   23.780  6.776   1.00 14.39 ? 330 NAD A O2N 1 
HETATM 8845 O O5D . NAD F 3 .   ? 8.032   24.270  7.407   1.00 14.39 ? 330 NAD A O5D 1 
HETATM 8846 C C5D . NAD F 3 .   ? 7.955   24.034  8.824   1.00 14.39 ? 330 NAD A C5D 1 
HETATM 8847 C C4D . NAD F 3 .   ? 9.310   23.925  9.391   1.00 14.39 ? 330 NAD A C4D 1 
HETATM 8848 O O4D . NAD F 3 .   ? 9.989   22.878  8.506   1.00 14.39 ? 330 NAD A O4D 1 
HETATM 8849 C C3D . NAD F 3 .   ? 10.209  25.171  9.178   1.00 14.39 ? 330 NAD A C3D 1 
HETATM 8850 O O3D . NAD F 3 .   ? 11.025  25.223  10.307  1.00 14.39 ? 330 NAD A O3D 1 
HETATM 8851 C C2D . NAD F 3 .   ? 11.091  24.855  7.925   1.00 14.39 ? 330 NAD A C2D 1 
HETATM 8852 O O2D . NAD F 3 .   ? 12.331  25.450  8.084   1.00 14.39 ? 330 NAD A O2D 1 
HETATM 8853 C C1D . NAD F 3 .   ? 11.311  23.350  8.274   1.00 14.39 ? 330 NAD A C1D 1 
HETATM 8854 N N1N . NAD F 3 .   ? 11.849  22.548  7.116   1.00 14.39 ? 330 NAD A N1N 1 
HETATM 8855 C C2N . NAD F 3 .   ? 12.878  21.690  7.462   1.00 14.39 ? 330 NAD A C2N 1 
HETATM 8856 C C3N . NAD F 3 .   ? 13.371  20.950  6.413   1.00 14.39 ? 330 NAD A C3N 1 
HETATM 8857 C C7N . NAD F 3 .   ? 14.532  19.977  6.855   1.00 14.39 ? 330 NAD A C7N 1 
HETATM 8858 O O7N . NAD F 3 .   ? 15.056  19.260  6.009   1.00 14.39 ? 330 NAD A O7N 1 
HETATM 8859 N N7N . NAD F 3 .   ? 14.825  19.971  8.192   1.00 14.39 ? 330 NAD A N7N 1 
HETATM 8860 C C4N . NAD F 3 .   ? 12.920  20.979  5.117   1.00 14.39 ? 330 NAD A C4N 1 
HETATM 8861 C C5N . NAD F 3 .   ? 11.877  21.911  4.877   1.00 14.39 ? 330 NAD A C5N 1 
HETATM 8862 C C6N . NAD F 3 .   ? 11.333  22.683  5.881   1.00 14.39 ? 330 NAD A C6N 1 
HETATM 8863 S S   . SO4 G 2 .   ? 15.237  -22.678 -3.133  1.00 70.98 ? 331 SO4 B S   1 
HETATM 8864 O O1  . SO4 G 2 .   ? 16.465  -22.132 -2.446  1.00 70.98 ? 331 SO4 B O1  1 
HETATM 8865 O O2  . SO4 G 2 .   ? 15.391  -22.613 -4.618  1.00 70.98 ? 331 SO4 B O2  1 
HETATM 8866 O O3  . SO4 G 2 .   ? 14.024  -21.942 -2.666  1.00 70.98 ? 331 SO4 B O3  1 
HETATM 8867 O O4  . SO4 G 2 .   ? 15.082  -24.138 -2.739  1.00 70.98 ? 331 SO4 B O4  1 
HETATM 8868 P PA  . NAD H 3 .   ? 4.781   -26.774 -7.827  1.00 33.77 ? 330 NAD B PA  1 
HETATM 8869 O O1A . NAD H 3 .   ? 4.980   -28.166 -8.335  1.00 33.77 ? 330 NAD B O1A 1 
HETATM 8870 O O2A . NAD H 3 .   ? 3.878   -26.667 -6.621  1.00 33.77 ? 330 NAD B O2A 1 
HETATM 8871 O O5B . NAD H 3 .   ? 4.175   -25.824 -8.939  1.00 33.77 ? 330 NAD B O5B 1 
HETATM 8872 C C5B . NAD H 3 .   ? 4.534   -25.923 -10.339 1.00 33.77 ? 330 NAD B C5B 1 
HETATM 8873 C C4B . NAD H 3 .   ? 3.301   -25.631 -11.111 1.00 33.77 ? 330 NAD B C4B 1 
HETATM 8874 O O4B . NAD H 3 .   ? 3.750   -25.711 -12.526 1.00 33.77 ? 330 NAD B O4B 1 
HETATM 8875 C C3B . NAD H 3 .   ? 2.122   -26.614 -11.060 1.00 33.77 ? 330 NAD B C3B 1 
HETATM 8876 O O3B . NAD H 3 .   ? 0.863   -26.009 -10.614 1.00 33.77 ? 330 NAD B O3B 1 
HETATM 8877 C C2B . NAD H 3 .   ? 1.984   -27.290 -12.394 1.00 33.77 ? 330 NAD B C2B 1 
HETATM 8878 O O2B . NAD H 3 .   ? 0.743   -27.741 -12.765 1.00 33.77 ? 330 NAD B O2B 1 
HETATM 8879 C C1B . NAD H 3 .   ? 2.640   -26.208 -13.252 1.00 33.77 ? 330 NAD B C1B 1 
HETATM 8880 N N9A . NAD H 3 .   ? 3.155   -26.648 -14.517 1.00 33.77 ? 330 NAD B N9A 1 
HETATM 8881 C C8A . NAD H 3 .   ? 4.019   -27.641 -14.880 1.00 33.77 ? 330 NAD B C8A 1 
HETATM 8882 N N7A . NAD H 3 .   ? 4.265   -27.726 -16.191 1.00 33.77 ? 330 NAD B N7A 1 
HETATM 8883 C C5A . NAD H 3 .   ? 3.530   -26.750 -16.749 1.00 33.77 ? 330 NAD B C5A 1 
HETATM 8884 C C6A . NAD H 3 .   ? 3.399   -26.373 -18.156 1.00 33.77 ? 330 NAD B C6A 1 
HETATM 8885 N N6A . NAD H 3 .   ? 3.999   -26.960 -19.164 1.00 33.77 ? 330 NAD B N6A 1 
HETATM 8886 N N1A . NAD H 3 .   ? 2.558   -25.295 -18.341 1.00 33.77 ? 330 NAD B N1A 1 
HETATM 8887 C C2A . NAD H 3 .   ? 1.891   -24.657 -17.371 1.00 33.77 ? 330 NAD B C2A 1 
HETATM 8888 N N3A . NAD H 3 .   ? 1.981   -24.984 -16.032 1.00 33.77 ? 330 NAD B N3A 1 
HETATM 8889 C C4A . NAD H 3 .   ? 2.831   -26.051 -15.767 1.00 33.77 ? 330 NAD B C4A 1 
HETATM 8890 O O3  . NAD H 3 .   ? 6.160   -26.155 -7.551  1.00 33.77 ? 330 NAD B O3  1 
HETATM 8891 P PN  . NAD H 3 .   ? 6.637   -24.800 -6.789  1.00 33.77 ? 330 NAD B PN  1 
HETATM 8892 O O1N . NAD H 3 .   ? 7.008   -25.174 -5.419  1.00 33.77 ? 330 NAD B O1N 1 
HETATM 8893 O O2N . NAD H 3 .   ? 5.592   -23.761 -6.927  1.00 33.77 ? 330 NAD B O2N 1 
HETATM 8894 O O5D . NAD H 3 .   ? 7.913   -24.383 -7.616  1.00 33.77 ? 330 NAD B O5D 1 
HETATM 8895 C C5D . NAD H 3 .   ? 7.811   -24.003 -9.033  1.00 33.77 ? 330 NAD B C5D 1 
HETATM 8896 C C4D . NAD H 3 .   ? 9.185   -23.945 -9.555  1.00 33.77 ? 330 NAD B C4D 1 
HETATM 8897 O O4D . NAD H 3 .   ? 9.855   -22.889 -8.665  1.00 33.77 ? 330 NAD B O4D 1 
HETATM 8898 C C3D . NAD H 3 .   ? 10.075  -25.203 -9.296  1.00 33.77 ? 330 NAD B C3D 1 
HETATM 8899 O O3D . NAD H 3 .   ? 10.957  -25.254 -10.399 1.00 33.77 ? 330 NAD B O3D 1 
HETATM 8900 C C2D . NAD H 3 .   ? 10.902  -24.900 -8.002  1.00 33.77 ? 330 NAD B C2D 1 
HETATM 8901 O O2D . NAD H 3 .   ? 12.161  -25.476 -8.102  1.00 33.77 ? 330 NAD B O2D 1 
HETATM 8902 C C1D . NAD H 3 .   ? 11.114  -23.377 -8.308  1.00 33.77 ? 330 NAD B C1D 1 
HETATM 8903 N N1N . NAD H 3 .   ? 11.790  -22.549 -7.239  1.00 33.77 ? 330 NAD B N1N 1 
HETATM 8904 C C2N . NAD H 3 .   ? 12.867  -21.805 -7.690  1.00 33.77 ? 330 NAD B C2N 1 
HETATM 8905 C C3N . NAD H 3 .   ? 13.477  -21.058 -6.737  1.00 33.77 ? 330 NAD B C3N 1 
HETATM 8906 C C7N . NAD H 3 .   ? 14.675  -20.203 -7.272  1.00 33.77 ? 330 NAD B C7N 1 
HETATM 8907 O O7N . NAD H 3 .   ? 15.307  -19.616 -6.388  1.00 33.77 ? 330 NAD B O7N 1 
HETATM 8908 N N7N . NAD H 3 .   ? 14.880  -20.126 -8.607  1.00 33.77 ? 330 NAD B N7N 1 
HETATM 8909 C C4N . NAD H 3 .   ? 13.125  -20.956 -5.389  1.00 33.77 ? 330 NAD B C4N 1 
HETATM 8910 C C5N . NAD H 3 .   ? 12.019  -21.788 -5.033  1.00 33.77 ? 330 NAD B C5N 1 
HETATM 8911 C C6N . NAD H 3 .   ? 11.356  -22.565 -5.950  1.00 33.77 ? 330 NAD B C6N 1 
HETATM 8912 S S   . SO4 I 2 .   ? -15.334 23.259  -2.490  1.00 78.89 ? 331 SO4 C S   1 
HETATM 8913 O O1  . SO4 I 2 .   ? -16.033 23.716  -1.252  1.00 78.89 ? 331 SO4 C O1  1 
HETATM 8914 O O2  . SO4 I 2 .   ? -13.881 23.085  -2.200  1.00 78.89 ? 331 SO4 C O2  1 
HETATM 8915 O O3  . SO4 I 2 .   ? -15.468 24.328  -3.583  1.00 78.89 ? 331 SO4 C O3  1 
HETATM 8916 O O4  . SO4 I 2 .   ? -15.922 22.004  -3.026  1.00 78.89 ? 331 SO4 C O4  1 
HETATM 8917 P PA  . NAD J 3 .   ? -4.480  26.916  -7.831  1.00 32.58 ? 330 NAD C PA  1 
HETATM 8918 O O1A . NAD J 3 .   ? -4.772  28.396  -8.101  1.00 32.58 ? 330 NAD C O1A 1 
HETATM 8919 O O2A . NAD J 3 .   ? -3.582  26.713  -6.629  1.00 32.58 ? 330 NAD C O2A 1 
HETATM 8920 O O5B . NAD J 3 .   ? -3.928  26.214  -9.106  1.00 32.58 ? 330 NAD C O5B 1 
HETATM 8921 C C5B . NAD J 3 .   ? -4.271  26.150  -10.505 1.00 32.58 ? 330 NAD C C5B 1 
HETATM 8922 C C4B . NAD J 3 .   ? -2.987  25.770  -11.238 1.00 32.58 ? 330 NAD C C4B 1 
HETATM 8923 O O4B . NAD J 3 .   ? -3.321  25.715  -12.657 1.00 32.58 ? 330 NAD C O4B 1 
HETATM 8924 C C3B . NAD J 3 .   ? -1.826  26.783  -11.133 1.00 32.58 ? 330 NAD C C3B 1 
HETATM 8925 O O3B . NAD J 3 .   ? -0.577  26.241  -10.590 1.00 32.58 ? 330 NAD C O3B 1 
HETATM 8926 C C2B . NAD J 3 .   ? -1.611  27.380  -12.500 1.00 32.58 ? 330 NAD C C2B 1 
HETATM 8927 O O2B . NAD J 3 .   ? -0.341  27.740  -12.881 1.00 32.58 ? 330 NAD C O2B 1 
HETATM 8928 C C1B . NAD J 3 .   ? -2.240  26.282  -13.370 1.00 32.58 ? 330 NAD C C1B 1 
HETATM 8929 N N9A . NAD J 3 .   ? -2.706  26.787  -14.634 1.00 32.58 ? 330 NAD C N9A 1 
HETATM 8930 C C8A . NAD J 3 .   ? -3.442  27.910  -14.915 1.00 32.58 ? 330 NAD C C8A 1 
HETATM 8931 N N7A . NAD J 3 .   ? -3.742  28.094  -16.188 1.00 32.58 ? 330 NAD C N7A 1 
HETATM 8932 C C5A . NAD J 3 .   ? -3.189  27.049  -16.839 1.00 32.58 ? 330 NAD C C5A 1 
HETATM 8933 C C6A . NAD J 3 .   ? -3.214  26.720  -18.260 1.00 32.58 ? 330 NAD C C6A 1 
HETATM 8934 N N6A . NAD J 3 .   ? -3.784  27.451  -19.201 1.00 32.58 ? 330 NAD C N6A 1 
HETATM 8935 N N1A . NAD J 3 .   ? -2.540  25.540  -18.513 1.00 32.58 ? 330 NAD C N1A 1 
HETATM 8936 C C2A . NAD J 3 .   ? -1.937  24.755  -17.622 1.00 32.58 ? 330 NAD C C2A 1 
HETATM 8937 N N3A . NAD J 3 .   ? -1.893  25.064  -16.275 1.00 32.58 ? 330 NAD C N3A 1 
HETATM 8938 C C4A . NAD J 3 .   ? -2.536  26.214  -15.914 1.00 32.58 ? 330 NAD C C4A 1 
HETATM 8939 O O3  . NAD J 3 .   ? -5.848  26.212  -7.711  1.00 32.58 ? 330 NAD C O3  1 
HETATM 8940 P PN  . NAD J 3 .   ? -6.491  24.950  -6.907  1.00 32.58 ? 330 NAD C PN  1 
HETATM 8941 O O1N . NAD J 3 .   ? -6.698  25.428  -5.558  1.00 32.58 ? 330 NAD C O1N 1 
HETATM 8942 O O2N . NAD J 3 .   ? -5.764  23.725  -7.286  1.00 32.58 ? 330 NAD C O2N 1 
HETATM 8943 O O5D . NAD J 3 .   ? -7.919  24.862  -7.654  1.00 32.58 ? 330 NAD C O5D 1 
HETATM 8944 C C5D . NAD J 3 .   ? -8.066  24.134  -8.875  1.00 32.58 ? 330 NAD C C5D 1 
HETATM 8945 C C4D . NAD J 3 .   ? -9.395  24.093  -9.415  1.00 32.58 ? 330 NAD C C4D 1 
HETATM 8946 O O4D . NAD J 3 .   ? -10.151 22.995  -8.695  1.00 32.58 ? 330 NAD C O4D 1 
HETATM 8947 C C3D . NAD J 3 .   ? -10.392 25.296  -9.360  1.00 32.58 ? 330 NAD C C3D 1 
HETATM 8948 O O3D . NAD J 3 .   ? -11.267 25.022  -10.435 1.00 32.58 ? 330 NAD C O3D 1 
HETATM 8949 C C2D . NAD J 3 .   ? -11.155 25.071  -8.027  1.00 32.58 ? 330 NAD C C2D 1 
HETATM 8950 O O2D . NAD J 3 .   ? -12.391 25.700  -7.910  1.00 32.58 ? 330 NAD C O2D 1 
HETATM 8951 C C1D . NAD J 3 .   ? -11.385 23.511  -8.249  1.00 32.58 ? 330 NAD C C1D 1 
HETATM 8952 N N1N . NAD J 3 .   ? -11.827 22.836  -6.938  1.00 32.58 ? 330 NAD C N1N 1 
HETATM 8953 C C2N . NAD J 3 .   ? -12.988 22.100  -7.076  1.00 32.58 ? 330 NAD C C2N 1 
HETATM 8954 C C3N . NAD J 3 .   ? -13.399 21.546  -5.899  1.00 32.58 ? 330 NAD C C3N 1 
HETATM 8955 C C7N . NAD J 3 .   ? -14.687 20.657  -6.059  1.00 32.58 ? 330 NAD C C7N 1 
HETATM 8956 O O7N . NAD J 3 .   ? -15.335 20.507  -5.018  1.00 32.58 ? 330 NAD C O7N 1 
HETATM 8957 N N7N . NAD J 3 .   ? -14.913 20.122  -7.271  1.00 32.58 ? 330 NAD C N7N 1 
HETATM 8958 C C4N . NAD J 3 .   ? -12.789 21.636  -4.639  1.00 32.58 ? 330 NAD C C4N 1 
HETATM 8959 C C5N . NAD J 3 .   ? -11.622 22.451  -4.658  1.00 32.58 ? 330 NAD C C5N 1 
HETATM 8960 C C6N . NAD J 3 .   ? -11.145 23.051  -5.778  1.00 32.58 ? 330 NAD C C6N 1 
HETATM 8961 S S   . SO4 K 2 .   ? -15.314 -22.840 2.396   1.00 86.06 ? 331 SO4 D S   1 
HETATM 8962 O O1  . SO4 K 2 .   ? -16.253 -23.451 1.383   1.00 86.06 ? 331 SO4 D O1  1 
HETATM 8963 O O2  . SO4 K 2 .   ? -16.060 -22.283 3.561   1.00 86.06 ? 331 SO4 D O2  1 
HETATM 8964 O O3  . SO4 K 2 .   ? -14.533 -21.744 1.716   1.00 86.06 ? 331 SO4 D O3  1 
HETATM 8965 O O4  . SO4 K 2 .   ? -14.363 -23.903 2.878   1.00 86.06 ? 331 SO4 D O4  1 
HETATM 8966 P PA  . NAD L 3 .   ? -4.500  -26.881 7.794   1.00 35.64 ? 330 NAD D PA  1 
HETATM 8967 O O1A . NAD L 3 .   ? -4.691  -28.379 8.042   1.00 35.64 ? 330 NAD D O1A 1 
HETATM 8968 O O2A . NAD L 3 .   ? -3.778  -26.519 6.522   1.00 35.64 ? 330 NAD D O2A 1 
HETATM 8969 O O5B . NAD L 3 .   ? -3.754  -26.287 9.054   1.00 35.64 ? 330 NAD D O5B 1 
HETATM 8970 C C5B . NAD L 3 .   ? -4.201  -26.232 10.451  1.00 35.64 ? 330 NAD D C5B 1 
HETATM 8971 C C4B . NAD L 3 .   ? -2.943  -25.787 11.172  1.00 35.64 ? 330 NAD D C4B 1 
HETATM 8972 O O4B . NAD L 3 .   ? -3.249  -25.693 12.604  1.00 35.64 ? 330 NAD D O4B 1 
HETATM 8973 C C3B . NAD L 3 .   ? -1.743  -26.740 11.045  1.00 35.64 ? 330 NAD D C3B 1 
HETATM 8974 O O3B . NAD L 3 .   ? -0.501  -26.043 10.675  1.00 35.64 ? 330 NAD D O3B 1 
HETATM 8975 C C2B . NAD L 3 .   ? -1.524  -27.377 12.420  1.00 35.64 ? 330 NAD D C2B 1 
HETATM 8976 O O2B . NAD L 3 .   ? -0.199  -27.605 12.694  1.00 35.64 ? 330 NAD D O2B 1 
HETATM 8977 C C1B . NAD L 3 .   ? -2.121  -26.249 13.284  1.00 35.64 ? 330 NAD D C1B 1 
HETATM 8978 N N9A . NAD L 3 .   ? -2.636  -26.731 14.543  1.00 35.64 ? 330 NAD D N9A 1 
HETATM 8979 C C8A . NAD L 3 .   ? -3.432  -27.817 14.826  1.00 35.64 ? 330 NAD D C8A 1 
HETATM 8980 N N7A . NAD L 3 .   ? -3.736  -27.980 16.086  1.00 35.64 ? 330 NAD D N7A 1 
HETATM 8981 C C5A . NAD L 3 .   ? -3.116  -26.973 16.739  1.00 35.64 ? 330 NAD D C5A 1 
HETATM 8982 C C6A . NAD L 3 .   ? -3.102  -26.654 18.147  1.00 35.64 ? 330 NAD D C6A 1 
HETATM 8983 N N6A . NAD L 3 .   ? -3.722  -27.375 19.053  1.00 35.64 ? 330 NAD D N6A 1 
HETATM 8984 N N1A . NAD L 3 .   ? -2.367  -25.529 18.442  1.00 35.64 ? 330 NAD D N1A 1 
HETATM 8985 C C2A . NAD L 3 .   ? -1.726  -24.785 17.559  1.00 35.64 ? 330 NAD D C2A 1 
HETATM 8986 N N3A . NAD L 3 .   ? -1.716  -25.064 16.199  1.00 35.64 ? 330 NAD D N3A 1 
HETATM 8987 C C4A . NAD L 3 .   ? -2.421  -26.159 15.812  1.00 35.64 ? 330 NAD D C4A 1 
HETATM 8988 O O3  . NAD L 3 .   ? -5.898  -26.184 7.884   1.00 35.64 ? 330 NAD D O3  1 
HETATM 8989 P PN  . NAD L 3 .   ? -6.523  -24.961 6.932   1.00 35.64 ? 330 NAD D PN  1 
HETATM 8990 O O1N . NAD L 3 .   ? -6.658  -25.535 5.607   1.00 35.64 ? 330 NAD D O1N 1 
HETATM 8991 O O2N . NAD L 3 .   ? -5.706  -23.776 7.219   1.00 35.64 ? 330 NAD D O2N 1 
HETATM 8992 O O5D . NAD L 3 .   ? -7.956  -24.803 7.605   1.00 35.64 ? 330 NAD D O5D 1 
HETATM 8993 C C5D . NAD L 3 .   ? -8.074  -24.406 8.971   1.00 35.64 ? 330 NAD D C5D 1 
HETATM 8994 C C4D . NAD L 3 .   ? -9.399  -24.219 9.498   1.00 35.64 ? 330 NAD D C4D 1 
HETATM 8995 O O4D . NAD L 3 .   ? -10.031 -23.094 8.669   1.00 35.64 ? 330 NAD D O4D 1 
HETATM 8996 C C3D . NAD L 3 .   ? -10.482 -25.359 9.429   1.00 35.64 ? 330 NAD D C3D 1 
HETATM 8997 O O3D . NAD L 3 .   ? -11.426 -25.083 10.425  1.00 35.64 ? 330 NAD D O3D 1 
HETATM 8998 C C2D . NAD L 3 .   ? -11.161 -25.123 8.039   1.00 35.64 ? 330 NAD D C2D 1 
HETATM 8999 O O2D . NAD L 3 .   ? -12.446 -25.661 7.983   1.00 35.64 ? 330 NAD D O2D 1 
HETATM 9000 C C1D . NAD L 3 .   ? -11.319 -23.546 8.270   1.00 35.64 ? 330 NAD D C1D 1 
HETATM 9001 N N1N . NAD L 3 .   ? -11.827 -22.821 7.017   1.00 35.64 ? 330 NAD D N1N 1 
HETATM 9002 C C2N . NAD L 3 .   ? -13.011 -22.114 7.275   1.00 35.64 ? 330 NAD D C2N 1 
HETATM 9003 C C3N . NAD L 3 .   ? -13.483 -21.501 6.175   1.00 35.64 ? 330 NAD D C3N 1 
HETATM 9004 C C7N . NAD L 3 .   ? -14.771 -20.622 6.335   1.00 35.64 ? 330 NAD D C7N 1 
HETATM 9005 O O7N . NAD L 3 .   ? -15.324 -20.453 5.237   1.00 35.64 ? 330 NAD D O7N 1 
HETATM 9006 N N7N . NAD L 3 .   ? -15.063 -20.115 7.537   1.00 35.64 ? 330 NAD D N7N 1 
HETATM 9007 C C4N . NAD L 3 .   ? -12.927 -21.492 4.876   1.00 35.64 ? 330 NAD D C4N 1 
HETATM 9008 C C5N . NAD L 3 .   ? -11.742 -22.249 4.761   1.00 35.64 ? 330 NAD D C5N 1 
HETATM 9009 C C6N . NAD L 3 .   ? -11.202 -22.918 5.822   1.00 35.64 ? 330 NAD D C6N 1 
HETATM 9010 O O   . HOH M 4 .   ? 13.280  12.209  0.819   1.00 15.65 ? 332 HOH A O   1 
HETATM 9011 O O   . HOH M 4 .   ? 7.886   4.263   19.732  1.00 26.81 ? 333 HOH A O   1 
HETATM 9012 O O   . HOH M 4 .   ? -5.960  6.591   5.962   1.00 19.19 ? 334 HOH A O   1 
HETATM 9013 O O   . HOH M 4 .   ? -4.420  6.365   8.100   1.00 13.44 ? 335 HOH A O   1 
HETATM 9014 O O   . HOH M 4 .   ? 25.720  7.777   14.829  1.00 22.83 ? 336 HOH A O   1 
HETATM 9015 O O   . HOH M 4 .   ? 18.094  8.691   1.802   1.00 20.89 ? 337 HOH A O   1 
HETATM 9016 O O   . HOH M 4 .   ? -17.678 5.581   0.328   1.00 26.94 ? 338 HOH A O   1 
HETATM 9017 O O   . HOH M 4 .   ? 16.019  17.376  7.329   1.00 26.86 ? 339 HOH A O   1 
HETATM 9018 O O   . HOH M 4 .   ? 5.931   0.966   10.802  1.00 16.62 ? 340 HOH A O   1 
HETATM 9019 O O   . HOH M 4 .   ? -5.331  11.115  -1.062  1.00 16.59 ? 341 HOH A O   1 
HETATM 9020 O O   . HOH M 4 .   ? 4.896   8.385   1.618   1.00 21.95 ? 342 HOH A O   1 
HETATM 9021 O O   . HOH M 4 .   ? -11.511 5.199   5.002   1.00 17.11 ? 343 HOH A O   1 
HETATM 9022 O O   . HOH M 4 .   ? -5.361  2.599   8.696   1.00 18.23 ? 344 HOH A O   1 
HETATM 9023 O O   . HOH M 4 .   ? -8.470  0.599   7.314   1.00 19.64 ? 345 HOH A O   1 
HETATM 9024 O O   . HOH M 4 .   ? 10.704  -0.163  -8.291  1.00 20.72 ? 346 HOH A O   1 
HETATM 9025 O O   . HOH M 4 .   ? -13.114 5.434   6.872   1.00 26.44 ? 347 HOH A O   1 
HETATM 9026 O O   . HOH M 4 .   ? 20.234  10.648  19.711  1.00 30.18 ? 348 HOH A O   1 
HETATM 9027 O O   . HOH M 4 .   ? 11.413  2.630   7.080   1.00 13.66 ? 349 HOH A O   1 
HETATM 9028 O O   . HOH M 4 .   ? -13.455 3.866   0.040   1.00 34.10 ? 350 HOH A O   1 
HETATM 9029 O O   . HOH M 4 .   ? 16.028  -0.125  -6.048  1.00 24.24 ? 351 HOH A O   1 
HETATM 9030 O O   . HOH M 4 .   ? 20.262  6.799   5.287   1.00 27.99 ? 352 HOH A O   1 
HETATM 9031 O O   . HOH M 4 .   ? -8.945  6.155   -3.412  1.00 34.44 ? 353 HOH A O   1 
HETATM 9032 O O   . HOH M 4 .   ? 26.432  13.467  17.221  1.00 20.84 ? 354 HOH A O   1 
HETATM 9033 O O   . HOH M 4 .   ? 18.555  -0.975  -5.715  1.00 29.56 ? 355 HOH A O   1 
HETATM 9034 O O   . HOH M 4 .   ? 21.911  17.601  10.466  1.00 20.68 ? 356 HOH A O   1 
HETATM 9035 O O   . HOH M 4 .   ? -1.350  -0.160  6.669   1.00 27.53 ? 357 HOH A O   1 
HETATM 9036 O O   . HOH M 4 .   ? 13.720  -0.948  19.971  1.00 24.30 ? 358 HOH A O   1 
HETATM 9037 O O   . HOH M 4 .   ? 4.206   7.465   24.206  1.00 17.52 ? 359 HOH A O   1 
HETATM 9038 O O   . HOH M 4 .   ? -15.794 11.031  4.252   1.00 20.45 ? 360 HOH A O   1 
HETATM 9039 O O   . HOH M 4 .   ? -3.400  21.588  3.693   1.00 36.46 ? 361 HOH A O   1 
HETATM 9040 O O   . HOH M 4 .   ? 0.625   18.585  -1.782  1.00 16.67 ? 362 HOH A O   1 
HETATM 9041 O O   . HOH M 4 .   ? 11.648  18.808  0.852   1.00 20.76 ? 363 HOH A O   1 
HETATM 9042 O O   . HOH M 4 .   ? -13.066 18.859  2.002   1.00 29.46 ? 364 HOH A O   1 
HETATM 9043 O O   . HOH M 4 .   ? 20.587  18.345  24.330  1.00 29.94 ? 365 HOH A O   1 
HETATM 9044 O O   . HOH M 4 .   ? -11.537 10.285  10.274  1.00 23.67 ? 366 HOH A O   1 
HETATM 9045 O O   . HOH M 4 .   ? 4.469   22.298  8.835   1.00 11.94 ? 367 HOH A O   1 
HETATM 9046 O O   . HOH M 4 .   ? 1.562   20.488  1.933   1.00 19.78 ? 368 HOH A O   1 
HETATM 9047 O O   . HOH M 4 .   ? -11.502 11.414  12.580  1.00 22.14 ? 369 HOH A O   1 
HETATM 9048 O O   . HOH M 4 .   ? -10.831 16.902  17.714  1.00 28.04 ? 370 HOH A O   1 
HETATM 9049 O O   . HOH M 4 .   ? 14.015  2.318   6.277   1.00 23.36 ? 371 HOH A O   1 
HETATM 9050 O O   . HOH M 4 .   ? 0.183   3.594   20.163  1.00 30.26 ? 372 HOH A O   1 
HETATM 9051 O O   . HOH M 4 .   ? 3.028   20.196  -0.309  1.00 23.91 ? 373 HOH A O   1 
HETATM 9052 O O   . HOH M 4 .   ? 17.346  10.896  -9.986  1.00 34.06 ? 374 HOH A O   1 
HETATM 9053 O O   . HOH M 4 .   ? -8.871  -0.684  4.995   1.00 29.04 ? 375 HOH A O   1 
HETATM 9054 O O   . HOH M 4 .   ? 23.599  8.323   18.726  1.00 39.83 ? 376 HOH A O   1 
HETATM 9055 O O   . HOH M 4 .   ? -5.838  4.587   2.237   1.00 31.27 ? 377 HOH A O   1 
HETATM 9056 O O   . HOH M 4 .   ? -2.768  3.792   20.115  1.00 33.43 ? 378 HOH A O   1 
HETATM 9057 O O   . HOH M 4 .   ? 9.981   9.943   24.950  1.00 25.91 ? 379 HOH A O   1 
HETATM 9058 O O   . HOH M 4 .   ? 21.693  4.596   5.146   1.00 39.68 ? 380 HOH A O   1 
HETATM 9059 O O   . HOH M 4 .   ? 13.117  32.222  24.704  1.00 36.09 ? 381 HOH A O   1 
HETATM 9060 O O   . HOH M 4 .   ? 24.979  1.321   -4.602  1.00 35.01 ? 382 HOH A O   1 
HETATM 9061 O O   . HOH M 4 .   ? -6.546  6.511   -2.699  1.00 36.70 ? 383 HOH A O   1 
HETATM 9062 O O   . HOH M 4 .   ? 19.635  6.874   2.743   1.00 44.79 ? 384 HOH A O   1 
HETATM 9063 O O   . HOH M 4 .   ? 22.405  6.560   1.366   1.00 44.82 ? 385 HOH A O   1 
HETATM 9064 O O   . HOH M 4 .   ? 13.536  -5.724  15.728  1.00 43.06 ? 386 HOH A O   1 
HETATM 9065 O O   . HOH M 4 .   ? -11.442 -0.262  1.381   1.00 34.55 ? 387 HOH A O   1 
HETATM 9066 O O   . HOH M 4 .   ? 9.085   24.074  3.807   1.00 13.34 ? 388 HOH A O   1 
HETATM 9067 O O   . HOH M 4 .   ? -0.528  27.027  8.319   1.00 34.64 ? 389 HOH A O   1 
HETATM 9068 O O   . HOH M 4 .   ? -4.528  27.497  19.525  1.00 37.03 ? 390 HOH A O   1 
HETATM 9069 O O   . HOH M 4 .   ? 5.849   2.211   19.366  1.00 48.77 ? 391 HOH A O   1 
HETATM 9070 O O   . HOH M 4 .   ? 14.955  -6.028  12.497  1.00 35.59 ? 392 HOH A O   1 
HETATM 9071 O O   . HOH M 4 .   ? 9.665   3.988   22.345  1.00 30.96 ? 393 HOH A O   1 
HETATM 9072 O O   . HOH M 4 .   ? 1.942   21.750  30.148  1.00 31.45 ? 394 HOH A O   1 
HETATM 9073 O O   . HOH M 4 .   ? 11.342  29.878  25.702  1.00 39.93 ? 395 HOH A O   1 
HETATM 9074 O O   . HOH M 4 .   ? 4.251   30.185  11.595  1.00 22.72 ? 396 HOH A O   1 
HETATM 9075 O O   . HOH M 4 .   ? 3.432   26.807  21.873  1.00 34.91 ? 397 HOH A O   1 
HETATM 9076 O O   . HOH M 4 .   ? 20.426  11.179  27.572  1.00 35.25 ? 398 HOH A O   1 
HETATM 9077 O O   . HOH M 4 .   ? 7.362   28.845  24.433  1.00 38.59 ? 399 HOH A O   1 
HETATM 9078 O O   . HOH M 4 .   ? 1.346   27.010  6.051   1.00 22.33 ? 400 HOH A O   1 
HETATM 9079 O O   . HOH M 4 .   ? -0.043  18.660  28.463  1.00 36.53 ? 401 HOH A O   1 
HETATM 9080 O O   . HOH M 4 .   ? 20.896  22.438  11.620  1.00 24.81 ? 402 HOH A O   1 
HETATM 9081 O O   . HOH M 4 .   ? 13.180  25.516  4.464   1.00 36.51 ? 403 HOH A O   1 
HETATM 9082 O O   . HOH M 4 .   ? -11.319 26.794  10.163  1.00 36.16 ? 404 HOH A O   1 
HETATM 9083 O O   . HOH M 4 .   ? 1.265   23.187  0.959   1.00 40.36 ? 405 HOH A O   1 
HETATM 9084 O O   . HOH M 4 .   ? -14.934 17.051  12.548  1.00 44.65 ? 406 HOH A O   1 
HETATM 9085 O O   . HOH M 4 .   ? 25.767  21.930  -11.097 1.00 49.47 ? 407 HOH A O   1 
HETATM 9086 O O   . HOH M 4 .   ? 13.708  33.317  22.173  1.00 47.76 ? 408 HOH A O   1 
HETATM 9087 O O   . HOH M 4 .   ? 33.619  6.923   -3.524  1.00 38.01 ? 409 HOH A O   1 
HETATM 9088 O O   . HOH M 4 .   ? 3.382   30.068  9.190   1.00 37.06 ? 410 HOH A O   1 
HETATM 9089 O O   . HOH M 4 .   ? 5.461   11.043  0.939   1.00 15.58 ? 411 HOH A O   1 
HETATM 9090 O O   . HOH M 4 .   ? 3.609   21.551  -3.602  1.00 20.39 ? 412 HOH A O   1 
HETATM 9091 O O   . HOH M 4 .   ? 10.671  2.607   4.719   1.00 35.00 ? 413 HOH A O   1 
HETATM 9092 O O   . HOH M 4 .   ? -12.375 2.681   -2.304  1.00 40.20 ? 414 HOH A O   1 
HETATM 9093 O O   . HOH M 4 .   ? -5.745  -0.844  10.841  1.00 19.43 ? 415 HOH A O   1 
HETATM 9094 O O   . HOH M 4 .   ? -5.881  0.109   8.371   1.00 16.22 ? 416 HOH A O   1 
HETATM 9095 O O   . HOH M 4 .   ? -3.822  -0.614  6.757   1.00 46.19 ? 417 HOH A O   1 
HETATM 9096 O O   . HOH M 4 .   ? 14.298  -8.785  10.879  1.00 42.34 ? 418 HOH A O   1 
HETATM 9097 O O   . HOH N 4 .   ? 24.350  1.227   -8.210  1.00 29.61 ? 332 HOH B O   1 
HETATM 9098 O O   . HOH N 4 .   ? -10.207 2.938   -4.372  1.00 35.64 ? 333 HOH B O   1 
HETATM 9099 O O   . HOH N 4 .   ? 26.530  -0.479  -6.129  1.00 36.17 ? 334 HOH B O   1 
HETATM 9100 O O   . HOH N 4 .   ? 13.231  -12.312 -0.900  1.00 14.54 ? 335 HOH B O   1 
HETATM 9101 O O   . HOH N 4 .   ? 7.883   -4.110  -19.793 1.00 40.29 ? 336 HOH B O   1 
HETATM 9102 O O   . HOH N 4 .   ? -6.157  -6.580  -6.017  1.00 23.91 ? 337 HOH B O   1 
HETATM 9103 O O   . HOH N 4 .   ? -4.448  -6.186  -8.075  1.00 19.99 ? 338 HOH B O   1 
HETATM 9104 O O   . HOH N 4 .   ? 24.144  -1.526  8.274   1.00 26.66 ? 339 HOH B O   1 
HETATM 9105 O O   . HOH N 4 .   ? 25.521  -7.870  -14.799 1.00 40.14 ? 340 HOH B O   1 
HETATM 9106 O O   . HOH N 4 .   ? -17.572 -5.547  -0.443  1.00 33.31 ? 341 HOH B O   1 
HETATM 9107 O O   . HOH N 4 .   ? 16.144  -17.426 -7.377  1.00 24.65 ? 342 HOH B O   1 
HETATM 9108 O O   . HOH N 4 .   ? -5.420  -11.226 0.935   1.00 21.60 ? 343 HOH B O   1 
HETATM 9109 O O   . HOH N 4 .   ? 4.910   -8.136  -1.924  1.00 36.68 ? 344 HOH B O   1 
HETATM 9110 O O   . HOH N 4 .   ? -11.485 -5.068  -5.021  1.00 21.29 ? 345 HOH B O   1 
HETATM 9111 O O   . HOH N 4 .   ? 5.759   0.209   -8.486  1.00 13.42 ? 346 HOH B O   1 
HETATM 9112 O O   . HOH N 4 .   ? 4.024   -0.619  -6.558  1.00 27.92 ? 347 HOH B O   1 
HETATM 9113 O O   . HOH N 4 .   ? -5.237  -2.703  -8.796  1.00 24.56 ? 348 HOH B O   1 
HETATM 9114 O O   . HOH N 4 .   ? -8.529  -0.436  -7.457  1.00 13.32 ? 349 HOH B O   1 
HETATM 9115 O O   . HOH N 4 .   ? 10.847  0.184   8.208   1.00 14.89 ? 350 HOH B O   1 
HETATM 9116 O O   . HOH N 4 .   ? 20.370  -11.121 -19.936 1.00 32.70 ? 351 HOH B O   1 
HETATM 9117 O O   . HOH N 4 .   ? 11.521  -2.963  -7.258  1.00 31.37 ? 352 HOH B O   1 
HETATM 9118 O O   . HOH N 4 .   ? -13.244 -3.853  0.276   1.00 30.08 ? 353 HOH B O   1 
HETATM 9119 O O   . HOH N 4 .   ? 16.271  0.107   6.305   1.00 24.37 ? 354 HOH B O   1 
HETATM 9120 O O   . HOH N 4 .   ? 20.156  -6.890  -5.419  1.00 31.57 ? 355 HOH B O   1 
HETATM 9121 O O   . HOH N 4 .   ? -8.512  -6.468  3.186   1.00 42.00 ? 356 HOH B O   1 
HETATM 9122 O O   . HOH N 4 .   ? 26.377  -13.386 -16.999 1.00 49.29 ? 357 HOH B O   1 
HETATM 9123 O O   . HOH N 4 .   ? 18.570  0.989   5.777   1.00 32.14 ? 358 HOH B O   1 
HETATM 9124 O O   . HOH N 4 .   ? 22.328  -17.569 -10.453 1.00 30.41 ? 359 HOH B O   1 
HETATM 9125 O O   . HOH N 4 .   ? -1.709  0.120   -6.708  1.00 36.47 ? 360 HOH B O   1 
HETATM 9126 O O   . HOH N 4 .   ? 14.185  0.775   -20.134 1.00 37.81 ? 361 HOH B O   1 
HETATM 9127 O O   . HOH N 4 .   ? 4.225   -7.683  -24.183 1.00 33.63 ? 362 HOH B O   1 
HETATM 9128 O O   . HOH N 4 .   ? -15.788 -10.923 -4.312  1.00 18.99 ? 363 HOH B O   1 
HETATM 9129 O O   . HOH N 4 .   ? -3.377  -21.593 -3.674  1.00 44.01 ? 364 HOH B O   1 
HETATM 9130 O O   . HOH N 4 .   ? 0.465   -18.516 1.836   1.00 20.16 ? 365 HOH B O   1 
HETATM 9131 O O   . HOH N 4 .   ? 11.513  -18.944 -1.078  1.00 32.49 ? 366 HOH B O   1 
HETATM 9132 O O   . HOH N 4 .   ? -13.294 -18.830 -1.756  1.00 23.63 ? 367 HOH B O   1 
HETATM 9133 O O   . HOH N 4 .   ? 21.029  -18.512 -24.209 1.00 45.12 ? 368 HOH B O   1 
HETATM 9134 O O   . HOH N 4 .   ? -12.077 -10.044 -10.359 1.00 50.36 ? 369 HOH B O   1 
HETATM 9135 O O   . HOH N 4 .   ? 4.400   -22.388 -9.081  1.00 23.71 ? 370 HOH B O   1 
HETATM 9136 O O   . HOH N 4 .   ? 1.719   -20.717 -2.046  1.00 28.45 ? 371 HOH B O   1 
HETATM 9137 O O   . HOH N 4 .   ? -11.724 -11.439 -12.606 1.00 36.46 ? 372 HOH B O   1 
HETATM 9138 O O   . HOH N 4 .   ? -10.206 -2.771  4.646   1.00 40.75 ? 373 HOH B O   1 
HETATM 9139 O O   . HOH N 4 .   ? -11.129 -16.769 -17.690 1.00 48.69 ? 374 HOH B O   1 
HETATM 9140 O O   . HOH N 4 .   ? 14.103  -2.077  -6.163  1.00 28.10 ? 375 HOH B O   1 
HETATM 9141 O O   . HOH N 4 .   ? -0.515  -3.641  -20.140 1.00 35.29 ? 376 HOH B O   1 
HETATM 9142 O O   . HOH N 4 .   ? 2.797   -19.879 0.522   1.00 41.27 ? 377 HOH B O   1 
HETATM 9143 O O   . HOH N 4 .   ? 16.492  -11.220 9.728   1.00 47.70 ? 378 HOH B O   1 
HETATM 9144 O O   . HOH N 4 .   ? -9.012  0.735   -4.887  1.00 25.19 ? 379 HOH B O   1 
HETATM 9145 O O   . HOH N 4 .   ? 23.646  -8.389  -19.092 1.00 41.29 ? 380 HOH B O   1 
HETATM 9146 O O   . HOH N 4 .   ? -5.725  -4.965  -2.203  1.00 36.95 ? 381 HOH B O   1 
HETATM 9147 O O   . HOH N 4 .   ? -3.347  -4.038  -19.575 1.00 44.42 ? 382 HOH B O   1 
HETATM 9148 O O   . HOH N 4 .   ? 26.643  0.365   6.316   1.00 32.49 ? 383 HOH B O   1 
HETATM 9149 O O   . HOH N 4 .   ? 10.327  -9.974  -25.025 1.00 49.31 ? 384 HOH B O   1 
HETATM 9150 O O   . HOH N 4 .   ? 21.676  -4.215  -5.258  1.00 47.59 ? 385 HOH B O   1 
HETATM 9151 O O   . HOH N 4 .   ? 25.345  -1.259  4.713   1.00 27.61 ? 386 HOH B O   1 
HETATM 9152 O O   . HOH N 4 .   ? 22.286  -6.313  -1.520  1.00 39.17 ? 387 HOH B O   1 
HETATM 9153 O O   . HOH N 4 .   ? 21.932  -9.286  -20.740 1.00 39.53 ? 388 HOH B O   1 
HETATM 9154 O O   . HOH N 4 .   ? 21.754  -3.220  16.303  1.00 49.16 ? 389 HOH B O   1 
HETATM 9155 O O   . HOH N 4 .   ? 9.091   -24.235 -3.969  1.00 23.90 ? 390 HOH B O   1 
HETATM 9156 O O   . HOH N 4 .   ? -0.427  -27.297 -8.300  1.00 44.38 ? 391 HOH B O   1 
HETATM 9157 O O   . HOH N 4 .   ? 22.754  -1.110  -4.463  1.00 45.72 ? 392 HOH B O   1 
HETATM 9158 O O   . HOH N 4 .   ? 14.874  -0.519  -3.596  1.00 36.35 ? 393 HOH B O   1 
HETATM 9159 O O   . HOH N 4 .   ? -5.751  0.821   -10.979 1.00 26.54 ? 394 HOH B O   1 
HETATM 9160 O O   . HOH N 4 .   ? -6.110  -0.305  -8.207  1.00 14.03 ? 395 HOH B O   1 
HETATM 9161 O O   . HOH N 4 .   ? -4.270  1.016   -6.156  1.00 40.97 ? 396 HOH B O   1 
HETATM 9162 O O   . HOH N 4 .   ? -13.551 -12.416 0.854   1.00 19.34 ? 397 HOH B O   1 
HETATM 9163 O O   . HOH N 4 .   ? 5.366   -11.193 -1.082  1.00 17.33 ? 398 HOH B O   1 
HETATM 9164 O O   . HOH N 4 .   ? 13.058  -5.333  6.665   1.00 24.08 ? 399 HOH B O   1 
HETATM 9165 O O   . HOH N 4 .   ? 3.626   -21.423 3.595   1.00 27.80 ? 400 HOH B O   1 
HETATM 9166 O O   . HOH N 4 .   ? -11.814 -3.111  2.284   1.00 41.35 ? 401 HOH B O   1 
HETATM 9167 O O   . HOH O 4 .   ? 16.833  19.280  -4.617  1.00 28.84 ? 332 HOH C O   1 
HETATM 9168 O O   . HOH O 4 .   ? 5.737   -1.015  -10.674 1.00 18.97 ? 333 HOH C O   1 
HETATM 9169 O O   . HOH O 4 .   ? -13.424 12.661  -0.835  1.00 18.03 ? 334 HOH C O   1 
HETATM 9170 O O   . HOH O 4 .   ? -7.779  4.399   -19.887 1.00 30.47 ? 335 HOH C O   1 
HETATM 9171 O O   . HOH O 4 .   ? 6.124   6.519   -6.038  1.00 15.53 ? 336 HOH C O   1 
HETATM 9172 O O   . HOH O 4 .   ? 4.462   6.395   -8.063  1.00 14.39 ? 337 HOH C O   1 
HETATM 9173 O O   . HOH O 4 .   ? -25.516 7.710   -15.092 1.00 35.89 ? 338 HOH C O   1 
HETATM 9174 O O   . HOH O 4 .   ? -17.955 8.631   -1.467  1.00 32.83 ? 339 HOH C O   1 
HETATM 9175 O O   . HOH O 4 .   ? 17.893  5.314   -0.499  1.00 33.64 ? 340 HOH C O   1 
HETATM 9176 O O   . HOH O 4 .   ? -16.022 17.792  -7.142  1.00 31.78 ? 341 HOH C O   1 
HETATM 9177 O O   . HOH O 4 .   ? -5.231  8.535   -1.863  1.00 19.36 ? 342 HOH C O   1 
HETATM 9178 O O   . HOH O 4 .   ? 11.871  5.042   -4.942  1.00 12.87 ? 343 HOH C O   1 
HETATM 9179 O O   . HOH O 4 .   ? 5.224   2.945   -8.970  1.00 26.52 ? 344 HOH C O   1 
HETATM 9180 O O   . HOH O 4 .   ? 8.257   0.660   -7.486  1.00 24.71 ? 345 HOH C O   1 
HETATM 9181 O O   . HOH O 4 .   ? -10.868 -0.177  8.365   1.00 17.78 ? 346 HOH C O   1 
HETATM 9182 O O   . HOH O 4 .   ? 13.340  5.344   -7.033  1.00 23.35 ? 347 HOH C O   1 
HETATM 9183 O O   . HOH O 4 .   ? -20.521 11.037  -19.625 1.00 21.79 ? 348 HOH C O   1 
HETATM 9184 O O   . HOH O 4 .   ? -11.434 2.780   -7.117  1.00 15.42 ? 349 HOH C O   1 
HETATM 9185 O O   . HOH O 4 .   ? 13.320  3.561   0.062   1.00 32.58 ? 350 HOH C O   1 
HETATM 9186 O O   . HOH O 4 .   ? -16.158 -0.149  5.962   1.00 32.80 ? 351 HOH C O   1 
HETATM 9187 O O   . HOH O 4 .   ? -20.216 7.067   -5.427  1.00 25.23 ? 352 HOH C O   1 
HETATM 9188 O O   . HOH O 4 .   ? 9.089   6.077   3.340   1.00 35.02 ? 353 HOH C O   1 
HETATM 9189 O O   . HOH O 4 .   ? -26.597 13.508  -17.058 1.00 24.95 ? 354 HOH C O   1 
HETATM 9190 O O   . HOH O 4 .   ? -18.872 -0.990  5.811   1.00 31.83 ? 355 HOH C O   1 
HETATM 9191 O O   . HOH O 4 .   ? -22.000 17.616  -10.101 1.00 21.33 ? 356 HOH C O   1 
HETATM 9192 O O   . HOH O 4 .   ? 1.329   -0.039  -6.830  1.00 31.10 ? 357 HOH C O   1 
HETATM 9193 O O   . HOH O 4 .   ? -13.774 -1.016  -20.108 1.00 43.69 ? 358 HOH C O   1 
HETATM 9194 O O   . HOH O 4 .   ? -4.189  7.563   -24.110 1.00 26.24 ? 359 HOH C O   1 
HETATM 9195 O O   . HOH O 4 .   ? 15.998  11.001  -4.213  1.00 21.44 ? 360 HOH C O   1 
HETATM 9196 O O   . HOH O 4 .   ? -0.363  18.353  1.573   1.00 17.18 ? 361 HOH C O   1 
HETATM 9197 O O   . HOH O 4 .   ? -11.481 19.086  -0.928  1.00 23.30 ? 362 HOH C O   1 
HETATM 9198 O O   . HOH O 4 .   ? 13.256  18.975  -1.818  1.00 23.74 ? 363 HOH C O   1 
HETATM 9199 O O   . HOH O 4 .   ? -20.920 18.377  -23.636 1.00 50.85 ? 364 HOH C O   1 
HETATM 9200 O O   . HOH O 4 .   ? 11.457  10.228  -10.324 1.00 28.89 ? 365 HOH C O   1 
HETATM 9201 O O   . HOH O 4 .   ? -4.313  22.548  -9.236  1.00 14.56 ? 366 HOH C O   1 
HETATM 9202 O O   . HOH O 4 .   ? -1.036  20.728  -2.266  1.00 23.33 ? 367 HOH C O   1 
HETATM 9203 O O   . HOH O 4 .   ? 11.589  11.503  -12.697 1.00 21.38 ? 368 HOH C O   1 
HETATM 9204 O O   . HOH O 4 .   ? 10.673  16.814  -17.936 1.00 26.04 ? 369 HOH C O   1 
HETATM 9205 O O   . HOH O 4 .   ? -14.133 2.537   -6.288  1.00 37.57 ? 370 HOH C O   1 
HETATM 9206 O O   . HOH O 4 .   ? -0.067  3.566   -20.339 1.00 29.57 ? 371 HOH C O   1 
HETATM 9207 O O   . HOH O 4 .   ? -3.014  20.485  0.269   1.00 31.45 ? 372 HOH C O   1 
HETATM 9208 O O   . HOH O 4 .   ? -17.334 10.628  9.816   1.00 32.45 ? 373 HOH C O   1 
HETATM 9209 O O   . HOH O 4 .   ? 8.765   -0.790  -4.774  1.00 19.16 ? 374 HOH C O   1 
HETATM 9210 O O   . HOH O 4 .   ? -23.898 8.262   -18.660 1.00 32.37 ? 375 HOH C O   1 
HETATM 9211 O O   . HOH O 4 .   ? 5.587   4.938   -2.018  1.00 34.64 ? 376 HOH C O   1 
HETATM 9212 O O   . HOH O 4 .   ? 3.291   4.215   -19.685 1.00 36.59 ? 377 HOH C O   1 
HETATM 9213 O O   . HOH O 4 .   ? -17.478 18.999  5.114   1.00 31.55 ? 378 HOH C O   1 
HETATM 9214 O O   . HOH O 4 .   ? -20.729 4.246   -5.262  1.00 35.58 ? 379 HOH C O   1 
HETATM 9215 O O   . HOH O 4 .   ? -12.943 32.515  -25.707 1.00 32.18 ? 380 HOH C O   1 
HETATM 9216 O O   . HOH O 4 .   ? -25.035 1.603   4.841   1.00 41.46 ? 381 HOH C O   1 
HETATM 9217 O O   . HOH O 4 .   ? 6.736   6.759   2.678   1.00 36.58 ? 382 HOH C O   1 
HETATM 9218 O O   . HOH O 4 .   ? -19.732 7.122   -2.526  1.00 32.78 ? 383 HOH C O   1 
HETATM 9219 O O   . HOH O 4 .   ? -22.243 6.383   -1.042  1.00 27.63 ? 384 HOH C O   1 
HETATM 9220 O O   . HOH O 4 .   ? 0.119   16.475  -0.032  1.00 9.30  ? 385 HOH C O   1 
HETATM 9221 O O   . HOH O 4 .   ? -21.855 9.174   -20.561 1.00 38.88 ? 386 HOH C O   1 
HETATM 9222 O O   . HOH O 4 .   ? 4.357   27.075  -19.514 1.00 40.80 ? 387 HOH C O   1 
HETATM 9223 O O   . HOH O 4 .   ? -1.971  21.469  -30.544 1.00 24.64 ? 388 HOH C O   1 
HETATM 9224 O O   . HOH O 4 .   ? -2.354  25.298  -23.441 1.00 34.47 ? 389 HOH C O   1 
HETATM 9225 O O   . HOH O 4 .   ? -21.491 2.782   16.930  1.00 41.03 ? 390 HOH C O   1 
HETATM 9226 O O   . HOH O 4 .   ? -15.619 12.354  10.688  1.00 36.12 ? 391 HOH C O   1 
HETATM 9227 O O   . HOH O 4 .   ? -10.383 21.408  -15.254 1.00 28.90 ? 392 HOH C O   1 
HETATM 9228 O O   . HOH O 4 .   ? -6.155  12.410  -29.140 1.00 37.51 ? 393 HOH C O   1 
HETATM 9229 O O   . HOH O 4 .   ? -21.673 29.854  -17.404 1.00 45.50 ? 394 HOH C O   1 
HETATM 9230 O O   . HOH O 4 .   ? -17.395 8.799   11.890  1.00 41.46 ? 395 HOH C O   1 
HETATM 9231 O O   . HOH O 4 .   ? 6.823   26.074  -20.454 1.00 32.88 ? 396 HOH C O   1 
HETATM 9232 O O   . HOH O 4 .   ? -1.217  24.775  -20.511 1.00 38.64 ? 397 HOH C O   1 
HETATM 9233 O O   . HOH O 4 .   ? -9.061  30.805  -27.356 1.00 36.67 ? 398 HOH C O   1 
HETATM 9234 O O   . HOH O 4 .   ? 5.659   17.505  -26.300 1.00 23.42 ? 399 HOH C O   1 
HETATM 9235 O O   . HOH O 4 .   ? -11.619 14.309  -30.982 1.00 42.71 ? 400 HOH C O   1 
HETATM 9236 O O   . HOH O 4 .   ? 0.845   23.353  -4.389  1.00 35.23 ? 401 HOH C O   1 
HETATM 9237 O O   . HOH O 4 .   ? 6.911   10.177  -17.764 1.00 29.63 ? 402 HOH C O   1 
HETATM 9238 O O   . HOH O 4 .   ? -21.318 21.956  -3.838  1.00 42.24 ? 403 HOH C O   1 
HETATM 9239 O O   . HOH O 4 .   ? -3.499  30.330  -18.304 1.00 45.12 ? 404 HOH C O   1 
HETATM 9240 O O   . HOH O 4 .   ? -31.774 21.227  -7.278  1.00 34.39 ? 405 HOH C O   1 
HETATM 9241 O O   . HOH O 4 .   ? -32.896 -3.606  5.732   1.00 39.72 ? 406 HOH C O   1 
HETATM 9242 O O   . HOH O 4 .   ? 7.985   13.715  -25.722 1.00 36.30 ? 407 HOH C O   1 
HETATM 9243 O O   . HOH O 4 .   ? 13.002  17.168  -16.935 1.00 46.57 ? 408 HOH C O   1 
HETATM 9244 O O   . HOH O 4 .   ? 9.098   6.255   -18.273 1.00 45.64 ? 409 HOH C O   1 
HETATM 9245 O O   . HOH O 4 .   ? -24.179 -1.181  -8.291  1.00 25.07 ? 410 HOH C O   1 
HETATM 9246 O O   . HOH P 4 .   ? 6.027   -0.276  8.229   1.00 16.61 ? 332 HOH D O   1 
HETATM 9247 O O   . HOH P 4 .   ? 4.160   0.711   6.361   1.00 32.23 ? 333 HOH D O   1 
HETATM 9248 O O   . HOH P 4 .   ? 17.896  -8.534  -2.146  1.00 40.75 ? 334 HOH D O   1 
HETATM 9249 O O   . HOH P 4 .   ? -13.257 -5.333  -6.885  1.00 23.17 ? 335 HOH D O   1 
HETATM 9250 O O   . HOH P 4 .   ? 16.690  -19.350 4.527   1.00 25.78 ? 336 HOH D O   1 
HETATM 9251 O O   . HOH P 4 .   ? 19.886  -7.005  -2.674  1.00 29.26 ? 337 HOH D O   1 
HETATM 9252 O O   . HOH P 4 .   ? -0.007  -16.440 0.089   1.00 14.40 ? 338 HOH D O   1 
HETATM 9253 O O   . HOH P 4 .   ? 11.397  -2.763  -2.521  1.00 41.57 ? 339 HOH D O   1 
HETATM 9254 O O   . HOH P 4 .   ? -24.330 1.496   8.264   1.00 26.21 ? 340 HOH D O   1 
HETATM 9255 O O   . HOH P 4 .   ? -26.567 -0.363  6.356   1.00 29.91 ? 341 HOH D O   1 
HETATM 9256 O O   . HOH P 4 .   ? -7.751  -4.504  20.006  1.00 32.47 ? 342 HOH D O   1 
HETATM 9257 O O   . HOH P 4 .   ? 6.074   -6.545  5.866   1.00 19.52 ? 343 HOH D O   1 
HETATM 9258 O O   . HOH P 4 .   ? 4.492   -6.199  8.090   1.00 14.67 ? 344 HOH D O   1 
HETATM 9259 O O   . HOH P 4 .   ? -25.688 -7.605  15.123  1.00 36.00 ? 345 HOH D O   1 
HETATM 9260 O O   . HOH P 4 .   ? -18.538 -8.331  1.879   1.00 31.78 ? 346 HOH D O   1 
HETATM 9261 O O   . HOH P 4 .   ? 17.526  -5.188  0.303   1.00 27.65 ? 347 HOH D O   1 
HETATM 9262 O O   . HOH P 4 .   ? -16.252 -17.755 7.341   1.00 35.30 ? 348 HOH D O   1 
HETATM 9263 O O   . HOH P 4 .   ? -4.974  -8.615  1.818   1.00 28.86 ? 349 HOH D O   1 
HETATM 9264 O O   . HOH P 4 .   ? 11.311  -5.232  4.792   1.00 15.52 ? 350 HOH D O   1 
HETATM 9265 O O   . HOH P 4 .   ? 5.139   -2.657  8.668   1.00 19.33 ? 351 HOH D O   1 
HETATM 9266 O O   . HOH P 4 .   ? 8.472   -0.467  7.353   1.00 18.40 ? 352 HOH D O   1 
HETATM 9267 O O   . HOH P 4 .   ? -11.015 0.433   -8.214  1.00 17.41 ? 353 HOH D O   1 
HETATM 9268 O O   . HOH P 4 .   ? -20.462 -11.190 19.465  1.00 25.79 ? 354 HOH D O   1 
HETATM 9269 O O   . HOH P 4 .   ? -11.677 -2.603  7.250   1.00 19.77 ? 355 HOH D O   1 
HETATM 9270 O O   . HOH P 4 .   ? 13.670  -3.373  -0.160  1.00 43.72 ? 356 HOH D O   1 
HETATM 9271 O O   . HOH P 4 .   ? -16.092 0.127   -6.004  1.00 27.02 ? 357 HOH D O   1 
HETATM 9272 O O   . HOH P 4 .   ? -20.172 -6.935  5.018   1.00 35.02 ? 358 HOH D O   1 
HETATM 9273 O O   . HOH P 4 .   ? 9.287   -6.119  -3.476  1.00 35.03 ? 359 HOH D O   1 
HETATM 9274 O O   . HOH P 4 .   ? -26.635 -13.213 16.903  1.00 28.30 ? 360 HOH D O   1 
HETATM 9275 O O   . HOH P 4 .   ? -18.768 1.087   -5.797  1.00 42.70 ? 361 HOH D O   1 
HETATM 9276 O O   . HOH P 4 .   ? -22.241 -17.760 9.824   1.00 35.10 ? 362 HOH D O   1 
HETATM 9277 O O   . HOH P 4 .   ? 1.498   0.208   6.447   1.00 46.28 ? 363 HOH D O   1 
HETATM 9278 O O   . HOH P 4 .   ? -14.088 0.537   19.815  1.00 31.00 ? 364 HOH D O   1 
HETATM 9279 O O   . HOH P 4 .   ? -4.043  -7.563  24.080  1.00 14.71 ? 365 HOH D O   1 
HETATM 9280 O O   . HOH P 4 .   ? 15.768  -11.060 4.024   1.00 17.02 ? 366 HOH D O   1 
HETATM 9281 O O   . HOH P 4 .   ? -0.365  -18.479 -1.679  1.00 24.09 ? 367 HOH D O   1 
HETATM 9282 O O   . HOH P 4 .   ? -11.647 -19.315 0.816   1.00 27.86 ? 368 HOH D O   1 
HETATM 9283 O O   . HOH P 4 .   ? 13.229  -18.797 1.678   1.00 22.07 ? 369 HOH D O   1 
HETATM 9284 O O   . HOH P 4 .   ? -20.502 -18.669 24.316  1.00 28.27 ? 370 HOH D O   1 
HETATM 9285 O O   . HOH P 4 .   ? 11.319  -10.346 10.153  1.00 32.08 ? 371 HOH D O   1 
HETATM 9286 O O   . HOH P 4 .   ? -4.311  -22.519 9.072   1.00 16.85 ? 372 HOH D O   1 
HETATM 9287 O O   . HOH P 4 .   ? -1.483  -20.717 2.037   1.00 24.72 ? 373 HOH D O   1 
HETATM 9288 O O   . HOH P 4 .   ? 11.504  -11.170 12.500  1.00 23.56 ? 374 HOH D O   1 
HETATM 9289 O O   . HOH P 4 .   ? 10.140  -3.142  -4.660  1.00 28.74 ? 375 HOH D O   1 
HETATM 9290 O O   . HOH P 4 .   ? 11.091  -16.978 17.876  1.00 38.63 ? 376 HOH D O   1 
HETATM 9291 O O   . HOH P 4 .   ? -14.067 -2.378  6.146   1.00 31.23 ? 377 HOH D O   1 
HETATM 9292 O O   . HOH P 4 .   ? -0.207  -3.595  20.057  1.00 25.79 ? 378 HOH D O   1 
HETATM 9293 O O   . HOH P 4 .   ? -3.132  -20.492 -0.206  1.00 31.60 ? 379 HOH D O   1 
HETATM 9294 O O   . HOH P 4 .   ? -17.469 -10.863 -10.086 1.00 40.97 ? 380 HOH D O   1 
HETATM 9295 O O   . HOH P 4 .   ? 8.677   0.848   4.778   1.00 28.83 ? 381 HOH D O   1 
HETATM 9296 O O   . HOH P 4 .   ? -23.406 -8.394  18.718  1.00 42.26 ? 382 HOH D O   1 
HETATM 9297 O O   . HOH P 4 .   ? -10.167 -10.314 24.757  1.00 28.03 ? 383 HOH D O   1 
HETATM 9298 O O   . HOH P 4 .   ? -12.956 -32.464 25.684  1.00 37.20 ? 384 HOH D O   1 
HETATM 9299 O O   . HOH P 4 .   ? 6.908   -6.474  -2.502  1.00 42.02 ? 385 HOH D O   1 
HETATM 9300 O O   . HOH P 4 .   ? -21.543 -8.912  20.484  1.00 45.47 ? 386 HOH D O   1 
HETATM 9301 O O   . HOH P 4 .   ? -13.776 5.882   15.210  1.00 38.54 ? 387 HOH D O   1 
HETATM 9302 O O   . HOH P 4 .   ? 11.530  0.297   1.552   1.00 47.34 ? 388 HOH D O   1 
HETATM 9303 O O   . HOH P 4 .   ? -5.979  -1.912  19.084  1.00 42.66 ? 389 HOH D O   1 
HETATM 9304 O O   . HOH P 4 .   ? -15.391 6.131   12.480  1.00 34.18 ? 390 HOH D O   1 
HETATM 9305 O O   . HOH P 4 .   ? -9.468  -4.182  22.391  1.00 47.14 ? 391 HOH D O   1 
HETATM 9306 O O   . HOH P 4 .   ? -11.751 -31.079 27.464  1.00 39.24 ? 392 HOH D O   1 
HETATM 9307 O O   . HOH P 4 .   ? -9.043  -30.893 27.651  1.00 33.08 ? 393 HOH D O   1 
HETATM 9308 O O   . HOH P 4 .   ? -15.713 -12.200 -11.289 1.00 41.05 ? 394 HOH D O   1 
HETATM 9309 O O   . HOH P 4 .   ? -10.168 -21.412 15.110  1.00 34.12 ? 395 HOH D O   1 
HETATM 9310 O O   . HOH P 4 .   ? -6.575  -12.312 29.473  1.00 27.04 ? 396 HOH D O   1 
HETATM 9311 O O   . HOH P 4 .   ? -21.713 -30.173 17.140  1.00 32.80 ? 397 HOH D O   1 
HETATM 9312 O O   . HOH P 4 .   ? -17.291 -8.835  -12.001 1.00 42.99 ? 398 HOH D O   1 
HETATM 9313 O O   . HOH P 4 .   ? 6.772   -26.140 20.611  1.00 33.96 ? 399 HOH D O   1 
HETATM 9314 O O   . HOH P 4 .   ? -17.531 -9.446  -14.579 1.00 46.71 ? 400 HOH D O   1 
HETATM 9315 O O   . HOH P 4 .   ? -32.704 -16.742 0.183   1.00 45.80 ? 401 HOH D O   1 
HETATM 9316 O O   . HOH P 4 .   ? -23.002 -18.005 23.294  1.00 44.75 ? 402 HOH D O   1 
HETATM 9317 O O   . HOH P 4 .   ? -7.235  -28.158 28.405  1.00 40.54 ? 403 HOH D O   1 
HETATM 9318 O O   . HOH P 4 .   ? -10.881 -9.217  27.249  1.00 45.03 ? 404 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   21  21  ALA ALA A . n 
A 1 2   ARG 2   22  22  ARG ARG A . n 
A 1 3   LYS 3   23  23  LYS LYS A . n 
A 1 4   ILE 4   24  24  ILE ILE A . n 
A 1 5   GLY 5   25  25  GLY GLY A . n 
A 1 6   ILE 6   26  26  ILE ILE A . n 
A 1 7   ILE 7   27  27  ILE ILE A . n 
A 1 8   GLY 8   28  28  GLY GLY A . n 
A 1 9   LEU 9   29  29  LEU LEU A . n 
A 1 10  GLY 10  30  30  GLY GLY A . n 
A 1 11  ASN 11  31  31  ASN ASN A . n 
A 1 12  VAL 12  32  32  VAL VAL A . n 
A 1 13  GLY 13  33  33  GLY GLY A . n 
A 1 14  ALA 14  34  34  ALA ALA A . n 
A 1 15  ALA 15  35  35  ALA ALA A . n 
A 1 16  VAL 16  36  36  VAL VAL A . n 
A 1 17  ALA 17  37  37  ALA ALA A . n 
A 1 18  HIS 18  38  38  HIS HIS A . n 
A 1 19  GLY 19  39  39  GLY GLY A . n 
A 1 20  LEU 20  40  40  LEU LEU A . n 
A 1 21  ILE 21  41  41  ILE ILE A . n 
A 1 22  ALA 22  42  42  ALA ALA A . n 
A 1 23  GLN 23  43  43  GLN GLN A . n 
A 1 24  GLY 24  44  44  GLY GLY A . n 
A 1 25  VAL 25  45  45  VAL VAL A . n 
A 1 26  ALA 26  46  46  ALA ALA A . n 
A 1 27  ASP 27  47  47  ASP ASP A . n 
A 1 28  ASP 28  48  48  ASP ASP A . n 
A 1 29  TYR 29  49  49  TYR TYR A . n 
A 1 30  VAL 30  50  50  VAL VAL A . n 
A 1 31  PHE 31  51  51  PHE PHE A . n 
A 1 32  ILE 32  52  52  ILE ILE A . n 
A 1 33  ASP 33  53  53  ASP ASP A . n 
A 1 34  ALA 34  54  54  ALA ALA A . n 
A 1 35  ASN 35  55  55  ASN ASN A . n 
A 1 36  GLU 36  56  56  GLU GLU A . n 
A 1 37  ALA 37  57  57  ALA ALA A . n 
A 1 38  LYS 38  58  58  LYS LYS A . n 
A 1 39  VAL 39  59  59  VAL VAL A . n 
A 1 40  LYS 40  60  60  LYS LYS A . n 
A 1 41  ALA 41  61  61  ALA ALA A . n 
A 1 42  ASP 42  62  62  ASP ASP A . n 
A 1 43  GLN 43  63  63  GLN GLN A . n 
A 1 44  ILE 44  64  64  ILE ILE A . n 
A 1 45  ASP 45  65  65  ASP ASP A . n 
A 1 46  PHE 46  66  66  PHE PHE A . n 
A 1 47  GLN 47  67  67  GLN GLN A . n 
A 1 48  ASP 48  68  68  ASP ASP A . n 
A 1 49  ALA 49  69  69  ALA ALA A . n 
A 1 50  MET 50  70  70  MET MET A . n 
A 1 51  ALA 51  71  71  ALA ALA A . n 
A 1 52  ASN 52  72  72  ASN ASN A . n 
A 1 53  LEU 53  73  73  LEU LEU A . n 
A 1 54  GLU 54  74  74  GLU GLU A . n 
A 1 55  ALA 55  75  75  ALA ALA A . n 
A 1 56  HIS 56  76  76  HIS HIS A . n 
A 1 57  GLY 57  77  77  GLY GLY A . n 
A 1 58  ASN 58  78  78  ASN ASN A . n 
A 1 59  ILE 59  79  79  ILE ILE A . n 
A 1 60  VAL 60  80  80  VAL VAL A . n 
A 1 61  ILE 61  81  81  ILE ILE A . n 
A 1 62  ASN 62  82  82  ASN ASN A . n 
A 1 63  ASP 63  83  83  ASP ASP A . n 
A 1 64  TRP 64  84  84  TRP TRP A . n 
A 1 65  ALA 65  85  85  ALA ALA A . n 
A 1 66  ALA 66  86  86  ALA ALA A . n 
A 1 67  LEU 67  87  87  LEU LEU A . n 
A 1 68  ALA 68  88  88  ALA ALA A . n 
A 1 69  ASP 69  89  89  ASP ASP A . n 
A 1 70  ALA 70  90  90  ALA ALA A . n 
A 1 71  ASP 71  91  91  ASP ASP A . n 
A 1 72  VAL 72  92  92  VAL VAL A . n 
A 1 73  VAL 73  93  93  VAL VAL A . n 
A 1 74  ILE 74  94  94  ILE ILE A . n 
A 1 75  SER 75  95  95  SER SER A . n 
A 1 76  THR 76  96  96  THR THR A . n 
A 1 77  LEU 77  97  97  LEU LEU A . n 
A 1 78  GLY 78  98  98  GLY GLY A . n 
A 1 79  ASN 79  99  99  ASN ASN A . n 
A 1 80  ILE 80  100 100 ILE ILE A . n 
A 1 81  LYS 81  101 101 LYS LYS A . n 
A 1 82  LEU 82  102 102 LEU LEU A . n 
A 1 83  GLN 83  103 103 GLN GLN A . n 
A 1 84  GLN 84  104 104 GLN GLN A . n 
A 1 85  ASP 85  105 ?   ?   ?   A . n 
A 1 86  ASN 86  106 ?   ?   ?   A . n 
A 1 87  PRO 87  107 ?   ?   ?   A . n 
A 1 88  THR 88  108 ?   ?   ?   A . n 
A 1 89  GLY 89  109 ?   ?   ?   A . n 
A 1 90  ASP 90  110 ?   ?   ?   A . n 
A 1 91  ARG 91  111 ?   ?   ?   A . n 
A 1 92  PHE 92  112 112 PHE PHE A . n 
A 1 93  ALA 93  113 113 ALA ALA A . n 
A 1 94  GLU 94  114 114 GLU GLU A . n 
A 1 95  LEU 95  115 115 LEU LEU A . n 
A 1 96  LYS 96  116 116 LYS LYS A . n 
A 1 97  PHE 97  117 117 PHE PHE A . n 
A 1 98  THR 98  118 118 THR THR A . n 
A 1 99  SER 99  119 119 SER SER A . n 
A 1 100 SER 100 120 120 SER SER A . n 
A 1 101 MET 101 121 121 MET MET A . n 
A 1 102 VAL 102 122 122 VAL VAL A . n 
A 1 103 GLN 103 123 123 GLN GLN A . n 
A 1 104 SER 104 124 124 SER SER A . n 
A 1 105 VAL 105 125 125 VAL VAL A . n 
A 1 106 GLY 106 126 126 GLY GLY A . n 
A 1 107 THR 107 127 127 THR THR A . n 
A 1 108 ASN 108 128 128 ASN ASN A . n 
A 1 109 LEU 109 129 129 LEU LEU A . n 
A 1 110 LYS 110 130 130 LYS LYS A . n 
A 1 111 GLU 111 131 131 GLU GLU A . n 
A 1 112 SER 112 132 132 SER SER A . n 
A 1 113 GLY 113 133 133 GLY GLY A . n 
A 1 114 PHE 114 134 134 PHE PHE A . n 
A 1 115 HIS 115 135 135 HIS HIS A . n 
A 1 116 GLY 116 136 136 GLY GLY A . n 
A 1 117 VAL 117 137 137 VAL VAL A . n 
A 1 118 LEU 118 138 138 LEU LEU A . n 
A 1 119 VAL 119 139 139 VAL VAL A . n 
A 1 120 VAL 120 140 140 VAL VAL A . n 
A 1 121 ILE 121 141 141 ILE ILE A . n 
A 1 122 SER 122 142 142 SER SER A . n 
A 1 123 ASN 123 143 143 ASN ASN A . n 
A 1 124 PRO 124 144 144 PRO PRO A . n 
A 1 125 VAL 125 145 145 VAL VAL A . n 
A 1 126 ASP 126 146 146 ASP ASP A . n 
A 1 127 VAL 127 147 147 VAL VAL A . n 
A 1 128 ILE 128 148 148 ILE ILE A . n 
A 1 129 THR 129 149 149 THR THR A . n 
A 1 130 ALA 130 150 150 ALA ALA A . n 
A 1 131 LEU 131 151 151 LEU LEU A . n 
A 1 132 PHE 132 152 152 PHE PHE A . n 
A 1 133 GLN 133 153 153 GLN GLN A . n 
A 1 134 HIS 134 154 154 HIS HIS A . n 
A 1 135 VAL 135 155 155 VAL VAL A . n 
A 1 136 THR 136 156 156 THR THR A . n 
A 1 137 GLY 137 157 157 GLY GLY A . n 
A 1 138 PHE 138 158 158 PHE PHE A . n 
A 1 139 PRO 139 159 159 PRO PRO A . n 
A 1 140 ALA 140 160 160 ALA ALA A . n 
A 1 141 HIS 141 161 161 HIS HIS A . n 
A 1 142 LYS 142 162 162 LYS LYS A . n 
A 1 143 VAL 143 163 163 VAL VAL A . n 
A 1 144 ILE 144 164 164 ILE ILE A . n 
A 1 145 GLY 145 165 165 GLY GLY A . n 
A 1 146 THR 146 166 166 THR THR A . n 
A 1 147 GLY 147 167 167 GLY GLY A . n 
A 1 148 THR 148 168 168 THR THR A . n 
A 1 149 LEU 149 169 169 LEU LEU A . n 
A 1 150 LEU 150 170 170 LEU LEU A . n 
A 1 151 ASP 151 171 171 ASP ASP A . n 
A 1 152 THR 152 172 172 THR THR A . n 
A 1 153 ALA 153 173 173 ALA ALA A . n 
A 1 154 ARG 154 174 174 ARG ARG A . n 
A 1 155 MET 155 175 175 MET MET A . n 
A 1 156 GLN 156 176 176 GLN GLN A . n 
A 1 157 ARG 157 177 177 ARG ARG A . n 
A 1 158 ALA 158 178 178 ALA ALA A . n 
A 1 159 VAL 159 179 179 VAL VAL A . n 
A 1 160 GLY 160 180 180 GLY GLY A . n 
A 1 161 GLU 161 181 181 GLU GLU A . n 
A 1 162 ALA 162 182 182 ALA ALA A . n 
A 1 163 PHE 163 183 183 PHE PHE A . n 
A 1 164 ASP 164 184 184 ASP ASP A . n 
A 1 165 LEU 165 185 185 LEU LEU A . n 
A 1 166 ASP 166 186 186 ASP ASP A . n 
A 1 167 PRO 167 187 187 PRO PRO A . n 
A 1 168 ARG 168 188 188 ARG ARG A . n 
A 1 169 SER 169 189 189 SER SER A . n 
A 1 170 VAL 170 190 190 VAL VAL A . n 
A 1 171 SER 171 191 191 SER SER A . n 
A 1 172 GLY 172 192 192 GLY GLY A . n 
A 1 173 TYR 173 193 193 TYR TYR A . n 
A 1 174 ASN 174 194 194 ASN ASN A . n 
A 1 175 LEU 175 195 195 LEU LEU A . n 
A 1 176 GLY 176 196 196 GLY GLY A . n 
A 1 177 GLU 177 197 197 GLU GLU A . n 
A 1 178 HIS 178 198 198 HIS HIS A . n 
A 1 179 GLY 179 199 199 GLY GLY A . n 
A 1 180 ASN 180 200 200 ASN ASN A . n 
A 1 181 SER 181 201 201 SER SER A . n 
A 1 182 GLN 182 202 202 GLN GLN A . n 
A 1 183 PHE 183 203 203 PHE PHE A . n 
A 1 184 VAL 184 204 204 VAL VAL A . n 
A 1 185 ALA 185 205 205 ALA ALA A . n 
A 1 186 TRP 186 206 206 TRP TRP A . n 
A 1 187 SER 187 207 207 SER SER A . n 
A 1 188 THR 188 208 208 THR THR A . n 
A 1 189 VAL 189 209 209 VAL VAL A . n 
A 1 190 ARG 190 210 210 ARG ARG A . n 
A 1 191 VAL 191 211 211 VAL VAL A . n 
A 1 192 MET 192 212 212 MET MET A . n 
A 1 193 GLY 193 213 213 GLY GLY A . n 
A 1 194 GLN 194 214 214 GLN GLN A . n 
A 1 195 PRO 195 215 215 PRO PRO A . n 
A 1 196 ILE 196 216 216 ILE ILE A . n 
A 1 197 VAL 197 217 217 VAL VAL A . n 
A 1 198 THR 198 218 218 THR THR A . n 
A 1 199 LEU 199 219 219 LEU LEU A . n 
A 1 200 ALA 200 220 ?   ?   ?   A . n 
A 1 201 ASP 201 221 ?   ?   ?   A . n 
A 1 202 ALA 202 222 ?   ?   ?   A . n 
A 1 203 GLY 203 223 ?   ?   ?   A . n 
A 1 204 ASP 204 224 ?   ?   ?   A . n 
A 1 205 ILE 205 225 225 ILE ILE A . n 
A 1 206 ASP 206 226 226 ASP ASP A . n 
A 1 207 LEU 207 227 227 LEU LEU A . n 
A 1 208 ALA 208 228 228 ALA ALA A . n 
A 1 209 ALA 209 229 229 ALA ALA A . n 
A 1 210 ILE 210 230 230 ILE ILE A . n 
A 1 211 GLU 211 231 231 GLU GLU A . n 
A 1 212 GLU 212 232 232 GLU GLU A . n 
A 1 213 GLU 213 233 233 GLU GLU A . n 
A 1 214 ALA 214 234 234 ALA ALA A . n 
A 1 215 ARG 215 235 235 ARG ARG A . n 
A 1 216 LYS 216 236 236 LYS LYS A . n 
A 1 217 GLY 217 237 237 GLY GLY A . n 
A 1 218 GLY 218 238 238 GLY GLY A . n 
A 1 219 PHE 219 239 239 PHE PHE A . n 
A 1 220 THR 220 240 240 THR THR A . n 
A 1 221 VAL 221 241 241 VAL VAL A . n 
A 1 222 LEU 222 242 242 LEU LEU A . n 
A 1 223 ASN 223 243 243 ASN ASN A . n 
A 1 224 GLY 224 244 244 GLY GLY A . n 
A 1 225 LYS 225 245 245 LYS LYS A . n 
A 1 226 GLY 226 246 246 GLY GLY A . n 
A 1 227 TYR 227 247 247 TYR TYR A . n 
A 1 228 THR 228 248 248 THR THR A . n 
A 1 229 SER 229 249 249 SER SER A . n 
A 1 230 TYR 230 250 250 TYR TYR A . n 
A 1 231 GLY 231 251 251 GLY GLY A . n 
A 1 232 VAL 232 252 252 VAL VAL A . n 
A 1 233 ALA 233 253 253 ALA ALA A . n 
A 1 234 THR 234 254 254 THR THR A . n 
A 1 235 SER 235 255 255 SER SER A . n 
A 1 236 ALA 236 256 256 ALA ALA A . n 
A 1 237 ILE 237 257 257 ILE ILE A . n 
A 1 238 ARG 238 258 258 ARG ARG A . n 
A 1 239 ILE 239 259 259 ILE ILE A . n 
A 1 240 ALA 240 260 260 ALA ALA A . n 
A 1 241 LYS 241 261 261 LYS LYS A . n 
A 1 242 ALA 242 262 262 ALA ALA A . n 
A 1 243 VAL 243 263 263 VAL VAL A . n 
A 1 244 MET 244 264 264 MET MET A . n 
A 1 245 ALA 245 265 265 ALA ALA A . n 
A 1 246 ASP 246 266 266 ASP ASP A . n 
A 1 247 ALA 247 267 267 ALA ALA A . n 
A 1 248 HIS 248 268 268 HIS HIS A . n 
A 1 249 ALA 249 269 269 ALA ALA A . n 
A 1 250 GLU 250 270 270 GLU GLU A . n 
A 1 251 LEU 251 271 271 LEU LEU A . n 
A 1 252 VAL 252 272 272 VAL VAL A . n 
A 1 253 VAL 253 273 273 VAL VAL A . n 
A 1 254 SER 254 274 274 SER SER A . n 
A 1 255 ASN 255 275 275 ASN ASN A . n 
A 1 256 ARG 256 276 276 ARG ARG A . n 
A 1 257 ARG 257 277 277 ARG ARG A . n 
A 1 258 ASP 258 278 278 ASP ASP A . n 
A 1 259 ASP 259 279 279 ASP ASP A . n 
A 1 260 MET 260 280 280 MET MET A . n 
A 1 261 GLY 261 281 281 GLY GLY A . n 
A 1 262 MET 262 282 282 MET MET A . n 
A 1 263 TYR 263 283 283 TYR TYR A . n 
A 1 264 LEU 264 284 284 LEU LEU A . n 
A 1 265 SER 265 285 285 SER SER A . n 
A 1 266 TYR 266 286 286 TYR TYR A . n 
A 1 267 PRO 267 287 287 PRO PRO A . n 
A 1 268 ALA 268 288 288 ALA ALA A . n 
A 1 269 ILE 269 289 289 ILE ILE A . n 
A 1 270 ILE 270 290 290 ILE ILE A . n 
A 1 271 GLY 271 291 291 GLY GLY A . n 
A 1 272 ARG 272 292 292 ARG ARG A . n 
A 1 273 ASP 273 293 293 ASP ASP A . n 
A 1 274 GLY 274 294 294 GLY GLY A . n 
A 1 275 VAL 275 295 295 VAL VAL A . n 
A 1 276 LEU 276 296 296 LEU LEU A . n 
A 1 277 ALA 277 297 297 ALA ALA A . n 
A 1 278 GLU 278 298 298 GLU GLU A . n 
A 1 279 THR 279 299 299 THR THR A . n 
A 1 280 THR 280 300 300 THR THR A . n 
A 1 281 LEU 281 301 301 LEU LEU A . n 
A 1 282 ASP 282 302 302 ASP ASP A . n 
A 1 283 LEU 283 303 303 LEU LEU A . n 
A 1 284 THR 284 304 304 THR THR A . n 
A 1 285 THR 285 305 305 THR THR A . n 
A 1 286 ASP 286 306 306 ASP ASP A . n 
A 1 287 GLU 287 307 307 GLU GLU A . n 
A 1 288 GLN 288 308 308 GLN GLN A . n 
A 1 289 GLU 289 309 309 GLU GLU A . n 
A 1 290 LYS 290 310 310 LYS LYS A . n 
A 1 291 LEU 291 311 311 LEU LEU A . n 
A 1 292 LEU 292 312 312 LEU LEU A . n 
A 1 293 GLN 293 313 313 GLN GLN A . n 
A 1 294 SER 294 314 314 SER SER A . n 
A 1 295 ARG 295 315 315 ARG ARG A . n 
A 1 296 ASP 296 316 316 ASP ASP A . n 
A 1 297 TYR 297 317 317 TYR TYR A . n 
A 1 298 ILE 298 318 318 ILE ILE A . n 
A 1 299 GLN 299 319 319 GLN GLN A . n 
A 1 300 GLN 300 320 320 GLN GLN A . n 
A 1 301 ARG 301 321 321 ARG ARG A . n 
A 1 302 PHE 302 322 322 PHE PHE A . n 
A 1 303 ASP 303 323 323 ASP ASP A . n 
A 1 304 GLU 304 324 324 GLU GLU A . n 
A 1 305 ILE 305 325 325 ILE ILE A . n 
A 1 306 VAL 306 326 326 VAL VAL A . n 
A 1 307 ASP 307 327 327 ASP ASP A . n 
A 1 308 THR 308 328 328 THR THR A . n 
A 1 309 LEU 309 329 329 LEU LEU A . n 
B 1 1   ALA 1   21  21  ALA ALA B . n 
B 1 2   ARG 2   22  22  ARG ARG B . n 
B 1 3   LYS 3   23  23  LYS LYS B . n 
B 1 4   ILE 4   24  24  ILE ILE B . n 
B 1 5   GLY 5   25  25  GLY GLY B . n 
B 1 6   ILE 6   26  26  ILE ILE B . n 
B 1 7   ILE 7   27  27  ILE ILE B . n 
B 1 8   GLY 8   28  28  GLY GLY B . n 
B 1 9   LEU 9   29  29  LEU LEU B . n 
B 1 10  GLY 10  30  30  GLY GLY B . n 
B 1 11  ASN 11  31  31  ASN ASN B . n 
B 1 12  VAL 12  32  32  VAL VAL B . n 
B 1 13  GLY 13  33  33  GLY GLY B . n 
B 1 14  ALA 14  34  34  ALA ALA B . n 
B 1 15  ALA 15  35  35  ALA ALA B . n 
B 1 16  VAL 16  36  36  VAL VAL B . n 
B 1 17  ALA 17  37  37  ALA ALA B . n 
B 1 18  HIS 18  38  38  HIS HIS B . n 
B 1 19  GLY 19  39  39  GLY GLY B . n 
B 1 20  LEU 20  40  40  LEU LEU B . n 
B 1 21  ILE 21  41  41  ILE ILE B . n 
B 1 22  ALA 22  42  42  ALA ALA B . n 
B 1 23  GLN 23  43  43  GLN GLN B . n 
B 1 24  GLY 24  44  44  GLY GLY B . n 
B 1 25  VAL 25  45  45  VAL VAL B . n 
B 1 26  ALA 26  46  46  ALA ALA B . n 
B 1 27  ASP 27  47  47  ASP ASP B . n 
B 1 28  ASP 28  48  48  ASP ASP B . n 
B 1 29  TYR 29  49  49  TYR TYR B . n 
B 1 30  VAL 30  50  50  VAL VAL B . n 
B 1 31  PHE 31  51  51  PHE PHE B . n 
B 1 32  ILE 32  52  52  ILE ILE B . n 
B 1 33  ASP 33  53  53  ASP ASP B . n 
B 1 34  ALA 34  54  54  ALA ALA B . n 
B 1 35  ASN 35  55  55  ASN ASN B . n 
B 1 36  GLU 36  56  56  GLU GLU B . n 
B 1 37  ALA 37  57  57  ALA ALA B . n 
B 1 38  LYS 38  58  58  LYS LYS B . n 
B 1 39  VAL 39  59  59  VAL VAL B . n 
B 1 40  LYS 40  60  60  LYS LYS B . n 
B 1 41  ALA 41  61  61  ALA ALA B . n 
B 1 42  ASP 42  62  62  ASP ASP B . n 
B 1 43  GLN 43  63  63  GLN GLN B . n 
B 1 44  ILE 44  64  64  ILE ILE B . n 
B 1 45  ASP 45  65  65  ASP ASP B . n 
B 1 46  PHE 46  66  66  PHE PHE B . n 
B 1 47  GLN 47  67  67  GLN GLN B . n 
B 1 48  ASP 48  68  68  ASP ASP B . n 
B 1 49  ALA 49  69  69  ALA ALA B . n 
B 1 50  MET 50  70  70  MET MET B . n 
B 1 51  ALA 51  71  71  ALA ALA B . n 
B 1 52  ASN 52  72  72  ASN ASN B . n 
B 1 53  LEU 53  73  73  LEU LEU B . n 
B 1 54  GLU 54  74  74  GLU GLU B . n 
B 1 55  ALA 55  75  75  ALA ALA B . n 
B 1 56  HIS 56  76  76  HIS HIS B . n 
B 1 57  GLY 57  77  77  GLY GLY B . n 
B 1 58  ASN 58  78  78  ASN ASN B . n 
B 1 59  ILE 59  79  79  ILE ILE B . n 
B 1 60  VAL 60  80  80  VAL VAL B . n 
B 1 61  ILE 61  81  81  ILE ILE B . n 
B 1 62  ASN 62  82  82  ASN ASN B . n 
B 1 63  ASP 63  83  83  ASP ASP B . n 
B 1 64  TRP 64  84  84  TRP TRP B . n 
B 1 65  ALA 65  85  85  ALA ALA B . n 
B 1 66  ALA 66  86  86  ALA ALA B . n 
B 1 67  LEU 67  87  87  LEU LEU B . n 
B 1 68  ALA 68  88  88  ALA ALA B . n 
B 1 69  ASP 69  89  89  ASP ASP B . n 
B 1 70  ALA 70  90  90  ALA ALA B . n 
B 1 71  ASP 71  91  91  ASP ASP B . n 
B 1 72  VAL 72  92  92  VAL VAL B . n 
B 1 73  VAL 73  93  93  VAL VAL B . n 
B 1 74  ILE 74  94  94  ILE ILE B . n 
B 1 75  SER 75  95  95  SER SER B . n 
B 1 76  THR 76  96  96  THR THR B . n 
B 1 77  LEU 77  97  97  LEU LEU B . n 
B 1 78  GLY 78  98  98  GLY GLY B . n 
B 1 79  ASN 79  99  99  ASN ASN B . n 
B 1 80  ILE 80  100 100 ILE ILE B . n 
B 1 81  LYS 81  101 101 LYS LYS B . n 
B 1 82  LEU 82  102 102 LEU LEU B . n 
B 1 83  GLN 83  103 103 GLN GLN B . n 
B 1 84  GLN 84  104 104 GLN GLN B . n 
B 1 85  ASP 85  105 ?   ?   ?   B . n 
B 1 86  ASN 86  106 ?   ?   ?   B . n 
B 1 87  PRO 87  107 ?   ?   ?   B . n 
B 1 88  THR 88  108 ?   ?   ?   B . n 
B 1 89  GLY 89  109 ?   ?   ?   B . n 
B 1 90  ASP 90  110 ?   ?   ?   B . n 
B 1 91  ARG 91  111 ?   ?   ?   B . n 
B 1 92  PHE 92  112 112 PHE PHE B . n 
B 1 93  ALA 93  113 113 ALA ALA B . n 
B 1 94  GLU 94  114 114 GLU GLU B . n 
B 1 95  LEU 95  115 115 LEU LEU B . n 
B 1 96  LYS 96  116 116 LYS LYS B . n 
B 1 97  PHE 97  117 117 PHE PHE B . n 
B 1 98  THR 98  118 118 THR THR B . n 
B 1 99  SER 99  119 119 SER SER B . n 
B 1 100 SER 100 120 120 SER SER B . n 
B 1 101 MET 101 121 121 MET MET B . n 
B 1 102 VAL 102 122 122 VAL VAL B . n 
B 1 103 GLN 103 123 123 GLN GLN B . n 
B 1 104 SER 104 124 124 SER SER B . n 
B 1 105 VAL 105 125 125 VAL VAL B . n 
B 1 106 GLY 106 126 126 GLY GLY B . n 
B 1 107 THR 107 127 127 THR THR B . n 
B 1 108 ASN 108 128 128 ASN ASN B . n 
B 1 109 LEU 109 129 129 LEU LEU B . n 
B 1 110 LYS 110 130 130 LYS LYS B . n 
B 1 111 GLU 111 131 131 GLU GLU B . n 
B 1 112 SER 112 132 132 SER SER B . n 
B 1 113 GLY 113 133 133 GLY GLY B . n 
B 1 114 PHE 114 134 134 PHE PHE B . n 
B 1 115 HIS 115 135 135 HIS HIS B . n 
B 1 116 GLY 116 136 136 GLY GLY B . n 
B 1 117 VAL 117 137 137 VAL VAL B . n 
B 1 118 LEU 118 138 138 LEU LEU B . n 
B 1 119 VAL 119 139 139 VAL VAL B . n 
B 1 120 VAL 120 140 140 VAL VAL B . n 
B 1 121 ILE 121 141 141 ILE ILE B . n 
B 1 122 SER 122 142 142 SER SER B . n 
B 1 123 ASN 123 143 143 ASN ASN B . n 
B 1 124 PRO 124 144 144 PRO PRO B . n 
B 1 125 VAL 125 145 145 VAL VAL B . n 
B 1 126 ASP 126 146 146 ASP ASP B . n 
B 1 127 VAL 127 147 147 VAL VAL B . n 
B 1 128 ILE 128 148 148 ILE ILE B . n 
B 1 129 THR 129 149 149 THR THR B . n 
B 1 130 ALA 130 150 150 ALA ALA B . n 
B 1 131 LEU 131 151 151 LEU LEU B . n 
B 1 132 PHE 132 152 152 PHE PHE B . n 
B 1 133 GLN 133 153 153 GLN GLN B . n 
B 1 134 HIS 134 154 154 HIS HIS B . n 
B 1 135 VAL 135 155 155 VAL VAL B . n 
B 1 136 THR 136 156 156 THR THR B . n 
B 1 137 GLY 137 157 157 GLY GLY B . n 
B 1 138 PHE 138 158 158 PHE PHE B . n 
B 1 139 PRO 139 159 159 PRO PRO B . n 
B 1 140 ALA 140 160 160 ALA ALA B . n 
B 1 141 HIS 141 161 161 HIS HIS B . n 
B 1 142 LYS 142 162 162 LYS LYS B . n 
B 1 143 VAL 143 163 163 VAL VAL B . n 
B 1 144 ILE 144 164 164 ILE ILE B . n 
B 1 145 GLY 145 165 165 GLY GLY B . n 
B 1 146 THR 146 166 166 THR THR B . n 
B 1 147 GLY 147 167 167 GLY GLY B . n 
B 1 148 THR 148 168 168 THR THR B . n 
B 1 149 LEU 149 169 169 LEU LEU B . n 
B 1 150 LEU 150 170 170 LEU LEU B . n 
B 1 151 ASP 151 171 171 ASP ASP B . n 
B 1 152 THR 152 172 172 THR THR B . n 
B 1 153 ALA 153 173 173 ALA ALA B . n 
B 1 154 ARG 154 174 174 ARG ARG B . n 
B 1 155 MET 155 175 175 MET MET B . n 
B 1 156 GLN 156 176 176 GLN GLN B . n 
B 1 157 ARG 157 177 177 ARG ARG B . n 
B 1 158 ALA 158 178 178 ALA ALA B . n 
B 1 159 VAL 159 179 179 VAL VAL B . n 
B 1 160 GLY 160 180 180 GLY GLY B . n 
B 1 161 GLU 161 181 181 GLU GLU B . n 
B 1 162 ALA 162 182 182 ALA ALA B . n 
B 1 163 PHE 163 183 183 PHE PHE B . n 
B 1 164 ASP 164 184 184 ASP ASP B . n 
B 1 165 LEU 165 185 185 LEU LEU B . n 
B 1 166 ASP 166 186 186 ASP ASP B . n 
B 1 167 PRO 167 187 187 PRO PRO B . n 
B 1 168 ARG 168 188 188 ARG ARG B . n 
B 1 169 SER 169 189 189 SER SER B . n 
B 1 170 VAL 170 190 190 VAL VAL B . n 
B 1 171 SER 171 191 191 SER SER B . n 
B 1 172 GLY 172 192 192 GLY GLY B . n 
B 1 173 TYR 173 193 193 TYR TYR B . n 
B 1 174 ASN 174 194 194 ASN ASN B . n 
B 1 175 LEU 175 195 195 LEU LEU B . n 
B 1 176 GLY 176 196 196 GLY GLY B . n 
B 1 177 GLU 177 197 197 GLU GLU B . n 
B 1 178 HIS 178 198 198 HIS HIS B . n 
B 1 179 GLY 179 199 199 GLY GLY B . n 
B 1 180 ASN 180 200 200 ASN ASN B . n 
B 1 181 SER 181 201 201 SER SER B . n 
B 1 182 GLN 182 202 202 GLN GLN B . n 
B 1 183 PHE 183 203 203 PHE PHE B . n 
B 1 184 VAL 184 204 204 VAL VAL B . n 
B 1 185 ALA 185 205 205 ALA ALA B . n 
B 1 186 TRP 186 206 206 TRP TRP B . n 
B 1 187 SER 187 207 207 SER SER B . n 
B 1 188 THR 188 208 208 THR THR B . n 
B 1 189 VAL 189 209 209 VAL VAL B . n 
B 1 190 ARG 190 210 210 ARG ARG B . n 
B 1 191 VAL 191 211 211 VAL VAL B . n 
B 1 192 MET 192 212 212 MET MET B . n 
B 1 193 GLY 193 213 213 GLY GLY B . n 
B 1 194 GLN 194 214 214 GLN GLN B . n 
B 1 195 PRO 195 215 215 PRO PRO B . n 
B 1 196 ILE 196 216 216 ILE ILE B . n 
B 1 197 VAL 197 217 217 VAL VAL B . n 
B 1 198 THR 198 218 218 THR THR B . n 
B 1 199 LEU 199 219 219 LEU LEU B . n 
B 1 200 ALA 200 220 ?   ?   ?   B . n 
B 1 201 ASP 201 221 ?   ?   ?   B . n 
B 1 202 ALA 202 222 ?   ?   ?   B . n 
B 1 203 GLY 203 223 ?   ?   ?   B . n 
B 1 204 ASP 204 224 ?   ?   ?   B . n 
B 1 205 ILE 205 225 225 ILE ILE B . n 
B 1 206 ASP 206 226 226 ASP ASP B . n 
B 1 207 LEU 207 227 227 LEU LEU B . n 
B 1 208 ALA 208 228 228 ALA ALA B . n 
B 1 209 ALA 209 229 229 ALA ALA B . n 
B 1 210 ILE 210 230 230 ILE ILE B . n 
B 1 211 GLU 211 231 231 GLU GLU B . n 
B 1 212 GLU 212 232 232 GLU GLU B . n 
B 1 213 GLU 213 233 233 GLU GLU B . n 
B 1 214 ALA 214 234 234 ALA ALA B . n 
B 1 215 ARG 215 235 235 ARG ARG B . n 
B 1 216 LYS 216 236 236 LYS LYS B . n 
B 1 217 GLY 217 237 237 GLY GLY B . n 
B 1 218 GLY 218 238 238 GLY GLY B . n 
B 1 219 PHE 219 239 239 PHE PHE B . n 
B 1 220 THR 220 240 240 THR THR B . n 
B 1 221 VAL 221 241 241 VAL VAL B . n 
B 1 222 LEU 222 242 242 LEU LEU B . n 
B 1 223 ASN 223 243 243 ASN ASN B . n 
B 1 224 GLY 224 244 244 GLY GLY B . n 
B 1 225 LYS 225 245 245 LYS LYS B . n 
B 1 226 GLY 226 246 246 GLY GLY B . n 
B 1 227 TYR 227 247 247 TYR TYR B . n 
B 1 228 THR 228 248 248 THR THR B . n 
B 1 229 SER 229 249 249 SER SER B . n 
B 1 230 TYR 230 250 250 TYR TYR B . n 
B 1 231 GLY 231 251 251 GLY GLY B . n 
B 1 232 VAL 232 252 252 VAL VAL B . n 
B 1 233 ALA 233 253 253 ALA ALA B . n 
B 1 234 THR 234 254 254 THR THR B . n 
B 1 235 SER 235 255 255 SER SER B . n 
B 1 236 ALA 236 256 256 ALA ALA B . n 
B 1 237 ILE 237 257 257 ILE ILE B . n 
B 1 238 ARG 238 258 258 ARG ARG B . n 
B 1 239 ILE 239 259 259 ILE ILE B . n 
B 1 240 ALA 240 260 260 ALA ALA B . n 
B 1 241 LYS 241 261 261 LYS LYS B . n 
B 1 242 ALA 242 262 262 ALA ALA B . n 
B 1 243 VAL 243 263 263 VAL VAL B . n 
B 1 244 MET 244 264 264 MET MET B . n 
B 1 245 ALA 245 265 265 ALA ALA B . n 
B 1 246 ASP 246 266 266 ASP ASP B . n 
B 1 247 ALA 247 267 267 ALA ALA B . n 
B 1 248 HIS 248 268 268 HIS HIS B . n 
B 1 249 ALA 249 269 269 ALA ALA B . n 
B 1 250 GLU 250 270 270 GLU GLU B . n 
B 1 251 LEU 251 271 271 LEU LEU B . n 
B 1 252 VAL 252 272 272 VAL VAL B . n 
B 1 253 VAL 253 273 273 VAL VAL B . n 
B 1 254 SER 254 274 274 SER SER B . n 
B 1 255 ASN 255 275 275 ASN ASN B . n 
B 1 256 ARG 256 276 276 ARG ARG B . n 
B 1 257 ARG 257 277 277 ARG ARG B . n 
B 1 258 ASP 258 278 278 ASP ASP B . n 
B 1 259 ASP 259 279 279 ASP ASP B . n 
B 1 260 MET 260 280 280 MET MET B . n 
B 1 261 GLY 261 281 281 GLY GLY B . n 
B 1 262 MET 262 282 282 MET MET B . n 
B 1 263 TYR 263 283 283 TYR TYR B . n 
B 1 264 LEU 264 284 284 LEU LEU B . n 
B 1 265 SER 265 285 285 SER SER B . n 
B 1 266 TYR 266 286 286 TYR TYR B . n 
B 1 267 PRO 267 287 287 PRO PRO B . n 
B 1 268 ALA 268 288 288 ALA ALA B . n 
B 1 269 ILE 269 289 289 ILE ILE B . n 
B 1 270 ILE 270 290 290 ILE ILE B . n 
B 1 271 GLY 271 291 291 GLY GLY B . n 
B 1 272 ARG 272 292 292 ARG ARG B . n 
B 1 273 ASP 273 293 293 ASP ASP B . n 
B 1 274 GLY 274 294 294 GLY GLY B . n 
B 1 275 VAL 275 295 295 VAL VAL B . n 
B 1 276 LEU 276 296 296 LEU LEU B . n 
B 1 277 ALA 277 297 297 ALA ALA B . n 
B 1 278 GLU 278 298 298 GLU GLU B . n 
B 1 279 THR 279 299 299 THR THR B . n 
B 1 280 THR 280 300 300 THR THR B . n 
B 1 281 LEU 281 301 301 LEU LEU B . n 
B 1 282 ASP 282 302 302 ASP ASP B . n 
B 1 283 LEU 283 303 303 LEU LEU B . n 
B 1 284 THR 284 304 304 THR THR B . n 
B 1 285 THR 285 305 305 THR THR B . n 
B 1 286 ASP 286 306 306 ASP ASP B . n 
B 1 287 GLU 287 307 307 GLU GLU B . n 
B 1 288 GLN 288 308 308 GLN GLN B . n 
B 1 289 GLU 289 309 309 GLU GLU B . n 
B 1 290 LYS 290 310 310 LYS LYS B . n 
B 1 291 LEU 291 311 311 LEU LEU B . n 
B 1 292 LEU 292 312 312 LEU LEU B . n 
B 1 293 GLN 293 313 313 GLN GLN B . n 
B 1 294 SER 294 314 314 SER SER B . n 
B 1 295 ARG 295 315 315 ARG ARG B . n 
B 1 296 ASP 296 316 316 ASP ASP B . n 
B 1 297 TYR 297 317 317 TYR TYR B . n 
B 1 298 ILE 298 318 318 ILE ILE B . n 
B 1 299 GLN 299 319 319 GLN GLN B . n 
B 1 300 GLN 300 320 320 GLN GLN B . n 
B 1 301 ARG 301 321 321 ARG ARG B . n 
B 1 302 PHE 302 322 322 PHE PHE B . n 
B 1 303 ASP 303 323 323 ASP ASP B . n 
B 1 304 GLU 304 324 324 GLU GLU B . n 
B 1 305 ILE 305 325 325 ILE ILE B . n 
B 1 306 VAL 306 326 326 VAL VAL B . n 
B 1 307 ASP 307 327 ?   ?   ?   B . n 
B 1 308 THR 308 328 ?   ?   ?   B . n 
B 1 309 LEU 309 329 ?   ?   ?   B . n 
C 1 1   ALA 1   21  21  ALA ALA C . n 
C 1 2   ARG 2   22  22  ARG ARG C . n 
C 1 3   LYS 3   23  23  LYS LYS C . n 
C 1 4   ILE 4   24  24  ILE ILE C . n 
C 1 5   GLY 5   25  25  GLY GLY C . n 
C 1 6   ILE 6   26  26  ILE ILE C . n 
C 1 7   ILE 7   27  27  ILE ILE C . n 
C 1 8   GLY 8   28  28  GLY GLY C . n 
C 1 9   LEU 9   29  29  LEU LEU C . n 
C 1 10  GLY 10  30  30  GLY GLY C . n 
C 1 11  ASN 11  31  31  ASN ASN C . n 
C 1 12  VAL 12  32  32  VAL VAL C . n 
C 1 13  GLY 13  33  33  GLY GLY C . n 
C 1 14  ALA 14  34  34  ALA ALA C . n 
C 1 15  ALA 15  35  35  ALA ALA C . n 
C 1 16  VAL 16  36  36  VAL VAL C . n 
C 1 17  ALA 17  37  37  ALA ALA C . n 
C 1 18  HIS 18  38  38  HIS HIS C . n 
C 1 19  GLY 19  39  39  GLY GLY C . n 
C 1 20  LEU 20  40  40  LEU LEU C . n 
C 1 21  ILE 21  41  41  ILE ILE C . n 
C 1 22  ALA 22  42  42  ALA ALA C . n 
C 1 23  GLN 23  43  43  GLN GLN C . n 
C 1 24  GLY 24  44  44  GLY GLY C . n 
C 1 25  VAL 25  45  45  VAL VAL C . n 
C 1 26  ALA 26  46  46  ALA ALA C . n 
C 1 27  ASP 27  47  47  ASP ASP C . n 
C 1 28  ASP 28  48  48  ASP ASP C . n 
C 1 29  TYR 29  49  49  TYR TYR C . n 
C 1 30  VAL 30  50  50  VAL VAL C . n 
C 1 31  PHE 31  51  51  PHE PHE C . n 
C 1 32  ILE 32  52  52  ILE ILE C . n 
C 1 33  ASP 33  53  53  ASP ASP C . n 
C 1 34  ALA 34  54  54  ALA ALA C . n 
C 1 35  ASN 35  55  55  ASN ASN C . n 
C 1 36  GLU 36  56  56  GLU GLU C . n 
C 1 37  ALA 37  57  57  ALA ALA C . n 
C 1 38  LYS 38  58  58  LYS LYS C . n 
C 1 39  VAL 39  59  59  VAL VAL C . n 
C 1 40  LYS 40  60  60  LYS LYS C . n 
C 1 41  ALA 41  61  61  ALA ALA C . n 
C 1 42  ASP 42  62  62  ASP ASP C . n 
C 1 43  GLN 43  63  63  GLN GLN C . n 
C 1 44  ILE 44  64  64  ILE ILE C . n 
C 1 45  ASP 45  65  65  ASP ASP C . n 
C 1 46  PHE 46  66  66  PHE PHE C . n 
C 1 47  GLN 47  67  67  GLN GLN C . n 
C 1 48  ASP 48  68  68  ASP ASP C . n 
C 1 49  ALA 49  69  69  ALA ALA C . n 
C 1 50  MET 50  70  70  MET MET C . n 
C 1 51  ALA 51  71  71  ALA ALA C . n 
C 1 52  ASN 52  72  72  ASN ASN C . n 
C 1 53  LEU 53  73  73  LEU LEU C . n 
C 1 54  GLU 54  74  74  GLU GLU C . n 
C 1 55  ALA 55  75  75  ALA ALA C . n 
C 1 56  HIS 56  76  76  HIS HIS C . n 
C 1 57  GLY 57  77  77  GLY GLY C . n 
C 1 58  ASN 58  78  78  ASN ASN C . n 
C 1 59  ILE 59  79  79  ILE ILE C . n 
C 1 60  VAL 60  80  80  VAL VAL C . n 
C 1 61  ILE 61  81  81  ILE ILE C . n 
C 1 62  ASN 62  82  82  ASN ASN C . n 
C 1 63  ASP 63  83  83  ASP ASP C . n 
C 1 64  TRP 64  84  84  TRP TRP C . n 
C 1 65  ALA 65  85  85  ALA ALA C . n 
C 1 66  ALA 66  86  86  ALA ALA C . n 
C 1 67  LEU 67  87  87  LEU LEU C . n 
C 1 68  ALA 68  88  88  ALA ALA C . n 
C 1 69  ASP 69  89  89  ASP ASP C . n 
C 1 70  ALA 70  90  90  ALA ALA C . n 
C 1 71  ASP 71  91  91  ASP ASP C . n 
C 1 72  VAL 72  92  92  VAL VAL C . n 
C 1 73  VAL 73  93  93  VAL VAL C . n 
C 1 74  ILE 74  94  94  ILE ILE C . n 
C 1 75  SER 75  95  95  SER SER C . n 
C 1 76  THR 76  96  96  THR THR C . n 
C 1 77  LEU 77  97  97  LEU LEU C . n 
C 1 78  GLY 78  98  98  GLY GLY C . n 
C 1 79  ASN 79  99  ?   ?   ?   C . n 
C 1 80  ILE 80  100 ?   ?   ?   C . n 
C 1 81  LYS 81  101 ?   ?   ?   C . n 
C 1 82  LEU 82  102 ?   ?   ?   C . n 
C 1 83  GLN 83  103 ?   ?   ?   C . n 
C 1 84  GLN 84  104 ?   ?   ?   C . n 
C 1 85  ASP 85  105 ?   ?   ?   C . n 
C 1 86  ASN 86  106 ?   ?   ?   C . n 
C 1 87  PRO 87  107 ?   ?   ?   C . n 
C 1 88  THR 88  108 ?   ?   ?   C . n 
C 1 89  GLY 89  109 109 GLY GLY C . n 
C 1 90  ASP 90  110 110 ASP ASP C . n 
C 1 91  ARG 91  111 111 ARG ARG C . n 
C 1 92  PHE 92  112 112 PHE PHE C . n 
C 1 93  ALA 93  113 113 ALA ALA C . n 
C 1 94  GLU 94  114 114 GLU GLU C . n 
C 1 95  LEU 95  115 115 LEU LEU C . n 
C 1 96  LYS 96  116 116 LYS LYS C . n 
C 1 97  PHE 97  117 117 PHE PHE C . n 
C 1 98  THR 98  118 118 THR THR C . n 
C 1 99  SER 99  119 119 SER SER C . n 
C 1 100 SER 100 120 120 SER SER C . n 
C 1 101 MET 101 121 121 MET MET C . n 
C 1 102 VAL 102 122 122 VAL VAL C . n 
C 1 103 GLN 103 123 123 GLN GLN C . n 
C 1 104 SER 104 124 124 SER SER C . n 
C 1 105 VAL 105 125 125 VAL VAL C . n 
C 1 106 GLY 106 126 126 GLY GLY C . n 
C 1 107 THR 107 127 127 THR THR C . n 
C 1 108 ASN 108 128 128 ASN ASN C . n 
C 1 109 LEU 109 129 129 LEU LEU C . n 
C 1 110 LYS 110 130 130 LYS LYS C . n 
C 1 111 GLU 111 131 131 GLU GLU C . n 
C 1 112 SER 112 132 132 SER SER C . n 
C 1 113 GLY 113 133 133 GLY GLY C . n 
C 1 114 PHE 114 134 134 PHE PHE C . n 
C 1 115 HIS 115 135 135 HIS HIS C . n 
C 1 116 GLY 116 136 136 GLY GLY C . n 
C 1 117 VAL 117 137 137 VAL VAL C . n 
C 1 118 LEU 118 138 138 LEU LEU C . n 
C 1 119 VAL 119 139 139 VAL VAL C . n 
C 1 120 VAL 120 140 140 VAL VAL C . n 
C 1 121 ILE 121 141 141 ILE ILE C . n 
C 1 122 SER 122 142 142 SER SER C . n 
C 1 123 ASN 123 143 143 ASN ASN C . n 
C 1 124 PRO 124 144 144 PRO PRO C . n 
C 1 125 VAL 125 145 145 VAL VAL C . n 
C 1 126 ASP 126 146 146 ASP ASP C . n 
C 1 127 VAL 127 147 147 VAL VAL C . n 
C 1 128 ILE 128 148 148 ILE ILE C . n 
C 1 129 THR 129 149 149 THR THR C . n 
C 1 130 ALA 130 150 150 ALA ALA C . n 
C 1 131 LEU 131 151 151 LEU LEU C . n 
C 1 132 PHE 132 152 152 PHE PHE C . n 
C 1 133 GLN 133 153 153 GLN GLN C . n 
C 1 134 HIS 134 154 154 HIS HIS C . n 
C 1 135 VAL 135 155 155 VAL VAL C . n 
C 1 136 THR 136 156 156 THR THR C . n 
C 1 137 GLY 137 157 157 GLY GLY C . n 
C 1 138 PHE 138 158 158 PHE PHE C . n 
C 1 139 PRO 139 159 159 PRO PRO C . n 
C 1 140 ALA 140 160 160 ALA ALA C . n 
C 1 141 HIS 141 161 161 HIS HIS C . n 
C 1 142 LYS 142 162 162 LYS LYS C . n 
C 1 143 VAL 143 163 163 VAL VAL C . n 
C 1 144 ILE 144 164 164 ILE ILE C . n 
C 1 145 GLY 145 165 165 GLY GLY C . n 
C 1 146 THR 146 166 166 THR THR C . n 
C 1 147 GLY 147 167 167 GLY GLY C . n 
C 1 148 THR 148 168 168 THR THR C . n 
C 1 149 LEU 149 169 169 LEU LEU C . n 
C 1 150 LEU 150 170 170 LEU LEU C . n 
C 1 151 ASP 151 171 171 ASP ASP C . n 
C 1 152 THR 152 172 172 THR THR C . n 
C 1 153 ALA 153 173 173 ALA ALA C . n 
C 1 154 ARG 154 174 174 ARG ARG C . n 
C 1 155 MET 155 175 175 MET MET C . n 
C 1 156 GLN 156 176 176 GLN GLN C . n 
C 1 157 ARG 157 177 177 ARG ARG C . n 
C 1 158 ALA 158 178 178 ALA ALA C . n 
C 1 159 VAL 159 179 179 VAL VAL C . n 
C 1 160 GLY 160 180 180 GLY GLY C . n 
C 1 161 GLU 161 181 181 GLU GLU C . n 
C 1 162 ALA 162 182 182 ALA ALA C . n 
C 1 163 PHE 163 183 183 PHE PHE C . n 
C 1 164 ASP 164 184 184 ASP ASP C . n 
C 1 165 LEU 165 185 185 LEU LEU C . n 
C 1 166 ASP 166 186 186 ASP ASP C . n 
C 1 167 PRO 167 187 187 PRO PRO C . n 
C 1 168 ARG 168 188 188 ARG ARG C . n 
C 1 169 SER 169 189 189 SER SER C . n 
C 1 170 VAL 170 190 190 VAL VAL C . n 
C 1 171 SER 171 191 191 SER SER C . n 
C 1 172 GLY 172 192 192 GLY GLY C . n 
C 1 173 TYR 173 193 193 TYR TYR C . n 
C 1 174 ASN 174 194 194 ASN ASN C . n 
C 1 175 LEU 175 195 195 LEU LEU C . n 
C 1 176 GLY 176 196 196 GLY GLY C . n 
C 1 177 GLU 177 197 197 GLU GLU C . n 
C 1 178 HIS 178 198 198 HIS HIS C . n 
C 1 179 GLY 179 199 199 GLY GLY C . n 
C 1 180 ASN 180 200 200 ASN ASN C . n 
C 1 181 SER 181 201 201 SER SER C . n 
C 1 182 GLN 182 202 202 GLN GLN C . n 
C 1 183 PHE 183 203 203 PHE PHE C . n 
C 1 184 VAL 184 204 204 VAL VAL C . n 
C 1 185 ALA 185 205 205 ALA ALA C . n 
C 1 186 TRP 186 206 206 TRP TRP C . n 
C 1 187 SER 187 207 207 SER SER C . n 
C 1 188 THR 188 208 208 THR THR C . n 
C 1 189 VAL 189 209 209 VAL VAL C . n 
C 1 190 ARG 190 210 210 ARG ARG C . n 
C 1 191 VAL 191 211 211 VAL VAL C . n 
C 1 192 MET 192 212 212 MET MET C . n 
C 1 193 GLY 193 213 213 GLY GLY C . n 
C 1 194 GLN 194 214 214 GLN GLN C . n 
C 1 195 PRO 195 215 215 PRO PRO C . n 
C 1 196 ILE 196 216 216 ILE ILE C . n 
C 1 197 VAL 197 217 217 VAL VAL C . n 
C 1 198 THR 198 218 218 THR THR C . n 
C 1 199 LEU 199 219 219 LEU LEU C . n 
C 1 200 ALA 200 220 220 ALA ALA C . n 
C 1 201 ASP 201 221 221 ASP ASP C . n 
C 1 202 ALA 202 222 222 ALA ALA C . n 
C 1 203 GLY 203 223 ?   ?   ?   C . n 
C 1 204 ASP 204 224 ?   ?   ?   C . n 
C 1 205 ILE 205 225 225 ILE ILE C . n 
C 1 206 ASP 206 226 226 ASP ASP C . n 
C 1 207 LEU 207 227 227 LEU LEU C . n 
C 1 208 ALA 208 228 228 ALA ALA C . n 
C 1 209 ALA 209 229 229 ALA ALA C . n 
C 1 210 ILE 210 230 230 ILE ILE C . n 
C 1 211 GLU 211 231 231 GLU GLU C . n 
C 1 212 GLU 212 232 232 GLU GLU C . n 
C 1 213 GLU 213 233 233 GLU GLU C . n 
C 1 214 ALA 214 234 234 ALA ALA C . n 
C 1 215 ARG 215 235 235 ARG ARG C . n 
C 1 216 LYS 216 236 236 LYS LYS C . n 
C 1 217 GLY 217 237 237 GLY GLY C . n 
C 1 218 GLY 218 238 238 GLY GLY C . n 
C 1 219 PHE 219 239 239 PHE PHE C . n 
C 1 220 THR 220 240 240 THR THR C . n 
C 1 221 VAL 221 241 241 VAL VAL C . n 
C 1 222 LEU 222 242 242 LEU LEU C . n 
C 1 223 ASN 223 243 243 ASN ASN C . n 
C 1 224 GLY 224 244 244 GLY GLY C . n 
C 1 225 LYS 225 245 245 LYS LYS C . n 
C 1 226 GLY 226 246 246 GLY GLY C . n 
C 1 227 TYR 227 247 247 TYR TYR C . n 
C 1 228 THR 228 248 248 THR THR C . n 
C 1 229 SER 229 249 249 SER SER C . n 
C 1 230 TYR 230 250 250 TYR TYR C . n 
C 1 231 GLY 231 251 251 GLY GLY C . n 
C 1 232 VAL 232 252 252 VAL VAL C . n 
C 1 233 ALA 233 253 253 ALA ALA C . n 
C 1 234 THR 234 254 254 THR THR C . n 
C 1 235 SER 235 255 255 SER SER C . n 
C 1 236 ALA 236 256 256 ALA ALA C . n 
C 1 237 ILE 237 257 257 ILE ILE C . n 
C 1 238 ARG 238 258 258 ARG ARG C . n 
C 1 239 ILE 239 259 259 ILE ILE C . n 
C 1 240 ALA 240 260 260 ALA ALA C . n 
C 1 241 LYS 241 261 261 LYS LYS C . n 
C 1 242 ALA 242 262 262 ALA ALA C . n 
C 1 243 VAL 243 263 263 VAL VAL C . n 
C 1 244 MET 244 264 264 MET MET C . n 
C 1 245 ALA 245 265 265 ALA ALA C . n 
C 1 246 ASP 246 266 266 ASP ASP C . n 
C 1 247 ALA 247 267 267 ALA ALA C . n 
C 1 248 HIS 248 268 268 HIS HIS C . n 
C 1 249 ALA 249 269 269 ALA ALA C . n 
C 1 250 GLU 250 270 270 GLU GLU C . n 
C 1 251 LEU 251 271 271 LEU LEU C . n 
C 1 252 VAL 252 272 272 VAL VAL C . n 
C 1 253 VAL 253 273 273 VAL VAL C . n 
C 1 254 SER 254 274 274 SER SER C . n 
C 1 255 ASN 255 275 275 ASN ASN C . n 
C 1 256 ARG 256 276 276 ARG ARG C . n 
C 1 257 ARG 257 277 277 ARG ARG C . n 
C 1 258 ASP 258 278 278 ASP ASP C . n 
C 1 259 ASP 259 279 279 ASP ASP C . n 
C 1 260 MET 260 280 280 MET MET C . n 
C 1 261 GLY 261 281 281 GLY GLY C . n 
C 1 262 MET 262 282 282 MET MET C . n 
C 1 263 TYR 263 283 283 TYR TYR C . n 
C 1 264 LEU 264 284 284 LEU LEU C . n 
C 1 265 SER 265 285 285 SER SER C . n 
C 1 266 TYR 266 286 286 TYR TYR C . n 
C 1 267 PRO 267 287 287 PRO PRO C . n 
C 1 268 ALA 268 288 288 ALA ALA C . n 
C 1 269 ILE 269 289 289 ILE ILE C . n 
C 1 270 ILE 270 290 290 ILE ILE C . n 
C 1 271 GLY 271 291 291 GLY GLY C . n 
C 1 272 ARG 272 292 292 ARG ARG C . n 
C 1 273 ASP 273 293 293 ASP ASP C . n 
C 1 274 GLY 274 294 294 GLY GLY C . n 
C 1 275 VAL 275 295 295 VAL VAL C . n 
C 1 276 LEU 276 296 296 LEU LEU C . n 
C 1 277 ALA 277 297 297 ALA ALA C . n 
C 1 278 GLU 278 298 298 GLU GLU C . n 
C 1 279 THR 279 299 299 THR THR C . n 
C 1 280 THR 280 300 300 THR THR C . n 
C 1 281 LEU 281 301 301 LEU LEU C . n 
C 1 282 ASP 282 302 302 ASP ASP C . n 
C 1 283 LEU 283 303 303 LEU LEU C . n 
C 1 284 THR 284 304 304 THR THR C . n 
C 1 285 THR 285 305 305 THR THR C . n 
C 1 286 ASP 286 306 306 ASP ASP C . n 
C 1 287 GLU 287 307 307 GLU GLU C . n 
C 1 288 GLN 288 308 308 GLN GLN C . n 
C 1 289 GLU 289 309 309 GLU GLU C . n 
C 1 290 LYS 290 310 310 LYS LYS C . n 
C 1 291 LEU 291 311 311 LEU LEU C . n 
C 1 292 LEU 292 312 312 LEU LEU C . n 
C 1 293 GLN 293 313 313 GLN GLN C . n 
C 1 294 SER 294 314 314 SER SER C . n 
C 1 295 ARG 295 315 315 ARG ARG C . n 
C 1 296 ASP 296 316 316 ASP ASP C . n 
C 1 297 TYR 297 317 317 TYR TYR C . n 
C 1 298 ILE 298 318 318 ILE ILE C . n 
C 1 299 GLN 299 319 319 GLN GLN C . n 
C 1 300 GLN 300 320 320 GLN GLN C . n 
C 1 301 ARG 301 321 321 ARG ARG C . n 
C 1 302 PHE 302 322 322 PHE PHE C . n 
C 1 303 ASP 303 323 323 ASP ASP C . n 
C 1 304 GLU 304 324 324 GLU GLU C . n 
C 1 305 ILE 305 325 325 ILE ILE C . n 
C 1 306 VAL 306 326 326 VAL VAL C . n 
C 1 307 ASP 307 327 327 ASP ASP C . n 
C 1 308 THR 308 328 328 THR THR C . n 
C 1 309 LEU 309 329 329 LEU LEU C . n 
D 1 1   ALA 1   21  21  ALA ALA D . n 
D 1 2   ARG 2   22  22  ARG ARG D . n 
D 1 3   LYS 3   23  23  LYS LYS D . n 
D 1 4   ILE 4   24  24  ILE ILE D . n 
D 1 5   GLY 5   25  25  GLY GLY D . n 
D 1 6   ILE 6   26  26  ILE ILE D . n 
D 1 7   ILE 7   27  27  ILE ILE D . n 
D 1 8   GLY 8   28  28  GLY GLY D . n 
D 1 9   LEU 9   29  29  LEU LEU D . n 
D 1 10  GLY 10  30  30  GLY GLY D . n 
D 1 11  ASN 11  31  31  ASN ASN D . n 
D 1 12  VAL 12  32  32  VAL VAL D . n 
D 1 13  GLY 13  33  33  GLY GLY D . n 
D 1 14  ALA 14  34  34  ALA ALA D . n 
D 1 15  ALA 15  35  35  ALA ALA D . n 
D 1 16  VAL 16  36  36  VAL VAL D . n 
D 1 17  ALA 17  37  37  ALA ALA D . n 
D 1 18  HIS 18  38  38  HIS HIS D . n 
D 1 19  GLY 19  39  39  GLY GLY D . n 
D 1 20  LEU 20  40  40  LEU LEU D . n 
D 1 21  ILE 21  41  41  ILE ILE D . n 
D 1 22  ALA 22  42  42  ALA ALA D . n 
D 1 23  GLN 23  43  43  GLN GLN D . n 
D 1 24  GLY 24  44  44  GLY GLY D . n 
D 1 25  VAL 25  45  45  VAL VAL D . n 
D 1 26  ALA 26  46  46  ALA ALA D . n 
D 1 27  ASP 27  47  47  ASP ASP D . n 
D 1 28  ASP 28  48  48  ASP ASP D . n 
D 1 29  TYR 29  49  49  TYR TYR D . n 
D 1 30  VAL 30  50  50  VAL VAL D . n 
D 1 31  PHE 31  51  51  PHE PHE D . n 
D 1 32  ILE 32  52  52  ILE ILE D . n 
D 1 33  ASP 33  53  53  ASP ASP D . n 
D 1 34  ALA 34  54  54  ALA ALA D . n 
D 1 35  ASN 35  55  55  ASN ASN D . n 
D 1 36  GLU 36  56  56  GLU GLU D . n 
D 1 37  ALA 37  57  57  ALA ALA D . n 
D 1 38  LYS 38  58  58  LYS LYS D . n 
D 1 39  VAL 39  59  59  VAL VAL D . n 
D 1 40  LYS 40  60  60  LYS LYS D . n 
D 1 41  ALA 41  61  61  ALA ALA D . n 
D 1 42  ASP 42  62  62  ASP ASP D . n 
D 1 43  GLN 43  63  63  GLN GLN D . n 
D 1 44  ILE 44  64  64  ILE ILE D . n 
D 1 45  ASP 45  65  65  ASP ASP D . n 
D 1 46  PHE 46  66  66  PHE PHE D . n 
D 1 47  GLN 47  67  67  GLN GLN D . n 
D 1 48  ASP 48  68  68  ASP ASP D . n 
D 1 49  ALA 49  69  69  ALA ALA D . n 
D 1 50  MET 50  70  70  MET MET D . n 
D 1 51  ALA 51  71  71  ALA ALA D . n 
D 1 52  ASN 52  72  72  ASN ASN D . n 
D 1 53  LEU 53  73  73  LEU LEU D . n 
D 1 54  GLU 54  74  74  GLU GLU D . n 
D 1 55  ALA 55  75  75  ALA ALA D . n 
D 1 56  HIS 56  76  76  HIS HIS D . n 
D 1 57  GLY 57  77  77  GLY GLY D . n 
D 1 58  ASN 58  78  78  ASN ASN D . n 
D 1 59  ILE 59  79  79  ILE ILE D . n 
D 1 60  VAL 60  80  80  VAL VAL D . n 
D 1 61  ILE 61  81  81  ILE ILE D . n 
D 1 62  ASN 62  82  82  ASN ASN D . n 
D 1 63  ASP 63  83  83  ASP ASP D . n 
D 1 64  TRP 64  84  84  TRP TRP D . n 
D 1 65  ALA 65  85  85  ALA ALA D . n 
D 1 66  ALA 66  86  86  ALA ALA D . n 
D 1 67  LEU 67  87  87  LEU LEU D . n 
D 1 68  ALA 68  88  88  ALA ALA D . n 
D 1 69  ASP 69  89  89  ASP ASP D . n 
D 1 70  ALA 70  90  90  ALA ALA D . n 
D 1 71  ASP 71  91  91  ASP ASP D . n 
D 1 72  VAL 72  92  92  VAL VAL D . n 
D 1 73  VAL 73  93  93  VAL VAL D . n 
D 1 74  ILE 74  94  94  ILE ILE D . n 
D 1 75  SER 75  95  95  SER SER D . n 
D 1 76  THR 76  96  96  THR THR D . n 
D 1 77  LEU 77  97  97  LEU LEU D . n 
D 1 78  GLY 78  98  98  GLY GLY D . n 
D 1 79  ASN 79  99  ?   ?   ?   D . n 
D 1 80  ILE 80  100 ?   ?   ?   D . n 
D 1 81  LYS 81  101 ?   ?   ?   D . n 
D 1 82  LEU 82  102 ?   ?   ?   D . n 
D 1 83  GLN 83  103 ?   ?   ?   D . n 
D 1 84  GLN 84  104 ?   ?   ?   D . n 
D 1 85  ASP 85  105 ?   ?   ?   D . n 
D 1 86  ASN 86  106 ?   ?   ?   D . n 
D 1 87  PRO 87  107 ?   ?   ?   D . n 
D 1 88  THR 88  108 ?   ?   ?   D . n 
D 1 89  GLY 89  109 109 GLY GLY D . n 
D 1 90  ASP 90  110 110 ASP ASP D . n 
D 1 91  ARG 91  111 111 ARG ARG D . n 
D 1 92  PHE 92  112 112 PHE PHE D . n 
D 1 93  ALA 93  113 113 ALA ALA D . n 
D 1 94  GLU 94  114 114 GLU GLU D . n 
D 1 95  LEU 95  115 115 LEU LEU D . n 
D 1 96  LYS 96  116 116 LYS LYS D . n 
D 1 97  PHE 97  117 117 PHE PHE D . n 
D 1 98  THR 98  118 118 THR THR D . n 
D 1 99  SER 99  119 119 SER SER D . n 
D 1 100 SER 100 120 120 SER SER D . n 
D 1 101 MET 101 121 121 MET MET D . n 
D 1 102 VAL 102 122 122 VAL VAL D . n 
D 1 103 GLN 103 123 123 GLN GLN D . n 
D 1 104 SER 104 124 124 SER SER D . n 
D 1 105 VAL 105 125 125 VAL VAL D . n 
D 1 106 GLY 106 126 126 GLY GLY D . n 
D 1 107 THR 107 127 127 THR THR D . n 
D 1 108 ASN 108 128 128 ASN ASN D . n 
D 1 109 LEU 109 129 129 LEU LEU D . n 
D 1 110 LYS 110 130 130 LYS LYS D . n 
D 1 111 GLU 111 131 131 GLU GLU D . n 
D 1 112 SER 112 132 132 SER SER D . n 
D 1 113 GLY 113 133 133 GLY GLY D . n 
D 1 114 PHE 114 134 134 PHE PHE D . n 
D 1 115 HIS 115 135 135 HIS HIS D . n 
D 1 116 GLY 116 136 136 GLY GLY D . n 
D 1 117 VAL 117 137 137 VAL VAL D . n 
D 1 118 LEU 118 138 138 LEU LEU D . n 
D 1 119 VAL 119 139 139 VAL VAL D . n 
D 1 120 VAL 120 140 140 VAL VAL D . n 
D 1 121 ILE 121 141 141 ILE ILE D . n 
D 1 122 SER 122 142 142 SER SER D . n 
D 1 123 ASN 123 143 143 ASN ASN D . n 
D 1 124 PRO 124 144 144 PRO PRO D . n 
D 1 125 VAL 125 145 145 VAL VAL D . n 
D 1 126 ASP 126 146 146 ASP ASP D . n 
D 1 127 VAL 127 147 147 VAL VAL D . n 
D 1 128 ILE 128 148 148 ILE ILE D . n 
D 1 129 THR 129 149 149 THR THR D . n 
D 1 130 ALA 130 150 150 ALA ALA D . n 
D 1 131 LEU 131 151 151 LEU LEU D . n 
D 1 132 PHE 132 152 152 PHE PHE D . n 
D 1 133 GLN 133 153 153 GLN GLN D . n 
D 1 134 HIS 134 154 154 HIS HIS D . n 
D 1 135 VAL 135 155 155 VAL VAL D . n 
D 1 136 THR 136 156 156 THR THR D . n 
D 1 137 GLY 137 157 157 GLY GLY D . n 
D 1 138 PHE 138 158 158 PHE PHE D . n 
D 1 139 PRO 139 159 159 PRO PRO D . n 
D 1 140 ALA 140 160 160 ALA ALA D . n 
D 1 141 HIS 141 161 161 HIS HIS D . n 
D 1 142 LYS 142 162 162 LYS LYS D . n 
D 1 143 VAL 143 163 163 VAL VAL D . n 
D 1 144 ILE 144 164 164 ILE ILE D . n 
D 1 145 GLY 145 165 165 GLY GLY D . n 
D 1 146 THR 146 166 166 THR THR D . n 
D 1 147 GLY 147 167 167 GLY GLY D . n 
D 1 148 THR 148 168 168 THR THR D . n 
D 1 149 LEU 149 169 169 LEU LEU D . n 
D 1 150 LEU 150 170 170 LEU LEU D . n 
D 1 151 ASP 151 171 171 ASP ASP D . n 
D 1 152 THR 152 172 172 THR THR D . n 
D 1 153 ALA 153 173 173 ALA ALA D . n 
D 1 154 ARG 154 174 174 ARG ARG D . n 
D 1 155 MET 155 175 175 MET MET D . n 
D 1 156 GLN 156 176 176 GLN GLN D . n 
D 1 157 ARG 157 177 177 ARG ARG D . n 
D 1 158 ALA 158 178 178 ALA ALA D . n 
D 1 159 VAL 159 179 179 VAL VAL D . n 
D 1 160 GLY 160 180 180 GLY GLY D . n 
D 1 161 GLU 161 181 181 GLU GLU D . n 
D 1 162 ALA 162 182 182 ALA ALA D . n 
D 1 163 PHE 163 183 183 PHE PHE D . n 
D 1 164 ASP 164 184 184 ASP ASP D . n 
D 1 165 LEU 165 185 185 LEU LEU D . n 
D 1 166 ASP 166 186 186 ASP ASP D . n 
D 1 167 PRO 167 187 187 PRO PRO D . n 
D 1 168 ARG 168 188 188 ARG ARG D . n 
D 1 169 SER 169 189 189 SER SER D . n 
D 1 170 VAL 170 190 190 VAL VAL D . n 
D 1 171 SER 171 191 191 SER SER D . n 
D 1 172 GLY 172 192 192 GLY GLY D . n 
D 1 173 TYR 173 193 193 TYR TYR D . n 
D 1 174 ASN 174 194 194 ASN ASN D . n 
D 1 175 LEU 175 195 195 LEU LEU D . n 
D 1 176 GLY 176 196 196 GLY GLY D . n 
D 1 177 GLU 177 197 197 GLU GLU D . n 
D 1 178 HIS 178 198 198 HIS HIS D . n 
D 1 179 GLY 179 199 199 GLY GLY D . n 
D 1 180 ASN 180 200 200 ASN ASN D . n 
D 1 181 SER 181 201 201 SER SER D . n 
D 1 182 GLN 182 202 202 GLN GLN D . n 
D 1 183 PHE 183 203 203 PHE PHE D . n 
D 1 184 VAL 184 204 204 VAL VAL D . n 
D 1 185 ALA 185 205 205 ALA ALA D . n 
D 1 186 TRP 186 206 206 TRP TRP D . n 
D 1 187 SER 187 207 207 SER SER D . n 
D 1 188 THR 188 208 208 THR THR D . n 
D 1 189 VAL 189 209 209 VAL VAL D . n 
D 1 190 ARG 190 210 210 ARG ARG D . n 
D 1 191 VAL 191 211 211 VAL VAL D . n 
D 1 192 MET 192 212 212 MET MET D . n 
D 1 193 GLY 193 213 213 GLY GLY D . n 
D 1 194 GLN 194 214 214 GLN GLN D . n 
D 1 195 PRO 195 215 215 PRO PRO D . n 
D 1 196 ILE 196 216 216 ILE ILE D . n 
D 1 197 VAL 197 217 217 VAL VAL D . n 
D 1 198 THR 198 218 218 THR THR D . n 
D 1 199 LEU 199 219 219 LEU LEU D . n 
D 1 200 ALA 200 220 220 ALA ALA D . n 
D 1 201 ASP 201 221 221 ASP ASP D . n 
D 1 202 ALA 202 222 222 ALA ALA D . n 
D 1 203 GLY 203 223 ?   ?   ?   D . n 
D 1 204 ASP 204 224 ?   ?   ?   D . n 
D 1 205 ILE 205 225 225 ILE ILE D . n 
D 1 206 ASP 206 226 226 ASP ASP D . n 
D 1 207 LEU 207 227 227 LEU LEU D . n 
D 1 208 ALA 208 228 228 ALA ALA D . n 
D 1 209 ALA 209 229 229 ALA ALA D . n 
D 1 210 ILE 210 230 230 ILE ILE D . n 
D 1 211 GLU 211 231 231 GLU GLU D . n 
D 1 212 GLU 212 232 232 GLU GLU D . n 
D 1 213 GLU 213 233 233 GLU GLU D . n 
D 1 214 ALA 214 234 234 ALA ALA D . n 
D 1 215 ARG 215 235 235 ARG ARG D . n 
D 1 216 LYS 216 236 236 LYS LYS D . n 
D 1 217 GLY 217 237 237 GLY GLY D . n 
D 1 218 GLY 218 238 238 GLY GLY D . n 
D 1 219 PHE 219 239 239 PHE PHE D . n 
D 1 220 THR 220 240 240 THR THR D . n 
D 1 221 VAL 221 241 241 VAL VAL D . n 
D 1 222 LEU 222 242 242 LEU LEU D . n 
D 1 223 ASN 223 243 243 ASN ASN D . n 
D 1 224 GLY 224 244 244 GLY GLY D . n 
D 1 225 LYS 225 245 245 LYS LYS D . n 
D 1 226 GLY 226 246 246 GLY GLY D . n 
D 1 227 TYR 227 247 247 TYR TYR D . n 
D 1 228 THR 228 248 248 THR THR D . n 
D 1 229 SER 229 249 249 SER SER D . n 
D 1 230 TYR 230 250 250 TYR TYR D . n 
D 1 231 GLY 231 251 251 GLY GLY D . n 
D 1 232 VAL 232 252 252 VAL VAL D . n 
D 1 233 ALA 233 253 253 ALA ALA D . n 
D 1 234 THR 234 254 254 THR THR D . n 
D 1 235 SER 235 255 255 SER SER D . n 
D 1 236 ALA 236 256 256 ALA ALA D . n 
D 1 237 ILE 237 257 257 ILE ILE D . n 
D 1 238 ARG 238 258 258 ARG ARG D . n 
D 1 239 ILE 239 259 259 ILE ILE D . n 
D 1 240 ALA 240 260 260 ALA ALA D . n 
D 1 241 LYS 241 261 261 LYS LYS D . n 
D 1 242 ALA 242 262 262 ALA ALA D . n 
D 1 243 VAL 243 263 263 VAL VAL D . n 
D 1 244 MET 244 264 264 MET MET D . n 
D 1 245 ALA 245 265 265 ALA ALA D . n 
D 1 246 ASP 246 266 266 ASP ASP D . n 
D 1 247 ALA 247 267 267 ALA ALA D . n 
D 1 248 HIS 248 268 268 HIS HIS D . n 
D 1 249 ALA 249 269 269 ALA ALA D . n 
D 1 250 GLU 250 270 270 GLU GLU D . n 
D 1 251 LEU 251 271 271 LEU LEU D . n 
D 1 252 VAL 252 272 272 VAL VAL D . n 
D 1 253 VAL 253 273 273 VAL VAL D . n 
D 1 254 SER 254 274 274 SER SER D . n 
D 1 255 ASN 255 275 275 ASN ASN D . n 
D 1 256 ARG 256 276 276 ARG ARG D . n 
D 1 257 ARG 257 277 277 ARG ARG D . n 
D 1 258 ASP 258 278 278 ASP ASP D . n 
D 1 259 ASP 259 279 279 ASP ASP D . n 
D 1 260 MET 260 280 280 MET MET D . n 
D 1 261 GLY 261 281 281 GLY GLY D . n 
D 1 262 MET 262 282 282 MET MET D . n 
D 1 263 TYR 263 283 283 TYR TYR D . n 
D 1 264 LEU 264 284 284 LEU LEU D . n 
D 1 265 SER 265 285 285 SER SER D . n 
D 1 266 TYR 266 286 286 TYR TYR D . n 
D 1 267 PRO 267 287 287 PRO PRO D . n 
D 1 268 ALA 268 288 288 ALA ALA D . n 
D 1 269 ILE 269 289 289 ILE ILE D . n 
D 1 270 ILE 270 290 290 ILE ILE D . n 
D 1 271 GLY 271 291 291 GLY GLY D . n 
D 1 272 ARG 272 292 292 ARG ARG D . n 
D 1 273 ASP 273 293 293 ASP ASP D . n 
D 1 274 GLY 274 294 294 GLY GLY D . n 
D 1 275 VAL 275 295 295 VAL VAL D . n 
D 1 276 LEU 276 296 296 LEU LEU D . n 
D 1 277 ALA 277 297 297 ALA ALA D . n 
D 1 278 GLU 278 298 298 GLU GLU D . n 
D 1 279 THR 279 299 299 THR THR D . n 
D 1 280 THR 280 300 300 THR THR D . n 
D 1 281 LEU 281 301 301 LEU LEU D . n 
D 1 282 ASP 282 302 302 ASP ASP D . n 
D 1 283 LEU 283 303 303 LEU LEU D . n 
D 1 284 THR 284 304 304 THR THR D . n 
D 1 285 THR 285 305 305 THR THR D . n 
D 1 286 ASP 286 306 306 ASP ASP D . n 
D 1 287 GLU 287 307 307 GLU GLU D . n 
D 1 288 GLN 288 308 308 GLN GLN D . n 
D 1 289 GLU 289 309 309 GLU GLU D . n 
D 1 290 LYS 290 310 310 LYS LYS D . n 
D 1 291 LEU 291 311 311 LEU LEU D . n 
D 1 292 LEU 292 312 312 LEU LEU D . n 
D 1 293 GLN 293 313 313 GLN GLN D . n 
D 1 294 SER 294 314 314 SER SER D . n 
D 1 295 ARG 295 315 315 ARG ARG D . n 
D 1 296 ASP 296 316 316 ASP ASP D . n 
D 1 297 TYR 297 317 317 TYR TYR D . n 
D 1 298 ILE 298 318 318 ILE ILE D . n 
D 1 299 GLN 299 319 319 GLN GLN D . n 
D 1 300 GLN 300 320 320 GLN GLN D . n 
D 1 301 ARG 301 321 321 ARG ARG D . n 
D 1 302 PHE 302 322 322 PHE PHE D . n 
D 1 303 ASP 303 323 323 ASP ASP D . n 
D 1 304 GLU 304 324 324 GLU GLU D . n 
D 1 305 ILE 305 325 325 ILE ILE D . n 
D 1 306 VAL 306 326 326 VAL VAL D . n 
D 1 307 ASP 307 327 327 ASP ASP D . n 
D 1 308 THR 308 328 328 THR THR D . n 
D 1 309 LEU 309 329 329 LEU LEU D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 SO4 1  331 331 SO4 SO4 A . 
F 3 NAD 1  330 330 NAD NAD A . 
G 2 SO4 1  331 331 SO4 SO4 B . 
H 3 NAD 1  330 330 NAD NAD B . 
I 2 SO4 1  331 331 SO4 SO4 C . 
J 3 NAD 1  330 330 NAD NAD C . 
K 2 SO4 1  331 331 SO4 SO4 D . 
L 3 NAD 1  330 330 NAD NAD D . 
M 4 HOH 1  332 332 HOH HOH A . 
M 4 HOH 2  333 333 HOH HOH A . 
M 4 HOH 3  334 334 HOH HOH A . 
M 4 HOH 4  335 335 HOH HOH A . 
M 4 HOH 5  336 337 HOH HOH A . 
M 4 HOH 6  337 338 HOH HOH A . 
M 4 HOH 7  338 339 HOH HOH A . 
M 4 HOH 8  339 340 HOH HOH A . 
M 4 HOH 9  340 341 HOH HOH A . 
M 4 HOH 10 341 342 HOH HOH A . 
M 4 HOH 11 342 343 HOH HOH A . 
M 4 HOH 12 343 344 HOH HOH A . 
M 4 HOH 13 344 347 HOH HOH A . 
M 4 HOH 14 345 348 HOH HOH A . 
M 4 HOH 15 346 349 HOH HOH A . 
M 4 HOH 16 347 350 HOH HOH A . 
M 4 HOH 17 348 351 HOH HOH A . 
M 4 HOH 18 349 352 HOH HOH A . 
M 4 HOH 19 350 353 HOH HOH A . 
M 4 HOH 20 351 354 HOH HOH A . 
M 4 HOH 21 352 355 HOH HOH A . 
M 4 HOH 22 353 356 HOH HOH A . 
M 4 HOH 23 354 357 HOH HOH A . 
M 4 HOH 24 355 358 HOH HOH A . 
M 4 HOH 25 356 359 HOH HOH A . 
M 4 HOH 26 357 360 HOH HOH A . 
M 4 HOH 27 358 361 HOH HOH A . 
M 4 HOH 28 359 362 HOH HOH A . 
M 4 HOH 29 360 363 HOH HOH A . 
M 4 HOH 30 361 364 HOH HOH A . 
M 4 HOH 31 362 365 HOH HOH A . 
M 4 HOH 32 363 366 HOH HOH A . 
M 4 HOH 33 364 367 HOH HOH A . 
M 4 HOH 34 365 368 HOH HOH A . 
M 4 HOH 35 366 369 HOH HOH A . 
M 4 HOH 36 367 370 HOH HOH A . 
M 4 HOH 37 368 371 HOH HOH A . 
M 4 HOH 38 369 372 HOH HOH A . 
M 4 HOH 39 370 374 HOH HOH A . 
M 4 HOH 40 371 375 HOH HOH A . 
M 4 HOH 41 372 376 HOH HOH A . 
M 4 HOH 42 373 377 HOH HOH A . 
M 4 HOH 43 374 378 HOH HOH A . 
M 4 HOH 44 375 379 HOH HOH A . 
M 4 HOH 45 376 380 HOH HOH A . 
M 4 HOH 46 377 381 HOH HOH A . 
M 4 HOH 47 378 382 HOH HOH A . 
M 4 HOH 48 379 385 HOH HOH A . 
M 4 HOH 49 380 386 HOH HOH A . 
M 4 HOH 50 381 387 HOH HOH A . 
M 4 HOH 51 382 388 HOH HOH A . 
M 4 HOH 52 383 389 HOH HOH A . 
M 4 HOH 53 384 390 HOH HOH A . 
M 4 HOH 54 385 391 HOH HOH A . 
M 4 HOH 55 386 392 HOH HOH A . 
M 4 HOH 56 387 393 HOH HOH A . 
M 4 HOH 57 388 394 HOH HOH A . 
M 4 HOH 58 389 395 HOH HOH A . 
M 4 HOH 59 390 396 HOH HOH A . 
M 4 HOH 60 391 397 HOH HOH A . 
M 4 HOH 61 392 398 HOH HOH A . 
M 4 HOH 62 393 399 HOH HOH A . 
M 4 HOH 63 394 400 HOH HOH A . 
M 4 HOH 64 395 401 HOH HOH A . 
M 4 HOH 65 396 402 HOH HOH A . 
M 4 HOH 66 397 403 HOH HOH A . 
M 4 HOH 67 398 404 HOH HOH A . 
M 4 HOH 68 399 405 HOH HOH A . 
M 4 HOH 69 400 406 HOH HOH A . 
M 4 HOH 70 401 407 HOH HOH A . 
M 4 HOH 71 402 408 HOH HOH A . 
M 4 HOH 72 403 409 HOH HOH A . 
M 4 HOH 73 404 410 HOH HOH A . 
M 4 HOH 74 405 411 HOH HOH A . 
M 4 HOH 75 406 412 HOH HOH A . 
M 4 HOH 76 407 413 HOH HOH A . 
M 4 HOH 77 408 414 HOH HOH A . 
M 4 HOH 78 409 415 HOH HOH A . 
M 4 HOH 79 410 416 HOH HOH A . 
M 4 HOH 80 411 342 HOH HOH A . 
M 4 HOH 81 412 364 HOH HOH A . 
M 4 HOH 82 413 373 HOH HOH A . 
M 4 HOH 83 414 392 HOH HOH A . 
M 4 HOH 84 415 341 HOH HOH A . 
M 4 HOH 85 416 345 HOH HOH A . 
M 4 HOH 86 417 346 HOH HOH A . 
M 4 HOH 87 418 399 HOH HOH A . 
N 4 HOH 1  332 336 HOH HOH B . 
N 4 HOH 2  333 373 HOH HOH B . 
N 4 HOH 3  334 384 HOH HOH B . 
N 4 HOH 4  335 332 HOH HOH B . 
N 4 HOH 5  336 333 HOH HOH B . 
N 4 HOH 6  337 334 HOH HOH B . 
N 4 HOH 7  338 335 HOH HOH B . 
N 4 HOH 8  339 336 HOH HOH B . 
N 4 HOH 9  340 337 HOH HOH B . 
N 4 HOH 10 341 339 HOH HOH B . 
N 4 HOH 11 342 340 HOH HOH B . 
N 4 HOH 12 343 342 HOH HOH B . 
N 4 HOH 13 344 343 HOH HOH B . 
N 4 HOH 14 345 344 HOH HOH B . 
N 4 HOH 15 346 345 HOH HOH B . 
N 4 HOH 16 347 346 HOH HOH B . 
N 4 HOH 17 348 347 HOH HOH B . 
N 4 HOH 18 349 348 HOH HOH B . 
N 4 HOH 19 350 349 HOH HOH B . 
N 4 HOH 20 351 351 HOH HOH B . 
N 4 HOH 21 352 352 HOH HOH B . 
N 4 HOH 22 353 353 HOH HOH B . 
N 4 HOH 23 354 354 HOH HOH B . 
N 4 HOH 24 355 355 HOH HOH B . 
N 4 HOH 25 356 356 HOH HOH B . 
N 4 HOH 26 357 357 HOH HOH B . 
N 4 HOH 27 358 358 HOH HOH B . 
N 4 HOH 28 359 359 HOH HOH B . 
N 4 HOH 29 360 360 HOH HOH B . 
N 4 HOH 30 361 361 HOH HOH B . 
N 4 HOH 31 362 362 HOH HOH B . 
N 4 HOH 32 363 363 HOH HOH B . 
N 4 HOH 33 364 364 HOH HOH B . 
N 4 HOH 34 365 365 HOH HOH B . 
N 4 HOH 35 366 366 HOH HOH B . 
N 4 HOH 36 367 367 HOH HOH B . 
N 4 HOH 37 368 368 HOH HOH B . 
N 4 HOH 38 369 369 HOH HOH B . 
N 4 HOH 39 370 370 HOH HOH B . 
N 4 HOH 40 371 371 HOH HOH B . 
N 4 HOH 41 372 372 HOH HOH B . 
N 4 HOH 42 373 373 HOH HOH B . 
N 4 HOH 43 374 374 HOH HOH B . 
N 4 HOH 44 375 375 HOH HOH B . 
N 4 HOH 45 376 376 HOH HOH B . 
N 4 HOH 46 377 377 HOH HOH B . 
N 4 HOH 47 378 378 HOH HOH B . 
N 4 HOH 48 379 379 HOH HOH B . 
N 4 HOH 49 380 380 HOH HOH B . 
N 4 HOH 50 381 381 HOH HOH B . 
N 4 HOH 51 382 382 HOH HOH B . 
N 4 HOH 52 383 384 HOH HOH B . 
N 4 HOH 53 384 385 HOH HOH B . 
N 4 HOH 54 385 386 HOH HOH B . 
N 4 HOH 55 386 387 HOH HOH B . 
N 4 HOH 56 387 389 HOH HOH B . 
N 4 HOH 57 388 392 HOH HOH B . 
N 4 HOH 58 389 393 HOH HOH B . 
N 4 HOH 59 390 394 HOH HOH B . 
N 4 HOH 60 391 395 HOH HOH B . 
N 4 HOH 61 392 396 HOH HOH B . 
N 4 HOH 62 393 397 HOH HOH B . 
N 4 HOH 63 394 341 HOH HOH B . 
N 4 HOH 64 395 345 HOH HOH B . 
N 4 HOH 65 396 346 HOH HOH B . 
N 4 HOH 66 397 332 HOH HOH B . 
N 4 HOH 67 398 342 HOH HOH B . 
N 4 HOH 68 399 350 HOH HOH B . 
N 4 HOH 69 400 364 HOH HOH B . 
N 4 HOH 70 401 384 HOH HOH B . 
O 4 HOH 1  332 383 HOH HOH C . 
O 4 HOH 2  333 341 HOH HOH C . 
O 4 HOH 3  334 332 HOH HOH C . 
O 4 HOH 4  335 333 HOH HOH C . 
O 4 HOH 5  336 334 HOH HOH C . 
O 4 HOH 6  337 335 HOH HOH C . 
O 4 HOH 7  338 337 HOH HOH C . 
O 4 HOH 8  339 338 HOH HOH C . 
O 4 HOH 9  340 339 HOH HOH C . 
O 4 HOH 10 341 340 HOH HOH C . 
O 4 HOH 11 342 343 HOH HOH C . 
O 4 HOH 12 343 344 HOH HOH C . 
O 4 HOH 13 344 347 HOH HOH C . 
O 4 HOH 14 345 348 HOH HOH C . 
O 4 HOH 15 346 349 HOH HOH C . 
O 4 HOH 16 347 350 HOH HOH C . 
O 4 HOH 17 348 351 HOH HOH C . 
O 4 HOH 18 349 352 HOH HOH C . 
O 4 HOH 19 350 353 HOH HOH C . 
O 4 HOH 20 351 354 HOH HOH C . 
O 4 HOH 21 352 355 HOH HOH C . 
O 4 HOH 22 353 356 HOH HOH C . 
O 4 HOH 23 354 357 HOH HOH C . 
O 4 HOH 24 355 358 HOH HOH C . 
O 4 HOH 25 356 359 HOH HOH C . 
O 4 HOH 26 357 360 HOH HOH C . 
O 4 HOH 27 358 361 HOH HOH C . 
O 4 HOH 28 359 362 HOH HOH C . 
O 4 HOH 29 360 363 HOH HOH C . 
O 4 HOH 30 361 365 HOH HOH C . 
O 4 HOH 31 362 366 HOH HOH C . 
O 4 HOH 32 363 367 HOH HOH C . 
O 4 HOH 33 364 368 HOH HOH C . 
O 4 HOH 34 365 369 HOH HOH C . 
O 4 HOH 35 366 370 HOH HOH C . 
O 4 HOH 36 367 371 HOH HOH C . 
O 4 HOH 37 368 372 HOH HOH C . 
O 4 HOH 38 369 374 HOH HOH C . 
O 4 HOH 39 370 375 HOH HOH C . 
O 4 HOH 40 371 376 HOH HOH C . 
O 4 HOH 41 372 377 HOH HOH C . 
O 4 HOH 42 373 378 HOH HOH C . 
O 4 HOH 43 374 379 HOH HOH C . 
O 4 HOH 44 375 380 HOH HOH C . 
O 4 HOH 45 376 381 HOH HOH C . 
O 4 HOH 46 377 382 HOH HOH C . 
O 4 HOH 47 378 383 HOH HOH C . 
O 4 HOH 48 379 385 HOH HOH C . 
O 4 HOH 49 380 386 HOH HOH C . 
O 4 HOH 50 381 387 HOH HOH C . 
O 4 HOH 51 382 388 HOH HOH C . 
O 4 HOH 52 383 389 HOH HOH C . 
O 4 HOH 53 384 390 HOH HOH C . 
O 4 HOH 54 385 391 HOH HOH C . 
O 4 HOH 55 386 393 HOH HOH C . 
O 4 HOH 56 387 394 HOH HOH C . 
O 4 HOH 57 388 395 HOH HOH C . 
O 4 HOH 58 389 396 HOH HOH C . 
O 4 HOH 59 390 397 HOH HOH C . 
O 4 HOH 60 391 398 HOH HOH C . 
O 4 HOH 61 392 399 HOH HOH C . 
O 4 HOH 62 393 400 HOH HOH C . 
O 4 HOH 63 394 401 HOH HOH C . 
O 4 HOH 64 395 402 HOH HOH C . 
O 4 HOH 65 396 403 HOH HOH C . 
O 4 HOH 66 397 404 HOH HOH C . 
O 4 HOH 67 398 405 HOH HOH C . 
O 4 HOH 68 399 406 HOH HOH C . 
O 4 HOH 69 400 407 HOH HOH C . 
O 4 HOH 70 401 408 HOH HOH C . 
O 4 HOH 71 402 409 HOH HOH C . 
O 4 HOH 72 403 410 HOH HOH C . 
O 4 HOH 73 404 411 HOH HOH C . 
O 4 HOH 74 405 412 HOH HOH C . 
O 4 HOH 75 406 413 HOH HOH C . 
O 4 HOH 76 407 414 HOH HOH C . 
O 4 HOH 77 408 415 HOH HOH C . 
O 4 HOH 78 409 416 HOH HOH C . 
O 4 HOH 79 410 336 HOH HOH C . 
P 4 HOH 1  332 345 HOH HOH D . 
P 4 HOH 2  333 346 HOH HOH D . 
P 4 HOH 3  334 338 HOH HOH D . 
P 4 HOH 4  335 350 HOH HOH D . 
P 4 HOH 5  336 383 HOH HOH D . 
P 4 HOH 6  337 388 HOH HOH D . 
P 4 HOH 7  338 390 HOH HOH D . 
P 4 HOH 8  339 391 HOH HOH D . 
P 4 HOH 9  340 336 HOH HOH D . 
P 4 HOH 10 341 384 HOH HOH D . 
P 4 HOH 11 342 333 HOH HOH D . 
P 4 HOH 12 343 334 HOH HOH D . 
P 4 HOH 13 344 335 HOH HOH D . 
P 4 HOH 14 345 337 HOH HOH D . 
P 4 HOH 15 346 338 HOH HOH D . 
P 4 HOH 16 347 339 HOH HOH D . 
P 4 HOH 17 348 340 HOH HOH D . 
P 4 HOH 18 349 343 HOH HOH D . 
P 4 HOH 19 350 344 HOH HOH D . 
P 4 HOH 20 351 347 HOH HOH D . 
P 4 HOH 21 352 348 HOH HOH D . 
P 4 HOH 22 353 349 HOH HOH D . 
P 4 HOH 23 354 351 HOH HOH D . 
P 4 HOH 24 355 352 HOH HOH D . 
P 4 HOH 25 356 353 HOH HOH D . 
P 4 HOH 26 357 354 HOH HOH D . 
P 4 HOH 27 358 355 HOH HOH D . 
P 4 HOH 28 359 356 HOH HOH D . 
P 4 HOH 29 360 357 HOH HOH D . 
P 4 HOH 30 361 358 HOH HOH D . 
P 4 HOH 31 362 359 HOH HOH D . 
P 4 HOH 32 363 360 HOH HOH D . 
P 4 HOH 33 364 361 HOH HOH D . 
P 4 HOH 34 365 362 HOH HOH D . 
P 4 HOH 35 366 363 HOH HOH D . 
P 4 HOH 36 367 365 HOH HOH D . 
P 4 HOH 37 368 366 HOH HOH D . 
P 4 HOH 38 369 367 HOH HOH D . 
P 4 HOH 39 370 368 HOH HOH D . 
P 4 HOH 40 371 369 HOH HOH D . 
P 4 HOH 41 372 370 HOH HOH D . 
P 4 HOH 42 373 371 HOH HOH D . 
P 4 HOH 43 374 372 HOH HOH D . 
P 4 HOH 44 375 373 HOH HOH D . 
P 4 HOH 45 376 374 HOH HOH D . 
P 4 HOH 46 377 375 HOH HOH D . 
P 4 HOH 47 378 376 HOH HOH D . 
P 4 HOH 48 379 377 HOH HOH D . 
P 4 HOH 49 380 378 HOH HOH D . 
P 4 HOH 50 381 379 HOH HOH D . 
P 4 HOH 51 382 380 HOH HOH D . 
P 4 HOH 52 383 381 HOH HOH D . 
P 4 HOH 53 384 382 HOH HOH D . 
P 4 HOH 54 385 383 HOH HOH D . 
P 4 HOH 55 386 385 HOH HOH D . 
P 4 HOH 56 387 386 HOH HOH D . 
P 4 HOH 57 388 387 HOH HOH D . 
P 4 HOH 58 389 388 HOH HOH D . 
P 4 HOH 59 390 389 HOH HOH D . 
P 4 HOH 60 391 390 HOH HOH D . 
P 4 HOH 61 392 391 HOH HOH D . 
P 4 HOH 62 393 392 HOH HOH D . 
P 4 HOH 63 394 393 HOH HOH D . 
P 4 HOH 64 395 394 HOH HOH D . 
P 4 HOH 65 396 395 HOH HOH D . 
P 4 HOH 66 397 396 HOH HOH D . 
P 4 HOH 67 398 397 HOH HOH D . 
P 4 HOH 68 399 398 HOH HOH D . 
P 4 HOH 69 400 400 HOH HOH D . 
P 4 HOH 70 401 401 HOH HOH D . 
P 4 HOH 71 402 402 HOH HOH D . 
P 4 HOH 72 403 403 HOH HOH D . 
P 4 HOH 73 404 404 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-10-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-05-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation                  
2 4 'Structure model' pdbx_database_status      
3 4 'Structure model' pdbx_struct_assembly      
4 4 'Structure model' pdbx_struct_assembly_gen  
5 4 'Structure model' pdbx_struct_assembly_prop 
6 4 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.pdbx_database_id_PubMed'  
2 4 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PROLSQ refinement       . ? 1 
MOSFLM 'data reduction' . ? 2 
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
;THE ENTRY COORDINATES
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME.
;
# 
_pdbx_entry_details.entry_id             1HYH 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       
;DSM NUMBER: DSM 20196 (DSM = DEUTSCHE SAMMLUNG VON
 MIKROORGANISMEN/GERMAN COLLECTION OF MICROORGANISMS)
;
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES ARE NUMBERED SEQUENTIALLY STARTING WITH ALA 21 AND
ENDING WITH LEU 329.  THE REASON FOR BEGINNING WITH 21
IS THAT L-HICDH MISSES AN N-TERMINAL ARM OF ABOUT 20
RESIDUES, WHICH IS PRESENT IN HOMOLOGOUS EUKARYOTIC
L-LACTATE DEHYDROGENASES.
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A LEU 329 ? ? OXT A LEU 329 ? ? 1.615 1.229 0.386 0.019 N 
2 1 CB B SER 255 ? ? OG  B SER 255 ? A 1.523 1.418 0.105 0.013 N 
3 1 C  C LEU 329 ? ? OXT C LEU 329 ? ? 1.353 1.229 0.124 0.019 N 
4 1 C  D LEU 329 ? ? OXT D LEU 329 ? ? 1.488 1.229 0.259 0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 171 ? ? CG A ASP 171 ? ? OD2 A ASP 171 ? ? 124.89 118.30 6.59  0.90 N 
2  1 NE A ARG 276 ? ? CZ A ARG 276 ? ? NH1 A ARG 276 ? ? 123.82 120.30 3.52  0.50 N 
3  1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH1 A ARG 277 ? ? 124.77 120.30 4.47  0.50 N 
4  1 NE A ARG 292 ? ? CZ A ARG 292 ? ? NH1 A ARG 292 ? ? 116.70 120.30 -3.61 0.50 N 
5  1 NE A ARG 292 ? ? CZ A ARG 292 ? ? NH2 A ARG 292 ? ? 125.20 120.30 4.90  0.50 N 
6  1 CB B ASP 65  ? ? CG B ASP 65  ? ? OD1 B ASP 65  ? ? 123.79 118.30 5.49  0.90 N 
7  1 NE B ARG 188 ? ? CZ B ARG 188 ? ? NH1 B ARG 188 ? ? 124.09 120.30 3.79  0.50 N 
8  1 NE B ARG 210 ? ? CZ B ARG 210 ? ? NH2 B ARG 210 ? ? 116.42 120.30 -3.88 0.50 N 
9  1 CB B TYR 250 ? ? CG B TYR 250 ? ? CD2 B TYR 250 ? ? 117.26 121.00 -3.74 0.60 N 
10 1 CD B ARG 276 ? ? NE B ARG 276 ? ? CZ  B ARG 276 ? ? 132.33 123.60 8.73  1.40 N 
11 1 NE B ARG 276 ? ? CZ B ARG 276 ? ? NH1 B ARG 276 ? ? 125.73 120.30 5.43  0.50 N 
12 1 NE B ARG 292 ? ? CZ B ARG 292 ? ? NH2 B ARG 292 ? ? 124.25 120.30 3.95  0.50 N 
13 1 NE C ARG 22  ? ? CZ C ARG 22  ? ? NH2 C ARG 22  ? ? 117.09 120.30 -3.21 0.50 N 
14 1 CB C ASP 146 ? ? CG C ASP 146 ? ? OD2 C ASP 146 ? ? 112.62 118.30 -5.68 0.90 N 
15 1 CA C LEU 185 ? ? CB C LEU 185 ? ? CG  C LEU 185 ? ? 130.81 115.30 15.51 2.30 N 
16 1 CD C ARG 188 ? ? NE C ARG 188 ? ? CZ  C ARG 188 ? ? 136.69 123.60 13.09 1.40 N 
17 1 NE C ARG 188 ? ? CZ C ARG 188 ? ? NH2 C ARG 188 ? ? 124.35 120.30 4.05  0.50 N 
18 1 CD C ARG 277 ? ? NE C ARG 277 ? ? CZ  C ARG 277 ? ? 132.69 123.60 9.09  1.40 N 
19 1 NE C ARG 277 ? ? CZ C ARG 277 ? ? NH1 C ARG 277 ? ? 123.94 120.30 3.64  0.50 N 
20 1 NE D ARG 22  ? ? CZ D ARG 22  ? ? NH2 D ARG 22  ? ? 116.93 120.30 -3.37 0.50 N 
21 1 CB D ASP 89  ? ? CG D ASP 89  ? ? OD1 D ASP 89  ? ? 123.82 118.30 5.52  0.90 N 
22 1 CA D LEU 185 ? ? CB D LEU 185 ? ? CG  D LEU 185 ? ? 131.46 115.30 16.16 2.30 N 
23 1 CD D ARG 188 ? ? NE D ARG 188 ? ? CZ  D ARG 188 ? ? 134.72 123.60 11.12 1.40 N 
24 1 CB D TYR 193 ? ? CG D TYR 193 ? ? CD1 D TYR 193 ? ? 115.96 121.00 -5.04 0.60 N 
25 1 CA D LYS 245 ? ? CB D LYS 245 ? ? CG  D LYS 245 ? ? 129.75 113.40 16.35 2.20 N 
26 1 NE D ARG 258 ? ? CZ D ARG 258 ? ? NH2 D ARG 258 ? ? 117.09 120.30 -3.21 0.50 N 
27 1 NE D ARG 315 ? ? CZ D ARG 315 ? ? NH1 D ARG 315 ? ? 124.59 120.30 4.29  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 82  ? ? 36.09   56.62   
2  1 HIS A 135 ? ? -144.03 25.44   
3  1 ASN A 200 ? ? -167.95 -104.31 
4  1 SER A 249 ? ? -140.05 -58.43  
5  1 ASN B 82  ? ? 38.89   51.51   
6  1 HIS B 135 ? ? -148.46 37.02   
7  1 SER B 142 ? ? -34.65  123.34  
8  1 ASN B 200 ? ? -175.14 -100.74 
9  1 VAL B 217 ? ? -69.39  7.37    
10 1 SER B 249 ? ? -150.42 -55.23  
11 1 HIS C 135 ? ? -140.44 27.20   
12 1 SER C 142 ? ? -173.42 -167.90 
13 1 ASN C 200 ? ? -151.78 -100.33 
14 1 SER C 201 ? ? -69.37  18.39   
15 1 TYR C 247 ? ? 177.49  166.67  
16 1 SER C 249 ? ? -143.81 -51.09  
17 1 LEU D 29  ? ? -95.91  57.67   
18 1 ASN D 82  ? ? 39.63   49.78   
19 1 HIS D 135 ? ? -148.71 30.53   
20 1 SER D 142 ? ? -168.25 -165.30 
21 1 ASN D 143 ? ? -166.42 115.83  
22 1 ASN D 200 ? ? -154.56 -84.54  
23 1 SER D 201 ? ? -76.47  22.55   
24 1 SER D 249 ? ? -134.06 -57.99  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 101 ? CE  ? A LYS 81  CE  
2   1 Y 1 A LYS 101 ? NZ  ? A LYS 81  NZ  
3   1 Y 1 A ILE 225 ? CG1 ? A ILE 205 CG1 
4   1 Y 1 A ILE 225 ? CG2 ? A ILE 205 CG2 
5   1 Y 1 A ILE 225 ? CD1 ? A ILE 205 CD1 
6   1 Y 1 A ASP 226 ? CB  ? A ASP 206 CB  
7   1 Y 1 A ASP 226 ? CG  ? A ASP 206 CG  
8   1 Y 1 A ASP 226 ? OD1 ? A ASP 206 OD1 
9   1 Y 1 A ASP 226 ? OD2 ? A ASP 206 OD2 
10  1 Y 1 A ARG 235 ? CG  ? A ARG 215 CG  
11  1 Y 1 A ARG 235 ? CD  ? A ARG 215 CD  
12  1 Y 1 A ARG 235 ? NE  ? A ARG 215 NE  
13  1 Y 1 A ARG 235 ? CZ  ? A ARG 215 CZ  
14  1 Y 1 A ARG 235 ? NH1 ? A ARG 215 NH1 
15  1 Y 1 A ARG 235 ? NH2 ? A ARG 215 NH2 
16  1 Y 1 A GLU 309 ? CB  ? A GLU 289 CB  
17  1 Y 1 A GLU 309 ? CG  ? A GLU 289 CG  
18  1 Y 1 A GLU 309 ? CD  ? A GLU 289 CD  
19  1 Y 1 A GLU 309 ? OE1 ? A GLU 289 OE1 
20  1 Y 1 A GLU 309 ? OE2 ? A GLU 289 OE2 
21  1 Y 1 A GLN 313 ? CG  ? A GLN 293 CG  
22  1 Y 1 A GLN 313 ? CD  ? A GLN 293 CD  
23  1 Y 1 A GLN 313 ? OE1 ? A GLN 293 OE1 
24  1 Y 1 A GLN 313 ? NE2 ? A GLN 293 NE2 
25  1 Y 1 A ASP 327 ? CG  ? A ASP 307 CG  
26  1 Y 1 A ASP 327 ? OD1 ? A ASP 307 OD1 
27  1 Y 1 A ASP 327 ? OD2 ? A ASP 307 OD2 
28  1 Y 1 B LYS 101 ? CD  ? B LYS 81  CD  
29  1 Y 1 B LYS 101 ? CE  ? B LYS 81  CE  
30  1 Y 1 B LYS 101 ? NZ  ? B LYS 81  NZ  
31  1 Y 1 B LYS 116 ? CB  ? B LYS 96  CB  
32  1 Y 1 B LYS 116 ? CG  ? B LYS 96  CG  
33  1 Y 1 B LYS 116 ? CD  ? B LYS 96  CD  
34  1 Y 1 B LYS 116 ? CE  ? B LYS 96  CE  
35  1 Y 1 B LYS 116 ? NZ  ? B LYS 96  NZ  
36  1 Y 1 B ILE 225 ? CG1 ? B ILE 205 CG1 
37  1 Y 1 B ILE 225 ? CG2 ? B ILE 205 CG2 
38  1 Y 1 B ILE 225 ? CD1 ? B ILE 205 CD1 
39  1 Y 1 B ASP 226 ? CB  ? B ASP 206 CB  
40  1 Y 1 B ASP 226 ? CG  ? B ASP 206 CG  
41  1 Y 1 B ASP 226 ? OD1 ? B ASP 206 OD1 
42  1 Y 1 B ASP 226 ? OD2 ? B ASP 206 OD2 
43  1 Y 1 B ARG 235 ? NE  ? B ARG 215 NE  
44  1 Y 1 B ARG 235 ? CZ  ? B ARG 215 CZ  
45  1 Y 1 B ARG 235 ? NH1 ? B ARG 215 NH1 
46  1 Y 1 B ARG 235 ? NH2 ? B ARG 215 NH2 
47  1 Y 1 B GLU 309 ? CG  ? B GLU 289 CG  
48  1 Y 1 B GLU 309 ? CD  ? B GLU 289 CD  
49  1 Y 1 B GLU 309 ? OE1 ? B GLU 289 OE1 
50  1 Y 1 B GLU 309 ? OE2 ? B GLU 289 OE2 
51  1 Y 1 B GLN 320 ? CG  ? B GLN 300 CG  
52  1 Y 1 B GLN 320 ? CD  ? B GLN 300 CD  
53  1 Y 1 B GLN 320 ? OE1 ? B GLN 300 OE1 
54  1 Y 1 B GLN 320 ? NE2 ? B GLN 300 NE2 
55  1 Y 1 B ARG 321 ? CG  ? B ARG 301 CG  
56  1 Y 1 B ARG 321 ? CD  ? B ARG 301 CD  
57  1 Y 1 B ARG 321 ? NE  ? B ARG 301 NE  
58  1 Y 1 B ARG 321 ? CZ  ? B ARG 301 CZ  
59  1 Y 1 B ARG 321 ? NH1 ? B ARG 301 NH1 
60  1 Y 1 B ARG 321 ? NH2 ? B ARG 301 NH2 
61  1 Y 1 B VAL 326 ? CB  ? B VAL 306 CB  
62  1 Y 1 B VAL 326 ? CG1 ? B VAL 306 CG1 
63  1 Y 1 B VAL 326 ? CG2 ? B VAL 306 CG2 
64  1 Y 1 C ASP 110 ? CG  ? C ASP 90  CG  
65  1 Y 1 C ASP 110 ? OD1 ? C ASP 90  OD1 
66  1 Y 1 C ASP 110 ? OD2 ? C ASP 90  OD2 
67  1 Y 1 C GLU 114 ? CD  ? C GLU 94  CD  
68  1 Y 1 C GLU 114 ? OE1 ? C GLU 94  OE1 
69  1 Y 1 C GLU 114 ? OE2 ? C GLU 94  OE2 
70  1 Y 1 C GLU 232 ? CB  ? C GLU 212 CB  
71  1 Y 1 C GLU 232 ? CG  ? C GLU 212 CG  
72  1 Y 1 C GLU 232 ? CD  ? C GLU 212 CD  
73  1 Y 1 C GLU 232 ? OE1 ? C GLU 212 OE1 
74  1 Y 1 C GLU 232 ? OE2 ? C GLU 212 OE2 
75  1 Y 1 C ARG 235 ? CB  ? C ARG 215 CB  
76  1 Y 1 C ARG 235 ? CG  ? C ARG 215 CG  
77  1 Y 1 C ARG 235 ? CD  ? C ARG 215 CD  
78  1 Y 1 C ARG 235 ? NE  ? C ARG 215 NE  
79  1 Y 1 C ARG 235 ? CZ  ? C ARG 215 CZ  
80  1 Y 1 C ARG 235 ? NH1 ? C ARG 215 NH1 
81  1 Y 1 C ARG 235 ? NH2 ? C ARG 215 NH2 
82  1 Y 1 C LYS 236 ? CD  ? C LYS 216 CD  
83  1 Y 1 C LYS 236 ? CE  ? C LYS 216 CE  
84  1 Y 1 C LYS 236 ? NZ  ? C LYS 216 NZ  
85  1 Y 1 C ARG 321 ? CD  ? C ARG 301 CD  
86  1 Y 1 C ARG 321 ? NE  ? C ARG 301 NE  
87  1 Y 1 C ARG 321 ? CZ  ? C ARG 301 CZ  
88  1 Y 1 C ARG 321 ? NH1 ? C ARG 301 NH1 
89  1 Y 1 C ARG 321 ? NH2 ? C ARG 301 NH2 
90  1 Y 1 D ASN 200 ? CG  ? D ASN 180 CG  
91  1 Y 1 D ASN 200 ? OD1 ? D ASN 180 OD1 
92  1 Y 1 D ASN 200 ? ND2 ? D ASN 180 ND2 
93  1 Y 1 D GLU 232 ? CB  ? D GLU 212 CB  
94  1 Y 1 D GLU 232 ? CG  ? D GLU 212 CG  
95  1 Y 1 D GLU 232 ? CD  ? D GLU 212 CD  
96  1 Y 1 D GLU 232 ? OE1 ? D GLU 212 OE1 
97  1 Y 1 D GLU 232 ? OE2 ? D GLU 212 OE2 
98  1 Y 1 D ARG 235 ? CD  ? D ARG 215 CD  
99  1 Y 1 D ARG 235 ? NE  ? D ARG 215 NE  
100 1 Y 1 D ARG 235 ? CZ  ? D ARG 215 CZ  
101 1 Y 1 D ARG 235 ? NH1 ? D ARG 215 NH1 
102 1 Y 1 D ARG 235 ? NH2 ? D ARG 215 NH2 
103 1 Y 1 D LYS 236 ? CE  ? D LYS 216 CE  
104 1 Y 1 D LYS 236 ? NZ  ? D LYS 216 NZ  
105 1 Y 1 D GLU 309 ? CG  ? D GLU 289 CG  
106 1 Y 1 D GLU 309 ? CD  ? D GLU 289 CD  
107 1 Y 1 D GLU 309 ? OE1 ? D GLU 289 OE1 
108 1 Y 1 D GLU 309 ? OE2 ? D GLU 289 OE2 
109 1 Y 1 D GLN 320 ? CG  ? D GLN 300 CG  
110 1 Y 1 D GLN 320 ? CD  ? D GLN 300 CD  
111 1 Y 1 D GLN 320 ? OE1 ? D GLN 300 OE1 
112 1 Y 1 D GLN 320 ? NE2 ? D GLN 300 NE2 
113 1 Y 1 D ARG 321 ? CD  ? D ARG 301 CD  
114 1 Y 1 D ARG 321 ? NE  ? D ARG 301 NE  
115 1 Y 1 D ARG 321 ? CZ  ? D ARG 301 CZ  
116 1 Y 1 D ARG 321 ? NH1 ? D ARG 301 NH1 
117 1 Y 1 D ARG 321 ? NH2 ? D ARG 301 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 105 ? A ASP 85  
2  1 Y 1 A ASN 106 ? A ASN 86  
3  1 Y 1 A PRO 107 ? A PRO 87  
4  1 Y 1 A THR 108 ? A THR 88  
5  1 Y 1 A GLY 109 ? A GLY 89  
6  1 Y 1 A ASP 110 ? A ASP 90  
7  1 Y 1 A ARG 111 ? A ARG 91  
8  1 Y 1 A ALA 220 ? A ALA 200 
9  1 Y 1 A ASP 221 ? A ASP 201 
10 1 Y 1 A ALA 222 ? A ALA 202 
11 1 Y 1 A GLY 223 ? A GLY 203 
12 1 Y 1 A ASP 224 ? A ASP 204 
13 1 Y 1 B ASP 105 ? B ASP 85  
14 1 Y 1 B ASN 106 ? B ASN 86  
15 1 Y 1 B PRO 107 ? B PRO 87  
16 1 Y 1 B THR 108 ? B THR 88  
17 1 Y 1 B GLY 109 ? B GLY 89  
18 1 Y 1 B ASP 110 ? B ASP 90  
19 1 Y 1 B ARG 111 ? B ARG 91  
20 1 Y 1 B ALA 220 ? B ALA 200 
21 1 Y 1 B ASP 221 ? B ASP 201 
22 1 Y 1 B ALA 222 ? B ALA 202 
23 1 Y 1 B GLY 223 ? B GLY 203 
24 1 Y 1 B ASP 224 ? B ASP 204 
25 1 Y 1 B ASP 327 ? B ASP 307 
26 1 Y 1 B THR 328 ? B THR 308 
27 1 Y 1 B LEU 329 ? B LEU 309 
28 1 Y 1 C ASN 99  ? C ASN 79  
29 1 Y 1 C ILE 100 ? C ILE 80  
30 1 Y 1 C LYS 101 ? C LYS 81  
31 1 Y 1 C LEU 102 ? C LEU 82  
32 1 Y 1 C GLN 103 ? C GLN 83  
33 1 Y 1 C GLN 104 ? C GLN 84  
34 1 Y 1 C ASP 105 ? C ASP 85  
35 1 Y 1 C ASN 106 ? C ASN 86  
36 1 Y 1 C PRO 107 ? C PRO 87  
37 1 Y 1 C THR 108 ? C THR 88  
38 1 Y 1 C GLY 223 ? C GLY 203 
39 1 Y 1 C ASP 224 ? C ASP 204 
40 1 Y 1 D ASN 99  ? D ASN 79  
41 1 Y 1 D ILE 100 ? D ILE 80  
42 1 Y 1 D LYS 101 ? D LYS 81  
43 1 Y 1 D LEU 102 ? D LEU 82  
44 1 Y 1 D GLN 103 ? D GLN 83  
45 1 Y 1 D GLN 104 ? D GLN 84  
46 1 Y 1 D ASP 105 ? D ASP 85  
47 1 Y 1 D ASN 106 ? D ASN 86  
48 1 Y 1 D PRO 107 ? D PRO 87  
49 1 Y 1 D THR 108 ? D THR 88  
50 1 Y 1 D GLY 223 ? D GLY 203 
51 1 Y 1 D ASP 224 ? D ASP 204 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                     SO4 
3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
4 water                             HOH 
#