data_1I09
# 
_entry.id   1I09 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I09         
RCSB  RCSB012744   
WWPDB D_1000012744 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I09 
_pdbx_database_status.recvd_initial_deposition_date   2001-01-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ter Haar, E.' 1 
'Coll, J.T.'   2 
'Jain, J.'     3 
# 
_citation.id                        primary 
_citation.title                     'Structure of GSK3beta reveals a primed phosphorylation mechanism.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                593 
_citation.page_last                 596 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11427888 
_citation.pdbx_database_id_DOI      10.1038/89624 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'ter Haar, E.' 1 
primary 'Coll, J.T.'   2 
primary 'Austen, D.A.' 3 
primary 'Hsiao, H.M.'  4 
primary 'Swenson, L.'  5 
primary 'Jain, J.'     6 
# 
_cell.entry_id           1I09 
_cell.length_a           83.272 
_cell.length_b           86.725 
_cell.length_c           177.917 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I09 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA' 46801.215 2  2.7.1.37 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                   94.971    4  ?        ? ? ? 
3 water       nat water                             18.015    46 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSK-3 BETA, GSK3B' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   ARG n 
1 5   PRO n 
1 6   ARG n 
1 7   THR n 
1 8   THR n 
1 9   SER n 
1 10  PHE n 
1 11  ALA n 
1 12  GLU n 
1 13  SER n 
1 14  CYS n 
1 15  LYS n 
1 16  PRO n 
1 17  VAL n 
1 18  GLN n 
1 19  GLN n 
1 20  PRO n 
1 21  SER n 
1 22  ALA n 
1 23  PHE n 
1 24  GLY n 
1 25  SER n 
1 26  MET n 
1 27  LYS n 
1 28  VAL n 
1 29  SER n 
1 30  ARG n 
1 31  ASP n 
1 32  LYS n 
1 33  ASP n 
1 34  GLY n 
1 35  SER n 
1 36  LYS n 
1 37  VAL n 
1 38  THR n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  THR n 
1 44  PRO n 
1 45  GLY n 
1 46  GLN n 
1 47  GLY n 
1 48  PRO n 
1 49  ASP n 
1 50  ARG n 
1 51  PRO n 
1 52  GLN n 
1 53  GLU n 
1 54  VAL n 
1 55  SER n 
1 56  TYR n 
1 57  THR n 
1 58  ASP n 
1 59  THR n 
1 60  LYS n 
1 61  VAL n 
1 62  ILE n 
1 63  GLY n 
1 64  ASN n 
1 65  GLY n 
1 66  SER n 
1 67  PHE n 
1 68  GLY n 
1 69  VAL n 
1 70  VAL n 
1 71  TYR n 
1 72  GLN n 
1 73  ALA n 
1 74  LYS n 
1 75  LEU n 
1 76  CYS n 
1 77  ASP n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  VAL n 
1 83  ALA n 
1 84  ILE n 
1 85  LYS n 
1 86  LYS n 
1 87  VAL n 
1 88  LEU n 
1 89  GLN n 
1 90  ASP n 
1 91  LYS n 
1 92  ARG n 
1 93  PHE n 
1 94  LYS n 
1 95  ASN n 
1 96  ARG n 
1 97  GLU n 
1 98  LEU n 
1 99  GLN n 
1 100 ILE n 
1 101 MET n 
1 102 ARG n 
1 103 LYS n 
1 104 LEU n 
1 105 ASP n 
1 106 HIS n 
1 107 CYS n 
1 108 ASN n 
1 109 ILE n 
1 110 VAL n 
1 111 ARG n 
1 112 LEU n 
1 113 ARG n 
1 114 TYR n 
1 115 PHE n 
1 116 PHE n 
1 117 TYR n 
1 118 SER n 
1 119 SER n 
1 120 GLY n 
1 121 GLU n 
1 122 LYS n 
1 123 LYS n 
1 124 ASP n 
1 125 GLU n 
1 126 VAL n 
1 127 TYR n 
1 128 LEU n 
1 129 ASN n 
1 130 LEU n 
1 131 VAL n 
1 132 LEU n 
1 133 ASP n 
1 134 TYR n 
1 135 VAL n 
1 136 PRO n 
1 137 GLU n 
1 138 THR n 
1 139 VAL n 
1 140 TYR n 
1 141 ARG n 
1 142 VAL n 
1 143 ALA n 
1 144 ARG n 
1 145 HIS n 
1 146 TYR n 
1 147 SER n 
1 148 ARG n 
1 149 ALA n 
1 150 LYS n 
1 151 GLN n 
1 152 THR n 
1 153 LEU n 
1 154 PRO n 
1 155 VAL n 
1 156 ILE n 
1 157 TYR n 
1 158 VAL n 
1 159 LYS n 
1 160 LEU n 
1 161 TYR n 
1 162 MET n 
1 163 TYR n 
1 164 GLN n 
1 165 LEU n 
1 166 PHE n 
1 167 ARG n 
1 168 SER n 
1 169 LEU n 
1 170 ALA n 
1 171 TYR n 
1 172 ILE n 
1 173 HIS n 
1 174 SER n 
1 175 PHE n 
1 176 GLY n 
1 177 ILE n 
1 178 CYS n 
1 179 HIS n 
1 180 ARG n 
1 181 ASP n 
1 182 ILE n 
1 183 LYS n 
1 184 PRO n 
1 185 GLN n 
1 186 ASN n 
1 187 LEU n 
1 188 LEU n 
1 189 LEU n 
1 190 ASP n 
1 191 PRO n 
1 192 ASP n 
1 193 THR n 
1 194 ALA n 
1 195 VAL n 
1 196 LEU n 
1 197 LYS n 
1 198 LEU n 
1 199 CYS n 
1 200 ASP n 
1 201 PHE n 
1 202 GLY n 
1 203 SER n 
1 204 ALA n 
1 205 LYS n 
1 206 GLN n 
1 207 LEU n 
1 208 VAL n 
1 209 ARG n 
1 210 GLY n 
1 211 GLU n 
1 212 PRO n 
1 213 ASN n 
1 214 VAL n 
1 215 SER n 
1 216 TYR n 
1 217 ILE n 
1 218 CYS n 
1 219 SER n 
1 220 ARG n 
1 221 TYR n 
1 222 TYR n 
1 223 ARG n 
1 224 ALA n 
1 225 PRO n 
1 226 GLU n 
1 227 LEU n 
1 228 ILE n 
1 229 PHE n 
1 230 GLY n 
1 231 ALA n 
1 232 THR n 
1 233 ASP n 
1 234 TYR n 
1 235 THR n 
1 236 SER n 
1 237 SER n 
1 238 ILE n 
1 239 ASP n 
1 240 VAL n 
1 241 TRP n 
1 242 SER n 
1 243 ALA n 
1 244 GLY n 
1 245 CYS n 
1 246 VAL n 
1 247 LEU n 
1 248 ALA n 
1 249 GLU n 
1 250 LEU n 
1 251 LEU n 
1 252 LEU n 
1 253 GLY n 
1 254 GLN n 
1 255 PRO n 
1 256 ILE n 
1 257 PHE n 
1 258 PRO n 
1 259 GLY n 
1 260 ASP n 
1 261 SER n 
1 262 GLY n 
1 263 VAL n 
1 264 ASP n 
1 265 GLN n 
1 266 LEU n 
1 267 VAL n 
1 268 GLU n 
1 269 ILE n 
1 270 ILE n 
1 271 LYS n 
1 272 VAL n 
1 273 LEU n 
1 274 GLY n 
1 275 THR n 
1 276 PRO n 
1 277 THR n 
1 278 ARG n 
1 279 GLU n 
1 280 GLN n 
1 281 ILE n 
1 282 ARG n 
1 283 GLU n 
1 284 MET n 
1 285 ASN n 
1 286 PRO n 
1 287 ASN n 
1 288 TYR n 
1 289 THR n 
1 290 GLU n 
1 291 PHE n 
1 292 LYS n 
1 293 PHE n 
1 294 PRO n 
1 295 GLN n 
1 296 ILE n 
1 297 LYS n 
1 298 ALA n 
1 299 HIS n 
1 300 PRO n 
1 301 TRP n 
1 302 THR n 
1 303 LYS n 
1 304 VAL n 
1 305 PHE n 
1 306 ARG n 
1 307 PRO n 
1 308 ARG n 
1 309 THR n 
1 310 PRO n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 ILE n 
1 315 ALA n 
1 316 LEU n 
1 317 CYS n 
1 318 SER n 
1 319 ARG n 
1 320 LEU n 
1 321 LEU n 
1 322 GLU n 
1 323 TYR n 
1 324 THR n 
1 325 PRO n 
1 326 THR n 
1 327 ALA n 
1 328 ARG n 
1 329 LEU n 
1 330 THR n 
1 331 PRO n 
1 332 LEU n 
1 333 GLU n 
1 334 ALA n 
1 335 CYS n 
1 336 ALA n 
1 337 HIS n 
1 338 SER n 
1 339 PHE n 
1 340 PHE n 
1 341 ASP n 
1 342 GLU n 
1 343 LEU n 
1 344 ARG n 
1 345 ASP n 
1 346 PRO n 
1 347 ASN n 
1 348 VAL n 
1 349 LYS n 
1 350 LEU n 
1 351 PRO n 
1 352 ASN n 
1 353 GLY n 
1 354 ARG n 
1 355 ASP n 
1 356 THR n 
1 357 PRO n 
1 358 ALA n 
1 359 LEU n 
1 360 PHE n 
1 361 ASN n 
1 362 PHE n 
1 363 THR n 
1 364 THR n 
1 365 GLN n 
1 366 GLU n 
1 367 LEU n 
1 368 SER n 
1 369 SER n 
1 370 ASN n 
1 371 PRO n 
1 372 PRO n 
1 373 LEU n 
1 374 ALA n 
1 375 THR n 
1 376 ILE n 
1 377 LEU n 
1 378 ILE n 
1 379 PRO n 
1 380 PRO n 
1 381 HIS n 
1 382 ALA n 
1 383 ARG n 
1 384 ILE n 
1 385 GLN n 
1 386 ALA n 
1 387 ALA n 
1 388 ALA n 
1 389 SER n 
1 390 THR n 
1 391 PRO n 
1 392 THR n 
1 393 ASN n 
1 394 ALA n 
1 395 THR n 
1 396 ALA n 
1 397 ALA n 
1 398 SER n 
1 399 ASP n 
1 400 ALA n 
1 401 ASN n 
1 402 THR n 
1 403 GLY n 
1 404 ASP n 
1 405 ARG n 
1 406 GLY n 
1 407 GLN n 
1 408 THR n 
1 409 ASN n 
1 410 ASN n 
1 411 ALA n 
1 412 ALA n 
1 413 SER n 
1 414 ALA n 
1 415 SER n 
1 416 ALA n 
1 417 SER n 
1 418 ASN n 
1 419 SER n 
1 420 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'unidentified baculovirus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10469 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSK3B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKHPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I09 A 1 ? 420 ? P49841 1 ? 420 ? 1 420 
2 1 1I09 B 1 ? 420 ? P49841 1 ? 420 ? 1 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1I09 LEU A 350 ? UNP P49841 HIS 350 'SEE REMARK 999' 350 1 
2 1I09 LEU B 350 ? UNP P49841 HIS 350 'SEE REMARK 999' 350 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I09 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.43 
_exptl_crystal.density_percent_sol   64.13 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.1 
_exptl_crystal_grow.pdbx_details    'PEG 3350 Na/K Phosphate DTT, pH 4.1, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1I09 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.31 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   34747 
_reflns.number_all                   35382 
_reflns.percent_possible_obs         96 
_reflns.pdbx_Rmerge_I_obs            0.0700000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19 
_reflns.B_iso_Wilson_estimate        34.9 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.3220000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I09 
_refine.ls_number_reflns_obs                     34747 
_refine.ls_number_reflns_all                     36194 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             48.3 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2420000 
_refine.ls_R_factor_R_free                       0.2740000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3146 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5238 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               5304 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        48.3 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.7 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3250000 
_refine_ls_shell.percent_reflns_obs               92.8 
_refine_ls_shell.R_factor_R_free                  0.3520000 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             467 
_refine_ls_shell.number_reflns_obs                5051 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1I09 
_struct.title                     'STRUCTURE OF GLYCOGEN SYNTHASE KINASE-3 (GSK3B)' 
_struct.pdbx_descriptor           'GLYCOGEN SYNTHASE KINASE-3 BETA (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I09 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'kinase, beta barrel, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 95  ? LYS A 103 ? ASN A 95  LYS A 103 1 ? 9  
HELX_P HELX_P2  2  VAL A 139 ? ALA A 149 ? VAL A 139 ALA A 149 1 ? 11 
HELX_P HELX_P3  3  PRO A 154 ? SER A 174 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 183 ? GLN A 185 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 219 ? ARG A 223 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 224 ? PHE A 229 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 237 ? GLY A 253 ? SER A 237 GLY A 253 1 ? 17 
HELX_P HELX_P8  8  SER A 261 ? GLY A 274 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 277 ? ASN A 285 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P10 10 PRO A 310 ? LEU A 321 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P11 11 THR A 324 ? ARG A 328 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P12 12 THR A 330 ? ALA A 336 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P13 13 HIS A 337 ? PHE A 339 ? HIS A 337 PHE A 339 5 ? 3  
HELX_P HELX_P14 14 PHE A 340 ? ASP A 345 ? PHE A 340 ASP A 345 1 ? 6  
HELX_P HELX_P15 15 THR A 363 ? SER A 368 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P16 16 SER A 369 ? PRO A 372 ? SER A 369 PRO A 372 5 ? 4  
HELX_P HELX_P17 17 LEU A 373 ? ILE A 378 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P18 18 PRO A 379 ? ILE A 384 ? PRO A 379 ILE A 384 5 ? 6  
HELX_P HELX_P19 19 ASN B 95  ? ARG B 102 ? ASN B 95  ARG B 102 1 ? 8  
HELX_P HELX_P20 20 VAL B 139 ? ALA B 149 ? VAL B 139 ALA B 149 1 ? 11 
HELX_P HELX_P21 21 PRO B 154 ? PHE B 175 ? PRO B 154 PHE B 175 1 ? 22 
HELX_P HELX_P22 22 LYS B 183 ? GLN B 185 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P23 23 ARG B 220 ? ARG B 223 ? ARG B 220 ARG B 223 5 ? 4  
HELX_P HELX_P24 24 ALA B 224 ? PHE B 229 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P25 25 SER B 236 ? GLY B 253 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P26 26 SER B 261 ? GLY B 274 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P27 27 THR B 277 ? GLU B 283 ? THR B 277 GLU B 283 1 ? 7  
HELX_P HELX_P28 28 PRO B 310 ? ARG B 319 ? PRO B 310 ARG B 319 1 ? 10 
HELX_P HELX_P29 29 THR B 324 ? ARG B 328 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P30 30 THR B 330 ? ALA B 336 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P31 31 HIS B 337 ? ASP B 345 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P32 32 THR B 363 ? SER B 368 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P33 33 ASN B 370 ? PRO B 372 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P34 34 LEU B 373 ? ILE B 378 ? LEU B 373 ILE B 378 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 26  ? SER A 29  ? MET A 26  SER A 29  
A 2 VAL A 37  ? PRO A 44  ? VAL A 37  PRO A 44  
A 3 GLN A 52  ? GLY A 63  ? GLN A 52  GLY A 63  
A 4 GLY A 68  ? LEU A 75  ? GLY A 68  LEU A 75  
A 5 LEU A 81  ? VAL A 87  ? LEU A 81  VAL A 87  
A 6 LEU A 128 ? ASP A 133 ? LEU A 128 ASP A 133 
A 7 LEU A 112 ? TYR A 117 ? LEU A 112 TYR A 117 
A 8 VAL A 37  ? PRO A 44  ? VAL A 37  PRO A 44  
B 1 GLU A 137 ? THR A 138 ? GLU A 137 THR A 138 
B 2 LEU A 187 ? LEU A 189 ? LEU A 187 LEU A 189 
B 3 LEU A 196 ? LEU A 198 ? LEU A 196 LEU A 198 
C 1 ILE A 177 ? CYS A 178 ? ILE A 177 CYS A 178 
C 2 LYS A 205 ? GLN A 206 ? LYS A 205 GLN A 206 
D 1 THR B 38  ? PRO B 44  ? THR B 38  PRO B 44  
D 2 GLN B 52  ? ASN B 64  ? GLN B 52  ASN B 64  
D 3 GLY B 68  ? LEU B 75  ? GLY B 68  LEU B 75  
D 4 LEU B 81  ? GLN B 89  ? LEU B 81  GLN B 89  
D 5 VAL B 126 ? ASP B 133 ? VAL B 126 ASP B 133 
D 6 LEU B 112 ? SER B 119 ? LEU B 112 SER B 119 
D 7 THR B 38  ? PRO B 44  ? THR B 38  PRO B 44  
E 1 GLU B 137 ? THR B 138 ? GLU B 137 THR B 138 
E 2 LEU B 187 ? ASP B 190 ? LEU B 187 ASP B 190 
E 3 VAL B 195 ? LEU B 198 ? VAL B 195 LEU B 198 
F 1 ILE B 177 ? CYS B 178 ? ILE B 177 CYS B 178 
F 2 LYS B 205 ? GLN B 206 ? LYS B 205 GLN B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 29  ? O SER A 29  N VAL A 37  ? N VAL A 37  
A 2 3 N ALA A 42  ? N ALA A 42  O GLN A 52  ? O GLN A 52  
A 3 4 N GLY A 63  ? N GLY A 63  O VAL A 70  ? O VAL A 70  
A 4 5 N ALA A 73  ? N ALA A 73  O VAL A 82  ? O VAL A 82  
A 5 6 O VAL A 87  ? O VAL A 87  N LEU A 128 ? N LEU A 128 
A 6 7 O VAL A 131 ? O VAL A 131 N ARG A 113 ? N ARG A 113 
A 7 8 O PHE A 115 ? O PHE A 115 N THR A 43  ? N THR A 43  
B 1 2 O GLU A 137 ? O GLU A 137 N LEU A 189 ? N LEU A 189 
B 2 3 O LEU A 188 ? O LEU A 188 N LYS A 197 ? N LYS A 197 
C 1 2 N CYS A 178 ? N CYS A 178 O LYS A 205 ? O LYS A 205 
D 1 2 O ALA B 42  ? O ALA B 42  N GLN B 52  ? N GLN B 52  
D 2 3 N ILE B 62  ? N ILE B 62  O VAL B 70  ? O VAL B 70  
D 3 4 N ALA B 73  ? N ALA B 73  O VAL B 82  ? O VAL B 82  
D 4 5 N GLN B 89  ? N GLN B 89  O VAL B 126 ? O VAL B 126 
D 5 6 O VAL B 131 ? O VAL B 131 N ARG B 113 ? N ARG B 113 
D 6 7 O PHE B 115 ? O PHE B 115 N THR B 43  ? N THR B 43  
E 1 2 O GLU B 137 ? O GLU B 137 N LEU B 189 ? N LEU B 189 
E 2 3 N ASP B 190 ? N ASP B 190 O VAL B 195 ? O VAL B 195 
F 1 2 N CYS B 178 ? N CYS B 178 O LYS B 205 ? O LYS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 B 421' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 A 421' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 A 422' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PO4 B 422' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG B 96  ? ARG B 96  . ? 1_555 ? 
2  AC1 4 ARG B 180 ? ARG B 180 . ? 1_555 ? 
3  AC1 4 LYS B 205 ? LYS B 205 . ? 1_555 ? 
4  AC1 4 VAL B 214 ? VAL B 214 . ? 1_555 ? 
5  AC2 5 ARG A 96  ? ARG A 96  . ? 1_555 ? 
6  AC2 5 ARG A 180 ? ARG A 180 . ? 1_555 ? 
7  AC2 5 LYS A 205 ? LYS A 205 . ? 1_555 ? 
8  AC2 5 ASN A 213 ? ASN A 213 . ? 1_555 ? 
9  AC2 5 VAL A 214 ? VAL A 214 . ? 1_555 ? 
10 AC3 5 HIS A 173 ? HIS A 173 . ? 1_555 ? 
11 AC3 5 SER A 236 ? SER A 236 . ? 1_555 ? 
12 AC3 5 SER A 237 ? SER A 237 . ? 1_555 ? 
13 AC3 5 PRO A 331 ? PRO A 331 . ? 1_555 ? 
14 AC3 5 HOH G .   ? HOH A 431 . ? 1_555 ? 
15 AC4 7 HIS B 173 ? HIS B 173 . ? 1_555 ? 
16 AC4 7 SER B 236 ? SER B 236 . ? 1_555 ? 
17 AC4 7 SER B 237 ? SER B 237 . ? 1_555 ? 
18 AC4 7 VAL B 240 ? VAL B 240 . ? 1_555 ? 
19 AC4 7 THR B 330 ? THR B 330 . ? 1_555 ? 
20 AC4 7 PRO B 331 ? PRO B 331 . ? 1_555 ? 
21 AC4 7 HOH H .   ? HOH B 427 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I09 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I09 
_atom_sites.fract_transf_matrix[1][1]   0.01201 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01153 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00562 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 25  ? 49.761 12.124 57.404  1.00 73.06  ? 25  SER A N   1 
ATOM   2    C CA  . SER A 1 25  ? 49.843 13.283 58.345  1.00 73.06  ? 25  SER A CA  1 
ATOM   3    C C   . SER A 1 25  ? 50.651 14.389 57.666  1.00 73.06  ? 25  SER A C   1 
ATOM   4    O O   . SER A 1 25  ? 50.845 14.354 56.450  0.00 73.06  ? 25  SER A O   1 
ATOM   5    C CB  . SER A 1 25  ? 50.535 12.861 59.654  1.00 74.21  ? 25  SER A CB  1 
ATOM   6    O OG  . SER A 1 25  ? 51.881 12.446 59.431  1.00 74.21  ? 25  SER A OG  1 
ATOM   7    N N   . MET A 1 26  ? 51.124 15.366 58.439  1.00 60.23  ? 26  MET A N   1 
ATOM   8    C CA  . MET A 1 26  ? 51.921 16.424 57.824  1.00 60.23  ? 26  MET A CA  1 
ATOM   9    C C   . MET A 1 26  ? 53.407 16.337 58.174  1.00 60.23  ? 26  MET A C   1 
ATOM   10   O O   . MET A 1 26  ? 53.781 16.042 59.315  1.00 60.23  ? 26  MET A O   1 
ATOM   11   C CB  . MET A 1 26  ? 51.352 17.824 58.147  1.00 70.25  ? 26  MET A CB  1 
ATOM   12   C CG  . MET A 1 26  ? 51.419 18.290 59.592  1.00 70.25  ? 26  MET A CG  1 
ATOM   13   S SD  . MET A 1 26  ? 50.344 19.765 59.811  1.00 70.25  ? 26  MET A SD  1 
ATOM   14   C CE  . MET A 1 26  ? 48.782 18.955 60.093  1.00 70.25  ? 26  MET A CE  1 
ATOM   15   N N   . LYS A 1 27  ? 54.235 16.565 57.153  1.00 56.51  ? 27  LYS A N   1 
ATOM   16   C CA  . LYS A 1 27  ? 55.692 16.533 57.262  1.00 56.51  ? 27  LYS A CA  1 
ATOM   17   C C   . LYS A 1 27  ? 56.201 17.936 56.941  1.00 56.51  ? 27  LYS A C   1 
ATOM   18   O O   . LYS A 1 27  ? 55.820 18.521 55.923  1.00 56.51  ? 27  LYS A O   1 
ATOM   19   C CB  . LYS A 1 27  ? 56.269 15.513 56.273  1.00 46.92  ? 27  LYS A CB  1 
ATOM   20   C CG  . LYS A 1 27  ? 55.663 14.129 56.427  1.00 46.92  ? 27  LYS A CG  1 
ATOM   21   C CD  . LYS A 1 27  ? 56.373 13.074 55.597  0.00 46.92  ? 27  LYS A CD  1 
ATOM   22   C CE  . LYS A 1 27  ? 57.742 12.749 56.167  0.00 46.92  ? 27  LYS A CE  1 
ATOM   23   N NZ  . LYS A 1 27  ? 58.347 11.567 55.494  1.00 46.92  ? 27  LYS A NZ  1 
ATOM   24   N N   . VAL A 1 28  ? 57.071 18.464 57.802  1.00 77.30  ? 28  VAL A N   1 
ATOM   25   C CA  . VAL A 1 28  ? 57.594 19.824 57.645  1.00 77.30  ? 28  VAL A CA  1 
ATOM   26   C C   . VAL A 1 28  ? 59.109 19.917 57.462  1.00 77.30  ? 28  VAL A C   1 
ATOM   27   O O   . VAL A 1 28  ? 59.849 19.965 58.445  1.00 77.30  ? 28  VAL A O   1 
ATOM   28   C CB  . VAL A 1 28  ? 57.187 20.691 58.879  1.00 74.69  ? 28  VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 28  ? 57.571 19.979 60.170  0.00 74.69  ? 28  VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 28  ? 57.853 22.057 58.812  1.00 74.69  ? 28  VAL A CG2 1 
ATOM   31   N N   . SER A 1 29  ? 59.562 19.953 56.206  1.00 60.45  ? 29  SER A N   1 
ATOM   32   C CA  . SER A 1 29  ? 60.987 20.058 55.915  1.00 60.45  ? 29  SER A CA  1 
ATOM   33   C C   . SER A 1 29  ? 61.401 21.504 55.656  1.00 60.45  ? 29  SER A C   1 
ATOM   34   O O   . SER A 1 29  ? 60.549 22.390 55.583  1.00 60.45  ? 29  SER A O   1 
ATOM   35   N N   . ARG A 1 30  ? 62.705 21.753 55.522  1.00 100.00 ? 30  ARG A N   1 
ATOM   36   C CA  . ARG A 1 30  ? 63.210 23.109 55.275  1.00 100.00 ? 30  ARG A CA  1 
ATOM   37   C C   . ARG A 1 30  ? 64.306 23.124 54.204  1.00 100.00 ? 30  ARG A C   1 
ATOM   38   O O   . ARG A 1 30  ? 65.501 23.089 54.517  1.00 100.00 ? 30  ARG A O   1 
ATOM   39   C CB  . ARG A 1 30  ? 63.741 23.734 56.582  1.00 93.57  ? 30  ARG A CB  1 
ATOM   40   C CG  . ARG A 1 30  ? 62.723 23.680 57.736  1.00 93.57  ? 30  ARG A CG  1 
ATOM   41   C CD  . ARG A 1 30  ? 62.760 24.920 58.641  1.00 93.57  ? 30  ARG A CD  1 
ATOM   42   N NE  . ARG A 1 30  ? 63.946 24.972 59.497  1.00 93.57  ? 30  ARG A NE  1 
ATOM   43   C CZ  . ARG A 1 30  ? 64.233 24.092 60.456  1.00 93.57  ? 30  ARG A CZ  1 
ATOM   44   N NH1 . ARG A 1 30  ? 63.420 23.072 60.697  0.00 93.57  ? 30  ARG A NH1 1 
ATOM   45   N NH2 . ARG A 1 30  ? 65.344 24.241 61.179  1.00 93.57  ? 30  ARG A NH2 1 
ATOM   46   N N   . ASP A 1 31  ? 63.889 23.163 52.941  1.00 64.77  ? 31  ASP A N   1 
ATOM   47   C CA  . ASP A 1 31  ? 64.842 23.183 51.853  0.00 64.77  ? 31  ASP A CA  1 
ATOM   48   C C   . ASP A 1 31  ? 64.524 24.323 50.914  1.00 64.77  ? 31  ASP A C   1 
ATOM   49   O O   . ASP A 1 31  ? 63.517 25.024 51.097  1.00 64.77  ? 31  ASP A O   1 
ATOM   50   N N   . LYS A 1 32  ? 65.380 24.508 49.907  1.00 94.72  ? 32  LYS A N   1 
ATOM   51   C CA  . LYS A 1 32  ? 65.171 25.571 48.937  1.00 94.72  ? 32  LYS A CA  1 
ATOM   52   C C   . LYS A 1 32  ? 65.379 26.960 49.533  1.00 94.72  ? 32  LYS A C   1 
ATOM   53   O O   . LYS A 1 32  ? 64.425 27.754 49.653  1.00 94.72  ? 32  LYS A O   1 
ATOM   54   N N   . ASP A 1 33  ? 66.627 27.251 49.914  1.00 100.00 ? 33  ASP A N   1 
ATOM   55   C CA  . ASP A 1 33  ? 66.961 28.548 50.491  1.00 100.00 ? 33  ASP A CA  1 
ATOM   56   C C   . ASP A 1 33  ? 66.187 28.957 51.741  1.00 100.00 ? 33  ASP A C   1 
ATOM   57   O O   . ASP A 1 33  ? 65.140 29.613 51.650  1.00 100.00 ? 33  ASP A O   1 
ATOM   58   N N   . GLY A 1 34  ? 66.705 28.575 52.907  1.00 55.02  ? 34  GLY A N   1 
ATOM   59   C CA  . GLY A 1 34  ? 66.079 28.920 54.172  0.00 55.02  ? 34  GLY A CA  1 
ATOM   60   C C   . GLY A 1 34  ? 64.595 29.238 54.137  0.00 55.02  ? 34  GLY A C   1 
ATOM   61   O O   . GLY A 1 34  ? 64.195 30.402 54.124  0.00 55.02  ? 34  GLY A O   1 
ATOM   62   N N   . SER A 1 35  ? 63.780 28.191 54.122  1.00 67.60  ? 35  SER A N   1 
ATOM   63   C CA  . SER A 1 35  ? 62.336 28.345 54.107  1.00 67.60  ? 35  SER A CA  1 
ATOM   64   C C   . SER A 1 35  ? 61.644 27.095 54.652  1.00 67.60  ? 35  SER A C   1 
ATOM   65   O O   . SER A 1 35  ? 61.932 25.974 54.207  1.00 67.60  ? 35  SER A O   1 
ATOM   66   N N   . LYS A 1 36  ? 60.739 27.272 55.616  1.00 65.29  ? 36  LYS A N   1 
ATOM   67   C CA  . LYS A 1 36  ? 60.010 26.138 56.199  1.00 65.29  ? 36  LYS A CA  1 
ATOM   68   C C   . LYS A 1 36  ? 58.952 25.617 55.247  1.00 65.29  ? 36  LYS A C   1 
ATOM   69   O O   . LYS A 1 36  ? 58.126 26.383 54.745  1.00 65.29  ? 36  LYS A O   1 
ATOM   70   C CB  . LYS A 1 36  ? 59.320 26.545 57.496  1.00 48.96  ? 36  LYS A CB  1 
ATOM   71   C CG  . LYS A 1 36  ? 58.431 25.464 58.105  1.00 48.96  ? 36  LYS A CG  1 
ATOM   72   C CD  . LYS A 1 36  ? 57.820 25.955 59.427  1.00 48.96  ? 36  LYS A CD  1 
ATOM   73   C CE  . LYS A 1 36  ? 57.028 24.873 60.134  1.00 48.96  ? 36  LYS A CE  1 
ATOM   74   N NZ  . LYS A 1 36  ? 56.438 25.361 61.412  0.00 48.96  ? 36  LYS A NZ  1 
ATOM   75   N N   . VAL A 1 37  ? 58.968 24.309 55.010  1.00 60.62  ? 37  VAL A N   1 
ATOM   76   C CA  . VAL A 1 37  ? 57.992 23.691 54.119  1.00 60.62  ? 37  VAL A CA  1 
ATOM   77   C C   . VAL A 1 37  ? 57.112 22.687 54.830  1.00 60.62  ? 37  VAL A C   1 
ATOM   78   O O   . VAL A 1 37  ? 57.591 21.779 55.508  0.00 60.62  ? 37  VAL A O   1 
ATOM   79   C CB  . VAL A 1 37  ? 58.668 22.974 52.944  1.00 46.81  ? 37  VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 37  ? 57.627 22.175 52.153  1.00 46.81  ? 37  VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 37  ? 59.352 23.994 52.044  1.00 46.81  ? 37  VAL A CG2 1 
ATOM   82   N N   . THR A 1 38  ? 55.809 22.869 54.661  1.00 44.94  ? 38  THR A N   1 
ATOM   83   C CA  . THR A 1 38  ? 54.836 21.972 55.254  1.00 44.94  ? 38  THR A CA  1 
ATOM   84   C C   . THR A 1 38  ? 54.233 21.142 54.129  1.00 44.94  ? 38  THR A C   1 
ATOM   85   O O   . THR A 1 38  ? 53.713 21.677 53.138  1.00 44.94  ? 38  THR A O   1 
ATOM   86   C CB  . THR A 1 38  ? 53.712 22.740 55.987  1.00 45.12  ? 38  THR A CB  1 
ATOM   87   O OG1 . THR A 1 38  ? 54.290 23.633 56.952  1.00 45.12  ? 38  THR A OG1 1 
ATOM   88   C CG2 . THR A 1 38  ? 52.783 21.752 56.701  1.00 45.12  ? 38  THR A CG2 1 
ATOM   89   N N   . THR A 1 39  ? 54.343 19.827 54.278  1.00 39.35  ? 39  THR A N   1 
ATOM   90   C CA  . THR A 1 39  ? 53.818 18.901 53.300  1.00 39.35  ? 39  THR A CA  1 
ATOM   91   C C   . THR A 1 39  ? 52.789 18.053 54.003  1.00 39.35  ? 39  THR A C   1 
ATOM   92   O O   . THR A 1 39  ? 52.973 17.646 55.149  1.00 39.35  ? 39  THR A O   1 
ATOM   93   C CB  . THR A 1 39  ? 54.914 17.998 52.738  1.00 43.54  ? 39  THR A CB  1 
ATOM   94   O OG1 . THR A 1 39  ? 55.894 18.803 52.063  1.00 43.54  ? 39  THR A OG1 1 
ATOM   95   C CG2 . THR A 1 39  ? 54.315 16.996 51.755  1.00 43.54  ? 39  THR A CG2 1 
ATOM   96   N N   . VAL A 1 40  ? 51.692 17.795 53.316  1.00 39.28  ? 40  VAL A N   1 
ATOM   97   C CA  . VAL A 1 40  ? 50.620 17.013 53.895  1.00 39.28  ? 40  VAL A CA  1 
ATOM   98   C C   . VAL A 1 40  ? 49.848 16.368 52.766  1.00 39.28  ? 40  VAL A C   1 
ATOM   99   O O   . VAL A 1 40  ? 49.945 16.782 51.609  1.00 39.28  ? 40  VAL A O   1 
ATOM   100  C CB  . VAL A 1 40  ? 49.647 17.914 54.710  1.00 35.69  ? 40  VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 40  ? 48.947 18.905 53.785  1.00 35.69  ? 40  VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 40  ? 48.622 17.055 55.432  0.00 35.69  ? 40  VAL A CG2 1 
ATOM   103  N N   . VAL A 1 41  ? 49.077 15.351 53.106  1.00 37.75  ? 41  VAL A N   1 
ATOM   104  C CA  . VAL A 1 41  ? 48.280 14.668 52.115  1.00 37.75  ? 41  VAL A CA  1 
ATOM   105  C C   . VAL A 1 41  ? 46.846 15.066 52.375  1.00 37.75  ? 41  VAL A C   1 
ATOM   106  O O   . VAL A 1 41  ? 46.294 14.711 53.407  1.00 37.75  ? 41  VAL A O   1 
ATOM   107  C CB  . VAL A 1 41  ? 48.429 13.149 52.257  1.00 35.15  ? 41  VAL A CB  1 
ATOM   108  C CG1 . VAL A 1 41  ? 47.543 12.434 51.244  1.00 35.15  ? 41  VAL A CG1 1 
ATOM   109  C CG2 . VAL A 1 41  ? 49.894 12.767 52.075  1.00 35.15  ? 41  VAL A CG2 1 
ATOM   110  N N   . ALA A 1 42  ? 46.246 15.812 51.453  1.00 35.42  ? 42  ALA A N   1 
ATOM   111  C CA  . ALA A 1 42  ? 44.862 16.244 51.634  1.00 35.42  ? 42  ALA A CA  1 
ATOM   112  C C   . ALA A 1 42  ? 43.924 15.684 50.578  1.00 35.42  ? 42  ALA A C   1 
ATOM   113  O O   . ALA A 1 42  ? 44.341 14.941 49.689  1.00 35.42  ? 42  ALA A O   1 
ATOM   114  C CB  . ALA A 1 42  ? 44.782 17.757 51.634  1.00 58.29  ? 42  ALA A CB  1 
ATOM   115  N N   . THR A 1 43  ? 42.655 16.070 50.689  1.00 42.71  ? 43  THR A N   1 
ATOM   116  C CA  . THR A 1 43  ? 41.590 15.635 49.786  1.00 42.71  ? 43  THR A CA  1 
ATOM   117  C C   . THR A 1 43  ? 41.051 16.801 48.950  1.00 42.71  ? 43  THR A C   1 
ATOM   118  O O   . THR A 1 43  ? 40.747 17.869 49.491  1.00 42.71  ? 43  THR A O   1 
ATOM   119  C CB  . THR A 1 43  ? 40.392 15.060 50.589  1.00 41.19  ? 43  THR A CB  1 
ATOM   120  O OG1 . THR A 1 43  ? 40.870 14.157 51.590  1.00 41.19  ? 43  THR A OG1 1 
ATOM   121  C CG2 . THR A 1 43  ? 39.423 14.322 49.672  1.00 41.19  ? 43  THR A CG2 1 
ATOM   122  N N   . PRO A 1 44  ? 40.899 16.603 47.628  1.00 40.41  ? 44  PRO A N   1 
ATOM   123  C CA  . PRO A 1 44  ? 40.385 17.640 46.729  1.00 40.41  ? 44  PRO A CA  1 
ATOM   124  C C   . PRO A 1 44  ? 39.113 18.213 47.319  1.00 40.41  ? 44  PRO A C   1 
ATOM   125  O O   . PRO A 1 44  ? 38.334 17.477 47.925  1.00 40.41  ? 44  PRO A O   1 
ATOM   126  C CB  . PRO A 1 44  ? 40.090 16.872 45.445  1.00 39.12  ? 44  PRO A CB  1 
ATOM   127  C CG  . PRO A 1 44  ? 41.122 15.825 45.437  1.00 39.12  ? 44  PRO A CG  1 
ATOM   128  C CD  . PRO A 1 44  ? 41.125 15.351 46.888  1.00 39.12  ? 44  PRO A CD  1 
ATOM   129  N N   . GLY A 1 45  ? 38.897 19.515 47.157  1.00 31.93  ? 45  GLY A N   1 
ATOM   130  C CA  . GLY A 1 45  ? 37.687 20.113 47.687  1.00 31.93  ? 45  GLY A CA  1 
ATOM   131  C C   . GLY A 1 45  ? 36.476 19.506 47.011  1.00 31.93  ? 45  GLY A C   1 
ATOM   132  O O   . GLY A 1 45  ? 35.509 19.121 47.660  1.00 31.93  ? 45  GLY A O   1 
ATOM   133  N N   . GLN A 1 46  ? 36.541 19.422 45.689  1.00 46.73  ? 46  GLN A N   1 
ATOM   134  C CA  . GLN A 1 46  ? 35.468 18.853 44.885  1.00 46.73  ? 46  GLN A CA  1 
ATOM   135  C C   . GLN A 1 46  ? 36.067 17.703 44.082  1.00 46.73  ? 46  GLN A C   1 
ATOM   136  O O   . GLN A 1 46  ? 37.292 17.621 43.919  1.00 46.73  ? 46  GLN A O   1 
ATOM   137  C CB  . GLN A 1 46  ? 34.901 19.910 43.950  1.00 47.06  ? 46  GLN A CB  1 
ATOM   138  N N   . GLY A 1 47  ? 35.216 16.813 43.579  1.00 65.73  ? 47  GLY A N   1 
ATOM   139  C CA  . GLY A 1 47  ? 35.722 15.684 42.809  1.00 65.73  ? 47  GLY A CA  1 
ATOM   140  C C   . GLY A 1 47  ? 35.779 14.418 43.650  1.00 65.73  ? 47  GLY A C   1 
ATOM   141  O O   . GLY A 1 47  ? 35.366 14.430 44.817  1.00 65.73  ? 47  GLY A O   1 
ATOM   142  N N   . PRO A 1 48  ? 36.288 13.305 43.095  1.00 49.54  ? 48  PRO A N   1 
ATOM   143  C CA  . PRO A 1 48  ? 36.386 12.029 43.820  1.00 49.54  ? 48  PRO A CA  1 
ATOM   144  C C   . PRO A 1 48  ? 37.581 12.049 44.781  1.00 49.54  ? 48  PRO A C   1 
ATOM   145  O O   . PRO A 1 48  ? 38.625 12.627 44.467  1.00 49.54  ? 48  PRO A O   1 
ATOM   146  C CB  . PRO A 1 48  ? 36.578 11.002 42.698  1.00 58.10  ? 48  PRO A CB  1 
ATOM   147  C CG  . PRO A 1 48  ? 36.272 11.782 41.404  1.00 58.10  ? 48  PRO A CG  1 
ATOM   148  C CD  . PRO A 1 48  ? 36.772 13.149 41.717  1.00 58.10  ? 48  PRO A CD  1 
ATOM   149  N N   . ASP A 1 49  ? 37.428 11.419 45.940  1.00 61.37  ? 49  ASP A N   1 
ATOM   150  C CA  . ASP A 1 49  ? 38.497 11.388 46.936  1.00 61.37  ? 49  ASP A CA  1 
ATOM   151  C C   . ASP A 1 49  ? 39.746 10.738 46.347  1.00 61.37  ? 49  ASP A C   1 
ATOM   152  O O   . ASP A 1 49  ? 39.815 9.510  46.243  1.00 61.37  ? 49  ASP A O   1 
ATOM   153  C CB  . ASP A 1 49  ? 38.063 10.591 48.179  1.00 57.83  ? 49  ASP A CB  1 
ATOM   154  C CG  . ASP A 1 49  ? 38.999 10.804 49.371  1.00 57.83  ? 49  ASP A CG  1 
ATOM   155  O OD1 . ASP A 1 49  ? 40.235 10.962 49.172  1.00 57.83  ? 49  ASP A OD1 1 
ATOM   156  O OD2 . ASP A 1 49  ? 38.486 10.803 50.513  1.00 57.83  ? 49  ASP A OD2 1 
ATOM   157  N N   . ARG A 1 50  ? 40.721 11.563 45.970  1.00 44.76  ? 50  ARG A N   1 
ATOM   158  C CA  . ARG A 1 50  ? 41.976 11.091 45.394  1.00 44.76  ? 50  ARG A CA  1 
ATOM   159  C C   . ARG A 1 50  ? 43.095 11.965 45.954  1.00 44.76  ? 50  ARG A C   1 
ATOM   160  O O   . ARG A 1 50  ? 43.581 12.890 45.291  1.00 44.76  ? 50  ARG A O   1 
ATOM   161  C CB  . ARG A 1 50  ? 41.927 11.184 43.868  1.00 49.13  ? 50  ARG A CB  1 
ATOM   162  C CG  . ARG A 1 50  ? 40.824 10.341 43.264  1.00 49.13  ? 50  ARG A CG  1 
ATOM   163  C CD  . ARG A 1 50  ? 41.134 8.852  43.346  1.00 49.13  ? 50  ARG A CD  1 
ATOM   164  N NE  . ARG A 1 50  ? 42.017 8.452  42.253  1.00 49.13  ? 50  ARG A NE  1 
ATOM   165  C CZ  . ARG A 1 50  ? 42.534 7.235  42.102  1.00 49.13  ? 50  ARG A CZ  1 
ATOM   166  N NH1 . ARG A 1 50  ? 42.261 6.278  42.978  0.00 49.13  ? 50  ARG A NH1 1 
ATOM   167  N NH2 . ARG A 1 50  ? 43.318 6.976  41.063  1.00 49.13  ? 50  ARG A NH2 1 
ATOM   168  N N   . PRO A 1 51  ? 43.530 11.655 47.186  1.00 32.41  ? 51  PRO A N   1 
ATOM   169  C CA  . PRO A 1 51  ? 44.577 12.346 47.939  1.00 32.41  ? 51  PRO A CA  1 
ATOM   170  C C   . PRO A 1 51  ? 45.713 12.895 47.100  1.00 32.41  ? 51  PRO A C   1 
ATOM   171  O O   . PRO A 1 51  ? 45.946 12.434 45.990  1.00 32.41  ? 51  PRO A O   1 
ATOM   172  C CB  . PRO A 1 51  ? 45.040 11.281 48.933  1.00 34.03  ? 51  PRO A CB  1 
ATOM   173  C CG  . PRO A 1 51  ? 44.677 9.986  48.262  1.00 34.03  ? 51  PRO A CG  1 
ATOM   174  C CD  . PRO A 1 51  ? 43.326 10.302 47.732  1.00 34.03  ? 51  PRO A CD  1 
ATOM   175  N N   . GLN A 1 52  ? 46.401 13.904 47.632  1.00 44.27  ? 52  GLN A N   1 
ATOM   176  C CA  . GLN A 1 52  ? 47.541 14.509 46.946  1.00 44.27  ? 52  GLN A CA  1 
ATOM   177  C C   . GLN A 1 52  ? 48.532 15.144 47.915  1.00 44.27  ? 52  GLN A C   1 
ATOM   178  O O   . GLN A 1 52  ? 48.202 15.421 49.077  1.00 44.27  ? 52  GLN A O   1 
ATOM   179  C CB  . GLN A 1 52  ? 47.076 15.564 45.958  0.00 68.01  ? 52  GLN A CB  1 
ATOM   180  C CG  . GLN A 1 52  ? 45.589 15.689 45.884  0.00 68.01  ? 52  GLN A CG  1 
ATOM   181  C CD  . GLN A 1 52  ? 45.145 16.042 44.505  1.00 68.01  ? 52  GLN A CD  1 
ATOM   182  O OE1 . GLN A 1 52  ? 45.422 17.145 44.014  1.00 68.01  ? 52  GLN A OE1 1 
ATOM   183  N NE2 . GLN A 1 52  ? 44.464 15.104 43.846  1.00 68.01  ? 52  GLN A NE2 1 
ATOM   184  N N   . GLU A 1 53  ? 49.753 15.349 47.428  1.00 37.18  ? 53  GLU A N   1 
ATOM   185  C CA  . GLU A 1 53  ? 50.809 15.972 48.211  1.00 37.18  ? 53  GLU A CA  1 
ATOM   186  C C   . GLU A 1 53  ? 50.690 17.475 48.033  1.00 37.18  ? 53  GLU A C   1 
ATOM   187  O O   . GLU A 1 53  ? 50.883 17.987 46.932  1.00 37.18  ? 53  GLU A O   1 
ATOM   188  C CB  . GLU A 1 53  ? 52.187 15.540 47.716  1.00 47.66  ? 53  GLU A CB  1 
ATOM   189  C CG  . GLU A 1 53  ? 52.569 14.112 48.019  1.00 47.66  ? 53  GLU A CG  1 
ATOM   190  C CD  . GLU A 1 53  ? 53.813 14.034 48.875  1.00 47.66  ? 53  GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 53  ? 54.795 14.750 48.556  1.00 47.66  ? 53  GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 53  ? 53.805 13.256 49.856  1.00 47.66  ? 53  GLU A OE2 1 
ATOM   193  N N   . VAL A 1 54  ? 50.374 18.180 49.112  1.00 39.29  ? 54  VAL A N   1 
ATOM   194  C CA  . VAL A 1 54  ? 50.259 19.621 49.037  1.00 39.29  ? 54  VAL A CA  1 
ATOM   195  C C   . VAL A 1 54  ? 51.333 20.241 49.910  1.00 39.29  ? 54  VAL A C   1 
ATOM   196  O O   . VAL A 1 54  ? 51.416 19.967 51.107  1.00 39.29  ? 54  VAL A O   1 
ATOM   197  C CB  . VAL A 1 54  ? 48.863 20.083 49.473  1.00 31.58  ? 54  VAL A CB  1 
ATOM   198  C CG1 . VAL A 1 54  ? 48.758 21.599 49.382  1.00 31.58  ? 54  VAL A CG1 1 
ATOM   199  C CG2 . VAL A 1 54  ? 47.817 19.435 48.578  1.00 31.58  ? 54  VAL A CG2 1 
ATOM   200  N N   . SER A 1 55  ? 52.173 21.065 49.295  1.00 42.34  ? 55  SER A N   1 
ATOM   201  C CA  . SER A 1 55  ? 53.259 21.708 50.020  1.00 42.34  ? 55  SER A CA  1 
ATOM   202  C C   . SER A 1 55  ? 53.152 23.226 49.958  1.00 42.34  ? 55  SER A C   1 
ATOM   203  O O   . SER A 1 55  ? 53.131 23.829 48.878  1.00 42.34  ? 55  SER A O   1 
ATOM   204  C CB  . SER A 1 55  ? 54.603 21.292 49.435  1.00 48.76  ? 55  SER A CB  1 
ATOM   205  O OG  . SER A 1 55  ? 54.845 21.999 48.229  1.00 48.76  ? 55  SER A OG  1 
ATOM   206  N N   . TYR A 1 56  ? 53.110 23.846 51.127  1.00 56.49  ? 56  TYR A N   1 
ATOM   207  C CA  . TYR A 1 56  ? 53.002 25.290 51.189  1.00 56.49  ? 56  TYR A CA  1 
ATOM   208  C C   . TYR A 1 56  ? 54.009 25.847 52.149  1.00 56.49  ? 56  TYR A C   1 
ATOM   209  O O   . TYR A 1 56  ? 54.557 25.121 52.976  1.00 56.49  ? 56  TYR A O   1 
ATOM   210  C CB  . TYR A 1 56  ? 51.612 25.691 51.652  1.00 34.56  ? 56  TYR A CB  1 
ATOM   211  C CG  . TYR A 1 56  ? 51.278 25.232 53.053  1.00 34.56  ? 56  TYR A CG  1 
ATOM   212  C CD1 . TYR A 1 56  ? 51.574 26.019 54.164  1.00 34.56  ? 56  TYR A CD1 1 
ATOM   213  C CD2 . TYR A 1 56  ? 50.594 24.038 53.257  1.00 34.56  ? 56  TYR A CD2 1 
ATOM   214  C CE1 . TYR A 1 56  ? 51.173 25.634 55.444  1.00 34.56  ? 56  TYR A CE1 1 
ATOM   215  C CE2 . TYR A 1 56  ? 50.198 23.644 54.523  1.00 34.56  ? 56  TYR A CE2 1 
ATOM   216  C CZ  . TYR A 1 56  ? 50.484 24.448 55.612  1.00 34.56  ? 56  TYR A CZ  1 
ATOM   217  O OH  . TYR A 1 56  ? 50.032 24.068 56.858  1.00 34.56  ? 56  TYR A OH  1 
ATOM   218  N N   . THR A 1 57  ? 54.239 27.147 52.047  1.00 50.93  ? 57  THR A N   1 
ATOM   219  C CA  . THR A 1 57  ? 55.182 27.802 52.923  1.00 50.93  ? 57  THR A CA  1 
ATOM   220  C C   . THR A 1 57  ? 54.670 29.187 53.287  1.00 50.93  ? 57  THR A C   1 
ATOM   221  O O   . THR A 1 57  ? 53.611 29.606 52.811  1.00 50.93  ? 57  THR A O   1 
ATOM   222  C CB  . THR A 1 57  ? 56.536 27.929 52.243  1.00 66.35  ? 57  THR A CB  1 
ATOM   223  O OG1 . THR A 1 57  ? 57.426 28.632 53.113  1.00 66.35  ? 57  THR A OG1 1 
ATOM   224  C CG2 . THR A 1 57  ? 56.408 28.684 50.934  0.00 66.35  ? 57  THR A CG2 1 
ATOM   225  N N   . ASP A 1 58  ? 55.423 29.888 54.133  1.00 59.63  ? 58  ASP A N   1 
ATOM   226  C CA  . ASP A 1 58  ? 55.063 31.237 54.560  1.00 59.63  ? 58  ASP A CA  1 
ATOM   227  C C   . ASP A 1 58  ? 53.720 31.256 55.299  1.00 59.63  ? 58  ASP A C   1 
ATOM   228  O O   . ASP A 1 58  ? 52.869 32.118 55.031  1.00 59.63  ? 58  ASP A O   1 
ATOM   229  C CB  . ASP A 1 58  ? 54.980 32.180 53.344  1.00 61.93  ? 58  ASP A CB  1 
ATOM   230  C CG  . ASP A 1 58  ? 56.237 32.150 52.485  1.00 61.93  ? 58  ASP A CG  1 
ATOM   231  O OD1 . ASP A 1 58  ? 57.277 31.664 52.987  1.00 61.93  ? 58  ASP A OD1 1 
ATOM   232  O OD2 . ASP A 1 58  ? 56.190 32.625 51.319  1.00 61.93  ? 58  ASP A OD2 1 
ATOM   233  N N   . THR A 1 59  ? 53.518 30.320 56.222  1.00 48.28  ? 59  THR A N   1 
ATOM   234  C CA  . THR A 1 59  ? 52.257 30.288 56.955  1.00 48.28  ? 59  THR A CA  1 
ATOM   235  C C   . THR A 1 59  ? 52.272 31.364 58.024  1.00 48.28  ? 59  THR A C   1 
ATOM   236  O O   . THR A 1 59  ? 53.131 31.352 58.906  1.00 48.28  ? 59  THR A O   1 
ATOM   237  C CB  . THR A 1 59  ? 52.004 28.919 57.644  1.00 63.84  ? 59  THR A CB  1 
ATOM   238  O OG1 . THR A 1 59  ? 52.862 28.789 58.787  1.00 63.84  ? 59  THR A OG1 1 
ATOM   239  C CG2 . THR A 1 59  ? 52.280 27.775 56.680  1.00 63.84  ? 59  THR A CG2 1 
ATOM   240  N N   . LYS A 1 60  ? 51.323 32.295 57.928  1.00 61.08  ? 60  LYS A N   1 
ATOM   241  C CA  . LYS A 1 60  ? 51.191 33.403 58.884  1.00 61.08  ? 60  LYS A CA  1 
ATOM   242  C C   . LYS A 1 60  ? 49.749 33.499 59.376  1.00 61.08  ? 60  LYS A C   1 
ATOM   243  O O   . LYS A 1 60  ? 48.818 33.584 58.569  1.00 61.08  ? 60  LYS A O   1 
ATOM   244  C CB  . LYS A 1 60  ? 51.616 34.739 58.249  1.00 57.34  ? 60  LYS A CB  1 
ATOM   245  C CG  . LYS A 1 60  ? 51.353 34.847 56.759  1.00 57.34  ? 60  LYS A CG  1 
ATOM   246  C CD  . LYS A 1 60  ? 51.449 36.292 56.249  1.00 57.34  ? 60  LYS A CD  1 
ATOM   247  C CE  . LYS A 1 60  ? 52.858 36.868 56.356  1.00 57.34  ? 60  LYS A CE  1 
ATOM   248  N NZ  . LYS A 1 60  ? 53.897 36.075 55.626  1.00 57.34  ? 60  LYS A NZ  1 
ATOM   249  N N   . VAL A 1 61  ? 49.588 33.492 60.701  1.00 65.10  ? 61  VAL A N   1 
ATOM   250  C CA  . VAL A 1 61  ? 48.289 33.536 61.377  1.00 65.10  ? 61  VAL A CA  1 
ATOM   251  C C   . VAL A 1 61  ? 47.505 34.808 61.113  1.00 65.10  ? 61  VAL A C   1 
ATOM   252  O O   . VAL A 1 61  ? 47.152 35.526 62.047  1.00 65.10  ? 61  VAL A O   1 
ATOM   253  C CB  . VAL A 1 61  ? 48.455 33.391 62.919  1.00 40.01  ? 61  VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 61  ? 47.101 33.164 63.578  0.00 40.01  ? 61  VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 61  ? 49.407 32.249 63.238  0.00 40.01  ? 61  VAL A CG2 1 
ATOM   256  N N   . ILE A 1 62  ? 47.207 35.073 59.846  1.00 100.00 ? 62  ILE A N   1 
ATOM   257  C CA  . ILE A 1 62  ? 46.467 36.277 59.455  1.00 100.00 ? 62  ILE A CA  1 
ATOM   258  C C   . ILE A 1 62  ? 45.156 36.519 60.196  1.00 100.00 ? 62  ILE A C   1 
ATOM   259  O O   . ILE A 1 62  ? 44.836 37.668 60.531  1.00 100.00 ? 62  ILE A O   1 
ATOM   260  C CB  . ILE A 1 62  ? 46.099 36.274 57.956  1.00 50.02  ? 62  ILE A CB  1 
ATOM   261  C CG1 . ILE A 1 62  ? 45.123 35.123 57.678  1.00 50.02  ? 62  ILE A CG1 1 
ATOM   262  C CG2 . ILE A 1 62  ? 47.362 36.214 57.105  1.00 50.02  ? 62  ILE A CG2 1 
ATOM   263  C CD1 . ILE A 1 62  ? 44.528 35.137 56.283  1.00 50.02  ? 62  ILE A CD1 1 
ATOM   264  N N   . GLY A 1 63  ? 44.386 35.457 60.427  1.00 44.28  ? 63  GLY A N   1 
ATOM   265  C CA  . GLY A 1 63  ? 43.111 35.635 61.087  1.00 44.28  ? 63  GLY A CA  1 
ATOM   266  C C   . GLY A 1 63  ? 42.932 34.729 62.272  1.00 44.28  ? 63  GLY A C   1 
ATOM   267  O O   . GLY A 1 63  ? 43.567 33.674 62.384  1.00 44.28  ? 63  GLY A O   1 
ATOM   268  N N   . ASN A 1 64  ? 42.052 35.156 63.163  1.00 62.35  ? 64  ASN A N   1 
ATOM   269  C CA  . ASN A 1 64  ? 41.742 34.426 64.384  1.00 62.35  ? 64  ASN A CA  1 
ATOM   270  C C   . ASN A 1 64  ? 40.240 34.409 64.673  1.00 62.35  ? 64  ASN A C   1 
ATOM   271  O O   . ASN A 1 64  ? 39.780 34.764 65.750  1.00 62.35  ? 64  ASN A O   1 
ATOM   272  C CB  . ASN A 1 64  ? 42.484 35.099 65.540  1.00 83.43  ? 64  ASN A CB  1 
ATOM   273  C CG  . ASN A 1 64  ? 42.465 34.196 66.747  1.00 83.43  ? 64  ASN A CG  1 
ATOM   274  O OD1 . ASN A 1 64  ? 41.449 34.028 67.415  1.00 83.43  ? 64  ASN A OD1 1 
ATOM   275  N ND2 . ASN A 1 64  ? 43.645 33.630 67.054  0.00 83.43  ? 64  ASN A ND2 1 
ATOM   276  N N   . GLY A 1 65  ? 39.455 34.023 63.653  1.00 85.88  ? 65  GLY A N   1 
ATOM   277  C CA  . GLY A 1 65  ? 38.018 33.917 63.883  1.00 85.88  ? 65  GLY A CA  1 
ATOM   278  C C   . GLY A 1 65  ? 37.748 33.418 65.305  1.00 85.88  ? 65  GLY A C   1 
ATOM   279  O O   . GLY A 1 65  ? 38.578 33.522 66.198  1.00 85.88  ? 65  GLY A O   1 
ATOM   280  N N   . SER A 1 66  ? 36.527 32.884 65.514  1.00 83.87  ? 66  SER A N   1 
ATOM   281  C CA  . SER A 1 66  ? 36.196 32.388 66.845  1.00 83.87  ? 66  SER A CA  1 
ATOM   282  C C   . SER A 1 66  ? 36.304 30.866 66.942  1.00 83.87  ? 66  SER A C   1 
ATOM   283  O O   . SER A 1 66  ? 36.889 30.311 67.865  1.00 83.87  ? 66  SER A O   1 
ATOM   284  C CB  . SER A 1 66  ? 34.781 32.841 67.208  1.00 65.14  ? 66  SER A CB  1 
ATOM   285  O OG  . SER A 1 66  ? 34.043 33.090 66.010  1.00 65.14  ? 66  SER A OG  1 
ATOM   286  N N   . PHE A 1 67  ? 35.683 30.179 65.963  1.00 87.07  ? 67  PHE A N   1 
ATOM   287  C CA  . PHE A 1 67  ? 35.646 28.718 66.018  1.00 87.07  ? 67  PHE A CA  1 
ATOM   288  C C   . PHE A 1 67  ? 37.039 28.094 65.947  1.00 87.07  ? 67  PHE A C   1 
ATOM   289  O O   . PHE A 1 67  ? 37.275 26.976 66.391  1.00 87.07  ? 67  PHE A O   1 
ATOM   290  C CB  . PHE A 1 67  ? 34.791 28.204 64.858  1.00 77.20  ? 67  PHE A CB  1 
ATOM   291  C CG  . PHE A 1 67  ? 33.373 28.655 65.042  1.00 77.20  ? 67  PHE A CG  1 
ATOM   292  C CD1 . PHE A 1 67  ? 33.037 29.966 64.738  1.00 77.20  ? 67  PHE A CD1 1 
ATOM   293  C CD2 . PHE A 1 67  ? 32.443 27.805 65.618  1.00 77.20  ? 67  PHE A CD2 1 
ATOM   294  C CE1 . PHE A 1 67  ? 31.760 30.431 65.016  0.00 77.20  ? 67  PHE A CE1 1 
ATOM   295  C CE2 . PHE A 1 67  ? 31.162 28.282 65.897  1.00 77.20  ? 67  PHE A CE2 1 
ATOM   296  C CZ  . PHE A 1 67  ? 30.817 29.594 65.597  1.00 77.20  ? 67  PHE A CZ  1 
ATOM   297  N N   . GLY A 1 68  ? 37.973 28.836 65.331  1.00 62.91  ? 68  GLY A N   1 
ATOM   298  C CA  . GLY A 1 68  ? 39.311 28.276 65.181  1.00 62.91  ? 68  GLY A CA  1 
ATOM   299  C C   . GLY A 1 68  ? 40.320 29.337 64.736  1.00 62.91  ? 68  GLY A C   1 
ATOM   300  O O   . GLY A 1 68  ? 40.232 30.510 65.075  1.00 62.91  ? 68  GLY A O   1 
ATOM   301  N N   . VAL A 1 69  ? 41.335 28.875 63.983  1.00 53.87  ? 69  VAL A N   1 
ATOM   302  C CA  . VAL A 1 69  ? 42.347 29.803 63.495  1.00 53.87  ? 69  VAL A CA  1 
ATOM   303  C C   . VAL A 1 69  ? 42.351 29.872 61.967  1.00 53.87  ? 69  VAL A C   1 
ATOM   304  O O   . VAL A 1 69  ? 42.098 28.900 61.268  1.00 53.87  ? 69  VAL A O   1 
ATOM   305  C CB  . VAL A 1 69  ? 43.710 29.329 63.999  1.00 67.84  ? 69  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 69  ? 44.227 30.280 65.077  0.00 67.84  ? 69  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 69  ? 43.591 27.932 64.578  1.00 67.84  ? 69  VAL A CG2 1 
ATOM   308  N N   . VAL A 1 70  ? 42.610 31.089 61.456  1.00 54.39  ? 70  VAL A N   1 
ATOM   309  C CA  . VAL A 1 70  ? 42.671 31.266 60.011  1.00 54.39  ? 70  VAL A CA  1 
ATOM   310  C C   . VAL A 1 70  ? 44.100 31.567 59.551  1.00 54.39  ? 70  VAL A C   1 
ATOM   311  O O   . VAL A 1 70  ? 44.699 32.576 59.899  1.00 54.39  ? 70  VAL A O   1 
ATOM   312  C CB  . VAL A 1 70  ? 41.745 32.424 59.634  1.00 28.35  ? 70  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 70  ? 41.969 32.815 58.174  1.00 28.35  ? 70  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 70  ? 40.297 32.015 59.826  0.00 28.35  ? 70  VAL A CG2 1 
ATOM   315  N N   . TYR A 1 71  ? 44.661 30.622 58.773  1.00 54.24  ? 71  TYR A N   1 
ATOM   316  C CA  . TYR A 1 71  ? 46.038 30.785 58.321  1.00 54.24  ? 71  TYR A CA  1 
ATOM   317  C C   . TYR A 1 71  ? 46.112 31.192 56.847  1.00 54.24  ? 71  TYR A C   1 
ATOM   318  O O   . TYR A 1 71  ? 45.257 30.869 56.033  1.00 54.24  ? 71  TYR A O   1 
ATOM   319  C CB  . TYR A 1 71  ? 46.765 29.456 58.521  1.00 56.39  ? 71  TYR A CB  1 
ATOM   320  C CG  . TYR A 1 71  ? 46.872 29.146 59.971  1.00 56.39  ? 71  TYR A CG  1 
ATOM   321  C CD1 . TYR A 1 71  ? 45.925 28.324 60.574  1.00 56.39  ? 71  TYR A CD1 1 
ATOM   322  C CD2 . TYR A 1 71  ? 47.969 29.593 60.709  1.00 56.39  ? 71  TYR A CD2 1 
ATOM   323  C CE1 . TYR A 1 71  ? 46.079 27.938 61.897  1.00 56.39  ? 71  TYR A CE1 1 
ATOM   324  C CE2 . TYR A 1 71  ? 48.123 29.207 62.033  1.00 56.39  ? 71  TYR A CE2 1 
ATOM   325  C CZ  . TYR A 1 71  ? 47.187 28.379 62.624  1.00 56.39  ? 71  TYR A CZ  1 
ATOM   326  O OH  . TYR A 1 71  ? 47.363 27.944 63.923  1.00 56.39  ? 71  TYR A OH  1 
ATOM   327  N N   . GLN A 1 72  ? 47.169 31.961 56.523  1.00 40.81  ? 72  GLN A N   1 
ATOM   328  C CA  . GLN A 1 72  ? 47.368 32.365 55.136  1.00 40.81  ? 72  GLN A CA  1 
ATOM   329  C C   . GLN A 1 72  ? 48.642 31.748 54.552  1.00 40.81  ? 72  GLN A C   1 
ATOM   330  O O   . GLN A 1 72  ? 49.706 31.764 55.158  1.00 40.81  ? 72  GLN A O   1 
ATOM   331  C CB  . GLN A 1 72  ? 47.460 33.891 55.091  1.00 71.49  ? 72  GLN A CB  1 
ATOM   332  C CG  . GLN A 1 72  ? 47.226 34.453 53.687  0.00 71.49  ? 72  GLN A CG  1 
ATOM   333  C CD  . GLN A 1 72  ? 48.554 34.639 52.992  1.00 71.49  ? 72  GLN A CD  1 
ATOM   334  O OE1 . GLN A 1 72  ? 49.409 33.770 52.951  1.00 71.49  ? 72  GLN A OE1 1 
ATOM   335  N NE2 . GLN A 1 72  ? 48.699 35.846 52.409  1.00 71.49  ? 72  GLN A NE2 1 
ATOM   336  N N   . ALA A 1 73  ? 48.711 31.077 53.405  1.00 48.24  ? 73  ALA A N   1 
ATOM   337  C CA  . ALA A 1 73  ? 49.960 30.453 52.989  1.00 48.24  ? 73  ALA A CA  1 
ATOM   338  C C   . ALA A 1 73  ? 50.239 30.505 51.493  1.00 48.24  ? 73  ALA A C   1 
ATOM   339  O O   . ALA A 1 73  ? 49.409 30.945 50.688  1.00 48.24  ? 73  ALA A O   1 
ATOM   340  C CB  . ALA A 1 73  ? 50.006 29.006 53.472  1.00 31.25  ? 73  ALA A CB  1 
ATOM   341  N N   . LYS A 1 74  ? 51.428 30.034 51.131  1.00 51.92  ? 74  LYS A N   1 
ATOM   342  C CA  . LYS A 1 74  ? 51.883 30.029 49.751  1.00 51.92  ? 74  LYS A CA  1 
ATOM   343  C C   . LYS A 1 74  ? 52.137 28.589 49.294  1.00 51.92  ? 74  LYS A C   1 
ATOM   344  O O   . LYS A 1 74  ? 52.856 27.839 49.962  1.00 51.92  ? 74  LYS A O   1 
ATOM   345  C CB  . LYS A 1 74  ? 53.175 30.858 49.653  1.00 49.31  ? 74  LYS A CB  1 
ATOM   346  C CG  . LYS A 1 74  ? 53.682 31.081 48.233  1.00 49.31  ? 74  LYS A CG  1 
ATOM   347  C CD  . LYS A 1 74  ? 54.790 32.136 48.168  1.00 49.31  ? 74  LYS A CD  1 
ATOM   348  C CE  . LYS A 1 74  ? 55.300 32.298 46.743  0.00 49.31  ? 74  LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 74  ? 55.857 31.026 46.202  0.00 49.31  ? 74  LYS A NZ  1 
ATOM   350  N N   . LEU A 1 75  ? 51.535 28.198 48.172  1.00 52.53  ? 75  LEU A N   1 
ATOM   351  C CA  . LEU A 1 75  ? 51.732 26.851 47.649  1.00 52.53  ? 75  LEU A CA  1 
ATOM   352  C C   . LEU A 1 75  ? 53.084 26.845 46.934  1.00 52.53  ? 75  LEU A C   1 
ATOM   353  O O   . LEU A 1 75  ? 53.322 27.649 46.022  1.00 52.53  ? 75  LEU A O   1 
ATOM   354  C CB  . LEU A 1 75  ? 50.612 26.480 46.674  1.00 33.25  ? 75  LEU A CB  1 
ATOM   355  C CG  . LEU A 1 75  ? 49.186 26.317 47.227  1.00 33.25  ? 75  LEU A CG  1 
ATOM   356  C CD1 . LEU A 1 75  ? 48.275 25.795 46.118  1.00 33.25  ? 75  LEU A CD1 1 
ATOM   357  C CD2 . LEU A 1 75  ? 49.175 25.362 48.406  1.00 33.25  ? 75  LEU A CD2 1 
ATOM   358  N N   . CYS A 1 76  ? 53.967 25.945 47.362  1.00 54.76  ? 76  CYS A N   1 
ATOM   359  C CA  . CYS A 1 76  ? 55.308 25.843 46.799  1.00 54.76  ? 76  CYS A CA  1 
ATOM   360  C C   . CYS A 1 76  ? 55.424 25.778 45.289  1.00 54.76  ? 76  CYS A C   1 
ATOM   361  O O   . CYS A 1 76  ? 56.356 26.346 44.712  1.00 54.76  ? 76  CYS A O   1 
ATOM   362  C CB  . CYS A 1 76  ? 56.016 24.635 47.368  1.00 54.02  ? 76  CYS A CB  1 
ATOM   363  S SG  . CYS A 1 76  ? 56.149 24.736 49.116  1.00 54.02  ? 76  CYS A SG  1 
ATOM   364  N N   . ASP A 1 77  ? 54.500 25.081 44.641  1.00 52.22  ? 77  ASP A N   1 
ATOM   365  C CA  . ASP A 1 77  ? 54.577 24.951 43.200  1.00 52.22  ? 77  ASP A CA  1 
ATOM   366  C C   . ASP A 1 77  ? 53.997 26.139 42.424  1.00 52.22  ? 77  ASP A C   1 
ATOM   367  O O   . ASP A 1 77  ? 54.756 26.939 41.860  1.00 52.22  ? 77  ASP A O   1 
ATOM   368  C CB  . ASP A 1 77  ? 53.931 23.627 42.797  1.00 81.37  ? 77  ASP A CB  1 
ATOM   369  C CG  . ASP A 1 77  ? 54.744 22.412 43.293  1.00 81.37  ? 77  ASP A CG  1 
ATOM   370  O OD1 . ASP A 1 77  ? 55.813 22.630 43.931  1.00 81.37  ? 77  ASP A OD1 1 
ATOM   371  O OD2 . ASP A 1 77  ? 54.323 21.245 43.045  1.00 81.37  ? 77  ASP A OD2 1 
ATOM   372  N N   . SER A 1 78  ? 52.669 26.263 42.397  1.00 65.45  ? 78  SER A N   1 
ATOM   373  C CA  . SER A 1 78  ? 52.013 27.373 41.693  1.00 65.45  ? 78  SER A CA  1 
ATOM   374  C C   . SER A 1 78  ? 52.378 28.736 42.305  1.00 65.45  ? 78  SER A C   1 
ATOM   375  O O   . SER A 1 78  ? 52.338 29.770 41.633  1.00 65.45  ? 78  SER A O   1 
ATOM   376  C CB  . SER A 1 78  ? 50.491 27.216 41.759  1.00 60.65  ? 78  SER A CB  1 
ATOM   377  O OG  . SER A 1 78  ? 50.021 27.564 43.056  1.00 60.65  ? 78  SER A OG  1 
ATOM   378  N N   . GLY A 1 79  ? 52.726 28.738 43.586  1.00 63.24  ? 79  GLY A N   1 
ATOM   379  C CA  . GLY A 1 79  ? 53.054 29.993 44.237  1.00 63.24  ? 79  GLY A CA  1 
ATOM   380  C C   . GLY A 1 79  ? 51.776 30.710 44.655  1.00 63.24  ? 79  GLY A C   1 
ATOM   381  O O   . GLY A 1 79  ? 51.825 31.794 45.250  1.00 63.24  ? 79  GLY A O   1 
ATOM   382  N N   . GLU A 1 80  ? 50.624 30.107 44.350  1.00 59.92  ? 80  GLU A N   1 
ATOM   383  C CA  . GLU A 1 80  ? 49.333 30.703 44.706  1.00 59.92  ? 80  GLU A CA  1 
ATOM   384  C C   . GLU A 1 80  ? 49.184 30.881 46.208  1.00 59.92  ? 80  GLU A C   1 
ATOM   385  O O   . GLU A 1 80  ? 49.721 30.101 46.995  1.00 59.92  ? 80  GLU A O   1 
ATOM   386  C CB  . GLU A 1 80  ? 48.188 29.833 44.200  1.00 74.64  ? 80  GLU A CB  1 
ATOM   387  C CG  . GLU A 1 80  ? 48.007 29.855 42.703  1.00 74.64  ? 80  GLU A CG  1 
ATOM   388  C CD  . GLU A 1 80  ? 47.013 28.820 42.260  1.00 74.64  ? 80  GLU A CD  1 
ATOM   389  O OE1 . GLU A 1 80  ? 47.311 27.607 42.398  1.00 74.64  ? 80  GLU A OE1 1 
ATOM   390  O OE2 . GLU A 1 80  ? 45.923 29.220 41.789  1.00 74.64  ? 80  GLU A OE2 1 
ATOM   391  N N   . LEU A 1 81  ? 48.456 31.913 46.609  1.00 43.62  ? 81  LEU A N   1 
ATOM   392  C CA  . LEU A 1 81  ? 48.247 32.168 48.023  1.00 43.62  ? 81  LEU A CA  1 
ATOM   393  C C   . LEU A 1 81  ? 46.940 31.545 48.458  1.00 43.62  ? 81  LEU A C   1 
ATOM   394  O O   . LEU A 1 81  ? 45.888 31.822 47.893  1.00 43.62  ? 81  LEU A O   1 
ATOM   395  C CB  . LEU A 1 81  ? 48.234 33.673 48.291  1.00 60.15  ? 81  LEU A CB  1 
ATOM   396  C CG  . LEU A 1 81  ? 49.631 34.295 48.325  1.00 60.15  ? 81  LEU A CG  1 
ATOM   397  C CD1 . LEU A 1 81  ? 49.555 35.818 48.466  1.00 60.15  ? 81  LEU A CD1 1 
ATOM   398  C CD2 . LEU A 1 81  ? 50.388 33.674 49.507  1.00 60.15  ? 81  LEU A CD2 1 
ATOM   399  N N   . VAL A 1 82  ? 47.007 30.685 49.456  1.00 32.15  ? 82  VAL A N   1 
ATOM   400  C CA  . VAL A 1 82  ? 45.812 30.031 49.940  1.00 32.15  ? 82  VAL A CA  1 
ATOM   401  C C   . VAL A 1 82  ? 45.549 30.482 51.355  1.00 32.15  ? 82  VAL A C   1 
ATOM   402  O O   . VAL A 1 82  ? 46.362 31.183 51.948  1.00 32.15  ? 82  VAL A O   1 
ATOM   403  C CB  . VAL A 1 82  ? 45.966 28.489 49.920  1.00 25.28  ? 82  VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 82  ? 45.867 27.974 48.489  1.00 25.28  ? 82  VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 82  ? 47.303 28.094 50.533  1.00 25.28  ? 82  VAL A CG2 1 
ATOM   406  N N   . ALA A 1 83  ? 44.401 30.080 51.881  1.00 36.55  ? 83  ALA A N   1 
ATOM   407  C CA  . ALA A 1 83  ? 44.011 30.413 53.238  1.00 36.55  ? 83  ALA A CA  1 
ATOM   408  C C   . ALA A 1 83  ? 43.668 29.103 53.904  1.00 36.55  ? 83  ALA A C   1 
ATOM   409  O O   . ALA A 1 83  ? 43.085 28.211 53.284  1.00 36.55  ? 83  ALA A O   1 
ATOM   410  C CB  . ALA A 1 83  ? 42.798 31.320 53.228  1.00 40.81  ? 83  ALA A CB  1 
ATOM   411  N N   . ILE A 1 84  ? 44.019 28.973 55.170  1.00 42.30  ? 84  ILE A N   1 
ATOM   412  C CA  . ILE A 1 84  ? 43.734 27.736 55.858  1.00 42.30  ? 84  ILE A CA  1 
ATOM   413  C C   . ILE A 1 84  ? 42.967 28.008 57.132  1.00 42.30  ? 84  ILE A C   1 
ATOM   414  O O   . ILE A 1 84  ? 43.491 28.607 58.073  1.00 42.30  ? 84  ILE A O   1 
ATOM   415  C CB  . ILE A 1 84  ? 45.046 26.990 56.166  1.00 28.52  ? 84  ILE A CB  1 
ATOM   416  C CG1 . ILE A 1 84  ? 45.822 26.789 54.853  1.00 28.52  ? 84  ILE A CG1 1 
ATOM   417  C CG2 . ILE A 1 84  ? 44.747 25.665 56.860  1.00 28.52  ? 84  ILE A CG2 1 
ATOM   418  C CD1 . ILE A 1 84  ? 47.146 26.082 54.999  1.00 28.52  ? 84  ILE A CD1 1 
ATOM   419  N N   . LYS A 1 85  ? 41.713 27.589 57.158  1.00 34.53  ? 85  LYS A N   1 
ATOM   420  C CA  . LYS A 1 85  ? 40.910 27.801 58.343  1.00 34.53  ? 85  LYS A CA  1 
ATOM   421  C C   . LYS A 1 85  ? 40.972 26.534 59.182  1.00 34.53  ? 85  LYS A C   1 
ATOM   422  O O   . LYS A 1 85  ? 40.342 25.530 58.844  1.00 34.53  ? 85  LYS A O   1 
ATOM   423  C CB  . LYS A 1 85  ? 39.446 28.097 57.974  1.00 53.69  ? 85  LYS A CB  1 
ATOM   424  C CG  . LYS A 1 85  ? 38.555 28.240 59.205  1.00 53.69  ? 85  LYS A CG  1 
ATOM   425  C CD  . LYS A 1 85  ? 37.058 28.157 58.908  1.00 53.69  ? 85  LYS A CD  1 
ATOM   426  C CE  . LYS A 1 85  ? 36.519 29.379 58.154  1.00 53.69  ? 85  LYS A CE  1 
ATOM   427  N NZ  . LYS A 1 85  ? 35.021 29.335 58.021  1.00 53.69  ? 85  LYS A NZ  1 
ATOM   428  N N   . LYS A 1 86  ? 41.742 26.564 60.264  1.00 44.17  ? 86  LYS A N   1 
ATOM   429  C CA  . LYS A 1 86  ? 41.822 25.391 61.122  1.00 44.17  ? 86  LYS A CA  1 
ATOM   430  C C   . LYS A 1 86  ? 40.811 25.537 62.239  1.00 44.17  ? 86  LYS A C   1 
ATOM   431  O O   . LYS A 1 86  ? 40.958 26.415 63.091  1.00 44.17  ? 86  LYS A O   1 
ATOM   432  C CB  . LYS A 1 86  ? 43.221 25.236 61.722  1.00 43.95  ? 86  LYS A CB  1 
ATOM   433  C CG  . LYS A 1 86  ? 43.349 24.035 62.648  0.00 43.95  ? 86  LYS A CG  1 
ATOM   434  C CD  . LYS A 1 86  ? 44.716 23.374 62.544  0.00 43.95  ? 86  LYS A CD  1 
ATOM   435  C CE  . LYS A 1 86  ? 45.843 24.296 62.978  0.00 43.95  ? 86  LYS A CE  1 
ATOM   436  N NZ  . LYS A 1 86  ? 47.169 23.621 62.840  1.00 43.95  ? 86  LYS A NZ  1 
ATOM   437  N N   . VAL A 1 87  ? 39.776 24.698 62.225  1.00 48.58  ? 87  VAL A N   1 
ATOM   438  C CA  . VAL A 1 87  ? 38.755 24.735 63.269  1.00 48.58  ? 87  VAL A CA  1 
ATOM   439  C C   . VAL A 1 87  ? 38.853 23.404 64.014  1.00 48.58  ? 87  VAL A C   1 
ATOM   440  O O   . VAL A 1 87  ? 39.323 22.408 63.450  1.00 48.58  ? 87  VAL A O   1 
ATOM   441  C CB  . VAL A 1 87  ? 37.335 24.893 62.689  1.00 34.61  ? 87  VAL A CB  1 
ATOM   442  C CG1 . VAL A 1 87  ? 36.881 23.588 62.077  1.00 34.61  ? 87  VAL A CG1 1 
ATOM   443  C CG2 . VAL A 1 87  ? 36.374 25.331 63.781  0.00 34.61  ? 87  VAL A CG2 1 
ATOM   444  N N   . LEU A 1 88  ? 38.406 23.392 65.272  1.00 79.34  ? 88  LEU A N   1 
ATOM   445  C CA  . LEU A 1 88  ? 38.484 22.196 66.119  1.00 79.34  ? 88  LEU A CA  1 
ATOM   446  C C   . LEU A 1 88  ? 37.542 21.069 65.692  1.00 79.34  ? 88  LEU A C   1 
ATOM   447  O O   . LEU A 1 88  ? 36.480 20.871 66.284  1.00 79.34  ? 88  LEU A O   1 
ATOM   448  C CB  . LEU A 1 88  ? 38.216 22.578 67.582  1.00 59.72  ? 88  LEU A CB  1 
ATOM   449  C CG  . LEU A 1 88  ? 38.780 21.662 68.674  1.00 59.72  ? 88  LEU A CG  1 
ATOM   450  C CD1 . LEU A 1 88  ? 38.094 20.304 68.667  0.00 59.72  ? 88  LEU A CD1 1 
ATOM   451  C CD2 . LEU A 1 88  ? 40.285 21.517 68.446  1.00 59.72  ? 88  LEU A CD2 1 
ATOM   452  N N   . GLN A 1 89  ? 37.944 20.323 64.666  1.00 72.41  ? 89  GLN A N   1 
ATOM   453  C CA  . GLN A 1 89  ? 37.137 19.216 64.169  1.00 72.41  ? 89  GLN A CA  1 
ATOM   454  C C   . GLN A 1 89  ? 36.832 18.254 65.306  1.00 72.41  ? 89  GLN A C   1 
ATOM   455  O O   . GLN A 1 89  ? 37.666 18.033 66.194  1.00 72.41  ? 89  GLN A O   1 
ATOM   456  C CB  . GLN A 1 89  ? 37.873 18.485 63.063  0.00 35.69  ? 89  GLN A CB  1 
ATOM   457  N N   . ASP A 1 90  ? 35.630 17.687 65.269  1.00 90.18  ? 90  ASP A N   1 
ATOM   458  C CA  . ASP A 1 90  ? 35.181 16.732 66.281  1.00 90.18  ? 90  ASP A CA  1 
ATOM   459  C C   . ASP A 1 90  ? 34.732 15.443 65.593  1.00 90.18  ? 90  ASP A C   1 
ATOM   460  O O   . ASP A 1 90  ? 34.280 15.470 64.449  0.00 90.18  ? 90  ASP A O   1 
ATOM   461  C CB  . ASP A 1 90  ? 34.010 17.330 67.078  1.00 57.39  ? 90  ASP A CB  1 
ATOM   462  N N   . LYS A 1 91  ? 34.859 14.317 66.290  1.00 91.89  ? 91  LYS A N   1 
ATOM   463  C CA  . LYS A 1 91  ? 34.419 13.040 65.721  1.00 91.89  ? 91  LYS A CA  1 
ATOM   464  C C   . LYS A 1 91  ? 32.926 12.808 66.058  1.00 91.89  ? 91  LYS A C   1 
ATOM   465  O O   . LYS A 1 91  ? 32.292 11.894 65.514  1.00 91.89  ? 91  LYS A O   1 
ATOM   466  C CB  . LYS A 1 91  ? 35.271 11.894 66.270  1.00 68.26  ? 91  LYS A CB  1 
ATOM   467  N N   . ARG A 1 92  ? 32.374 13.646 66.940  1.00 72.03  ? 92  ARG A N   1 
ATOM   468  C CA  . ARG A 1 92  ? 30.972 13.530 67.347  1.00 72.03  ? 92  ARG A CA  1 
ATOM   469  C C   . ARG A 1 92  ? 29.995 13.660 66.172  1.00 72.03  ? 92  ARG A C   1 
ATOM   470  O O   . ARG A 1 92  ? 28.799 13.360 66.325  1.00 72.03  ? 92  ARG A O   1 
ATOM   471  C CB  . ARG A 1 92  ? 30.642 14.592 68.420  1.00 56.05  ? 92  ARG A CB  1 
ATOM   472  N N   . PHE A 1 93  ? 30.490 14.116 65.013  1.00 67.00  ? 93  PHE A N   1 
ATOM   473  C CA  . PHE A 1 93  ? 29.636 14.277 63.817  1.00 67.00  ? 93  PHE A CA  1 
ATOM   474  C C   . PHE A 1 93  ? 30.360 14.863 62.589  1.00 67.00  ? 93  PHE A C   1 
ATOM   475  O O   . PHE A 1 93  ? 31.562 15.149 62.627  1.00 67.00  ? 93  PHE A O   1 
ATOM   476  C CB  . PHE A 1 93  ? 28.420 15.141 64.157  0.00 35.69  ? 93  PHE A CB  1 
ATOM   477  N N   . LYS A 1 94  ? 29.624 15.031 61.494  1.00 51.48  ? 94  LYS A N   1 
ATOM   478  C CA  . LYS A 1 94  ? 30.203 15.594 60.273  1.00 51.48  ? 94  LYS A CA  1 
ATOM   479  C C   . LYS A 1 94  ? 30.321 17.118 60.429  1.00 51.48  ? 94  LYS A C   1 
ATOM   480  O O   . LYS A 1 94  ? 29.620 17.738 61.250  1.00 51.48  ? 94  LYS A O   1 
ATOM   481  C CB  . LYS A 1 94  ? 29.331 15.253 59.071  0.00 35.69  ? 94  LYS A CB  1 
ATOM   482  N N   . ASN A 1 95  ? 31.218 17.717 59.655  1.00 34.95  ? 95  ASN A N   1 
ATOM   483  C CA  . ASN A 1 95  ? 31.401 19.160 59.717  1.00 34.95  ? 95  ASN A CA  1 
ATOM   484  C C   . ASN A 1 95  ? 30.562 19.796 58.608  1.00 34.95  ? 95  ASN A C   1 
ATOM   485  O O   . ASN A 1 95  ? 30.909 19.742 57.432  1.00 34.95  ? 95  ASN A O   1 
ATOM   486  C CB  . ASN A 1 95  ? 32.880 19.523 59.555  1.00 44.43  ? 95  ASN A CB  1 
ATOM   487  C CG  . ASN A 1 95  ? 33.152 20.968 59.890  1.00 44.43  ? 95  ASN A CG  1 
ATOM   488  O OD1 . ASN A 1 95  ? 32.707 21.867 59.176  1.00 44.43  ? 95  ASN A OD1 1 
ATOM   489  N ND2 . ASN A 1 95  ? 33.870 21.207 60.993  1.00 44.43  ? 95  ASN A ND2 1 
ATOM   490  N N   . ARG A 1 96  ? 29.438 20.379 59.008  1.00 34.56  ? 96  ARG A N   1 
ATOM   491  C CA  . ARG A 1 96  ? 28.504 21.016 58.090  1.00 34.56  ? 96  ARG A CA  1 
ATOM   492  C C   . ARG A 1 96  ? 29.121 21.976 57.078  1.00 34.56  ? 96  ARG A C   1 
ATOM   493  O O   . ARG A 1 96  ? 28.735 21.963 55.912  1.00 34.56  ? 96  ARG A O   1 
ATOM   494  C CB  . ARG A 1 96  ? 27.424 21.745 58.882  1.00 40.73  ? 96  ARG A CB  1 
ATOM   495  C CG  . ARG A 1 96  ? 26.445 22.485 58.012  1.00 40.73  ? 96  ARG A CG  1 
ATOM   496  C CD  . ARG A 1 96  ? 25.496 23.294 58.854  1.00 40.73  ? 96  ARG A CD  1 
ATOM   497  N NE  . ARG A 1 96  ? 24.681 22.440 59.702  1.00 40.73  ? 96  ARG A NE  1 
ATOM   498  C CZ  . ARG A 1 96  ? 23.859 22.893 60.641  1.00 40.73  ? 96  ARG A CZ  1 
ATOM   499  N NH1 . ARG A 1 96  ? 23.752 24.201 60.854  1.00 40.73  ? 96  ARG A NH1 1 
ATOM   500  N NH2 . ARG A 1 96  ? 23.135 22.039 61.355  1.00 40.73  ? 96  ARG A NH2 1 
ATOM   501  N N   . GLU A 1 97  ? 30.058 22.815 57.512  1.00 27.76  ? 97  GLU A N   1 
ATOM   502  C CA  . GLU A 1 97  ? 30.686 23.751 56.591  1.00 27.76  ? 97  GLU A CA  1 
ATOM   503  C C   . GLU A 1 97  ? 31.401 22.947 55.519  1.00 27.76  ? 97  GLU A C   1 
ATOM   504  O O   . GLU A 1 97  ? 31.151 23.130 54.330  1.00 27.76  ? 97  GLU A O   1 
ATOM   505  C CB  . GLU A 1 97  ? 31.666 24.684 57.324  1.00 34.86  ? 97  GLU A CB  1 
ATOM   506  C CG  . GLU A 1 97  ? 32.493 25.561 56.381  1.00 34.86  ? 97  GLU A CG  1 
ATOM   507  C CD  . GLU A 1 97  ? 33.175 26.742 57.065  1.00 34.86  ? 97  GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 97  ? 33.379 26.690 58.299  1.00 34.86  ? 97  GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 97  ? 33.524 27.719 56.353  1.00 34.86  ? 97  GLU A OE2 1 
ATOM   510  N N   . LEU A 1 98  ? 32.278 22.045 55.947  1.00 29.35  ? 98  LEU A N   1 
ATOM   511  C CA  . LEU A 1 98  ? 33.000 21.187 55.022  1.00 29.35  ? 98  LEU A CA  1 
ATOM   512  C C   . LEU A 1 98  ? 32.024 20.498 54.079  1.00 29.35  ? 98  LEU A C   1 
ATOM   513  O O   . LEU A 1 98  ? 32.208 20.488 52.867  1.00 29.35  ? 98  LEU A O   1 
ATOM   514  C CB  . LEU A 1 98  ? 33.768 20.113 55.779  1.00 27.06  ? 98  LEU A CB  1 
ATOM   515  C CG  . LEU A 1 98  ? 34.273 18.972 54.888  1.00 27.06  ? 98  LEU A CG  1 
ATOM   516  C CD1 . LEU A 1 98  ? 35.236 19.512 53.843  1.00 27.06  ? 98  LEU A CD1 1 
ATOM   517  C CD2 . LEU A 1 98  ? 34.950 17.927 55.743  1.00 27.06  ? 98  LEU A CD2 1 
ATOM   518  N N   . GLN A 1 99  ? 30.981 19.911 54.635  1.00 35.85  ? 99  GLN A N   1 
ATOM   519  C CA  . GLN A 1 99  ? 30.027 19.227 53.795  1.00 35.85  ? 99  GLN A CA  1 
ATOM   520  C C   . GLN A 1 99  ? 29.423 20.174 52.760  1.00 35.85  ? 99  GLN A C   1 
ATOM   521  O O   . GLN A 1 99  ? 29.413 19.870 51.560  1.00 35.85  ? 99  GLN A O   1 
ATOM   522  C CB  . GLN A 1 99  ? 28.935 18.554 54.649  1.00 48.31  ? 99  GLN A CB  1 
ATOM   523  C CG  . GLN A 1 99  ? 29.467 17.459 55.595  0.00 48.31  ? 99  GLN A CG  1 
ATOM   524  C CD  . GLN A 1 99  ? 30.595 16.603 54.997  1.00 48.31  ? 99  GLN A CD  1 
ATOM   525  O OE1 . GLN A 1 99  ? 30.452 16.003 53.926  1.00 48.31  ? 99  GLN A OE1 1 
ATOM   526  N NE2 . GLN A 1 99  ? 31.722 16.544 55.700  1.00 48.31  ? 99  GLN A NE2 1 
ATOM   527  N N   . ILE A 1 100 ? 28.945 21.331 53.210  1.00 37.51  ? 100 ILE A N   1 
ATOM   528  C CA  . ILE A 1 100 ? 28.337 22.289 52.293  1.00 37.51  ? 100 ILE A CA  1 
ATOM   529  C C   . ILE A 1 100 ? 29.301 22.772 51.214  1.00 37.51  ? 100 ILE A C   1 
ATOM   530  O O   . ILE A 1 100 ? 28.977 22.779 50.021  1.00 37.51  ? 100 ILE A O   1 
ATOM   531  C CB  . ILE A 1 100 ? 27.786 23.487 53.060  1.00 24.76  ? 100 ILE A CB  1 
ATOM   532  C CG1 . ILE A 1 100 ? 26.602 23.025 53.909  1.00 24.76  ? 100 ILE A CG1 1 
ATOM   533  C CG2 . ILE A 1 100 ? 27.384 24.602 52.094  1.00 24.76  ? 100 ILE A CG2 1 
ATOM   534  C CD1 . ILE A 1 100 ? 26.069 24.076 54.806  1.00 24.76  ? 100 ILE A CD1 1 
ATOM   535  N N   . MET A 1 101 ? 30.493 23.169 51.624  1.00 34.60  ? 101 MET A N   1 
ATOM   536  C CA  . MET A 1 101 ? 31.452 23.646 50.657  1.00 34.60  ? 101 MET A CA  1 
ATOM   537  C C   . MET A 1 101 ? 31.939 22.556 49.733  1.00 34.60  ? 101 MET A C   1 
ATOM   538  O O   . MET A 1 101 ? 32.421 22.831 48.637  1.00 34.60  ? 101 MET A O   1 
ATOM   539  C CB  . MET A 1 101 ? 32.623 24.289 51.372  1.00 44.27  ? 101 MET A CB  1 
ATOM   540  C CG  . MET A 1 101 ? 32.278 25.669 51.904  1.00 44.27  ? 101 MET A CG  1 
ATOM   541  S SD  . MET A 1 101 ? 33.586 26.784 51.454  1.00 44.27  ? 101 MET A SD  1 
ATOM   542  C CE  . MET A 1 101 ? 34.778 26.342 52.697  1.00 44.27  ? 101 MET A CE  1 
ATOM   543  N N   . ARG A 1 102 ? 31.806 21.315 50.176  1.00 44.54  ? 102 ARG A N   1 
ATOM   544  C CA  . ARG A 1 102 ? 32.248 20.181 49.384  1.00 44.54  ? 102 ARG A CA  1 
ATOM   545  C C   . ARG A 1 102 ? 31.359 20.058 48.137  1.00 44.54  ? 102 ARG A C   1 
ATOM   546  O O   . ARG A 1 102 ? 31.740 19.415 47.154  1.00 44.54  ? 102 ARG A O   1 
ATOM   547  C CB  . ARG A 1 102 ? 32.164 18.911 50.236  1.00 47.18  ? 102 ARG A CB  1 
ATOM   548  C CG  . ARG A 1 102 ? 32.971 17.725 49.747  1.00 47.18  ? 102 ARG A CG  1 
ATOM   549  C CD  . ARG A 1 102 ? 34.103 17.414 50.708  1.00 47.18  ? 102 ARG A CD  1 
ATOM   550  N NE  . ARG A 1 102 ? 34.693 16.092 50.479  1.00 47.18  ? 102 ARG A NE  1 
ATOM   551  C CZ  . ARG A 1 102 ? 34.083 14.933 50.737  1.00 47.18  ? 102 ARG A CZ  1 
ATOM   552  N NH1 . ARG A 1 102 ? 32.850 14.915 51.241  1.00 47.18  ? 102 ARG A NH1 1 
ATOM   553  N NH2 . ARG A 1 102 ? 34.706 13.789 50.488  0.00 47.18  ? 102 ARG A NH2 1 
ATOM   554  N N   . LYS A 1 103 ? 30.187 20.687 48.164  1.00 25.86  ? 103 LYS A N   1 
ATOM   555  C CA  . LYS A 1 103 ? 29.288 20.597 47.025  1.00 25.86  ? 103 LYS A CA  1 
ATOM   556  C C   . LYS A 1 103 ? 29.047 21.891 46.269  1.00 25.86  ? 103 LYS A C   1 
ATOM   557  O O   . LYS A 1 103 ? 28.101 21.999 45.504  1.00 25.86  ? 103 LYS A O   1 
ATOM   558  C CB  . LYS A 1 103 ? 27.935 19.999 47.447  1.00 42.64  ? 103 LYS A CB  1 
ATOM   559  C CG  . LYS A 1 103 ? 27.255 20.630 48.647  1.00 42.64  ? 103 LYS A CG  1 
ATOM   560  C CD  . LYS A 1 103 ? 25.724 20.455 48.594  1.00 42.64  ? 103 LYS A CD  1 
ATOM   561  C CE  . LYS A 1 103 ? 25.233 19.015 48.773  1.00 42.64  ? 103 LYS A CE  1 
ATOM   562  N NZ  . LYS A 1 103 ? 25.461 18.448 50.150  1.00 42.64  ? 103 LYS A NZ  1 
ATOM   563  N N   . LEU A 1 104 ? 29.911 22.872 46.455  1.00 37.96  ? 104 LEU A N   1 
ATOM   564  C CA  . LEU A 1 104 ? 29.724 24.136 45.765  1.00 37.96  ? 104 LEU A CA  1 
ATOM   565  C C   . LEU A 1 104 ? 30.795 24.393 44.722  1.00 37.96  ? 104 LEU A C   1 
ATOM   566  O O   . LEU A 1 104 ? 31.987 24.275 44.990  1.00 37.96  ? 104 LEU A O   1 
ATOM   567  C CB  . LEU A 1 104 ? 29.688 25.284 46.775  1.00 37.19  ? 104 LEU A CB  1 
ATOM   568  C CG  . LEU A 1 104 ? 28.326 25.673 47.370  1.00 37.19  ? 104 LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 104 ? 27.526 24.451 47.771  1.00 37.19  ? 104 LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 104 ? 28.566 26.583 48.565  1.00 37.19  ? 104 LEU A CD2 1 
ATOM   571  N N   . ASP A 1 105 ? 30.354 24.713 43.513  1.00 35.85  ? 105 ASP A N   1 
ATOM   572  C CA  . ASP A 1 105 ? 31.274 25.017 42.434  1.00 35.85  ? 105 ASP A CA  1 
ATOM   573  C C   . ASP A 1 105 ? 30.652 26.168 41.667  1.00 35.85  ? 105 ASP A C   1 
ATOM   574  O O   . ASP A 1 105 ? 29.788 25.960 40.810  1.00 35.85  ? 105 ASP A O   1 
ATOM   575  C CB  . ASP A 1 105 ? 31.470 23.811 41.521  0.00 46.91  ? 105 ASP A CB  1 
ATOM   576  C CG  . ASP A 1 105 ? 32.491 24.073 40.443  1.00 46.91  ? 105 ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 105 ? 33.552 24.660 40.761  1.00 46.91  ? 105 ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 105 ? 32.238 23.696 39.278  1.00 46.91  ? 105 ASP A OD2 1 
ATOM   579  N N   . HIS A 1 106 ? 31.076 27.387 42.007  1.00 22.60  ? 106 HIS A N   1 
ATOM   580  C CA  . HIS A 1 106 ? 30.546 28.583 41.371  1.00 22.60  ? 106 HIS A CA  1 
ATOM   581  C C   . HIS A 1 106 ? 31.606 29.665 41.329  1.00 22.60  ? 106 HIS A C   1 
ATOM   582  O O   . HIS A 1 106 ? 32.392 29.810 42.252  1.00 22.60  ? 106 HIS A O   1 
ATOM   583  C CB  . HIS A 1 106 ? 29.308 29.065 42.120  1.00 24.71  ? 106 HIS A CB  1 
ATOM   584  C CG  . HIS A 1 106 ? 28.550 30.135 41.403  1.00 24.71  ? 106 HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 106 ? 28.996 31.435 41.318  1.00 24.71  ? 106 HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 106 ? 27.373 30.096 40.732  1.00 24.71  ? 106 HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 106 ? 28.125 32.153 40.629  1.00 24.71  ? 106 HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 106 ? 27.132 31.363 40.262  1.00 24.71  ? 106 HIS A NE2 1 
ATOM   589  N N   . CYS A 1 107 ? 31.620 30.424 40.241  1.00 38.47  ? 107 CYS A N   1 
ATOM   590  C CA  . CYS A 1 107 ? 32.616 31.468 40.052  1.00 38.47  ? 107 CYS A CA  1 
ATOM   591  C C   . CYS A 1 107 ? 32.495 32.617 41.029  1.00 38.47  ? 107 CYS A C   1 
ATOM   592  O O   . CYS A 1 107 ? 33.287 33.543 40.986  1.00 38.47  ? 107 CYS A O   1 
ATOM   593  C CB  . CYS A 1 107 ? 32.562 32.007 38.616  1.00 37.90  ? 107 CYS A CB  1 
ATOM   594  S SG  . CYS A 1 107 ? 31.007 32.828 38.143  1.00 37.90  ? 107 CYS A SG  1 
ATOM   595  N N   . ASN A 1 108 ? 31.525 32.554 41.928  1.00 34.41  ? 108 ASN A N   1 
ATOM   596  C CA  . ASN A 1 108 ? 31.345 33.632 42.887  1.00 34.41  ? 108 ASN A CA  1 
ATOM   597  C C   . ASN A 1 108 ? 31.354 33.178 44.338  1.00 34.41  ? 108 ASN A C   1 
ATOM   598  O O   . ASN A 1 108 ? 30.897 33.888 45.231  1.00 34.41  ? 108 ASN A O   1 
ATOM   599  C CB  . ASN A 1 108 ? 30.056 34.386 42.558  1.00 26.75  ? 108 ASN A CB  1 
ATOM   600  C CG  . ASN A 1 108 ? 30.225 35.321 41.371  1.00 26.75  ? 108 ASN A CG  1 
ATOM   601  O OD1 . ASN A 1 108 ? 29.311 35.526 40.569  1.00 26.75  ? 108 ASN A OD1 1 
ATOM   602  N ND2 . ASN A 1 108 ? 31.402 35.902 41.265  1.00 26.75  ? 108 ASN A ND2 1 
ATOM   603  N N   . ILE A 1 109 ? 31.880 31.985 44.574  1.00 26.40  ? 109 ILE A N   1 
ATOM   604  C CA  . ILE A 1 109 ? 31.970 31.463 45.929  1.00 26.40  ? 109 ILE A CA  1 
ATOM   605  C C   . ILE A 1 109 ? 33.422 31.034 46.123  1.00 26.40  ? 109 ILE A C   1 
ATOM   606  O O   . ILE A 1 109 ? 34.013 30.445 45.217  1.00 26.40  ? 109 ILE A O   1 
ATOM   607  C CB  . ILE A 1 109 ? 31.049 30.245 46.116  1.00 20.95  ? 109 ILE A CB  1 
ATOM   608  C CG1 . ILE A 1 109 ? 29.592 30.648 45.890  1.00 20.95  ? 109 ILE A CG1 1 
ATOM   609  C CG2 . ILE A 1 109 ? 31.243 29.660 47.496  1.00 20.95  ? 109 ILE A CG2 1 
ATOM   610  C CD1 . ILE A 1 109 ? 28.635 29.474 45.843  0.00 20.95  ? 109 ILE A CD1 1 
ATOM   611  N N   . VAL A 1 110 ? 34.014 31.343 47.271  1.00 21.56  ? 110 VAL A N   1 
ATOM   612  C CA  . VAL A 1 110 ? 35.392 30.928 47.494  1.00 21.56  ? 110 VAL A CA  1 
ATOM   613  C C   . VAL A 1 110 ? 35.488 29.447 47.184  1.00 21.56  ? 110 VAL A C   1 
ATOM   614  O O   . VAL A 1 110 ? 34.571 28.682 47.450  1.00 21.56  ? 110 VAL A O   1 
ATOM   615  C CB  . VAL A 1 110 ? 35.860 31.150 48.951  1.00 28.38  ? 110 VAL A CB  1 
ATOM   616  C CG1 . VAL A 1 110 ? 36.336 32.556 49.129  1.00 28.38  ? 110 VAL A CG1 1 
ATOM   617  C CG2 . VAL A 1 110 ? 34.725 30.847 49.914  1.00 28.38  ? 110 VAL A CG2 1 
ATOM   618  N N   . ARG A 1 111 ? 36.619 29.061 46.620  1.00 26.01  ? 111 ARG A N   1 
ATOM   619  C CA  . ARG A 1 111 ? 36.882 27.689 46.233  1.00 26.01  ? 111 ARG A CA  1 
ATOM   620  C C   . ARG A 1 111 ? 37.595 26.926 47.356  1.00 26.01  ? 111 ARG A C   1 
ATOM   621  O O   . ARG A 1 111 ? 38.528 27.438 47.987  1.00 26.01  ? 111 ARG A O   1 
ATOM   622  C CB  . ARG A 1 111 ? 37.753 27.709 44.968  1.00 74.46  ? 111 ARG A CB  1 
ATOM   623  C CG  . ARG A 1 111 ? 37.449 26.661 43.902  1.00 74.46  ? 111 ARG A CG  1 
ATOM   624  C CD  . ARG A 1 111 ? 38.176 27.020 42.592  1.00 74.46  ? 111 ARG A CD  1 
ATOM   625  N NE  . ARG A 1 111 ? 39.614 27.206 42.804  1.00 74.46  ? 111 ARG A NE  1 
ATOM   626  C CZ  . ARG A 1 111 ? 40.294 28.326 42.525  1.00 74.46  ? 111 ARG A CZ  1 
ATOM   627  N NH1 . ARG A 1 111 ? 39.663 29.385 42.010  1.00 74.46  ? 111 ARG A NH1 1 
ATOM   628  N NH2 . ARG A 1 111 ? 41.608 28.392 42.758  1.00 74.46  ? 111 ARG A NH2 1 
ATOM   629  N N   . LEU A 1 112 ? 37.131 25.708 47.615  1.00 28.45  ? 112 LEU A N   1 
ATOM   630  C CA  . LEU A 1 112 ? 37.757 24.857 48.619  1.00 28.45  ? 112 LEU A CA  1 
ATOM   631  C C   . LEU A 1 112 ? 38.804 24.020 47.874  1.00 28.45  ? 112 LEU A C   1 
ATOM   632  O O   . LEU A 1 112 ? 38.483 22.965 47.337  1.00 28.45  ? 112 LEU A O   1 
ATOM   633  C CB  . LEU A 1 112 ? 36.735 23.916 49.267  1.00 23.28  ? 112 LEU A CB  1 
ATOM   634  C CG  . LEU A 1 112 ? 37.352 22.977 50.319  1.00 23.28  ? 112 LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 112 ? 37.639 23.768 51.586  1.00 23.28  ? 112 LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 112 ? 36.425 21.797 50.624  1.00 23.28  ? 112 LEU A CD2 1 
ATOM   637  N N   . ARG A 1 113 ? 40.047 24.484 47.826  1.00 26.78  ? 113 ARG A N   1 
ATOM   638  C CA  . ARG A 1 113 ? 41.078 23.734 47.118  1.00 26.78  ? 113 ARG A CA  1 
ATOM   639  C C   . ARG A 1 113 ? 41.241 22.325 47.701  1.00 26.78  ? 113 ARG A C   1 
ATOM   640  O O   . ARG A 1 113 ? 41.126 21.327 46.992  1.00 26.78  ? 113 ARG A O   1 
ATOM   641  C CB  . ARG A 1 113 ? 42.424 24.466 47.194  1.00 66.27  ? 113 ARG A CB  1 
ATOM   642  C CG  . ARG A 1 113 ? 42.325 25.990 47.160  1.00 66.27  ? 113 ARG A CG  1 
ATOM   643  C CD  . ARG A 1 113 ? 41.871 26.498 45.816  1.00 66.27  ? 113 ARG A CD  1 
ATOM   644  N NE  . ARG A 1 113 ? 42.985 26.718 44.895  1.00 66.27  ? 113 ARG A NE  1 
ATOM   645  C CZ  . ARG A 1 113 ? 43.812 27.764 44.951  1.00 66.27  ? 113 ARG A CZ  1 
ATOM   646  N NH1 . ARG A 1 113 ? 43.646 28.686 45.893  1.00 66.27  ? 113 ARG A NH1 1 
ATOM   647  N NH2 . ARG A 1 113 ? 44.794 27.900 44.055  1.00 66.27  ? 113 ARG A NH2 1 
ATOM   648  N N   . TYR A 1 114 ? 41.496 22.247 49.003  1.00 41.01  ? 114 TYR A N   1 
ATOM   649  C CA  . TYR A 1 114 ? 41.707 20.966 49.657  1.00 41.01  ? 114 TYR A CA  1 
ATOM   650  C C   . TYR A 1 114 ? 41.279 21.086 51.099  1.00 41.01  ? 114 TYR A C   1 
ATOM   651  O O   . TYR A 1 114 ? 40.965 22.170 51.578  1.00 41.01  ? 114 TYR A O   1 
ATOM   652  C CB  . TYR A 1 114 ? 43.202 20.609 49.677  1.00 35.34  ? 114 TYR A CB  1 
ATOM   653  C CG  . TYR A 1 114 ? 43.946 20.748 48.366  1.00 35.34  ? 114 TYR A CG  1 
ATOM   654  C CD1 . TYR A 1 114 ? 43.812 19.797 47.365  1.00 35.34  ? 114 TYR A CD1 1 
ATOM   655  C CD2 . TYR A 1 114 ? 44.794 21.829 48.134  1.00 35.34  ? 114 TYR A CD2 1 
ATOM   656  C CE1 . TYR A 1 114 ? 44.501 19.918 46.161  1.00 35.34  ? 114 TYR A CE1 1 
ATOM   657  C CE2 . TYR A 1 114 ? 45.484 21.960 46.933  1.00 35.34  ? 114 TYR A CE2 1 
ATOM   658  C CZ  . TYR A 1 114 ? 45.331 20.998 45.954  1.00 35.34  ? 114 TYR A CZ  1 
ATOM   659  O OH  . TYR A 1 114 ? 45.995 21.115 44.757  1.00 35.34  ? 114 TYR A OH  1 
ATOM   660  N N   . PHE A 1 115 ? 41.303 19.956 51.790  1.00 39.24  ? 115 PHE A N   1 
ATOM   661  C CA  . PHE A 1 115 ? 41.006 19.913 53.207  1.00 39.24  ? 115 PHE A CA  1 
ATOM   662  C C   . PHE A 1 115 ? 41.721 18.696 53.810  1.00 39.24  ? 115 PHE A C   1 
ATOM   663  O O   . PHE A 1 115 ? 41.898 17.679 53.144  1.00 39.24  ? 115 PHE A O   1 
ATOM   664  C CB  . PHE A 1 115 ? 39.499 19.860 53.436  1.00 31.61  ? 115 PHE A CB  1 
ATOM   665  C CG  . PHE A 1 115 ? 38.864 18.580 53.022  1.00 31.61  ? 115 PHE A CG  1 
ATOM   666  C CD1 . PHE A 1 115 ? 38.748 17.529 53.922  1.00 31.61  ? 115 PHE A CD1 1 
ATOM   667  C CD2 . PHE A 1 115 ? 38.305 18.448 51.751  1.00 31.61  ? 115 PHE A CD2 1 
ATOM   668  C CE1 . PHE A 1 115 ? 38.072 16.368 53.568  1.00 31.61  ? 115 PHE A CE1 1 
ATOM   669  C CE2 . PHE A 1 115 ? 37.623 17.287 51.383  1.00 31.61  ? 115 PHE A CE2 1 
ATOM   670  C CZ  . PHE A 1 115 ? 37.504 16.249 52.294  1.00 31.61  ? 115 PHE A CZ  1 
ATOM   671  N N   . PHE A 1 116 ? 42.166 18.818 55.056  1.00 46.90  ? 116 PHE A N   1 
ATOM   672  C CA  . PHE A 1 116 ? 42.862 17.723 55.724  1.00 46.90  ? 116 PHE A CA  1 
ATOM   673  C C   . PHE A 1 116 ? 42.779 17.895 57.232  1.00 46.90  ? 116 PHE A C   1 
ATOM   674  O O   . PHE A 1 116 ? 42.307 18.926 57.723  1.00 46.90  ? 116 PHE A O   1 
ATOM   675  C CB  . PHE A 1 116 ? 44.322 17.681 55.282  1.00 27.87  ? 116 PHE A CB  1 
ATOM   676  C CG  . PHE A 1 116 ? 45.112 18.890 55.687  1.00 27.87  ? 116 PHE A CG  1 
ATOM   677  C CD1 . PHE A 1 116 ? 45.650 18.991 56.960  1.00 27.87  ? 116 PHE A CD1 1 
ATOM   678  C CD2 . PHE A 1 116 ? 45.319 19.938 54.789  1.00 27.87  ? 116 PHE A CD2 1 
ATOM   679  C CE1 . PHE A 1 116 ? 46.382 20.123 57.337  1.00 27.87  ? 116 PHE A CE1 1 
ATOM   680  C CE2 . PHE A 1 116 ? 46.050 21.072 55.159  1.00 27.87  ? 116 PHE A CE2 1 
ATOM   681  C CZ  . PHE A 1 116 ? 46.581 21.162 56.434  1.00 27.87  ? 116 PHE A CZ  1 
ATOM   682  N N   . TYR A 1 117 ? 43.253 16.888 57.961  1.00 64.42  ? 117 TYR A N   1 
ATOM   683  C CA  . TYR A 1 117 ? 43.221 16.908 59.421  1.00 64.42  ? 117 TYR A CA  1 
ATOM   684  C C   . TYR A 1 117 ? 44.594 17.059 60.126  1.00 64.42  ? 117 TYR A C   1 
ATOM   685  O O   . TYR A 1 117 ? 45.635 16.612 59.613  1.00 64.42  ? 117 TYR A O   1 
ATOM   686  C CB  . TYR A 1 117 ? 42.489 15.652 59.895  1.00 44.40  ? 117 TYR A CB  1 
ATOM   687  C CG  . TYR A 1 117 ? 41.058 15.583 59.375  1.00 44.40  ? 117 TYR A CG  1 
ATOM   688  C CD1 . TYR A 1 117 ? 40.078 16.473 59.838  1.00 44.40  ? 117 TYR A CD1 1 
ATOM   689  C CD2 . TYR A 1 117 ? 40.686 14.648 58.404  1.00 44.40  ? 117 TYR A CD2 1 
ATOM   690  C CE1 . TYR A 1 117 ? 38.766 16.428 59.350  1.00 44.40  ? 117 TYR A CE1 1 
ATOM   691  C CE2 . TYR A 1 117 ? 39.381 14.597 57.911  1.00 44.40  ? 117 TYR A CE2 1 
ATOM   692  C CZ  . TYR A 1 117 ? 38.428 15.486 58.388  1.00 44.40  ? 117 TYR A CZ  1 
ATOM   693  O OH  . TYR A 1 117 ? 37.128 15.419 57.920  1.00 44.40  ? 117 TYR A OH  1 
ATOM   694  N N   . SER A 1 118 ? 44.577 17.722 61.292  1.00 83.11  ? 118 SER A N   1 
ATOM   695  C CA  . SER A 1 118 ? 45.773 17.972 62.124  1.00 83.11  ? 118 SER A CA  1 
ATOM   696  C C   . SER A 1 118 ? 45.413 17.716 63.583  1.00 83.11  ? 118 SER A C   1 
ATOM   697  O O   . SER A 1 118 ? 44.267 17.959 63.999  1.00 83.11  ? 118 SER A O   1 
ATOM   698  C CB  . SER A 1 118 ? 46.235 19.430 62.022  1.00 70.63  ? 118 SER A CB  1 
ATOM   699  O OG  . SER A 1 118 ? 46.412 19.833 60.677  1.00 70.63  ? 118 SER A OG  1 
ATOM   700  N N   . SER A 1 119 ? 46.395 17.260 64.361  1.00 68.91  ? 119 SER A N   1 
ATOM   701  C CA  . SER A 1 119 ? 46.180 16.967 65.779  1.00 68.91  ? 119 SER A CA  1 
ATOM   702  C C   . SER A 1 119 ? 46.199 18.227 66.648  1.00 68.91  ? 119 SER A C   1 
ATOM   703  O O   . SER A 1 119 ? 46.474 19.326 66.162  1.00 68.91  ? 119 SER A O   1 
ATOM   704  C CB  . SER A 1 119 ? 47.248 15.987 66.269  1.00 69.37  ? 119 SER A CB  1 
ATOM   705  O OG  . SER A 1 119 ? 47.158 14.759 65.562  1.00 69.37  ? 119 SER A OG  1 
ATOM   706  N N   . TYR A 1 127 ? 42.467 20.925 64.527  1.00 61.36  ? 127 TYR A N   1 
ATOM   707  C CA  . TYR A 1 127 ? 41.976 19.596 64.149  1.00 61.36  ? 127 TYR A CA  1 
ATOM   708  C C   . TYR A 1 127 ? 41.643 19.495 62.642  1.00 61.36  ? 127 TYR A C   1 
ATOM   709  O O   . TYR A 1 127 ? 42.286 18.728 61.919  1.00 61.36  ? 127 TYR A O   1 
ATOM   710  C CB  . TYR A 1 127 ? 40.746 19.214 65.007  1.00 37.80  ? 127 TYR A CB  1 
ATOM   711  N N   . LEU A 1 128 ? 40.638 20.241 62.172  1.00 53.88  ? 128 LEU A N   1 
ATOM   712  C CA  . LEU A 1 128 ? 40.281 20.224 60.742  1.00 53.88  ? 128 LEU A CA  1 
ATOM   713  C C   . LEU A 1 128 ? 40.810 21.467 60.042  1.00 53.88  ? 128 LEU A C   1 
ATOM   714  O O   . LEU A 1 128 ? 40.764 22.578 60.595  1.00 53.88  ? 128 LEU A O   1 
ATOM   715  C CB  . LEU A 1 128 ? 38.766 20.163 60.520  1.00 37.71  ? 128 LEU A CB  1 
ATOM   716  C CG  . LEU A 1 128 ? 38.395 20.424 59.051  1.00 37.71  ? 128 LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 128 ? 39.234 19.529 58.154  1.00 37.71  ? 128 LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 128 ? 36.913 20.177 58.815  1.00 37.71  ? 128 LEU A CD2 1 
ATOM   719  N N   . ASN A 1 129 ? 41.285 21.278 58.815  1.00 50.03  ? 129 ASN A N   1 
ATOM   720  C CA  . ASN A 1 129 ? 41.849 22.374 58.043  1.00 50.03  ? 129 ASN A CA  1 
ATOM   721  C C   . ASN A 1 129 ? 41.112 22.576 56.730  1.00 50.03  ? 129 ASN A C   1 
ATOM   722  O O   . ASN A 1 129 ? 40.812 21.605 56.037  1.00 50.03  ? 129 ASN A O   1 
ATOM   723  C CB  . ASN A 1 129 ? 43.324 22.087 57.754  1.00 36.05  ? 129 ASN A CB  1 
ATOM   724  C CG  . ASN A 1 129 ? 44.147 21.895 59.029  1.00 36.05  ? 129 ASN A CG  1 
ATOM   725  O OD1 . ASN A 1 129 ? 44.813 22.818 59.504  1.00 36.05  ? 129 ASN A OD1 1 
ATOM   726  N ND2 . ASN A 1 129 ? 44.094 20.688 59.591  1.00 36.05  ? 129 ASN A ND2 1 
ATOM   727  N N   . LEU A 1 130 ? 40.816 23.833 56.391  1.00 48.89  ? 130 LEU A N   1 
ATOM   728  C CA  . LEU A 1 130 ? 40.156 24.142 55.126  1.00 48.89  ? 130 LEU A CA  1 
ATOM   729  C C   . LEU A 1 130 ? 41.036 25.048 54.254  1.00 48.89  ? 130 LEU A C   1 
ATOM   730  O O   . LEU A 1 130 ? 41.168 26.246 54.516  1.00 48.89  ? 130 LEU A O   1 
ATOM   731  C CB  . LEU A 1 130 ? 38.817 24.826 55.357  1.00 34.06  ? 130 LEU A CB  1 
ATOM   732  C CG  . LEU A 1 130 ? 37.698 24.044 56.035  1.00 34.06  ? 130 LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 130 ? 36.403 24.790 55.780  1.00 34.06  ? 130 LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 130 ? 37.589 22.639 55.483  1.00 34.06  ? 130 LEU A CD2 1 
ATOM   735  N N   . VAL A 1 131 ? 41.643 24.475 53.222  1.00 33.05  ? 131 VAL A N   1 
ATOM   736  C CA  . VAL A 1 131 ? 42.490 25.249 52.331  1.00 33.05  ? 131 VAL A CA  1 
ATOM   737  C C   . VAL A 1 131 ? 41.584 25.914 51.304  1.00 33.05  ? 131 VAL A C   1 
ATOM   738  O O   . VAL A 1 131 ? 41.027 25.238 50.435  1.00 33.05  ? 131 VAL A O   1 
ATOM   739  C CB  . VAL A 1 131 ? 43.494 24.344 51.612  1.00 25.51  ? 131 VAL A CB  1 
ATOM   740  C CG1 . VAL A 1 131 ? 44.532 25.182 50.913  1.00 25.51  ? 131 VAL A CG1 1 
ATOM   741  C CG2 . VAL A 1 131 ? 44.147 23.413 52.607  1.00 25.51  ? 131 VAL A CG2 1 
ATOM   742  N N   . LEU A 1 132 ? 41.444 27.237 51.409  1.00 37.71  ? 132 LEU A N   1 
ATOM   743  C CA  . LEU A 1 132 ? 40.580 28.020 50.515  1.00 37.71  ? 132 LEU A CA  1 
ATOM   744  C C   . LEU A 1 132 ? 41.344 29.014 49.659  1.00 37.71  ? 132 LEU A C   1 
ATOM   745  O O   . LEU A 1 132 ? 42.514 29.292 49.928  1.00 37.71  ? 132 LEU A O   1 
ATOM   746  C CB  . LEU A 1 132 ? 39.573 28.793 51.348  1.00 23.63  ? 132 LEU A CB  1 
ATOM   747  C CG  . LEU A 1 132 ? 38.726 27.947 52.286  1.00 23.63  ? 132 LEU A CG  1 
ATOM   748  C CD1 . LEU A 1 132 ? 38.515 28.697 53.579  1.00 23.63  ? 132 LEU A CD1 1 
ATOM   749  C CD2 . LEU A 1 132 ? 37.412 27.613 51.614  1.00 23.63  ? 132 LEU A CD2 1 
ATOM   750  N N   . ASP A 1 133 ? 40.688 29.546 48.625  1.00 40.09  ? 133 ASP A N   1 
ATOM   751  C CA  . ASP A 1 133 ? 41.332 30.550 47.780  1.00 40.09  ? 133 ASP A CA  1 
ATOM   752  C C   . ASP A 1 133 ? 41.609 31.722 48.713  1.00 40.09  ? 133 ASP A C   1 
ATOM   753  O O   . ASP A 1 133 ? 40.865 31.951 49.670  1.00 40.09  ? 133 ASP A O   1 
ATOM   754  C CB  . ASP A 1 133 ? 40.403 31.071 46.674  1.00 52.78  ? 133 ASP A CB  1 
ATOM   755  C CG  . ASP A 1 133 ? 40.311 30.141 45.466  1.00 52.78  ? 133 ASP A CG  1 
ATOM   756  O OD1 . ASP A 1 133 ? 41.310 29.447 45.156  1.00 52.78  ? 133 ASP A OD1 1 
ATOM   757  O OD2 . ASP A 1 133 ? 39.235 30.137 44.808  1.00 52.78  ? 133 ASP A OD2 1 
ATOM   758  N N   . TYR A 1 134 ? 42.672 32.467 48.447  1.00 51.56  ? 134 TYR A N   1 
ATOM   759  C CA  . TYR A 1 134 ? 42.970 33.623 49.279  1.00 51.56  ? 134 TYR A CA  1 
ATOM   760  C C   . TYR A 1 134 ? 42.667 34.884 48.504  1.00 51.56  ? 134 TYR A C   1 
ATOM   761  O O   . TYR A 1 134 ? 43.071 35.021 47.350  1.00 51.56  ? 134 TYR A O   1 
ATOM   762  C CB  . TYR A 1 134 ? 44.426 33.656 49.670  1.00 64.72  ? 134 TYR A CB  1 
ATOM   763  C CG  . TYR A 1 134 ? 44.760 34.885 50.461  1.00 64.72  ? 134 TYR A CG  1 
ATOM   764  C CD1 . TYR A 1 134 ? 44.292 35.040 51.766  1.00 64.72  ? 134 TYR A CD1 1 
ATOM   765  C CD2 . TYR A 1 134 ? 45.574 35.884 49.920  1.00 64.72  ? 134 TYR A CD2 1 
ATOM   766  C CE1 . TYR A 1 134 ? 44.633 36.157 52.526  1.00 64.72  ? 134 TYR A CE1 1 
ATOM   767  C CE2 . TYR A 1 134 ? 45.923 37.004 50.665  1.00 64.72  ? 134 TYR A CE2 1 
ATOM   768  C CZ  . TYR A 1 134 ? 45.454 37.133 51.970  1.00 64.72  ? 134 TYR A CZ  1 
ATOM   769  O OH  . TYR A 1 134 ? 45.835 38.228 52.721  1.00 64.72  ? 134 TYR A OH  1 
ATOM   770  N N   . VAL A 1 135 ? 41.961 35.807 49.139  1.00 34.95  ? 135 VAL A N   1 
ATOM   771  C CA  . VAL A 1 135 ? 41.602 37.059 48.492  1.00 34.95  ? 135 VAL A CA  1 
ATOM   772  C C   . VAL A 1 135 ? 41.826 38.179 49.505  1.00 34.95  ? 135 VAL A C   1 
ATOM   773  O O   . VAL A 1 135 ? 41.124 38.293 50.511  1.00 34.95  ? 135 VAL A O   1 
ATOM   774  C CB  . VAL A 1 135 ? 40.147 37.012 48.026  1.00 27.14  ? 135 VAL A CB  1 
ATOM   775  C CG1 . VAL A 1 135 ? 39.836 38.199 47.135  1.00 27.14  ? 135 VAL A CG1 1 
ATOM   776  C CG2 . VAL A 1 135 ? 39.900 35.705 47.296  1.00 27.14  ? 135 VAL A CG2 1 
ATOM   777  N N   . PRO A 1 136 ? 42.811 39.035 49.227  1.00 55.48  ? 136 PRO A N   1 
ATOM   778  C CA  . PRO A 1 136 ? 43.225 40.170 50.051  1.00 55.48  ? 136 PRO A CA  1 
ATOM   779  C C   . PRO A 1 136 ? 42.168 41.217 50.396  1.00 55.48  ? 136 PRO A C   1 
ATOM   780  O O   . PRO A 1 136 ? 41.998 41.572 51.567  1.00 55.48  ? 136 PRO A O   1 
ATOM   781  C CB  . PRO A 1 136 ? 44.374 40.757 49.244  1.00 53.53  ? 136 PRO A CB  1 
ATOM   782  C CG  . PRO A 1 136 ? 43.874 40.604 47.848  1.00 53.53  ? 136 PRO A CG  1 
ATOM   783  C CD  . PRO A 1 136 ? 43.341 39.177 47.856  1.00 53.53  ? 136 PRO A CD  1 
ATOM   784  N N   . GLU A 1 137 ? 41.453 41.709 49.393  1.00 27.12  ? 137 GLU A N   1 
ATOM   785  C CA  . GLU A 1 137 ? 40.466 42.749 49.639  1.00 27.12  ? 137 GLU A CA  1 
ATOM   786  C C   . GLU A 1 137 ? 39.053 42.221 49.879  1.00 27.12  ? 137 GLU A C   1 
ATOM   787  O O   . GLU A 1 137 ? 38.720 41.120 49.477  1.00 27.12  ? 137 GLU A O   1 
ATOM   788  C CB  . GLU A 1 137 ? 40.490 43.740 48.471  1.00 54.17  ? 137 GLU A CB  1 
ATOM   789  C CG  . GLU A 1 137 ? 40.158 45.159 48.865  1.00 54.17  ? 137 GLU A CG  1 
ATOM   790  C CD  . GLU A 1 137 ? 41.004 45.651 50.032  1.00 54.17  ? 137 GLU A CD  1 
ATOM   791  O OE1 . GLU A 1 137 ? 42.107 46.212 49.812  1.00 54.17  ? 137 GLU A OE1 1 
ATOM   792  O OE2 . GLU A 1 137 ? 40.565 45.460 51.186  1.00 54.17  ? 137 GLU A OE2 1 
ATOM   793  N N   . THR A 1 138 ? 38.234 43.020 50.553  1.00 24.91  ? 138 THR A N   1 
ATOM   794  C CA  . THR A 1 138 ? 36.852 42.664 50.860  1.00 24.91  ? 138 THR A CA  1 
ATOM   795  C C   . THR A 1 138 ? 35.984 43.887 50.619  1.00 24.91  ? 138 THR A C   1 
ATOM   796  O O   . THR A 1 138 ? 36.472 45.004 50.614  1.00 24.91  ? 138 THR A O   1 
ATOM   797  C CB  . THR A 1 138 ? 36.680 42.259 52.330  1.00 31.52  ? 138 THR A CB  1 
ATOM   798  O OG1 . THR A 1 138 ? 36.902 43.400 53.169  1.00 31.52  ? 138 THR A OG1 1 
ATOM   799  C CG2 . THR A 1 138 ? 37.663 41.168 52.699  1.00 31.52  ? 138 THR A CG2 1 
ATOM   800  N N   . VAL A 1 139 ? 34.691 43.685 50.424  1.00 27.42  ? 139 VAL A N   1 
ATOM   801  C CA  . VAL A 1 139 ? 33.813 44.812 50.186  1.00 27.42  ? 139 VAL A CA  1 
ATOM   802  C C   . VAL A 1 139 ? 33.867 45.755 51.373  1.00 27.42  ? 139 VAL A C   1 
ATOM   803  O O   . VAL A 1 139 ? 33.842 46.969 51.219  1.00 27.42  ? 139 VAL A O   1 
ATOM   804  C CB  . VAL A 1 139 ? 32.367 44.351 49.949  1.00 26.39  ? 139 VAL A CB  1 
ATOM   805  C CG1 . VAL A 1 139 ? 31.405 45.536 50.103  1.00 26.39  ? 139 VAL A CG1 1 
ATOM   806  C CG2 . VAL A 1 139 ? 32.248 43.748 48.548  1.00 26.39  ? 139 VAL A CG2 1 
ATOM   807  N N   . TYR A 1 140 ? 33.953 45.179 52.560  1.00 28.15  ? 140 TYR A N   1 
ATOM   808  C CA  . TYR A 1 140 ? 34.024 45.952 53.775  1.00 28.15  ? 140 TYR A CA  1 
ATOM   809  C C   . TYR A 1 140 ? 35.190 46.941 53.684  1.00 28.15  ? 140 TYR A C   1 
ATOM   810  O O   . TYR A 1 140 ? 34.999 48.153 53.763  1.00 28.15  ? 140 TYR A O   1 
ATOM   811  C CB  . TYR A 1 140 ? 34.222 45.015 54.963  1.00 29.23  ? 140 TYR A CB  1 
ATOM   812  C CG  . TYR A 1 140 ? 34.441 45.736 56.267  1.00 29.23  ? 140 TYR A CG  1 
ATOM   813  C CD1 . TYR A 1 140 ? 33.378 46.326 56.949  1.00 29.23  ? 140 TYR A CD1 1 
ATOM   814  C CD2 . TYR A 1 140 ? 35.718 45.860 56.803  1.00 29.23  ? 140 TYR A CD2 1 
ATOM   815  C CE1 . TYR A 1 140 ? 33.584 47.030 58.133  1.00 29.23  ? 140 TYR A CE1 1 
ATOM   816  C CE2 . TYR A 1 140 ? 35.937 46.557 57.980  1.00 29.23  ? 140 TYR A CE2 1 
ATOM   817  C CZ  . TYR A 1 140 ? 34.870 47.140 58.641  1.00 29.23  ? 140 TYR A CZ  1 
ATOM   818  O OH  . TYR A 1 140 ? 35.096 47.852 59.792  1.00 29.23  ? 140 TYR A OH  1 
ATOM   819  N N   . ARG A 1 141 ? 36.399 46.420 53.509  1.00 29.92  ? 141 ARG A N   1 
ATOM   820  C CA  . ARG A 1 141 ? 37.571 47.273 53.414  1.00 29.92  ? 141 ARG A CA  1 
ATOM   821  C C   . ARG A 1 141 ? 37.448 48.355 52.349  1.00 29.92  ? 141 ARG A C   1 
ATOM   822  O O   . ARG A 1 141 ? 37.799 49.504 52.582  1.00 29.92  ? 141 ARG A O   1 
ATOM   823  C CB  . ARG A 1 141 ? 38.809 46.430 53.152  1.00 61.43  ? 141 ARG A CB  1 
ATOM   824  C CG  . ARG A 1 141 ? 39.293 45.649 54.372  1.00 61.43  ? 141 ARG A CG  1 
ATOM   825  C CD  . ARG A 1 141 ? 40.677 45.065 54.119  1.00 61.43  ? 141 ARG A CD  1 
ATOM   826  N NE  . ARG A 1 141 ? 41.506 46.012 53.372  1.00 61.43  ? 141 ARG A NE  1 
ATOM   827  C CZ  . ARG A 1 141 ? 42.714 45.731 52.899  1.00 61.43  ? 141 ARG A CZ  1 
ATOM   828  N NH1 . ARG A 1 141 ? 43.243 44.527 53.109  1.00 61.43  ? 141 ARG A NH1 1 
ATOM   829  N NH2 . ARG A 1 141 ? 43.374 46.637 52.179  1.00 61.43  ? 141 ARG A NH2 1 
ATOM   830  N N   . VAL A 1 142 ? 36.950 47.995 51.175  1.00 36.65  ? 142 VAL A N   1 
ATOM   831  C CA  . VAL A 1 142 ? 36.799 48.980 50.117  1.00 36.65  ? 142 VAL A CA  1 
ATOM   832  C C   . VAL A 1 142 ? 35.778 50.036 50.521  1.00 36.65  ? 142 VAL A C   1 
ATOM   833  O O   . VAL A 1 142 ? 36.065 51.228 50.480  1.00 36.65  ? 142 VAL A O   1 
ATOM   834  C CB  . VAL A 1 142 ? 36.356 48.327 48.796  1.00 25.48  ? 142 VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 142 ? 36.110 49.380 47.754  1.00 25.48  ? 142 VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 142 ? 37.416 47.370 48.314  1.00 25.48  ? 142 VAL A CG2 1 
ATOM   837  N N   . ALA A 1 143 ? 34.591 49.609 50.931  1.00 26.42  ? 143 ALA A N   1 
ATOM   838  C CA  . ALA A 1 143 ? 33.563 50.570 51.320  1.00 26.42  ? 143 ALA A CA  1 
ATOM   839  C C   . ALA A 1 143 ? 34.039 51.495 52.431  1.00 26.42  ? 143 ALA A C   1 
ATOM   840  O O   . ALA A 1 143 ? 33.655 52.657 52.470  1.00 26.42  ? 143 ALA A O   1 
ATOM   841  C CB  . ALA A 1 143 ? 32.284 49.842 51.756  1.00 31.94  ? 143 ALA A CB  1 
ATOM   842  N N   . ARG A 1 144 ? 34.876 50.969 53.319  1.00 30.25  ? 144 ARG A N   1 
ATOM   843  C CA  . ARG A 1 144 ? 35.403 51.724 54.456  1.00 30.25  ? 144 ARG A CA  1 
ATOM   844  C C   . ARG A 1 144 ? 36.392 52.783 53.983  1.00 30.25  ? 144 ARG A C   1 
ATOM   845  O O   . ARG A 1 144 ? 36.352 53.925 54.433  1.00 30.25  ? 144 ARG A O   1 
ATOM   846  C CB  . ARG A 1 144 ? 36.091 50.768 55.440  1.00 46.52  ? 144 ARG A CB  1 
ATOM   847  C CG  . ARG A 1 144 ? 36.504 51.391 56.758  1.00 46.52  ? 144 ARG A CG  1 
ATOM   848  C CD  . ARG A 1 144 ? 37.357 50.429 57.593  1.00 46.52  ? 144 ARG A CD  1 
ATOM   849  N NE  . ARG A 1 144 ? 37.502 50.867 58.978  0.00 46.52  ? 144 ARG A NE  1 
ATOM   850  C CZ  . ARG A 1 144 ? 36.493 50.966 59.838  0.00 46.52  ? 144 ARG A CZ  1 
ATOM   851  N NH1 . ARG A 1 144 ? 35.261 50.659 59.454  0.00 46.52  ? 144 ARG A NH1 1 
ATOM   852  N NH2 . ARG A 1 144 ? 36.712 51.368 61.082  0.00 46.52  ? 144 ARG A NH2 1 
ATOM   853  N N   . HIS A 1 145 ? 37.278 52.387 53.075  1.00 35.85  ? 145 HIS A N   1 
ATOM   854  C CA  . HIS A 1 145 ? 38.276 53.283 52.508  1.00 35.85  ? 145 HIS A CA  1 
ATOM   855  C C   . HIS A 1 145 ? 37.592 54.547 51.972  1.00 35.85  ? 145 HIS A C   1 
ATOM   856  O O   . HIS A 1 145 ? 37.940 55.670 52.351  1.00 35.85  ? 145 HIS A O   1 
ATOM   857  C CB  . HIS A 1 145 ? 39.003 52.573 51.369  1.00 46.47  ? 145 HIS A CB  1 
ATOM   858  C CG  . HIS A 1 145 ? 40.063 53.399 50.714  1.00 46.47  ? 145 HIS A CG  1 
ATOM   859  N ND1 . HIS A 1 145 ? 41.407 53.205 50.954  1.00 46.47  ? 145 HIS A ND1 1 
ATOM   860  C CD2 . HIS A 1 145 ? 39.981 54.421 49.828  1.00 46.47  ? 145 HIS A CD2 1 
ATOM   861  C CE1 . HIS A 1 145 ? 42.107 54.071 50.238  1.00 46.47  ? 145 HIS A CE1 1 
ATOM   862  N NE2 . HIS A 1 145 ? 41.268 54.821 49.546  1.00 46.47  ? 145 HIS A NE2 1 
ATOM   863  N N   . TYR A 1 146 ? 36.612 54.354 51.093  1.00 35.25  ? 146 TYR A N   1 
ATOM   864  C CA  . TYR A 1 146 ? 35.884 55.466 50.502  1.00 35.25  ? 146 TYR A CA  1 
ATOM   865  C C   . TYR A 1 146 ? 35.126 56.252 51.539  1.00 35.25  ? 146 TYR A C   1 
ATOM   866  O O   . TYR A 1 146 ? 35.114 57.483 51.512  1.00 35.25  ? 146 TYR A O   1 
ATOM   867  C CB  . TYR A 1 146 ? 34.902 54.968 49.437  1.00 26.45  ? 146 TYR A CB  1 
ATOM   868  C CG  . TYR A 1 146 ? 35.576 54.507 48.172  1.00 26.45  ? 146 TYR A CG  1 
ATOM   869  C CD1 . TYR A 1 146 ? 36.298 53.322 48.142  1.00 26.45  ? 146 TYR A CD1 1 
ATOM   870  C CD2 . TYR A 1 146 ? 35.559 55.302 47.022  1.00 26.45  ? 146 TYR A CD2 1 
ATOM   871  C CE1 . TYR A 1 146 ? 36.989 52.937 47.007  1.00 26.45  ? 146 TYR A CE1 1 
ATOM   872  C CE2 . TYR A 1 146 ? 36.248 54.929 45.879  1.00 26.45  ? 146 TYR A CE2 1 
ATOM   873  C CZ  . TYR A 1 146 ? 36.967 53.745 45.877  1.00 26.45  ? 146 TYR A CZ  1 
ATOM   874  O OH  . TYR A 1 146 ? 37.682 53.381 44.753  1.00 26.45  ? 146 TYR A OH  1 
ATOM   875  N N   . SER A 1 147 ? 34.503 55.543 52.468  1.00 38.55  ? 147 SER A N   1 
ATOM   876  C CA  . SER A 1 147 ? 33.714 56.205 53.491  1.00 38.55  ? 147 SER A CA  1 
ATOM   877  C C   . SER A 1 147 ? 34.547 57.133 54.363  1.00 38.55  ? 147 SER A C   1 
ATOM   878  O O   . SER A 1 147 ? 34.071 58.191 54.786  1.00 38.55  ? 147 SER A O   1 
ATOM   879  C CB  . SER A 1 147 ? 33.006 55.173 54.367  1.00 46.88  ? 147 SER A CB  1 
ATOM   880  O OG  . SER A 1 147 ? 31.981 55.793 55.126  1.00 46.88  ? 147 SER A OG  1 
ATOM   881  N N   . ARG A 1 148 ? 35.787 56.736 54.631  1.00 44.27  ? 148 ARG A N   1 
ATOM   882  C CA  . ARG A 1 148 ? 36.666 57.544 55.453  1.00 44.27  ? 148 ARG A CA  1 
ATOM   883  C C   . ARG A 1 148 ? 37.076 58.789 54.673  1.00 44.27  ? 148 ARG A C   1 
ATOM   884  O O   . ARG A 1 148 ? 37.144 59.886 55.233  1.00 44.27  ? 148 ARG A O   1 
ATOM   885  C CB  . ARG A 1 148 ? 37.913 56.750 55.849  1.00 40.43  ? 148 ARG A CB  1 
ATOM   886  C CG  . ARG A 1 148 ? 37.665 55.525 56.728  1.00 40.43  ? 148 ARG A CG  1 
ATOM   887  C CD  . ARG A 1 148 ? 36.858 55.872 57.962  1.00 40.43  ? 148 ARG A CD  1 
ATOM   888  N NE  . ARG A 1 148 ? 36.949 54.835 58.984  0.00 40.43  ? 148 ARG A NE  1 
ATOM   889  C CZ  . ARG A 1 148 ? 38.075 54.498 59.604  0.00 40.43  ? 148 ARG A CZ  1 
ATOM   890  N NH1 . ARG A 1 148 ? 39.210 55.116 59.306  0.00 40.43  ? 148 ARG A NH1 1 
ATOM   891  N NH2 . ARG A 1 148 ? 38.067 53.547 60.526  0.00 40.43  ? 148 ARG A NH2 1 
ATOM   892  N N   . ALA A 1 149 ? 37.341 58.618 53.381  1.00 38.37  ? 149 ALA A N   1 
ATOM   893  C CA  . ALA A 1 149 ? 37.752 59.729 52.530  1.00 38.37  ? 149 ALA A CA  1 
ATOM   894  C C   . ALA A 1 149 ? 36.546 60.558 52.092  1.00 38.37  ? 149 ALA A C   1 
ATOM   895  O O   . ALA A 1 149 ? 36.610 61.293 51.104  1.00 38.37  ? 149 ALA A O   1 
ATOM   896  C CB  . ALA A 1 149 ? 38.507 59.199 51.299  1.00 20.40  ? 149 ALA A CB  1 
ATOM   897  N N   . LYS A 1 150 ? 35.443 60.440 52.825  1.00 54.55  ? 150 LYS A N   1 
ATOM   898  C CA  . LYS A 1 150 ? 34.233 61.183 52.487  1.00 54.55  ? 150 LYS A CA  1 
ATOM   899  C C   . LYS A 1 150 ? 33.969 61.123 50.977  1.00 54.55  ? 150 LYS A C   1 
ATOM   900  O O   . LYS A 1 150 ? 33.400 62.049 50.384  1.00 54.55  ? 150 LYS A O   1 
ATOM   901  C CB  . LYS A 1 150 ? 34.352 62.643 52.948  1.00 59.91  ? 150 LYS A CB  1 
ATOM   902  C CG  . LYS A 1 150 ? 34.441 62.820 54.464  1.00 59.91  ? 150 LYS A CG  1 
ATOM   903  C CD  . LYS A 1 150 ? 34.362 64.295 54.853  0.00 59.91  ? 150 LYS A CD  1 
ATOM   904  C CE  . LYS A 1 150 ? 33.016 64.902 54.479  1.00 59.91  ? 150 LYS A CE  1 
ATOM   905  N NZ  . LYS A 1 150 ? 32.906 66.353 54.862  1.00 59.91  ? 150 LYS A NZ  1 
ATOM   906  N N   . GLN A 1 151 ? 34.399 60.028 50.359  1.00 44.44  ? 151 GLN A N   1 
ATOM   907  C CA  . GLN A 1 151 ? 34.182 59.827 48.930  1.00 44.44  ? 151 GLN A CA  1 
ATOM   908  C C   . GLN A 1 151 ? 33.140 58.722 48.763  1.00 44.44  ? 151 GLN A C   1 
ATOM   909  O O   . GLN A 1 151 ? 32.525 58.267 49.745  1.00 44.44  ? 151 GLN A O   1 
ATOM   910  C CB  . GLN A 1 151 ? 35.486 59.416 48.254  1.00 51.73  ? 151 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 151 ? 36.625 60.380 48.515  1.00 51.73  ? 151 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 151 ? 37.972 59.838 48.063  1.00 51.73  ? 151 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 151 ? 39.001 60.500 48.210  1.00 51.73  ? 151 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 151 ? 37.973 58.627 47.509  1.00 51.73  ? 151 GLN A NE2 1 
ATOM   915  N N   . THR A 1 152 ? 32.917 58.302 47.524  1.00 51.39  ? 152 THR A N   1 
ATOM   916  C CA  . THR A 1 152 ? 31.959 57.231 47.287  1.00 51.39  ? 152 THR A CA  1 
ATOM   917  C C   . THR A 1 152 ? 32.396 56.366 46.136  1.00 51.39  ? 152 THR A C   1 
ATOM   918  O O   . THR A 1 152 ? 33.016 56.830 45.167  1.00 51.39  ? 152 THR A O   1 
ATOM   919  C CB  . THR A 1 152 ? 30.537 57.748 46.996  1.00 72.10  ? 152 THR A CB  1 
ATOM   920  O OG1 . THR A 1 152 ? 29.597 56.749 47.405  1.00 72.10  ? 152 THR A OG1 1 
ATOM   921  C CG2 . THR A 1 152 ? 30.340 58.016 45.511  0.00 72.10  ? 152 THR A CG2 1 
ATOM   922  N N   . LEU A 1 153 ? 32.065 55.092 46.259  1.00 40.52  ? 153 LEU A N   1 
ATOM   923  C CA  . LEU A 1 153 ? 32.414 54.110 45.255  1.00 40.52  ? 153 LEU A CA  1 
ATOM   924  C C   . LEU A 1 153 ? 31.584 54.303 43.985  1.00 40.52  ? 153 LEU A C   1 
ATOM   925  O O   . LEU A 1 153 ? 30.374 54.516 44.050  1.00 40.52  ? 153 LEU A O   1 
ATOM   926  C CB  . LEU A 1 153 ? 32.164 52.717 45.825  1.00 33.52  ? 153 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 153 ? 32.729 51.570 45.003  1.00 33.52  ? 153 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 153 ? 34.246 51.536 45.166  1.00 33.52  ? 153 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 153 ? 32.091 50.270 45.455  1.00 33.52  ? 153 LEU A CD2 1 
ATOM   930  N N   . PRO A 1 154 ? 32.234 54.271 42.816  1.00 28.10  ? 154 PRO A N   1 
ATOM   931  C CA  . PRO A 1 154 ? 31.528 54.428 41.544  1.00 28.10  ? 154 PRO A CA  1 
ATOM   932  C C   . PRO A 1 154 ? 30.486 53.315 41.418  1.00 28.10  ? 154 PRO A C   1 
ATOM   933  O O   . PRO A 1 154 ? 30.808 52.139 41.565  1.00 28.10  ? 154 PRO A O   1 
ATOM   934  C CB  . PRO A 1 154 ? 32.640 54.281 40.517  1.00 34.70  ? 154 PRO A CB  1 
ATOM   935  C CG  . PRO A 1 154 ? 33.802 54.894 41.217  1.00 34.70  ? 154 PRO A CG  1 
ATOM   936  C CD  . PRO A 1 154 ? 33.690 54.357 42.622  1.00 34.70  ? 154 PRO A CD  1 
ATOM   937  N N   . VAL A 1 155 ? 29.246 53.711 41.152  1.00 35.03  ? 155 VAL A N   1 
ATOM   938  C CA  . VAL A 1 155 ? 28.123 52.801 41.013  1.00 35.03  ? 155 VAL A CA  1 
ATOM   939  C C   . VAL A 1 155 ? 28.469 51.573 40.186  1.00 35.03  ? 155 VAL A C   1 
ATOM   940  O O   . VAL A 1 155 ? 27.975 50.482 40.460  1.00 35.03  ? 155 VAL A O   1 
ATOM   941  C CB  . VAL A 1 155 ? 26.908 53.515 40.376  1.00 22.64  ? 155 VAL A CB  1 
ATOM   942  C CG1 . VAL A 1 155 ? 26.464 54.670 41.258  0.00 22.64  ? 155 VAL A CG1 1 
ATOM   943  C CG2 . VAL A 1 155 ? 27.268 54.018 38.986  0.00 22.64  ? 155 VAL A CG2 1 
ATOM   944  N N   . ILE A 1 156 ? 29.316 51.739 39.177  1.00 27.63  ? 156 ILE A N   1 
ATOM   945  C CA  . ILE A 1 156 ? 29.687 50.602 38.349  1.00 27.63  ? 156 ILE A CA  1 
ATOM   946  C C   . ILE A 1 156 ? 30.146 49.446 39.244  1.00 27.63  ? 156 ILE A C   1 
ATOM   947  O O   . ILE A 1 156 ? 29.787 48.293 39.002  1.00 27.63  ? 156 ILE A O   1 
ATOM   948  C CB  . ILE A 1 156 ? 30.803 50.980 37.353  1.00 24.51  ? 156 ILE A CB  1 
ATOM   949  C CG1 . ILE A 1 156 ? 31.297 49.743 36.600  1.00 24.51  ? 156 ILE A CG1 1 
ATOM   950  C CG2 . ILE A 1 156 ? 31.940 51.625 38.089  1.00 24.51  ? 156 ILE A CG2 1 
ATOM   951  C CD1 . ILE A 1 156 ? 30.333 49.197 35.573  1.00 24.51  ? 156 ILE A CD1 1 
ATOM   952  N N   . TYR A 1 157 ? 30.931 49.748 40.277  1.00 23.27  ? 157 TYR A N   1 
ATOM   953  C CA  . TYR A 1 157 ? 31.398 48.706 41.188  1.00 23.27  ? 157 TYR A CA  1 
ATOM   954  C C   . TYR A 1 157 ? 30.239 48.215 42.024  1.00 23.27  ? 157 TYR A C   1 
ATOM   955  O O   . TYR A 1 157 ? 30.139 47.035 42.321  1.00 23.27  ? 157 TYR A O   1 
ATOM   956  C CB  . TYR A 1 157 ? 32.495 49.223 42.129  1.00 37.48  ? 157 TYR A CB  1 
ATOM   957  C CG  . TYR A 1 157 ? 33.819 49.461 41.453  1.00 37.48  ? 157 TYR A CG  1 
ATOM   958  C CD1 . TYR A 1 157 ? 34.418 50.722 41.469  1.00 37.48  ? 157 TYR A CD1 1 
ATOM   959  C CD2 . TYR A 1 157 ? 34.452 48.437 40.746  1.00 37.48  ? 157 TYR A CD2 1 
ATOM   960  C CE1 . TYR A 1 157 ? 35.609 50.955 40.786  1.00 37.48  ? 157 TYR A CE1 1 
ATOM   961  C CE2 . TYR A 1 157 ? 35.630 48.660 40.061  1.00 37.48  ? 157 TYR A CE2 1 
ATOM   962  C CZ  . TYR A 1 157 ? 36.203 49.917 40.086  1.00 37.48  ? 157 TYR A CZ  1 
ATOM   963  O OH  . TYR A 1 157 ? 37.373 50.127 39.405  1.00 37.48  ? 157 TYR A OH  1 
ATOM   964  N N   . VAL A 1 158 ? 29.367 49.134 42.410  1.00 25.33  ? 158 VAL A N   1 
ATOM   965  C CA  . VAL A 1 158 ? 28.224 48.776 43.223  1.00 25.33  ? 158 VAL A CA  1 
ATOM   966  C C   . VAL A 1 158 ? 27.443 47.711 42.464  1.00 25.33  ? 158 VAL A C   1 
ATOM   967  O O   . VAL A 1 158 ? 27.139 46.645 42.999  1.00 25.33  ? 158 VAL A O   1 
ATOM   968  C CB  . VAL A 1 158 ? 27.339 50.026 43.506  1.00 23.12  ? 158 VAL A CB  1 
ATOM   969  C CG1 . VAL A 1 158 ? 26.188 49.671 44.453  1.00 23.12  ? 158 VAL A CG1 1 
ATOM   970  C CG2 . VAL A 1 158 ? 28.189 51.125 44.117  1.00 23.12  ? 158 VAL A CG2 1 
ATOM   971  N N   . LYS A 1 159 ? 27.152 48.007 41.201  1.00 26.41  ? 159 LYS A N   1 
ATOM   972  C CA  . LYS A 1 159 ? 26.416 47.106 40.330  1.00 26.41  ? 159 LYS A CA  1 
ATOM   973  C C   . LYS A 1 159 ? 27.164 45.796 40.177  1.00 26.41  ? 159 LYS A C   1 
ATOM   974  O O   . LYS A 1 159 ? 26.597 44.725 40.358  1.00 26.41  ? 159 LYS A O   1 
ATOM   975  C CB  . LYS A 1 159 ? 26.217 47.755 38.962  1.00 30.79  ? 159 LYS A CB  1 
ATOM   976  C CG  . LYS A 1 159 ? 25.480 49.092 39.010  1.00 30.79  ? 159 LYS A CG  1 
ATOM   977  C CD  . LYS A 1 159 ? 25.282 49.655 37.617  1.00 30.79  ? 159 LYS A CD  1 
ATOM   978  C CE  . LYS A 1 159 ? 24.500 50.953 37.622  1.00 30.79  ? 159 LYS A CE  1 
ATOM   979  N NZ  . LYS A 1 159 ? 24.241 51.420 36.226  1.00 30.79  ? 159 LYS A NZ  1 
ATOM   980  N N   . LEU A 1 160 ? 28.442 45.886 39.843  1.00 28.98  ? 160 LEU A N   1 
ATOM   981  C CA  . LEU A 1 160 ? 29.267 44.700 39.682  1.00 28.98  ? 160 LEU A CA  1 
ATOM   982  C C   . LEU A 1 160 ? 29.241 43.802 40.903  1.00 28.98  ? 160 LEU A C   1 
ATOM   983  O O   . LEU A 1 160 ? 28.957 42.613 40.802  1.00 28.98  ? 160 LEU A O   1 
ATOM   984  C CB  . LEU A 1 160 ? 30.718 45.090 39.398  1.00 27.95  ? 160 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 160 ? 31.101 45.332 37.941  1.00 27.95  ? 160 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 160 ? 32.508 45.865 37.869  1.00 27.95  ? 160 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 160 ? 30.988 44.032 37.160  1.00 27.95  ? 160 LEU A CD2 1 
ATOM   988  N N   . TYR A 1 161 ? 29.544 44.373 42.061  1.00 30.87  ? 161 TYR A N   1 
ATOM   989  C CA  . TYR A 1 161 ? 29.591 43.597 43.289  1.00 30.87  ? 161 TYR A CA  1 
ATOM   990  C C   . TYR A 1 161 ? 28.241 43.008 43.680  1.00 30.87  ? 161 TYR A C   1 
ATOM   991  O O   . TYR A 1 161 ? 28.121 41.794 43.895  1.00 30.87  ? 161 TYR A O   1 
ATOM   992  C CB  . TYR A 1 161 ? 30.120 44.447 44.452  1.00 30.35  ? 161 TYR A CB  1 
ATOM   993  C CG  . TYR A 1 161 ? 31.512 45.025 44.293  1.00 30.35  ? 161 TYR A CG  1 
ATOM   994  C CD1 . TYR A 1 161 ? 32.444 44.456 43.432  1.00 30.35  ? 161 TYR A CD1 1 
ATOM   995  C CD2 . TYR A 1 161 ? 31.905 46.138 45.047  1.00 30.35  ? 161 TYR A CD2 1 
ATOM   996  C CE1 . TYR A 1 161 ? 33.730 44.977 43.329  1.00 30.35  ? 161 TYR A CE1 1 
ATOM   997  C CE2 . TYR A 1 161 ? 33.194 46.664 44.954  1.00 30.35  ? 161 TYR A CE2 1 
ATOM   998  C CZ  . TYR A 1 161 ? 34.097 46.080 44.096  1.00 30.35  ? 161 TYR A CZ  1 
ATOM   999  O OH  . TYR A 1 161 ? 35.373 46.588 44.021  1.00 30.35  ? 161 TYR A OH  1 
ATOM   1000 N N   . MET A 1 162 ? 27.227 43.861 43.784  1.00 23.41  ? 162 MET A N   1 
ATOM   1001 C CA  . MET A 1 162 ? 25.906 43.394 44.171  1.00 23.41  ? 162 MET A CA  1 
ATOM   1002 C C   . MET A 1 162 ? 25.369 42.295 43.257  1.00 23.41  ? 162 MET A C   1 
ATOM   1003 O O   . MET A 1 162 ? 24.759 41.335 43.733  1.00 23.41  ? 162 MET A O   1 
ATOM   1004 C CB  . MET A 1 162 ? 24.915 44.564 44.227  1.00 22.26  ? 162 MET A CB  1 
ATOM   1005 C CG  . MET A 1 162 ? 25.111 45.500 45.418  1.00 22.26  ? 162 MET A CG  1 
ATOM   1006 S SD  . MET A 1 162 ? 25.381 44.652 46.986  1.00 22.26  ? 162 MET A SD  1 
ATOM   1007 C CE  . MET A 1 162 ? 23.973 43.619 47.107  1.00 22.26  ? 162 MET A CE  1 
ATOM   1008 N N   . TYR A 1 163 ? 25.598 42.447 41.951  1.00 21.29  ? 163 TYR A N   1 
ATOM   1009 C CA  . TYR A 1 163 ? 25.156 41.480 40.957  1.00 21.29  ? 163 TYR A CA  1 
ATOM   1010 C C   . TYR A 1 163 ? 25.762 40.114 41.252  1.00 21.29  ? 163 TYR A C   1 
ATOM   1011 O O   . TYR A 1 163 ? 25.065 39.099 41.360  1.00 21.29  ? 163 TYR A O   1 
ATOM   1012 C CB  . TYR A 1 163 ? 25.599 41.922 39.569  1.00 27.46  ? 163 TYR A CB  1 
ATOM   1013 C CG  . TYR A 1 163 ? 25.196 40.971 38.463  1.00 27.46  ? 163 TYR A CG  1 
ATOM   1014 C CD1 . TYR A 1 163 ? 23.945 41.065 37.860  1.00 27.46  ? 163 TYR A CD1 1 
ATOM   1015 C CD2 . TYR A 1 163 ? 26.066 39.978 38.025  1.00 27.46  ? 163 TYR A CD2 1 
ATOM   1016 C CE1 . TYR A 1 163 ? 23.570 40.192 36.843  1.00 27.46  ? 163 TYR A CE1 1 
ATOM   1017 C CE2 . TYR A 1 163 ? 25.706 39.106 37.021  1.00 27.46  ? 163 TYR A CE2 1 
ATOM   1018 C CZ  . TYR A 1 163 ? 24.460 39.216 36.423  1.00 27.46  ? 163 TYR A CZ  1 
ATOM   1019 O OH  . TYR A 1 163 ? 24.120 38.373 35.380  1.00 27.46  ? 163 TYR A OH  1 
ATOM   1020 N N   . GLN A 1 164 ? 27.078 40.098 41.377  1.00 23.12  ? 164 GLN A N   1 
ATOM   1021 C CA  . GLN A 1 164 ? 27.768 38.864 41.648  1.00 23.12  ? 164 GLN A CA  1 
ATOM   1022 C C   . GLN A 1 164 ? 27.300 38.214 42.951  1.00 23.12  ? 164 GLN A C   1 
ATOM   1023 O O   . GLN A 1 164 ? 27.198 36.991 43.029  1.00 23.12  ? 164 GLN A O   1 
ATOM   1024 C CB  . GLN A 1 164 ? 29.276 39.116 41.641  1.00 30.11  ? 164 GLN A CB  1 
ATOM   1025 C CG  . GLN A 1 164 ? 29.763 39.698 40.313  1.00 30.11  ? 164 GLN A CG  1 
ATOM   1026 C CD  . GLN A 1 164 ? 31.266 39.831 40.232  1.00 30.11  ? 164 GLN A CD  1 
ATOM   1027 O OE1 . GLN A 1 164 ? 31.973 38.841 40.085  1.00 30.11  ? 164 GLN A OE1 1 
ATOM   1028 N NE2 . GLN A 1 164 ? 31.765 41.058 40.334  1.00 30.11  ? 164 GLN A NE2 1 
ATOM   1029 N N   . LEU A 1 165 ? 26.999 39.017 43.969  1.00 24.85  ? 165 LEU A N   1 
ATOM   1030 C CA  . LEU A 1 165 ? 26.528 38.450 45.225  1.00 24.85  ? 165 LEU A CA  1 
ATOM   1031 C C   . LEU A 1 165 ? 25.153 37.818 45.006  1.00 24.85  ? 165 LEU A C   1 
ATOM   1032 O O   . LEU A 1 165 ? 24.876 36.713 45.472  1.00 24.85  ? 165 LEU A O   1 
ATOM   1033 C CB  . LEU A 1 165 ? 26.455 39.527 46.309  1.00 19.06  ? 165 LEU A CB  1 
ATOM   1034 C CG  . LEU A 1 165 ? 25.716 39.235 47.625  1.00 19.06  ? 165 LEU A CG  1 
ATOM   1035 C CD1 . LEU A 1 165 ? 26.302 38.018 48.340  1.00 19.06  ? 165 LEU A CD1 1 
ATOM   1036 C CD2 . LEU A 1 165 ? 25.789 40.460 48.508  1.00 19.06  ? 165 LEU A CD2 1 
ATOM   1037 N N   . PHE A 1 166 ? 24.289 38.507 44.275  1.00 26.70  ? 166 PHE A N   1 
ATOM   1038 C CA  . PHE A 1 166 ? 22.968 37.959 44.036  1.00 26.70  ? 166 PHE A CA  1 
ATOM   1039 C C   . PHE A 1 166 ? 23.044 36.654 43.268  1.00 26.70  ? 166 PHE A C   1 
ATOM   1040 O O   . PHE A 1 166 ? 22.239 35.745 43.469  1.00 26.70  ? 166 PHE A O   1 
ATOM   1041 C CB  . PHE A 1 166 ? 22.094 38.970 43.303  1.00 15.81  ? 166 PHE A CB  1 
ATOM   1042 C CG  . PHE A 1 166 ? 21.510 40.001 44.204  1.00 15.81  ? 166 PHE A CG  1 
ATOM   1043 C CD1 . PHE A 1 166 ? 20.795 39.619 45.332  1.00 15.81  ? 166 PHE A CD1 1 
ATOM   1044 C CD2 . PHE A 1 166 ? 21.688 41.352 43.951  1.00 15.81  ? 166 PHE A CD2 1 
ATOM   1045 C CE1 . PHE A 1 166 ? 20.268 40.566 46.199  1.00 15.81  ? 166 PHE A CE1 1 
ATOM   1046 C CE2 . PHE A 1 166 ? 21.163 42.302 44.812  1.00 15.81  ? 166 PHE A CE2 1 
ATOM   1047 C CZ  . PHE A 1 166 ? 20.452 41.903 45.940  1.00 15.81  ? 166 PHE A CZ  1 
ATOM   1048 N N   . ARG A 1 167 ? 24.029 36.558 42.393  1.00 36.56  ? 167 ARG A N   1 
ATOM   1049 C CA  . ARG A 1 167 ? 24.196 35.352 41.618  1.00 36.56  ? 167 ARG A CA  1 
ATOM   1050 C C   . ARG A 1 167 ? 24.684 34.240 42.539  1.00 36.56  ? 167 ARG A C   1 
ATOM   1051 O O   . ARG A 1 167 ? 24.209 33.109 42.473  1.00 36.56  ? 167 ARG A O   1 
ATOM   1052 C CB  . ARG A 1 167 ? 25.193 35.593 40.496  1.00 35.25  ? 167 ARG A CB  1 
ATOM   1053 C CG  . ARG A 1 167 ? 25.194 34.513 39.452  1.00 35.25  ? 167 ARG A CG  1 
ATOM   1054 C CD  . ARG A 1 167 ? 26.048 34.929 38.290  1.00 35.25  ? 167 ARG A CD  1 
ATOM   1055 N NE  . ARG A 1 167 ? 26.250 33.830 37.367  1.00 35.25  ? 167 ARG A NE  1 
ATOM   1056 C CZ  . ARG A 1 167 ? 27.311 33.725 36.585  1.00 35.25  ? 167 ARG A CZ  1 
ATOM   1057 N NH1 . ARG A 1 167 ? 28.251 34.662 36.635  1.00 35.25  ? 167 ARG A NH1 1 
ATOM   1058 N NH2 . ARG A 1 167 ? 27.430 32.696 35.753  1.00 35.25  ? 167 ARG A NH2 1 
ATOM   1059 N N   . SER A 1 168 ? 25.623 34.560 43.418  1.00 31.54  ? 168 SER A N   1 
ATOM   1060 C CA  . SER A 1 168 ? 26.121 33.542 44.325  1.00 31.54  ? 168 SER A CA  1 
ATOM   1061 C C   . SER A 1 168 ? 24.994 33.039 45.224  1.00 31.54  ? 168 SER A C   1 
ATOM   1062 O O   . SER A 1 168 ? 24.991 31.885 45.632  1.00 31.54  ? 168 SER A O   1 
ATOM   1063 C CB  . SER A 1 168 ? 27.266 34.091 45.175  1.00 22.91  ? 168 SER A CB  1 
ATOM   1064 O OG  . SER A 1 168 ? 26.815 35.085 46.062  1.00 22.91  ? 168 SER A OG  1 
ATOM   1065 N N   . LEU A 1 169 ? 24.027 33.903 45.508  1.00 25.05  ? 169 LEU A N   1 
ATOM   1066 C CA  . LEU A 1 169 ? 22.928 33.537 46.379  1.00 25.05  ? 169 LEU A CA  1 
ATOM   1067 C C   . LEU A 1 169 ? 21.940 32.660 45.667  1.00 25.05  ? 169 LEU A C   1 
ATOM   1068 O O   . LEU A 1 169 ? 21.365 31.759 46.264  1.00 25.05  ? 169 LEU A O   1 
ATOM   1069 C CB  . LEU A 1 169 ? 22.228 34.786 46.910  1.00 26.63  ? 169 LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 169 ? 22.394 35.175 48.390  1.00 26.63  ? 169 LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 169 ? 23.849 35.228 48.786  1.00 26.63  ? 169 LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 169 ? 21.726 36.531 48.614  1.00 26.63  ? 169 LEU A CD2 1 
ATOM   1073 N N   . ALA A 1 170 ? 21.742 32.917 44.381  1.00 29.29  ? 170 ALA A N   1 
ATOM   1074 C CA  . ALA A 1 170 ? 20.808 32.122 43.601  1.00 29.29  ? 170 ALA A CA  1 
ATOM   1075 C C   . ALA A 1 170 ? 21.369 30.708 43.482  1.00 29.29  ? 170 ALA A C   1 
ATOM   1076 O O   . ALA A 1 170 ? 20.644 29.726 43.475  1.00 29.29  ? 170 ALA A O   1 
ATOM   1077 C CB  . ALA A 1 170 ? 20.625 32.740 42.230  1.00 8.31   ? 170 ALA A CB  1 
ATOM   1078 N N   . TYR A 1 171 ? 22.684 30.614 43.421  1.00 28.63  ? 171 TYR A N   1 
ATOM   1079 C CA  . TYR A 1 171 ? 23.320 29.328 43.282  1.00 28.63  ? 171 TYR A CA  1 
ATOM   1080 C C   . TYR A 1 171 ? 23.184 28.449 44.511  1.00 28.63  ? 171 TYR A C   1 
ATOM   1081 O O   . TYR A 1 171 ? 22.729 27.318 44.410  1.00 28.63  ? 171 TYR A O   1 
ATOM   1082 C CB  . TYR A 1 171 ? 24.789 29.517 42.941  1.00 35.01  ? 171 TYR A CB  1 
ATOM   1083 C CG  . TYR A 1 171 ? 25.518 28.219 42.790  1.00 35.01  ? 171 TYR A CG  1 
ATOM   1084 C CD1 . TYR A 1 171 ? 25.255 27.366 41.721  1.00 35.01  ? 171 TYR A CD1 1 
ATOM   1085 C CD2 . TYR A 1 171 ? 26.473 27.835 43.716  1.00 35.01  ? 171 TYR A CD2 1 
ATOM   1086 C CE1 . TYR A 1 171 ? 25.934 26.164 41.577  1.00 35.01  ? 171 TYR A CE1 1 
ATOM   1087 C CE2 . TYR A 1 171 ? 27.160 26.633 43.585  1.00 35.01  ? 171 TYR A CE2 1 
ATOM   1088 C CZ  . TYR A 1 171 ? 26.889 25.802 42.512  1.00 35.01  ? 171 TYR A CZ  1 
ATOM   1089 O OH  . TYR A 1 171 ? 27.601 24.627 42.370  1.00 35.01  ? 171 TYR A OH  1 
ATOM   1090 N N   . ILE A 1 172 ? 23.587 28.954 45.670  1.00 23.62  ? 172 ILE A N   1 
ATOM   1091 C CA  . ILE A 1 172 ? 23.492 28.170 46.891  1.00 23.62  ? 172 ILE A CA  1 
ATOM   1092 C C   . ILE A 1 172 ? 22.041 27.962 47.309  1.00 23.62  ? 172 ILE A C   1 
ATOM   1093 O O   . ILE A 1 172 ? 21.702 26.948 47.906  1.00 23.62  ? 172 ILE A O   1 
ATOM   1094 C CB  . ILE A 1 172 ? 24.263 28.822 48.051  1.00 20.34  ? 172 ILE A CB  1 
ATOM   1095 C CG1 . ILE A 1 172 ? 23.753 30.238 48.287  1.00 20.34  ? 172 ILE A CG1 1 
ATOM   1096 C CG2 . ILE A 1 172 ? 25.750 28.809 47.755  1.00 20.34  ? 172 ILE A CG2 1 
ATOM   1097 C CD1 . ILE A 1 172 ? 24.191 30.792 49.601  1.00 20.34  ? 172 ILE A CD1 1 
ATOM   1098 N N   . HIS A 1 173 ? 21.185 28.924 46.995  1.00 26.99  ? 173 HIS A N   1 
ATOM   1099 C CA  . HIS A 1 173 ? 19.779 28.796 47.338  1.00 26.99  ? 173 HIS A CA  1 
ATOM   1100 C C   . HIS A 1 173 ? 19.170 27.654 46.532  1.00 26.99  ? 173 HIS A C   1 
ATOM   1101 O O   . HIS A 1 173 ? 18.306 26.917 47.022  1.00 26.99  ? 173 HIS A O   1 
ATOM   1102 C CB  . HIS A 1 173 ? 19.021 30.103 47.054  1.00 22.05  ? 173 HIS A CB  1 
ATOM   1103 C CG  . HIS A 1 173 ? 19.186 31.149 48.120  1.00 22.05  ? 173 HIS A CG  1 
ATOM   1104 N ND1 . HIS A 1 173 ? 18.495 32.340 48.104  1.00 22.05  ? 173 HIS A ND1 1 
ATOM   1105 C CD2 . HIS A 1 173 ? 19.989 31.201 49.207  1.00 22.05  ? 173 HIS A CD2 1 
ATOM   1106 C CE1 . HIS A 1 173 ? 18.870 33.081 49.130  1.00 22.05  ? 173 HIS A CE1 1 
ATOM   1107 N NE2 . HIS A 1 173 ? 19.776 32.415 49.815  1.00 22.05  ? 173 HIS A NE2 1 
ATOM   1108 N N   . SER A 1 174 ? 19.635 27.499 45.297  1.00 35.53  ? 174 SER A N   1 
ATOM   1109 C CA  . SER A 1 174 ? 19.128 26.451 44.428  1.00 35.53  ? 174 SER A CA  1 
ATOM   1110 C C   . SER A 1 174 ? 19.321 25.091 45.082  1.00 35.53  ? 174 SER A C   1 
ATOM   1111 O O   . SER A 1 174 ? 18.616 24.149 44.748  1.00 35.53  ? 174 SER A O   1 
ATOM   1112 C CB  . SER A 1 174 ? 19.818 26.495 43.059  1.00 34.86  ? 174 SER A CB  1 
ATOM   1113 O OG  . SER A 1 174 ? 21.175 26.113 43.151  1.00 34.86  ? 174 SER A OG  1 
ATOM   1114 N N   . PHE A 1 175 ? 20.275 24.991 46.004  1.00 28.76  ? 175 PHE A N   1 
ATOM   1115 C CA  . PHE A 1 175 ? 20.525 23.749 46.724  1.00 28.76  ? 175 PHE A CA  1 
ATOM   1116 C C   . PHE A 1 175 ? 19.823 23.820 48.067  1.00 28.76  ? 175 PHE A C   1 
ATOM   1117 O O   . PHE A 1 175 ? 20.035 22.970 48.934  1.00 28.76  ? 175 PHE A O   1 
ATOM   1118 C CB  . PHE A 1 175 ? 22.016 23.543 46.980  1.00 47.49  ? 175 PHE A CB  1 
ATOM   1119 C CG  . PHE A 1 175 ? 22.815 23.237 45.749  1.00 47.49  ? 175 PHE A CG  1 
ATOM   1120 C CD1 . PHE A 1 175 ? 22.334 22.357 44.792  1.00 47.49  ? 175 PHE A CD1 1 
ATOM   1121 C CD2 . PHE A 1 175 ? 24.070 23.799 45.567  1.00 47.49  ? 175 PHE A CD2 1 
ATOM   1122 C CE1 . PHE A 1 175 ? 23.089 22.041 43.665  1.00 47.49  ? 175 PHE A CE1 1 
ATOM   1123 C CE2 . PHE A 1 175 ? 24.838 23.493 44.445  1.00 47.49  ? 175 PHE A CE2 1 
ATOM   1124 C CZ  . PHE A 1 175 ? 24.348 22.610 43.488  1.00 47.49  ? 175 PHE A CZ  1 
ATOM   1125 N N   . GLY A 1 176 ? 18.997 24.849 48.240  1.00 30.85  ? 176 GLY A N   1 
ATOM   1126 C CA  . GLY A 1 176 ? 18.283 25.042 49.491  1.00 30.85  ? 176 GLY A CA  1 
ATOM   1127 C C   . GLY A 1 176 ? 19.168 25.516 50.636  1.00 30.85  ? 176 GLY A C   1 
ATOM   1128 O O   . GLY A 1 176 ? 18.747 25.511 51.788  1.00 30.85  ? 176 GLY A O   1 
ATOM   1129 N N   . ILE A 1 177 ? 20.393 25.926 50.320  1.00 26.68  ? 177 ILE A N   1 
ATOM   1130 C CA  . ILE A 1 177 ? 21.331 26.394 51.333  1.00 26.68  ? 177 ILE A CA  1 
ATOM   1131 C C   . ILE A 1 177 ? 21.291 27.905 51.564  1.00 26.68  ? 177 ILE A C   1 
ATOM   1132 O O   . ILE A 1 177 ? 21.374 28.690 50.631  1.00 26.68  ? 177 ILE A O   1 
ATOM   1133 C CB  . ILE A 1 177 ? 22.770 25.997 50.980  1.00 30.66  ? 177 ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 177 ? 22.870 24.480 50.893  1.00 30.66  ? 177 ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 177 ? 23.733 26.511 52.044  1.00 30.66  ? 177 ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 177 ? 24.173 24.010 50.333  1.00 30.66  ? 177 ILE A CD1 1 
ATOM   1137 N N   . CYS A 1 178 ? 21.178 28.292 52.830  1.00 23.27  ? 178 CYS A N   1 
ATOM   1138 C CA  . CYS A 1 178 ? 21.106 29.688 53.233  1.00 23.27  ? 178 CYS A CA  1 
ATOM   1139 C C   . CYS A 1 178 ? 22.415 30.049 53.907  1.00 23.27  ? 178 CYS A C   1 
ATOM   1140 O O   . CYS A 1 178 ? 22.857 29.354 54.811  1.00 23.27  ? 178 CYS A O   1 
ATOM   1141 C CB  . CYS A 1 178 ? 19.943 29.859 54.198  1.00 24.81  ? 178 CYS A CB  1 
ATOM   1142 S SG  . CYS A 1 178 ? 19.595 31.517 54.719  1.00 24.81  ? 178 CYS A SG  1 
ATOM   1143 N N   . HIS A 1 179 ? 23.036 31.134 53.462  1.00 22.31  ? 179 HIS A N   1 
ATOM   1144 C CA  . HIS A 1 179 ? 24.314 31.543 54.023  1.00 22.31  ? 179 HIS A CA  1 
ATOM   1145 C C   . HIS A 1 179 ? 24.145 31.959 55.478  1.00 22.31  ? 179 HIS A C   1 
ATOM   1146 O O   . HIS A 1 179 ? 24.888 31.510 56.343  1.00 22.31  ? 179 HIS A O   1 
ATOM   1147 C CB  . HIS A 1 179 ? 24.914 32.683 53.184  1.00 20.53  ? 179 HIS A CB  1 
ATOM   1148 C CG  . HIS A 1 179 ? 26.342 32.992 53.511  1.00 20.53  ? 179 HIS A CG  1 
ATOM   1149 N ND1 . HIS A 1 179 ? 26.714 33.698 54.637  1.00 20.53  ? 179 HIS A ND1 1 
ATOM   1150 C CD2 . HIS A 1 179 ? 27.489 32.662 52.879  1.00 20.53  ? 179 HIS A CD2 1 
ATOM   1151 C CE1 . HIS A 1 179 ? 28.029 33.787 54.683  1.00 20.53  ? 179 HIS A CE1 1 
ATOM   1152 N NE2 . HIS A 1 179 ? 28.525 33.166 53.628  1.00 20.53  ? 179 HIS A NE2 1 
ATOM   1153 N N   . ARG A 1 180 ? 23.159 32.815 55.732  1.00 34.54  ? 180 ARG A N   1 
ATOM   1154 C CA  . ARG A 1 180 ? 22.849 33.292 57.075  1.00 34.54  ? 180 ARG A CA  1 
ATOM   1155 C C   . ARG A 1 180 ? 23.777 34.346 57.671  1.00 34.54  ? 180 ARG A C   1 
ATOM   1156 O O   . ARG A 1 180 ? 23.511 34.853 58.761  1.00 34.54  ? 180 ARG A O   1 
ATOM   1157 C CB  . ARG A 1 180 ? 22.798 32.129 58.039  1.00 18.15  ? 180 ARG A CB  1 
ATOM   1158 C CG  . ARG A 1 180 ? 21.666 31.199 57.856  1.00 18.15  ? 180 ARG A CG  1 
ATOM   1159 C CD  . ARG A 1 180 ? 22.049 29.996 58.616  1.00 18.15  ? 180 ARG A CD  1 
ATOM   1160 N NE  . ARG A 1 180 ? 21.007 29.512 59.487  1.00 18.15  ? 180 ARG A NE  1 
ATOM   1161 C CZ  . ARG A 1 180 ? 21.237 28.665 60.472  1.00 18.15  ? 180 ARG A CZ  1 
ATOM   1162 N NH1 . ARG A 1 180 ? 22.466 28.240 60.690  1.00 18.15  ? 180 ARG A NH1 1 
ATOM   1163 N NH2 . ARG A 1 180 ? 20.241 28.235 61.218  1.00 18.15  ? 180 ARG A NH2 1 
ATOM   1164 N N   . ASP A 1 181 ? 24.866 34.669 56.991  1.00 23.17  ? 181 ASP A N   1 
ATOM   1165 C CA  . ASP A 1 181 ? 25.770 35.676 57.525  1.00 23.17  ? 181 ASP A CA  1 
ATOM   1166 C C   . ASP A 1 181 ? 26.338 36.569 56.409  1.00 23.17  ? 181 ASP A C   1 
ATOM   1167 O O   . ASP A 1 181 ? 27.544 36.811 56.317  1.00 23.17  ? 181 ASP A O   1 
ATOM   1168 C CB  . ASP A 1 181 ? 26.885 34.987 58.326  1.00 30.39  ? 181 ASP A CB  1 
ATOM   1169 C CG  . ASP A 1 181 ? 27.696 35.960 59.165  1.00 30.39  ? 181 ASP A CG  1 
ATOM   1170 O OD1 . ASP A 1 181 ? 27.178 37.058 59.464  1.00 30.39  ? 181 ASP A OD1 1 
ATOM   1171 O OD2 . ASP A 1 181 ? 28.845 35.620 59.540  1.00 30.39  ? 181 ASP A OD2 1 
ATOM   1172 N N   . ILE A 1 182 ? 25.445 37.060 55.566  1.00 12.70  ? 182 ILE A N   1 
ATOM   1173 C CA  . ILE A 1 182 ? 25.854 37.913 54.481  1.00 12.70  ? 182 ILE A CA  1 
ATOM   1174 C C   . ILE A 1 182 ? 26.198 39.282 55.049  1.00 12.70  ? 182 ILE A C   1 
ATOM   1175 O O   . ILE A 1 182 ? 25.362 39.959 55.639  1.00 12.70  ? 182 ILE A O   1 
ATOM   1176 C CB  . ILE A 1 182 ? 24.733 38.035 53.417  1.00 18.50  ? 182 ILE A CB  1 
ATOM   1177 C CG1 . ILE A 1 182 ? 24.390 36.648 52.867  1.00 18.50  ? 182 ILE A CG1 1 
ATOM   1178 C CG2 . ILE A 1 182 ? 25.154 38.975 52.297  1.00 18.50  ? 182 ILE A CG2 1 
ATOM   1179 C CD1 . ILE A 1 182 ? 25.543 35.928 52.216  1.00 18.50  ? 182 ILE A CD1 1 
ATOM   1180 N N   . LYS A 1 183 ? 27.450 39.669 54.887  1.00 22.40  ? 183 LYS A N   1 
ATOM   1181 C CA  . LYS A 1 183 ? 27.912 40.947 55.372  1.00 22.40  ? 183 LYS A CA  1 
ATOM   1182 C C   . LYS A 1 183 ? 29.123 41.353 54.558  1.00 22.40  ? 183 LYS A C   1 
ATOM   1183 O O   . LYS A 1 183 ? 29.874 40.506 54.073  1.00 22.40  ? 183 LYS A O   1 
ATOM   1184 C CB  . LYS A 1 183 ? 28.284 40.868 56.852  1.00 28.78  ? 183 LYS A CB  1 
ATOM   1185 C CG  . LYS A 1 183 ? 29.327 39.814 57.188  1.00 28.78  ? 183 LYS A CG  1 
ATOM   1186 C CD  . LYS A 1 183 ? 29.784 39.987 58.614  1.00 28.78  ? 183 LYS A CD  1 
ATOM   1187 C CE  . LYS A 1 183 ? 30.439 38.737 59.150  1.00 28.78  ? 183 LYS A CE  1 
ATOM   1188 N NZ  . LYS A 1 183 ? 30.875 38.884 60.564  0.00 28.78  ? 183 LYS A NZ  1 
ATOM   1189 N N   . PRO A 1 184 ? 29.340 42.662 54.420  1.00 25.56  ? 184 PRO A N   1 
ATOM   1190 C CA  . PRO A 1 184 ? 30.454 43.232 53.664  1.00 25.56  ? 184 PRO A CA  1 
ATOM   1191 C C   . PRO A 1 184 ? 31.780 42.508 53.819  1.00 25.56  ? 184 PRO A C   1 
ATOM   1192 O O   . PRO A 1 184 ? 32.515 42.372 52.848  1.00 25.56  ? 184 PRO A O   1 
ATOM   1193 C CB  . PRO A 1 184 ? 30.509 44.667 54.173  1.00 20.25  ? 184 PRO A CB  1 
ATOM   1194 C CG  . PRO A 1 184 ? 29.075 44.965 54.462  1.00 20.25  ? 184 PRO A CG  1 
ATOM   1195 C CD  . PRO A 1 184 ? 28.617 43.710 55.158  1.00 20.25  ? 184 PRO A CD  1 
ATOM   1196 N N   . GLN A 1 185 ? 32.077 42.041 55.031  1.00 23.26  ? 185 GLN A N   1 
ATOM   1197 C CA  . GLN A 1 185 ? 33.335 41.341 55.304  1.00 23.26  ? 185 GLN A CA  1 
ATOM   1198 C C   . GLN A 1 185 ? 33.437 39.961 54.693  1.00 23.26  ? 185 GLN A C   1 
ATOM   1199 O O   . GLN A 1 185 ? 34.536 39.465 54.484  1.00 23.26  ? 185 GLN A O   1 
ATOM   1200 C CB  . GLN A 1 185 ? 33.586 41.205 56.807  1.00 41.92  ? 185 GLN A CB  1 
ATOM   1201 C CG  . GLN A 1 185 ? 33.616 42.510 57.564  1.00 41.92  ? 185 GLN A CG  1 
ATOM   1202 C CD  . GLN A 1 185 ? 32.273 42.847 58.164  1.00 41.92  ? 185 GLN A CD  1 
ATOM   1203 O OE1 . GLN A 1 185 ? 31.253 42.905 57.464  1.00 41.92  ? 185 GLN A OE1 1 
ATOM   1204 N NE2 . GLN A 1 185 ? 32.258 43.064 59.477  1.00 41.92  ? 185 GLN A NE2 1 
ATOM   1205 N N   . ASN A 1 186 ? 32.295 39.338 54.422  1.00 19.39  ? 186 ASN A N   1 
ATOM   1206 C CA  . ASN A 1 186 ? 32.293 38.011 53.829  1.00 19.39  ? 186 ASN A CA  1 
ATOM   1207 C C   . ASN A 1 186 ? 32.199 38.070 52.320  1.00 19.39  ? 186 ASN A C   1 
ATOM   1208 O O   . ASN A 1 186 ? 31.858 37.088 51.668  1.00 19.39  ? 186 ASN A O   1 
ATOM   1209 C CB  . ASN A 1 186 ? 31.158 37.164 54.390  1.00 23.19  ? 186 ASN A CB  1 
ATOM   1210 C CG  . ASN A 1 186 ? 31.369 36.812 55.841  1.00 23.19  ? 186 ASN A CG  1 
ATOM   1211 O OD1 . ASN A 1 186 ? 32.500 36.606 56.273  1.00 23.19  ? 186 ASN A OD1 1 
ATOM   1212 N ND2 . ASN A 1 186 ? 30.282 36.731 56.599  1.00 23.19  ? 186 ASN A ND2 1 
ATOM   1213 N N   . LEU A 1 187 ? 32.505 39.238 51.777  1.00 16.46  ? 187 LEU A N   1 
ATOM   1214 C CA  . LEU A 1 187 ? 32.499 39.433 50.345  1.00 16.46  ? 187 LEU A CA  1 
ATOM   1215 C C   . LEU A 1 187 ? 33.925 39.728 49.903  1.00 16.46  ? 187 LEU A C   1 
ATOM   1216 O O   . LEU A 1 187 ? 34.386 40.861 49.964  1.00 16.46  ? 187 LEU A O   1 
ATOM   1217 C CB  . LEU A 1 187 ? 31.578 40.590 49.966  1.00 21.42  ? 187 LEU A CB  1 
ATOM   1218 C CG  . LEU A 1 187 ? 30.114 40.438 50.384  1.00 21.42  ? 187 LEU A CG  1 
ATOM   1219 C CD1 . LEU A 1 187 ? 29.348 41.638 49.928  1.00 21.42  ? 187 LEU A CD1 1 
ATOM   1220 C CD2 . LEU A 1 187 ? 29.514 39.164 49.801  1.00 21.42  ? 187 LEU A CD2 1 
ATOM   1221 N N   . LEU A 1 188 ? 34.633 38.691 49.478  1.00 26.45  ? 188 LEU A N   1 
ATOM   1222 C CA  . LEU A 1 188 ? 36.004 38.848 49.028  1.00 26.45  ? 188 LEU A CA  1 
ATOM   1223 C C   . LEU A 1 188 ? 35.994 39.337 47.594  1.00 26.45  ? 188 LEU A C   1 
ATOM   1224 O O   . LEU A 1 188 ? 35.086 39.026 46.818  1.00 26.45  ? 188 LEU A O   1 
ATOM   1225 C CB  . LEU A 1 188 ? 36.745 37.515 49.088  1.00 28.74  ? 188 LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 188 ? 36.637 36.664 50.352  1.00 28.74  ? 188 LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 188 ? 37.412 35.392 50.137  1.00 28.74  ? 188 LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 188 ? 37.173 37.406 51.560  1.00 28.74  ? 188 LEU A CD2 1 
ATOM   1229 N N   . LEU A 1 189 ? 37.006 40.107 47.230  1.00 31.93  ? 189 LEU A N   1 
ATOM   1230 C CA  . LEU A 1 189 ? 37.075 40.596 45.873  1.00 31.93  ? 189 LEU A CA  1 
ATOM   1231 C C   . LEU A 1 189 ? 38.495 40.884 45.400  1.00 31.93  ? 189 LEU A C   1 
ATOM   1232 O O   . LEU A 1 189 ? 39.360 41.292 46.169  1.00 31.93  ? 189 LEU A O   1 
ATOM   1233 C CB  . LEU A 1 189 ? 36.168 41.824 45.716  1.00 28.57  ? 189 LEU A CB  1 
ATOM   1234 C CG  . LEU A 1 189 ? 36.507 43.170 46.340  1.00 28.57  ? 189 LEU A CG  1 
ATOM   1235 C CD1 . LEU A 1 189 ? 35.261 44.016 46.315  1.00 28.57  ? 189 LEU A CD1 1 
ATOM   1236 C CD2 . LEU A 1 189 ? 36.994 43.010 47.751  0.00 28.57  ? 189 LEU A CD2 1 
ATOM   1237 N N   . ASP A 1 190 ? 38.718 40.606 44.121  1.00 38.76  ? 190 ASP A N   1 
ATOM   1238 C CA  . ASP A 1 190 ? 39.991 40.812 43.451  1.00 38.76  ? 190 ASP A CA  1 
ATOM   1239 C C   . ASP A 1 190 ? 39.926 42.256 42.991  1.00 38.76  ? 190 ASP A C   1 
ATOM   1240 O O   . ASP A 1 190 ? 39.009 42.629 42.270  1.00 38.76  ? 190 ASP A O   1 
ATOM   1241 C CB  . ASP A 1 190 ? 40.082 39.881 42.245  1.00 48.51  ? 190 ASP A CB  1 
ATOM   1242 C CG  . ASP A 1 190 ? 41.351 40.069 41.456  1.00 48.51  ? 190 ASP A CG  1 
ATOM   1243 O OD1 . ASP A 1 190 ? 41.693 41.248 41.171  1.00 48.51  ? 190 ASP A OD1 1 
ATOM   1244 O OD2 . ASP A 1 190 ? 41.991 39.042 41.116  1.00 48.51  ? 190 ASP A OD2 1 
ATOM   1245 N N   . PRO A 1 191 ? 40.897 43.088 43.396  1.00 50.51  ? 191 PRO A N   1 
ATOM   1246 C CA  . PRO A 1 191 ? 40.897 44.501 43.005  1.00 50.51  ? 191 PRO A CA  1 
ATOM   1247 C C   . PRO A 1 191 ? 40.987 44.813 41.513  1.00 50.51  ? 191 PRO A C   1 
ATOM   1248 O O   . PRO A 1 191 ? 40.411 45.806 41.045  1.00 50.51  ? 191 PRO A O   1 
ATOM   1249 C CB  . PRO A 1 191 ? 42.060 45.080 43.803  1.00 49.44  ? 191 PRO A CB  1 
ATOM   1250 C CG  . PRO A 1 191 ? 42.989 43.914 43.959  1.00 49.44  ? 191 PRO A CG  1 
ATOM   1251 C CD  . PRO A 1 191 ? 42.057 42.772 44.253  1.00 49.44  ? 191 PRO A CD  1 
ATOM   1252 N N   . ASP A 1 192 ? 41.681 43.976 40.753  1.00 42.25  ? 192 ASP A N   1 
ATOM   1253 C CA  . ASP A 1 192 ? 41.802 44.245 39.327  1.00 42.25  ? 192 ASP A CA  1 
ATOM   1254 C C   . ASP A 1 192 ? 40.721 43.625 38.468  1.00 42.25  ? 192 ASP A C   1 
ATOM   1255 O O   . ASP A 1 192 ? 40.156 44.297 37.612  1.00 42.25  ? 192 ASP A O   1 
ATOM   1256 C CB  . ASP A 1 192 ? 43.175 43.814 38.841  1.00 49.21  ? 192 ASP A CB  1 
ATOM   1257 C CG  . ASP A 1 192 ? 44.270 44.582 39.523  1.00 49.21  ? 192 ASP A CG  1 
ATOM   1258 O OD1 . ASP A 1 192 ? 44.255 45.826 39.412  1.00 49.21  ? 192 ASP A OD1 1 
ATOM   1259 O OD2 . ASP A 1 192 ? 45.126 43.957 40.182  1.00 49.21  ? 192 ASP A OD2 1 
ATOM   1260 N N   . THR A 1 193 ? 40.426 42.350 38.684  1.00 29.33  ? 193 THR A N   1 
ATOM   1261 C CA  . THR A 1 193 ? 39.397 41.688 37.899  1.00 29.33  ? 193 THR A CA  1 
ATOM   1262 C C   . THR A 1 193 ? 37.991 42.148 38.290  1.00 29.33  ? 193 THR A C   1 
ATOM   1263 O O   . THR A 1 193 ? 37.080 42.157 37.464  1.00 29.33  ? 193 THR A O   1 
ATOM   1264 C CB  . THR A 1 193 ? 39.495 40.166 38.063  1.00 34.77  ? 193 THR A CB  1 
ATOM   1265 O OG1 . THR A 1 193 ? 39.388 39.823 39.450  1.00 34.77  ? 193 THR A OG1 1 
ATOM   1266 C CG2 . THR A 1 193 ? 40.823 39.671 37.532  1.00 34.77  ? 193 THR A CG2 1 
ATOM   1267 N N   . ALA A 1 194 ? 37.830 42.532 39.553  1.00 23.90  ? 194 ALA A N   1 
ATOM   1268 C CA  . ALA A 1 194 ? 36.550 42.986 40.087  1.00 23.90  ? 194 ALA A CA  1 
ATOM   1269 C C   . ALA A 1 194 ? 35.613 41.818 40.375  1.00 23.90  ? 194 ALA A C   1 
ATOM   1270 O O   . ALA A 1 194 ? 34.409 42.010 40.529  1.00 23.90  ? 194 ALA A O   1 
ATOM   1271 C CB  . ALA A 1 194 ? 35.873 43.964 39.118  1.00 9.74   ? 194 ALA A CB  1 
ATOM   1272 N N   . VAL A 1 195 ? 36.148 40.604 40.439  1.00 29.57  ? 195 VAL A N   1 
ATOM   1273 C CA  . VAL A 1 195 ? 35.279 39.473 40.713  1.00 29.57  ? 195 VAL A CA  1 
ATOM   1274 C C   . VAL A 1 195 ? 35.125 39.322 42.213  1.00 29.57  ? 195 VAL A C   1 
ATOM   1275 O O   . VAL A 1 195 ? 36.091 39.427 42.973  1.00 29.57  ? 195 VAL A O   1 
ATOM   1276 C CB  . VAL A 1 195 ? 35.783 38.129 40.049  1.00 32.11  ? 195 VAL A CB  1 
ATOM   1277 C CG1 . VAL A 1 195 ? 36.886 38.418 39.064  1.00 32.11  ? 195 VAL A CG1 1 
ATOM   1278 C CG2 . VAL A 1 195 ? 36.198 37.107 41.103  1.00 32.11  ? 195 VAL A CG2 1 
ATOM   1279 N N   . LEU A 1 196 ? 33.887 39.095 42.630  1.00 27.44  ? 196 LEU A N   1 
ATOM   1280 C CA  . LEU A 1 196 ? 33.576 38.954 44.032  1.00 27.44  ? 196 LEU A CA  1 
ATOM   1281 C C   . LEU A 1 196 ? 33.298 37.496 44.345  1.00 27.44  ? 196 LEU A C   1 
ATOM   1282 O O   . LEU A 1 196 ? 32.859 36.743 43.484  1.00 27.44  ? 196 LEU A O   1 
ATOM   1283 C CB  . LEU A 1 196 ? 32.375 39.843 44.368  1.00 15.60  ? 196 LEU A CB  1 
ATOM   1284 C CG  . LEU A 1 196 ? 31.772 39.758 45.762  1.00 15.60  ? 196 LEU A CG  1 
ATOM   1285 C CD1 . LEU A 1 196 ? 31.063 41.042 46.092  1.00 15.60  ? 196 LEU A CD1 1 
ATOM   1286 C CD2 . LEU A 1 196 ? 30.829 38.582 45.820  1.00 15.60  ? 196 LEU A CD2 1 
ATOM   1287 N N   . LYS A 1 197 ? 33.586 37.098 45.575  1.00 23.44  ? 197 LYS A N   1 
ATOM   1288 C CA  . LYS A 1 197 ? 33.353 35.730 45.990  1.00 23.44  ? 197 LYS A CA  1 
ATOM   1289 C C   . LYS A 1 197 ? 32.820 35.680 47.399  1.00 23.44  ? 197 LYS A C   1 
ATOM   1290 O O   . LYS A 1 197 ? 33.408 36.253 48.310  1.00 23.44  ? 197 LYS A O   1 
ATOM   1291 C CB  . LYS A 1 197 ? 34.641 34.922 45.888  1.00 30.76  ? 197 LYS A CB  1 
ATOM   1292 C CG  . LYS A 1 197 ? 35.011 34.626 44.472  1.00 30.76  ? 197 LYS A CG  1 
ATOM   1293 C CD  . LYS A 1 197 ? 36.302 33.890 44.382  1.00 30.76  ? 197 LYS A CD  1 
ATOM   1294 C CE  . LYS A 1 197 ? 36.624 33.624 42.930  1.00 30.76  ? 197 LYS A CE  1 
ATOM   1295 N NZ  . LYS A 1 197 ? 37.910 32.895 42.780  1.00 30.76  ? 197 LYS A NZ  1 
ATOM   1296 N N   . LEU A 1 198 ? 31.695 35.002 47.584  1.00 25.20  ? 198 LEU A N   1 
ATOM   1297 C CA  . LEU A 1 198 ? 31.133 34.912 48.916  1.00 25.20  ? 198 LEU A CA  1 
ATOM   1298 C C   . LEU A 1 198 ? 31.959 33.914 49.695  1.00 25.20  ? 198 LEU A C   1 
ATOM   1299 O O   . LEU A 1 198 ? 32.332 32.872 49.179  1.00 25.20  ? 198 LEU A O   1 
ATOM   1300 C CB  . LEU A 1 198 ? 29.685 34.455 48.883  1.00 24.11  ? 198 LEU A CB  1 
ATOM   1301 C CG  . LEU A 1 198 ? 28.877 34.984 50.062  1.00 24.11  ? 198 LEU A CG  1 
ATOM   1302 C CD1 . LEU A 1 198 ? 27.541 34.314 50.020  1.00 24.11  ? 198 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A 1 198 ? 29.551 34.722 51.391  0.00 24.11  ? 198 LEU A CD2 1 
ATOM   1304 N N   . CYS A 1 199 ? 32.259 34.237 50.940  1.00 21.99  ? 199 CYS A N   1 
ATOM   1305 C CA  . CYS A 1 199 ? 33.044 33.334 51.744  1.00 21.99  ? 199 CYS A CA  1 
ATOM   1306 C C   . CYS A 1 199 ? 32.413 33.097 53.097  1.00 21.99  ? 199 CYS A C   1 
ATOM   1307 O O   . CYS A 1 199 ? 31.312 33.560 53.378  1.00 21.99  ? 199 CYS A O   1 
ATOM   1308 C CB  . CYS A 1 199 ? 34.451 33.890 51.934  1.00 29.06  ? 199 CYS A CB  1 
ATOM   1309 S SG  . CYS A 1 199 ? 34.512 35.423 52.831  1.00 29.06  ? 199 CYS A SG  1 
ATOM   1310 N N   . ASP A 1 200 ? 33.131 32.344 53.919  1.00 24.47  ? 200 ASP A N   1 
ATOM   1311 C CA  . ASP A 1 200 ? 32.719 32.024 55.274  1.00 24.47  ? 200 ASP A CA  1 
ATOM   1312 C C   . ASP A 1 200 ? 31.352 31.376 55.428  1.00 24.47  ? 200 ASP A C   1 
ATOM   1313 O O   . ASP A 1 200 ? 30.389 32.028 55.813  1.00 24.47  ? 200 ASP A O   1 
ATOM   1314 C CB  . ASP A 1 200 ? 32.782 33.281 56.117  1.00 45.70  ? 200 ASP A CB  1 
ATOM   1315 C CG  . ASP A 1 200 ? 32.661 32.984 57.569  1.00 45.70  ? 200 ASP A CG  1 
ATOM   1316 O OD1 . ASP A 1 200 ? 33.267 31.971 58.004  1.00 45.70  ? 200 ASP A OD1 1 
ATOM   1317 O OD2 . ASP A 1 200 ? 31.968 33.759 58.270  1.00 45.70  ? 200 ASP A OD2 1 
ATOM   1318 N N   . PHE A 1 201 ? 31.285 30.082 55.146  1.00 23.81  ? 201 PHE A N   1 
ATOM   1319 C CA  . PHE A 1 201 ? 30.038 29.346 55.244  1.00 23.81  ? 201 PHE A CA  1 
ATOM   1320 C C   . PHE A 1 201 ? 29.875 28.656 56.579  1.00 23.81  ? 201 PHE A C   1 
ATOM   1321 O O   . PHE A 1 201 ? 29.098 27.731 56.720  1.00 23.81  ? 201 PHE A O   1 
ATOM   1322 C CB  . PHE A 1 201 ? 29.951 28.331 54.112  1.00 17.81  ? 201 PHE A CB  1 
ATOM   1323 C CG  . PHE A 1 201 ? 29.820 28.962 52.766  1.00 17.81  ? 201 PHE A CG  1 
ATOM   1324 C CD1 . PHE A 1 201 ? 30.888 29.655 52.209  1.00 17.81  ? 201 PHE A CD1 1 
ATOM   1325 C CD2 . PHE A 1 201 ? 28.609 28.929 52.086  1.00 17.81  ? 201 PHE A CD2 1 
ATOM   1326 C CE1 . PHE A 1 201 ? 30.746 30.313 50.989  1.00 17.81  ? 201 PHE A CE1 1 
ATOM   1327 C CE2 . PHE A 1 201 ? 28.458 29.580 50.873  1.00 17.81  ? 201 PHE A CE2 1 
ATOM   1328 C CZ  . PHE A 1 201 ? 29.522 30.277 50.320  1.00 17.81  ? 201 PHE A CZ  1 
ATOM   1329 N N   . GLY A 1 202 ? 30.604 29.142 57.567  1.00 20.45  ? 202 GLY A N   1 
ATOM   1330 C CA  . GLY A 1 202 ? 30.540 28.563 58.889  1.00 20.45  ? 202 GLY A CA  1 
ATOM   1331 C C   . GLY A 1 202 ? 29.183 28.704 59.538  1.00 20.45  ? 202 GLY A C   1 
ATOM   1332 O O   . GLY A 1 202 ? 28.952 28.139 60.604  1.00 20.45  ? 202 GLY A O   1 
ATOM   1333 N N   . SER A 1 203 ? 28.280 29.444 58.907  1.00 28.53  ? 203 SER A N   1 
ATOM   1334 C CA  . SER A 1 203 ? 26.944 29.627 59.474  1.00 28.53  ? 203 SER A CA  1 
ATOM   1335 C C   . SER A 1 203 ? 25.884 29.102 58.515  1.00 28.53  ? 203 SER A C   1 
ATOM   1336 O O   . SER A 1 203 ? 24.692 29.142 58.810  1.00 28.53  ? 203 SER A O   1 
ATOM   1337 C CB  . SER A 1 203 ? 26.690 31.114 59.776  1.00 27.90  ? 203 SER A CB  1 
ATOM   1338 O OG  . SER A 1 203 ? 27.546 31.584 60.800  1.00 27.90  ? 203 SER A OG  1 
ATOM   1339 N N   . ALA A 1 204 ? 26.341 28.601 57.371  1.00 22.96  ? 204 ALA A N   1 
ATOM   1340 C CA  . ALA A 1 204 ? 25.462 28.086 56.337  1.00 22.96  ? 204 ALA A CA  1 
ATOM   1341 C C   . ALA A 1 204 ? 24.753 26.827 56.773  1.00 22.96  ? 204 ALA A C   1 
ATOM   1342 O O   . ALA A 1 204 ? 25.292 26.003 57.520  1.00 22.96  ? 204 ALA A O   1 
ATOM   1343 C CB  . ALA A 1 204 ? 26.255 27.824 55.072  1.00 20.62  ? 204 ALA A CB  1 
ATOM   1344 N N   . LYS A 1 205 ? 23.533 26.674 56.292  1.00 33.91  ? 205 LYS A N   1 
ATOM   1345 C CA  . LYS A 1 205 ? 22.737 25.517 56.628  1.00 33.91  ? 205 LYS A CA  1 
ATOM   1346 C C   . LYS A 1 205 ? 21.677 25.306 55.566  1.00 33.91  ? 205 LYS A C   1 
ATOM   1347 O O   . LYS A 1 205 ? 21.088 26.255 55.060  1.00 33.91  ? 205 LYS A O   1 
ATOM   1348 C CB  . LYS A 1 205 ? 22.039 25.735 57.965  1.00 32.05  ? 205 LYS A CB  1 
ATOM   1349 C CG  . LYS A 1 205 ? 21.308 24.510 58.466  1.00 32.05  ? 205 LYS A CG  1 
ATOM   1350 C CD  . LYS A 1 205 ? 20.141 24.864 59.375  1.00 32.05  ? 205 LYS A CD  1 
ATOM   1351 C CE  . LYS A 1 205 ? 19.483 23.602 59.955  1.00 32.05  ? 205 LYS A CE  1 
ATOM   1352 N NZ  . LYS A 1 205 ? 18.258 23.874 60.780  1.00 32.05  ? 205 LYS A NZ  1 
ATOM   1353 N N   . GLN A 1 206 ? 21.429 24.057 55.212  1.00 36.97  ? 206 GLN A N   1 
ATOM   1354 C CA  . GLN A 1 206 ? 20.378 23.813 54.254  1.00 36.97  ? 206 GLN A CA  1 
ATOM   1355 C C   . GLN A 1 206 ? 19.094 23.860 55.061  1.00 36.97  ? 206 GLN A C   1 
ATOM   1356 O O   . GLN A 1 206 ? 18.964 23.134 56.036  1.00 36.97  ? 206 GLN A O   1 
ATOM   1357 C CB  . GLN A 1 206 ? 20.525 22.448 53.618  1.00 58.75  ? 206 GLN A CB  1 
ATOM   1358 C CG  . GLN A 1 206 ? 19.285 22.091 52.831  1.00 58.75  ? 206 GLN A CG  1 
ATOM   1359 C CD  . GLN A 1 206 ? 19.457 20.860 51.976  1.00 58.75  ? 206 GLN A CD  1 
ATOM   1360 O OE1 . GLN A 1 206 ? 18.467 20.295 51.484  1.00 58.75  ? 206 GLN A OE1 1 
ATOM   1361 N NE2 . GLN A 1 206 ? 20.719 20.434 51.779  1.00 58.75  ? 206 GLN A NE2 1 
ATOM   1362 N N   . LEU A 1 207 ? 18.158 24.719 54.659  1.00 40.39  ? 207 LEU A N   1 
ATOM   1363 C CA  . LEU A 1 207 ? 16.887 24.876 55.361  1.00 40.39  ? 207 LEU A CA  1 
ATOM   1364 C C   . LEU A 1 207 ? 15.795 23.974 54.801  1.00 40.39  ? 207 LEU A C   1 
ATOM   1365 O O   . LEU A 1 207 ? 15.569 23.924 53.585  1.00 40.39  ? 207 LEU A O   1 
ATOM   1366 C CB  . LEU A 1 207 ? 16.408 26.323 55.273  1.00 21.32  ? 207 LEU A CB  1 
ATOM   1367 C CG  . LEU A 1 207 ? 17.335 27.473 55.684  1.00 21.32  ? 207 LEU A CG  1 
ATOM   1368 C CD1 . LEU A 1 207 ? 16.665 28.788 55.319  1.00 21.32  ? 207 LEU A CD1 1 
ATOM   1369 C CD2 . LEU A 1 207 ? 17.652 27.420 57.172  1.00 21.32  ? 207 LEU A CD2 1 
ATOM   1370 N N   . VAL A 1 208 ? 15.109 23.268 55.691  1.00 39.57  ? 208 VAL A N   1 
ATOM   1371 C CA  . VAL A 1 208 ? 14.032 22.382 55.276  1.00 39.57  ? 208 VAL A CA  1 
ATOM   1372 C C   . VAL A 1 208 ? 12.716 22.826 55.879  1.00 39.57  ? 208 VAL A C   1 
ATOM   1373 O O   . VAL A 1 208 ? 12.600 22.933 57.103  1.00 39.57  ? 208 VAL A O   1 
ATOM   1374 C CB  . VAL A 1 208 ? 14.284 20.961 55.733  1.00 29.39  ? 208 VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 208 ? 13.162 20.075 55.254  1.00 29.39  ? 208 VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 208 ? 15.627 20.495 55.226  1.00 29.39  ? 208 VAL A CG2 1 
ATOM   1377 N N   . ARG A 1 209 ? 11.721 23.077 55.029  1.00 40.70  ? 209 ARG A N   1 
ATOM   1378 C CA  . ARG A 1 209 ? 10.412 23.505 55.520  1.00 40.70  ? 209 ARG A CA  1 
ATOM   1379 C C   . ARG A 1 209 ? 10.003 22.538 56.618  1.00 40.70  ? 209 ARG A C   1 
ATOM   1380 O O   . ARG A 1 209 ? 10.265 21.333 56.533  1.00 40.70  ? 209 ARG A O   1 
ATOM   1381 C CB  . ARG A 1 209 ? 9.368  23.483 54.398  1.00 85.10  ? 209 ARG A CB  1 
ATOM   1382 C CG  . ARG A 1 209 ? 8.128  24.315 54.682  0.00 85.10  ? 209 ARG A CG  1 
ATOM   1383 C CD  . ARG A 1 209 ? 7.075  24.073 53.620  0.00 85.10  ? 209 ARG A CD  1 
ATOM   1384 N NE  . ARG A 1 209 ? 7.679  23.980 52.296  1.00 85.10  ? 209 ARG A NE  1 
ATOM   1385 C CZ  . ARG A 1 209 ? 7.016  23.643 51.187  1.00 85.10  ? 209 ARG A CZ  1 
ATOM   1386 N NH1 . ARG A 1 209 ? 5.709  23.369 51.240  1.00 85.10  ? 209 ARG A NH1 1 
ATOM   1387 N NH2 . ARG A 1 209 ? 7.666  23.558 50.021  1.00 85.10  ? 209 ARG A NH2 1 
ATOM   1388 N N   . GLY A 1 210 ? 9.367  23.072 57.650  1.00 41.81  ? 210 GLY A N   1 
ATOM   1389 C CA  . GLY A 1 210 ? 8.960  22.243 58.764  1.00 41.81  ? 210 GLY A CA  1 
ATOM   1390 C C   . GLY A 1 210 ? 10.007 22.300 59.858  1.00 41.81  ? 210 GLY A C   1 
ATOM   1391 O O   . GLY A 1 210 ? 9.668  22.477 61.024  1.00 41.81  ? 210 GLY A O   1 
ATOM   1392 N N   . GLU A 1 211 ? 11.279 22.160 59.488  1.00 54.48  ? 211 GLU A N   1 
ATOM   1393 C CA  . GLU A 1 211 ? 12.385 22.194 60.457  1.00 54.48  ? 211 GLU A CA  1 
ATOM   1394 C C   . GLU A 1 211 ? 12.723 23.618 60.931  1.00 54.48  ? 211 GLU A C   1 
ATOM   1395 O O   . GLU A 1 211 ? 12.869 24.535 60.122  1.00 54.48  ? 211 GLU A O   1 
ATOM   1396 C CB  . GLU A 1 211 ? 13.649 21.548 59.859  1.00 81.01  ? 211 GLU A CB  1 
ATOM   1397 C CG  . GLU A 1 211 ? 13.657 20.017 59.844  1.00 81.01  ? 211 GLU A CG  1 
ATOM   1398 C CD  . GLU A 1 211 ? 14.987 19.435 59.329  1.00 81.01  ? 211 GLU A CD  1 
ATOM   1399 O OE1 . GLU A 1 211 ? 15.254 18.217 59.556  1.00 81.01  ? 211 GLU A OE1 1 
ATOM   1400 O OE2 . GLU A 1 211 ? 15.764 20.201 58.696  1.00 81.01  ? 211 GLU A OE2 1 
ATOM   1401 N N   . PRO A 1 212 ? 12.859 23.808 62.258  1.00 40.07  ? 212 PRO A N   1 
ATOM   1402 C CA  . PRO A 1 212 ? 13.176 25.089 62.912  1.00 40.07  ? 212 PRO A CA  1 
ATOM   1403 C C   . PRO A 1 212 ? 14.669 25.427 62.905  1.00 40.07  ? 212 PRO A C   1 
ATOM   1404 O O   . PRO A 1 212 ? 15.507 24.527 62.878  1.00 40.07  ? 212 PRO A O   1 
ATOM   1405 C CB  . PRO A 1 212 ? 12.657 24.869 64.325  1.00 38.64  ? 212 PRO A CB  1 
ATOM   1406 C CG  . PRO A 1 212 ? 13.068 23.416 64.564  1.00 38.64  ? 212 PRO A CG  1 
ATOM   1407 C CD  . PRO A 1 212 ? 12.631 22.750 63.266  1.00 38.64  ? 212 PRO A CD  1 
ATOM   1408 N N   . ASN A 1 213 ? 14.999 26.716 62.964  1.00 28.50  ? 213 ASN A N   1 
ATOM   1409 C CA  . ASN A 1 213 ? 16.403 27.132 62.953  1.00 28.50  ? 213 ASN A CA  1 
ATOM   1410 C C   . ASN A 1 213 ? 16.722 28.250 63.941  1.00 28.50  ? 213 ASN A C   1 
ATOM   1411 O O   . ASN A 1 213 ? 15.885 29.120 64.182  1.00 28.50  ? 213 ASN A O   1 
ATOM   1412 C CB  . ASN A 1 213 ? 16.771 27.582 61.551  1.00 27.76  ? 213 ASN A CB  1 
ATOM   1413 C CG  . ASN A 1 213 ? 16.288 26.628 60.502  1.00 27.76  ? 213 ASN A CG  1 
ATOM   1414 O OD1 . ASN A 1 213 ? 16.830 25.535 60.346  1.00 27.76  ? 213 ASN A OD1 1 
ATOM   1415 N ND2 . ASN A 1 213 ? 15.244 27.027 59.779  1.00 27.76  ? 213 ASN A ND2 1 
ATOM   1416 N N   . VAL A 1 214 ? 17.930 28.240 64.504  1.00 20.19  ? 214 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 214 ? 18.294 29.282 65.463  1.00 20.19  ? 214 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 214 ? 18.167 30.634 64.835  1.00 20.19  ? 214 VAL A C   1 
ATOM   1419 O O   . VAL A 1 214 ? 18.460 30.816 63.660  1.00 20.19  ? 214 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 214 ? 19.730 29.190 65.961  1.00 10.57  ? 214 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 214 ? 19.873 27.959 66.868  1.00 10.57  ? 214 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 214 ? 20.724 29.302 64.746  1.00 10.57  ? 214 VAL A CG2 1 
ATOM   1423 N N   . SER A 1 215 ? 17.758 31.599 65.636  1.00 27.64  ? 215 SER A N   1 
ATOM   1424 C CA  . SER A 1 215 ? 17.486 32.908 65.054  1.00 27.64  ? 215 SER A CA  1 
ATOM   1425 C C   . SER A 1 215 ? 18.557 33.923 65.452  1.00 27.64  ? 215 SER A C   1 
ATOM   1426 O O   . SER A 1 215 ? 18.393 35.131 65.345  1.00 27.64  ? 215 SER A O   1 
ATOM   1427 C CB  . SER A 1 215 ? 16.109 33.377 65.532  1.00 34.41  ? 215 SER A CB  1 
ATOM   1428 O OG  . SER A 1 215 ? 16.138 33.573 66.945  1.00 34.41  ? 215 SER A OG  1 
ATOM   1429 N N   . TYR A 1 216 ? 19.674 33.381 65.967  1.00 27.22  ? 216 TYR A N   1 
ATOM   1430 C CA  . TYR A 1 216 ? 20.797 34.231 66.337  1.00 27.22  ? 216 TYR A CA  1 
ATOM   1431 C C   . TYR A 1 216 ? 22.058 33.838 65.563  1.00 27.22  ? 216 TYR A C   1 
ATOM   1432 O O   . TYR A 1 216 ? 23.053 33.390 66.115  1.00 27.22  ? 216 TYR A O   1 
ATOM   1433 C CB  . TYR A 1 216 ? 21.038 34.067 67.838  1.00 34.54  ? 216 TYR A CB  1 
ATOM   1434 C CG  . TYR A 1 216 ? 21.243 32.629 68.161  1.00 34.54  ? 216 TYR A CG  1 
ATOM   1435 C CD1 . TYR A 1 216 ? 22.340 31.949 67.638  1.00 34.54  ? 216 TYR A CD1 1 
ATOM   1436 C CD2 . TYR A 1 216 ? 20.340 31.951 68.980  1.00 34.54  ? 216 TYR A CD2 1 
ATOM   1437 C CE1 . TYR A 1 216 ? 22.534 30.607 67.931  1.00 34.54  ? 216 TYR A CE1 1 
ATOM   1438 C CE2 . TYR A 1 216 ? 20.533 30.609 69.273  1.00 34.54  ? 216 TYR A CE2 1 
ATOM   1439 C CZ  . TYR A 1 216 ? 21.625 29.938 68.753  1.00 34.54  ? 216 TYR A CZ  1 
ATOM   1440 O OH  . TYR A 1 216 ? 21.848 28.613 69.075  1.00 34.54  ? 216 TYR A OH  1 
ATOM   1441 N N   . ILE A 1 217 ? 21.975 33.983 64.228  1.00 41.65  ? 217 ILE A N   1 
ATOM   1442 C CA  . ILE A 1 217 ? 23.089 33.559 63.390  1.00 41.65  ? 217 ILE A CA  1 
ATOM   1443 C C   . ILE A 1 217 ? 23.558 34.676 62.455  1.00 41.65  ? 217 ILE A C   1 
ATOM   1444 O O   . ILE A 1 217 ? 24.606 34.605 61.828  1.00 41.65  ? 217 ILE A O   1 
ATOM   1445 C CB  . ILE A 1 217 ? 22.626 32.356 62.568  1.00 29.43  ? 217 ILE A CB  1 
ATOM   1446 C CG1 . ILE A 1 217 ? 21.099 32.257 62.593  1.00 29.43  ? 217 ILE A CG1 1 
ATOM   1447 C CG2 . ILE A 1 217 ? 23.192 31.058 63.171  1.00 29.43  ? 217 ILE A CG2 1 
ATOM   1448 C CD1 . ILE A 1 217 ? 20.440 33.159 61.549  1.00 29.43  ? 217 ILE A CD1 1 
ATOM   1449 N N   . CYS A 1 218 ? 22.717 35.721 62.343  1.00 31.34  ? 218 CYS A N   1 
ATOM   1450 C CA  . CYS A 1 218 ? 23.042 36.804 61.423  1.00 31.34  ? 218 CYS A CA  1 
ATOM   1451 C C   . CYS A 1 218 ? 23.754 37.961 62.125  1.00 31.34  ? 218 CYS A C   1 
ATOM   1452 O O   . CYS A 1 218 ? 23.629 38.180 63.324  1.00 31.34  ? 218 CYS A O   1 
ATOM   1453 C CB  . CYS A 1 218 ? 21.744 37.298 60.784  1.00 31.69  ? 218 CYS A CB  1 
ATOM   1454 S SG  . CYS A 1 218 ? 22.030 38.092 59.187  1.00 31.69  ? 218 CYS A SG  1 
ATOM   1455 N N   . SER A 1 219 ? 24.559 38.692 61.331  1.00 23.25  ? 219 SER A N   1 
ATOM   1456 C CA  . SER A 1 219 ? 25.203 39.900 61.831  1.00 23.25  ? 219 SER A CA  1 
ATOM   1457 C C   . SER A 1 219 ? 24.239 41.038 62.172  1.00 23.25  ? 219 SER A C   1 
ATOM   1458 O O   . SER A 1 219 ? 23.228 41.249 61.515  1.00 23.25  ? 219 SER A O   1 
ATOM   1459 C CB  . SER A 1 219 ? 26.049 40.492 60.703  1.00 11.21  ? 219 SER A CB  1 
ATOM   1460 O OG  . SER A 1 219 ? 27.304 39.815 60.653  0.00 11.21  ? 219 SER A OG  1 
ATOM   1461 N N   . ARG A 1 220 ? 24.654 41.786 63.208  1.00 28.67  ? 220 ARG A N   1 
ATOM   1462 C CA  . ARG A 1 220 ? 23.784 42.856 63.657  1.00 28.67  ? 220 ARG A CA  1 
ATOM   1463 C C   . ARG A 1 220 ? 23.107 43.748 62.593  1.00 28.67  ? 220 ARG A C   1 
ATOM   1464 O O   . ARG A 1 220 ? 21.920 43.645 62.316  1.00 28.67  ? 220 ARG A O   1 
ATOM   1465 C CB  . ARG A 1 220 ? 24.565 43.773 64.640  0.00 67.76  ? 220 ARG A CB  1 
ATOM   1466 C CG  . ARG A 1 220 ? 24.656 43.163 66.039  0.00 67.76  ? 220 ARG A CG  1 
ATOM   1467 C CD  . ARG A 1 220 ? 25.838 43.724 66.839  0.00 67.76  ? 220 ARG A CD  1 
ATOM   1468 N NE  . ARG A 1 220 ? 25.543 45.078 67.317  1.00 67.76  ? 220 ARG A NE  1 
ATOM   1469 C CZ  . ARG A 1 220 ? 26.088 46.105 66.637  1.00 67.76  ? 220 ARG A CZ  1 
ATOM   1470 N NH1 . ARG A 1 220 ? 26.846 45.872 65.579  0.00 67.76  ? 220 ARG A NH1 1 
ATOM   1471 N NH2 . ARG A 1 220 ? 25.860 47.359 67.039  1.00 67.76  ? 220 ARG A NH2 1 
ATOM   1472 N N   . TYR A 1 221 ? 23.914 44.647 61.997  1.00 20.20  ? 221 TYR A N   1 
ATOM   1473 C CA  . TYR A 1 221 ? 23.368 45.518 60.960  1.00 20.20  ? 221 TYR A CA  1 
ATOM   1474 C C   . TYR A 1 221 ? 22.770 44.711 59.803  1.00 20.20  ? 221 TYR A C   1 
ATOM   1475 O O   . TYR A 1 221 ? 22.145 45.246 58.897  1.00 20.20  ? 221 TYR A O   1 
ATOM   1476 C CB  . TYR A 1 221 ? 24.492 46.420 60.445  1.00 47.15  ? 221 TYR A CB  1 
ATOM   1477 C CG  . TYR A 1 221 ? 25.111 47.157 61.578  1.00 47.15  ? 221 TYR A CG  1 
ATOM   1478 C CD1 . TYR A 1 221 ? 24.347 47.484 62.695  1.00 47.15  ? 221 TYR A CD1 1 
ATOM   1479 C CD2 . TYR A 1 221 ? 26.462 47.503 61.541  1.00 47.15  ? 221 TYR A CD2 1 
ATOM   1480 C CE1 . TYR A 1 221 ? 24.929 48.145 63.768  1.00 47.15  ? 221 TYR A CE1 1 
ATOM   1481 C CE2 . TYR A 1 221 ? 27.043 48.163 62.613  1.00 47.15  ? 221 TYR A CE2 1 
ATOM   1482 C CZ  . TYR A 1 221 ? 26.284 48.481 63.725  1.00 47.15  ? 221 TYR A CZ  1 
ATOM   1483 O OH  . TYR A 1 221 ? 26.870 49.083 64.822  1.00 47.15  ? 221 TYR A OH  1 
ATOM   1484 N N   . TYR A 1 222 ? 22.817 43.375 59.655  1.00 23.68  ? 222 TYR A N   1 
ATOM   1485 C CA  . TYR A 1 222 ? 22.209 42.776 58.469  1.00 23.68  ? 222 TYR A CA  1 
ATOM   1486 C C   . TYR A 1 222 ? 21.126 41.754 58.822  1.00 23.68  ? 222 TYR A C   1 
ATOM   1487 O O   . TYR A 1 222 ? 20.614 41.035 57.973  1.00 23.68  ? 222 TYR A O   1 
ATOM   1488 C CB  . TYR A 1 222 ? 23.315 42.110 57.649  1.00 22.29  ? 222 TYR A CB  1 
ATOM   1489 C CG  . TYR A 1 222 ? 24.478 43.031 57.538  1.00 22.29  ? 222 TYR A CG  1 
ATOM   1490 C CD1 . TYR A 1 222 ? 25.552 42.900 58.415  1.00 22.29  ? 222 TYR A CD1 1 
ATOM   1491 C CD2 . TYR A 1 222 ? 24.455 44.091 56.631  1.00 22.29  ? 222 TYR A CD2 1 
ATOM   1492 C CE1 . TYR A 1 222 ? 26.586 43.825 58.395  1.00 22.29  ? 222 TYR A CE1 1 
ATOM   1493 C CE2 . TYR A 1 222 ? 25.487 45.017 56.612  1.00 22.29  ? 222 TYR A CE2 1 
ATOM   1494 C CZ  . TYR A 1 222 ? 26.546 44.889 57.492  1.00 22.29  ? 222 TYR A CZ  1 
ATOM   1495 O OH  . TYR A 1 222 ? 27.571 45.815 57.488  1.00 22.29  ? 222 TYR A OH  1 
ATOM   1496 N N   . ARG A 1 223 ? 20.715 41.632 60.077  1.00 28.31  ? 223 ARG A N   1 
ATOM   1497 C CA  . ARG A 1 223 ? 19.701 40.658 60.443  1.00 28.31  ? 223 ARG A CA  1 
ATOM   1498 C C   . ARG A 1 223 ? 18.345 41.086 59.935  1.00 28.31  ? 223 ARG A C   1 
ATOM   1499 O O   . ARG A 1 223 ? 17.962 42.247 60.048  1.00 28.31  ? 223 ARG A O   1 
ATOM   1500 C CB  . ARG A 1 223 ? 19.627 40.500 61.953  1.00 36.69  ? 223 ARG A CB  1 
ATOM   1501 C CG  . ARG A 1 223 ? 20.971 40.587 62.639  1.00 36.69  ? 223 ARG A CG  1 
ATOM   1502 C CD  . ARG A 1 223 ? 20.551 39.890 63.938  1.00 36.69  ? 223 ARG A CD  1 
ATOM   1503 N NE  . ARG A 1 223 ? 19.662 38.735 64.093  1.00 36.69  ? 223 ARG A NE  1 
ATOM   1504 C CZ  . ARG A 1 223 ? 19.143 38.162 65.195  1.00 36.69  ? 223 ARG A CZ  1 
ATOM   1505 N NH1 . ARG A 1 223 ? 18.499 38.738 66.214  1.00 36.69  ? 223 ARG A NH1 1 
ATOM   1506 N NH2 . ARG A 1 223 ? 19.122 36.848 65.053  1.00 36.69  ? 223 ARG A NH2 1 
ATOM   1507 N N   . ALA A 1 224 ? 17.626 40.137 59.359  1.00 24.40  ? 224 ALA A N   1 
ATOM   1508 C CA  . ALA A 1 224 ? 16.295 40.398 58.859  1.00 24.40  ? 224 ALA A CA  1 
ATOM   1509 C C   . ALA A 1 224 ? 15.353 40.555 60.056  1.00 24.40  ? 224 ALA A C   1 
ATOM   1510 O O   . ALA A 1 224 ? 15.523 39.906 61.091  1.00 24.40  ? 224 ALA A O   1 
ATOM   1511 C CB  . ALA A 1 224 ? 15.845 39.244 57.980  1.00 16.64  ? 224 ALA A CB  1 
ATOM   1512 N N   . PRO A 1 225 ? 14.347 41.424 59.928  1.00 28.21  ? 225 PRO A N   1 
ATOM   1513 C CA  . PRO A 1 225 ? 13.382 41.656 61.005  1.00 28.21  ? 225 PRO A CA  1 
ATOM   1514 C C   . PRO A 1 225 ? 12.925 40.389 61.726  1.00 28.21  ? 225 PRO A C   1 
ATOM   1515 O O   . PRO A 1 225 ? 12.790 40.377 62.949  1.00 28.21  ? 225 PRO A O   1 
ATOM   1516 C CB  . PRO A 1 225 ? 12.234 42.373 60.292  1.00 27.42  ? 225 PRO A CB  1 
ATOM   1517 C CG  . PRO A 1 225 ? 12.502 42.144 58.800  1.00 27.42  ? 225 PRO A CG  1 
ATOM   1518 C CD  . PRO A 1 225 ? 13.978 42.181 58.724  1.00 27.42  ? 225 PRO A CD  1 
ATOM   1519 N N   . GLU A 1 226 ? 12.692 39.325 60.962  1.00 36.44  ? 226 GLU A N   1 
ATOM   1520 C CA  . GLU A 1 226 ? 12.262 38.043 61.517  1.00 36.44  ? 226 GLU A CA  1 
ATOM   1521 C C   . GLU A 1 226 ? 13.296 37.519 62.514  1.00 36.44  ? 226 GLU A C   1 
ATOM   1522 O O   . GLU A 1 226 ? 12.961 37.053 63.608  1.00 36.44  ? 226 GLU A O   1 
ATOM   1523 C CB  . GLU A 1 226 ? 12.103 37.012 60.408  1.00 33.70  ? 226 GLU A CB  1 
ATOM   1524 C CG  . GLU A 1 226 ? 11.499 37.565 59.156  1.00 33.70  ? 226 GLU A CG  1 
ATOM   1525 C CD  . GLU A 1 226 ? 12.524 37.794 58.075  1.00 33.70  ? 226 GLU A CD  1 
ATOM   1526 O OE1 . GLU A 1 226 ? 12.969 36.799 57.448  1.00 33.70  ? 226 GLU A OE1 1 
ATOM   1527 O OE2 . GLU A 1 226 ? 12.883 38.971 57.865  1.00 33.70  ? 226 GLU A OE2 1 
ATOM   1528 N N   . LEU A 1 227 ? 14.561 37.571 62.123  1.00 28.87  ? 227 LEU A N   1 
ATOM   1529 C CA  . LEU A 1 227 ? 15.597 37.115 63.014  1.00 28.87  ? 227 LEU A CA  1 
ATOM   1530 C C   . LEU A 1 227 ? 15.503 37.948 64.291  1.00 28.87  ? 227 LEU A C   1 
ATOM   1531 O O   . LEU A 1 227 ? 15.635 37.423 65.385  1.00 28.87  ? 227 LEU A O   1 
ATOM   1532 C CB  . LEU A 1 227 ? 16.961 37.278 62.339  1.00 20.76  ? 227 LEU A CB  1 
ATOM   1533 C CG  . LEU A 1 227 ? 17.100 36.496 61.027  1.00 20.76  ? 227 LEU A CG  1 
ATOM   1534 C CD1 . LEU A 1 227 ? 18.488 36.720 60.459  1.00 20.76  ? 227 LEU A CD1 1 
ATOM   1535 C CD2 . LEU A 1 227 ? 16.841 35.009 61.259  1.00 20.76  ? 227 LEU A CD2 1 
ATOM   1536 N N   . ILE A 1 228 ? 15.244 39.244 64.136  1.00 25.06  ? 228 ILE A N   1 
ATOM   1537 C CA  . ILE A 1 228 ? 15.138 40.168 65.259  1.00 25.06  ? 228 ILE A CA  1 
ATOM   1538 C C   . ILE A 1 228 ? 13.943 39.810 66.118  1.00 25.06  ? 228 ILE A C   1 
ATOM   1539 O O   . ILE A 1 228 ? 13.978 39.924 67.336  1.00 25.06  ? 228 ILE A O   1 
ATOM   1540 C CB  . ILE A 1 228 ? 14.978 41.619 64.770  1.00 24.30  ? 228 ILE A CB  1 
ATOM   1541 C CG1 . ILE A 1 228 ? 16.204 42.027 63.945  1.00 24.30  ? 228 ILE A CG1 1 
ATOM   1542 C CG2 . ILE A 1 228 ? 14.785 42.548 65.960  1.00 24.30  ? 228 ILE A CG2 1 
ATOM   1543 C CD1 . ILE A 1 228 ? 16.122 43.415 63.307  1.00 24.30  ? 228 ILE A CD1 1 
ATOM   1544 N N   . PHE A 1 229 ? 12.875 39.390 65.466  1.00 20.97  ? 229 PHE A N   1 
ATOM   1545 C CA  . PHE A 1 229 ? 11.680 38.985 66.171  1.00 20.97  ? 229 PHE A CA  1 
ATOM   1546 C C   . PHE A 1 229 ? 11.830 37.548 66.670  1.00 20.97  ? 229 PHE A C   1 
ATOM   1547 O O   . PHE A 1 229 ? 10.879 36.968 67.166  1.00 20.97  ? 229 PHE A O   1 
ATOM   1548 C CB  . PHE A 1 229 ? 10.456 39.087 65.259  1.00 31.34  ? 229 PHE A CB  1 
ATOM   1549 C CG  . PHE A 1 229 ? 9.930  40.480 65.104  1.00 31.34  ? 229 PHE A CG  1 
ATOM   1550 C CD1 . PHE A 1 229 ? 9.581  41.227 66.219  1.00 31.34  ? 229 PHE A CD1 1 
ATOM   1551 C CD2 . PHE A 1 229 ? 9.770  41.046 63.840  1.00 31.34  ? 229 PHE A CD2 1 
ATOM   1552 C CE1 . PHE A 1 229 ? 9.081  42.524 66.083  1.00 31.34  ? 229 PHE A CE1 1 
ATOM   1553 C CE2 . PHE A 1 229 ? 9.272  42.341 63.694  1.00 31.34  ? 229 PHE A CE2 1 
ATOM   1554 C CZ  . PHE A 1 229 ? 8.928  43.081 64.816  1.00 31.34  ? 229 PHE A CZ  1 
ATOM   1555 N N   . GLY A 1 230 ? 13.020 36.978 66.529  1.00 25.31  ? 230 GLY A N   1 
ATOM   1556 C CA  . GLY A 1 230 ? 13.251 35.621 66.999  1.00 25.31  ? 230 GLY A CA  1 
ATOM   1557 C C   . GLY A 1 230 ? 12.540 34.473 66.277  1.00 25.31  ? 230 GLY A C   1 
ATOM   1558 O O   . GLY A 1 230 ? 12.422 33.379 66.835  1.00 25.31  ? 230 GLY A O   1 
ATOM   1559 N N   . ALA A 1 231 ? 12.069 34.703 65.051  1.00 21.06  ? 231 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 231 ? 11.406 33.657 64.275  1.00 21.06  ? 231 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 231 ? 12.369 32.492 64.085  1.00 21.06  ? 231 ALA A C   1 
ATOM   1562 O O   . ALA A 1 231 ? 13.576 32.698 63.997  1.00 21.06  ? 231 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 231 ? 10.976 34.202 62.915  1.00 14.27  ? 231 ALA A CB  1 
ATOM   1564 N N   . THR A 1 232 ? 11.843 31.272 64.033  1.00 25.78  ? 232 THR A N   1 
ATOM   1565 C CA  . THR A 1 232 ? 12.701 30.106 63.849  1.00 25.78  ? 232 THR A CA  1 
ATOM   1566 C C   . THR A 1 232 ? 12.293 29.338 62.605  1.00 25.78  ? 232 THR A C   1 
ATOM   1567 O O   . THR A 1 232 ? 12.861 28.290 62.290  1.00 25.78  ? 232 THR A O   1 
ATOM   1568 C CB  . THR A 1 232 ? 12.645 29.150 65.054  1.00 38.77  ? 232 THR A CB  1 
ATOM   1569 O OG1 . THR A 1 232 ? 11.361 28.521 65.115  1.00 38.77  ? 232 THR A OG1 1 
ATOM   1570 C CG2 . THR A 1 232 ? 12.890 29.910 66.337  1.00 38.77  ? 232 THR A CG2 1 
ATOM   1571 N N   . ASP A 1 233 ? 11.308 29.881 61.900  1.00 29.45  ? 233 ASP A N   1 
ATOM   1572 C CA  . ASP A 1 233 ? 10.795 29.289 60.670  1.00 29.45  ? 233 ASP A CA  1 
ATOM   1573 C C   . ASP A 1 233 ? 11.153 30.180 59.476  1.00 29.45  ? 233 ASP A C   1 
ATOM   1574 O O   . ASP A 1 233 ? 10.468 30.161 58.454  1.00 29.45  ? 233 ASP A O   1 
ATOM   1575 C CB  . ASP A 1 233 ? 9.273  29.161 60.760  1.00 35.57  ? 233 ASP A CB  1 
ATOM   1576 C CG  . ASP A 1 233 ? 8.592  30.509 60.852  1.00 35.57  ? 233 ASP A CG  1 
ATOM   1577 O OD1 . ASP A 1 233 ? 9.239  31.464 61.316  1.00 35.57  ? 233 ASP A OD1 1 
ATOM   1578 O OD2 . ASP A 1 233 ? 7.415  30.622 60.475  1.00 35.57  ? 233 ASP A OD2 1 
ATOM   1579 N N   . TYR A 1 234 ? 12.213 30.969 59.610  1.00 23.50  ? 234 TYR A N   1 
ATOM   1580 C CA  . TYR A 1 234 ? 12.622 31.848 58.524  1.00 23.50  ? 234 TYR A CA  1 
ATOM   1581 C C   . TYR A 1 234 ? 13.056 31.070 57.285  1.00 23.50  ? 234 TYR A C   1 
ATOM   1582 O O   . TYR A 1 234 ? 13.426 29.896 57.361  1.00 23.50  ? 234 TYR A O   1 
ATOM   1583 C CB  . TYR A 1 234 ? 13.738 32.791 58.987  1.00 16.93  ? 234 TYR A CB  1 
ATOM   1584 C CG  . TYR A 1 234 ? 14.973 32.120 59.545  1.00 16.93  ? 234 TYR A CG  1 
ATOM   1585 C CD1 . TYR A 1 234 ? 15.953 31.609 58.704  1.00 16.93  ? 234 TYR A CD1 1 
ATOM   1586 C CD2 . TYR A 1 234 ? 15.170 32.017 60.916  1.00 16.93  ? 234 TYR A CD2 1 
ATOM   1587 C CE1 . TYR A 1 234 ? 17.092 31.016 59.214  1.00 16.93  ? 234 TYR A CE1 1 
ATOM   1588 C CE2 . TYR A 1 234 ? 16.307 31.423 61.434  1.00 16.93  ? 234 TYR A CE2 1 
ATOM   1589 C CZ  . TYR A 1 234 ? 17.261 30.924 60.581  1.00 16.93  ? 234 TYR A CZ  1 
ATOM   1590 O OH  . TYR A 1 234 ? 18.364 30.299 61.097  1.00 16.93  ? 234 TYR A OH  1 
ATOM   1591 N N   . THR A 1 235 ? 12.990 31.734 56.139  1.00 28.45  ? 235 THR A N   1 
ATOM   1592 C CA  . THR A 1 235 ? 13.360 31.128 54.873  1.00 28.45  ? 235 THR A CA  1 
ATOM   1593 C C   . THR A 1 235 ? 14.672 31.711 54.432  1.00 28.45  ? 235 THR A C   1 
ATOM   1594 O O   . THR A 1 235 ? 15.094 32.748 54.937  1.00 28.45  ? 235 THR A O   1 
ATOM   1595 C CB  . THR A 1 235 ? 12.335 31.441 53.800  1.00 25.35  ? 235 THR A CB  1 
ATOM   1596 O OG1 . THR A 1 235 ? 12.297 32.856 53.584  1.00 25.35  ? 235 THR A OG1 1 
ATOM   1597 C CG2 . THR A 1 235 ? 10.969 30.983 54.234  1.00 25.35  ? 235 THR A CG2 1 
ATOM   1598 N N   . SER A 1 236 ? 15.313 31.062 53.471  1.00 27.63  ? 236 SER A N   1 
ATOM   1599 C CA  . SER A 1 236 ? 16.593 31.554 52.991  1.00 27.63  ? 236 SER A CA  1 
ATOM   1600 C C   . SER A 1 236 ? 16.502 32.981 52.447  1.00 27.63  ? 236 SER A C   1 
ATOM   1601 O O   . SER A 1 236 ? 17.507 33.550 52.052  1.00 27.63  ? 236 SER A O   1 
ATOM   1602 C CB  . SER A 1 236 ? 17.159 30.625 51.920  1.00 18.08  ? 236 SER A CB  1 
ATOM   1603 O OG  . SER A 1 236 ? 16.497 30.813 50.696  1.00 18.08  ? 236 SER A OG  1 
ATOM   1604 N N   . SER A 1 237 ? 15.315 33.575 52.435  1.00 27.48  ? 237 SER A N   1 
ATOM   1605 C CA  . SER A 1 237 ? 15.233 34.925 51.918  1.00 27.48  ? 237 SER A CA  1 
ATOM   1606 C C   . SER A 1 237 ? 15.835 35.942 52.879  1.00 27.48  ? 237 SER A C   1 
ATOM   1607 O O   . SER A 1 237 ? 15.849 37.139 52.588  1.00 27.48  ? 237 SER A O   1 
ATOM   1608 C CB  . SER A 1 237 ? 13.795 35.314 51.560  1.00 24.33  ? 237 SER A CB  1 
ATOM   1609 O OG  . SER A 1 237 ? 13.001 35.535 52.702  1.00 24.33  ? 237 SER A OG  1 
ATOM   1610 N N   . ILE A 1 238 ? 16.331 35.481 54.025  1.00 29.83  ? 238 ILE A N   1 
ATOM   1611 C CA  . ILE A 1 238 ? 16.966 36.407 54.956  1.00 29.83  ? 238 ILE A CA  1 
ATOM   1612 C C   . ILE A 1 238 ? 18.305 36.855 54.347  1.00 29.83  ? 238 ILE A C   1 
ATOM   1613 O O   . ILE A 1 238 ? 18.841 37.895 54.706  1.00 29.83  ? 238 ILE A O   1 
ATOM   1614 C CB  . ILE A 1 238 ? 17.233 35.776 56.343  1.00 23.63  ? 238 ILE A CB  1 
ATOM   1615 C CG1 . ILE A 1 238 ? 18.061 34.508 56.198  1.00 23.63  ? 238 ILE A CG1 1 
ATOM   1616 C CG2 . ILE A 1 238 ? 15.936 35.494 57.044  1.00 23.63  ? 238 ILE A CG2 1 
ATOM   1617 C CD1 . ILE A 1 238 ? 18.605 34.016 57.513  1.00 23.63  ? 238 ILE A CD1 1 
ATOM   1618 N N   . ASP A 1 239 ? 18.838 36.054 53.428  1.00 27.51  ? 239 ASP A N   1 
ATOM   1619 C CA  . ASP A 1 239 ? 20.077 36.381 52.743  1.00 27.51  ? 239 ASP A CA  1 
ATOM   1620 C C   . ASP A 1 239 ? 19.827 37.573 51.833  1.00 27.51  ? 239 ASP A C   1 
ATOM   1621 O O   . ASP A 1 239 ? 20.704 38.409 51.627  1.00 27.51  ? 239 ASP A O   1 
ATOM   1622 C CB  . ASP A 1 239 ? 20.563 35.209 51.898  1.00 21.27  ? 239 ASP A CB  1 
ATOM   1623 C CG  . ASP A 1 239 ? 21.273 34.163 52.713  1.00 21.27  ? 239 ASP A CG  1 
ATOM   1624 O OD1 . ASP A 1 239 ? 21.701 34.480 53.840  1.00 21.27  ? 239 ASP A OD1 1 
ATOM   1625 O OD2 . ASP A 1 239 ? 21.421 33.027 52.218  1.00 21.27  ? 239 ASP A OD2 1 
ATOM   1626 N N   . VAL A 1 240 ? 18.620 37.654 51.293  1.00 23.41  ? 240 VAL A N   1 
ATOM   1627 C CA  . VAL A 1 240 ? 18.275 38.756 50.406  1.00 23.41  ? 240 VAL A CA  1 
ATOM   1628 C C   . VAL A 1 240 ? 18.175 40.088 51.158  1.00 23.41  ? 240 VAL A C   1 
ATOM   1629 O O   . VAL A 1 240 ? 18.592 41.127 50.653  1.00 23.41  ? 240 VAL A O   1 
ATOM   1630 C CB  . VAL A 1 240 ? 16.961 38.454 49.669  1.00 19.10  ? 240 VAL A CB  1 
ATOM   1631 C CG1 . VAL A 1 240 ? 16.540 39.637 48.821  1.00 19.10  ? 240 VAL A CG1 1 
ATOM   1632 C CG2 . VAL A 1 240 ? 17.149 37.224 48.803  1.00 19.10  ? 240 VAL A CG2 1 
ATOM   1633 N N   . TRP A 1 241 ? 17.629 40.041 52.372  1.00 22.76  ? 241 TRP A N   1 
ATOM   1634 C CA  . TRP A 1 241 ? 17.485 41.224 53.202  1.00 22.76  ? 241 TRP A CA  1 
ATOM   1635 C C   . TRP A 1 241 ? 18.878 41.777 53.473  1.00 22.76  ? 241 TRP A C   1 
ATOM   1636 O O   . TRP A 1 241 ? 19.139 42.964 53.295  1.00 22.76  ? 241 TRP A O   1 
ATOM   1637 C CB  . TRP A 1 241 ? 16.777 40.862 54.521  1.00 20.47  ? 241 TRP A CB  1 
ATOM   1638 C CG  . TRP A 1 241 ? 16.707 42.011 55.513  1.00 20.47  ? 241 TRP A CG  1 
ATOM   1639 C CD1 . TRP A 1 241 ? 17.689 42.406 56.369  1.00 20.47  ? 241 TRP A CD1 1 
ATOM   1640 C CD2 . TRP A 1 241 ? 15.647 42.967 55.656  1.00 20.47  ? 241 TRP A CD2 1 
ATOM   1641 N NE1 . TRP A 1 241 ? 17.320 43.542 57.025  1.00 20.47  ? 241 TRP A NE1 1 
ATOM   1642 C CE2 . TRP A 1 241 ? 16.072 43.912 56.613  1.00 20.47  ? 241 TRP A CE2 1 
ATOM   1643 C CE3 . TRP A 1 241 ? 14.385 43.118 55.066  1.00 20.47  ? 241 TRP A CE3 1 
ATOM   1644 C CZ2 . TRP A 1 241 ? 15.276 45.005 56.998  1.00 20.47  ? 241 TRP A CZ2 1 
ATOM   1645 C CZ3 . TRP A 1 241 ? 13.593 44.206 55.447  1.00 20.47  ? 241 TRP A CZ3 1 
ATOM   1646 C CH2 . TRP A 1 241 ? 14.044 45.132 56.406  1.00 20.47  ? 241 TRP A CH2 1 
ATOM   1647 N N   . SER A 1 242 ? 19.767 40.892 53.897  1.00 23.50  ? 242 SER A N   1 
ATOM   1648 C CA  . SER A 1 242 ? 21.140 41.257 54.188  1.00 23.50  ? 242 SER A CA  1 
ATOM   1649 C C   . SER A 1 242 ? 21.789 41.915 52.989  1.00 23.50  ? 242 SER A C   1 
ATOM   1650 O O   . SER A 1 242 ? 22.464 42.931 53.125  1.00 23.50  ? 242 SER A O   1 
ATOM   1651 C CB  . SER A 1 242 ? 21.951 40.020 54.559  1.00 29.39  ? 242 SER A CB  1 
ATOM   1652 O OG  . SER A 1 242 ? 21.385 39.370 55.673  1.00 29.39  ? 242 SER A OG  1 
ATOM   1653 N N   . ALA A 1 243 ? 21.589 41.311 51.819  1.00 26.63  ? 243 ALA A N   1 
ATOM   1654 C CA  . ALA A 1 243 ? 22.159 41.813 50.586  1.00 26.63  ? 243 ALA A CA  1 
ATOM   1655 C C   . ALA A 1 243 ? 21.642 43.218 50.348  1.00 26.63  ? 243 ALA A C   1 
ATOM   1656 O O   . ALA A 1 243 ? 22.400 44.111 49.976  1.00 26.63  ? 243 ALA A O   1 
ATOM   1657 C CB  . ALA A 1 243 ? 21.785 40.905 49.436  1.00 21.53  ? 243 ALA A CB  1 
ATOM   1658 N N   . GLY A 1 244 ? 20.347 43.413 50.564  1.00 28.52  ? 244 GLY A N   1 
ATOM   1659 C CA  . GLY A 1 244 ? 19.781 44.732 50.389  1.00 28.52  ? 244 GLY A CA  1 
ATOM   1660 C C   . GLY A 1 244 ? 20.447 45.715 51.338  1.00 28.52  ? 244 GLY A C   1 
ATOM   1661 O O   . GLY A 1 244 ? 20.545 46.900 51.045  1.00 28.52  ? 244 GLY A O   1 
ATOM   1662 N N   . CYS A 1 245 ? 20.907 45.216 52.481  1.00 29.37  ? 245 CYS A N   1 
ATOM   1663 C CA  . CYS A 1 245 ? 21.577 46.046 53.474  1.00 29.37  ? 245 CYS A CA  1 
ATOM   1664 C C   . CYS A 1 245 ? 22.977 46.407 53.020  1.00 29.37  ? 245 CYS A C   1 
ATOM   1665 O O   . CYS A 1 245 ? 23.465 47.503 53.287  1.00 29.37  ? 245 CYS A O   1 
ATOM   1666 C CB  . CYS A 1 245 ? 21.637 45.324 54.823  1.00 20.33  ? 245 CYS A CB  1 
ATOM   1667 S SG  . CYS A 1 245 ? 20.102 45.379 55.736  1.00 20.33  ? 245 CYS A SG  1 
ATOM   1668 N N   . VAL A 1 246 ? 23.629 45.473 52.342  1.00 21.92  ? 246 VAL A N   1 
ATOM   1669 C CA  . VAL A 1 246 ? 24.964 45.714 51.824  1.00 21.92  ? 246 VAL A CA  1 
ATOM   1670 C C   . VAL A 1 246 ? 24.867 46.794 50.751  1.00 21.92  ? 246 VAL A C   1 
ATOM   1671 O O   . VAL A 1 246 ? 25.639 47.743 50.744  1.00 21.92  ? 246 VAL A O   1 
ATOM   1672 C CB  . VAL A 1 246 ? 25.551 44.433 51.210  1.00 25.13  ? 246 VAL A CB  1 
ATOM   1673 C CG1 . VAL A 1 246 ? 26.869 44.736 50.514  1.00 25.13  ? 246 VAL A CG1 1 
ATOM   1674 C CG2 . VAL A 1 246 ? 25.746 43.400 52.299  1.00 25.13  ? 246 VAL A CG2 1 
ATOM   1675 N N   . LEU A 1 247 ? 23.886 46.635 49.868  1.00 20.11  ? 247 LEU A N   1 
ATOM   1676 C CA  . LEU A 1 247 ? 23.630 47.555 48.771  1.00 20.11  ? 247 LEU A CA  1 
ATOM   1677 C C   . LEU A 1 247 ? 23.345 48.955 49.281  1.00 20.11  ? 247 LEU A C   1 
ATOM   1678 O O   . LEU A 1 247 ? 23.983 49.923 48.876  1.00 20.11  ? 247 LEU A O   1 
ATOM   1679 C CB  . LEU A 1 247 ? 22.447 47.052 47.956  1.00 25.29  ? 247 LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 247 ? 21.822 48.030 46.965  1.00 25.29  ? 247 LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 247 ? 22.832 48.486 45.909  1.00 25.29  ? 247 LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 247 ? 20.633 47.344 46.323  1.00 25.29  ? 247 LEU A CD2 1 
ATOM   1683 N N   . ALA A 1 248 ? 22.368 49.048 50.170  1.00 27.36  ? 248 ALA A N   1 
ATOM   1684 C CA  . ALA A 1 248 ? 22.000 50.314 50.768  1.00 27.36  ? 248 ALA A CA  1 
ATOM   1685 C C   . ALA A 1 248 ? 23.207 50.944 51.464  1.00 27.36  ? 248 ALA A C   1 
ATOM   1686 O O   . ALA A 1 248 ? 23.389 52.155 51.419  1.00 27.36  ? 248 ALA A O   1 
ATOM   1687 C CB  . ALA A 1 248 ? 20.891 50.099 51.763  1.00 10.48  ? 248 ALA A CB  1 
ATOM   1688 N N   . GLU A 1 249 ? 24.031 50.124 52.108  1.00 21.02  ? 249 GLU A N   1 
ATOM   1689 C CA  . GLU A 1 249 ? 25.198 50.643 52.794  1.00 21.02  ? 249 GLU A CA  1 
ATOM   1690 C C   . GLU A 1 249 ? 26.215 51.205 51.810  1.00 21.02  ? 249 GLU A C   1 
ATOM   1691 O O   . GLU A 1 249 ? 26.838 52.229 52.070  1.00 21.02  ? 249 GLU A O   1 
ATOM   1692 C CB  . GLU A 1 249 ? 25.839 49.547 53.642  1.00 24.29  ? 249 GLU A CB  1 
ATOM   1693 C CG  . GLU A 1 249 ? 26.943 50.043 54.549  1.00 24.29  ? 249 GLU A CG  1 
ATOM   1694 C CD  . GLU A 1 249 ? 27.495 48.952 55.424  1.00 24.29  ? 249 GLU A CD  1 
ATOM   1695 O OE1 . GLU A 1 249 ? 26.685 48.153 55.928  1.00 24.29  ? 249 GLU A OE1 1 
ATOM   1696 O OE2 . GLU A 1 249 ? 28.727 48.905 55.623  1.00 24.29  ? 249 GLU A OE2 1 
ATOM   1697 N N   . LEU A 1 250 ? 26.387 50.524 50.682  1.00 28.26  ? 250 LEU A N   1 
ATOM   1698 C CA  . LEU A 1 250 ? 27.319 50.960 49.653  1.00 28.26  ? 250 LEU A CA  1 
ATOM   1699 C C   . LEU A 1 250 ? 26.929 52.326 49.104  1.00 28.26  ? 250 LEU A C   1 
ATOM   1700 O O   . LEU A 1 250 ? 27.781 53.156 48.814  1.00 28.26  ? 250 LEU A O   1 
ATOM   1701 C CB  . LEU A 1 250 ? 27.350 49.951 48.515  1.00 19.31  ? 250 LEU A CB  1 
ATOM   1702 C CG  . LEU A 1 250 ? 27.995 48.599 48.812  1.00 19.31  ? 250 LEU A CG  1 
ATOM   1703 C CD1 . LEU A 1 250 ? 28.001 47.749 47.563  1.00 19.31  ? 250 LEU A CD1 1 
ATOM   1704 C CD2 . LEU A 1 250 ? 29.401 48.816 49.316  1.00 19.31  ? 250 LEU A CD2 1 
ATOM   1705 N N   . LEU A 1 251 ? 25.629 52.552 48.972  1.00 28.98  ? 251 LEU A N   1 
ATOM   1706 C CA  . LEU A 1 251 ? 25.111 53.802 48.459  1.00 28.98  ? 251 LEU A CA  1 
ATOM   1707 C C   . LEU A 1 251 ? 25.101 54.914 49.490  1.00 28.98  ? 251 LEU A C   1 
ATOM   1708 O O   . LEU A 1 251 ? 25.218 56.077 49.135  1.00 28.98  ? 251 LEU A O   1 
ATOM   1709 C CB  . LEU A 1 251 ? 23.687 53.604 47.951  1.00 14.16  ? 251 LEU A CB  1 
ATOM   1710 C CG  . LEU A 1 251 ? 23.474 52.537 46.882  1.00 14.16  ? 251 LEU A CG  1 
ATOM   1711 C CD1 . LEU A 1 251 ? 21.991 52.316 46.676  1.00 14.16  ? 251 LEU A CD1 1 
ATOM   1712 C CD2 . LEU A 1 251 ? 24.160 52.942 45.601  1.00 14.16  ? 251 LEU A CD2 1 
ATOM   1713 N N   . LEU A 1 252 ? 24.967 54.562 50.763  1.00 28.99  ? 252 LEU A N   1 
ATOM   1714 C CA  . LEU A 1 252 ? 24.895 55.546 51.838  1.00 28.99  ? 252 LEU A CA  1 
ATOM   1715 C C   . LEU A 1 252 ? 26.224 55.896 52.503  1.00 28.99  ? 252 LEU A C   1 
ATOM   1716 O O   . LEU A 1 252 ? 26.389 56.994 53.021  1.00 28.99  ? 252 LEU A O   1 
ATOM   1717 C CB  . LEU A 1 252 ? 23.908 55.060 52.902  1.00 27.47  ? 252 LEU A CB  1 
ATOM   1718 C CG  . LEU A 1 252 ? 22.882 56.045 53.473  1.00 27.47  ? 252 LEU A CG  1 
ATOM   1719 C CD1 . LEU A 1 252 ? 22.028 56.611 52.353  0.00 27.47  ? 252 LEU A CD1 1 
ATOM   1720 C CD2 . LEU A 1 252 ? 22.018 55.338 54.504  0.00 27.47  ? 252 LEU A CD2 1 
ATOM   1721 N N   . GLY A 1 253 ? 27.178 54.978 52.499  1.00 27.31  ? 253 GLY A N   1 
ATOM   1722 C CA  . GLY A 1 253 ? 28.456 55.263 53.131  1.00 27.31  ? 253 GLY A CA  1 
ATOM   1723 C C   . GLY A 1 253 ? 28.508 54.802 54.580  1.00 27.31  ? 253 GLY A C   1 
ATOM   1724 O O   . GLY A 1 253 ? 29.527 54.940 55.256  1.00 27.31  ? 253 GLY A O   1 
ATOM   1725 N N   . GLN A 1 254 ? 27.398 54.247 55.048  1.00 27.88  ? 254 GLN A N   1 
ATOM   1726 C CA  . GLN A 1 254 ? 27.274 53.749 56.412  1.00 27.88  ? 254 GLN A CA  1 
ATOM   1727 C C   . GLN A 1 254 ? 26.091 52.786 56.422  1.00 27.88  ? 254 GLN A C   1 
ATOM   1728 O O   . GLN A 1 254 ? 25.270 52.813 55.508  1.00 27.88  ? 254 GLN A O   1 
ATOM   1729 C CB  . GLN A 1 254 ? 26.994 54.908 57.368  1.00 51.39  ? 254 GLN A CB  1 
ATOM   1730 C CG  . GLN A 1 254 ? 25.709 55.657 57.030  1.00 51.39  ? 254 GLN A CG  1 
ATOM   1731 C CD  . GLN A 1 254 ? 25.455 56.873 57.918  1.00 51.39  ? 254 GLN A CD  1 
ATOM   1732 O OE1 . GLN A 1 254 ? 25.280 56.756 59.141  1.00 51.39  ? 254 GLN A OE1 1 
ATOM   1733 N NE2 . GLN A 1 254 ? 25.429 58.051 57.301  1.00 51.39  ? 254 GLN A NE2 1 
ATOM   1734 N N   . PRO A 1 255 ? 26.001 51.912 57.441  1.00 33.15  ? 255 PRO A N   1 
ATOM   1735 C CA  . PRO A 1 255 ? 24.898 50.956 57.540  1.00 33.15  ? 255 PRO A CA  1 
ATOM   1736 C C   . PRO A 1 255 ? 23.584 51.709 57.538  1.00 33.15  ? 255 PRO A C   1 
ATOM   1737 O O   . PRO A 1 255 ? 23.525 52.849 57.985  1.00 33.15  ? 255 PRO A O   1 
ATOM   1738 C CB  . PRO A 1 255 ? 25.152 50.277 58.877  1.00 21.02  ? 255 PRO A CB  1 
ATOM   1739 C CG  . PRO A 1 255 ? 26.631 50.260 58.956  1.00 21.02  ? 255 PRO A CG  1 
ATOM   1740 C CD  . PRO A 1 255 ? 27.011 51.643 58.480  1.00 21.02  ? 255 PRO A CD  1 
ATOM   1741 N N   . ILE A 1 256 ? 22.530 51.075 57.042  1.00 29.77  ? 256 ILE A N   1 
ATOM   1742 C CA  . ILE A 1 256 ? 21.228 51.707 56.995  1.00 29.77  ? 256 ILE A CA  1 
ATOM   1743 C C   . ILE A 1 256 ? 20.360 51.396 58.220  1.00 29.77  ? 256 ILE A C   1 
ATOM   1744 O O   . ILE A 1 256 ? 19.510 52.196 58.590  1.00 29.77  ? 256 ILE A O   1 
ATOM   1745 C CB  . ILE A 1 256 ? 20.486 51.309 55.704  1.00 22.31  ? 256 ILE A CB  1 
ATOM   1746 C CG1 . ILE A 1 256 ? 19.158 52.052 55.620  1.00 22.31  ? 256 ILE A CG1 1 
ATOM   1747 C CG2 . ILE A 1 256 ? 20.266 49.816 55.662  1.00 22.31  ? 256 ILE A CG2 1 
ATOM   1748 C CD1 . ILE A 1 256 ? 18.564 52.075 54.233  1.00 22.31  ? 256 ILE A CD1 1 
ATOM   1749 N N   . PHE A 1 257 ? 20.579 50.250 58.859  1.00 26.75  ? 257 PHE A N   1 
ATOM   1750 C CA  . PHE A 1 257 ? 19.793 49.873 60.034  1.00 26.75  ? 257 PHE A CA  1 
ATOM   1751 C C   . PHE A 1 257 ? 20.684 49.530 61.218  1.00 26.75  ? 257 PHE A C   1 
ATOM   1752 O O   . PHE A 1 257 ? 20.745 48.385 61.656  1.00 26.75  ? 257 PHE A O   1 
ATOM   1753 C CB  . PHE A 1 257 ? 18.902 48.669 59.726  1.00 28.25  ? 257 PHE A CB  1 
ATOM   1754 C CG  . PHE A 1 257 ? 18.025 48.854 58.536  1.00 28.25  ? 257 PHE A CG  1 
ATOM   1755 C CD1 . PHE A 1 257 ? 17.262 50.005 58.392  1.00 28.25  ? 257 PHE A CD1 1 
ATOM   1756 C CD2 . PHE A 1 257 ? 17.950 47.882 57.557  1.00 28.25  ? 257 PHE A CD2 1 
ATOM   1757 C CE1 . PHE A 1 257 ? 16.436 50.185 57.289  1.00 28.25  ? 257 PHE A CE1 1 
ATOM   1758 C CE2 . PHE A 1 257 ? 17.126 48.056 56.450  1.00 28.25  ? 257 PHE A CE2 1 
ATOM   1759 C CZ  . PHE A 1 257 ? 16.370 49.208 56.317  1.00 28.25  ? 257 PHE A CZ  1 
ATOM   1760 N N   . PRO A 1 258 ? 21.398 50.517 61.754  1.00 31.14  ? 258 PRO A N   1 
ATOM   1761 C CA  . PRO A 1 258 ? 22.250 50.184 62.888  1.00 31.14  ? 258 PRO A CA  1 
ATOM   1762 C C   . PRO A 1 258 ? 21.453 50.205 64.185  1.00 31.14  ? 258 PRO A C   1 
ATOM   1763 O O   . PRO A 1 258 ? 20.242 50.445 64.181  1.00 31.14  ? 258 PRO A O   1 
ATOM   1764 C CB  . PRO A 1 258 ? 23.313 51.259 62.829  1.00 19.46  ? 258 PRO A CB  1 
ATOM   1765 C CG  . PRO A 1 258 ? 22.535 52.441 62.399  1.00 19.46  ? 258 PRO A CG  1 
ATOM   1766 C CD  . PRO A 1 258 ? 21.604 51.911 61.327  1.00 19.46  ? 258 PRO A CD  1 
ATOM   1767 N N   . GLY A 1 259 ? 22.140 49.942 65.289  1.00 29.28  ? 259 GLY A N   1 
ATOM   1768 C CA  . GLY A 1 259 ? 21.489 49.926 66.580  1.00 29.28  ? 259 GLY A CA  1 
ATOM   1769 C C   . GLY A 1 259 ? 22.201 48.973 67.510  1.00 29.28  ? 259 GLY A C   1 
ATOM   1770 O O   . GLY A 1 259 ? 22.611 47.892 67.093  1.00 29.28  ? 259 GLY A O   1 
ATOM   1771 N N   . ASP A 1 260 ? 22.374 49.373 68.764  1.00 36.38  ? 260 ASP A N   1 
ATOM   1772 C CA  . ASP A 1 260 ? 23.038 48.521 69.739  1.00 36.38  ? 260 ASP A CA  1 
ATOM   1773 C C   . ASP A 1 260 ? 22.120 47.370 70.134  1.00 36.38  ? 260 ASP A C   1 
ATOM   1774 O O   . ASP A 1 260 ? 22.592 46.315 70.545  1.00 36.38  ? 260 ASP A O   1 
ATOM   1775 C CB  . ASP A 1 260 ? 23.420 49.323 70.987  1.00 47.71  ? 260 ASP A CB  1 
ATOM   1776 C CG  . ASP A 1 260 ? 24.776 50.008 70.855  1.00 47.71  ? 260 ASP A CG  1 
ATOM   1777 O OD1 . ASP A 1 260 ? 25.300 50.097 69.716  1.00 47.71  ? 260 ASP A OD1 1 
ATOM   1778 O OD2 . ASP A 1 260 ? 25.310 50.463 71.896  1.00 47.71  ? 260 ASP A OD2 1 
ATOM   1779 N N   . SER A 1 261 ? 20.812 47.577 70.006  1.00 17.64  ? 261 SER A N   1 
ATOM   1780 C CA  . SER A 1 261 ? 19.852 46.550 70.357  1.00 17.64  ? 261 SER A CA  1 
ATOM   1781 C C   . SER A 1 261 ? 18.826 46.331 69.253  1.00 17.64  ? 261 SER A C   1 
ATOM   1782 O O   . SER A 1 261 ? 18.721 47.114 68.324  1.00 17.64  ? 261 SER A O   1 
ATOM   1783 C CB  . SER A 1 261 ? 19.120 46.935 71.638  1.00 27.99  ? 261 SER A CB  1 
ATOM   1784 O OG  . SER A 1 261 ? 18.171 47.965 71.386  1.00 27.99  ? 261 SER A OG  1 
ATOM   1785 N N   . GLY A 1 262 ? 18.062 45.255 69.375  1.00 31.16  ? 262 GLY A N   1 
ATOM   1786 C CA  . GLY A 1 262 ? 17.038 44.975 68.398  1.00 31.16  ? 262 GLY A CA  1 
ATOM   1787 C C   . GLY A 1 262 ? 16.107 46.163 68.362  1.00 31.16  ? 262 GLY A C   1 
ATOM   1788 O O   . GLY A 1 262 ? 15.875 46.750 67.310  1.00 31.16  ? 262 GLY A O   1 
ATOM   1789 N N   . VAL A 1 263 ? 15.580 46.538 69.517  1.00 25.51  ? 263 VAL A N   1 
ATOM   1790 C CA  . VAL A 1 263 ? 14.674 47.672 69.581  1.00 25.51  ? 263 VAL A CA  1 
ATOM   1791 C C   . VAL A 1 263 ? 15.180 48.841 68.742  1.00 25.51  ? 263 VAL A C   1 
ATOM   1792 O O   . VAL A 1 263 ? 14.433 49.408 67.954  1.00 25.51  ? 263 VAL A O   1 
ATOM   1793 C CB  . VAL A 1 263 ? 14.456 48.141 71.046  1.00 26.72  ? 263 VAL A CB  1 
ATOM   1794 C CG1 . VAL A 1 263 ? 13.550 49.377 71.078  1.00 26.72  ? 263 VAL A CG1 1 
ATOM   1795 C CG2 . VAL A 1 263 ? 13.830 47.020 71.852  1.00 26.72  ? 263 VAL A CG2 1 
ATOM   1796 N N   . ASP A 1 264 ? 16.446 49.195 68.902  1.00 23.62  ? 264 ASP A N   1 
ATOM   1797 C CA  . ASP A 1 264 ? 16.992 50.297 68.132  1.00 23.62  ? 264 ASP A CA  1 
ATOM   1798 C C   . ASP A 1 264 ? 16.962 50.012 66.641  1.00 23.62  ? 264 ASP A C   1 
ATOM   1799 O O   . ASP A 1 264 ? 16.538 50.855 65.848  1.00 23.62  ? 264 ASP A O   1 
ATOM   1800 C CB  . ASP A 1 264 ? 18.421 50.594 68.566  1.00 36.57  ? 264 ASP A CB  1 
ATOM   1801 C CG  . ASP A 1 264 ? 18.488 51.166 69.958  1.00 36.57  ? 264 ASP A CG  1 
ATOM   1802 O OD1 . ASP A 1 264 ? 17.525 51.854 70.338  1.00 36.57  ? 264 ASP A OD1 1 
ATOM   1803 O OD2 . ASP A 1 264 ? 19.493 50.945 70.663  1.00 36.57  ? 264 ASP A OD2 1 
ATOM   1804 N N   . GLN A 1 265 ? 17.423 48.817 66.272  1.00 27.66  ? 265 GLN A N   1 
ATOM   1805 C CA  . GLN A 1 265 ? 17.458 48.370 64.883  1.00 27.66  ? 265 GLN A CA  1 
ATOM   1806 C C   . GLN A 1 265 ? 16.065 48.472 64.264  1.00 27.66  ? 265 GLN A C   1 
ATOM   1807 O O   . GLN A 1 265 ? 15.900 48.988 63.158  1.00 27.66  ? 265 GLN A O   1 
ATOM   1808 C CB  . GLN A 1 265 ? 17.952 46.925 64.817  1.00 38.02  ? 265 GLN A CB  1 
ATOM   1809 C CG  . GLN A 1 265 ? 19.470 46.759 64.893  1.00 38.02  ? 265 GLN A CG  1 
ATOM   1810 C CD  . GLN A 1 265 ? 19.888 45.365 65.365  1.00 38.02  ? 265 GLN A CD  1 
ATOM   1811 O OE1 . GLN A 1 265 ? 19.269 44.376 65.006  1.00 38.02  ? 265 GLN A OE1 1 
ATOM   1812 N NE2 . GLN A 1 265 ? 20.940 45.292 66.170  1.00 38.02  ? 265 GLN A NE2 1 
ATOM   1813 N N   . LEU A 1 266 ? 15.059 47.985 64.977  1.00 29.79  ? 266 LEU A N   1 
ATOM   1814 C CA  . LEU A 1 266 ? 13.712 48.065 64.455  1.00 29.79  ? 266 LEU A CA  1 
ATOM   1815 C C   . LEU A 1 266 ? 13.312 49.514 64.227  1.00 29.79  ? 266 LEU A C   1 
ATOM   1816 O O   . LEU A 1 266 ? 12.702 49.829 63.208  1.00 29.79  ? 266 LEU A O   1 
ATOM   1817 C CB  . LEU A 1 266 ? 12.724 47.381 65.395  1.00 30.81  ? 266 LEU A CB  1 
ATOM   1818 C CG  . LEU A 1 266 ? 12.338 45.984 64.932  1.00 30.81  ? 266 LEU A CG  1 
ATOM   1819 C CD1 . LEU A 1 266 ? 13.576 45.190 64.729  1.00 30.81  ? 266 LEU A CD1 1 
ATOM   1820 C CD2 . LEU A 1 266 ? 11.448 45.316 65.944  1.00 30.81  ? 266 LEU A CD2 1 
ATOM   1821 N N   . VAL A 1 267 ? 13.660 50.396 65.160  1.00 27.95  ? 267 VAL A N   1 
ATOM   1822 C CA  . VAL A 1 267 ? 13.329 51.808 65.010  1.00 27.95  ? 267 VAL A CA  1 
ATOM   1823 C C   . VAL A 1 267 ? 13.797 52.295 63.645  1.00 27.95  ? 267 VAL A C   1 
ATOM   1824 O O   . VAL A 1 267 ? 13.018 52.815 62.844  1.00 27.95  ? 267 VAL A O   1 
ATOM   1825 C CB  . VAL A 1 267 ? 14.010 52.675 66.092  1.00 35.03  ? 267 VAL A CB  1 
ATOM   1826 C CG1 . VAL A 1 267 ? 13.841 54.158 65.769  1.00 35.03  ? 267 VAL A CG1 1 
ATOM   1827 C CG2 . VAL A 1 267 ? 13.412 52.369 67.441  1.00 35.03  ? 267 VAL A CG2 1 
ATOM   1828 N N   . GLU A 1 268 ? 15.080 52.119 63.384  1.00 40.12  ? 268 GLU A N   1 
ATOM   1829 C CA  . GLU A 1 268 ? 15.627 52.537 62.111  1.00 40.12  ? 268 GLU A CA  1 
ATOM   1830 C C   . GLU A 1 268 ? 14.919 51.849 60.935  1.00 40.12  ? 268 GLU A C   1 
ATOM   1831 O O   . GLU A 1 268 ? 14.607 52.488 59.934  1.00 40.12  ? 268 GLU A O   1 
ATOM   1832 C CB  . GLU A 1 268 ? 17.137 52.281 62.080  1.00 48.16  ? 268 GLU A CB  1 
ATOM   1833 C CG  . GLU A 1 268 ? 17.923 53.207 63.003  1.00 48.16  ? 268 GLU A CG  1 
ATOM   1834 C CD  . GLU A 1 268 ? 17.444 54.649 62.911  1.00 48.16  ? 268 GLU A CD  1 
ATOM   1835 O OE1 . GLU A 1 268 ? 17.356 55.192 61.785  1.00 48.16  ? 268 GLU A OE1 1 
ATOM   1836 O OE2 . GLU A 1 268 ? 17.146 55.239 63.971  1.00 48.16  ? 268 GLU A OE2 1 
ATOM   1837 N N   . ILE A 1 269 ? 14.645 50.556 61.055  1.00 28.21  ? 269 ILE A N   1 
ATOM   1838 C CA  . ILE A 1 269 ? 13.952 49.861 59.978  1.00 28.21  ? 269 ILE A CA  1 
ATOM   1839 C C   . ILE A 1 269 ? 12.587 50.511 59.712  1.00 28.21  ? 269 ILE A C   1 
ATOM   1840 O O   . ILE A 1 269 ? 12.221 50.790 58.566  1.00 28.21  ? 269 ILE A O   1 
ATOM   1841 C CB  . ILE A 1 269 ? 13.771 48.374 60.321  1.00 12.18  ? 269 ILE A CB  1 
ATOM   1842 C CG1 . ILE A 1 269 ? 15.142 47.703 60.345  1.00 12.18  ? 269 ILE A CG1 1 
ATOM   1843 C CG2 . ILE A 1 269 ? 12.855 47.704 59.321  1.00 12.18  ? 269 ILE A CG2 1 
ATOM   1844 C CD1 . ILE A 1 269 ? 15.101 46.204 60.519  1.00 12.18  ? 269 ILE A CD1 1 
ATOM   1845 N N   . ILE A 1 270 ? 11.852 50.769 60.785  1.00 38.75  ? 270 ILE A N   1 
ATOM   1846 C CA  . ILE A 1 270 ? 10.542 51.378 60.678  1.00 38.75  ? 270 ILE A CA  1 
ATOM   1847 C C   . ILE A 1 270 ? 10.626 52.806 60.131  1.00 38.75  ? 270 ILE A C   1 
ATOM   1848 O O   . ILE A 1 270 ? 9.827  53.197 59.269  1.00 38.75  ? 270 ILE A O   1 
ATOM   1849 C CB  . ILE A 1 270 ? 9.833  51.367 62.054  1.00 36.77  ? 270 ILE A CB  1 
ATOM   1850 C CG1 . ILE A 1 270 ? 9.534  49.916 62.456  1.00 36.77  ? 270 ILE A CG1 1 
ATOM   1851 C CG2 . ILE A 1 270 ? 8.532  52.163 61.990  1.00 36.77  ? 270 ILE A CG2 1 
ATOM   1852 C CD1 . ILE A 1 270 ? 9.003  49.744 63.857  1.00 36.77  ? 270 ILE A CD1 1 
ATOM   1853 N N   . LYS A 1 271 ? 11.590 53.583 60.614  1.00 38.41  ? 271 LYS A N   1 
ATOM   1854 C CA  . LYS A 1 271 ? 11.738 54.954 60.139  1.00 38.41  ? 271 LYS A CA  1 
ATOM   1855 C C   . LYS A 1 271 ? 11.741 55.018 58.614  1.00 38.41  ? 271 LYS A C   1 
ATOM   1856 O O   . LYS A 1 271 ? 11.315 56.011 58.027  1.00 38.41  ? 271 LYS A O   1 
ATOM   1857 C CB  . LYS A 1 271 ? 13.036 55.585 60.663  1.00 37.99  ? 271 LYS A CB  1 
ATOM   1858 C CG  . LYS A 1 271 ? 12.988 56.118 62.083  1.00 37.99  ? 271 LYS A CG  1 
ATOM   1859 C CD  . LYS A 1 271 ? 14.318 56.785 62.467  1.00 37.99  ? 271 LYS A CD  1 
ATOM   1860 C CE  . LYS A 1 271 ? 14.241 57.404 63.853  0.00 37.99  ? 271 LYS A CE  1 
ATOM   1861 N NZ  . LYS A 1 271 ? 15.513 58.075 64.233  0.00 37.99  ? 271 LYS A NZ  1 
ATOM   1862 N N   . VAL A 1 272 ? 12.215 53.969 57.956  1.00 54.30  ? 272 VAL A N   1 
ATOM   1863 C CA  . VAL A 1 272 ? 12.262 54.007 56.500  1.00 54.30  ? 272 VAL A CA  1 
ATOM   1864 C C   . VAL A 1 272 ? 11.197 53.184 55.791  1.00 54.30  ? 272 VAL A C   1 
ATOM   1865 O O   . VAL A 1 272 ? 10.608 53.642 54.799  1.00 54.30  ? 272 VAL A O   1 
ATOM   1866 C CB  . VAL A 1 272 ? 13.637 53.580 55.975  1.00 55.29  ? 272 VAL A CB  1 
ATOM   1867 C CG1 . VAL A 1 272 ? 14.577 54.756 56.003  1.00 55.29  ? 272 VAL A CG1 1 
ATOM   1868 C CG2 . VAL A 1 272 ? 14.201 52.476 56.844  1.00 55.29  ? 272 VAL A CG2 1 
ATOM   1869 N N   . LEU A 1 273 ? 10.943 51.977 56.282  1.00 40.87  ? 273 LEU A N   1 
ATOM   1870 C CA  . LEU A 1 273 ? 9.934  51.144 55.652  1.00 40.87  ? 273 LEU A CA  1 
ATOM   1871 C C   . LEU A 1 273 ? 8.524  51.541 56.069  1.00 40.87  ? 273 LEU A C   1 
ATOM   1872 O O   . LEU A 1 273 ? 7.560  51.300 55.343  1.00 40.87  ? 273 LEU A O   1 
ATOM   1873 C CB  . LEU A 1 273 ? 10.164 49.675 55.999  1.00 29.67  ? 273 LEU A CB  1 
ATOM   1874 C CG  . LEU A 1 273 ? 11.261 48.951 55.234  1.00 29.67  ? 273 LEU A CG  1 
ATOM   1875 C CD1 . LEU A 1 273 ? 11.190 47.491 55.599  1.00 29.67  ? 273 LEU A CD1 1 
ATOM   1876 C CD2 . LEU A 1 273 ? 11.070 49.124 53.740  0.00 29.67  ? 273 LEU A CD2 1 
ATOM   1877 N N   . GLY A 1 274 ? 8.400  52.153 57.239  1.00 52.25  ? 274 GLY A N   1 
ATOM   1878 C CA  . GLY A 1 274 ? 7.077  52.520 57.717  1.00 52.25  ? 274 GLY A CA  1 
ATOM   1879 C C   . GLY A 1 274 ? 6.592  51.464 58.688  1.00 52.25  ? 274 GLY A C   1 
ATOM   1880 O O   . GLY A 1 274 ? 7.061  50.323 58.645  1.00 52.25  ? 274 GLY A O   1 
ATOM   1881 N N   . THR A 1 275 ? 5.675  51.828 59.572  1.00 47.53  ? 275 THR A N   1 
ATOM   1882 C CA  . THR A 1 275 ? 5.168  50.911 60.588  1.00 47.53  ? 275 THR A CA  1 
ATOM   1883 C C   . THR A 1 275 ? 4.584  49.619 59.977  1.00 47.53  ? 275 THR A C   1 
ATOM   1884 O O   . THR A 1 275 ? 3.838  49.634 59.008  1.00 47.53  ? 275 THR A O   1 
ATOM   1885 C CB  . THR A 1 275 ? 4.042  51.644 61.436  1.00 64.24  ? 275 THR A CB  1 
ATOM   1886 O OG1 . THR A 1 275 ? 4.675  52.510 62.399  1.00 64.24  ? 275 THR A OG1 1 
ATOM   1887 C CG2 . THR A 1 275 ? 3.100  50.629 62.113  1.00 64.24  ? 275 THR A CG2 1 
ATOM   1888 N N   . PRO A 1 276 ? 4.898  48.466 60.546  1.00 59.25  ? 276 PRO A N   1 
ATOM   1889 C CA  . PRO A 1 276 ? 4.299  47.287 59.918  1.00 59.25  ? 276 PRO A CA  1 
ATOM   1890 C C   . PRO A 1 276 ? 2.834  47.036 60.244  1.00 59.25  ? 276 PRO A C   1 
ATOM   1891 O O   . PRO A 1 276 ? 2.378  47.188 61.388  1.00 59.25  ? 276 PRO A O   1 
ATOM   1892 C CB  . PRO A 1 276 ? 5.185  46.162 60.376  1.00 56.82  ? 276 PRO A CB  1 
ATOM   1893 C CG  . PRO A 1 276 ? 6.005  46.787 61.522  1.00 56.82  ? 276 PRO A CG  1 
ATOM   1894 C CD  . PRO A 1 276 ? 5.536  48.132 61.810  1.00 56.82  ? 276 PRO A CD  1 
ATOM   1895 N N   . THR A 1 277 ? 2.144  46.581 59.217  1.00 63.97  ? 277 THR A N   1 
ATOM   1896 C CA  . THR A 1 277 ? 0.756  46.257 59.382  1.00 63.97  ? 277 THR A CA  1 
ATOM   1897 C C   . THR A 1 277 ? 0.681  44.943 60.114  1.00 63.97  ? 277 THR A C   1 
ATOM   1898 O O   . THR A 1 277 ? 1.732  44.280 60.229  1.00 63.97  ? 277 THR A O   1 
ATOM   1899 C CB  . THR A 1 277 ? 0.085  46.093 58.007  1.00 62.34  ? 277 THR A CB  1 
ATOM   1900 O OG1 . THR A 1 277 ? 0.705  44.991 57.306  1.00 62.34  ? 277 THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 277 ? 0.217  47.369 57.215  1.00 62.34  ? 277 THR A CG2 1 
ATOM   1902 N N   . ARG A 1 278 ? -0.500 44.588 60.608  1.00 59.83  ? 278 ARG A N   1 
ATOM   1903 C CA  . ARG A 1 278 ? -0.700 43.352 61.298  1.00 59.83  ? 278 ARG A CA  1 
ATOM   1904 C C   . ARG A 1 278 ? -0.339 42.143 60.461  1.00 59.83  ? 278 ARG A C   1 
ATOM   1905 O O   . ARG A 1 278 ? 0.131  41.174 60.993  1.00 59.83  ? 278 ARG A O   1 
ATOM   1906 C CB  . ARG A 1 278 ? -2.189 43.217 61.914  0.00 35.69  ? 278 ARG A CB  1 
ATOM   1907 N N   . GLU A 1 279 ? -0.676 42.199 59.175  1.00 67.05  ? 279 GLU A N   1 
ATOM   1908 C CA  . GLU A 1 279 ? -0.378 41.084 58.287  1.00 67.05  ? 279 GLU A CA  1 
ATOM   1909 C C   . GLU A 1 279 ? 1.155  41.017 58.180  1.00 67.05  ? 279 GLU A C   1 
ATOM   1910 O O   . GLU A 1 279 ? 1.793  39.983 58.525  1.00 67.05  ? 279 GLU A O   1 
ATOM   1911 C CB  . GLU A 1 279 ? -1.059 41.264 56.897  1.00 100.00 ? 279 GLU A CB  1 
ATOM   1912 C CG  . GLU A 1 279 ? -2.546 40.928 56.958  1.00 100.00 ? 279 GLU A CG  1 
ATOM   1913 C CD  . GLU A 1 279 ? -2.837 39.631 57.745  1.00 100.00 ? 279 GLU A CD  1 
ATOM   1914 O OE1 . GLU A 1 279 ? -2.052 38.631 57.620  1.00 100.00 ? 279 GLU A OE1 1 
ATOM   1915 O OE2 . GLU A 1 279 ? -3.869 39.608 58.492  1.00 100.00 ? 279 GLU A OE2 1 
ATOM   1916 N N   . GLN A 1 280 ? 1.753  42.135 57.756  1.00 69.01  ? 280 GLN A N   1 
ATOM   1917 C CA  . GLN A 1 280 ? 3.201  42.194 57.609  1.00 69.01  ? 280 GLN A CA  1 
ATOM   1918 C C   . GLN A 1 280 ? 3.899  41.514 58.779  1.00 69.01  ? 280 GLN A C   1 
ATOM   1919 O O   . GLN A 1 280 ? 4.871  40.768 58.593  1.00 69.01  ? 280 GLN A O   1 
ATOM   1920 C CB  . GLN A 1 280 ? 3.678  43.655 57.480  1.00 63.74  ? 280 GLN A CB  1 
ATOM   1921 C CG  . GLN A 1 280 ? 3.420  44.297 56.110  1.00 63.74  ? 280 GLN A CG  1 
ATOM   1922 C CD  . GLN A 1 280 ? 3.982  45.697 56.020  1.00 63.74  ? 280 GLN A CD  1 
ATOM   1923 O OE1 . GLN A 1 280 ? 3.886  46.360 54.980  1.00 63.74  ? 280 GLN A OE1 1 
ATOM   1924 N NE2 . GLN A 1 280 ? 4.580  46.162 57.116  1.00 63.74  ? 280 GLN A NE2 1 
ATOM   1925 N N   . ILE A 1 281 ? 3.389  41.739 59.985  1.00 74.60  ? 281 ILE A N   1 
ATOM   1926 C CA  . ILE A 1 281 ? 4.005  41.129 61.147  1.00 74.60  ? 281 ILE A CA  1 
ATOM   1927 C C   . ILE A 1 281 ? 3.804  39.629 61.167  1.00 74.60  ? 281 ILE A C   1 
ATOM   1928 O O   . ILE A 1 281 ? 4.768  38.869 61.285  1.00 74.60  ? 281 ILE A O   1 
ATOM   1929 C CB  . ILE A 1 281 ? 3.435  41.706 62.415  1.00 72.22  ? 281 ILE A CB  1 
ATOM   1930 C CG1 . ILE A 1 281 ? 3.623  43.233 62.388  1.00 72.22  ? 281 ILE A CG1 1 
ATOM   1931 C CG2 . ILE A 1 281 ? 4.116  41.046 63.612  1.00 72.22  ? 281 ILE A CG2 1 
ATOM   1932 C CD1 . ILE A 1 281 ? 2.664  44.027 63.287  1.00 72.22  ? 281 ILE A CD1 1 
ATOM   1933 N N   . ARG A 1 282 ? 2.546  39.209 61.042  1.00 63.19  ? 282 ARG A N   1 
ATOM   1934 C CA  . ARG A 1 282 ? 2.224  37.794 61.048  1.00 63.19  ? 282 ARG A CA  1 
ATOM   1935 C C   . ARG A 1 282 ? 3.187  37.043 60.158  1.00 63.19  ? 282 ARG A C   1 
ATOM   1936 O O   . ARG A 1 282 ? 3.652  35.969 60.519  1.00 63.19  ? 282 ARG A O   1 
ATOM   1937 C CB  . ARG A 1 282 ? 0.797  37.575 60.568  1.00 58.92  ? 282 ARG A CB  1 
ATOM   1938 N N   . GLU A 1 283 ? 3.496  37.622 59.000  1.00 98.45  ? 283 GLU A N   1 
ATOM   1939 C CA  . GLU A 1 283 ? 4.402  36.978 58.047  1.00 98.45  ? 283 GLU A CA  1 
ATOM   1940 C C   . GLU A 1 283 ? 5.842  36.999 58.559  1.00 98.45  ? 283 GLU A C   1 
ATOM   1941 O O   . GLU A 1 283 ? 6.670  36.180 58.141  1.00 98.45  ? 283 GLU A O   1 
ATOM   1942 C CB  . GLU A 1 283 ? 4.290  37.658 56.686  0.00 85.00  ? 283 GLU A CB  1 
ATOM   1943 C CG  . GLU A 1 283 ? 2.860  37.639 56.157  0.00 85.00  ? 283 GLU A CG  1 
ATOM   1944 C CD  . GLU A 1 283 ? 2.653  38.684 55.130  1.00 85.00  ? 283 GLU A CD  1 
ATOM   1945 O OE1 . GLU A 1 283 ? 3.448  39.655 55.176  1.00 85.00  ? 283 GLU A OE1 1 
ATOM   1946 O OE2 . GLU A 1 283 ? 1.715  38.584 54.285  1.00 85.00  ? 283 GLU A OE2 1 
ATOM   1947 N N   . MET A 1 284 ? 6.123  37.911 59.490  1.00 73.55  ? 284 MET A N   1 
ATOM   1948 C CA  . MET A 1 284 ? 7.462  38.002 60.062  1.00 73.55  ? 284 MET A CA  1 
ATOM   1949 C C   . MET A 1 284 ? 7.711  36.894 61.057  1.00 73.55  ? 284 MET A C   1 
ATOM   1950 O O   . MET A 1 284 ? 8.391  35.917 60.739  1.00 73.55  ? 284 MET A O   1 
ATOM   1951 C CB  . MET A 1 284 ? 7.695  39.355 60.732  1.00 75.43  ? 284 MET A CB  1 
ATOM   1952 C CG  . MET A 1 284 ? 8.283  40.366 59.780  1.00 75.43  ? 284 MET A CG  1 
ATOM   1953 S SD  . MET A 1 284 ? 8.408  41.862 60.689  1.00 75.43  ? 284 MET A SD  1 
ATOM   1954 C CE  . MET A 1 284 ? 9.078  42.774 59.560  1.00 75.43  ? 284 MET A CE  1 
ATOM   1955 N N   . ASN A 1 285 ? 7.166  37.026 62.256  1.00 68.20  ? 285 ASN A N   1 
ATOM   1956 C CA  . ASN A 1 285 ? 7.402  35.974 63.222  1.00 68.20  ? 285 ASN A CA  1 
ATOM   1957 C C   . ASN A 1 285 ? 7.076  36.410 64.626  1.00 68.20  ? 285 ASN A C   1 
ATOM   1958 O O   . ASN A 1 285 ? 5.998  36.061 65.108  1.00 68.20  ? 285 ASN A O   1 
ATOM   1959 N N   . TRP A 1 301 ? 12.071 56.413 51.578  1.00 61.19  ? 301 TRP A N   1 
ATOM   1960 C CA  . TRP A 1 301 ? 13.023 55.807 50.655  1.00 61.19  ? 301 TRP A CA  1 
ATOM   1961 C C   . TRP A 1 301 ? 13.648 56.851 49.727  1.00 61.19  ? 301 TRP A C   1 
ATOM   1962 O O   . TRP A 1 301 ? 14.833 56.831 49.420  1.00 61.19  ? 301 TRP A O   1 
ATOM   1963 C CB  . TRP A 1 301 ? 12.280 54.756 49.829  1.00 42.80  ? 301 TRP A CB  1 
ATOM   1964 C CG  . TRP A 1 301 ? 12.497 53.409 50.404  1.00 42.80  ? 301 TRP A CG  1 
ATOM   1965 C CD1 . TRP A 1 301 ? 11.516 52.421 50.641  1.00 42.80  ? 301 TRP A CD1 1 
ATOM   1966 C CD2 . TRP A 1 301 ? 13.759 52.850 50.841  1.00 42.80  ? 301 TRP A CD2 1 
ATOM   1967 N NE1 . TRP A 1 301 ? 12.037 51.290 51.185  1.00 42.80  ? 301 TRP A NE1 1 
ATOM   1968 C CE2 . TRP A 1 301 ? 13.493 51.545 51.324  1.00 42.80  ? 301 TRP A CE2 1 
ATOM   1969 C CE3 . TRP A 1 301 ? 15.063 53.336 50.864  1.00 42.80  ? 301 TRP A CE3 1 
ATOM   1970 C CZ2 . TRP A 1 301 ? 14.526 50.768 51.820  1.00 42.80  ? 301 TRP A CZ2 1 
ATOM   1971 C CZ3 . TRP A 1 301 ? 16.097 52.558 51.359  1.00 42.80  ? 301 TRP A CZ3 1 
ATOM   1972 C CH2 . TRP A 1 301 ? 15.824 51.265 51.841  1.00 42.80  ? 301 TRP A CH2 1 
ATOM   1973 N N   . THR A 1 302 ? 12.789 57.767 49.246  1.00 54.08  ? 302 THR A N   1 
ATOM   1974 C CA  . THR A 1 302 ? 13.268 58.791 48.326  1.00 54.08  ? 302 THR A CA  1 
ATOM   1975 C C   . THR A 1 302 ? 14.139 59.832 49.035  1.00 54.08  ? 302 THR A C   1 
ATOM   1976 O O   . THR A 1 302 ? 14.910 60.562 48.427  1.00 54.08  ? 302 THR A O   1 
ATOM   1977 C CB  . THR A 1 302 ? 12.051 59.463 47.690  1.00 72.44  ? 302 THR A CB  1 
ATOM   1978 O OG1 . THR A 1 302 ? 11.102 59.772 48.713  1.00 72.44  ? 302 THR A OG1 1 
ATOM   1979 C CG2 . THR A 1 302 ? 11.397 58.512 46.683  0.00 72.44  ? 302 THR A CG2 1 
ATOM   1980 N N   . LYS A 1 303 ? 13.965 59.912 50.369  1.00 42.66  ? 303 LYS A N   1 
ATOM   1981 C CA  . LYS A 1 303 ? 14.756 60.879 51.120  1.00 42.66  ? 303 LYS A CA  1 
ATOM   1982 C C   . LYS A 1 303 ? 15.760 60.185 52.043  1.00 42.66  ? 303 LYS A C   1 
ATOM   1983 O O   . LYS A 1 303 ? 16.146 60.688 53.090  1.00 42.66  ? 303 LYS A O   1 
ATOM   1984 C CB  . LYS A 1 303 ? 13.799 61.742 51.944  1.00 60.61  ? 303 LYS A CB  1 
ATOM   1985 N N   . VAL A 1 304 ? 16.154 58.964 51.636  1.00 57.27  ? 304 VAL A N   1 
ATOM   1986 C CA  . VAL A 1 304 ? 17.096 58.204 52.448  1.00 57.27  ? 304 VAL A CA  1 
ATOM   1987 C C   . VAL A 1 304 ? 18.520 58.288 51.893  1.00 57.27  ? 304 VAL A C   1 
ATOM   1988 O O   . VAL A 1 304 ? 19.483 58.552 52.601  1.00 57.27  ? 304 VAL A O   1 
ATOM   1989 C CB  . VAL A 1 304 ? 16.633 56.747 52.473  1.00 33.85  ? 304 VAL A CB  1 
ATOM   1990 C CG1 . VAL A 1 304 ? 17.801 55.836 52.848  1.00 33.85  ? 304 VAL A CG1 1 
ATOM   1991 C CG2 . VAL A 1 304 ? 15.518 56.575 53.488  1.00 33.85  ? 304 VAL A CG2 1 
ATOM   1992 N N   . PHE A 1 305 ? 18.638 58.012 50.580  1.00 37.26  ? 305 PHE A N   1 
ATOM   1993 C CA  . PHE A 1 305 ? 19.955 58.026 49.954  1.00 37.26  ? 305 PHE A CA  1 
ATOM   1994 C C   . PHE A 1 305 ? 20.357 59.433 49.507  1.00 37.26  ? 305 PHE A C   1 
ATOM   1995 O O   . PHE A 1 305 ? 19.536 60.323 49.325  1.00 37.26  ? 305 PHE A O   1 
ATOM   1996 C CB  . PHE A 1 305 ? 19.918 57.090 48.746  1.00 37.35  ? 305 PHE A CB  1 
ATOM   1997 C CG  . PHE A 1 305 ? 19.730 55.675 49.207  1.00 37.35  ? 305 PHE A CG  1 
ATOM   1998 C CD1 . PHE A 1 305 ? 18.450 55.136 49.263  1.00 37.35  ? 305 PHE A CD1 1 
ATOM   1999 C CD2 . PHE A 1 305 ? 20.826 54.918 49.585  1.00 37.35  ? 305 PHE A CD2 1 
ATOM   2000 C CE1 . PHE A 1 305 ? 18.271 53.832 49.702  1.00 37.35  ? 305 PHE A CE1 1 
ATOM   2001 C CE2 . PHE A 1 305 ? 20.639 53.610 50.025  1.00 37.35  ? 305 PHE A CE2 1 
ATOM   2002 C CZ  . PHE A 1 305 ? 19.363 53.064 50.085  1.00 37.35  ? 305 PHE A CZ  1 
ATOM   2003 N N   . ARG A 1 306 ? 21.682 59.628 49.370  1.00 31.29  ? 306 ARG A N   1 
ATOM   2004 C CA  . ARG A 1 306 ? 22.172 60.920 48.910  1.00 31.29  ? 306 ARG A CA  1 
ATOM   2005 C C   . ARG A 1 306 ? 21.530 61.313 47.577  1.00 31.29  ? 306 ARG A C   1 
ATOM   2006 O O   . ARG A 1 306 ? 21.054 60.485 46.811  1.00 31.29  ? 306 ARG A O   1 
ATOM   2007 C CB  . ARG A 1 306 ? 23.690 60.825 48.752  1.00 61.41  ? 306 ARG A CB  1 
ATOM   2008 C CG  . ARG A 1 306 ? 24.143 61.070 47.313  1.00 61.41  ? 306 ARG A CG  1 
ATOM   2009 C CD  . ARG A 1 306 ? 25.026 59.931 46.787  1.00 61.41  ? 306 ARG A CD  1 
ATOM   2010 N NE  . ARG A 1 306 ? 26.116 60.464 45.965  1.00 61.41  ? 306 ARG A NE  1 
ATOM   2011 C CZ  . ARG A 1 306 ? 27.118 59.624 45.644  1.00 61.41  ? 306 ARG A CZ  1 
ATOM   2012 N NH1 . ARG A 1 306 ? 27.091 58.368 46.057  1.00 61.41  ? 306 ARG A NH1 1 
ATOM   2013 N NH2 . ARG A 1 306 ? 28.150 60.073 44.927  1.00 61.41  ? 306 ARG A NH2 1 
ATOM   2014 N N   . PRO A 1 307 ? 21.492 62.637 47.333  1.00 53.14  ? 307 PRO A N   1 
ATOM   2015 C CA  . PRO A 1 307 ? 20.901 63.176 46.116  1.00 53.14  ? 307 PRO A CA  1 
ATOM   2016 C C   . PRO A 1 307 ? 21.664 62.732 44.866  1.00 53.14  ? 307 PRO A C   1 
ATOM   2017 O O   . PRO A 1 307 ? 22.816 62.322 44.913  1.00 53.14  ? 307 PRO A O   1 
ATOM   2018 C CB  . PRO A 1 307 ? 20.920 64.701 46.223  1.00 64.42  ? 307 PRO A CB  1 
ATOM   2019 C CG  . PRO A 1 307 ? 21.315 65.072 47.651  1.00 64.42  ? 307 PRO A CG  1 
ATOM   2020 C CD  . PRO A 1 307 ? 21.990 63.717 48.167  1.00 64.42  ? 307 PRO A CD  1 
ATOM   2021 N N   . ARG A 1 308 ? 20.957 62.786 43.720  1.00 40.68  ? 308 ARG A N   1 
ATOM   2022 C CA  . ARG A 1 308 ? 21.597 62.439 42.455  1.00 40.68  ? 308 ARG A CA  1 
ATOM   2023 C C   . ARG A 1 308 ? 21.934 60.949 42.375  1.00 40.68  ? 308 ARG A C   1 
ATOM   2024 O O   . ARG A 1 308 ? 22.704 60.498 41.537  1.00 40.68  ? 308 ARG A O   1 
ATOM   2025 C CB  . ARG A 1 308 ? 22.876 63.267 42.324  0.00 35.69  ? 308 ARG A CB  1 
ATOM   2026 N N   . THR A 1 309 ? 21.354 60.178 43.313  1.00 34.01  ? 309 THR A N   1 
ATOM   2027 C CA  . THR A 1 309 ? 21.635 58.747 43.336  1.00 34.01  ? 309 THR A CA  1 
ATOM   2028 C C   . THR A 1 309 ? 20.659 57.963 42.458  1.00 34.01  ? 309 THR A C   1 
ATOM   2029 O O   . THR A 1 309 ? 19.452 58.162 42.493  1.00 34.01  ? 309 THR A O   1 
ATOM   2030 C CB  . THR A 1 309 ? 21.545 58.259 44.782  1.00 33.02  ? 309 THR A CB  1 
ATOM   2031 O OG1 . THR A 1 309 ? 21.821 56.858 44.817  1.00 33.02  ? 309 THR A OG1 1 
ATOM   2032 C CG2 . THR A 1 309 ? 20.135 58.499 45.330  1.00 33.02  ? 309 THR A CG2 1 
ATOM   2033 N N   . PRO A 1 310 ? 21.105 57.128 41.510  1.00 38.98  ? 310 PRO A N   1 
ATOM   2034 C CA  . PRO A 1 310 ? 20.190 56.439 40.630  1.00 38.98  ? 310 PRO A CA  1 
ATOM   2035 C C   . PRO A 1 310 ? 18.969 55.967 41.411  1.00 38.98  ? 310 PRO A C   1 
ATOM   2036 O O   . PRO A 1 310 ? 19.056 55.394 42.489  1.00 38.98  ? 310 PRO A O   1 
ATOM   2037 C CB  . PRO A 1 310 ? 20.935 55.246 40.037  1.00 20.74  ? 310 PRO A CB  1 
ATOM   2038 C CG  . PRO A 1 310 ? 22.409 55.341 40.440  1.00 20.74  ? 310 PRO A CG  1 
ATOM   2039 C CD  . PRO A 1 310 ? 22.467 56.749 41.203  1.00 20.74  ? 310 PRO A CD  1 
ATOM   2040 N N   . PRO A 1 311 ? 17.875 56.267 40.684  1.00 39.47  ? 311 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 311 ? 16.543 55.842 41.090  1.00 39.47  ? 311 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 311 ? 16.341 54.340 40.867  1.00 39.47  ? 311 PRO A C   1 
ATOM   2043 O O   . PRO A 1 311 ? 15.580 53.675 41.558  1.00 39.47  ? 311 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 311 ? 15.532 56.637 40.260  1.00 36.28  ? 311 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 311 ? 16.301 57.586 39.338  1.00 36.28  ? 311 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 311 ? 17.796 57.027 39.451  1.00 36.28  ? 311 PRO A CD  1 
ATOM   2047 N N   . GLU A 1 312 ? 17.085 53.665 40.003  1.00 32.81  ? 312 GLU A N   1 
ATOM   2048 C CA  . GLU A 1 312 ? 16.999 52.214 39.903  1.00 32.81  ? 312 GLU A CA  1 
ATOM   2049 C C   . GLU A 1 312 ? 17.545 51.536 41.155  1.00 32.81  ? 312 GLU A C   1 
ATOM   2050 O O   . GLU A 1 312 ? 17.016 50.512 41.600  1.00 32.81  ? 312 GLU A O   1 
ATOM   2051 C CB  . GLU A 1 312 ? 17.773 51.710 38.688  1.00 59.36  ? 312 GLU A CB  1 
ATOM   2052 C CG  . GLU A 1 312 ? 17.230 52.203 37.372  1.00 59.36  ? 312 GLU A CG  1 
ATOM   2053 C CD  . GLU A 1 312 ? 17.179 53.722 37.294  1.00 59.36  ? 312 GLU A CD  1 
ATOM   2054 O OE1 . GLU A 1 312 ? 18.077 54.395 37.878  1.00 59.36  ? 312 GLU A OE1 1 
ATOM   2055 O OE2 . GLU A 1 312 ? 16.242 54.237 36.632  1.00 59.36  ? 312 GLU A OE2 1 
ATOM   2056 N N   . ALA A 1 313 ? 18.600 52.116 41.719  1.00 27.51  ? 313 ALA A N   1 
ATOM   2057 C CA  . ALA A 1 313 ? 19.225 51.564 42.910  1.00 27.51  ? 313 ALA A CA  1 
ATOM   2058 C C   . ALA A 1 313 ? 18.299 51.666 44.101  1.00 27.51  ? 313 ALA A C   1 
ATOM   2059 O O   . ALA A 1 313 ? 18.207 50.751 44.923  1.00 27.51  ? 313 ALA A O   1 
ATOM   2060 C CB  . ALA A 1 313 ? 20.522 52.296 43.204  1.00 47.57  ? 313 ALA A CB  1 
ATOM   2061 N N   . ILE A 1 314 ? 17.621 52.800 44.191  1.00 31.65  ? 314 ILE A N   1 
ATOM   2062 C CA  . ILE A 1 314 ? 16.701 53.043 45.279  1.00 31.65  ? 314 ILE A CA  1 
ATOM   2063 C C   . ILE A 1 314 ? 15.500 52.115 45.126  1.00 31.65  ? 314 ILE A C   1 
ATOM   2064 O O   . ILE A 1 314 ? 14.946 51.639 46.111  1.00 31.65  ? 314 ILE A O   1 
ATOM   2065 C CB  . ILE A 1 314 ? 16.237 54.504 45.281  1.00 32.54  ? 314 ILE A CB  1 
ATOM   2066 C CG1 . ILE A 1 314 ? 17.447 55.439 45.291  0.00 32.54  ? 314 ILE A CG1 1 
ATOM   2067 C CG2 . ILE A 1 314 ? 15.371 54.758 46.507  1.00 32.54  ? 314 ILE A CG2 1 
ATOM   2068 C CD1 . ILE A 1 314 ? 17.088 56.908 45.242  0.00 32.54  ? 314 ILE A CD1 1 
ATOM   2069 N N   . ALA A 1 315 ? 15.108 51.850 43.884  1.00 30.21  ? 315 ALA A N   1 
ATOM   2070 C CA  . ALA A 1 315 ? 13.975 50.969 43.626  1.00 30.21  ? 315 ALA A CA  1 
ATOM   2071 C C   . ALA A 1 315 ? 14.271 49.552 44.102  1.00 30.21  ? 315 ALA A C   1 
ATOM   2072 O O   . ALA A 1 315 ? 13.484 48.973 44.840  1.00 30.21  ? 315 ALA A O   1 
ATOM   2073 C CB  . ALA A 1 315 ? 13.646 50.963 42.143  1.00 24.26  ? 315 ALA A CB  1 
ATOM   2074 N N   . LEU A 1 316 ? 15.406 49.002 43.667  1.00 29.43  ? 316 LEU A N   1 
ATOM   2075 C CA  . LEU A 1 316 ? 15.836 47.652 44.037  1.00 29.43  ? 316 LEU A CA  1 
ATOM   2076 C C   . LEU A 1 316 ? 15.888 47.500 45.556  1.00 29.43  ? 316 LEU A C   1 
ATOM   2077 O O   . LEU A 1 316 ? 15.361 46.533 46.110  1.00 29.43  ? 316 LEU A O   1 
ATOM   2078 C CB  . LEU A 1 316 ? 17.218 47.342 43.433  1.00 23.31  ? 316 LEU A CB  1 
ATOM   2079 C CG  . LEU A 1 316 ? 17.832 45.970 43.756  1.00 23.31  ? 316 LEU A CG  1 
ATOM   2080 C CD1 . LEU A 1 316 ? 17.018 44.852 43.137  1.00 23.31  ? 316 LEU A CD1 1 
ATOM   2081 C CD2 . LEU A 1 316 ? 19.256 45.914 43.247  1.00 23.31  ? 316 LEU A CD2 1 
ATOM   2082 N N   . CYS A 1 317 ? 16.518 48.456 46.229  1.00 29.07  ? 317 CYS A N   1 
ATOM   2083 C CA  . CYS A 1 317 ? 16.601 48.396 47.683  1.00 29.07  ? 317 CYS A CA  1 
ATOM   2084 C C   . CYS A 1 317 ? 15.230 48.137 48.287  1.00 29.07  ? 317 CYS A C   1 
ATOM   2085 O O   . CYS A 1 317 ? 15.075 47.264 49.132  1.00 29.07  ? 317 CYS A O   1 
ATOM   2086 C CB  . CYS A 1 317 ? 17.147 49.703 48.260  1.00 36.87  ? 317 CYS A CB  1 
ATOM   2087 S SG  . CYS A 1 317 ? 18.896 49.960 48.001  1.00 36.87  ? 317 CYS A SG  1 
ATOM   2088 N N   . SER A 1 318 ? 14.243 48.903 47.837  1.00 31.67  ? 318 SER A N   1 
ATOM   2089 C CA  . SER A 1 318 ? 12.884 48.792 48.332  1.00 31.67  ? 318 SER A CA  1 
ATOM   2090 C C   . SER A 1 318 ? 12.255 47.433 48.065  1.00 31.67  ? 318 SER A C   1 
ATOM   2091 O O   . SER A 1 318 ? 11.400 46.985 48.833  1.00 31.67  ? 318 SER A O   1 
ATOM   2092 C CB  . SER A 1 318 ? 12.014 49.878 47.709  1.00 44.38  ? 318 SER A CB  1 
ATOM   2093 O OG  . SER A 1 318 ? 11.875 49.661 46.310  1.00 44.38  ? 318 SER A OG  1 
ATOM   2094 N N   . ARG A 1 319 ? 12.658 46.779 46.979  1.00 31.95  ? 319 ARG A N   1 
ATOM   2095 C CA  . ARG A 1 319 ? 12.103 45.467 46.653  1.00 31.95  ? 319 ARG A CA  1 
ATOM   2096 C C   . ARG A 1 319 ? 12.905 44.356 47.320  1.00 31.95  ? 319 ARG A C   1 
ATOM   2097 O O   . ARG A 1 319 ? 12.592 43.180 47.159  1.00 31.95  ? 319 ARG A O   1 
ATOM   2098 C CB  . ARG A 1 319 ? 12.079 45.248 45.140  1.00 39.24  ? 319 ARG A CB  1 
ATOM   2099 C CG  . ARG A 1 319 ? 11.378 46.352 44.355  1.00 39.24  ? 319 ARG A CG  1 
ATOM   2100 C CD  . ARG A 1 319 ? 9.861  46.361 44.522  1.00 39.24  ? 319 ARG A CD  1 
ATOM   2101 N NE  . ARG A 1 319 ? 9.240  45.174 43.940  1.00 39.24  ? 319 ARG A NE  1 
ATOM   2102 C CZ  . ARG A 1 319 ? 9.037  44.032 44.594  1.00 39.24  ? 319 ARG A CZ  1 
ATOM   2103 N NH1 . ARG A 1 319 ? 9.395  43.912 45.869  1.00 39.24  ? 319 ARG A NH1 1 
ATOM   2104 N NH2 . ARG A 1 319 ? 8.496  42.995 43.967  1.00 39.24  ? 319 ARG A NH2 1 
ATOM   2105 N N   . LEU A 1 320 ? 13.944 44.730 48.061  1.00 31.81  ? 320 LEU A N   1 
ATOM   2106 C CA  . LEU A 1 320 ? 14.756 43.749 48.767  1.00 31.81  ? 320 LEU A CA  1 
ATOM   2107 C C   . LEU A 1 320 ? 14.476 43.811 50.264  1.00 31.81  ? 320 LEU A C   1 
ATOM   2108 O O   . LEU A 1 320 ? 14.458 42.788 50.947  1.00 31.81  ? 320 LEU A O   1 
ATOM   2109 C CB  . LEU A 1 320 ? 16.240 44.005 48.529  1.00 25.62  ? 320 LEU A CB  1 
ATOM   2110 C CG  . LEU A 1 320 ? 16.820 43.750 47.137  1.00 25.62  ? 320 LEU A CG  1 
ATOM   2111 C CD1 . LEU A 1 320 ? 18.204 44.341 47.072  1.00 25.62  ? 320 LEU A CD1 1 
ATOM   2112 C CD2 . LEU A 1 320 ? 16.871 42.270 46.846  1.00 25.62  ? 320 LEU A CD2 1 
ATOM   2113 N N   . LEU A 1 321 ? 14.249 45.018 50.768  1.00 29.10  ? 321 LEU A N   1 
ATOM   2114 C CA  . LEU A 1 321 ? 14.014 45.217 52.195  1.00 29.10  ? 321 LEU A CA  1 
ATOM   2115 C C   . LEU A 1 321 ? 12.521 45.330 52.511  1.00 29.10  ? 321 LEU A C   1 
ATOM   2116 O O   . LEU A 1 321 ? 11.984 46.402 52.763  1.00 29.10  ? 321 LEU A O   1 
ATOM   2117 C CB  . LEU A 1 321 ? 14.735 46.496 52.625  1.00 21.28  ? 321 LEU A CB  1 
ATOM   2118 C CG  . LEU A 1 321 ? 16.250 46.410 52.432  1.00 21.28  ? 321 LEU A CG  1 
ATOM   2119 C CD1 . LEU A 1 321 ? 16.970 47.680 52.889  1.00 21.28  ? 321 LEU A CD1 1 
ATOM   2120 C CD2 . LEU A 1 321 ? 16.883 45.255 53.208  1.00 21.28  ? 321 LEU A CD2 1 
ATOM   2121 N N   . GLU A 1 322 ? 11.838 44.173 52.455  1.00 39.08  ? 322 GLU A N   1 
ATOM   2122 C CA  . GLU A 1 322 ? 10.405 44.172 52.723  1.00 39.08  ? 322 GLU A CA  1 
ATOM   2123 C C   . GLU A 1 322 ? 10.063 43.364 53.975  1.00 39.08  ? 322 GLU A C   1 
ATOM   2124 O O   . GLU A 1 322 ? 10.642 42.324 54.262  1.00 39.08  ? 322 GLU A O   1 
ATOM   2125 C CB  . GLU A 1 322 ? 9.696  43.570 51.510  1.00 55.55  ? 322 GLU A CB  1 
ATOM   2126 C CG  . GLU A 1 322 ? 10.113 44.238 50.199  1.00 55.55  ? 322 GLU A CG  1 
ATOM   2127 C CD  . GLU A 1 322 ? 8.938  45.000 49.630  1.00 55.55  ? 322 GLU A CD  1 
ATOM   2128 O OE1 . GLU A 1 322 ? 8.070  45.396 50.395  1.00 55.55  ? 322 GLU A OE1 1 
ATOM   2129 O OE2 . GLU A 1 322 ? 8.896  45.185 48.415  1.00 55.55  ? 322 GLU A OE2 1 
ATOM   2130 N N   . TYR A 1 323 ? 9.110  43.902 54.758  1.00 30.49  ? 323 TYR A N   1 
ATOM   2131 C CA  . TYR A 1 323 ? 8.663  43.184 55.945  1.00 30.49  ? 323 TYR A CA  1 
ATOM   2132 C C   . TYR A 1 323 ? 8.285  41.741 55.607  1.00 30.49  ? 323 TYR A C   1 
ATOM   2133 O O   . TYR A 1 323 ? 8.700  40.786 56.251  1.00 30.49  ? 323 TYR A O   1 
ATOM   2134 C CB  . TYR A 1 323 ? 7.450  43.918 56.517  1.00 33.61  ? 323 TYR A CB  1 
ATOM   2135 C CG  . TYR A 1 323 ? 7.899  45.110 57.284  1.00 33.61  ? 323 TYR A CG  1 
ATOM   2136 C CD1 . TYR A 1 323 ? 7.251  46.330 57.113  1.00 33.61  ? 323 TYR A CD1 1 
ATOM   2137 C CD2 . TYR A 1 323 ? 8.964  45.014 58.180  1.00 33.61  ? 323 TYR A CD2 1 
ATOM   2138 C CE1 . TYR A 1 323 ? 7.662  47.444 57.829  1.00 33.61  ? 323 TYR A CE1 1 
ATOM   2139 C CE2 . TYR A 1 323 ? 9.375  46.128 58.897  1.00 33.61  ? 323 TYR A CE2 1 
ATOM   2140 C CZ  . TYR A 1 323 ? 8.729  47.338 58.723  1.00 33.61  ? 323 TYR A CZ  1 
ATOM   2141 O OH  . TYR A 1 323 ? 9.119  48.448 59.448  1.00 33.61  ? 323 TYR A OH  1 
ATOM   2142 N N   . THR A 1 324 ? 7.429  41.608 54.576  1.00 27.56  ? 324 THR A N   1 
ATOM   2143 C CA  . THR A 1 324 ? 7.040  40.276 54.133  1.00 27.56  ? 324 THR A CA  1 
ATOM   2144 C C   . THR A 1 324 ? 8.206  39.558 53.453  1.00 27.56  ? 324 THR A C   1 
ATOM   2145 O O   . THR A 1 324 ? 8.640  39.913 52.365  1.00 27.56  ? 324 THR A O   1 
ATOM   2146 C CB  . THR A 1 324 ? 5.878  40.423 53.150  1.00 33.13  ? 324 THR A CB  1 
ATOM   2147 O OG1 . THR A 1 324 ? 4.840  41.191 53.762  1.00 33.13  ? 324 THR A OG1 1 
ATOM   2148 C CG2 . THR A 1 324 ? 5.322  39.043 52.785  1.00 33.13  ? 324 THR A CG2 1 
ATOM   2149 N N   . PRO A 1 325 ? 8.718  38.515 54.106  1.00 37.10  ? 325 PRO A N   1 
ATOM   2150 C CA  . PRO A 1 325 ? 9.844  37.756 53.566  1.00 37.10  ? 325 PRO A CA  1 
ATOM   2151 C C   . PRO A 1 325 ? 9.556  37.224 52.172  1.00 37.10  ? 325 PRO A C   1 
ATOM   2152 O O   . PRO A 1 325 ? 10.434 37.166 51.310  1.00 37.10  ? 325 PRO A O   1 
ATOM   2153 C CB  . PRO A 1 325 ? 10.021 36.634 54.591  1.00 24.40  ? 325 PRO A CB  1 
ATOM   2154 C CG  . PRO A 1 325 ? 9.476  37.230 55.853  1.00 24.40  ? 325 PRO A CG  1 
ATOM   2155 C CD  . PRO A 1 325 ? 8.241  37.916 55.359  1.00 24.40  ? 325 PRO A CD  1 
ATOM   2156 N N   . THR A 1 326 ? 8.305  36.864 51.947  1.00 32.23  ? 326 THR A N   1 
ATOM   2157 C CA  . THR A 1 326 ? 7.910  36.293 50.676  1.00 32.23  ? 326 THR A CA  1 
ATOM   2158 C C   . THR A 1 326 ? 7.697  37.318 49.554  1.00 32.23  ? 326 THR A C   1 
ATOM   2159 O O   . THR A 1 326 ? 7.446  36.952 48.405  1.00 32.23  ? 326 THR A O   1 
ATOM   2160 C CB  . THR A 1 326 ? 6.655  35.417 50.895  1.00 36.85  ? 326 THR A CB  1 
ATOM   2161 O OG1 . THR A 1 326 ? 6.513  34.513 49.804  1.00 36.85  ? 326 THR A OG1 1 
ATOM   2162 C CG2 . THR A 1 326 ? 5.418  36.263 51.034  1.00 36.85  ? 326 THR A CG2 1 
ATOM   2163 N N   . ALA A 1 327 ? 7.836  38.598 49.889  1.00 32.40  ? 327 ALA A N   1 
ATOM   2164 C CA  . ALA A 1 327 ? 7.660  39.676 48.919  1.00 32.40  ? 327 ALA A CA  1 
ATOM   2165 C C   . ALA A 1 327 ? 8.993  40.184 48.374  1.00 32.40  ? 327 ALA A C   1 
ATOM   2166 O O   . ALA A 1 327 ? 9.036  40.934 47.392  1.00 32.40  ? 327 ALA A O   1 
ATOM   2167 C CB  . ALA A 1 327 ? 6.896  40.826 49.552  1.00 22.71  ? 327 ALA A CB  1 
ATOM   2168 N N   . ARG A 1 328 ? 10.081 39.781 49.018  1.00 29.48  ? 328 ARG A N   1 
ATOM   2169 C CA  . ARG A 1 328 ? 11.403 40.195 48.586  1.00 29.48  ? 328 ARG A CA  1 
ATOM   2170 C C   . ARG A 1 328 ? 11.739 39.497 47.268  1.00 29.48  ? 328 ARG A C   1 
ATOM   2171 O O   . ARG A 1 328 ? 11.318 38.366 47.020  1.00 29.48  ? 328 ARG A O   1 
ATOM   2172 C CB  . ARG A 1 328 ? 12.439 39.842 49.657  1.00 24.82  ? 328 ARG A CB  1 
ATOM   2173 C CG  . ARG A 1 328 ? 12.228 40.558 50.979  1.00 24.82  ? 328 ARG A CG  1 
ATOM   2174 C CD  . ARG A 1 328 ? 12.873 39.823 52.139  1.00 24.82  ? 328 ARG A CD  1 
ATOM   2175 N NE  . ARG A 1 328 ? 12.317 40.282 53.413  1.00 24.82  ? 328 ARG A NE  1 
ATOM   2176 C CZ  . ARG A 1 328 ? 12.558 39.724 54.598  1.00 24.82  ? 328 ARG A CZ  1 
ATOM   2177 N NH1 . ARG A 1 328 ? 13.349 38.671 54.699  1.00 24.82  ? 328 ARG A NH1 1 
ATOM   2178 N NH2 . ARG A 1 328 ? 12.000 40.222 55.687  1.00 24.82  ? 328 ARG A NH2 1 
ATOM   2179 N N   . LEU A 1 329 ? 12.472 40.196 46.411  1.00 24.91  ? 329 LEU A N   1 
ATOM   2180 C CA  . LEU A 1 329 ? 12.879 39.646 45.132  1.00 24.91  ? 329 LEU A CA  1 
ATOM   2181 C C   . LEU A 1 329 ? 13.737 38.443 45.415  1.00 24.91  ? 329 LEU A C   1 
ATOM   2182 O O   . LEU A 1 329 ? 14.281 38.299 46.507  1.00 24.91  ? 329 LEU A O   1 
ATOM   2183 C CB  . LEU A 1 329 ? 13.704 40.667 44.354  1.00 35.89  ? 329 LEU A CB  1 
ATOM   2184 C CG  . LEU A 1 329 ? 12.990 41.653 43.431  1.00 35.89  ? 329 LEU A CG  1 
ATOM   2185 C CD1 . LEU A 1 329 ? 11.593 41.992 43.947  1.00 35.89  ? 329 LEU A CD1 1 
ATOM   2186 C CD2 . LEU A 1 329 ? 13.863 42.900 43.308  1.00 35.89  ? 329 LEU A CD2 1 
ATOM   2187 N N   . THR A 1 330 ? 13.854 37.575 44.427  1.00 27.02  ? 330 THR A N   1 
ATOM   2188 C CA  . THR A 1 330 ? 14.686 36.405 44.581  1.00 27.02  ? 330 THR A CA  1 
ATOM   2189 C C   . THR A 1 330 ? 16.005 36.805 43.964  1.00 27.02  ? 330 THR A C   1 
ATOM   2190 O O   . THR A 1 330 ? 16.066 37.733 43.163  1.00 27.02  ? 330 THR A O   1 
ATOM   2191 C CB  . THR A 1 330 ? 14.141 35.218 43.814  1.00 37.14  ? 330 THR A CB  1 
ATOM   2192 O OG1 . THR A 1 330 ? 14.347 35.429 42.411  1.00 37.14  ? 330 THR A OG1 1 
ATOM   2193 C CG2 . THR A 1 330 ? 12.658 35.054 44.101  1.00 37.14  ? 330 THR A CG2 1 
ATOM   2194 N N   . PRO A 1 331 ? 17.086 36.121 44.338  1.00 26.91  ? 331 PRO A N   1 
ATOM   2195 C CA  . PRO A 1 331 ? 18.396 36.453 43.783  1.00 26.91  ? 331 PRO A CA  1 
ATOM   2196 C C   . PRO A 1 331 ? 18.392 36.654 42.268  1.00 26.91  ? 331 PRO A C   1 
ATOM   2197 O O   . PRO A 1 331 ? 18.976 37.617 41.764  1.00 26.91  ? 331 PRO A O   1 
ATOM   2198 C CB  . PRO A 1 331 ? 19.256 35.277 44.229  1.00 24.45  ? 331 PRO A CB  1 
ATOM   2199 C CG  . PRO A 1 331 ? 18.683 34.975 45.582  1.00 24.45  ? 331 PRO A CG  1 
ATOM   2200 C CD  . PRO A 1 331 ? 17.189 35.048 45.340  1.00 24.45  ? 331 PRO A CD  1 
ATOM   2201 N N   . LEU A 1 332 ? 17.729 35.758 41.541  1.00 33.38  ? 332 LEU A N   1 
ATOM   2202 C CA  . LEU A 1 332 ? 17.682 35.885 40.092  1.00 33.38  ? 332 LEU A CA  1 
ATOM   2203 C C   . LEU A 1 332 ? 16.915 37.123 39.688  1.00 33.38  ? 332 LEU A C   1 
ATOM   2204 O O   . LEU A 1 332 ? 17.292 37.790 38.735  1.00 33.38  ? 332 LEU A O   1 
ATOM   2205 C CB  . LEU A 1 332 ? 17.050 34.658 39.442  1.00 38.61  ? 332 LEU A CB  1 
ATOM   2206 C CG  . LEU A 1 332 ? 17.919 33.426 39.163  1.00 38.61  ? 332 LEU A CG  1 
ATOM   2207 C CD1 . LEU A 1 332 ? 17.076 32.396 38.439  1.00 38.61  ? 332 LEU A CD1 1 
ATOM   2208 C CD2 . LEU A 1 332 ? 19.103 33.792 38.305  1.00 38.61  ? 332 LEU A CD2 1 
ATOM   2209 N N   . GLU A 1 333 ? 15.842 37.435 40.408  1.00 36.97  ? 333 GLU A N   1 
ATOM   2210 C CA  . GLU A 1 333 ? 15.057 38.627 40.093  1.00 36.97  ? 333 GLU A CA  1 
ATOM   2211 C C   . GLU A 1 333 ? 15.873 39.882 40.406  1.00 36.97  ? 333 GLU A C   1 
ATOM   2212 O O   . GLU A 1 333 ? 15.729 40.920 39.755  1.00 36.97  ? 333 GLU A O   1 
ATOM   2213 C CB  . GLU A 1 333 ? 13.738 38.631 40.880  1.00 39.30  ? 333 GLU A CB  1 
ATOM   2214 C CG  . GLU A 1 333 ? 12.857 37.429 40.567  1.00 39.30  ? 333 GLU A CG  1 
ATOM   2215 C CD  . GLU A 1 333 ? 11.646 37.303 41.486  1.00 39.30  ? 333 GLU A CD  1 
ATOM   2216 O OE1 . GLU A 1 333 ? 11.776 37.603 42.691  1.00 39.30  ? 333 GLU A OE1 1 
ATOM   2217 O OE2 . GLU A 1 333 ? 10.567 36.880 41.010  1.00 39.30  ? 333 GLU A OE2 1 
ATOM   2218 N N   . ALA A 1 334 ? 16.745 39.780 41.397  1.00 32.12  ? 334 ALA A N   1 
ATOM   2219 C CA  . ALA A 1 334 ? 17.582 40.908 41.762  1.00 32.12  ? 334 ALA A CA  1 
ATOM   2220 C C   . ALA A 1 334 ? 18.535 41.136 40.608  1.00 32.12  ? 334 ALA A C   1 
ATOM   2221 O O   . ALA A 1 334 ? 18.742 42.260 40.190  1.00 32.12  ? 334 ALA A O   1 
ATOM   2222 C CB  . ALA A 1 334 ? 18.347 40.604 43.040  1.00 22.68  ? 334 ALA A CB  1 
ATOM   2223 N N   . CYS A 1 335 ? 19.092 40.055 40.080  1.00 31.34  ? 335 CYS A N   1 
ATOM   2224 C CA  . CYS A 1 335 ? 20.026 40.129 38.958  1.00 31.34  ? 335 CYS A CA  1 
ATOM   2225 C C   . CYS A 1 335 ? 19.455 40.746 37.695  1.00 31.34  ? 335 CYS A C   1 
ATOM   2226 O O   . CYS A 1 335 ? 20.172 41.406 36.943  1.00 31.34  ? 335 CYS A O   1 
ATOM   2227 C CB  . CYS A 1 335 ? 20.530 38.739 38.590  1.00 28.29  ? 335 CYS A CB  1 
ATOM   2228 S SG  . CYS A 1 335 ? 21.696 38.049 39.729  1.00 28.29  ? 335 CYS A SG  1 
ATOM   2229 N N   . ALA A 1 336 ? 18.172 40.506 37.452  1.00 25.38  ? 336 ALA A N   1 
ATOM   2230 C CA  . ALA A 1 336 ? 17.507 41.009 36.257  1.00 25.38  ? 336 ALA A CA  1 
ATOM   2231 C C   . ALA A 1 336 ? 16.890 42.385 36.449  1.00 25.38  ? 336 ALA A C   1 
ATOM   2232 O O   . ALA A 1 336 ? 16.183 42.884 35.572  1.00 25.38  ? 336 ALA A O   1 
ATOM   2233 C CB  . ALA A 1 336 ? 16.443 40.020 35.816  1.00 20.49  ? 336 ALA A CB  1 
ATOM   2234 N N   . HIS A 1 337 ? 17.150 42.990 37.600  1.00 25.00  ? 337 HIS A N   1 
ATOM   2235 C CA  . HIS A 1 337 ? 16.610 44.307 37.881  1.00 25.00  ? 337 HIS A CA  1 
ATOM   2236 C C   . HIS A 1 337 ? 17.274 45.325 36.960  1.00 25.00  ? 337 HIS A C   1 
ATOM   2237 O O   . HIS A 1 337 ? 18.437 45.164 36.583  1.00 25.00  ? 337 HIS A O   1 
ATOM   2238 C CB  . HIS A 1 337 ? 16.847 44.691 39.345  1.00 25.76  ? 337 HIS A CB  1 
ATOM   2239 C CG  . HIS A 1 337 ? 16.185 45.975 39.738  1.00 25.76  ? 337 HIS A CG  1 
ATOM   2240 N ND1 . HIS A 1 337 ? 14.927 46.022 40.296  1.00 25.76  ? 337 HIS A ND1 1 
ATOM   2241 C CD2 . HIS A 1 337 ? 16.579 47.260 39.593  1.00 25.76  ? 337 HIS A CD2 1 
ATOM   2242 C CE1 . HIS A 1 337 ? 14.575 47.281 40.478  1.00 25.76  ? 337 HIS A CE1 1 
ATOM   2243 N NE2 . HIS A 1 337 ? 15.559 48.054 40.059  1.00 25.76  ? 337 HIS A NE2 1 
ATOM   2244 N N   . SER A 1 338 ? 16.535 46.369 36.598  1.00 33.10  ? 338 SER A N   1 
ATOM   2245 C CA  . SER A 1 338 ? 17.068 47.392 35.705  1.00 33.10  ? 338 SER A CA  1 
ATOM   2246 C C   . SER A 1 338 ? 18.389 47.987 36.196  1.00 33.10  ? 338 SER A C   1 
ATOM   2247 O O   . SER A 1 338 ? 19.247 48.336 35.386  1.00 33.10  ? 338 SER A O   1 
ATOM   2248 C CB  . SER A 1 338 ? 16.030 48.498 35.477  1.00 46.43  ? 338 SER A CB  1 
ATOM   2249 O OG  . SER A 1 338 ? 15.598 49.057 36.705  1.00 46.43  ? 338 SER A OG  1 
ATOM   2250 N N   . PHE A 1 339 ? 18.553 48.086 37.512  1.00 25.39  ? 339 PHE A N   1 
ATOM   2251 C CA  . PHE A 1 339 ? 19.783 48.612 38.108  1.00 25.39  ? 339 PHE A CA  1 
ATOM   2252 C C   . PHE A 1 339 ? 21.048 47.945 37.557  1.00 25.39  ? 339 PHE A C   1 
ATOM   2253 O O   . PHE A 1 339 ? 22.129 48.526 37.588  1.00 25.39  ? 339 PHE A O   1 
ATOM   2254 C CB  . PHE A 1 339 ? 19.757 48.434 39.634  1.00 25.22  ? 339 PHE A CB  1 
ATOM   2255 C CG  . PHE A 1 339 ? 20.991 48.941 40.327  1.00 25.22  ? 339 PHE A CG  1 
ATOM   2256 C CD1 . PHE A 1 339 ? 21.347 50.284 40.248  1.00 25.22  ? 339 PHE A CD1 1 
ATOM   2257 C CD2 . PHE A 1 339 ? 21.814 48.069 41.032  1.00 25.22  ? 339 PHE A CD2 1 
ATOM   2258 C CE1 . PHE A 1 339 ? 22.499 50.755 40.854  1.00 25.22  ? 339 PHE A CE1 1 
ATOM   2259 C CE2 . PHE A 1 339 ? 22.974 48.529 41.647  1.00 25.22  ? 339 PHE A CE2 1 
ATOM   2260 C CZ  . PHE A 1 339 ? 23.316 49.881 41.555  1.00 25.22  ? 339 PHE A CZ  1 
ATOM   2261 N N   . PHE A 1 340 ? 20.913 46.726 37.053  1.00 26.97  ? 340 PHE A N   1 
ATOM   2262 C CA  . PHE A 1 340 ? 22.056 46.016 36.512  1.00 26.97  ? 340 PHE A CA  1 
ATOM   2263 C C   . PHE A 1 340 ? 22.082 46.031 34.994  1.00 26.97  ? 340 PHE A C   1 
ATOM   2264 O O   . PHE A 1 340 ? 22.797 45.241 34.374  1.00 26.97  ? 340 PHE A O   1 
ATOM   2265 C CB  . PHE A 1 340 ? 22.056 44.577 37.010  1.00 20.05  ? 340 PHE A CB  1 
ATOM   2266 C CG  . PHE A 1 340 ? 22.178 44.461 38.494  1.00 20.05  ? 340 PHE A CG  1 
ATOM   2267 C CD1 . PHE A 1 340 ? 23.372 44.777 39.132  1.00 20.05  ? 340 PHE A CD1 1 
ATOM   2268 C CD2 . PHE A 1 340 ? 21.094 44.058 39.265  1.00 20.05  ? 340 PHE A CD2 1 
ATOM   2269 C CE1 . PHE A 1 340 ? 23.485 44.691 40.511  1.00 20.05  ? 340 PHE A CE1 1 
ATOM   2270 C CE2 . PHE A 1 340 ? 21.197 43.969 40.645  1.00 20.05  ? 340 PHE A CE2 1 
ATOM   2271 C CZ  . PHE A 1 340 ? 22.394 44.285 41.270  1.00 20.05  ? 340 PHE A CZ  1 
ATOM   2272 N N   . ASP A 1 341 ? 21.312 46.930 34.384  1.00 31.18  ? 341 ASP A N   1 
ATOM   2273 C CA  . ASP A 1 341 ? 21.283 46.986 32.929  1.00 31.18  ? 341 ASP A CA  1 
ATOM   2274 C C   . ASP A 1 341 ? 22.637 47.374 32.335  1.00 31.18  ? 341 ASP A C   1 
ATOM   2275 O O   . ASP A 1 341 ? 23.035 46.834 31.314  1.00 31.18  ? 341 ASP A O   1 
ATOM   2276 C CB  . ASP A 1 341 ? 20.173 47.933 32.437  1.00 36.78  ? 341 ASP A CB  1 
ATOM   2277 C CG  . ASP A 1 341 ? 18.795 47.262 32.425  1.00 36.78  ? 341 ASP A CG  1 
ATOM   2278 O OD1 . ASP A 1 341 ? 18.759 46.014 32.490  1.00 36.78  ? 341 ASP A OD1 1 
ATOM   2279 O OD2 . ASP A 1 341 ? 17.752 47.961 32.335  1.00 36.78  ? 341 ASP A OD2 1 
ATOM   2280 N N   . GLU A 1 342 ? 23.354 48.293 32.973  1.00 28.84  ? 342 GLU A N   1 
ATOM   2281 C CA  . GLU A 1 342 ? 24.663 48.704 32.463  1.00 28.84  ? 342 GLU A CA  1 
ATOM   2282 C C   . GLU A 1 342 ? 25.551 47.462 32.293  1.00 28.84  ? 342 GLU A C   1 
ATOM   2283 O O   . GLU A 1 342 ? 26.273 47.336 31.312  1.00 28.84  ? 342 GLU A O   1 
ATOM   2284 C CB  . GLU A 1 342 ? 25.339 49.697 33.438  1.00 37.21  ? 342 GLU A CB  1 
ATOM   2285 C CG  . GLU A 1 342 ? 26.453 50.556 32.831  1.00 37.21  ? 342 GLU A CG  1 
ATOM   2286 C CD  . GLU A 1 342 ? 27.265 51.353 33.868  1.00 37.21  ? 342 GLU A CD  1 
ATOM   2287 O OE1 . GLU A 1 342 ? 26.684 51.856 34.854  1.00 37.21  ? 342 GLU A OE1 1 
ATOM   2288 O OE2 . GLU A 1 342 ? 28.498 51.496 33.692  1.00 37.21  ? 342 GLU A OE2 1 
ATOM   2289 N N   . LEU A 1 343 ? 25.492 46.545 33.255  1.00 34.22  ? 343 LEU A N   1 
ATOM   2290 C CA  . LEU A 1 343 ? 26.311 45.347 33.202  1.00 34.22  ? 343 LEU A CA  1 
ATOM   2291 C C   . LEU A 1 343 ? 25.972 44.534 31.966  1.00 34.22  ? 343 LEU A C   1 
ATOM   2292 O O   . LEU A 1 343 ? 26.816 43.815 31.428  1.00 34.22  ? 343 LEU A O   1 
ATOM   2293 C CB  . LEU A 1 343 ? 26.091 44.499 34.456  1.00 33.33  ? 343 LEU A CB  1 
ATOM   2294 C CG  . LEU A 1 343 ? 26.357 45.196 35.790  1.00 33.33  ? 343 LEU A CG  1 
ATOM   2295 C CD1 . LEU A 1 343 ? 26.132 44.227 36.942  1.00 33.33  ? 343 LEU A CD1 1 
ATOM   2296 C CD2 . LEU A 1 343 ? 27.783 45.727 35.806  1.00 33.33  ? 343 LEU A CD2 1 
ATOM   2297 N N   . ARG A 1 344 ? 24.730 44.646 31.518  1.00 38.25  ? 344 ARG A N   1 
ATOM   2298 C CA  . ARG A 1 344 ? 24.304 43.908 30.350  1.00 38.25  ? 344 ARG A CA  1 
ATOM   2299 C C   . ARG A 1 344 ? 24.775 44.565 29.056  1.00 38.25  ? 344 ARG A C   1 
ATOM   2300 O O   . ARG A 1 344 ? 24.904 43.893 28.027  1.00 38.25  ? 344 ARG A O   1 
ATOM   2301 C CB  . ARG A 1 344 ? 22.784 43.721 30.363  1.00 30.47  ? 344 ARG A CB  1 
ATOM   2302 C CG  . ARG A 1 344 ? 22.348 42.457 31.114  1.00 30.47  ? 344 ARG A CG  1 
ATOM   2303 C CD  . ARG A 1 344 ? 20.839 42.242 31.113  1.00 30.47  ? 344 ARG A CD  1 
ATOM   2304 N NE  . ARG A 1 344 ? 20.145 43.139 32.032  1.00 30.47  ? 344 ARG A NE  1 
ATOM   2305 C CZ  . ARG A 1 344 ? 20.171 43.027 33.356  1.00 30.47  ? 344 ARG A CZ  1 
ATOM   2306 N NH1 . ARG A 1 344 ? 20.858 42.051 33.935  1.00 30.47  ? 344 ARG A NH1 1 
ATOM   2307 N NH2 . ARG A 1 344 ? 19.497 43.889 34.103  1.00 30.47  ? 344 ARG A NH2 1 
ATOM   2308 N N   . ASP A 1 345 ? 25.057 45.866 29.109  1.00 36.28  ? 345 ASP A N   1 
ATOM   2309 C CA  . ASP A 1 345 ? 25.540 46.589 27.936  1.00 36.28  ? 345 ASP A CA  1 
ATOM   2310 C C   . ASP A 1 345 ? 26.738 45.860 27.328  1.00 36.28  ? 345 ASP A C   1 
ATOM   2311 O O   . ASP A 1 345 ? 27.570 45.303 28.038  1.00 36.28  ? 345 ASP A O   1 
ATOM   2312 C CB  . ASP A 1 345 ? 25.968 48.001 28.322  1.00 54.81  ? 345 ASP A CB  1 
ATOM   2313 C CG  . ASP A 1 345 ? 26.315 48.869 27.109  1.00 54.81  ? 345 ASP A CG  1 
ATOM   2314 O OD1 . ASP A 1 345 ? 27.238 48.503 26.331  1.00 54.81  ? 345 ASP A OD1 1 
ATOM   2315 O OD2 . ASP A 1 345 ? 25.658 49.927 26.946  1.00 54.81  ? 345 ASP A OD2 1 
ATOM   2316 N N   . PRO A 1 346 ? 26.836 45.844 25.997  1.00 36.28  ? 346 PRO A N   1 
ATOM   2317 C CA  . PRO A 1 346 ? 27.975 45.154 25.392  1.00 36.28  ? 346 PRO A CA  1 
ATOM   2318 C C   . PRO A 1 346 ? 29.270 45.958 25.436  1.00 36.28  ? 346 PRO A C   1 
ATOM   2319 O O   . PRO A 1 346 ? 30.351 45.376 25.403  1.00 36.28  ? 346 PRO A O   1 
ATOM   2320 C CB  . PRO A 1 346 ? 27.502 44.910 23.967  1.00 29.59  ? 346 PRO A CB  1 
ATOM   2321 C CG  . PRO A 1 346 ? 26.639 46.105 23.706  1.00 29.59  ? 346 PRO A CG  1 
ATOM   2322 C CD  . PRO A 1 346 ? 25.834 46.205 24.979  1.00 29.59  ? 346 PRO A CD  1 
ATOM   2323 N N   . ASN A 1 347 ? 29.166 47.285 25.519  1.00 50.30  ? 347 ASN A N   1 
ATOM   2324 C CA  . ASN A 1 347 ? 30.358 48.140 25.535  1.00 50.30  ? 347 ASN A CA  1 
ATOM   2325 C C   . ASN A 1 347 ? 30.938 48.462 26.918  1.00 50.30  ? 347 ASN A C   1 
ATOM   2326 O O   . ASN A 1 347 ? 31.947 49.171 27.024  1.00 50.30  ? 347 ASN A O   1 
ATOM   2327 C CB  . ASN A 1 347 ? 30.074 49.459 24.807  0.00 52.63  ? 347 ASN A CB  1 
ATOM   2328 C CG  . ASN A 1 347 ? 29.667 49.256 23.360  1.00 52.63  ? 347 ASN A CG  1 
ATOM   2329 O OD1 . ASN A 1 347 ? 28.632 49.764 22.925  1.00 52.63  ? 347 ASN A OD1 1 
ATOM   2330 N ND2 . ASN A 1 347 ? 30.478 48.514 22.604  1.00 52.63  ? 347 ASN A ND2 1 
ATOM   2331 N N   . VAL A 1 348 ? 30.330 47.928 27.974  1.00 43.46  ? 348 VAL A N   1 
ATOM   2332 C CA  . VAL A 1 348 ? 30.793 48.218 29.324  1.00 43.46  ? 348 VAL A CA  1 
ATOM   2333 C C   . VAL A 1 348 ? 32.133 47.586 29.694  1.00 43.46  ? 348 VAL A C   1 
ATOM   2334 O O   . VAL A 1 348 ? 32.438 46.454 29.325  1.00 43.46  ? 348 VAL A O   1 
ATOM   2335 C CB  . VAL A 1 348 ? 29.728 47.790 30.382  1.00 52.14  ? 348 VAL A CB  1 
ATOM   2336 C CG1 . VAL A 1 348 ? 29.686 46.256 30.508  1.00 52.14  ? 348 VAL A CG1 1 
ATOM   2337 C CG2 . VAL A 1 348 ? 30.030 48.452 31.731  1.00 52.14  ? 348 VAL A CG2 1 
ATOM   2338 N N   . LYS A 1 349 ? 32.929 48.343 30.434  1.00 40.96  ? 349 LYS A N   1 
ATOM   2339 C CA  . LYS A 1 349 ? 34.225 47.876 30.897  1.00 40.96  ? 349 LYS A CA  1 
ATOM   2340 C C   . LYS A 1 349 ? 34.479 48.496 32.270  1.00 40.96  ? 349 LYS A C   1 
ATOM   2341 O O   . LYS A 1 349 ? 33.711 49.339 32.731  1.00 40.96  ? 349 LYS A O   1 
ATOM   2342 C CB  . LYS A 1 349 ? 35.314 48.284 29.905  1.00 49.14  ? 349 LYS A CB  1 
ATOM   2343 C CG  . LYS A 1 349 ? 34.986 47.877 28.461  1.00 49.14  ? 349 LYS A CG  1 
ATOM   2344 C CD  . LYS A 1 349 ? 36.244 47.631 27.632  1.00 49.14  ? 349 LYS A CD  1 
ATOM   2345 C CE  . LYS A 1 349 ? 37.016 46.420 28.149  1.00 49.14  ? 349 LYS A CE  1 
ATOM   2346 N NZ  . LYS A 1 349 ? 38.397 46.300 27.585  1.00 49.14  ? 349 LYS A NZ  1 
ATOM   2347 N N   . LEU A 1 350 ? 35.538 48.071 32.938  1.00 38.10  ? 350 LEU A N   1 
ATOM   2348 C CA  . LEU A 1 350 ? 35.843 48.624 34.245  1.00 38.10  ? 350 LEU A CA  1 
ATOM   2349 C C   . LEU A 1 350 ? 36.566 49.929 34.006  1.00 38.10  ? 350 LEU A C   1 
ATOM   2350 O O   . LEU A 1 350 ? 37.191 50.097 32.962  1.00 38.10  ? 350 LEU A O   1 
ATOM   2351 C CB  . LEU A 1 350 ? 36.736 47.662 35.011  1.00 30.19  ? 350 LEU A CB  1 
ATOM   2352 C CG  . LEU A 1 350 ? 36.202 46.227 35.043  1.00 30.19  ? 350 LEU A CG  1 
ATOM   2353 C CD1 . LEU A 1 350 ? 37.156 45.354 35.830  1.00 30.19  ? 350 LEU A CD1 1 
ATOM   2354 C CD2 . LEU A 1 350 ? 34.816 46.199 35.651  1.00 30.19  ? 350 LEU A CD2 1 
ATOM   2355 N N   . PRO A 1 351 ? 36.498 50.872 34.962  1.00 48.81  ? 351 PRO A N   1 
ATOM   2356 C CA  . PRO A 1 351 ? 37.180 52.168 34.795  1.00 48.81  ? 351 PRO A CA  1 
ATOM   2357 C C   . PRO A 1 351 ? 38.595 51.859 34.362  1.00 48.81  ? 351 PRO A C   1 
ATOM   2358 O O   . PRO A 1 351 ? 39.256 52.621 33.668  1.00 48.81  ? 351 PRO A O   1 
ATOM   2359 C CB  . PRO A 1 351 ? 37.137 52.755 36.197  1.00 41.63  ? 351 PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 351 ? 37.230 51.547 37.045  1.00 41.63  ? 351 PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 351 ? 36.233 50.616 36.385  1.00 41.63  ? 351 PRO A CD  1 
ATOM   2362 N N   . ASN A 1 352 ? 39.006 50.683 34.800  1.00 44.98  ? 352 ASN A N   1 
ATOM   2363 C CA  . ASN A 1 352 ? 40.288 50.068 34.557  1.00 44.98  ? 352 ASN A CA  1 
ATOM   2364 C C   . ASN A 1 352 ? 40.641 49.972 33.066  1.00 44.98  ? 352 ASN A C   1 
ATOM   2365 O O   . ASN A 1 352 ? 41.800 50.140 32.672  1.00 44.98  ? 352 ASN A O   1 
ATOM   2366 C CB  . ASN A 1 352 ? 40.209 48.663 35.143  1.00 62.78  ? 352 ASN A CB  1 
ATOM   2367 C CG  . ASN A 1 352 ? 41.538 48.063 35.350  1.00 62.78  ? 352 ASN A CG  1 
ATOM   2368 O OD1 . ASN A 1 352 ? 42.539 48.590 34.857  1.00 62.78  ? 352 ASN A OD1 1 
ATOM   2369 N ND2 . ASN A 1 352 ? 41.584 46.950 36.081  1.00 62.78  ? 352 ASN A ND2 1 
ATOM   2370 N N   . GLY A 1 353 ? 39.634 49.682 32.244  1.00 41.80  ? 353 GLY A N   1 
ATOM   2371 C CA  . GLY A 1 353 ? 39.852 49.522 30.820  1.00 41.80  ? 353 GLY A CA  1 
ATOM   2372 C C   . GLY A 1 353 ? 39.692 48.043 30.522  1.00 41.80  ? 353 GLY A C   1 
ATOM   2373 O O   . GLY A 1 353 ? 39.389 47.649 29.395  1.00 41.80  ? 353 GLY A O   1 
ATOM   2374 N N   . ARG A 1 354 ? 39.899 47.214 31.545  1.00 33.12  ? 354 ARG A N   1 
ATOM   2375 C CA  . ARG A 1 354 ? 39.756 45.762 31.404  1.00 33.12  ? 354 ARG A CA  1 
ATOM   2376 C C   . ARG A 1 354 ? 38.282 45.402 31.267  1.00 33.12  ? 354 ARG A C   1 
ATOM   2377 O O   . ARG A 1 354 ? 37.395 46.218 31.517  1.00 33.12  ? 354 ARG A O   1 
ATOM   2378 C CB  . ARG A 1 354 ? 40.341 45.040 32.626  1.00 60.57  ? 354 ARG A CB  1 
ATOM   2379 C CG  . ARG A 1 354 ? 41.776 45.437 32.924  1.00 60.57  ? 354 ARG A CG  1 
ATOM   2380 C CD  . ARG A 1 354 ? 42.350 44.793 34.188  1.00 60.57  ? 354 ARG A CD  1 
ATOM   2381 N NE  . ARG A 1 354 ? 42.624 43.364 34.035  1.00 60.57  ? 354 ARG A NE  1 
ATOM   2382 C CZ  . ARG A 1 354 ? 43.483 42.684 34.800  1.00 60.57  ? 354 ARG A CZ  1 
ATOM   2383 N NH1 . ARG A 1 354 ? 44.155 43.303 35.773  1.00 60.57  ? 354 ARG A NH1 1 
ATOM   2384 N NH2 . ARG A 1 354 ? 43.675 41.383 34.595  1.00 60.57  ? 354 ARG A NH2 1 
ATOM   2385 N N   . ASP A 1 355 ? 38.023 44.170 30.868  1.00 31.58  ? 355 ASP A N   1 
ATOM   2386 C CA  . ASP A 1 355 ? 36.656 43.717 30.705  1.00 31.58  ? 355 ASP A CA  1 
ATOM   2387 C C   . ASP A 1 355 ? 36.064 43.308 32.045  1.00 31.58  ? 355 ASP A C   1 
ATOM   2388 O O   . ASP A 1 355 ? 36.794 43.062 33.017  1.00 31.58  ? 355 ASP A O   1 
ATOM   2389 C CB  . ASP A 1 355 ? 36.617 42.534 29.740  1.00 57.55  ? 355 ASP A CB  1 
ATOM   2390 C CG  . ASP A 1 355 ? 35.948 42.882 28.422  1.00 57.55  ? 355 ASP A CG  1 
ATOM   2391 O OD1 . ASP A 1 355 ? 34.694 42.805 28.340  1.00 57.55  ? 355 ASP A OD1 1 
ATOM   2392 O OD2 . ASP A 1 355 ? 36.678 43.247 27.471  1.00 57.55  ? 355 ASP A OD2 1 
ATOM   2393 N N   . THR A 1 356 ? 34.738 43.245 32.096  1.00 22.57  ? 356 THR A N   1 
ATOM   2394 C CA  . THR A 1 356 ? 34.065 42.845 33.314  1.00 22.57  ? 356 THR A CA  1 
ATOM   2395 C C   . THR A 1 356 ? 34.219 41.331 33.447  1.00 22.57  ? 356 THR A C   1 
ATOM   2396 O O   . THR A 1 356 ? 34.465 40.623 32.474  1.00 22.57  ? 356 THR A O   1 
ATOM   2397 C CB  . THR A 1 356 ? 32.552 43.200 33.297  1.00 29.12  ? 356 THR A CB  1 
ATOM   2398 O OG1 . THR A 1 356 ? 31.849 42.315 32.422  1.00 29.12  ? 356 THR A OG1 1 
ATOM   2399 C CG2 . THR A 1 356 ? 32.339 44.614 32.832  1.00 29.12  ? 356 THR A CG2 1 
ATOM   2400 N N   . PRO A 1 357 ? 34.099 40.816 34.667  1.00 31.50  ? 357 PRO A N   1 
ATOM   2401 C CA  . PRO A 1 357 ? 34.240 39.368 34.800  1.00 31.50  ? 357 PRO A CA  1 
ATOM   2402 C C   . PRO A 1 357 ? 33.018 38.707 34.175  1.00 31.50  ? 357 PRO A C   1 
ATOM   2403 O O   . PRO A 1 357 ? 32.069 39.389 33.790  1.00 31.50  ? 357 PRO A O   1 
ATOM   2404 C CB  . PRO A 1 357 ? 34.326 39.177 36.315  1.00 41.97  ? 357 PRO A CB  1 
ATOM   2405 C CG  . PRO A 1 357 ? 33.464 40.297 36.849  1.00 41.97  ? 357 PRO A CG  1 
ATOM   2406 C CD  . PRO A 1 357 ? 33.852 41.467 35.969  1.00 41.97  ? 357 PRO A CD  1 
ATOM   2407 N N   . ALA A 1 358 ? 33.039 37.388 34.050  1.00 29.10  ? 358 ALA A N   1 
ATOM   2408 C CA  . ALA A 1 358 ? 31.902 36.694 33.478  1.00 29.10  ? 358 ALA A CA  1 
ATOM   2409 C C   . ALA A 1 358 ? 30.695 37.026 34.338  1.00 29.10  ? 358 ALA A C   1 
ATOM   2410 O O   . ALA A 1 358 ? 30.790 37.031 35.560  1.00 29.10  ? 358 ALA A O   1 
ATOM   2411 C CB  . ALA A 1 358 ? 32.148 35.191 33.478  0.00 35.69  ? 358 ALA A CB  1 
ATOM   2412 N N   . LEU A 1 359 ? 29.570 37.322 33.700  1.00 28.58  ? 359 LEU A N   1 
ATOM   2413 C CA  . LEU A 1 359 ? 28.351 37.641 34.427  1.00 28.58  ? 359 LEU A CA  1 
ATOM   2414 C C   . LEU A 1 359 ? 27.150 36.921 33.847  1.00 28.58  ? 359 LEU A C   1 
ATOM   2415 O O   . LEU A 1 359 ? 26.087 36.863 34.472  1.00 28.58  ? 359 LEU A O   1 
ATOM   2416 C CB  . LEU A 1 359 ? 28.078 39.138 34.378  1.00 30.76  ? 359 LEU A CB  1 
ATOM   2417 C CG  . LEU A 1 359 ? 29.200 40.053 34.854  1.00 30.76  ? 359 LEU A CG  1 
ATOM   2418 C CD1 . LEU A 1 359 ? 28.704 41.499 34.831  1.00 30.76  ? 359 LEU A CD1 1 
ATOM   2419 C CD2 . LEU A 1 359 ? 29.641 39.647 36.254  1.00 30.76  ? 359 LEU A CD2 1 
ATOM   2420 N N   . PHE A 1 360 ? 27.327 36.364 32.652  1.00 37.37  ? 360 PHE A N   1 
ATOM   2421 C CA  . PHE A 1 360 ? 26.248 35.673 31.957  1.00 37.37  ? 360 PHE A CA  1 
ATOM   2422 C C   . PHE A 1 360 ? 26.391 34.152 31.756  1.00 37.37  ? 360 PHE A C   1 
ATOM   2423 O O   . PHE A 1 360 ? 25.471 33.506 31.266  1.00 37.37  ? 360 PHE A O   1 
ATOM   2424 C CB  . PHE A 1 360 ? 26.056 36.344 30.610  1.00 30.39  ? 360 PHE A CB  1 
ATOM   2425 C CG  . PHE A 1 360 ? 26.165 37.831 30.666  1.00 30.39  ? 360 PHE A CG  1 
ATOM   2426 C CD1 . PHE A 1 360 ? 25.249 38.581 31.391  1.00 30.39  ? 360 PHE A CD1 1 
ATOM   2427 C CD2 . PHE A 1 360 ? 27.182 38.488 29.987  1.00 30.39  ? 360 PHE A CD2 1 
ATOM   2428 C CE1 . PHE A 1 360 ? 25.344 39.970 31.436  1.00 30.39  ? 360 PHE A CE1 1 
ATOM   2429 C CE2 . PHE A 1 360 ? 27.283 39.873 30.026  1.00 30.39  ? 360 PHE A CE2 1 
ATOM   2430 C CZ  . PHE A 1 360 ? 26.359 40.615 30.755  1.00 30.39  ? 360 PHE A CZ  1 
ATOM   2431 N N   . ASN A 1 361 ? 27.528 33.579 32.129  1.00 33.59  ? 361 ASN A N   1 
ATOM   2432 C CA  . ASN A 1 361 ? 27.725 32.148 31.956  1.00 33.59  ? 361 ASN A CA  1 
ATOM   2433 C C   . ASN A 1 361 ? 26.911 31.335 32.973  1.00 33.59  ? 361 ASN A C   1 
ATOM   2434 O O   . ASN A 1 361 ? 27.448 30.530 33.760  1.00 33.59  ? 361 ASN A O   1 
ATOM   2435 C CB  . ASN A 1 361 ? 29.218 31.822 32.051  1.00 42.55  ? 361 ASN A CB  1 
ATOM   2436 C CG  . ASN A 1 361 ? 29.825 32.288 33.340  1.00 42.55  ? 361 ASN A CG  1 
ATOM   2437 O OD1 . ASN A 1 361 ? 29.370 33.277 33.932  1.00 42.55  ? 361 ASN A OD1 1 
ATOM   2438 N ND2 . ASN A 1 361 ? 30.872 31.592 33.790  1.00 42.55  ? 361 ASN A ND2 1 
ATOM   2439 N N   . PHE A 1 362 ? 25.598 31.548 32.926  1.00 48.99  ? 362 PHE A N   1 
ATOM   2440 C CA  . PHE A 1 362 ? 24.652 30.880 33.809  1.00 48.99  ? 362 PHE A CA  1 
ATOM   2441 C C   . PHE A 1 362 ? 24.545 29.378 33.587  1.00 48.99  ? 362 PHE A C   1 
ATOM   2442 O O   . PHE A 1 362 ? 24.934 28.871 32.534  1.00 48.99  ? 362 PHE A O   1 
ATOM   2443 C CB  . PHE A 1 362 ? 23.275 31.510 33.627  1.00 38.42  ? 362 PHE A CB  1 
ATOM   2444 C CG  . PHE A 1 362 ? 23.124 32.840 34.320  1.00 38.42  ? 362 PHE A CG  1 
ATOM   2445 C CD1 . PHE A 1 362 ? 23.062 32.911 35.712  1.00 38.42  ? 362 PHE A CD1 1 
ATOM   2446 C CD2 . PHE A 1 362 ? 23.048 34.023 33.586  1.00 38.42  ? 362 PHE A CD2 1 
ATOM   2447 C CE1 . PHE A 1 362 ? 22.929 34.135 36.353  1.00 38.42  ? 362 PHE A CE1 1 
ATOM   2448 C CE2 . PHE A 1 362 ? 22.914 35.254 34.228  1.00 38.42  ? 362 PHE A CE2 1 
ATOM   2449 C CZ  . PHE A 1 362 ? 22.854 35.305 35.610  1.00 38.42  ? 362 PHE A CZ  1 
ATOM   2450 N N   . THR A 1 363 ? 24.014 28.667 34.580  1.00 41.08  ? 363 THR A N   1 
ATOM   2451 C CA  . THR A 1 363 ? 23.826 27.222 34.457  1.00 41.08  ? 363 THR A CA  1 
ATOM   2452 C C   . THR A 1 363 ? 22.365 26.848 34.677  1.00 41.08  ? 363 THR A C   1 
ATOM   2453 O O   . THR A 1 363 ? 21.565 27.677 35.122  1.00 41.08  ? 363 THR A O   1 
ATOM   2454 C CB  . THR A 1 363 ? 24.676 26.448 35.469  1.00 37.00  ? 363 THR A CB  1 
ATOM   2455 O OG1 . THR A 1 363 ? 24.205 26.704 36.802  1.00 37.00  ? 363 THR A OG1 1 
ATOM   2456 C CG2 . THR A 1 363 ? 26.133 26.856 35.336  1.00 37.00  ? 363 THR A CG2 1 
ATOM   2457 N N   . THR A 1 364 ? 22.011 25.611 34.349  1.00 41.13  ? 364 THR A N   1 
ATOM   2458 C CA  . THR A 1 364 ? 20.634 25.151 34.541  1.00 41.13  ? 364 THR A CA  1 
ATOM   2459 C C   . THR A 1 364 ? 20.395 25.201 36.037  1.00 41.13  ? 364 THR A C   1 
ATOM   2460 O O   . THR A 1 364 ? 19.319 25.585 36.504  1.00 41.13  ? 364 THR A O   1 
ATOM   2461 C CB  . THR A 1 364 ? 20.436 23.698 34.061  1.00 37.94  ? 364 THR A CB  1 
ATOM   2462 O OG1 . THR A 1 364 ? 21.219 22.813 34.872  0.00 37.94  ? 364 THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 364 ? 20.857 23.564 32.610  1.00 37.94  ? 364 THR A CG2 1 
ATOM   2464 N N   . GLN A 1 365 ? 21.431 24.812 36.773  1.00 41.29  ? 365 GLN A N   1 
ATOM   2465 C CA  . GLN A 1 365 ? 21.406 24.812 38.227  1.00 41.29  ? 365 GLN A CA  1 
ATOM   2466 C C   . GLN A 1 365 ? 21.041 26.215 38.698  1.00 41.29  ? 365 GLN A C   1 
ATOM   2467 O O   . GLN A 1 365 ? 20.152 26.393 39.543  1.00 41.29  ? 365 GLN A O   1 
ATOM   2468 C CB  . GLN A 1 365 ? 22.787 24.435 38.768  1.00 48.42  ? 365 GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 365 ? 22.851 24.277 40.267  1.00 48.42  ? 365 GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 365 ? 21.817 23.292 40.769  1.00 48.42  ? 365 GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 365 ? 21.587 22.264 40.135  1.00 48.42  ? 365 GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 365 ? 21.191 23.589 41.914  1.00 48.42  ? 365 GLN A NE2 1 
ATOM   2473 N N   . GLU A 1 366 ? 21.720 27.211 38.132  1.00 37.78  ? 366 GLU A N   1 
ATOM   2474 C CA  . GLU A 1 366 ? 21.490 28.593 38.502  1.00 37.78  ? 366 GLU A CA  1 
ATOM   2475 C C   . GLU A 1 366 ? 20.132 29.124 38.134  1.00 37.78  ? 366 GLU A C   1 
ATOM   2476 O O   . GLU A 1 366 ? 19.481 29.747 38.964  1.00 37.78  ? 366 GLU A O   1 
ATOM   2477 C CB  . GLU A 1 366 ? 22.533 29.514 37.871  1.00 50.83  ? 366 GLU A CB  1 
ATOM   2478 C CG  . GLU A 1 366 ? 23.944 29.277 38.349  1.00 50.83  ? 366 GLU A CG  1 
ATOM   2479 C CD  . GLU A 1 366 ? 24.889 30.390 37.943  1.00 50.83  ? 366 GLU A CD  1 
ATOM   2480 O OE1 . GLU A 1 366 ? 24.662 31.536 38.399  1.00 50.83  ? 366 GLU A OE1 1 
ATOM   2481 O OE2 . GLU A 1 366 ? 25.851 30.108 37.181  1.00 50.83  ? 366 GLU A OE2 1 
ATOM   2482 N N   . LEU A 1 367 ? 19.701 28.890 36.901  1.00 30.92  ? 367 LEU A N   1 
ATOM   2483 C CA  . LEU A 1 367 ? 18.425 29.422 36.429  1.00 30.92  ? 367 LEU A CA  1 
ATOM   2484 C C   . LEU A 1 367 ? 17.180 28.620 36.806  1.00 30.92  ? 367 LEU A C   1 
ATOM   2485 O O   . LEU A 1 367 ? 16.055 29.021 36.471  1.00 30.92  ? 367 LEU A O   1 
ATOM   2486 C CB  . LEU A 1 367 ? 18.482 29.558 34.916  1.00 29.00  ? 367 LEU A CB  1 
ATOM   2487 C CG  . LEU A 1 367 ? 19.753 30.228 34.410  1.00 29.00  ? 367 LEU A CG  1 
ATOM   2488 C CD1 . LEU A 1 367 ? 20.084 29.713 33.030  1.00 29.00  ? 367 LEU A CD1 1 
ATOM   2489 C CD2 . LEU A 1 367 ? 19.572 31.736 34.410  1.00 29.00  ? 367 LEU A CD2 1 
ATOM   2490 N N   . SER A 1 368 ? 17.382 27.495 37.494  1.00 46.84  ? 368 SER A N   1 
ATOM   2491 C CA  . SER A 1 368 ? 16.277 26.618 37.882  1.00 46.84  ? 368 SER A CA  1 
ATOM   2492 C C   . SER A 1 368 ? 15.114 27.301 38.600  1.00 46.84  ? 368 SER A C   1 
ATOM   2493 O O   . SER A 1 368 ? 13.958 26.980 38.332  1.00 46.84  ? 368 SER A O   1 
ATOM   2494 C CB  . SER A 1 368 ? 16.785 25.463 38.746  1.00 35.11  ? 368 SER A CB  1 
ATOM   2495 O OG  . SER A 1 368 ? 17.241 25.906 40.016  1.00 35.11  ? 368 SER A OG  1 
ATOM   2496 N N   . SER A 1 369 ? 15.400 28.237 39.503  1.00 37.04  ? 369 SER A N   1 
ATOM   2497 C CA  . SER A 1 369 ? 14.324 28.911 40.230  1.00 37.04  ? 369 SER A CA  1 
ATOM   2498 C C   . SER A 1 369 ? 13.305 29.542 39.273  1.00 37.04  ? 369 SER A C   1 
ATOM   2499 O O   . SER A 1 369 ? 12.125 29.621 39.596  1.00 37.04  ? 369 SER A O   1 
ATOM   2500 C CB  . SER A 1 369 ? 14.895 29.980 41.174  1.00 33.53  ? 369 SER A CB  1 
ATOM   2501 O OG  . SER A 1 369 ? 14.796 31.295 40.642  1.00 33.53  ? 369 SER A OG  1 
ATOM   2502 N N   . ASN A 1 370 ? 13.767 29.974 38.097  1.00 46.91  ? 370 ASN A N   1 
ATOM   2503 C CA  . ASN A 1 370 ? 12.908 30.607 37.096  1.00 46.91  ? 370 ASN A CA  1 
ATOM   2504 C C   . ASN A 1 370 ? 13.632 30.703 35.740  1.00 46.91  ? 370 ASN A C   1 
ATOM   2505 O O   . ASN A 1 370 ? 14.044 31.785 35.310  1.00 46.91  ? 370 ASN A O   1 
ATOM   2506 C CB  . ASN A 1 370 ? 12.505 32.009 37.570  1.00 40.14  ? 370 ASN A CB  1 
ATOM   2507 C CG  . ASN A 1 370 ? 11.582 32.725 36.590  1.00 40.14  ? 370 ASN A CG  1 
ATOM   2508 O OD1 . ASN A 1 370 ? 11.781 32.663 35.376  1.00 40.14  ? 370 ASN A OD1 1 
ATOM   2509 N ND2 . ASN A 1 370 ? 10.577 33.425 37.115  1.00 40.14  ? 370 ASN A ND2 1 
ATOM   2510 N N   . PRO A 1 371 ? 13.793 29.564 35.051  1.00 42.70  ? 371 PRO A N   1 
ATOM   2511 C CA  . PRO A 1 371 ? 14.462 29.499 33.751  1.00 42.70  ? 371 PRO A CA  1 
ATOM   2512 C C   . PRO A 1 371 ? 14.163 30.659 32.802  1.00 42.70  ? 371 PRO A C   1 
ATOM   2513 O O   . PRO A 1 371 ? 15.077 31.288 32.262  1.00 42.70  ? 371 PRO A O   1 
ATOM   2514 C CB  . PRO A 1 371 ? 13.984 28.167 33.207  1.00 33.77  ? 371 PRO A CB  1 
ATOM   2515 C CG  . PRO A 1 371 ? 13.967 27.313 34.449  1.00 33.77  ? 371 PRO A CG  1 
ATOM   2516 C CD  . PRO A 1 371 ? 13.304 28.232 35.458  1.00 33.77  ? 371 PRO A CD  1 
ATOM   2517 N N   . PRO A 1 372 ? 12.881 30.956 32.577  1.00 37.15  ? 372 PRO A N   1 
ATOM   2518 C CA  . PRO A 1 372 ? 12.516 32.054 31.677  1.00 37.15  ? 372 PRO A CA  1 
ATOM   2519 C C   . PRO A 1 372 ? 13.143 33.401 31.966  1.00 37.15  ? 372 PRO A C   1 
ATOM   2520 O O   . PRO A 1 372 ? 13.033 34.326 31.152  1.00 37.15  ? 372 PRO A O   1 
ATOM   2521 C CB  . PRO A 1 372 ? 10.987 32.097 31.758  1.00 41.47  ? 372 PRO A CB  1 
ATOM   2522 C CG  . PRO A 1 372 ? 10.644 31.271 32.973  1.00 41.47  ? 372 PRO A CG  1 
ATOM   2523 C CD  . PRO A 1 372 ? 11.691 30.201 32.987  1.00 41.47  ? 372 PRO A CD  1 
ATOM   2524 N N   . LEU A 1 373 ? 13.796 33.534 33.114  1.00 34.30  ? 373 LEU A N   1 
ATOM   2525 C CA  . LEU A 1 373 ? 14.418 34.812 33.424  1.00 34.30  ? 373 LEU A CA  1 
ATOM   2526 C C   . LEU A 1 373 ? 15.681 34.998 32.606  1.00 34.30  ? 373 LEU A C   1 
ATOM   2527 O O   . LEU A 1 373 ? 16.243 36.092 32.542  1.00 34.30  ? 373 LEU A O   1 
ATOM   2528 C CB  . LEU A 1 373 ? 14.722 34.930 34.915  1.00 28.60  ? 373 LEU A CB  1 
ATOM   2529 C CG  . LEU A 1 373 ? 13.548 35.427 35.774  1.00 28.60  ? 373 LEU A CG  1 
ATOM   2530 C CD1 . LEU A 1 373 ? 14.027 35.644 37.203  0.00 28.60  ? 373 LEU A CD1 1 
ATOM   2531 C CD2 . LEU A 1 373 ? 12.981 36.716 35.189  1.00 28.60  ? 373 LEU A CD2 1 
ATOM   2532 N N   . ALA A 1 374 ? 16.108 33.922 31.961  1.00 40.00  ? 374 ALA A N   1 
ATOM   2533 C CA  . ALA A 1 374 ? 17.301 33.953 31.130  1.00 40.00  ? 374 ALA A CA  1 
ATOM   2534 C C   . ALA A 1 374 ? 17.129 34.903 29.926  1.00 40.00  ? 374 ALA A C   1 
ATOM   2535 O O   . ALA A 1 374 ? 18.109 35.392 29.360  1.00 40.00  ? 374 ALA A O   1 
ATOM   2536 C CB  . ALA A 1 374 ? 17.609 32.553 30.653  1.00 28.45  ? 374 ALA A CB  1 
ATOM   2537 N N   . THR A 1 375 ? 15.881 35.162 29.541  1.00 40.27  ? 375 THR A N   1 
ATOM   2538 C CA  . THR A 1 375 ? 15.599 36.041 28.418  1.00 40.27  ? 375 THR A CA  1 
ATOM   2539 C C   . THR A 1 375 ? 15.987 37.467 28.775  1.00 40.27  ? 375 THR A C   1 
ATOM   2540 O O   . THR A 1 375 ? 16.067 38.333 27.913  1.00 40.27  ? 375 THR A O   1 
ATOM   2541 C CB  . THR A 1 375 ? 14.102 35.991 28.016  1.00 31.59  ? 375 THR A CB  1 
ATOM   2542 O OG1 . THR A 1 375 ? 13.293 36.541 29.063  1.00 31.59  ? 375 THR A OG1 1 
ATOM   2543 C CG2 . THR A 1 375 ? 13.680 34.560 27.766  1.00 31.59  ? 375 THR A CG2 1 
ATOM   2544 N N   . ILE A 1 376 ? 16.213 37.720 30.055  1.00 45.14  ? 376 ILE A N   1 
ATOM   2545 C CA  . ILE A 1 376 ? 16.640 39.042 30.474  1.00 45.14  ? 376 ILE A CA  1 
ATOM   2546 C C   . ILE A 1 376 ? 18.079 38.886 30.942  1.00 45.14  ? 376 ILE A C   1 
ATOM   2547 O O   . ILE A 1 376 ? 18.956 39.665 30.559  1.00 45.14  ? 376 ILE A O   1 
ATOM   2548 C CB  . ILE A 1 376 ? 15.804 39.599 31.644  1.00 36.61  ? 376 ILE A CB  1 
ATOM   2549 C CG1 . ILE A 1 376 ? 14.328 39.701 31.250  1.00 36.61  ? 376 ILE A CG1 1 
ATOM   2550 C CG2 . ILE A 1 376 ? 16.334 40.972 32.027  1.00 36.61  ? 376 ILE A CG2 1 
ATOM   2551 C CD1 . ILE A 1 376 ? 13.426 40.236 32.341  0.00 36.61  ? 376 ILE A CD1 1 
ATOM   2552 N N   . LEU A 1 377 ? 18.312 37.850 31.745  1.00 32.88  ? 377 LEU A N   1 
ATOM   2553 C CA  . LEU A 1 377 ? 19.633 37.566 32.302  1.00 32.88  ? 377 LEU A CA  1 
ATOM   2554 C C   . LEU A 1 377 ? 20.760 37.410 31.292  1.00 32.88  ? 377 LEU A C   1 
ATOM   2555 O O   . LEU A 1 377 ? 21.856 37.920 31.517  1.00 32.88  ? 377 LEU A O   1 
ATOM   2556 C CB  . LEU A 1 377 ? 19.577 36.318 33.180  1.00 40.08  ? 377 LEU A CB  1 
ATOM   2557 C CG  . LEU A 1 377 ? 18.758 36.407 34.472  1.00 40.08  ? 377 LEU A CG  1 
ATOM   2558 C CD1 . LEU A 1 377 ? 18.716 35.029 35.117  1.00 40.08  ? 377 LEU A CD1 1 
ATOM   2559 C CD2 . LEU A 1 377 ? 19.373 37.446 35.415  1.00 40.08  ? 377 LEU A CD2 1 
ATOM   2560 N N   . ILE A 1 378 ? 20.511 36.690 30.197  1.00 43.30  ? 378 ILE A N   1 
ATOM   2561 C CA  . ILE A 1 378 ? 21.531 36.508 29.163  1.00 43.30  ? 378 ILE A CA  1 
ATOM   2562 C C   . ILE A 1 378 ? 21.261 37.478 28.011  1.00 43.30  ? 378 ILE A C   1 
ATOM   2563 O O   . ILE A 1 378 ? 20.361 37.274 27.199  1.00 43.30  ? 378 ILE A O   1 
ATOM   2564 C CB  . ILE A 1 378 ? 21.555 35.061 28.639  1.00 30.57  ? 378 ILE A CB  1 
ATOM   2565 C CG1 . ILE A 1 378 ? 21.857 34.103 29.796  1.00 30.57  ? 378 ILE A CG1 1 
ATOM   2566 C CG2 . ILE A 1 378 ? 22.610 34.925 27.569  1.00 30.57  ? 378 ILE A CG2 1 
ATOM   2567 C CD1 . ILE A 1 378 ? 22.140 32.662 29.388  1.00 30.57  ? 378 ILE A CD1 1 
ATOM   2568 N N   . PRO A 1 379 ? 22.060 38.548 27.919  1.00 39.61  ? 379 PRO A N   1 
ATOM   2569 C CA  . PRO A 1 379 ? 21.909 39.564 26.877  1.00 39.61  ? 379 PRO A CA  1 
ATOM   2570 C C   . PRO A 1 379 ? 22.275 39.095 25.471  1.00 39.61  ? 379 PRO A C   1 
ATOM   2571 O O   . PRO A 1 379 ? 23.170 38.270 25.281  1.00 39.61  ? 379 PRO A O   1 
ATOM   2572 C CB  . PRO A 1 379 ? 22.805 40.683 27.377  1.00 32.34  ? 379 PRO A CB  1 
ATOM   2573 C CG  . PRO A 1 379 ? 23.952 39.922 27.948  1.00 32.34  ? 379 PRO A CG  1 
ATOM   2574 C CD  . PRO A 1 379 ? 23.292 38.776 28.696  1.00 32.34  ? 379 PRO A CD  1 
ATOM   2575 N N   . PRO A 1 380 ? 21.582 39.638 24.463  1.00 34.90  ? 380 PRO A N   1 
ATOM   2576 C CA  . PRO A 1 380 ? 21.752 39.345 23.040  1.00 34.90  ? 380 PRO A CA  1 
ATOM   2577 C C   . PRO A 1 380 ? 23.182 39.093 22.593  1.00 34.90  ? 380 PRO A C   1 
ATOM   2578 O O   . PRO A 1 380 ? 23.491 38.000 22.121  1.00 34.90  ? 380 PRO A O   1 
ATOM   2579 C CB  . PRO A 1 380 ? 21.151 40.570 22.369  1.00 43.65  ? 380 PRO A CB  1 
ATOM   2580 C CG  . PRO A 1 380 ? 20.005 40.891 23.271  1.00 43.65  ? 380 PRO A CG  1 
ATOM   2581 C CD  . PRO A 1 380 ? 20.600 40.722 24.658  1.00 43.65  ? 380 PRO A CD  1 
ATOM   2582 N N   . HIS A 1 381 ? 24.058 40.089 22.730  1.00 31.94  ? 381 HIS A N   1 
ATOM   2583 C CA  . HIS A 1 381 ? 25.432 39.891 22.286  1.00 31.94  ? 381 HIS A CA  1 
ATOM   2584 C C   . HIS A 1 381 ? 26.027 38.613 22.864  1.00 31.94  ? 381 HIS A C   1 
ATOM   2585 O O   . HIS A 1 381 ? 26.861 37.967 22.230  1.00 31.94  ? 381 HIS A O   1 
ATOM   2586 C CB  . HIS A 1 381 ? 26.314 41.117 22.589  1.00 42.72  ? 381 HIS A CB  1 
ATOM   2587 C CG  . HIS A 1 381 ? 26.465 41.446 24.040  1.00 42.72  ? 381 HIS A CG  1 
ATOM   2588 N ND1 . HIS A 1 381 ? 27.485 40.925 24.825  1.00 42.72  ? 381 HIS A ND1 1 
ATOM   2589 C CD2 . HIS A 1 381 ? 25.798 42.311 24.838  1.00 42.72  ? 381 HIS A CD2 1 
ATOM   2590 C CE1 . HIS A 1 381 ? 27.435 41.464 26.024  1.00 42.72  ? 381 HIS A CE1 1 
ATOM   2591 N NE2 . HIS A 1 381 ? 26.418 42.316 26.065  1.00 42.72  ? 381 HIS A NE2 1 
ATOM   2592 N N   . ALA A 1 382 ? 25.564 38.221 24.046  1.00 47.93  ? 382 ALA A N   1 
ATOM   2593 C CA  . ALA A 1 382 ? 26.056 37.001 24.679  1.00 47.93  ? 382 ALA A CA  1 
ATOM   2594 C C   . ALA A 1 382 ? 25.575 35.746 23.931  1.00 47.93  ? 382 ALA A C   1 
ATOM   2595 O O   . ALA A 1 382 ? 26.067 34.634 24.173  1.00 47.93  ? 382 ALA A O   1 
ATOM   2596 C CB  . ALA A 1 382 ? 25.605 36.950 26.126  1.00 51.96  ? 382 ALA A CB  1 
ATOM   2597 N N   . ARG A 1 383 ? 24.630 35.932 23.012  1.00 65.05  ? 383 ARG A N   1 
ATOM   2598 C CA  . ARG A 1 383 ? 24.079 34.828 22.235  1.00 65.05  ? 383 ARG A CA  1 
ATOM   2599 C C   . ARG A 1 383 ? 24.639 34.795 20.810  1.00 65.05  ? 383 ARG A C   1 
ATOM   2600 O O   . ARG A 1 383 ? 23.971 34.342 19.872  1.00 65.05  ? 383 ARG A O   1 
ATOM   2601 C CB  . ARG A 1 383 ? 22.543 34.932 22.202  1.00 55.86  ? 383 ARG A CB  1 
ATOM   2602 C CG  . ARG A 1 383 ? 21.860 34.470 23.487  1.00 55.86  ? 383 ARG A CG  1 
ATOM   2603 C CD  . ARG A 1 383 ? 20.930 35.515 24.090  1.00 55.86  ? 383 ARG A CD  1 
ATOM   2604 N NE  . ARG A 1 383 ? 19.519 35.334 23.742  1.00 55.86  ? 383 ARG A NE  1 
ATOM   2605 C CZ  . ARG A 1 383 ? 18.523 35.994 24.336  1.00 55.86  ? 383 ARG A CZ  1 
ATOM   2606 N NH1 . ARG A 1 383 ? 18.779 36.871 25.302  1.00 55.86  ? 383 ARG A NH1 1 
ATOM   2607 N NH2 . ARG A 1 383 ? 17.266 35.784 23.967  1.00 55.86  ? 383 ARG A NH2 1 
ATOM   2608 N N   . ILE A 1 384 ? 25.872 35.262 20.654  1.00 66.55  ? 384 ILE A N   1 
ATOM   2609 C CA  . ILE A 1 384 ? 26.513 35.294 19.346  1.00 66.55  ? 384 ILE A CA  1 
ATOM   2610 C C   . ILE A 1 384 ? 27.751 34.391 19.360  1.00 66.55  ? 384 ILE A C   1 
ATOM   2611 O O   . ILE A 1 384 ? 28.407 34.334 20.435  1.00 66.55  ? 384 ILE A O   1 
ATOM   2612 C CB  . ILE A 1 384 ? 26.918 36.742 19.009  1.00 45.60  ? 384 ILE A CB  1 
ATOM   2613 C CG1 . ILE A 1 384 ? 25.666 37.629 19.027  1.00 45.60  ? 384 ILE A CG1 1 
ATOM   2614 C CG2 . ILE A 1 384 ? 27.619 36.793 17.670  1.00 45.60  ? 384 ILE A CG2 1 
ATOM   2615 C CD1 . ILE A 1 384 ? 25.953 39.127 19.005  1.00 45.60  ? 384 ILE A CD1 1 
ATOM   2616 N N   . VAL B 1 37  ? 14.552 82.083 77.018  1.00 56.12  ? 37  VAL B N   1 
ATOM   2617 C CA  . VAL B 1 37  ? 13.942 81.747 78.345  1.00 56.12  ? 37  VAL B CA  1 
ATOM   2618 C C   . VAL B 1 37  ? 12.523 81.177 78.206  1.00 56.12  ? 37  VAL B C   1 
ATOM   2619 O O   . VAL B 1 37  ? 11.555 81.926 78.150  1.00 56.12  ? 37  VAL B O   1 
ATOM   2620 C CB  . VAL B 1 37  ? 13.875 82.990 79.253  1.00 52.00  ? 37  VAL B CB  1 
ATOM   2621 C CG1 . VAL B 1 37  ? 13.231 82.624 80.581  1.00 52.00  ? 37  VAL B CG1 1 
ATOM   2622 C CG2 . VAL B 1 37  ? 15.271 83.548 79.479  0.00 52.00  ? 37  VAL B CG2 1 
ATOM   2623 N N   . THR B 1 38  ? 12.408 79.851 78.170  1.00 50.61  ? 38  THR B N   1 
ATOM   2624 C CA  . THR B 1 38  ? 11.114 79.171 78.020  1.00 50.61  ? 38  THR B CA  1 
ATOM   2625 C C   . THR B 1 38  ? 10.316 78.942 79.309  1.00 50.61  ? 38  THR B C   1 
ATOM   2626 O O   . THR B 1 38  ? 10.876 78.558 80.346  1.00 50.61  ? 38  THR B O   1 
ATOM   2627 C CB  . THR B 1 38  ? 11.308 77.796 77.351  1.00 36.91  ? 38  THR B CB  1 
ATOM   2628 O OG1 . THR B 1 38  ? 11.830 77.984 76.031  1.00 36.91  ? 38  THR B OG1 1 
ATOM   2629 C CG2 . THR B 1 38  ? 9.993  77.039 77.270  1.00 36.91  ? 38  THR B CG2 1 
ATOM   2630 N N   . THR B 1 39  ? 9.005  79.170 79.233  1.00 35.81  ? 39  THR B N   1 
ATOM   2631 C CA  . THR B 1 39  ? 8.109  78.962 80.375  1.00 35.81  ? 39  THR B CA  1 
ATOM   2632 C C   . THR B 1 39  ? 7.008  77.971 80.011  1.00 35.81  ? 39  THR B C   1 
ATOM   2633 O O   . THR B 1 39  ? 6.230  78.201 79.085  1.00 35.81  ? 39  THR B O   1 
ATOM   2634 C CB  . THR B 1 39  ? 7.439  80.276 80.841  1.00 39.66  ? 39  THR B CB  1 
ATOM   2635 O OG1 . THR B 1 39  ? 8.434  81.167 81.359  1.00 39.66  ? 39  THR B OG1 1 
ATOM   2636 C CG2 . THR B 1 39  ? 6.414  79.998 81.935  1.00 39.66  ? 39  THR B CG2 1 
ATOM   2637 N N   . VAL B 1 40  ? 6.947  76.865 80.740  1.00 41.05  ? 40  VAL B N   1 
ATOM   2638 C CA  . VAL B 1 40  ? 5.938  75.852 80.474  1.00 41.05  ? 40  VAL B CA  1 
ATOM   2639 C C   . VAL B 1 40  ? 5.248  75.539 81.794  1.00 41.05  ? 40  VAL B C   1 
ATOM   2640 O O   . VAL B 1 40  ? 5.676  76.006 82.851  1.00 41.05  ? 40  VAL B O   1 
ATOM   2641 C CB  . VAL B 1 40  ? 6.588  74.551 79.913  1.00 19.78  ? 40  VAL B CB  1 
ATOM   2642 C CG1 . VAL B 1 40  ? 7.415  73.880 80.985  1.00 19.78  ? 40  VAL B CG1 1 
ATOM   2643 C CG2 . VAL B 1 40  ? 5.516  73.604 79.399  0.00 19.78  ? 40  VAL B CG2 1 
ATOM   2644 N N   . VAL B 1 41  ? 4.168  74.773 81.740  1.00 31.97  ? 41  VAL B N   1 
ATOM   2645 C CA  . VAL B 1 41  ? 3.477  74.387 82.957  1.00 31.97  ? 41  VAL B CA  1 
ATOM   2646 C C   . VAL B 1 41  ? 3.739  72.883 83.078  1.00 31.97  ? 41  VAL B C   1 
ATOM   2647 O O   . VAL B 1 41  ? 3.239  72.082 82.291  1.00 31.97  ? 41  VAL B O   1 
ATOM   2648 C CB  . VAL B 1 41  ? 1.966  74.715 82.863  1.00 24.67  ? 41  VAL B CB  1 
ATOM   2649 C CG1 . VAL B 1 41  ? 1.356  74.043 81.647  0.00 24.67  ? 41  VAL B CG1 1 
ATOM   2650 C CG2 . VAL B 1 41  ? 1.265  74.293 84.138  1.00 24.67  ? 41  VAL B CG2 1 
ATOM   2651 N N   . ALA B 1 42  ? 4.549  72.496 84.052  1.00 33.95  ? 42  ALA B N   1 
ATOM   2652 C CA  . ALA B 1 42  ? 4.891  71.092 84.191  1.00 33.95  ? 42  ALA B CA  1 
ATOM   2653 C C   . ALA B 1 42  ? 4.369  70.395 85.434  1.00 33.95  ? 42  ALA B C   1 
ATOM   2654 O O   . ALA B 1 42  ? 4.246  70.990 86.501  1.00 33.95  ? 42  ALA B O   1 
ATOM   2655 C CB  . ALA B 1 42  ? 6.410  70.927 84.101  1.00 51.36  ? 42  ALA B CB  1 
ATOM   2656 N N   . THR B 1 43  ? 4.083  69.109 85.279  1.00 37.68  ? 43  THR B N   1 
ATOM   2657 C CA  . THR B 1 43  ? 3.576  68.290 86.364  1.00 37.68  ? 43  THR B CA  1 
ATOM   2658 C C   . THR B 1 43  ? 4.746  67.575 87.025  1.00 37.68  ? 43  THR B C   1 
ATOM   2659 O O   . THR B 1 43  ? 5.542  66.921 86.356  1.00 37.68  ? 43  THR B O   1 
ATOM   2660 C CB  . THR B 1 43  ? 2.596  67.238 85.832  1.00 34.53  ? 43  THR B CB  1 
ATOM   2661 O OG1 . THR B 1 43  ? 1.518  67.892 85.161  1.00 34.53  ? 43  THR B OG1 1 
ATOM   2662 C CG2 . THR B 1 43  ? 2.041  66.397 86.965  1.00 34.53  ? 43  THR B CG2 1 
ATOM   2663 N N   . PRO B 1 44  ? 4.877  67.709 88.348  1.00 34.56  ? 44  PRO B N   1 
ATOM   2664 C CA  . PRO B 1 44  ? 5.963  67.062 89.092  1.00 34.56  ? 44  PRO B CA  1 
ATOM   2665 C C   . PRO B 1 44  ? 5.900  65.529 89.007  1.00 34.56  ? 44  PRO B C   1 
ATOM   2666 O O   . PRO B 1 44  ? 4.817  64.937 89.023  1.00 34.56  ? 44  PRO B O   1 
ATOM   2667 C CB  . PRO B 1 44  ? 5.752  67.575 90.514  1.00 26.17  ? 44  PRO B CB  1 
ATOM   2668 C CG  . PRO B 1 44  ? 5.167  68.935 90.285  1.00 26.17  ? 44  PRO B CG  1 
ATOM   2669 C CD  . PRO B 1 44  ? 4.165  68.684 89.193  1.00 26.17  ? 44  PRO B CD  1 
ATOM   2670 N N   . GLY B 1 45  ? 7.064  64.893 88.923  1.00 35.52  ? 45  GLY B N   1 
ATOM   2671 C CA  . GLY B 1 45  ? 7.116  63.445 88.828  1.00 35.52  ? 45  GLY B CA  1 
ATOM   2672 C C   . GLY B 1 45  ? 6.416  62.752 89.975  1.00 35.52  ? 45  GLY B C   1 
ATOM   2673 O O   . GLY B 1 45  ? 5.636  61.825 89.756  1.00 35.52  ? 45  GLY B O   1 
ATOM   2674 N N   . GLN B 1 46  ? 6.696  63.211 91.195  1.00 53.35  ? 46  GLN B N   1 
ATOM   2675 C CA  . GLN B 1 46  ? 6.111  62.650 92.412  1.00 53.35  ? 46  GLN B CA  1 
ATOM   2676 C C   . GLN B 1 46  ? 4.783  63.330 92.734  1.00 53.35  ? 46  GLN B C   1 
ATOM   2677 O O   . GLN B 1 46  ? 4.261  64.109 91.920  1.00 53.35  ? 46  GLN B O   1 
ATOM   2678 C CB  . GLN B 1 46  ? 7.081  62.815 93.577  0.00 35.69  ? 46  GLN B CB  1 
ATOM   2679 N N   . GLY B 1 47  ? 4.245  63.027 93.915  1.00 56.57  ? 47  GLY B N   1 
ATOM   2680 C CA  . GLY B 1 47  ? 2.983  63.600 94.355  0.00 56.57  ? 47  GLY B CA  1 
ATOM   2681 C C   . GLY B 1 47  ? 1.859  63.454 93.348  1.00 56.57  ? 47  GLY B C   1 
ATOM   2682 O O   . GLY B 1 47  ? 2.074  62.931 92.252  1.00 56.57  ? 47  GLY B O   1 
ATOM   2683 N N   . PRO B 1 48  ? 0.633  63.894 93.686  1.00 57.40  ? 48  PRO B N   1 
ATOM   2684 C CA  . PRO B 1 48  ? -0.478 63.775 92.731  1.00 57.40  ? 48  PRO B CA  1 
ATOM   2685 C C   . PRO B 1 48  ? -0.367 64.882 91.676  1.00 57.40  ? 48  PRO B C   1 
ATOM   2686 O O   . PRO B 1 48  ? 0.295  65.891 91.914  1.00 57.40  ? 48  PRO B O   1 
ATOM   2687 C CB  . PRO B 1 48  ? -1.701 63.932 93.621  1.00 31.51  ? 48  PRO B CB  1 
ATOM   2688 C CG  . PRO B 1 48  ? -1.226 64.924 94.638  0.00 31.51  ? 48  PRO B CG  1 
ATOM   2689 C CD  . PRO B 1 48  ? 0.160  64.413 94.981  0.00 31.51  ? 48  PRO B CD  1 
ATOM   2690 N N   . ASP B 1 49  ? -1.008 64.708 90.523  1.00 47.39  ? 49  ASP B N   1 
ATOM   2691 C CA  . ASP B 1 49  ? -0.925 65.724 89.476  1.00 47.39  ? 49  ASP B CA  1 
ATOM   2692 C C   . ASP B 1 49  ? -1.165 67.154 89.974  1.00 47.39  ? 49  ASP B C   1 
ATOM   2693 O O   . ASP B 1 49  ? -2.290 67.652 89.945  1.00 47.39  ? 49  ASP B O   1 
ATOM   2694 C CB  . ASP B 1 49  ? -1.892 65.410 88.324  1.00 55.67  ? 49  ASP B CB  1 
ATOM   2695 C CG  . ASP B 1 49  ? -1.395 64.281 87.433  1.00 55.67  ? 49  ASP B CG  1 
ATOM   2696 O OD1 . ASP B 1 49  ? -1.916 64.117 86.304  1.00 55.67  ? 49  ASP B OD1 1 
ATOM   2697 O OD2 . ASP B 1 49  ? -0.485 63.543 87.870  1.00 55.67  ? 49  ASP B OD2 1 
ATOM   2698 N N   . ARG B 1 50  ? -0.083 67.814 90.392  1.00 45.98  ? 50  ARG B N   1 
ATOM   2699 C CA  . ARG B 1 50  ? -0.121 69.183 90.922  1.00 45.98  ? 50  ARG B CA  1 
ATOM   2700 C C   . ARG B 1 50  ? 0.768  70.097 90.059  1.00 45.98  ? 50  ARG B C   1 
ATOM   2701 O O   . ARG B 1 50  ? 1.798  70.583 90.527  1.00 45.98  ? 50  ARG B O   1 
ATOM   2702 C CB  . ARG B 1 50  ? 0.421  69.164 92.351  1.00 70.01  ? 50  ARG B CB  1 
ATOM   2703 C CG  . ARG B 1 50  ? -0.140 70.225 93.277  1.00 70.01  ? 50  ARG B CG  1 
ATOM   2704 C CD  . ARG B 1 50  ? -1.448 69.768 93.921  1.00 70.01  ? 50  ARG B CD  1 
ATOM   2705 N NE  . ARG B 1 50  ? -2.530 69.633 92.944  1.00 70.01  ? 50  ARG B NE  1 
ATOM   2706 C CZ  . ARG B 1 50  ? -3.815 69.491 93.275  1.00 70.01  ? 50  ARG B CZ  1 
ATOM   2707 N NH1 . ARG B 1 50  ? -4.166 69.460 94.553  0.00 70.01  ? 50  ARG B NH1 1 
ATOM   2708 N NH2 . ARG B 1 50  ? -4.754 69.394 92.332  1.00 70.01  ? 50  ARG B NH2 1 
ATOM   2709 N N   . PRO B 1 51  ? 0.381  70.337 88.793  1.00 33.39  ? 51  PRO B N   1 
ATOM   2710 C CA  . PRO B 1 51  ? 1.114  71.179 87.835  1.00 33.39  ? 51  PRO B CA  1 
ATOM   2711 C C   . PRO B 1 51  ? 1.512  72.548 88.361  1.00 33.39  ? 51  PRO B C   1 
ATOM   2712 O O   . PRO B 1 51  ? 0.789  73.146 89.137  1.00 33.39  ? 51  PRO B O   1 
ATOM   2713 C CB  . PRO B 1 51  ? 0.141  71.302 86.668  1.00 25.10  ? 51  PRO B CB  1 
ATOM   2714 C CG  . PRO B 1 51  ? -0.589 70.024 86.704  1.00 25.10  ? 51  PRO B CG  1 
ATOM   2715 C CD  . PRO B 1 51  ? -0.849 69.812 88.180  1.00 25.10  ? 51  PRO B CD  1 
ATOM   2716 N N   . GLN B 1 52  ? 2.661  73.051 87.933  1.00 31.52  ? 52  GLN B N   1 
ATOM   2717 C CA  . GLN B 1 52  ? 3.112  74.372 88.357  1.00 31.52  ? 52  GLN B CA  1 
ATOM   2718 C C   . GLN B 1 52  ? 3.814  75.029 87.193  1.00 31.52  ? 52  GLN B C   1 
ATOM   2719 O O   . GLN B 1 52  ? 4.183  74.362 86.232  1.00 31.52  ? 52  GLN B O   1 
ATOM   2720 C CB  . GLN B 1 52  ? 4.053  74.283 89.571  1.00 48.92  ? 52  GLN B CB  1 
ATOM   2721 C CG  . GLN B 1 52  ? 5.087  73.175 89.484  1.00 48.92  ? 52  GLN B CG  1 
ATOM   2722 C CD  . GLN B 1 52  ? 5.887  72.998 90.774  1.00 48.92  ? 52  GLN B CD  1 
ATOM   2723 O OE1 . GLN B 1 52  ? 6.846  73.734 91.037  1.00 48.92  ? 52  GLN B OE1 1 
ATOM   2724 N NE2 . GLN B 1 52  ? 5.489  72.024 91.585  0.00 48.92  ? 52  GLN B NE2 1 
ATOM   2725 N N   . GLU B 1 53  ? 3.966  76.344 87.247  1.00 38.95  ? 53  GLU B N   1 
ATOM   2726 C CA  . GLU B 1 53  ? 4.650  77.036 86.166  1.00 38.95  ? 53  GLU B CA  1 
ATOM   2727 C C   . GLU B 1 53  ? 6.156  76.838 86.382  1.00 38.95  ? 53  GLU B C   1 
ATOM   2728 O O   . GLU B 1 53  ? 6.670  76.993 87.497  1.00 38.95  ? 53  GLU B O   1 
ATOM   2729 C CB  . GLU B 1 53  ? 4.252  78.528 86.146  1.00 73.86  ? 53  GLU B CB  1 
ATOM   2730 C CG  . GLU B 1 53  ? 2.766  78.743 85.768  1.00 73.86  ? 53  GLU B CG  1 
ATOM   2731 C CD  . GLU B 1 53  ? 2.200  80.131 86.133  1.00 73.86  ? 53  GLU B CD  1 
ATOM   2732 O OE1 . GLU B 1 53  ? 2.446  80.609 87.275  1.00 73.86  ? 53  GLU B OE1 1 
ATOM   2733 O OE2 . GLU B 1 53  ? 1.490  80.730 85.280  1.00 73.86  ? 53  GLU B OE2 1 
ATOM   2734 N N   . VAL B 1 54  ? 6.838  76.446 85.306  1.00 31.78  ? 54  VAL B N   1 
ATOM   2735 C CA  . VAL B 1 54  ? 8.270  76.185 85.330  1.00 31.78  ? 54  VAL B CA  1 
ATOM   2736 C C   . VAL B 1 54  ? 8.977  76.902 84.175  1.00 31.78  ? 54  VAL B C   1 
ATOM   2737 O O   . VAL B 1 54  ? 8.542  76.824 83.021  1.00 31.78  ? 54  VAL B O   1 
ATOM   2738 C CB  . VAL B 1 54  ? 8.546  74.665 85.226  1.00 20.11  ? 54  VAL B CB  1 
ATOM   2739 C CG1 . VAL B 1 54  ? 10.032 74.391 85.393  1.00 20.11  ? 54  VAL B CG1 1 
ATOM   2740 C CG2 . VAL B 1 54  ? 7.760  73.917 86.279  1.00 20.11  ? 54  VAL B CG2 1 
ATOM   2741 N N   . SER B 1 55  ? 10.068 77.600 84.494  1.00 37.42  ? 55  SER B N   1 
ATOM   2742 C CA  . SER B 1 55  ? 10.845 78.333 83.488  1.00 37.42  ? 55  SER B CA  1 
ATOM   2743 C C   . SER B 1 55  ? 12.308 77.887 83.422  1.00 37.42  ? 55  SER B C   1 
ATOM   2744 O O   . SER B 1 55  ? 12.982 77.753 84.446  1.00 37.42  ? 55  SER B O   1 
ATOM   2745 C CB  . SER B 1 55  ? 10.780 79.837 83.771  1.00 49.54  ? 55  SER B CB  1 
ATOM   2746 O OG  . SER B 1 55  ? 9.465  80.335 83.562  1.00 49.54  ? 55  SER B OG  1 
ATOM   2747 N N   . TYR B 1 56  ? 12.793 77.661 82.207  1.00 44.46  ? 56  TYR B N   1 
ATOM   2748 C CA  . TYR B 1 56  ? 14.173 77.231 82.003  1.00 44.46  ? 56  TYR B CA  1 
ATOM   2749 C C   . TYR B 1 56  ? 14.799 77.949 80.806  1.00 44.46  ? 56  TYR B C   1 
ATOM   2750 O O   . TYR B 1 56  ? 14.088 78.480 79.928  1.00 44.46  ? 56  TYR B O   1 
ATOM   2751 C CB  . TYR B 1 56  ? 14.229 75.718 81.775  1.00 34.06  ? 56  TYR B CB  1 
ATOM   2752 C CG  . TYR B 1 56  ? 13.523 75.218 80.520  1.00 34.06  ? 56  TYR B CG  1 
ATOM   2753 C CD1 . TYR B 1 56  ? 14.085 75.390 79.248  1.00 34.06  ? 56  TYR B CD1 1 
ATOM   2754 C CD2 . TYR B 1 56  ? 12.305 74.532 80.607  1.00 34.06  ? 56  TYR B CD2 1 
ATOM   2755 C CE1 . TYR B 1 56  ? 13.453 74.881 78.093  1.00 34.06  ? 56  TYR B CE1 1 
ATOM   2756 C CE2 . TYR B 1 56  ? 11.668 74.022 79.457  1.00 34.06  ? 56  TYR B CE2 1 
ATOM   2757 C CZ  . TYR B 1 56  ? 12.250 74.203 78.210  1.00 34.06  ? 56  TYR B CZ  1 
ATOM   2758 O OH  . TYR B 1 56  ? 11.618 73.706 77.093  1.00 34.06  ? 56  TYR B OH  1 
ATOM   2759 N N   . THR B 1 57  ? 16.131 77.958 80.757  1.00 63.55  ? 57  THR B N   1 
ATOM   2760 C CA  . THR B 1 57  ? 16.817 78.613 79.651  1.00 63.55  ? 57  THR B CA  1 
ATOM   2761 C C   . THR B 1 57  ? 18.191 77.993 79.370  1.00 63.55  ? 57  THR B C   1 
ATOM   2762 O O   . THR B 1 57  ? 18.516 76.924 79.908  1.00 63.55  ? 57  THR B O   1 
ATOM   2763 C CB  . THR B 1 57  ? 16.951 80.123 79.932  1.00 44.35  ? 57  THR B CB  1 
ATOM   2764 O OG1 . THR B 1 57  ? 17.145 80.830 78.696  1.00 44.35  ? 57  THR B OG1 1 
ATOM   2765 C CG2 . THR B 1 57  ? 18.103 80.376 80.907  1.00 44.35  ? 57  THR B CG2 1 
ATOM   2766 N N   . ASP B 1 58  ? 18.987 78.665 78.532  1.00 61.81  ? 58  ASP B N   1 
ATOM   2767 C CA  . ASP B 1 58  ? 20.319 78.181 78.148  1.00 61.81  ? 58  ASP B CA  1 
ATOM   2768 C C   . ASP B 1 58  ? 20.138 76.761 77.639  1.00 61.81  ? 58  ASP B C   1 
ATOM   2769 O O   . ASP B 1 58  ? 20.860 75.844 78.030  1.00 61.81  ? 58  ASP B O   1 
ATOM   2770 C CB  . ASP B 1 58  ? 21.278 78.189 79.350  1.00 60.47  ? 58  ASP B CB  1 
ATOM   2771 C CG  . ASP B 1 58  ? 21.455 79.579 79.950  1.00 60.47  ? 58  ASP B CG  1 
ATOM   2772 O OD1 . ASP B 1 58  ? 21.159 80.580 79.253  1.00 60.47  ? 58  ASP B OD1 1 
ATOM   2773 O OD2 . ASP B 1 58  ? 21.901 79.677 81.115  1.00 60.47  ? 58  ASP B OD2 1 
ATOM   2774 N N   . THR B 1 59  ? 19.171 76.602 76.747  1.00 46.38  ? 59  THR B N   1 
ATOM   2775 C CA  . THR B 1 59  ? 18.807 75.302 76.203  1.00 46.38  ? 59  THR B CA  1 
ATOM   2776 C C   . THR B 1 59  ? 19.540 74.828 74.959  1.00 46.38  ? 59  THR B C   1 
ATOM   2777 O O   . THR B 1 59  ? 19.313 75.356 73.861  1.00 46.38  ? 59  THR B O   1 
ATOM   2778 C CB  . THR B 1 59  ? 17.294 75.288 75.918  1.00 44.29  ? 59  THR B CB  1 
ATOM   2779 O OG1 . THR B 1 59  ? 16.596 75.512 77.152  1.00 44.29  ? 59  THR B OG1 1 
ATOM   2780 C CG2 . THR B 1 59  ? 16.857 73.972 75.285  1.00 44.29  ? 59  THR B CG2 1 
ATOM   2781 N N   . LYS B 1 60  ? 20.390 73.813 75.135  1.00 56.43  ? 60  LYS B N   1 
ATOM   2782 C CA  . LYS B 1 60  ? 21.138 73.257 74.013  1.00 56.43  ? 60  LYS B CA  1 
ATOM   2783 C C   . LYS B 1 60  ? 20.959 71.741 73.912  1.00 56.43  ? 60  LYS B C   1 
ATOM   2784 O O   . LYS B 1 60  ? 20.663 71.050 74.879  1.00 56.43  ? 60  LYS B O   1 
ATOM   2785 C CB  . LYS B 1 60  ? 22.617 73.590 74.215  1.00 46.68  ? 60  LYS B CB  1 
ATOM   2786 C CG  . LYS B 1 60  ? 23.273 72.691 75.265  1.00 46.68  ? 60  LYS B CG  1 
ATOM   2787 C CD  . LYS B 1 60  ? 24.747 73.037 75.489  0.00 46.68  ? 60  LYS B CD  1 
ATOM   2788 C CE  . LYS B 1 60  ? 24.937 74.410 76.140  0.00 46.68  ? 60  LYS B CE  1 
ATOM   2789 N NZ  . LYS B 1 60  ? 24.177 74.474 77.388  0.00 46.68  ? 60  LYS B NZ  1 
ATOM   2790 N N   . VAL B 1 61  ? 21.111 71.232 72.675  1.00 52.10  ? 61  VAL B N   1 
ATOM   2791 C CA  . VAL B 1 61  ? 20.994 69.794 72.467  1.00 52.10  ? 61  VAL B CA  1 
ATOM   2792 C C   . VAL B 1 61  ? 22.231 69.053 72.981  1.00 52.10  ? 61  VAL B C   1 
ATOM   2793 O O   . VAL B 1 61  ? 23.360 69.511 72.869  1.00 52.10  ? 61  VAL B O   1 
ATOM   2794 C CB  . VAL B 1 61  ? 20.825 69.545 70.968  1.00 33.83  ? 61  VAL B CB  1 
ATOM   2795 C CG1 . VAL B 1 61  ? 20.703 68.047 70.698  1.00 33.83  ? 61  VAL B CG1 1 
ATOM   2796 C CG2 . VAL B 1 61  ? 19.579 70.248 70.463  1.00 33.83  ? 61  VAL B CG2 1 
ATOM   2797 N N   . ILE B 1 62  ? 21.980 67.883 73.599  1.00 46.31  ? 62  ILE B N   1 
ATOM   2798 C CA  . ILE B 1 62  ? 23.088 67.106 74.140  1.00 46.31  ? 62  ILE B CA  1 
ATOM   2799 C C   . ILE B 1 62  ? 23.037 65.646 73.683  1.00 46.31  ? 62  ILE B C   1 
ATOM   2800 O O   . ILE B 1 62  ? 23.389 64.722 74.404  1.00 46.31  ? 62  ILE B O   1 
ATOM   2801 C CB  . ILE B 1 62  ? 23.025 67.181 75.667  1.00 46.04  ? 62  ILE B CB  1 
ATOM   2802 C CG1 . ILE B 1 62  ? 21.730 66.542 76.177  1.00 46.04  ? 62  ILE B CG1 1 
ATOM   2803 C CG2 . ILE B 1 62  ? 23.032 68.653 76.116  1.00 46.04  ? 62  ILE B CG2 1 
ATOM   2804 C CD1 . ILE B 1 62  ? 21.747 66.327 77.692  1.00 46.04  ? 62  ILE B CD1 1 
ATOM   2805 N N   . GLY B 1 63  ? 22.538 65.450 72.448  1.00 47.10  ? 63  GLY B N   1 
ATOM   2806 C CA  . GLY B 1 63  ? 22.471 64.097 71.909  1.00 47.10  ? 63  GLY B CA  1 
ATOM   2807 C C   . GLY B 1 63  ? 21.111 63.808 71.270  1.00 47.10  ? 63  GLY B C   1 
ATOM   2808 O O   . GLY B 1 63  ? 20.113 64.471 71.523  1.00 47.10  ? 63  GLY B O   1 
ATOM   2809 N N   . ASN B 1 64  ? 21.106 62.800 70.378  1.00 62.66  ? 64  ASN B N   1 
ATOM   2810 C CA  . ASN B 1 64  ? 19.862 62.434 69.712  1.00 62.66  ? 64  ASN B CA  1 
ATOM   2811 C C   . ASN B 1 64  ? 19.632 60.922 69.742  1.00 62.66  ? 64  ASN B C   1 
ATOM   2812 O O   . ASN B 1 64  ? 20.358 60.137 69.146  1.00 62.66  ? 64  ASN B O   1 
ATOM   2813 C CB  . ASN B 1 64  ? 19.935 62.920 68.264  1.00 87.20  ? 64  ASN B CB  1 
ATOM   2814 C CG  . ASN B 1 64  ? 19.849 64.424 68.235  1.00 87.20  ? 64  ASN B CG  1 
ATOM   2815 O OD1 . ASN B 1 64  ? 18.885 65.010 67.752  1.00 87.20  ? 64  ASN B OD1 1 
ATOM   2816 N ND2 . ASN B 1 64  ? 20.900 65.061 68.779  1.00 87.20  ? 64  ASN B ND2 1 
ATOM   2817 N N   . GLY B 1 65  ? 18.600 60.517 70.504  1.00 91.55  ? 65  GLY B N   1 
ATOM   2818 C CA  . GLY B 1 65  ? 18.291 59.096 70.600  1.00 91.55  ? 65  GLY B CA  1 
ATOM   2819 C C   . GLY B 1 65  ? 17.528 58.602 69.368  1.00 91.55  ? 65  GLY B C   1 
ATOM   2820 O O   . GLY B 1 65  ? 17.514 59.224 68.314  0.00 91.55  ? 65  GLY B O   1 
ATOM   2821 N N   . SER B 1 66  ? 16.909 57.416 69.520  1.00 76.40  ? 66  SER B N   1 
ATOM   2822 C CA  . SER B 1 66  ? 16.146 56.855 68.412  1.00 76.40  ? 66  SER B CA  1 
ATOM   2823 C C   . SER B 1 66  ? 14.673 57.262 68.483  1.00 76.40  ? 66  SER B C   1 
ATOM   2824 O O   . SER B 1 66  ? 13.973 57.362 67.484  1.00 76.40  ? 66  SER B O   1 
ATOM   2825 C CB  . SER B 1 66  ? 16.270 55.332 68.471  1.00 42.15  ? 66  SER B CB  1 
ATOM   2826 O OG  . SER B 1 66  ? 17.555 54.984 68.986  1.00 42.15  ? 66  SER B OG  1 
ATOM   2827 N N   . PHE B 1 67  ? 14.197 57.460 69.726  1.00 43.17  ? 67  PHE B N   1 
ATOM   2828 C CA  . PHE B 1 67  ? 12.803 57.847 69.910  1.00 43.17  ? 67  PHE B CA  1 
ATOM   2829 C C   . PHE B 1 67  ? 12.625 59.365 69.834  1.00 43.17  ? 67  PHE B C   1 
ATOM   2830 O O   . PHE B 1 67  ? 11.657 59.886 69.296  1.00 43.17  ? 67  PHE B O   1 
ATOM   2831 C CB  . PHE B 1 67  ? 12.343 57.337 71.276  1.00 20.00  ? 67  PHE B CB  1 
ATOM   2832 C CG  . PHE B 1 67  ? 12.326 55.837 71.278  1.00 20.00  ? 67  PHE B CG  1 
ATOM   2833 C CD1 . PHE B 1 67  ? 13.432 55.138 71.745  1.00 20.00  ? 67  PHE B CD1 1 
ATOM   2834 C CD2 . PHE B 1 67  ? 11.214 55.156 70.809  1.00 20.00  ? 67  PHE B CD2 1 
ATOM   2835 C CE1 . PHE B 1 67  ? 13.421 53.750 71.742  1.00 20.00  ? 67  PHE B CE1 1 
ATOM   2836 C CE2 . PHE B 1 67  ? 11.211 53.764 70.810  1.00 20.00  ? 67  PHE B CE2 1 
ATOM   2837 C CZ  . PHE B 1 67  ? 12.312 53.057 71.276  1.00 20.00  ? 67  PHE B CZ  1 
ATOM   2838 N N   . GLY B 1 68  ? 13.590 60.081 70.440  1.00 50.61  ? 68  GLY B N   1 
ATOM   2839 C CA  . GLY B 1 68  ? 13.525 61.537 70.425  1.00 50.61  ? 68  GLY B CA  1 
ATOM   2840 C C   . GLY B 1 68  ? 14.874 62.162 70.786  1.00 50.61  ? 68  GLY B C   1 
ATOM   2841 O O   . GLY B 1 68  ? 15.882 61.489 70.958  1.00 50.61  ? 68  GLY B O   1 
ATOM   2842 N N   . VAL B 1 69  ? 14.880 63.506 70.857  1.00 42.75  ? 69  VAL B N   1 
ATOM   2843 C CA  . VAL B 1 69  ? 16.116 64.201 71.197  1.00 42.75  ? 69  VAL B CA  1 
ATOM   2844 C C   . VAL B 1 69  ? 16.193 64.516 72.692  1.00 42.75  ? 69  VAL B C   1 
ATOM   2845 O O   . VAL B 1 69  ? 15.211 64.473 73.422  1.00 42.75  ? 69  VAL B O   1 
ATOM   2846 C CB  . VAL B 1 69  ? 16.174 65.497 70.388  1.00 36.53  ? 69  VAL B CB  1 
ATOM   2847 C CG1 . VAL B 1 69  ? 17.277 66.402 70.934  1.00 36.53  ? 69  VAL B CG1 1 
ATOM   2848 C CG2 . VAL B 1 69  ? 16.458 65.187 68.930  0.00 36.53  ? 69  VAL B CG2 1 
ATOM   2849 N N   . VAL B 1 70  ? 17.426 64.800 73.150  1.00 37.08  ? 70  VAL B N   1 
ATOM   2850 C CA  . VAL B 1 70  ? 17.615 65.114 74.560  1.00 37.08  ? 70  VAL B CA  1 
ATOM   2851 C C   . VAL B 1 70  ? 18.339 66.449 74.747  1.00 37.08  ? 70  VAL B C   1 
ATOM   2852 O O   . VAL B 1 70  ? 19.486 66.631 74.362  1.00 37.08  ? 70  VAL B O   1 
ATOM   2853 C CB  . VAL B 1 70  ? 18.430 63.987 75.195  1.00 29.90  ? 70  VAL B CB  1 
ATOM   2854 C CG1 . VAL B 1 70  ? 18.765 64.338 76.643  1.00 29.90  ? 70  VAL B CG1 1 
ATOM   2855 C CG2 . VAL B 1 70  ? 17.638 62.693 75.164  1.00 29.90  ? 70  VAL B CG2 1 
ATOM   2856 N N   . TYR B 1 71  ? 17.605 67.418 75.326  1.00 36.25  ? 71  TYR B N   1 
ATOM   2857 C CA  . TYR B 1 71  ? 18.199 68.729 75.555  1.00 36.25  ? 71  TYR B CA  1 
ATOM   2858 C C   . TYR B 1 71  ? 18.782 68.845 76.965  1.00 36.25  ? 71  TYR B C   1 
ATOM   2859 O O   . TYR B 1 71  ? 18.431 68.103 77.874  1.00 36.25  ? 71  TYR B O   1 
ATOM   2860 C CB  . TYR B 1 71  ? 17.113 69.787 75.351  1.00 47.16  ? 71  TYR B CB  1 
ATOM   2861 C CG  . TYR B 1 71  ? 16.428 69.563 74.049  1.00 47.16  ? 71  TYR B CG  1 
ATOM   2862 C CD1 . TYR B 1 71  ? 15.421 68.609 73.950  1.00 47.16  ? 71  TYR B CD1 1 
ATOM   2863 C CD2 . TYR B 1 71  ? 16.783 70.313 72.927  1.00 47.16  ? 71  TYR B CD2 1 
ATOM   2864 C CE1 . TYR B 1 71  ? 14.770 68.404 72.742  1.00 47.16  ? 71  TYR B CE1 1 
ATOM   2865 C CE2 . TYR B 1 71  ? 16.133 70.108 71.718  1.00 47.16  ? 71  TYR B CE2 1 
ATOM   2866 C CZ  . TYR B 1 71  ? 15.130 69.160 71.624  1.00 47.16  ? 71  TYR B CZ  1 
ATOM   2867 O OH  . TYR B 1 71  ? 14.462 68.967 70.431  1.00 47.16  ? 71  TYR B OH  1 
ATOM   2868 N N   . GLN B 1 72  ? 19.607 69.842 77.260  1.00 45.35  ? 72  GLN B N   1 
ATOM   2869 C CA  . GLN B 1 72  ? 20.009 70.092 78.634  1.00 45.35  ? 72  GLN B CA  1 
ATOM   2870 C C   . GLN B 1 72  ? 19.556 71.524 78.937  1.00 45.35  ? 72  GLN B C   1 
ATOM   2871 O O   . GLN B 1 72  ? 19.410 72.340 78.020  1.00 45.35  ? 72  GLN B O   1 
ATOM   2872 C CB  . GLN B 1 72  ? 21.515 69.956 78.797  1.00 46.73  ? 72  GLN B CB  1 
ATOM   2873 C CG  . GLN B 1 72  ? 22.239 71.264 78.969  1.00 46.73  ? 72  GLN B CG  1 
ATOM   2874 C CD  . GLN B 1 72  ? 23.283 71.198 80.065  1.00 46.73  ? 72  GLN B CD  1 
ATOM   2875 O OE1 . GLN B 1 72  ? 24.143 72.074 80.161  1.00 46.73  ? 72  GLN B OE1 1 
ATOM   2876 N NE2 . GLN B 1 72  ? 23.213 70.158 80.904  1.00 46.73  ? 72  GLN B NE2 1 
ATOM   2877 N N   . ALA B 1 73  ? 19.317 71.846 80.202  1.00 28.13  ? 73  ALA B N   1 
ATOM   2878 C CA  . ALA B 1 73  ? 18.861 73.186 80.499  1.00 28.13  ? 73  ALA B CA  1 
ATOM   2879 C C   . ALA B 1 73  ? 19.069 73.593 81.933  1.00 28.13  ? 73  ALA B C   1 
ATOM   2880 O O   . ALA B 1 73  ? 19.506 72.799 82.776  1.00 28.13  ? 73  ALA B O   1 
ATOM   2881 C CB  . ALA B 1 73  ? 17.405 73.328 80.129  1.00 26.55  ? 73  ALA B CB  1 
ATOM   2882 N N   . LYS B 1 74  ? 18.727 74.849 82.198  1.00 42.42  ? 74  LYS B N   1 
ATOM   2883 C CA  . LYS B 1 74  ? 18.898 75.434 83.515  1.00 42.42  ? 74  LYS B CA  1 
ATOM   2884 C C   . LYS B 1 74  ? 17.608 76.043 84.058  1.00 42.42  ? 74  LYS B C   1 
ATOM   2885 O O   . LYS B 1 74  ? 17.096 77.025 83.511  1.00 42.42  ? 74  LYS B O   1 
ATOM   2886 C CB  . LYS B 1 74  ? 19.980 76.518 83.446  1.00 65.58  ? 74  LYS B CB  1 
ATOM   2887 C CG  . LYS B 1 74  ? 20.341 77.120 84.788  1.00 65.58  ? 74  LYS B CG  1 
ATOM   2888 C CD  . LYS B 1 74  ? 20.980 78.494 84.610  1.00 65.58  ? 74  LYS B CD  1 
ATOM   2889 C CE  . LYS B 1 74  ? 21.459 79.062 85.953  1.00 65.58  ? 74  LYS B CE  1 
ATOM   2890 N NZ  . LYS B 1 74  ? 21.878 80.496 85.840  1.00 65.58  ? 74  LYS B NZ  1 
ATOM   2891 N N   . LEU B 1 75  ? 17.088 75.457 85.133  1.00 44.40  ? 75  LEU B N   1 
ATOM   2892 C CA  . LEU B 1 75  ? 15.878 75.976 85.758  1.00 44.40  ? 75  LEU B CA  1 
ATOM   2893 C C   . LEU B 1 75  ? 16.185 77.439 86.074  1.00 44.40  ? 75  LEU B C   1 
ATOM   2894 O O   . LEU B 1 75  ? 17.188 77.741 86.727  1.00 44.40  ? 75  LEU B O   1 
ATOM   2895 C CB  . LEU B 1 75  ? 15.563 75.216 87.057  1.00 30.55  ? 75  LEU B CB  1 
ATOM   2896 C CG  . LEU B 1 75  ? 15.393 73.684 87.016  1.00 30.55  ? 75  LEU B CG  1 
ATOM   2897 C CD1 . LEU B 1 75  ? 14.893 73.192 88.366  0.00 30.55  ? 75  LEU B CD1 1 
ATOM   2898 C CD2 . LEU B 1 75  ? 14.428 73.293 85.904  1.00 30.55  ? 75  LEU B CD2 1 
ATOM   2899 N N   . CYS B 1 76  ? 15.345 78.354 85.610  1.00 49.50  ? 76  CYS B N   1 
ATOM   2900 C CA  . CYS B 1 76  ? 15.613 79.756 85.876  1.00 49.50  ? 76  CYS B CA  1 
ATOM   2901 C C   . CYS B 1 76  ? 15.795 80.076 87.359  1.00 49.50  ? 76  CYS B C   1 
ATOM   2902 O O   . CYS B 1 76  ? 16.826 80.632 87.735  1.00 49.50  ? 76  CYS B O   1 
ATOM   2903 C CB  . CYS B 1 76  ? 14.540 80.640 85.243  1.00 37.27  ? 76  CYS B CB  1 
ATOM   2904 S SG  . CYS B 1 76  ? 14.594 80.599 83.398  1.00 37.27  ? 76  CYS B SG  1 
ATOM   2905 N N   . ASP B 1 77  ? 14.852 79.724 88.226  1.00 50.48  ? 77  ASP B N   1 
ATOM   2906 C CA  . ASP B 1 77  ? 15.083 80.066 89.629  1.00 50.48  ? 77  ASP B CA  1 
ATOM   2907 C C   . ASP B 1 77  ? 16.235 79.301 90.278  1.00 50.48  ? 77  ASP B C   1 
ATOM   2908 O O   . ASP B 1 77  ? 17.333 79.832 90.404  1.00 50.48  ? 77  ASP B O   1 
ATOM   2909 C CB  . ASP B 1 77  ? 13.808 79.924 90.487  1.00 89.67  ? 77  ASP B CB  1 
ATOM   2910 C CG  . ASP B 1 77  ? 13.106 78.584 90.311  1.00 89.67  ? 77  ASP B CG  1 
ATOM   2911 O OD1 . ASP B 1 77  ? 13.735 77.614 89.803  1.00 89.67  ? 77  ASP B OD1 1 
ATOM   2912 O OD2 . ASP B 1 77  ? 11.913 78.504 90.703  1.00 89.67  ? 77  ASP B OD2 1 
ATOM   2913 N N   . SER B 1 78  ? 16.002 78.061 90.690  1.00 48.72  ? 78  SER B N   1 
ATOM   2914 C CA  . SER B 1 78  ? 17.057 77.280 91.333  1.00 48.72  ? 78  SER B CA  1 
ATOM   2915 C C   . SER B 1 78  ? 18.365 77.318 90.547  1.00 48.72  ? 78  SER B C   1 
ATOM   2916 O O   . SER B 1 78  ? 19.433 77.094 91.102  1.00 48.72  ? 78  SER B O   1 
ATOM   2917 C CB  . SER B 1 78  ? 16.615 75.818 91.513  1.00 60.46  ? 78  SER B CB  1 
ATOM   2918 O OG  . SER B 1 78  ? 16.594 75.116 90.277  1.00 60.46  ? 78  SER B OG  1 
ATOM   2919 N N   . GLY B 1 79  ? 18.281 77.592 89.252  1.00 53.55  ? 79  GLY B N   1 
ATOM   2920 C CA  . GLY B 1 79  ? 19.490 77.637 88.452  1.00 53.55  ? 79  GLY B CA  1 
ATOM   2921 C C   . GLY B 1 79  ? 20.117 76.267 88.238  1.00 53.55  ? 79  GLY B C   1 
ATOM   2922 O O   . GLY B 1 79  ? 21.197 76.156 87.654  1.00 53.55  ? 79  GLY B O   1 
ATOM   2923 N N   . GLU B 1 80  ? 19.447 75.214 88.696  1.00 51.07  ? 80  GLU B N   1 
ATOM   2924 C CA  . GLU B 1 80  ? 19.975 73.860 88.534  1.00 51.07  ? 80  GLU B CA  1 
ATOM   2925 C C   . GLU B 1 80  ? 19.954 73.386 87.081  1.00 51.07  ? 80  GLU B C   1 
ATOM   2926 O O   . GLU B 1 80  ? 19.295 73.982 86.219  1.00 51.07  ? 80  GLU B O   1 
ATOM   2927 C CB  . GLU B 1 80  ? 19.177 72.886 89.387  1.00 57.03  ? 80  GLU B CB  1 
ATOM   2928 C CG  . GLU B 1 80  ? 19.187 73.210 90.857  1.00 57.03  ? 80  GLU B CG  1 
ATOM   2929 C CD  . GLU B 1 80  ? 18.311 72.259 91.650  1.00 57.03  ? 80  GLU B CD  1 
ATOM   2930 O OE1 . GLU B 1 80  ? 18.490 71.026 91.496  1.00 57.03  ? 80  GLU B OE1 1 
ATOM   2931 O OE2 . GLU B 1 80  ? 17.448 72.741 92.424  1.00 57.03  ? 80  GLU B OE2 1 
ATOM   2932 N N   . LEU B 1 81  ? 20.685 72.310 86.815  1.00 36.12  ? 81  LEU B N   1 
ATOM   2933 C CA  . LEU B 1 81  ? 20.746 71.758 85.475  1.00 36.12  ? 81  LEU B CA  1 
ATOM   2934 C C   . LEU B 1 81  ? 19.886 70.514 85.404  1.00 36.12  ? 81  LEU B C   1 
ATOM   2935 O O   . LEU B 1 81  ? 19.949 69.631 86.265  1.00 36.12  ? 81  LEU B O   1 
ATOM   2936 C CB  . LEU B 1 81  ? 22.188 71.426 85.094  1.00 49.98  ? 81  LEU B CB  1 
ATOM   2937 C CG  . LEU B 1 81  ? 23.133 72.634 85.029  1.00 49.98  ? 81  LEU B CG  1 
ATOM   2938 C CD1 . LEU B 1 81  ? 24.560 72.157 84.770  1.00 49.98  ? 81  LEU B CD1 1 
ATOM   2939 C CD2 . LEU B 1 81  ? 22.681 73.587 83.923  1.00 49.98  ? 81  LEU B CD2 1 
ATOM   2940 N N   . VAL B 1 82  ? 19.071 70.461 84.363  1.00 36.66  ? 82  VAL B N   1 
ATOM   2941 C CA  . VAL B 1 82  ? 18.168 69.351 84.157  1.00 36.66  ? 82  VAL B CA  1 
ATOM   2942 C C   . VAL B 1 82  ? 18.322 68.927 82.718  1.00 36.66  ? 82  VAL B C   1 
ATOM   2943 O O   . VAL B 1 82  ? 18.778 69.712 81.882  1.00 36.66  ? 82  VAL B O   1 
ATOM   2944 C CB  . VAL B 1 82  ? 16.695 69.783 84.391  1.00 30.54  ? 82  VAL B CB  1 
ATOM   2945 C CG1 . VAL B 1 82  ? 16.537 70.327 85.788  1.00 30.54  ? 82  VAL B CG1 1 
ATOM   2946 C CG2 . VAL B 1 82  ? 16.281 70.847 83.364  1.00 30.54  ? 82  VAL B CG2 1 
ATOM   2947 N N   . ALA B 1 83  ? 17.936 67.689 82.439  1.00 27.82  ? 83  ALA B N   1 
ATOM   2948 C CA  . ALA B 1 83  ? 17.998 67.142 81.098  1.00 27.82  ? 83  ALA B CA  1 
ATOM   2949 C C   . ALA B 1 83  ? 16.566 66.993 80.629  1.00 27.82  ? 83  ALA B C   1 
ATOM   2950 O O   . ALA B 1 83  ? 15.691 66.620 81.412  1.00 27.82  ? 83  ALA B O   1 
ATOM   2951 C CB  . ALA B 1 83  ? 18.672 65.792 81.129  1.00 31.27  ? 83  ALA B CB  1 
ATOM   2952 N N   . ILE B 1 84  ? 16.309 67.297 79.362  1.00 35.11  ? 84  ILE B N   1 
ATOM   2953 C CA  . ILE B 1 84  ? 14.956 67.157 78.853  1.00 35.11  ? 84  ILE B CA  1 
ATOM   2954 C C   . ILE B 1 84  ? 14.922 66.132 77.742  1.00 35.11  ? 84  ILE B C   1 
ATOM   2955 O O   . ILE B 1 84  ? 15.550 66.311 76.711  1.00 35.11  ? 84  ILE B O   1 
ATOM   2956 C CB  . ILE B 1 84  ? 14.388 68.482 78.318  1.00 31.83  ? 84  ILE B CB  1 
ATOM   2957 C CG1 . ILE B 1 84  ? 14.429 69.555 79.403  1.00 31.83  ? 84  ILE B CG1 1 
ATOM   2958 C CG2 . ILE B 1 84  ? 12.940 68.282 77.902  1.00 31.83  ? 84  ILE B CG2 1 
ATOM   2959 C CD1 . ILE B 1 84  ? 13.780 70.870 78.988  1.00 31.83  ? 84  ILE B CD1 1 
ATOM   2960 N N   . LYS B 1 85  ? 14.194 65.050 77.969  1.00 41.14  ? 85  LYS B N   1 
ATOM   2961 C CA  . LYS B 1 85  ? 14.065 63.990 76.990  1.00 41.14  ? 85  LYS B CA  1 
ATOM   2962 C C   . LYS B 1 85  ? 12.688 64.137 76.372  1.00 41.14  ? 85  LYS B C   1 
ATOM   2963 O O   . LYS B 1 85  ? 11.681 63.850 77.015  1.00 41.14  ? 85  LYS B O   1 
ATOM   2964 C CB  . LYS B 1 85  ? 14.188 62.630 77.672  1.00 32.95  ? 85  LYS B CB  1 
ATOM   2965 C CG  . LYS B 1 85  ? 14.010 61.453 76.737  1.00 32.95  ? 85  LYS B CG  1 
ATOM   2966 C CD  . LYS B 1 85  ? 14.173 60.119 77.454  1.00 32.95  ? 85  LYS B CD  1 
ATOM   2967 C CE  . LYS B 1 85  ? 14.088 58.975 76.459  1.00 32.95  ? 85  LYS B CE  1 
ATOM   2968 N NZ  . LYS B 1 85  ? 14.169 57.645 77.115  1.00 32.95  ? 85  LYS B NZ  1 
ATOM   2969 N N   . LYS B 1 86  ? 12.660 64.578 75.121  1.00 36.80  ? 86  LYS B N   1 
ATOM   2970 C CA  . LYS B 1 86  ? 11.430 64.804 74.374  1.00 36.80  ? 86  LYS B CA  1 
ATOM   2971 C C   . LYS B 1 86  ? 11.157 63.669 73.400  1.00 36.80  ? 86  LYS B C   1 
ATOM   2972 O O   . LYS B 1 86  ? 11.937 63.453 72.488  1.00 36.80  ? 86  LYS B O   1 
ATOM   2973 C CB  . LYS B 1 86  ? 11.587 66.116 73.606  1.00 26.01  ? 86  LYS B CB  1 
ATOM   2974 C CG  . LYS B 1 86  ? 10.462 66.516 72.697  1.00 26.01  ? 86  LYS B CG  1 
ATOM   2975 C CD  . LYS B 1 86  ? 10.774 67.890 72.133  1.00 26.01  ? 86  LYS B CD  1 
ATOM   2976 C CE  . LYS B 1 86  ? 9.646  68.431 71.261  1.00 26.01  ? 86  LYS B CE  1 
ATOM   2977 N NZ  . LYS B 1 86  ? 9.983  69.765 70.687  0.00 26.01  ? 86  LYS B NZ  1 
ATOM   2978 N N   . VAL B 1 87  ? 10.061 62.944 73.577  1.00 28.90  ? 87  VAL B N   1 
ATOM   2979 C CA  . VAL B 1 87  ? 9.747  61.852 72.660  1.00 28.90  ? 87  VAL B CA  1 
ATOM   2980 C C   . VAL B 1 87  ? 8.361  62.065 72.053  1.00 28.90  ? 87  VAL B C   1 
ATOM   2981 O O   . VAL B 1 87  ? 7.528  62.748 72.630  1.00 28.90  ? 87  VAL B O   1 
ATOM   2982 C CB  . VAL B 1 87  ? 9.772  60.494 73.377  1.00 34.71  ? 87  VAL B CB  1 
ATOM   2983 C CG1 . VAL B 1 87  ? 10.979 60.419 74.298  1.00 34.71  ? 87  VAL B CG1 1 
ATOM   2984 C CG2 . VAL B 1 87  ? 8.496  60.287 74.146  1.00 34.71  ? 87  VAL B CG2 1 
ATOM   2985 N N   . LEU B 1 88  ? 8.109  61.489 70.884  1.00 46.68  ? 88  LEU B N   1 
ATOM   2986 C CA  . LEU B 1 88  ? 6.815  61.659 70.244  1.00 46.68  ? 88  LEU B CA  1 
ATOM   2987 C C   . LEU B 1 88  ? 5.822  60.776 70.970  1.00 46.68  ? 88  LEU B C   1 
ATOM   2988 O O   . LEU B 1 88  ? 6.039  59.576 71.105  1.00 46.68  ? 88  LEU B O   1 
ATOM   2989 C CB  . LEU B 1 88  ? 6.905  61.265 68.777  1.00 48.05  ? 88  LEU B CB  1 
ATOM   2990 C CG  . LEU B 1 88  ? 5.891  61.882 67.808  1.00 48.05  ? 88  LEU B CG  1 
ATOM   2991 C CD1 . LEU B 1 88  ? 6.239  61.414 66.415  1.00 48.05  ? 88  LEU B CD1 1 
ATOM   2992 C CD2 . LEU B 1 88  ? 4.473  61.472 68.169  0.00 48.05  ? 88  LEU B CD2 1 
ATOM   2993 N N   . GLN B 1 89  ? 4.720  61.355 71.429  1.00 48.15  ? 89  GLN B N   1 
ATOM   2994 C CA  . GLN B 1 89  ? 3.754  60.571 72.185  1.00 48.15  ? 89  GLN B CA  1 
ATOM   2995 C C   . GLN B 1 89  ? 2.343  60.623 71.632  1.00 48.15  ? 89  GLN B C   1 
ATOM   2996 O O   . GLN B 1 89  ? 1.812  61.703 71.374  1.00 48.15  ? 89  GLN B O   1 
ATOM   2997 C CB  . GLN B 1 89  ? 3.759  61.041 73.643  0.00 59.22  ? 89  GLN B CB  1 
ATOM   2998 C CG  . GLN B 1 89  ? 2.735  60.368 74.534  1.00 59.22  ? 89  GLN B CG  1 
ATOM   2999 C CD  . GLN B 1 89  ? 2.763  58.847 74.416  1.00 59.22  ? 89  GLN B CD  1 
ATOM   3000 O OE1 . GLN B 1 89  ? 3.734  58.265 73.921  1.00 59.22  ? 89  GLN B OE1 1 
ATOM   3001 N NE2 . GLN B 1 89  ? 1.696  58.196 74.882  1.00 59.22  ? 89  GLN B NE2 1 
ATOM   3002 N N   . ASP B 1 90  ? 1.736  59.452 71.452  1.00 61.58  ? 90  ASP B N   1 
ATOM   3003 C CA  . ASP B 1 90  ? 0.367  59.379 70.946  1.00 61.58  ? 90  ASP B CA  1 
ATOM   3004 C C   . ASP B 1 90  ? -0.660 59.553 72.072  1.00 61.58  ? 90  ASP B C   1 
ATOM   3005 O O   . ASP B 1 90  ? -0.778 58.696 72.970  1.00 61.58  ? 90  ASP B O   1 
ATOM   3006 C CB  . ASP B 1 90  ? 0.114  58.049 70.242  1.00 58.64  ? 90  ASP B CB  1 
ATOM   3007 C CG  . ASP B 1 90  ? -1.346 57.892 69.812  1.00 58.64  ? 90  ASP B CG  1 
ATOM   3008 O OD1 . ASP B 1 90  ? -2.219 57.757 70.704  1.00 58.64  ? 90  ASP B OD1 1 
ATOM   3009 O OD2 . ASP B 1 90  ? -1.622 57.915 68.585  1.00 58.64  ? 90  ASP B OD2 1 
ATOM   3010 N N   . LYS B 1 91  ? -1.401 60.663 72.003  1.00 58.28  ? 91  LYS B N   1 
ATOM   3011 C CA  . LYS B 1 91  ? -2.428 61.012 72.987  1.00 58.28  ? 91  LYS B CA  1 
ATOM   3012 C C   . LYS B 1 91  ? -3.242 59.802 73.441  1.00 58.28  ? 91  LYS B C   1 
ATOM   3013 O O   . LYS B 1 91  ? -3.607 59.708 74.625  1.00 58.28  ? 91  LYS B O   1 
ATOM   3014 C CB  . LYS B 1 91  ? -3.355 62.077 72.414  0.00 35.69  ? 91  LYS B CB  1 
ATOM   3015 N N   . ARG B 1 92  ? -3.520 58.885 72.509  1.00 52.70  ? 92  ARG B N   1 
ATOM   3016 C CA  . ARG B 1 92  ? -4.287 57.680 72.821  1.00 52.70  ? 92  ARG B CA  1 
ATOM   3017 C C   . ARG B 1 92  ? -3.540 56.753 73.799  1.00 52.70  ? 92  ARG B C   1 
ATOM   3018 O O   . ARG B 1 92  ? -3.967 56.589 74.945  1.00 52.70  ? 92  ARG B O   1 
ATOM   3019 C CB  . ARG B 1 92  ? -4.638 56.926 71.540  0.00 35.69  ? 92  ARG B CB  1 
ATOM   3020 N N   . PHE B 1 93  ? -2.433 56.149 73.354  1.00 72.05  ? 93  PHE B N   1 
ATOM   3021 C CA  . PHE B 1 93  ? -1.647 55.243 74.205  1.00 72.05  ? 93  PHE B CA  1 
ATOM   3022 C C   . PHE B 1 93  ? -1.095 55.968 75.446  1.00 72.05  ? 93  PHE B C   1 
ATOM   3023 O O   . PHE B 1 93  ? -0.996 57.209 75.461  1.00 72.05  ? 93  PHE B O   1 
ATOM   3024 C CB  . PHE B 1 93  ? -0.501 54.643 73.402  0.00 35.69  ? 93  PHE B CB  1 
ATOM   3025 N N   . LYS B 1 94  ? -0.761 55.200 76.487  1.00 45.43  ? 94  LYS B N   1 
ATOM   3026 C CA  . LYS B 1 94  ? -0.200 55.765 77.715  1.00 45.43  ? 94  LYS B CA  1 
ATOM   3027 C C   . LYS B 1 94  ? 1.288  55.431 77.688  1.00 45.43  ? 94  LYS B C   1 
ATOM   3028 O O   . LYS B 1 94  ? 1.656  54.272 77.491  1.00 45.43  ? 94  LYS B O   1 
ATOM   3029 C CB  . LYS B 1 94  ? -0.845 55.128 78.948  1.00 48.79  ? 94  LYS B CB  1 
ATOM   3030 C CG  . LYS B 1 94  ? -1.028 56.084 80.125  1.00 48.79  ? 94  LYS B CG  1 
ATOM   3031 C CD  . LYS B 1 94  ? -2.079 57.136 79.804  0.00 48.79  ? 94  LYS B CD  1 
ATOM   3032 C CE  . LYS B 1 94  ? -2.347 58.045 80.991  0.00 48.79  ? 94  LYS B CE  1 
ATOM   3033 N NZ  . LYS B 1 94  ? -3.393 59.058 80.676  0.00 48.79  ? 94  LYS B NZ  1 
ATOM   3034 N N   . ASN B 1 95  ? 2.138  56.436 77.891  1.00 32.06  ? 95  ASN B N   1 
ATOM   3035 C CA  . ASN B 1 95  ? 3.588  56.240 77.848  1.00 32.06  ? 95  ASN B CA  1 
ATOM   3036 C C   . ASN B 1 95  ? 4.174  55.443 78.998  1.00 32.06  ? 95  ASN B C   1 
ATOM   3037 O O   . ASN B 1 95  ? 4.227  55.911 80.135  1.00 32.06  ? 95  ASN B O   1 
ATOM   3038 C CB  . ASN B 1 95  ? 4.301  57.581 77.771  1.00 26.97  ? 95  ASN B CB  1 
ATOM   3039 C CG  . ASN B 1 95  ? 5.794  57.426 77.668  1.00 26.97  ? 95  ASN B CG  1 
ATOM   3040 O OD1 . ASN B 1 95  ? 6.446  56.944 78.589  1.00 26.97  ? 95  ASN B OD1 1 
ATOM   3041 N ND2 . ASN B 1 95  ? 6.346  57.828 76.536  1.00 26.97  ? 95  ASN B ND2 1 
ATOM   3042 N N   . ARG B 1 96  ? 4.662  54.248 78.685  1.00 30.08  ? 96  ARG B N   1 
ATOM   3043 C CA  . ARG B 1 96  ? 5.224  53.375 79.696  1.00 30.08  ? 96  ARG B CA  1 
ATOM   3044 C C   . ARG B 1 96  ? 6.360  53.971 80.511  1.00 30.08  ? 96  ARG B C   1 
ATOM   3045 O O   . ARG B 1 96  ? 6.392  53.827 81.740  1.00 30.08  ? 96  ARG B O   1 
ATOM   3046 C CB  . ARG B 1 96  ? 5.689  52.073 79.060  1.00 46.35  ? 96  ARG B CB  1 
ATOM   3047 C CG  . ARG B 1 96  ? 5.092  50.883 79.749  1.00 46.35  ? 96  ARG B CG  1 
ATOM   3048 C CD  . ARG B 1 96  ? 6.126  49.873 80.138  1.00 46.35  ? 96  ARG B CD  1 
ATOM   3049 N NE  . ARG B 1 96  ? 6.598  49.087 79.001  1.00 46.35  ? 96  ARG B NE  1 
ATOM   3050 C CZ  . ARG B 1 96  ? 5.826  48.302 78.252  1.00 46.35  ? 96  ARG B CZ  1 
ATOM   3051 N NH1 . ARG B 1 96  ? 4.526  48.204 78.506  1.00 46.35  ? 96  ARG B NH1 1 
ATOM   3052 N NH2 . ARG B 1 96  ? 6.361  47.576 77.275  1.00 46.35  ? 96  ARG B NH2 1 
ATOM   3053 N N   . GLU B 1 97  ? 7.290  54.634 79.833  1.00 20.49  ? 97  GLU B N   1 
ATOM   3054 C CA  . GLU B 1 97  ? 8.427  55.230 80.507  1.00 20.49  ? 97  GLU B CA  1 
ATOM   3055 C C   . GLU B 1 97  ? 7.955  56.234 81.547  1.00 20.49  ? 97  GLU B C   1 
ATOM   3056 O O   . GLU B 1 97  ? 8.364  56.173 82.698  1.00 20.49  ? 97  GLU B O   1 
ATOM   3057 C CB  . GLU B 1 97  ? 9.361  55.895 79.488  1.00 29.56  ? 97  GLU B CB  1 
ATOM   3058 C CG  . GLU B 1 97  ? 10.623 56.510 80.082  1.00 29.56  ? 97  GLU B CG  1 
ATOM   3059 C CD  . GLU B 1 97  ? 11.613 56.970 79.026  1.00 29.56  ? 97  GLU B CD  1 
ATOM   3060 O OE1 . GLU B 1 97  ? 12.707 57.439 79.389  1.00 29.56  ? 97  GLU B OE1 1 
ATOM   3061 O OE2 . GLU B 1 97  ? 11.303 56.865 77.829  1.00 29.56  ? 97  GLU B OE2 1 
ATOM   3062 N N   . LEU B 1 98  ? 7.087  57.153 81.154  1.00 20.95  ? 98  LEU B N   1 
ATOM   3063 C CA  . LEU B 1 98  ? 6.583  58.129 82.109  1.00 20.95  ? 98  LEU B CA  1 
ATOM   3064 C C   . LEU B 1 98  ? 5.951  57.376 83.266  1.00 20.95  ? 98  LEU B C   1 
ATOM   3065 O O   . LEU B 1 98  ? 6.198  57.661 84.432  1.00 20.95  ? 98  LEU B O   1 
ATOM   3066 C CB  . LEU B 1 98  ? 5.520  59.021 81.459  1.00 22.17  ? 98  LEU B CB  1 
ATOM   3067 C CG  . LEU B 1 98  ? 4.680  59.879 82.410  1.00 22.17  ? 98  LEU B CG  1 
ATOM   3068 C CD1 . LEU B 1 98  ? 5.549  60.878 83.141  1.00 22.17  ? 98  LEU B CD1 1 
ATOM   3069 C CD2 . LEU B 1 98  ? 3.629  60.590 81.624  1.00 22.17  ? 98  LEU B CD2 1 
ATOM   3070 N N   . GLN B 1 99  ? 5.126  56.405 82.909  1.00 28.37  ? 99  GLN B N   1 
ATOM   3071 C CA  . GLN B 1 99  ? 4.422  55.592 83.871  1.00 28.37  ? 99  GLN B CA  1 
ATOM   3072 C C   . GLN B 1 99  ? 5.297  55.076 85.007  1.00 28.37  ? 99  GLN B C   1 
ATOM   3073 O O   . GLN B 1 99  ? 4.988  55.308 86.174  1.00 28.37  ? 99  GLN B O   1 
ATOM   3074 C CB  . GLN B 1 99  ? 3.744  54.413 83.151  1.00 81.31  ? 99  GLN B CB  1 
ATOM   3075 C CG  . GLN B 1 99  ? 2.963  53.459 84.077  1.00 81.31  ? 99  GLN B CG  1 
ATOM   3076 C CD  . GLN B 1 99  ? 2.314  52.283 83.339  1.00 81.31  ? 99  GLN B CD  1 
ATOM   3077 O OE1 . GLN B 1 99  ? 1.505  51.546 83.918  1.00 81.31  ? 99  GLN B OE1 1 
ATOM   3078 N NE2 . GLN B 1 99  ? 2.670  52.097 82.069  1.00 81.31  ? 99  GLN B NE2 1 
ATOM   3079 N N   . ILE B 1 100 ? 6.389  54.383 84.683  1.00 33.97  ? 100 ILE B N   1 
ATOM   3080 C CA  . ILE B 1 100 ? 7.226  53.832 85.752  1.00 33.97  ? 100 ILE B CA  1 
ATOM   3081 C C   . ILE B 1 100 ? 8.135  54.860 86.428  1.00 33.97  ? 100 ILE B C   1 
ATOM   3082 O O   . ILE B 1 100 ? 8.454  54.719 87.597  1.00 33.97  ? 100 ILE B O   1 
ATOM   3083 C CB  . ILE B 1 100 ? 8.079  52.591 85.279  1.00 30.63  ? 100 ILE B CB  1 
ATOM   3084 C CG1 . ILE B 1 100 ? 7.531  51.265 84.745  1.00 30.63  ? 100 ILE B CG1 1 
ATOM   3085 C CG2 . ILE B 1 100 ? 8.970  52.276 86.495  1.00 30.63  ? 100 ILE B CG2 1 
ATOM   3086 C CD1 . ILE B 1 100 ? 8.319  50.146 84.062  1.00 30.63  ? 100 ILE B CD1 1 
ATOM   3087 N N   . MET B 1 101 ? 8.548  55.895 85.706  1.00 30.86  ? 101 MET B N   1 
ATOM   3088 C CA  . MET B 1 101 ? 9.402  56.931 86.295  1.00 30.86  ? 101 MET B CA  1 
ATOM   3089 C C   . MET B 1 101 ? 8.659  57.539 87.482  1.00 30.86  ? 101 MET B C   1 
ATOM   3090 O O   . MET B 1 101 ? 9.196  57.679 88.581  1.00 30.86  ? 101 MET B O   1 
ATOM   3091 C CB  . MET B 1 101 ? 9.691  58.039 85.273  1.00 50.72  ? 101 MET B CB  1 
ATOM   3092 C CG  . MET B 1 101 ? 10.661 57.676 84.151  1.00 50.72  ? 101 MET B CG  1 
ATOM   3093 S SD  . MET B 1 101 ? 12.380 58.030 84.563  1.00 50.72  ? 101 MET B SD  1 
ATOM   3094 C CE  . MET B 1 101 ? 12.699 56.669 85.726  1.00 50.72  ? 101 MET B CE  1 
ATOM   3095 N N   . ARG B 1 102 ? 7.409  57.897 87.225  1.00 36.65  ? 102 ARG B N   1 
ATOM   3096 C CA  . ARG B 1 102 ? 6.518  58.505 88.202  1.00 36.65  ? 102 ARG B CA  1 
ATOM   3097 C C   . ARG B 1 102 ? 6.444  57.845 89.579  1.00 36.65  ? 102 ARG B C   1 
ATOM   3098 O O   . ARG B 1 102 ? 6.241  58.534 90.586  1.00 36.65  ? 102 ARG B O   1 
ATOM   3099 C CB  . ARG B 1 102 ? 5.119  58.575 87.598  1.00 36.45  ? 102 ARG B CB  1 
ATOM   3100 C CG  . ARG B 1 102 ? 4.998  59.626 86.541  1.00 36.45  ? 102 ARG B CG  1 
ATOM   3101 C CD  . ARG B 1 102 ? 4.463  60.872 87.148  1.00 36.45  ? 102 ARG B CD  1 
ATOM   3102 N NE  . ARG B 1 102 ? 3.049  60.960 86.853  1.00 36.45  ? 102 ARG B NE  1 
ATOM   3103 C CZ  . ARG B 1 102 ? 2.211  61.795 87.451  1.00 36.45  ? 102 ARG B CZ  1 
ATOM   3104 N NH1 . ARG B 1 102 ? 2.653  62.621 88.400  1.00 36.45  ? 102 ARG B NH1 1 
ATOM   3105 N NH2 . ARG B 1 102 ? 0.936  61.813 87.080  1.00 36.45  ? 102 ARG B NH2 1 
ATOM   3106 N N   . LYS B 1 103 ? 6.600  56.523 89.619  1.00 27.44  ? 103 LYS B N   1 
ATOM   3107 C CA  . LYS B 1 103 ? 6.527  55.789 90.872  1.00 27.44  ? 103 LYS B CA  1 
ATOM   3108 C C   . LYS B 1 103 ? 7.895  55.353 91.399  1.00 27.44  ? 103 LYS B C   1 
ATOM   3109 O O   . LYS B 1 103 ? 7.997  54.433 92.213  1.00 27.44  ? 103 LYS B O   1 
ATOM   3110 C CB  . LYS B 1 103 ? 5.623  54.561 90.700  1.00 46.06  ? 103 LYS B CB  1 
ATOM   3111 C CG  . LYS B 1 103 ? 6.336  53.326 90.201  1.00 46.06  ? 103 LYS B CG  1 
ATOM   3112 C CD  . LYS B 1 103 ? 5.435  52.108 90.221  1.00 46.06  ? 103 LYS B CD  1 
ATOM   3113 C CE  . LYS B 1 103 ? 4.335  52.221 89.177  1.00 46.06  ? 103 LYS B CE  1 
ATOM   3114 N NZ  . LYS B 1 103 ? 3.732  50.878 88.899  1.00 46.06  ? 103 LYS B NZ  1 
ATOM   3115 N N   . LEU B 1 104 ? 8.946  56.020 90.945  1.00 26.13  ? 104 LEU B N   1 
ATOM   3116 C CA  . LEU B 1 104 ? 10.290 55.675 91.364  1.00 26.13  ? 104 LEU B CA  1 
ATOM   3117 C C   . LEU B 1 104 ? 10.907 56.751 92.218  1.00 26.13  ? 104 LEU B C   1 
ATOM   3118 O O   . LEU B 1 104 ? 10.772 57.932 91.939  1.00 26.13  ? 104 LEU B O   1 
ATOM   3119 C CB  . LEU B 1 104 ? 11.158 55.422 90.137  1.00 27.85  ? 104 LEU B CB  1 
ATOM   3120 C CG  . LEU B 1 104 ? 11.366 53.955 89.770  1.00 27.85  ? 104 LEU B CG  1 
ATOM   3121 C CD1 . LEU B 1 104 ? 10.087 53.136 89.991  1.00 27.85  ? 104 LEU B CD1 1 
ATOM   3122 C CD2 . LEU B 1 104 ? 11.849 53.890 88.335  1.00 27.85  ? 104 LEU B CD2 1 
ATOM   3123 N N   . ASP B 1 105 ? 11.588 56.344 93.274  1.00 26.38  ? 105 ASP B N   1 
ATOM   3124 C CA  . ASP B 1 105 ? 12.217 57.308 94.151  1.00 26.38  ? 105 ASP B CA  1 
ATOM   3125 C C   . ASP B 1 105 ? 13.330 56.642 94.941  1.00 26.38  ? 105 ASP B C   1 
ATOM   3126 O O   . ASP B 1 105 ? 13.104 56.090 96.010  1.00 26.38  ? 105 ASP B O   1 
ATOM   3127 C CB  . ASP B 1 105 ? 11.173 57.900 95.082  1.00 48.94  ? 105 ASP B CB  1 
ATOM   3128 C CG  . ASP B 1 105 ? 11.750 58.928 96.004  1.00 48.94  ? 105 ASP B CG  1 
ATOM   3129 O OD1 . ASP B 1 105 ? 12.593 59.720 95.528  1.00 48.94  ? 105 ASP B OD1 1 
ATOM   3130 O OD2 . ASP B 1 105 ? 11.359 58.945 97.194  1.00 48.94  ? 105 ASP B OD2 1 
ATOM   3131 N N   . HIS B 1 106 ? 14.536 56.702 94.385  1.00 21.83  ? 106 HIS B N   1 
ATOM   3132 C CA  . HIS B 1 106 ? 15.719 56.097 94.978  1.00 21.83  ? 106 HIS B CA  1 
ATOM   3133 C C   . HIS B 1 106 ? 16.930 56.981 94.695  1.00 21.83  ? 106 HIS B C   1 
ATOM   3134 O O   . HIS B 1 106 ? 17.095 57.479 93.591  1.00 21.83  ? 106 HIS B O   1 
ATOM   3135 C CB  . HIS B 1 106 ? 15.910 54.708 94.376  1.00 30.89  ? 106 HIS B CB  1 
ATOM   3136 C CG  . HIS B 1 106 ? 16.905 53.863 95.103  1.00 30.89  ? 106 HIS B CG  1 
ATOM   3137 N ND1 . HIS B 1 106 ? 18.264 53.967 94.894  1.00 30.89  ? 106 HIS B ND1 1 
ATOM   3138 C CD2 . HIS B 1 106 ? 16.738 52.892 96.029  1.00 30.89  ? 106 HIS B CD2 1 
ATOM   3139 C CE1 . HIS B 1 106 ? 18.889 53.091 95.660  1.00 30.89  ? 106 HIS B CE1 1 
ATOM   3140 N NE2 . HIS B 1 106 ? 17.987 52.425 96.358  1.00 30.89  ? 106 HIS B NE2 1 
ATOM   3141 N N   . CYS B 1 107 ? 17.774 57.181 95.694  1.00 21.99  ? 107 CYS B N   1 
ATOM   3142 C CA  . CYS B 1 107 ? 18.940 58.036 95.537  1.00 21.99  ? 107 CYS B CA  1 
ATOM   3143 C C   . CYS B 1 107 ? 19.835 57.623 94.386  1.00 21.99  ? 107 CYS B C   1 
ATOM   3144 O O   . CYS B 1 107 ? 20.590 58.440 93.861  1.00 21.99  ? 107 CYS B O   1 
ATOM   3145 C CB  . CYS B 1 107 ? 19.751 58.045 96.824  1.00 28.50  ? 107 CYS B CB  1 
ATOM   3146 S SG  . CYS B 1 107 ? 20.348 56.432 97.301  1.00 28.50  ? 107 CYS B SG  1 
ATOM   3147 N N   . ASN B 1 108 ? 19.739 56.356 93.993  1.00 24.69  ? 108 ASN B N   1 
ATOM   3148 C CA  . ASN B 1 108 ? 20.547 55.824 92.911  1.00 24.69  ? 108 ASN B CA  1 
ATOM   3149 C C   . ASN B 1 108 ? 19.831 55.690 91.583  1.00 24.69  ? 108 ASN B C   1 
ATOM   3150 O O   . ASN B 1 108 ? 20.191 54.855 90.765  1.00 24.69  ? 108 ASN B O   1 
ATOM   3151 C CB  . ASN B 1 108 ? 21.116 54.469 93.309  1.00 25.83  ? 108 ASN B CB  1 
ATOM   3152 C CG  . ASN B 1 108 ? 22.234 54.585 94.308  1.00 25.83  ? 108 ASN B CG  1 
ATOM   3153 O OD1 . ASN B 1 108 ? 22.343 53.775 95.223  1.00 25.83  ? 108 ASN B OD1 1 
ATOM   3154 N ND2 . ASN B 1 108 ? 23.082 55.584 94.132  1.00 25.83  ? 108 ASN B ND2 1 
ATOM   3155 N N   . ILE B 1 109 ? 18.805 56.496 91.371  1.00 18.34  ? 109 ILE B N   1 
ATOM   3156 C CA  . ILE B 1 109 ? 18.084 56.467 90.110  1.00 18.34  ? 109 ILE B CA  1 
ATOM   3157 C C   . ILE B 1 109 ? 17.802 57.902 89.718  1.00 18.34  ? 109 ILE B C   1 
ATOM   3158 O O   . ILE B 1 109 ? 17.457 58.712 90.573  1.00 18.34  ? 109 ILE B O   1 
ATOM   3159 C CB  . ILE B 1 109 ? 16.772 55.677 90.220  1.00 15.88  ? 109 ILE B CB  1 
ATOM   3160 C CG1 . ILE B 1 109 ? 17.100 54.224 90.540  1.00 15.88  ? 109 ILE B CG1 1 
ATOM   3161 C CG2 . ILE B 1 109 ? 15.991 55.766 88.917  1.00 15.88  ? 109 ILE B CG2 1 
ATOM   3162 C CD1 . ILE B 1 109 ? 15.910 53.321 90.644  1.00 15.88  ? 109 ILE B CD1 1 
ATOM   3163 N N   . VAL B 1 110 ? 17.977 58.220 88.438  1.00 20.08  ? 110 VAL B N   1 
ATOM   3164 C CA  . VAL B 1 110 ? 17.743 59.580 87.967  1.00 20.08  ? 110 VAL B CA  1 
ATOM   3165 C C   . VAL B 1 110 ? 16.286 59.966 88.211  1.00 20.08  ? 110 VAL B C   1 
ATOM   3166 O O   . VAL B 1 110 ? 15.372 59.246 87.853  1.00 20.08  ? 110 VAL B O   1 
ATOM   3167 C CB  . VAL B 1 110 ? 18.112 59.742 86.453  1.00 24.07  ? 110 VAL B CB  1 
ATOM   3168 C CG1 . VAL B 1 110 ? 17.350 58.744 85.612  1.00 24.07  ? 110 VAL B CG1 1 
ATOM   3169 C CG2 . VAL B 1 110 ? 17.807 61.155 85.979  1.00 24.07  ? 110 VAL B CG2 1 
ATOM   3170 N N   . ARG B 1 111 ? 16.093 61.115 88.834  1.00 26.42  ? 111 ARG B N   1 
ATOM   3171 C CA  . ARG B 1 111 ? 14.775 61.604 89.157  1.00 26.42  ? 111 ARG B CA  1 
ATOM   3172 C C   . ARG B 1 111 ? 14.046 62.356 88.048  1.00 26.42  ? 111 ARG B C   1 
ATOM   3173 O O   . ARG B 1 111 ? 14.624 63.185 87.349  1.00 26.42  ? 111 ARG B O   1 
ATOM   3174 C CB  . ARG B 1 111 ? 14.864 62.501 90.395  1.00 68.98  ? 111 ARG B CB  1 
ATOM   3175 C CG  . ARG B 1 111 ? 13.553 63.185 90.760  1.00 68.98  ? 111 ARG B CG  1 
ATOM   3176 C CD  . ARG B 1 111 ? 13.666 64.005 92.035  1.00 68.98  ? 111 ARG B CD  1 
ATOM   3177 N NE  . ARG B 1 111 ? 14.680 65.047 91.911  1.00 68.98  ? 111 ARG B NE  1 
ATOM   3178 C CZ  . ARG B 1 111 ? 15.002 65.897 92.883  1.00 68.98  ? 111 ARG B CZ  1 
ATOM   3179 N NH1 . ARG B 1 111 ? 14.387 65.835 94.056  0.00 68.98  ? 111 ARG B NH1 1 
ATOM   3180 N NH2 . ARG B 1 111 ? 15.947 66.812 92.680  1.00 68.98  ? 111 ARG B NH2 1 
ATOM   3181 N N   . LEU B 1 112 ? 12.766 62.050 87.889  1.00 24.53  ? 112 LEU B N   1 
ATOM   3182 C CA  . LEU B 1 112 ? 11.948 62.750 86.920  1.00 24.53  ? 112 LEU B CA  1 
ATOM   3183 C C   . LEU B 1 112 ? 11.497 63.976 87.708  1.00 24.53  ? 112 LEU B C   1 
ATOM   3184 O O   . LEU B 1 112 ? 10.731 63.847 88.659  1.00 24.53  ? 112 LEU B O   1 
ATOM   3185 C CB  . LEU B 1 112 ? 10.737 61.907 86.534  1.00 24.78  ? 112 LEU B CB  1 
ATOM   3186 C CG  . LEU B 1 112 ? 9.638  62.629 85.747  1.00 24.78  ? 112 LEU B CG  1 
ATOM   3187 C CD1 . LEU B 1 112 ? 10.146 63.010 84.373  1.00 24.78  ? 112 LEU B CD1 1 
ATOM   3188 C CD2 . LEU B 1 112 ? 8.406  61.725 85.631  1.00 24.78  ? 112 LEU B CD2 1 
ATOM   3189 N N   . ARG B 1 113 ? 11.990 65.156 87.354  1.00 27.71  ? 113 ARG B N   1 
ATOM   3190 C CA  . ARG B 1 113 ? 11.594 66.364 88.079  1.00 27.71  ? 113 ARG B CA  1 
ATOM   3191 C C   . ARG B 1 113 ? 10.203 66.821 87.622  1.00 27.71  ? 113 ARG B C   1 
ATOM   3192 O O   . ARG B 1 113 ? 9.351  67.169 88.430  1.00 27.71  ? 113 ARG B O   1 
ATOM   3193 C CB  . ARG B 1 113 ? 12.589 67.499 87.824  1.00 55.49  ? 113 ARG B CB  1 
ATOM   3194 C CG  . ARG B 1 113 ? 14.038 67.077 87.765  1.00 55.49  ? 113 ARG B CG  1 
ATOM   3195 C CD  . ARG B 1 113 ? 14.657 66.937 89.142  1.00 55.49  ? 113 ARG B CD  1 
ATOM   3196 N NE  . ARG B 1 113 ? 15.688 67.948 89.388  1.00 55.49  ? 113 ARG B NE  1 
ATOM   3197 C CZ  . ARG B 1 113 ? 15.442 69.234 89.626  1.00 55.49  ? 113 ARG B CZ  1 
ATOM   3198 N NH1 . ARG B 1 113 ? 14.191 69.683 89.651  1.00 55.49  ? 113 ARG B NH1 1 
ATOM   3199 N NH2 . ARG B 1 113 ? 16.449 70.069 89.857  1.00 55.49  ? 113 ARG B NH2 1 
ATOM   3200 N N   . TYR B 1 114 ? 9.995  66.824 86.310  1.00 41.56  ? 114 TYR B N   1 
ATOM   3201 C CA  . TYR B 1 114 ? 8.730  67.243 85.731  1.00 41.56  ? 114 TYR B CA  1 
ATOM   3202 C C   . TYR B 1 114 ? 8.515  66.511 84.423  1.00 41.56  ? 114 TYR B C   1 
ATOM   3203 O O   . TYR B 1 114 ? 9.331  65.701 84.015  1.00 41.56  ? 114 TYR B O   1 
ATOM   3204 C CB  . TYR B 1 114 ? 8.753  68.747 85.436  1.00 37.17  ? 114 TYR B CB  1 
ATOM   3205 C CG  . TYR B 1 114 ? 8.980  69.612 86.641  1.00 37.17  ? 114 TYR B CG  1 
ATOM   3206 C CD1 . TYR B 1 114 ? 7.989  69.765 87.601  1.00 37.17  ? 114 TYR B CD1 1 
ATOM   3207 C CD2 . TYR B 1 114 ? 10.208 70.240 86.851  1.00 37.17  ? 114 TYR B CD2 1 
ATOM   3208 C CE1 . TYR B 1 114 ? 8.210  70.518 88.743  1.00 37.17  ? 114 TYR B CE1 1 
ATOM   3209 C CE2 . TYR B 1 114 ? 10.441 70.990 87.993  1.00 37.17  ? 114 TYR B CE2 1 
ATOM   3210 C CZ  . TYR B 1 114 ? 9.436  71.122 88.933  1.00 37.17  ? 114 TYR B CZ  1 
ATOM   3211 O OH  . TYR B 1 114 ? 9.657  71.845 90.079  1.00 37.17  ? 114 TYR B OH  1 
ATOM   3212 N N   . PHE B 1 115 ? 7.395  66.807 83.784  1.00 30.06  ? 115 PHE B N   1 
ATOM   3213 C CA  . PHE B 1 115 ? 7.062  66.264 82.482  1.00 30.06  ? 115 PHE B CA  1 
ATOM   3214 C C   . PHE B 1 115 ? 5.959  67.157 81.965  1.00 30.06  ? 115 PHE B C   1 
ATOM   3215 O O   . PHE B 1 115 ? 5.232  67.767 82.742  1.00 30.06  ? 115 PHE B O   1 
ATOM   3216 C CB  . PHE B 1 115 ? 6.643  64.781 82.548  1.00 30.07  ? 115 PHE B CB  1 
ATOM   3217 C CG  . PHE B 1 115 ? 5.346  64.516 83.254  1.00 30.07  ? 115 PHE B CG  1 
ATOM   3218 C CD1 . PHE B 1 115 ? 4.167  64.372 82.539  1.00 30.07  ? 115 PHE B CD1 1 
ATOM   3219 C CD2 . PHE B 1 115 ? 5.314  64.329 84.627  1.00 30.07  ? 115 PHE B CD2 1 
ATOM   3220 C CE1 . PHE B 1 115 ? 2.977  64.039 83.180  1.00 30.07  ? 115 PHE B CE1 1 
ATOM   3221 C CE2 . PHE B 1 115 ? 4.124  63.995 85.277  1.00 30.07  ? 115 PHE B CE2 1 
ATOM   3222 C CZ  . PHE B 1 115 ? 2.958  63.849 84.550  1.00 30.07  ? 115 PHE B CZ  1 
ATOM   3223 N N   . PHE B 1 116 ? 5.877  67.281 80.652  1.00 31.41  ? 116 PHE B N   1 
ATOM   3224 C CA  . PHE B 1 116 ? 4.869  68.124 80.045  1.00 31.41  ? 116 PHE B CA  1 
ATOM   3225 C C   . PHE B 1 116 ? 4.780  67.808 78.568  1.00 31.41  ? 116 PHE B C   1 
ATOM   3226 O O   . PHE B 1 116 ? 5.650  67.134 78.031  1.00 31.41  ? 116 PHE B O   1 
ATOM   3227 C CB  . PHE B 1 116 ? 5.213  69.605 80.282  1.00 24.12  ? 116 PHE B CB  1 
ATOM   3228 C CG  . PHE B 1 116 ? 6.529  70.058 79.687  1.00 24.12  ? 116 PHE B CG  1 
ATOM   3229 C CD1 . PHE B 1 116 ? 6.649  70.308 78.328  1.00 24.12  ? 116 PHE B CD1 1 
ATOM   3230 C CD2 . PHE B 1 116 ? 7.632  70.288 80.501  1.00 24.12  ? 116 PHE B CD2 1 
ATOM   3231 C CE1 . PHE B 1 116 ? 7.854  70.783 77.786  1.00 24.12  ? 116 PHE B CE1 1 
ATOM   3232 C CE2 . PHE B 1 116 ? 8.837  70.762 79.972  1.00 24.12  ? 116 PHE B CE2 1 
ATOM   3233 C CZ  . PHE B 1 116 ? 8.946  71.011 78.612  1.00 24.12  ? 116 PHE B CZ  1 
ATOM   3234 N N   . TYR B 1 117 ? 3.721  68.267 77.913  1.00 37.66  ? 117 TYR B N   1 
ATOM   3235 C CA  . TYR B 1 117 ? 3.570  68.012 76.485  1.00 37.66  ? 117 TYR B CA  1 
ATOM   3236 C C   . TYR B 1 117 ? 3.758  69.295 75.690  1.00 37.66  ? 117 TYR B C   1 
ATOM   3237 O O   . TYR B 1 117 ? 3.533  70.389 76.205  1.00 37.66  ? 117 TYR B O   1 
ATOM   3238 C CB  . TYR B 1 117 ? 2.200  67.402 76.184  1.00 27.23  ? 117 TYR B CB  1 
ATOM   3239 C CG  . TYR B 1 117 ? 1.917  66.165 76.994  1.00 27.23  ? 117 TYR B CG  1 
ATOM   3240 C CD1 . TYR B 1 117 ? 1.417  66.257 78.286  1.00 27.23  ? 117 TYR B CD1 1 
ATOM   3241 C CD2 . TYR B 1 117 ? 2.196  64.900 76.489  1.00 27.23  ? 117 TYR B CD2 1 
ATOM   3242 C CE1 . TYR B 1 117 ? 1.204  65.131 79.055  1.00 27.23  ? 117 TYR B CE1 1 
ATOM   3243 C CE2 . TYR B 1 117 ? 1.987  63.760 77.258  1.00 27.23  ? 117 TYR B CE2 1 
ATOM   3244 C CZ  . TYR B 1 117 ? 1.494  63.888 78.539  1.00 27.23  ? 117 TYR B CZ  1 
ATOM   3245 O OH  . TYR B 1 117 ? 1.326  62.775 79.323  1.00 27.23  ? 117 TYR B OH  1 
ATOM   3246 N N   . SER B 1 118 ? 4.187  69.149 74.438  1.00 46.94  ? 118 SER B N   1 
ATOM   3247 C CA  . SER B 1 118 ? 4.414  70.287 73.550  1.00 46.94  ? 118 SER B CA  1 
ATOM   3248 C C   . SER B 1 118 ? 4.074  69.910 72.099  1.00 46.94  ? 118 SER B C   1 
ATOM   3249 O O   . SER B 1 118 ? 4.019  68.723 71.747  1.00 46.94  ? 118 SER B O   1 
ATOM   3250 C CB  . SER B 1 118 ? 5.869  70.729 73.640  1.00 56.00  ? 118 SER B CB  1 
ATOM   3251 O OG  . SER B 1 118 ? 6.714  69.722 73.110  1.00 56.00  ? 118 SER B OG  1 
ATOM   3252 N N   . SER B 1 119 ? 3.858  70.928 71.266  1.00 78.48  ? 119 SER B N   1 
ATOM   3253 C CA  . SER B 1 119 ? 3.492  70.733 69.860  1.00 78.48  ? 119 SER B CA  1 
ATOM   3254 C C   . SER B 1 119 ? 4.583  70.157 68.969  1.00 78.48  ? 119 SER B C   1 
ATOM   3255 O O   . SER B 1 119 ? 5.676  70.740 68.817  1.00 78.48  ? 119 SER B O   1 
ATOM   3256 C CB  . SER B 1 119 ? 2.993  72.045 69.243  1.00 47.32  ? 119 SER B CB  1 
ATOM   3257 O OG  . SER B 1 119 ? 1.600  72.185 69.455  1.00 47.32  ? 119 SER B OG  1 
ATOM   3258 N N   . GLY B 1 120 ? 4.264  69.009 68.369  1.00 100.00 ? 120 GLY B N   1 
ATOM   3259 C CA  . GLY B 1 120 ? 5.217  68.356 67.479  1.00 100.00 ? 120 GLY B CA  1 
ATOM   3260 C C   . GLY B 1 120 ? 5.431  69.166 66.200  1.00 100.00 ? 120 GLY B C   1 
ATOM   3261 O O   . GLY B 1 120 ? 4.695  70.089 65.880  1.00 100.00 ? 120 GLY B O   1 
ATOM   3262 N N   . GLU B 1 121 ? 6.508  68.813 65.475  1.00 91.82  ? 121 GLU B N   1 
ATOM   3263 C CA  . GLU B 1 121 ? 6.806  69.526 64.239  1.00 91.82  ? 121 GLU B CA  1 
ATOM   3264 C C   . GLU B 1 121 ? 5.623  69.482 63.270  1.00 91.82  ? 121 GLU B C   1 
ATOM   3265 O O   . GLU B 1 121 ? 5.507  70.268 62.338  1.00 91.82  ? 121 GLU B O   1 
ATOM   3266 C CB  . GLU B 1 121 ? 8.033  68.876 63.596  1.00 31.03  ? 121 GLU B CB  1 
ATOM   3267 N N   . LYS B 1 122 ? 4.744  68.491 63.496  1.00 74.25  ? 122 LYS B N   1 
ATOM   3268 C CA  . LYS B 1 122 ? 3.597  68.330 62.613  1.00 74.25  ? 122 LYS B CA  1 
ATOM   3269 C C   . LYS B 1 122 ? 2.317  68.854 63.264  1.00 74.25  ? 122 LYS B C   1 
ATOM   3270 O O   . LYS B 1 122 ? 2.327  69.478 64.316  1.00 74.25  ? 122 LYS B O   1 
ATOM   3271 C CB  . LYS B 1 122 ? 3.447  66.843 62.292  0.00 35.69  ? 122 LYS B CB  1 
ATOM   3272 N N   . LYS B 1 123 ? 1.188  68.617 62.574  1.00 83.38  ? 123 LYS B N   1 
ATOM   3273 C CA  . LYS B 1 123 ? -0.083 69.095 63.102  1.00 83.38  ? 123 LYS B CA  1 
ATOM   3274 C C   . LYS B 1 123 ? -0.652 68.139 64.154  1.00 83.38  ? 123 LYS B C   1 
ATOM   3275 O O   . LYS B 1 123 ? -0.767 68.466 65.328  1.00 83.38  ? 123 LYS B O   1 
ATOM   3276 C CB  . LYS B 1 123 ? -1.062 69.232 61.935  1.00 56.49  ? 123 LYS B CB  1 
ATOM   3277 N N   . ASP B 1 124 ? -1.057 66.885 63.954  1.00 86.23  ? 124 ASP B N   1 
ATOM   3278 C CA  . ASP B 1 124 ? -1.570 66.054 65.047  1.00 86.23  ? 124 ASP B CA  1 
ATOM   3279 C C   . ASP B 1 124 ? -0.474 65.322 65.849  1.00 86.23  ? 124 ASP B C   1 
ATOM   3280 O O   . ASP B 1 124 ? -0.759 64.317 66.500  0.00 86.23  ? 124 ASP B O   1 
ATOM   3281 C CB  . ASP B 1 124 ? -2.568 65.045 64.495  0.00 35.69  ? 124 ASP B CB  1 
ATOM   3282 N N   . GLU B 1 125 ? 0.773  65.812 65.801  1.00 71.69  ? 125 GLU B N   1 
ATOM   3283 C CA  . GLU B 1 125 ? 1.853  65.158 66.558  1.00 71.69  ? 125 GLU B CA  1 
ATOM   3284 C C   . GLU B 1 125 ? 2.221  65.936 67.813  1.00 71.69  ? 125 GLU B C   1 
ATOM   3285 O O   . GLU B 1 125 ? 2.446  67.147 67.768  1.00 71.69  ? 125 GLU B O   1 
ATOM   3286 C CB  . GLU B 1 125 ? 3.113  64.929 65.697  1.00 71.11  ? 125 GLU B CB  1 
ATOM   3287 C CG  . GLU B 1 125 ? 3.815  66.178 65.168  1.00 71.11  ? 125 GLU B CG  1 
ATOM   3288 C CD  . GLU B 1 125 ? 5.144  65.846 64.459  1.00 71.11  ? 125 GLU B CD  1 
ATOM   3289 O OE1 . GLU B 1 125 ? 5.177  64.913 63.601  1.00 71.11  ? 125 GLU B OE1 1 
ATOM   3290 O OE2 . GLU B 1 125 ? 6.161  66.525 64.760  1.00 71.11  ? 125 GLU B OE2 1 
ATOM   3291 N N   . VAL B 1 126 ? 2.266  65.234 68.938  1.00 34.98  ? 126 VAL B N   1 
ATOM   3292 C CA  . VAL B 1 126 ? 2.604  65.884 70.186  1.00 34.98  ? 126 VAL B CA  1 
ATOM   3293 C C   . VAL B 1 126 ? 3.668  65.082 70.916  1.00 34.98  ? 126 VAL B C   1 
ATOM   3294 O O   . VAL B 1 126 ? 3.723  63.846 70.828  1.00 34.98  ? 126 VAL B O   1 
ATOM   3295 C CB  . VAL B 1 126 ? 1.345  66.060 71.091  1.00 35.27  ? 126 VAL B CB  1 
ATOM   3296 C CG1 . VAL B 1 126 ? 0.146  66.450 70.228  1.00 35.27  ? 126 VAL B CG1 1 
ATOM   3297 C CG2 . VAL B 1 126 ? 1.049  64.788 71.861  1.00 35.27  ? 126 VAL B CG2 1 
ATOM   3298 N N   . TYR B 1 127 ? 4.517  65.796 71.641  1.00 37.11  ? 127 TYR B N   1 
ATOM   3299 C CA  . TYR B 1 127 ? 5.581  65.152 72.371  1.00 37.11  ? 127 TYR B CA  1 
ATOM   3300 C C   . TYR B 1 127 ? 5.386  65.159 73.866  1.00 37.11  ? 127 TYR B C   1 
ATOM   3301 O O   . TYR B 1 127 ? 4.664  65.983 74.415  1.00 37.11  ? 127 TYR B O   1 
ATOM   3302 C CB  . TYR B 1 127 ? 6.900  65.834 72.075  1.00 69.17  ? 127 TYR B CB  1 
ATOM   3303 C CG  . TYR B 1 127 ? 7.322  65.772 70.642  1.00 69.17  ? 127 TYR B CG  1 
ATOM   3304 C CD1 . TYR B 1 127 ? 7.277  66.907 69.841  1.00 69.17  ? 127 TYR B CD1 1 
ATOM   3305 C CD2 . TYR B 1 127 ? 7.820  64.590 70.095  1.00 69.17  ? 127 TYR B CD2 1 
ATOM   3306 C CE1 . TYR B 1 127 ? 7.730  66.878 68.530  1.00 69.17  ? 127 TYR B CE1 1 
ATOM   3307 C CE2 . TYR B 1 127 ? 8.273  64.540 68.778  1.00 69.17  ? 127 TYR B CE2 1 
ATOM   3308 C CZ  . TYR B 1 127 ? 8.227  65.696 67.998  1.00 69.17  ? 127 TYR B CZ  1 
ATOM   3309 O OH  . TYR B 1 127 ? 8.678  65.686 66.690  1.00 69.17  ? 127 TYR B OH  1 
ATOM   3310 N N   . LEU B 1 128 ? 6.063  64.221 74.514  1.00 35.76  ? 128 LEU B N   1 
ATOM   3311 C CA  . LEU B 1 128 ? 6.055  64.089 75.958  1.00 35.76  ? 128 LEU B CA  1 
ATOM   3312 C C   . LEU B 1 128 ? 7.447  64.560 76.341  1.00 35.76  ? 128 LEU B C   1 
ATOM   3313 O O   . LEU B 1 128 ? 8.435  64.095 75.783  1.00 35.76  ? 128 LEU B O   1 
ATOM   3314 C CB  . LEU B 1 128 ? 5.861  62.630 76.360  1.00 23.71  ? 128 LEU B CB  1 
ATOM   3315 C CG  . LEU B 1 128 ? 6.155  62.311 77.823  1.00 23.71  ? 128 LEU B CG  1 
ATOM   3316 C CD1 . LEU B 1 128 ? 5.191  63.066 78.730  1.00 23.71  ? 128 LEU B CD1 1 
ATOM   3317 C CD2 . LEU B 1 128 ? 6.040  60.812 78.040  1.00 23.71  ? 128 LEU B CD2 1 
ATOM   3318 N N   . ASN B 1 129 ? 7.524  65.498 77.270  1.00 26.19  ? 129 ASN B N   1 
ATOM   3319 C CA  . ASN B 1 129 ? 8.807  66.034 77.698  1.00 26.19  ? 129 ASN B CA  1 
ATOM   3320 C C   . ASN B 1 129 ? 9.159  65.533 79.080  1.00 26.19  ? 129 ASN B C   1 
ATOM   3321 O O   . ASN B 1 129 ? 8.418  65.752 80.031  1.00 26.19  ? 129 ASN B O   1 
ATOM   3322 C CB  . ASN B 1 129 ? 8.756  67.563 77.702  1.00 38.77  ? 129 ASN B CB  1 
ATOM   3323 C CG  . ASN B 1 129 ? 8.549  68.144 76.313  1.00 38.77  ? 129 ASN B CG  1 
ATOM   3324 O OD1 . ASN B 1 129 ? 9.482  68.657 75.697  1.00 38.77  ? 129 ASN B OD1 1 
ATOM   3325 N ND2 . ASN B 1 129 ? 7.324  68.059 75.811  1.00 38.77  ? 129 ASN B ND2 1 
ATOM   3326 N N   . LEU B 1 130 ? 10.290 64.851 79.189  1.00 33.93  ? 130 LEU B N   1 
ATOM   3327 C CA  . LEU B 1 130 ? 10.736 64.333 80.475  1.00 33.93  ? 130 LEU B CA  1 
ATOM   3328 C C   . LEU B 1 130 ? 11.864 65.194 81.021  1.00 33.93  ? 130 LEU B C   1 
ATOM   3329 O O   . LEU B 1 130 ? 12.980 65.175 80.500  1.00 33.93  ? 130 LEU B O   1 
ATOM   3330 C CB  . LEU B 1 130 ? 11.203 62.878 80.336  1.00 30.88  ? 130 LEU B CB  1 
ATOM   3331 C CG  . LEU B 1 130 ? 10.092 61.821 80.356  1.00 30.88  ? 130 LEU B CG  1 
ATOM   3332 C CD1 . LEU B 1 130 ? 9.086  62.143 79.288  1.00 30.88  ? 130 LEU B CD1 1 
ATOM   3333 C CD2 . LEU B 1 130 ? 10.661 60.431 80.146  1.00 30.88  ? 130 LEU B CD2 1 
ATOM   3334 N N   . VAL B 1 131 ? 11.556 65.969 82.056  1.00 34.92  ? 131 VAL B N   1 
ATOM   3335 C CA  . VAL B 1 131 ? 12.541 66.833 82.686  1.00 34.92  ? 131 VAL B CA  1 
ATOM   3336 C C   . VAL B 1 131 ? 13.202 66.033 83.783  1.00 34.92  ? 131 VAL B C   1 
ATOM   3337 O O   . VAL B 1 131 ? 12.641 65.866 84.865  1.00 34.92  ? 131 VAL B O   1 
ATOM   3338 C CB  . VAL B 1 131 ? 11.895 68.067 83.309  1.00 27.17  ? 131 VAL B CB  1 
ATOM   3339 C CG1 . VAL B 1 131 ? 12.909 68.802 84.166  1.00 27.17  ? 131 VAL B CG1 1 
ATOM   3340 C CG2 . VAL B 1 131 ? 11.374 68.974 82.217  1.00 27.17  ? 131 VAL B CG2 1 
ATOM   3341 N N   . LEU B 1 132 ? 14.399 65.540 83.492  1.00 31.94  ? 132 LEU B N   1 
ATOM   3342 C CA  . LEU B 1 132 ? 15.149 64.731 84.435  1.00 31.94  ? 132 LEU B CA  1 
ATOM   3343 C C   . LEU B 1 132 ? 16.348 65.456 84.988  1.00 31.94  ? 132 LEU B C   1 
ATOM   3344 O O   . LEU B 1 132 ? 16.743 66.495 84.485  1.00 31.94  ? 132 LEU B O   1 
ATOM   3345 C CB  . LEU B 1 132 ? 15.638 63.476 83.739  1.00 26.39  ? 132 LEU B CB  1 
ATOM   3346 C CG  . LEU B 1 132 ? 14.522 62.679 83.087  1.00 26.39  ? 132 LEU B CG  1 
ATOM   3347 C CD1 . LEU B 1 132 ? 15.005 62.182 81.741  1.00 26.39  ? 132 LEU B CD1 1 
ATOM   3348 C CD2 . LEU B 1 132 ? 14.087 61.547 83.999  1.00 26.39  ? 132 LEU B CD2 1 
ATOM   3349 N N   . ASP B 1 133 ? 16.925 64.900 86.041  1.00 31.67  ? 133 ASP B N   1 
ATOM   3350 C CA  . ASP B 1 133 ? 18.128 65.470 86.617  1.00 31.67  ? 133 ASP B CA  1 
ATOM   3351 C C   . ASP B 1 133 ? 19.228 65.315 85.576  1.00 31.67  ? 133 ASP B C   1 
ATOM   3352 O O   . ASP B 1 133 ? 19.218 64.374 84.782  1.00 31.67  ? 133 ASP B O   1 
ATOM   3353 C CB  . ASP B 1 133 ? 18.518 64.707 87.873  1.00 40.71  ? 133 ASP B CB  1 
ATOM   3354 C CG  . ASP B 1 133 ? 17.855 65.255 89.102  1.00 40.71  ? 133 ASP B CG  1 
ATOM   3355 O OD1 . ASP B 1 133 ? 17.718 64.495 90.072  1.00 40.71  ? 133 ASP B OD1 1 
ATOM   3356 O OD2 . ASP B 1 133 ? 17.483 66.448 89.106  1.00 40.71  ? 133 ASP B OD2 1 
ATOM   3357 N N   . TYR B 1 134 ? 20.172 66.242 85.559  1.00 35.47  ? 134 TYR B N   1 
ATOM   3358 C CA  . TYR B 1 134 ? 21.268 66.141 84.613  1.00 35.47  ? 134 TYR B CA  1 
ATOM   3359 C C   . TYR B 1 134 ? 22.488 65.568 85.323  1.00 35.47  ? 134 TYR B C   1 
ATOM   3360 O O   . TYR B 1 134 ? 22.778 65.907 86.471  1.00 35.47  ? 134 TYR B O   1 
ATOM   3361 C CB  . TYR B 1 134 ? 21.613 67.506 84.037  1.00 64.33  ? 134 TYR B CB  1 
ATOM   3362 C CG  . TYR B 1 134 ? 22.881 67.492 83.211  1.00 64.33  ? 134 TYR B CG  1 
ATOM   3363 C CD1 . TYR B 1 134 ? 22.903 66.946 81.929  1.00 64.33  ? 134 TYR B CD1 1 
ATOM   3364 C CD2 . TYR B 1 134 ? 24.065 68.010 83.727  1.00 64.33  ? 134 TYR B CD2 1 
ATOM   3365 C CE1 . TYR B 1 134 ? 24.069 66.919 81.190  1.00 64.33  ? 134 TYR B CE1 1 
ATOM   3366 C CE2 . TYR B 1 134 ? 25.232 67.986 82.999  1.00 64.33  ? 134 TYR B CE2 1 
ATOM   3367 C CZ  . TYR B 1 134 ? 25.231 67.440 81.735  1.00 64.33  ? 134 TYR B CZ  1 
ATOM   3368 O OH  . TYR B 1 134 ? 26.422 67.399 81.044  1.00 64.33  ? 134 TYR B OH  1 
ATOM   3369 N N   . VAL B 1 135 ? 23.192 64.675 84.650  1.00 30.56  ? 135 VAL B N   1 
ATOM   3370 C CA  . VAL B 1 135 ? 24.370 64.089 85.243  1.00 30.56  ? 135 VAL B CA  1 
ATOM   3371 C C   . VAL B 1 135 ? 25.398 63.981 84.141  1.00 30.56  ? 135 VAL B C   1 
ATOM   3372 O O   . VAL B 1 135 ? 25.229 63.241 83.170  1.00 30.56  ? 135 VAL B O   1 
ATOM   3373 C CB  . VAL B 1 135 ? 24.056 62.738 85.852  1.00 22.63  ? 135 VAL B CB  1 
ATOM   3374 C CG1 . VAL B 1 135 ? 25.287 62.169 86.517  1.00 22.63  ? 135 VAL B CG1 1 
ATOM   3375 C CG2 . VAL B 1 135 ? 22.943 62.902 86.862  1.00 22.63  ? 135 VAL B CG2 1 
ATOM   3376 N N   . PRO B 1 136 ? 26.492 64.734 84.289  1.00 35.98  ? 136 PRO B N   1 
ATOM   3377 C CA  . PRO B 1 136 ? 27.631 64.832 83.368  1.00 35.98  ? 136 PRO B CA  1 
ATOM   3378 C C   . PRO B 1 136 ? 28.259 63.512 82.899  1.00 35.98  ? 136 PRO B C   1 
ATOM   3379 O O   . PRO B 1 136 ? 28.084 63.107 81.750  1.00 35.98  ? 136 PRO B O   1 
ATOM   3380 C CB  . PRO B 1 136 ? 28.610 65.700 84.145  1.00 40.90  ? 136 PRO B CB  1 
ATOM   3381 C CG  . PRO B 1 136 ? 28.342 65.271 85.585  1.00 40.90  ? 136 PRO B CG  1 
ATOM   3382 C CD  . PRO B 1 136 ? 26.847 65.256 85.626  1.00 40.90  ? 136 PRO B CD  1 
ATOM   3383 N N   . GLU B 1 137 ? 28.984 62.837 83.781  1.00 28.75  ? 137 GLU B N   1 
ATOM   3384 C CA  . GLU B 1 137 ? 29.637 61.594 83.396  1.00 28.75  ? 137 GLU B CA  1 
ATOM   3385 C C   . GLU B 1 137 ? 28.745 60.355 83.351  1.00 28.75  ? 137 GLU B C   1 
ATOM   3386 O O   . GLU B 1 137 ? 27.585 60.375 83.757  1.00 28.75  ? 137 GLU B O   1 
ATOM   3387 C CB  . GLU B 1 137 ? 30.807 61.301 84.334  1.00 50.44  ? 137 GLU B CB  1 
ATOM   3388 C CG  . GLU B 1 137 ? 31.938 62.303 84.315  0.00 50.44  ? 137 GLU B CG  1 
ATOM   3389 C CD  . GLU B 1 137 ? 32.535 62.479 82.939  1.00 50.44  ? 137 GLU B CD  1 
ATOM   3390 O OE1 . GLU B 1 137 ? 32.658 61.478 82.197  1.00 50.44  ? 137 GLU B OE1 1 
ATOM   3391 O OE2 . GLU B 1 137 ? 32.897 63.624 82.599  1.00 50.44  ? 137 GLU B OE2 1 
ATOM   3392 N N   . THR B 1 138 ? 29.324 59.277 82.840  1.00 27.67  ? 138 THR B N   1 
ATOM   3393 C CA  . THR B 1 138 ? 28.665 57.981 82.754  1.00 27.67  ? 138 THR B CA  1 
ATOM   3394 C C   . THR B 1 138 ? 29.761 56.954 82.974  1.00 27.67  ? 138 THR B C   1 
ATOM   3395 O O   . THR B 1 138 ? 30.930 57.240 82.757  1.00 27.67  ? 138 THR B O   1 
ATOM   3396 C CB  . THR B 1 138 ? 28.037 57.714 81.367  1.00 24.07  ? 138 THR B CB  1 
ATOM   3397 O OG1 . THR B 1 138 ? 29.067 57.644 80.383  1.00 24.07  ? 138 THR B OG1 1 
ATOM   3398 C CG2 . THR B 1 138 ? 27.059 58.803 80.995  1.00 24.07  ? 138 THR B CG2 1 
ATOM   3399 N N   . VAL B 1 139 ? 29.389 55.768 83.427  1.00 24.31  ? 139 VAL B N   1 
ATOM   3400 C CA  . VAL B 1 139 ? 30.368 54.723 83.636  1.00 24.31  ? 139 VAL B CA  1 
ATOM   3401 C C   . VAL B 1 139 ? 31.078 54.456 82.320  1.00 24.31  ? 139 VAL B C   1 
ATOM   3402 O O   . VAL B 1 139 ? 32.248 54.100 82.310  1.00 24.31  ? 139 VAL B O   1 
ATOM   3403 C CB  . VAL B 1 139 ? 29.701 53.423 84.137  1.00 25.24  ? 139 VAL B CB  1 
ATOM   3404 C CG1 . VAL B 1 139 ? 30.678 52.246 84.046  1.00 25.24  ? 139 VAL B CG1 1 
ATOM   3405 C CG2 . VAL B 1 139 ? 29.257 53.614 85.560  1.00 25.24  ? 139 VAL B CG2 1 
ATOM   3406 N N   . TYR B 1 140 ? 30.364 54.640 81.214  1.00 26.09  ? 140 TYR B N   1 
ATOM   3407 C CA  . TYR B 1 140 ? 30.928 54.424 79.889  1.00 26.09  ? 140 TYR B CA  1 
ATOM   3408 C C   . TYR B 1 140 ? 32.098 55.377 79.610  1.00 26.09  ? 140 TYR B C   1 
ATOM   3409 O O   . TYR B 1 140 ? 33.233 54.933 79.424  1.00 26.09  ? 140 TYR B O   1 
ATOM   3410 C CB  . TYR B 1 140 ? 29.867 54.624 78.811  1.00 42.32  ? 140 TYR B CB  1 
ATOM   3411 C CG  . TYR B 1 140 ? 30.452 54.552 77.424  1.00 42.32  ? 140 TYR B CG  1 
ATOM   3412 C CD1 . TYR B 1 140 ? 30.799 53.325 76.860  1.00 42.32  ? 140 TYR B CD1 1 
ATOM   3413 C CD2 . TYR B 1 140 ? 30.732 55.713 76.702  1.00 42.32  ? 140 TYR B CD2 1 
ATOM   3414 C CE1 . TYR B 1 140 ? 31.410 53.248 75.617  1.00 42.32  ? 140 TYR B CE1 1 
ATOM   3415 C CE2 . TYR B 1 140 ? 31.348 55.648 75.458  1.00 42.32  ? 140 TYR B CE2 1 
ATOM   3416 C CZ  . TYR B 1 140 ? 31.684 54.406 74.920  1.00 42.32  ? 140 TYR B CZ  1 
ATOM   3417 O OH  . TYR B 1 140 ? 32.297 54.311 73.686  1.00 42.32  ? 140 TYR B OH  1 
ATOM   3418 N N   . ARG B 1 141 ? 31.816 56.682 79.564  1.00 33.10  ? 141 ARG B N   1 
ATOM   3419 C CA  . ARG B 1 141 ? 32.849 57.680 79.312  1.00 33.10  ? 141 ARG B CA  1 
ATOM   3420 C C   . ARG B 1 141 ? 34.049 57.465 80.220  1.00 33.10  ? 141 ARG B C   1 
ATOM   3421 O O   . ARG B 1 141 ? 35.197 57.567 79.782  1.00 33.10  ? 141 ARG B O   1 
ATOM   3422 C CB  . ARG B 1 141 ? 32.329 59.100 79.546  1.00 64.61  ? 141 ARG B CB  1 
ATOM   3423 C CG  . ARG B 1 141 ? 31.473 59.684 78.441  1.00 64.61  ? 141 ARG B CG  1 
ATOM   3424 C CD  . ARG B 1 141 ? 31.388 61.205 78.609  1.00 64.61  ? 141 ARG B CD  1 
ATOM   3425 N NE  . ARG B 1 141 ? 32.711 61.828 78.451  1.00 64.61  ? 141 ARG B NE  1 
ATOM   3426 C CZ  . ARG B 1 141 ? 33.190 62.808 79.221  1.00 64.61  ? 141 ARG B CZ  1 
ATOM   3427 N NH1 . ARG B 1 141 ? 32.457 63.296 80.218  1.00 64.61  ? 141 ARG B NH1 1 
ATOM   3428 N NH2 . ARG B 1 141 ? 34.413 63.288 79.000  1.00 64.61  ? 141 ARG B NH2 1 
ATOM   3429 N N   . VAL B 1 142 ? 33.780 57.178 81.487  1.00 26.47  ? 142 VAL B N   1 
ATOM   3430 C CA  . VAL B 1 142 ? 34.849 56.979 82.446  1.00 26.47  ? 142 VAL B CA  1 
ATOM   3431 C C   . VAL B 1 142 ? 35.674 55.763 82.130  1.00 26.47  ? 142 VAL B C   1 
ATOM   3432 O O   . VAL B 1 142 ? 36.879 55.859 81.961  1.00 26.47  ? 142 VAL B O   1 
ATOM   3433 C CB  . VAL B 1 142 ? 34.297 56.870 83.861  1.00 22.73  ? 142 VAL B CB  1 
ATOM   3434 C CG1 . VAL B 1 142 ? 35.361 56.356 84.811  1.00 22.73  ? 142 VAL B CG1 1 
ATOM   3435 C CG2 . VAL B 1 142 ? 33.810 58.237 84.299  1.00 22.73  ? 142 VAL B CG2 1 
ATOM   3436 N N   . ALA B 1 143 ? 35.025 54.615 82.037  1.00 31.01  ? 143 ALA B N   1 
ATOM   3437 C CA  . ALA B 1 143 ? 35.735 53.383 81.724  1.00 31.01  ? 143 ALA B CA  1 
ATOM   3438 C C   . ALA B 1 143 ? 36.558 53.527 80.443  1.00 31.01  ? 143 ALA B C   1 
ATOM   3439 O O   . ALA B 1 143 ? 37.628 52.933 80.319  1.00 31.01  ? 143 ALA B O   1 
ATOM   3440 C CB  . ALA B 1 143 ? 34.746 52.238 81.577  1.00 38.81  ? 143 ALA B CB  1 
ATOM   3441 N N   . ARG B 1 144 ? 36.057 54.317 79.497  1.00 38.23  ? 144 ARG B N   1 
ATOM   3442 C CA  . ARG B 1 144 ? 36.745 54.513 78.229  1.00 38.23  ? 144 ARG B CA  1 
ATOM   3443 C C   . ARG B 1 144 ? 38.046 55.270 78.416  1.00 38.23  ? 144 ARG B C   1 
ATOM   3444 O O   . ARG B 1 144 ? 39.026 55.003 77.724  1.00 38.23  ? 144 ARG B O   1 
ATOM   3445 C CB  . ARG B 1 144 ? 35.858 55.266 77.244  1.00 59.20  ? 144 ARG B CB  1 
ATOM   3446 C CG  . ARG B 1 144 ? 36.376 55.247 75.821  1.00 59.20  ? 144 ARG B CG  1 
ATOM   3447 C CD  . ARG B 1 144 ? 35.399 55.922 74.870  1.00 59.20  ? 144 ARG B CD  1 
ATOM   3448 N NE  . ARG B 1 144 ? 35.901 55.933 73.500  1.00 59.20  ? 144 ARG B NE  1 
ATOM   3449 C CZ  . ARG B 1 144 ? 35.200 56.351 72.444  1.00 59.20  ? 144 ARG B CZ  1 
ATOM   3450 N NH1 . ARG B 1 144 ? 33.948 56.797 72.596  1.00 59.20  ? 144 ARG B NH1 1 
ATOM   3451 N NH2 . ARG B 1 144 ? 35.748 56.330 71.230  1.00 59.20  ? 144 ARG B NH2 1 
ATOM   3452 N N   . HIS B 1 145 ? 38.067 56.210 79.351  1.00 38.97  ? 145 HIS B N   1 
ATOM   3453 C CA  . HIS B 1 145 ? 39.282 56.959 79.586  1.00 38.97  ? 145 HIS B CA  1 
ATOM   3454 C C   . HIS B 1 145 ? 40.371 56.083 80.187  1.00 38.97  ? 145 HIS B C   1 
ATOM   3455 O O   . HIS B 1 145 ? 41.476 56.024 79.656  1.00 38.97  ? 145 HIS B O   1 
ATOM   3456 C CB  . HIS B 1 145 ? 39.005 58.163 80.486  1.00 93.08  ? 145 HIS B CB  1 
ATOM   3457 C CG  . HIS B 1 145 ? 38.368 59.309 79.763  1.00 93.08  ? 145 HIS B CG  1 
ATOM   3458 N ND1 . HIS B 1 145 ? 37.378 60.091 80.327  1.00 93.08  ? 145 HIS B ND1 1 
ATOM   3459 C CD2 . HIS B 1 145 ? 38.562 59.789 78.514  1.00 93.08  ? 145 HIS B CD2 1 
ATOM   3460 C CE1 . HIS B 1 145 ? 36.987 61.000 79.450  1.00 93.08  ? 145 HIS B CE1 1 
ATOM   3461 N NE2 . HIS B 1 145 ? 37.688 60.840 78.342  1.00 93.08  ? 145 HIS B NE2 1 
ATOM   3462 N N   . TYR B 1 146 ? 40.077 55.394 81.279  1.00 29.76  ? 146 TYR B N   1 
ATOM   3463 C CA  . TYR B 1 146 ? 41.094 54.555 81.877  1.00 29.76  ? 146 TYR B CA  1 
ATOM   3464 C C   . TYR B 1 146 ? 41.565 53.547 80.849  1.00 29.76  ? 146 TYR B C   1 
ATOM   3465 O O   . TYR B 1 146 ? 42.743 53.185 80.798  1.00 29.76  ? 146 TYR B O   1 
ATOM   3466 C CB  . TYR B 1 146 ? 40.547 53.836 83.108  1.00 30.48  ? 146 TYR B CB  1 
ATOM   3467 C CG  . TYR B 1 146 ? 40.420 54.737 84.309  1.00 30.48  ? 146 TYR B CG  1 
ATOM   3468 C CD1 . TYR B 1 146 ? 39.383 55.660 84.404  1.00 30.48  ? 146 TYR B CD1 1 
ATOM   3469 C CD2 . TYR B 1 146 ? 41.371 54.706 85.328  1.00 30.48  ? 146 TYR B CD2 1 
ATOM   3470 C CE1 . TYR B 1 146 ? 39.296 56.526 85.479  1.00 30.48  ? 146 TYR B CE1 1 
ATOM   3471 C CE2 . TYR B 1 146 ? 41.292 55.572 86.408  1.00 30.48  ? 146 TYR B CE2 1 
ATOM   3472 C CZ  . TYR B 1 146 ? 40.252 56.477 86.473  1.00 30.48  ? 146 TYR B CZ  1 
ATOM   3473 O OH  . TYR B 1 146 ? 40.151 57.330 87.536  1.00 30.48  ? 146 TYR B OH  1 
ATOM   3474 N N   . SER B 1 147 ? 40.635 53.117 80.008  1.00 35.64  ? 147 SER B N   1 
ATOM   3475 C CA  . SER B 1 147 ? 40.938 52.135 78.990  1.00 35.64  ? 147 SER B CA  1 
ATOM   3476 C C   . SER B 1 147 ? 41.828 52.738 77.915  1.00 35.64  ? 147 SER B C   1 
ATOM   3477 O O   . SER B 1 147 ? 42.930 52.256 77.651  1.00 35.64  ? 147 SER B O   1 
ATOM   3478 C CB  . SER B 1 147 ? 39.640 51.625 78.378  1.00 47.74  ? 147 SER B CB  1 
ATOM   3479 O OG  . SER B 1 147 ? 39.859 50.415 77.678  1.00 47.74  ? 147 SER B OG  1 
ATOM   3480 N N   . ARG B 1 148 ? 41.342 53.802 77.293  1.00 49.06  ? 148 ARG B N   1 
ATOM   3481 C CA  . ARG B 1 148 ? 42.079 54.490 76.236  1.00 49.06  ? 148 ARG B CA  1 
ATOM   3482 C C   . ARG B 1 148 ? 43.491 54.825 76.720  1.00 49.06  ? 148 ARG B C   1 
ATOM   3483 O O   . ARG B 1 148 ? 44.417 54.937 75.925  1.00 49.06  ? 148 ARG B O   1 
ATOM   3484 C CB  . ARG B 1 148 ? 41.338 55.778 75.861  1.00 58.59  ? 148 ARG B CB  1 
ATOM   3485 C CG  . ARG B 1 148 ? 40.945 55.933 74.398  1.00 58.59  ? 148 ARG B CG  1 
ATOM   3486 C CD  . ARG B 1 148 ? 41.941 56.839 73.676  0.00 58.59  ? 148 ARG B CD  1 
ATOM   3487 N NE  . ARG B 1 148 ? 41.391 57.434 72.460  1.00 58.59  ? 148 ARG B NE  1 
ATOM   3488 C CZ  . ARG B 1 148 ? 41.945 58.464 71.819  1.00 58.59  ? 148 ARG B CZ  1 
ATOM   3489 N NH1 . ARG B 1 148 ? 43.071 59.023 72.271  1.00 58.59  ? 148 ARG B NH1 1 
ATOM   3490 N NH2 . ARG B 1 148 ? 41.365 58.949 70.726  1.00 58.59  ? 148 ARG B NH2 1 
ATOM   3491 N N   . ALA B 1 149 ? 43.652 54.987 78.028  1.00 28.91  ? 149 ALA B N   1 
ATOM   3492 C CA  . ALA B 1 149 ? 44.958 55.312 78.600  1.00 28.91  ? 149 ALA B CA  1 
ATOM   3493 C C   . ALA B 1 149 ? 45.665 54.067 79.175  1.00 28.91  ? 149 ALA B C   1 
ATOM   3494 O O   . ALA B 1 149 ? 46.592 54.170 79.980  1.00 28.91  ? 149 ALA B O   1 
ATOM   3495 C CB  . ALA B 1 149 ? 44.790 56.369 79.681  1.00 22.19  ? 149 ALA B CB  1 
ATOM   3496 N N   . LYS B 1 150 ? 45.219 52.894 78.741  1.00 44.90  ? 150 LYS B N   1 
ATOM   3497 C CA  . LYS B 1 150 ? 45.775 51.631 79.210  1.00 44.90  ? 150 LYS B CA  1 
ATOM   3498 C C   . LYS B 1 150 ? 46.014 51.669 80.714  1.00 44.90  ? 150 LYS B C   1 
ATOM   3499 O O   . LYS B 1 150 ? 47.122 51.437 81.185  1.00 44.90  ? 150 LYS B O   1 
ATOM   3500 C CB  . LYS B 1 150 ? 47.071 51.321 78.478  1.00 50.99  ? 150 LYS B CB  1 
ATOM   3501 N N   . GLN B 1 151 ? 44.968 51.992 81.460  1.00 40.59  ? 151 GLN B N   1 
ATOM   3502 C CA  . GLN B 1 151 ? 45.037 52.041 82.912  1.00 40.59  ? 151 GLN B CA  1 
ATOM   3503 C C   . GLN B 1 151 ? 43.744 51.424 83.443  1.00 40.59  ? 151 GLN B C   1 
ATOM   3504 O O   . GLN B 1 151 ? 42.708 51.427 82.763  1.00 40.59  ? 151 GLN B O   1 
ATOM   3505 C CB  . GLN B 1 151 ? 45.188 53.483 83.414  1.00 25.05  ? 151 GLN B CB  1 
ATOM   3506 C CG  . GLN B 1 151 ? 46.526 54.112 83.094  0.00 25.05  ? 151 GLN B CG  1 
ATOM   3507 C CD  . GLN B 1 151 ? 46.679 55.475 83.728  1.00 25.05  ? 151 GLN B CD  1 
ATOM   3508 O OE1 . GLN B 1 151 ? 46.615 55.616 84.948  0.00 25.05  ? 151 GLN B OE1 1 
ATOM   3509 N NE2 . GLN B 1 151 ? 46.884 56.493 82.899  0.00 25.05  ? 151 GLN B NE2 1 
ATOM   3510 N N   . THR B 1 152 ? 43.808 50.890 84.658  1.00 54.76  ? 152 THR B N   1 
ATOM   3511 C CA  . THR B 1 152 ? 42.652 50.246 85.267  1.00 54.76  ? 152 THR B CA  1 
ATOM   3512 C C   . THR B 1 152 ? 41.882 51.155 86.220  1.00 54.76  ? 152 THR B C   1 
ATOM   3513 O O   . THR B 1 152 ? 42.475 51.883 87.009  1.00 54.76  ? 152 THR B O   1 
ATOM   3514 C CB  . THR B 1 152 ? 43.085 48.981 86.053  1.00 65.66  ? 152 THR B CB  1 
ATOM   3515 O OG1 . THR B 1 152 ? 42.402 48.953 87.317  1.00 65.66  ? 152 THR B OG1 1 
ATOM   3516 C CG2 . THR B 1 152 ? 44.620 48.972 86.279  1.00 65.66  ? 152 THR B CG2 1 
ATOM   3517 N N   . LEU B 1 153 ? 40.561 51.119 86.147  1.00 34.37  ? 153 LEU B N   1 
ATOM   3518 C CA  . LEU B 1 153 ? 39.768 51.922 87.058  1.00 34.37  ? 153 LEU B CA  1 
ATOM   3519 C C   . LEU B 1 153 ? 39.990 51.351 88.471  1.00 34.37  ? 153 LEU B C   1 
ATOM   3520 O O   . LEU B 1 153 ? 39.784 50.162 88.704  1.00 34.37  ? 153 LEU B O   1 
ATOM   3521 C CB  . LEU B 1 153 ? 38.290 51.831 86.684  1.00 26.23  ? 153 LEU B CB  1 
ATOM   3522 C CG  . LEU B 1 153 ? 37.313 52.522 87.646  1.00 26.23  ? 153 LEU B CG  1 
ATOM   3523 C CD1 . LEU B 1 153 ? 37.367 54.022 87.459  1.00 26.23  ? 153 LEU B CD1 1 
ATOM   3524 C CD2 . LEU B 1 153 ? 35.903 52.005 87.397  1.00 26.23  ? 153 LEU B CD2 1 
ATOM   3525 N N   . PRO B 1 154 ? 40.422 52.188 89.427  1.00 27.76  ? 154 PRO B N   1 
ATOM   3526 C CA  . PRO B 1 154 ? 40.655 51.719 90.801  1.00 27.76  ? 154 PRO B CA  1 
ATOM   3527 C C   . PRO B 1 154 ? 39.451 50.948 91.340  1.00 27.76  ? 154 PRO B C   1 
ATOM   3528 O O   . PRO B 1 154 ? 38.328 51.424 91.253  1.00 27.76  ? 154 PRO B O   1 
ATOM   3529 C CB  . PRO B 1 154 ? 40.904 53.012 91.561  1.00 28.15  ? 154 PRO B CB  1 
ATOM   3530 C CG  . PRO B 1 154 ? 41.580 53.865 90.533  1.00 28.15  ? 154 PRO B CG  1 
ATOM   3531 C CD  . PRO B 1 154 ? 40.747 53.618 89.296  1.00 28.15  ? 154 PRO B CD  1 
ATOM   3532 N N   . VAL B 1 155 ? 39.686 49.767 91.908  1.00 29.65  ? 155 VAL B N   1 
ATOM   3533 C CA  . VAL B 1 155 ? 38.592 48.941 92.422  1.00 29.65  ? 155 VAL B CA  1 
ATOM   3534 C C   . VAL B 1 155 ? 37.692 49.635 93.444  1.00 29.65  ? 155 VAL B C   1 
ATOM   3535 O O   . VAL B 1 155 ? 36.622 49.141 93.778  1.00 29.65  ? 155 VAL B O   1 
ATOM   3536 C CB  . VAL B 1 155 ? 39.114 47.597 93.040  1.00 35.58  ? 155 VAL B CB  1 
ATOM   3537 C CG1 . VAL B 1 155 ? 40.230 47.036 92.186  1.00 35.58  ? 155 VAL B CG1 1 
ATOM   3538 C CG2 . VAL B 1 155 ? 39.579 47.794 94.471  1.00 35.58  ? 155 VAL B CG2 1 
ATOM   3539 N N   . ILE B 1 156 ? 38.114 50.781 93.949  1.00 23.25  ? 156 ILE B N   1 
ATOM   3540 C CA  . ILE B 1 156 ? 37.285 51.459 94.924  1.00 23.25  ? 156 ILE B CA  1 
ATOM   3541 C C   . ILE B 1 156 ? 36.057 51.982 94.189  1.00 23.25  ? 156 ILE B C   1 
ATOM   3542 O O   . ILE B 1 156 ? 34.948 51.947 94.718  1.00 23.25  ? 156 ILE B O   1 
ATOM   3543 C CB  . ILE B 1 156 ? 38.069 52.604 95.641  1.00 22.07  ? 156 ILE B CB  1 
ATOM   3544 C CG1 . ILE B 1 156 ? 37.215 53.214 96.749  1.00 22.07  ? 156 ILE B CG1 1 
ATOM   3545 C CG2 . ILE B 1 156 ? 38.496 53.654 94.652  1.00 22.07  ? 156 ILE B CG2 1 
ATOM   3546 C CD1 . ILE B 1 156 ? 37.044 52.330 97.950  1.00 22.07  ? 156 ILE B CD1 1 
ATOM   3547 N N   . TYR B 1 157 ? 36.258 52.437 92.956  1.00 25.85  ? 157 TYR B N   1 
ATOM   3548 C CA  . TYR B 1 157 ? 35.162 52.954 92.136  1.00 25.85  ? 157 TYR B CA  1 
ATOM   3549 C C   . TYR B 1 157 ? 34.320 51.817 91.593  1.00 25.85  ? 157 TYR B C   1 
ATOM   3550 O O   . TYR B 1 157 ? 33.103 51.932 91.472  1.00 25.85  ? 157 TYR B O   1 
ATOM   3551 C CB  . TYR B 1 157 ? 35.701 53.774 90.972  1.00 35.67  ? 157 TYR B CB  1 
ATOM   3552 C CG  . TYR B 1 157 ? 36.420 55.017 91.416  1.00 35.67  ? 157 TYR B CG  1 
ATOM   3553 C CD1 . TYR B 1 157 ? 35.786 55.960 92.227  1.00 35.67  ? 157 TYR B CD1 1 
ATOM   3554 C CD2 . TYR B 1 157 ? 37.737 55.259 91.027  1.00 35.67  ? 157 TYR B CD2 1 
ATOM   3555 C CE1 . TYR B 1 157 ? 36.450 57.114 92.638  1.00 35.67  ? 157 TYR B CE1 1 
ATOM   3556 C CE2 . TYR B 1 157 ? 38.409 56.410 91.429  1.00 35.67  ? 157 TYR B CE2 1 
ATOM   3557 C CZ  . TYR B 1 157 ? 37.763 57.331 92.232  1.00 35.67  ? 157 TYR B CZ  1 
ATOM   3558 O OH  . TYR B 1 157 ? 38.430 58.468 92.617  1.00 35.67  ? 157 TYR B OH  1 
ATOM   3559 N N   . VAL B 1 158 ? 34.990 50.726 91.250  1.00 27.71  ? 158 VAL B N   1 
ATOM   3560 C CA  . VAL B 1 158 ? 34.309 49.552 90.747  1.00 27.71  ? 158 VAL B CA  1 
ATOM   3561 C C   . VAL B 1 158 ? 33.366 49.086 91.853  1.00 27.71  ? 158 VAL B C   1 
ATOM   3562 O O   . VAL B 1 158 ? 32.209 48.772 91.587  1.00 27.71  ? 158 VAL B O   1 
ATOM   3563 C CB  . VAL B 1 158 ? 35.313 48.443 90.399  1.00 22.20  ? 158 VAL B CB  1 
ATOM   3564 C CG1 . VAL B 1 158 ? 34.598 47.253 89.789  1.00 22.20  ? 158 VAL B CG1 1 
ATOM   3565 C CG2 . VAL B 1 158 ? 36.349 48.982 89.455  1.00 22.20  ? 158 VAL B CG2 1 
ATOM   3566 N N   . LYS B 1 159 ? 33.857 49.061 93.091  1.00 26.79  ? 159 LYS B N   1 
ATOM   3567 C CA  . LYS B 1 159 ? 33.034 48.666 94.235  1.00 26.79  ? 159 LYS B CA  1 
ATOM   3568 C C   . LYS B 1 159 ? 31.851 49.633 94.412  1.00 26.79  ? 159 LYS B C   1 
ATOM   3569 O O   . LYS B 1 159 ? 30.701 49.221 94.549  1.00 26.79  ? 159 LYS B O   1 
ATOM   3570 C CB  . LYS B 1 159 ? 33.855 48.693 95.525  1.00 27.27  ? 159 LYS B CB  1 
ATOM   3571 C CG  . LYS B 1 159 ? 34.990 47.699 95.606  1.00 27.27  ? 159 LYS B CG  1 
ATOM   3572 C CD  . LYS B 1 159 ? 35.776 47.902 96.893  1.00 27.27  ? 159 LYS B CD  1 
ATOM   3573 C CE  . LYS B 1 159 ? 36.910 46.911 97.023  1.00 27.27  ? 159 LYS B CE  1 
ATOM   3574 N NZ  . LYS B 1 159 ? 36.435 45.519 96.912  1.00 27.27  ? 159 LYS B NZ  1 
ATOM   3575 N N   . LEU B 1 160 ? 32.162 50.925 94.413  1.00 30.06  ? 160 LEU B N   1 
ATOM   3576 C CA  . LEU B 1 160 ? 31.175 51.978 94.590  1.00 30.06  ? 160 LEU B CA  1 
ATOM   3577 C C   . LEU B 1 160 ? 30.112 52.009 93.508  1.00 30.06  ? 160 LEU B C   1 
ATOM   3578 O O   . LEU B 1 160 ? 28.921 52.104 93.796  1.00 30.06  ? 160 LEU B O   1 
ATOM   3579 C CB  . LEU B 1 160 ? 31.876 53.335 94.638  1.00 32.79  ? 160 LEU B CB  1 
ATOM   3580 C CG  . LEU B 1 160 ? 31.337 54.303 95.684  1.00 32.79  ? 160 LEU B CG  1 
ATOM   3581 C CD1 . LEU B 1 160 ? 31.496 53.698 97.063  1.00 32.79  ? 160 LEU B CD1 1 
ATOM   3582 C CD2 . LEU B 1 160 ? 32.084 55.618 95.599  0.00 32.79  ? 160 LEU B CD2 1 
ATOM   3583 N N   . TYR B 1 161 ? 30.542 51.941 92.256  1.00 21.41  ? 161 TYR B N   1 
ATOM   3584 C CA  . TYR B 1 161 ? 29.609 51.969 91.145  1.00 21.41  ? 161 TYR B CA  1 
ATOM   3585 C C   . TYR B 1 161 ? 28.720 50.726 91.082  1.00 21.41  ? 161 TYR B C   1 
ATOM   3586 O O   . TYR B 1 161 ? 27.514 50.830 90.887  1.00 21.41  ? 161 TYR B O   1 
ATOM   3587 C CB  . TYR B 1 161 ? 30.379 52.131 89.841  1.00 29.26  ? 161 TYR B CB  1 
ATOM   3588 C CG  . TYR B 1 161 ? 31.181 53.410 89.748  1.00 29.26  ? 161 TYR B CG  1 
ATOM   3589 C CD1 . TYR B 1 161 ? 31.170 54.344 90.784  1.00 29.26  ? 161 TYR B CD1 1 
ATOM   3590 C CD2 . TYR B 1 161 ? 31.893 53.719 88.589  1.00 29.26  ? 161 TYR B CD2 1 
ATOM   3591 C CE1 . TYR B 1 161 ? 31.840 55.559 90.667  1.00 29.26  ? 161 TYR B CE1 1 
ATOM   3592 C CE2 . TYR B 1 161 ? 32.566 54.927 88.455  1.00 29.26  ? 161 TYR B CE2 1 
ATOM   3593 C CZ  . TYR B 1 161 ? 32.531 55.847 89.493  1.00 29.26  ? 161 TYR B CZ  1 
ATOM   3594 O OH  . TYR B 1 161 ? 33.136 57.073 89.336  1.00 29.26  ? 161 TYR B OH  1 
ATOM   3595 N N   . MET B 1 162 ? 29.310 49.548 91.256  1.00 24.74  ? 162 MET B N   1 
ATOM   3596 C CA  . MET B 1 162 ? 28.533 48.313 91.206  1.00 24.74  ? 162 MET B CA  1 
ATOM   3597 C C   . MET B 1 162 ? 27.537 48.190 92.347  1.00 24.74  ? 162 MET B C   1 
ATOM   3598 O O   . MET B 1 162 ? 26.437 47.667 92.180  1.00 24.74  ? 162 MET B O   1 
ATOM   3599 C CB  . MET B 1 162 ? 29.455 47.093 91.204  1.00 22.38  ? 162 MET B CB  1 
ATOM   3600 C CG  . MET B 1 162 ? 30.317 46.965 89.954  1.00 22.38  ? 162 MET B CG  1 
ATOM   3601 S SD  . MET B 1 162 ? 29.387 47.058 88.413  1.00 22.38  ? 162 MET B SD  1 
ATOM   3602 C CE  . MET B 1 162 ? 28.237 45.713 88.638  1.00 22.38  ? 162 MET B CE  1 
ATOM   3603 N N   . TYR B 1 163 ? 27.929 48.676 93.512  1.00 26.83  ? 163 TYR B N   1 
ATOM   3604 C CA  . TYR B 1 163 ? 27.071 48.622 94.686  1.00 26.83  ? 163 TYR B CA  1 
ATOM   3605 C C   . TYR B 1 163 ? 25.801 49.444 94.468  1.00 26.83  ? 163 TYR B C   1 
ATOM   3606 O O   . TYR B 1 163 ? 24.705 48.988 94.775  1.00 26.83  ? 163 TYR B O   1 
ATOM   3607 C CB  . TYR B 1 163 ? 27.835 49.144 95.911  1.00 21.69  ? 163 TYR B CB  1 
ATOM   3608 C CG  . TYR B 1 163 ? 27.015 49.204 97.176  1.00 21.69  ? 163 TYR B CG  1 
ATOM   3609 C CD1 . TYR B 1 163 ? 26.822 48.065 97.961  1.00 21.69  ? 163 TYR B CD1 1 
ATOM   3610 C CD2 . TYR B 1 163 ? 26.420 50.398 97.581  1.00 21.69  ? 163 TYR B CD2 1 
ATOM   3611 C CE1 . TYR B 1 163 ? 26.062 48.120 99.109  1.00 21.69  ? 163 TYR B CE1 1 
ATOM   3612 C CE2 . TYR B 1 163 ? 25.654 50.459 98.726  1.00 21.69  ? 163 TYR B CE2 1 
ATOM   3613 C CZ  . TYR B 1 163 ? 25.481 49.318 99.486  1.00 21.69  ? 163 TYR B CZ  1 
ATOM   3614 O OH  . TYR B 1 163 ? 24.731 49.374 100.633 1.00 21.69  ? 163 TYR B OH  1 
ATOM   3615 N N   . GLN B 1 164 ? 25.968 50.655 93.937  1.00 28.12  ? 164 GLN B N   1 
ATOM   3616 C CA  . GLN B 1 164 ? 24.852 51.557 93.677  1.00 28.12  ? 164 GLN B CA  1 
ATOM   3617 C C   . GLN B 1 164 ? 23.958 51.051 92.534  1.00 28.12  ? 164 GLN B C   1 
ATOM   3618 O O   . GLN B 1 164 ? 22.751 51.302 92.510  1.00 28.12  ? 164 GLN B O   1 
ATOM   3619 C CB  . GLN B 1 164 ? 25.392 52.964 93.386  1.00 24.38  ? 164 GLN B CB  1 
ATOM   3620 C CG  . GLN B 1 164 ? 26.209 53.544 94.547  1.00 24.38  ? 164 GLN B CG  1 
ATOM   3621 C CD  . GLN B 1 164 ? 26.797 54.908 94.247  1.00 24.38  ? 164 GLN B CD  1 
ATOM   3622 O OE1 . GLN B 1 164 ? 26.083 55.907 94.165  1.00 24.38  ? 164 GLN B OE1 1 
ATOM   3623 N NE2 . GLN B 1 164 ? 28.109 54.956 94.073  1.00 24.38  ? 164 GLN B NE2 1 
ATOM   3624 N N   . LEU B 1 165 ? 24.549 50.328 91.588  1.00 34.87  ? 165 LEU B N   1 
ATOM   3625 C CA  . LEU B 1 165 ? 23.778 49.779 90.489  1.00 34.87  ? 165 LEU B CA  1 
ATOM   3626 C C   . LEU B 1 165 ? 22.925 48.679 91.085  1.00 34.87  ? 165 LEU B C   1 
ATOM   3627 O O   . LEU B 1 165 ? 21.728 48.648 90.864  1.00 34.87  ? 165 LEU B O   1 
ATOM   3628 C CB  . LEU B 1 165 ? 24.682 49.171 89.418  1.00 12.92  ? 165 LEU B CB  1 
ATOM   3629 C CG  . LEU B 1 165 ? 24.102 48.943 88.016  1.00 12.92  ? 165 LEU B CG  1 
ATOM   3630 C CD1 . LEU B 1 165 ? 24.787 47.754 87.426  1.00 12.92  ? 165 LEU B CD1 1 
ATOM   3631 C CD2 . LEU B 1 165 ? 22.617 48.721 88.038  1.00 12.92  ? 165 LEU B CD2 1 
ATOM   3632 N N   . PHE B 1 166 ? 23.547 47.776 91.836  1.00 24.28  ? 166 PHE B N   1 
ATOM   3633 C CA  . PHE B 1 166 ? 22.813 46.681 92.452  1.00 24.28  ? 166 PHE B CA  1 
ATOM   3634 C C   . PHE B 1 166 ? 21.706 47.181 93.373  1.00 24.28  ? 166 PHE B C   1 
ATOM   3635 O O   . PHE B 1 166 ? 20.681 46.517 93.539  1.00 24.28  ? 166 PHE B O   1 
ATOM   3636 C CB  . PHE B 1 166 ? 23.759 45.754 93.226  1.00 22.27  ? 166 PHE B CB  1 
ATOM   3637 C CG  . PHE B 1 166 ? 24.545 44.821 92.351  1.00 22.27  ? 166 PHE B CG  1 
ATOM   3638 C CD1 . PHE B 1 166 ? 23.905 44.025 91.399  1.00 22.27  ? 166 PHE B CD1 1 
ATOM   3639 C CD2 . PHE B 1 166 ? 25.921 44.741 92.462  1.00 22.27  ? 166 PHE B CD2 1 
ATOM   3640 C CE1 . PHE B 1 166 ? 24.633 43.170 90.571  1.00 22.27  ? 166 PHE B CE1 1 
ATOM   3641 C CE2 . PHE B 1 166 ? 26.650 43.887 91.639  1.00 22.27  ? 166 PHE B CE2 1 
ATOM   3642 C CZ  . PHE B 1 166 ? 26.006 43.105 90.694  1.00 22.27  ? 166 PHE B CZ  1 
ATOM   3643 N N   . ARG B 1 167 ? 21.914 48.348 93.974  1.00 27.11  ? 167 ARG B N   1 
ATOM   3644 C CA  . ARG B 1 167 ? 20.915 48.935 94.856  1.00 27.11  ? 167 ARG B CA  1 
ATOM   3645 C C   . ARG B 1 167 ? 19.756 49.370 93.991  1.00 27.11  ? 167 ARG B C   1 
ATOM   3646 O O   . ARG B 1 167 ? 18.624 49.001 94.238  1.00 27.11  ? 167 ARG B O   1 
ATOM   3647 C CB  . ARG B 1 167 ? 21.478 50.147 95.600  1.00 28.07  ? 167 ARG B CB  1 
ATOM   3648 C CG  . ARG B 1 167 ? 22.148 49.821 96.922  1.00 28.07  ? 167 ARG B CG  1 
ATOM   3649 C CD  . ARG B 1 167 ? 21.328 50.358 98.067  1.00 28.07  ? 167 ARG B CD  1 
ATOM   3650 N NE  . ARG B 1 167 ? 21.631 51.755 98.350  1.00 28.07  ? 167 ARG B NE  1 
ATOM   3651 C CZ  . ARG B 1 167 ? 20.879 52.543 99.109  1.00 28.07  ? 167 ARG B CZ  1 
ATOM   3652 N NH1 . ARG B 1 167 ? 19.769 52.077 99.657  1.00 28.07  ? 167 ARG B NH1 1 
ATOM   3653 N NH2 . ARG B 1 167 ? 21.251 53.790 99.334  1.00 28.07  ? 167 ARG B NH2 1 
ATOM   3654 N N   . SER B 1 168 ? 20.040 50.148 92.960  1.00 27.02  ? 168 SER B N   1 
ATOM   3655 C CA  . SER B 1 168 ? 18.986 50.605 92.080  1.00 27.02  ? 168 SER B CA  1 
ATOM   3656 C C   . SER B 1 168 ? 18.205 49.411 91.559  1.00 27.02  ? 168 SER B C   1 
ATOM   3657 O O   . SER B 1 168 ? 16.997 49.468 91.410  1.00 27.02  ? 168 SER B O   1 
ATOM   3658 C CB  . SER B 1 168 ? 19.576 51.399 90.911  1.00 22.20  ? 168 SER B CB  1 
ATOM   3659 O OG  . SER B 1 168 ? 20.303 50.565 90.031  1.00 22.20  ? 168 SER B OG  1 
ATOM   3660 N N   . LEU B 1 169 ? 18.905 48.322 91.297  1.00 21.22  ? 169 LEU B N   1 
ATOM   3661 C CA  . LEU B 1 169 ? 18.277 47.118 90.778  1.00 21.22  ? 169 LEU B CA  1 
ATOM   3662 C C   . LEU B 1 169 ? 17.384 46.401 91.782  1.00 21.22  ? 169 LEU B C   1 
ATOM   3663 O O   . LEU B 1 169 ? 16.311 45.929 91.428  1.00 21.22  ? 169 LEU B O   1 
ATOM   3664 C CB  . LEU B 1 169 ? 19.351 46.173 90.235  1.00 15.10  ? 169 LEU B CB  1 
ATOM   3665 C CG  . LEU B 1 169 ? 19.509 46.105 88.707  1.00 15.10  ? 169 LEU B CG  1 
ATOM   3666 C CD1 . LEU B 1 169 ? 19.167 47.413 88.024  1.00 15.10  ? 169 LEU B CD1 1 
ATOM   3667 C CD2 . LEU B 1 169 ? 20.918 45.683 88.413  1.00 15.10  ? 169 LEU B CD2 1 
ATOM   3668 N N   . ALA B 1 170 ? 17.826 46.323 93.033  1.00 28.26  ? 170 ALA B N   1 
ATOM   3669 C CA  . ALA B 1 170 ? 17.038 45.688 94.091  1.00 28.26  ? 170 ALA B CA  1 
ATOM   3670 C C   . ALA B 1 170 ? 15.771 46.520 94.246  1.00 28.26  ? 170 ALA B C   1 
ATOM   3671 O O   . ALA B 1 170 ? 14.670 46.003 94.456  1.00 28.26  ? 170 ALA B O   1 
ATOM   3672 C CB  . ALA B 1 170 ? 17.824 45.672 95.398  1.00 16.51  ? 170 ALA B CB  1 
ATOM   3673 N N   . TYR B 1 171 ? 15.945 47.824 94.116  1.00 22.86  ? 171 TYR B N   1 
ATOM   3674 C CA  . TYR B 1 171 ? 14.842 48.743 94.210  1.00 22.86  ? 171 TYR B CA  1 
ATOM   3675 C C   . TYR B 1 171 ? 13.790 48.449 93.154  1.00 22.86  ? 171 TYR B C   1 
ATOM   3676 O O   . TYR B 1 171 ? 12.745 47.903 93.461  1.00 22.86  ? 171 TYR B O   1 
ATOM   3677 C CB  . TYR B 1 171 ? 15.321 50.173 94.042  1.00 18.75  ? 171 TYR B CB  1 
ATOM   3678 C CG  . TYR B 1 171 ? 14.200 51.148 94.194  1.00 18.75  ? 171 TYR B CG  1 
ATOM   3679 C CD1 . TYR B 1 171 ? 13.580 51.319 95.421  1.00 18.75  ? 171 TYR B CD1 1 
ATOM   3680 C CD2 . TYR B 1 171 ? 13.718 51.871 93.105  1.00 18.75  ? 171 TYR B CD2 1 
ATOM   3681 C CE1 . TYR B 1 171 ? 12.516 52.178 95.569  1.00 18.75  ? 171 TYR B CE1 1 
ATOM   3682 C CE2 . TYR B 1 171 ? 12.646 52.739 93.243  1.00 18.75  ? 171 TYR B CE2 1 
ATOM   3683 C CZ  . TYR B 1 171 ? 12.052 52.882 94.486  1.00 18.75  ? 171 TYR B CZ  1 
ATOM   3684 O OH  . TYR B 1 171 ? 10.995 53.731 94.658  1.00 18.75  ? 171 TYR B OH  1 
ATOM   3685 N N   . ILE B 1 172 ? 14.061 48.793 91.904  1.00 28.69  ? 172 ILE B N   1 
ATOM   3686 C CA  . ILE B 1 172 ? 13.075 48.566 90.861  1.00 28.69  ? 172 ILE B CA  1 
ATOM   3687 C C   . ILE B 1 172 ? 12.568 47.126 90.801  1.00 28.69  ? 172 ILE B C   1 
ATOM   3688 O O   . ILE B 1 172 ? 11.412 46.894 90.485  1.00 28.69  ? 172 ILE B O   1 
ATOM   3689 C CB  . ILE B 1 172 ? 13.595 48.997 89.456  1.00 14.84  ? 172 ILE B CB  1 
ATOM   3690 C CG1 . ILE B 1 172 ? 14.803 48.148 89.045  1.00 14.84  ? 172 ILE B CG1 1 
ATOM   3691 C CG2 . ILE B 1 172 ? 13.919 50.485 89.461  1.00 14.84  ? 172 ILE B CG2 1 
ATOM   3692 C CD1 . ILE B 1 172 ? 15.027 48.099 87.559  1.00 14.84  ? 172 ILE B CD1 1 
ATOM   3693 N N   . HIS B 1 173 ? 13.403 46.149 91.112  1.00 27.82  ? 173 HIS B N   1 
ATOM   3694 C CA  . HIS B 1 173 ? 12.903 44.789 91.065  1.00 27.82  ? 173 HIS B CA  1 
ATOM   3695 C C   . HIS B 1 173 ? 11.809 44.525 92.105  1.00 27.82  ? 173 HIS B C   1 
ATOM   3696 O O   . HIS B 1 173 ? 10.848 43.793 91.836  1.00 27.82  ? 173 HIS B O   1 
ATOM   3697 C CB  . HIS B 1 173 ? 14.037 43.783 91.217  1.00 17.84  ? 173 HIS B CB  1 
ATOM   3698 C CG  . HIS B 1 173 ? 14.879 43.653 89.990  1.00 17.84  ? 173 HIS B CG  1 
ATOM   3699 N ND1 . HIS B 1 173 ? 15.771 42.623 89.804  1.00 17.84  ? 173 HIS B ND1 1 
ATOM   3700 C CD2 . HIS B 1 173 ? 15.003 44.457 88.908  1.00 17.84  ? 173 HIS B CD2 1 
ATOM   3701 C CE1 . HIS B 1 173 ? 16.413 42.800 88.665  1.00 17.84  ? 173 HIS B CE1 1 
ATOM   3702 N NE2 . HIS B 1 173 ? 15.966 43.907 88.102  1.00 17.84  ? 173 HIS B NE2 1 
ATOM   3703 N N   . SER B 1 174 ? 11.939 45.129 93.281  1.00 29.40  ? 174 SER B N   1 
ATOM   3704 C CA  . SER B 1 174 ? 10.944 44.930 94.315  1.00 29.40  ? 174 SER B CA  1 
ATOM   3705 C C   . SER B 1 174 ? 9.554  45.291 93.799  1.00 29.40  ? 174 SER B C   1 
ATOM   3706 O O   . SER B 1 174 ? 8.560  44.851 94.361  1.00 29.40  ? 174 SER B O   1 
ATOM   3707 C CB  . SER B 1 174 ? 11.281 45.760 95.549  1.00 29.34  ? 174 SER B CB  1 
ATOM   3708 O OG  . SER B 1 174 ? 10.922 47.113 95.369  1.00 29.34  ? 174 SER B OG  1 
ATOM   3709 N N   . PHE B 1 175 ? 9.472  46.077 92.731  1.00 30.15  ? 175 PHE B N   1 
ATOM   3710 C CA  . PHE B 1 175 ? 8.168  46.439 92.176  1.00 30.15  ? 175 PHE B CA  1 
ATOM   3711 C C   . PHE B 1 175 ? 7.823  45.578 90.974  1.00 30.15  ? 175 PHE B C   1 
ATOM   3712 O O   . PHE B 1 175 ? 6.802  45.804 90.317  1.00 30.15  ? 175 PHE B O   1 
ATOM   3713 C CB  . PHE B 1 175 ? 8.134  47.895 91.724  1.00 53.96  ? 175 PHE B CB  1 
ATOM   3714 C CG  . PHE B 1 175 ? 8.375  48.866 92.816  1.00 53.96  ? 175 PHE B CG  1 
ATOM   3715 C CD1 . PHE B 1 175 ? 9.662  49.116 93.260  1.00 53.96  ? 175 PHE B CD1 1 
ATOM   3716 C CD2 . PHE B 1 175 ? 7.306  49.502 93.440  1.00 53.96  ? 175 PHE B CD2 1 
ATOM   3717 C CE1 . PHE B 1 175 ? 9.888  49.990 94.320  1.00 53.96  ? 175 PHE B CE1 1 
ATOM   3718 C CE2 . PHE B 1 175 ? 7.510  50.376 94.500  1.00 53.96  ? 175 PHE B CE2 1 
ATOM   3719 C CZ  . PHE B 1 175 ? 8.807  50.622 94.945  1.00 53.96  ? 175 PHE B CZ  1 
ATOM   3720 N N   . GLY B 1 176 ? 8.684  44.608 90.675  1.00 31.38  ? 176 GLY B N   1 
ATOM   3721 C CA  . GLY B 1 176 ? 8.449  43.746 89.534  1.00 31.38  ? 176 GLY B CA  1 
ATOM   3722 C C   . GLY B 1 176 ? 8.853  44.396 88.222  1.00 31.38  ? 176 GLY B C   1 
ATOM   3723 O O   . GLY B 1 176 ? 8.416  43.972 87.155  1.00 31.38  ? 176 GLY B O   1 
ATOM   3724 N N   . ILE B 1 177 ? 9.688  45.426 88.303  1.00 38.54  ? 177 ILE B N   1 
ATOM   3725 C CA  . ILE B 1 177 ? 10.161 46.138 87.123  1.00 38.54  ? 177 ILE B CA  1 
ATOM   3726 C C   . ILE B 1 177 ? 11.560 45.683 86.686  1.00 38.54  ? 177 ILE B C   1 
ATOM   3727 O O   . ILE B 1 177 ? 12.450 45.482 87.512  1.00 38.54  ? 177 ILE B O   1 
ATOM   3728 C CB  . ILE B 1 177 ? 10.212 47.655 87.381  1.00 27.99  ? 177 ILE B CB  1 
ATOM   3729 C CG1 . ILE B 1 177 ? 8.805  48.179 87.678  1.00 27.99  ? 177 ILE B CG1 1 
ATOM   3730 C CG2 . ILE B 1 177 ? 10.819 48.365 86.185  1.00 27.99  ? 177 ILE B CG2 1 
ATOM   3731 C CD1 . ILE B 1 177 ? 8.761  49.658 88.047  1.00 27.99  ? 177 ILE B CD1 1 
ATOM   3732 N N   . CYS B 1 178 ? 11.750 45.514 85.385  1.00 26.93  ? 178 CYS B N   1 
ATOM   3733 C CA  . CYS B 1 178 ? 13.045 45.115 84.870  1.00 26.93  ? 178 CYS B CA  1 
ATOM   3734 C C   . CYS B 1 178 ? 13.464 46.220 83.916  1.00 26.93  ? 178 CYS B C   1 
ATOM   3735 O O   . CYS B 1 178 ? 12.712 46.583 83.023  1.00 26.93  ? 178 CYS B O   1 
ATOM   3736 C CB  . CYS B 1 178 ? 12.936 43.779 84.132  1.00 26.16  ? 178 CYS B CB  1 
ATOM   3737 S SG  . CYS B 1 178 ? 14.492 43.108 83.516  1.00 26.16  ? 178 CYS B SG  1 
ATOM   3738 N N   . HIS B 1 179 ? 14.658 46.763 84.119  1.00 20.61  ? 179 HIS B N   1 
ATOM   3739 C CA  . HIS B 1 179 ? 15.167 47.835 83.275  1.00 20.61  ? 179 HIS B CA  1 
ATOM   3740 C C   . HIS B 1 179 ? 15.328 47.360 81.828  1.00 20.61  ? 179 HIS B C   1 
ATOM   3741 O O   . HIS B 1 179 ? 14.998 48.076 80.895  1.00 20.61  ? 179 HIS B O   1 
ATOM   3742 C CB  . HIS B 1 179 ? 16.505 48.334 83.845  1.00 18.60  ? 179 HIS B CB  1 
ATOM   3743 C CG  . HIS B 1 179 ? 17.093 49.493 83.104  1.00 18.60  ? 179 HIS B CG  1 
ATOM   3744 N ND1 . HIS B 1 179 ? 17.723 49.358 81.886  1.00 18.60  ? 179 HIS B ND1 1 
ATOM   3745 C CD2 . HIS B 1 179 ? 17.136 50.812 83.407  1.00 18.60  ? 179 HIS B CD2 1 
ATOM   3746 C CE1 . HIS B 1 179 ? 18.128 50.544 81.471  1.00 18.60  ? 179 HIS B CE1 1 
ATOM   3747 N NE2 . HIS B 1 179 ? 17.784 51.443 82.376  1.00 18.60  ? 179 HIS B NE2 1 
ATOM   3748 N N   . ARG B 1 180 ? 15.835 46.140 81.676  1.00 26.80  ? 180 ARG B N   1 
ATOM   3749 C CA  . ARG B 1 180 ? 16.063 45.500 80.378  1.00 26.80  ? 180 ARG B CA  1 
ATOM   3750 C C   . ARG B 1 180 ? 17.120 46.105 79.447  1.00 26.80  ? 180 ARG B C   1 
ATOM   3751 O O   . ARG B 1 180 ? 17.208 45.710 78.288  1.00 26.80  ? 180 ARG B O   1 
ATOM   3752 C CB  . ARG B 1 180 ? 14.759 45.413 79.602  1.00 22.91  ? 180 ARG B CB  1 
ATOM   3753 C CG  . ARG B 1 180 ? 13.746 44.443 80.141  1.00 22.91  ? 180 ARG B CG  1 
ATOM   3754 C CD  . ARG B 1 180 ? 12.416 44.906 79.668  1.00 22.91  ? 180 ARG B CD  1 
ATOM   3755 N NE  . ARG B 1 180 ? 11.722 43.922 78.868  1.00 22.91  ? 180 ARG B NE  1 
ATOM   3756 C CZ  . ARG B 1 180 ? 10.768 44.224 77.999  1.00 22.91  ? 180 ARG B CZ  1 
ATOM   3757 N NH1 . ARG B 1 180 ? 10.403 45.485 77.808  1.00 22.91  ? 180 ARG B NH1 1 
ATOM   3758 N NH2 . ARG B 1 180 ? 10.159 43.255 77.339  1.00 22.91  ? 180 ARG B NH2 1 
ATOM   3759 N N   . ASP B 1 181 ? 17.911 47.055 79.934  1.00 22.02  ? 181 ASP B N   1 
ATOM   3760 C CA  . ASP B 1 181 ? 18.939 47.666 79.103  1.00 22.02  ? 181 ASP B CA  1 
ATOM   3761 C C   . ASP B 1 181 ? 20.011 48.256 80.021  1.00 22.02  ? 181 ASP B C   1 
ATOM   3762 O O   . ASP B 1 181 ? 20.261 49.455 80.038  1.00 22.02  ? 181 ASP B O   1 
ATOM   3763 C CB  . ASP B 1 181 ? 18.316 48.732 78.194  1.00 28.37  ? 181 ASP B CB  1 
ATOM   3764 C CG  . ASP B 1 181 ? 19.271 49.206 77.106  1.00 28.37  ? 181 ASP B CG  1 
ATOM   3765 O OD1 . ASP B 1 181 ? 19.981 48.352 76.522  1.00 28.37  ? 181 ASP B OD1 1 
ATOM   3766 O OD2 . ASP B 1 181 ? 19.300 50.427 76.835  1.00 28.37  ? 181 ASP B OD2 1 
ATOM   3767 N N   . ILE B 1 182 ? 20.662 47.324 80.738  1.00 24.27  ? 182 ILE B N   1 
ATOM   3768 C CA  . ILE B 1 182 ? 21.658 47.779 81.688  1.00 24.27  ? 182 ILE B CA  1 
ATOM   3769 C C   . ILE B 1 182 ? 22.981 47.701 80.939  1.00 24.27  ? 182 ILE B C   1 
ATOM   3770 O O   . ILE B 1 182 ? 23.420 46.628 80.542  1.00 24.27  ? 182 ILE B O   1 
ATOM   3771 C CB  . ILE B 1 182 ? 21.766 46.828 82.914  1.00 11.90  ? 182 ILE B CB  1 
ATOM   3772 C CG1 . ILE B 1 182 ? 20.465 46.898 83.727  1.00 11.90  ? 182 ILE B CG1 1 
ATOM   3773 C CG2 . ILE B 1 182 ? 22.995 47.152 83.750  1.00 11.90  ? 182 ILE B CG2 1 
ATOM   3774 C CD1 . ILE B 1 182 ? 20.183 48.232 84.344  1.00 11.90  ? 182 ILE B CD1 1 
ATOM   3775 N N   . LYS B 1 183 ? 23.582 48.858 80.720  1.00 25.61  ? 183 LYS B N   1 
ATOM   3776 C CA  . LYS B 1 183 ? 24.840 48.953 80.017  1.00 25.61  ? 183 LYS B CA  1 
ATOM   3777 C C   . LYS B 1 183 ? 25.529 50.185 80.599  1.00 25.61  ? 183 LYS B C   1 
ATOM   3778 O O   . LYS B 1 183 ? 24.864 51.071 81.133  1.00 25.61  ? 183 LYS B O   1 
ATOM   3779 C CB  . LYS B 1 183 ? 24.587 49.097 78.521  1.00 26.84  ? 183 LYS B CB  1 
ATOM   3780 C CG  . LYS B 1 183 ? 23.655 50.227 78.160  1.00 26.84  ? 183 LYS B CG  1 
ATOM   3781 C CD  . LYS B 1 183 ? 23.386 50.212 76.676  1.00 26.84  ? 183 LYS B CD  1 
ATOM   3782 C CE  . LYS B 1 183 ? 22.511 51.361 76.259  1.00 26.84  ? 183 LYS B CE  1 
ATOM   3783 N NZ  . LYS B 1 183 ? 22.311 51.388 74.793  1.00 26.84  ? 183 LYS B NZ  1 
ATOM   3784 N N   . PRO B 1 184 ? 26.864 50.262 80.493  1.00 24.98  ? 184 PRO B N   1 
ATOM   3785 C CA  . PRO B 1 184 ? 27.637 51.390 81.028  1.00 24.98  ? 184 PRO B CA  1 
ATOM   3786 C C   . PRO B 1 184 ? 27.109 52.772 80.686  1.00 24.98  ? 184 PRO B C   1 
ATOM   3787 O O   . PRO B 1 184 ? 27.178 53.689 81.499  1.00 24.98  ? 184 PRO B O   1 
ATOM   3788 C CB  . PRO B 1 184 ? 29.033 51.144 80.469  1.00 26.91  ? 184 PRO B CB  1 
ATOM   3789 C CG  . PRO B 1 184 ? 29.075 49.638 80.323  1.00 26.91  ? 184 PRO B CG  1 
ATOM   3790 C CD  . PRO B 1 184 ? 27.731 49.346 79.732  1.00 26.91  ? 184 PRO B CD  1 
ATOM   3791 N N   . GLN B 1 185 ? 26.580 52.906 79.478  1.00 25.81  ? 185 GLN B N   1 
ATOM   3792 C CA  . GLN B 1 185 ? 26.048 54.171 78.985  1.00 25.81  ? 185 GLN B CA  1 
ATOM   3793 C C   . GLN B 1 185 ? 24.842 54.664 79.776  1.00 25.81  ? 185 GLN B C   1 
ATOM   3794 O O   . GLN B 1 185 ? 24.535 55.855 79.783  1.00 25.81  ? 185 GLN B O   1 
ATOM   3795 C CB  . GLN B 1 185 ? 25.661 54.035 77.504  1.00 36.37  ? 185 GLN B CB  1 
ATOM   3796 C CG  . GLN B 1 185 ? 26.826 53.687 76.573  1.00 36.37  ? 185 GLN B CG  1 
ATOM   3797 C CD  . GLN B 1 185 ? 27.430 52.332 76.885  1.00 36.37  ? 185 GLN B CD  1 
ATOM   3798 O OE1 . GLN B 1 185 ? 26.987 51.315 76.374  1.00 36.37  ? 185 GLN B OE1 1 
ATOM   3799 N NE2 . GLN B 1 185 ? 28.434 52.316 77.748  0.00 36.37  ? 185 GLN B NE2 1 
ATOM   3800 N N   . ASN B 1 186 ? 24.154 53.739 80.437  1.00 30.97  ? 186 ASN B N   1 
ATOM   3801 C CA  . ASN B 1 186 ? 22.984 54.092 81.223  1.00 30.97  ? 186 ASN B CA  1 
ATOM   3802 C C   . ASN B 1 186 ? 23.307 54.276 82.685  1.00 30.97  ? 186 ASN B C   1 
ATOM   3803 O O   . ASN B 1 186 ? 22.403 54.435 83.500  1.00 30.97  ? 186 ASN B O   1 
ATOM   3804 C CB  . ASN B 1 186 ? 21.888 53.046 81.078  1.00 18.75  ? 186 ASN B CB  1 
ATOM   3805 C CG  . ASN B 1 186 ? 21.236 53.078 79.732  1.00 18.75  ? 186 ASN B CG  1 
ATOM   3806 O OD1 . ASN B 1 186 ? 21.075 54.132 79.138  1.00 18.75  ? 186 ASN B OD1 1 
ATOM   3807 N ND2 . ASN B 1 186 ? 20.838 51.921 79.246  1.00 18.75  ? 186 ASN B ND2 1 
ATOM   3808 N N   . LEU B 1 187 ? 24.589 54.243 83.024  1.00 21.44  ? 187 LEU B N   1 
ATOM   3809 C CA  . LEU B 1 187 ? 24.998 54.463 84.404  1.00 21.44  ? 187 LEU B CA  1 
ATOM   3810 C C   . LEU B 1 187 ? 25.540 55.899 84.601  1.00 21.44  ? 187 LEU B C   1 
ATOM   3811 O O   . LEU B 1 187 ? 26.734 56.163 84.424  1.00 21.44  ? 187 LEU B O   1 
ATOM   3812 C CB  . LEU B 1 187 ? 26.043 53.419 84.797  1.00 26.67  ? 187 LEU B CB  1 
ATOM   3813 C CG  . LEU B 1 187 ? 25.584 52.033 85.281  1.00 26.67  ? 187 LEU B CG  1 
ATOM   3814 C CD1 . LEU B 1 187 ? 24.105 51.819 85.046  1.00 26.67  ? 187 LEU B CD1 1 
ATOM   3815 C CD2 . LEU B 1 187 ? 26.386 50.967 84.581  1.00 26.67  ? 187 LEU B CD2 1 
ATOM   3816 N N   . LEU B 1 188 ? 24.656 56.835 84.943  1.00 23.69  ? 188 LEU B N   1 
ATOM   3817 C CA  . LEU B 1 188 ? 25.087 58.218 85.153  1.00 23.69  ? 188 LEU B CA  1 
ATOM   3818 C C   . LEU B 1 188 ? 25.867 58.343 86.453  1.00 23.69  ? 188 LEU B C   1 
ATOM   3819 O O   . LEU B 1 188 ? 25.525 57.704 87.441  1.00 23.69  ? 188 LEU B O   1 
ATOM   3820 C CB  . LEU B 1 188 ? 23.889 59.159 85.228  1.00 27.99  ? 188 LEU B CB  1 
ATOM   3821 C CG  . LEU B 1 188 ? 22.887 59.177 84.077  1.00 27.99  ? 188 LEU B CG  1 
ATOM   3822 C CD1 . LEU B 1 188 ? 21.903 60.288 84.317  1.00 27.99  ? 188 LEU B CD1 1 
ATOM   3823 C CD2 . LEU B 1 188 ? 23.581 59.387 82.766  1.00 27.99  ? 188 LEU B CD2 1 
ATOM   3824 N N   . LEU B 1 189 ? 26.914 59.163 86.456  1.00 25.95  ? 189 LEU B N   1 
ATOM   3825 C CA  . LEU B 1 189 ? 27.693 59.346 87.670  1.00 25.95  ? 189 LEU B CA  1 
ATOM   3826 C C   . LEU B 1 189 ? 28.250 60.745 87.866  1.00 25.95  ? 189 LEU B C   1 
ATOM   3827 O O   . LEU B 1 189 ? 28.472 61.479 86.913  1.00 25.95  ? 189 LEU B O   1 
ATOM   3828 C CB  . LEU B 1 189 ? 28.821 58.313 87.741  1.00 37.67  ? 189 LEU B CB  1 
ATOM   3829 C CG  . LEU B 1 189 ? 29.947 58.308 86.715  1.00 37.67  ? 189 LEU B CG  1 
ATOM   3830 C CD1 . LEU B 1 189 ? 30.933 59.435 86.993  0.00 37.67  ? 189 LEU B CD1 1 
ATOM   3831 C CD2 . LEU B 1 189 ? 30.658 56.958 86.805  1.00 37.67  ? 189 LEU B CD2 1 
ATOM   3832 N N   . ASP B 1 190 ? 28.444 61.111 89.127  1.00 32.61  ? 190 ASP B N   1 
ATOM   3833 C CA  . ASP B 1 190 ? 28.983 62.410 89.482  1.00 32.61  ? 190 ASP B CA  1 
ATOM   3834 C C   . ASP B 1 190 ? 30.426 62.172 89.897  1.00 32.61  ? 190 ASP B C   1 
ATOM   3835 O O   . ASP B 1 190 ? 30.685 61.519 90.908  1.00 32.61  ? 190 ASP B O   1 
ATOM   3836 C CB  . ASP B 1 190 ? 28.205 63.015 90.646  1.00 39.95  ? 190 ASP B CB  1 
ATOM   3837 C CG  . ASP B 1 190 ? 28.748 64.369 91.063  1.00 39.95  ? 190 ASP B CG  1 
ATOM   3838 O OD1 . ASP B 1 190 ? 29.982 64.491 91.251  1.00 39.95  ? 190 ASP B OD1 1 
ATOM   3839 O OD2 . ASP B 1 190 ? 27.940 65.309 91.211  1.00 39.95  ? 190 ASP B OD2 1 
ATOM   3840 N N   . PRO B 1 191 ? 31.386 62.719 89.133  1.00 50.68  ? 191 PRO B N   1 
ATOM   3841 C CA  . PRO B 1 191 ? 32.805 62.542 89.437  1.00 50.68  ? 191 PRO B CA  1 
ATOM   3842 C C   . PRO B 1 191 ? 33.152 62.863 90.876  1.00 50.68  ? 191 PRO B C   1 
ATOM   3843 O O   . PRO B 1 191 ? 33.746 62.029 91.574  1.00 50.68  ? 191 PRO B O   1 
ATOM   3844 C CB  . PRO B 1 191 ? 33.491 63.479 88.448  0.00 60.50  ? 191 PRO B CB  1 
ATOM   3845 C CG  . PRO B 1 191 ? 32.532 64.582 88.337  1.00 60.50  ? 191 PRO B CG  1 
ATOM   3846 C CD  . PRO B 1 191 ? 31.211 63.833 88.184  1.00 60.50  ? 191 PRO B CD  1 
ATOM   3847 N N   . ASP B 1 192 ? 32.757 64.056 91.322  1.00 41.81  ? 192 ASP B N   1 
ATOM   3848 C CA  . ASP B 1 192 ? 33.054 64.518 92.676  1.00 41.81  ? 192 ASP B CA  1 
ATOM   3849 C C   . ASP B 1 192 ? 32.441 63.700 93.822  1.00 41.81  ? 192 ASP B C   1 
ATOM   3850 O O   . ASP B 1 192 ? 33.104 63.423 94.819  1.00 41.81  ? 192 ASP B O   1 
ATOM   3851 C CB  . ASP B 1 192 ? 32.623 65.983 92.852  1.00 58.23  ? 192 ASP B CB  1 
ATOM   3852 C CG  . ASP B 1 192 ? 33.083 66.895 91.702  1.00 58.23  ? 192 ASP B CG  1 
ATOM   3853 O OD1 . ASP B 1 192 ? 34.262 66.788 91.253  1.00 58.23  ? 192 ASP B OD1 1 
ATOM   3854 O OD2 . ASP B 1 192 ? 32.249 67.742 91.267  1.00 58.23  ? 192 ASP B OD2 1 
ATOM   3855 N N   . THR B 1 193 ? 31.181 63.314 93.703  1.00 27.29  ? 193 THR B N   1 
ATOM   3856 C CA  . THR B 1 193 ? 30.561 62.580 94.794  1.00 27.29  ? 193 THR B CA  1 
ATOM   3857 C C   . THR B 1 193 ? 30.584 61.063 94.634  1.00 27.29  ? 193 THR B C   1 
ATOM   3858 O O   . THR B 1 193 ? 30.344 60.336 95.585  1.00 27.29  ? 193 THR B O   1 
ATOM   3859 C CB  . THR B 1 193 ? 29.123 63.069 94.994  1.00 28.38  ? 193 THR B CB  1 
ATOM   3860 O OG1 . THR B 1 193 ? 28.315 62.652 93.890  1.00 28.38  ? 193 THR B OG1 1 
ATOM   3861 C CG2 . THR B 1 193 ? 29.102 64.584 95.052  1.00 28.38  ? 193 THR B CG2 1 
ATOM   3862 N N   . ALA B 1 194 ? 30.889 60.585 93.434  1.00 24.90  ? 194 ALA B N   1 
ATOM   3863 C CA  . ALA B 1 194 ? 30.932 59.146 93.179  1.00 24.90  ? 194 ALA B CA  1 
ATOM   3864 C C   . ALA B 1 194 ? 29.542 58.511 93.285  1.00 24.90  ? 194 ALA B C   1 
ATOM   3865 O O   . ALA B 1 194 ? 29.405 57.316 93.535  1.00 24.90  ? 194 ALA B O   1 
ATOM   3866 C CB  . ALA B 1 194 ? 31.897 58.468 94.148  1.00 15.13  ? 194 ALA B CB  1 
ATOM   3867 N N   . VAL B 1 195 ? 28.516 59.330 93.087  1.00 23.36  ? 195 VAL B N   1 
ATOM   3868 C CA  . VAL B 1 195 ? 27.135 58.880 93.147  1.00 23.36  ? 195 VAL B CA  1 
ATOM   3869 C C   . VAL B 1 195 ? 26.725 58.335 91.790  1.00 23.36  ? 195 VAL B C   1 
ATOM   3870 O O   . VAL B 1 195 ? 26.898 58.993 90.773  1.00 23.36  ? 195 VAL B O   1 
ATOM   3871 C CB  . VAL B 1 195 ? 26.203 60.053 93.536  1.00 15.16  ? 195 VAL B CB  1 
ATOM   3872 C CG1 . VAL B 1 195 ? 24.752 59.695 93.304  1.00 15.16  ? 195 VAL B CG1 1 
ATOM   3873 C CG2 . VAL B 1 195 ? 26.421 60.403 94.980  1.00 15.16  ? 195 VAL B CG2 1 
ATOM   3874 N N   . LEU B 1 196 ? 26.194 57.124 91.768  1.00 19.41  ? 196 LEU B N   1 
ATOM   3875 C CA  . LEU B 1 196 ? 25.764 56.552 90.510  1.00 19.41  ? 196 LEU B CA  1 
ATOM   3876 C C   . LEU B 1 196 ? 24.253 56.633 90.422  1.00 19.41  ? 196 LEU B C   1 
ATOM   3877 O O   . LEU B 1 196 ? 23.566 56.597 91.433  1.00 19.41  ? 196 LEU B O   1 
ATOM   3878 C CB  . LEU B 1 196 ? 26.223 55.094 90.391  1.00 19.09  ? 196 LEU B CB  1 
ATOM   3879 C CG  . LEU B 1 196 ? 25.774 54.309 89.151  1.00 19.09  ? 196 LEU B CG  1 
ATOM   3880 C CD1 . LEU B 1 196 ? 26.694 53.126 88.926  1.00 19.09  ? 196 LEU B CD1 1 
ATOM   3881 C CD2 . LEU B 1 196 ? 24.328 53.855 89.320  1.00 19.09  ? 196 LEU B CD2 1 
ATOM   3882 N N   . LYS B 1 197 ? 23.745 56.759 89.206  1.00 25.21  ? 197 LYS B N   1 
ATOM   3883 C CA  . LYS B 1 197 ? 22.311 56.829 88.978  1.00 25.21  ? 197 LYS B CA  1 
ATOM   3884 C C   . LYS B 1 197 ? 21.907 56.062 87.738  1.00 25.21  ? 197 LYS B C   1 
ATOM   3885 O O   . LYS B 1 197 ? 22.498 56.238 86.677  1.00 25.21  ? 197 LYS B O   1 
ATOM   3886 C CB  . LYS B 1 197 ? 21.859 58.281 88.850  1.00 21.67  ? 197 LYS B CB  1 
ATOM   3887 C CG  . LYS B 1 197 ? 21.609 58.937 90.172  1.00 21.67  ? 197 LYS B CG  1 
ATOM   3888 C CD  . LYS B 1 197 ? 21.334 60.399 90.008  1.00 21.67  ? 197 LYS B CD  1 
ATOM   3889 C CE  . LYS B 1 197 ? 20.902 61.012 91.327  1.00 21.67  ? 197 LYS B CE  1 
ATOM   3890 N NZ  . LYS B 1 197 ? 21.876 60.720 92.392  1.00 21.67  ? 197 LYS B NZ  1 
ATOM   3891 N N   . LEU B 1 198 ? 20.916 55.189 87.883  1.00 24.72  ? 198 LEU B N   1 
ATOM   3892 C CA  . LEU B 1 198 ? 20.425 54.418 86.753  1.00 24.72  ? 198 LEU B CA  1 
ATOM   3893 C C   . LEU B 1 198 ? 19.507 55.338 85.954  1.00 24.72  ? 198 LEU B C   1 
ATOM   3894 O O   . LEU B 1 198 ? 18.703 56.068 86.530  1.00 24.72  ? 198 LEU B O   1 
ATOM   3895 C CB  . LEU B 1 198 ? 19.659 53.187 87.240  1.00 13.35  ? 198 LEU B CB  1 
ATOM   3896 C CG  . LEU B 1 198 ? 19.010 52.280 86.194  1.00 13.35  ? 198 LEU B CG  1 
ATOM   3897 C CD1 . LEU B 1 198 ? 20.025 51.791 85.212  1.00 13.35  ? 198 LEU B CD1 1 
ATOM   3898 C CD2 . LEU B 1 198 ? 18.363 51.113 86.871  1.00 13.35  ? 198 LEU B CD2 1 
ATOM   3899 N N   . CYS B 1 199 ? 19.651 55.325 84.632  1.00 22.21  ? 199 CYS B N   1 
ATOM   3900 C CA  . CYS B 1 199 ? 18.823 56.160 83.768  1.00 22.21  ? 199 CYS B CA  1 
ATOM   3901 C C   . CYS B 1 199 ? 18.315 55.392 82.542  1.00 22.21  ? 199 CYS B C   1 
ATOM   3902 O O   . CYS B 1 199 ? 18.629 54.225 82.357  1.00 22.21  ? 199 CYS B O   1 
ATOM   3903 C CB  . CYS B 1 199 ? 19.604 57.397 83.308  1.00 28.99  ? 199 CYS B CB  1 
ATOM   3904 S SG  . CYS B 1 199 ? 20.866 57.074 82.054  1.00 28.99  ? 199 CYS B SG  1 
ATOM   3905 N N   . ASP B 1 200 ? 17.524 56.070 81.719  1.00 23.92  ? 200 ASP B N   1 
ATOM   3906 C CA  . ASP B 1 200 ? 16.956 55.484 80.515  1.00 23.92  ? 200 ASP B CA  1 
ATOM   3907 C C   . ASP B 1 200 ? 16.026 54.289 80.752  1.00 23.92  ? 200 ASP B C   1 
ATOM   3908 O O   . ASP B 1 200 ? 16.443 53.131 80.646  1.00 23.92  ? 200 ASP B O   1 
ATOM   3909 C CB  . ASP B 1 200 ? 18.057 55.053 79.563  1.00 34.92  ? 200 ASP B CB  1 
ATOM   3910 C CG  . ASP B 1 200 ? 17.512 54.618 78.231  1.00 34.92  ? 200 ASP B CG  1 
ATOM   3911 O OD1 . ASP B 1 200 ? 16.270 54.557 78.095  1.00 34.92  ? 200 ASP B OD1 1 
ATOM   3912 O OD2 . ASP B 1 200 ? 18.319 54.339 77.317  1.00 34.92  ? 200 ASP B OD2 1 
ATOM   3913 N N   . PHE B 1 201 ? 14.759 54.564 81.045  1.00 29.97  ? 201 PHE B N   1 
ATOM   3914 C CA  . PHE B 1 201 ? 13.805 53.495 81.281  1.00 29.97  ? 201 PHE B CA  1 
ATOM   3915 C C   . PHE B 1 201 ? 12.904 53.211 80.069  1.00 29.97  ? 201 PHE B C   1 
ATOM   3916 O O   . PHE B 1 201 ? 11.803 52.680 80.203  1.00 29.97  ? 201 PHE B O   1 
ATOM   3917 C CB  . PHE B 1 201 ? 12.971 53.824 82.524  1.00 21.34  ? 201 PHE B CB  1 
ATOM   3918 C CG  . PHE B 1 201 ? 13.738 53.713 83.806  1.00 21.34  ? 201 PHE B CG  1 
ATOM   3919 C CD1 . PHE B 1 201 ? 14.659 54.683 84.166  1.00 21.34  ? 201 PHE B CD1 1 
ATOM   3920 C CD2 . PHE B 1 201 ? 13.596 52.595 84.618  1.00 21.34  ? 201 PHE B CD2 1 
ATOM   3921 C CE1 . PHE B 1 201 ? 15.437 54.536 85.318  1.00 21.34  ? 201 PHE B CE1 1 
ATOM   3922 C CE2 . PHE B 1 201 ? 14.363 52.438 85.765  1.00 21.34  ? 201 PHE B CE2 1 
ATOM   3923 C CZ  . PHE B 1 201 ? 15.288 53.411 86.116  1.00 21.34  ? 201 PHE B CZ  1 
ATOM   3924 N N   . GLY B 1 202 ? 13.388 53.549 78.882  1.00 21.68  ? 202 GLY B N   1 
ATOM   3925 C CA  . GLY B 1 202 ? 12.601 53.324 77.685  1.00 21.68  ? 202 GLY B CA  1 
ATOM   3926 C C   . GLY B 1 202 ? 12.315 51.869 77.356  1.00 21.68  ? 202 GLY B C   1 
ATOM   3927 O O   . GLY B 1 202 ? 11.433 51.575 76.552  1.00 21.68  ? 202 GLY B O   1 
ATOM   3928 N N   . SER B 1 203 ? 13.048 50.954 77.975  1.00 32.70  ? 203 SER B N   1 
ATOM   3929 C CA  . SER B 1 203 ? 12.856 49.534 77.715  1.00 32.70  ? 203 SER B CA  1 
ATOM   3930 C C   . SER B 1 203 ? 12.335 48.806 78.921  1.00 32.70  ? 203 SER B C   1 
ATOM   3931 O O   . SER B 1 203 ? 12.117 47.608 78.855  1.00 32.70  ? 203 SER B O   1 
ATOM   3932 C CB  . SER B 1 203 ? 14.171 48.881 77.311  1.00 29.51  ? 203 SER B CB  1 
ATOM   3933 O OG  . SER B 1 203 ? 14.771 49.595 76.259  1.00 29.51  ? 203 SER B OG  1 
ATOM   3934 N N   . ALA B 1 204 ? 12.156 49.528 80.020  1.00 20.67  ? 204 ALA B N   1 
ATOM   3935 C CA  . ALA B 1 204 ? 11.687 48.942 81.262  1.00 20.67  ? 204 ALA B CA  1 
ATOM   3936 C C   . ALA B 1 204 ? 10.236 48.489 81.209  1.00 20.67  ? 204 ALA B C   1 
ATOM   3937 O O   . ALA B 1 204 ? 9.406  49.062 80.496  1.00 20.67  ? 204 ALA B O   1 
ATOM   3938 C CB  . ALA B 1 204 ? 11.882 49.932 82.405  1.00 28.67  ? 204 ALA B CB  1 
ATOM   3939 N N   . LYS B 1 205 ? 9.933  47.465 81.993  1.00 24.34  ? 205 LYS B N   1 
ATOM   3940 C CA  . LYS B 1 205 ? 8.590  46.930 82.035  1.00 24.34  ? 205 LYS B CA  1 
ATOM   3941 C C   . LYS B 1 205 ? 8.311  46.105 83.293  1.00 24.34  ? 205 LYS B C   1 
ATOM   3942 O O   . LYS B 1 205 ? 9.210  45.511 83.879  1.00 24.34  ? 205 LYS B O   1 
ATOM   3943 C CB  . LYS B 1 205 ? 8.359  46.057 80.809  1.00 33.91  ? 205 LYS B CB  1 
ATOM   3944 C CG  . LYS B 1 205 ? 6.923  45.660 80.675  1.00 33.91  ? 205 LYS B CG  1 
ATOM   3945 C CD  . LYS B 1 205 ? 6.705  44.576 79.642  1.00 33.91  ? 205 LYS B CD  1 
ATOM   3946 C CE  . LYS B 1 205 ? 5.210  44.354 79.383  1.00 33.91  ? 205 LYS B CE  1 
ATOM   3947 N NZ  . LYS B 1 205 ? 4.954  43.138 78.564  1.00 33.91  ? 205 LYS B NZ  1 
ATOM   3948 N N   . GLN B 1 206 ? 7.056  46.083 83.715  1.00 31.27  ? 206 GLN B N   1 
ATOM   3949 C CA  . GLN B 1 206 ? 6.670  45.280 84.862  1.00 31.27  ? 206 GLN B CA  1 
ATOM   3950 C C   . GLN B 1 206 ? 6.597  43.871 84.292  1.00 31.27  ? 206 GLN B C   1 
ATOM   3951 O O   . GLN B 1 206 ? 5.893  43.642 83.317  1.00 31.27  ? 206 GLN B O   1 
ATOM   3952 C CB  . GLN B 1 206 ? 5.300  45.705 85.366  1.00 53.66  ? 206 GLN B CB  1 
ATOM   3953 C CG  . GLN B 1 206 ? 5.180  47.198 85.627  1.00 53.66  ? 206 GLN B CG  1 
ATOM   3954 C CD  . GLN B 1 206 ? 4.520  47.475 86.971  1.00 53.66  ? 206 GLN B CD  1 
ATOM   3955 O OE1 . GLN B 1 206 ? 4.259  48.638 87.338  1.00 53.66  ? 206 GLN B OE1 1 
ATOM   3956 N NE2 . GLN B 1 206 ? 4.247  46.395 87.721  1.00 53.66  ? 206 GLN B NE2 1 
ATOM   3957 N N   . LEU B 1 207 ? 7.331  42.934 84.876  1.00 33.98  ? 207 LEU B N   1 
ATOM   3958 C CA  . LEU B 1 207 ? 7.336  41.569 84.361  1.00 33.98  ? 207 LEU B CA  1 
ATOM   3959 C C   . LEU B 1 207 ? 6.400  40.639 85.101  1.00 33.98  ? 207 LEU B C   1 
ATOM   3960 O O   . LEU B 1 207 ? 6.827  39.908 85.997  1.00 33.98  ? 207 LEU B O   1 
ATOM   3961 C CB  . LEU B 1 207 ? 8.743  40.969 84.418  1.00 29.59  ? 207 LEU B CB  1 
ATOM   3962 C CG  . LEU B 1 207 ? 9.856  41.433 83.481  1.00 29.59  ? 207 LEU B CG  1 
ATOM   3963 C CD1 . LEU B 1 207 ? 11.024 40.470 83.647  1.00 29.59  ? 207 LEU B CD1 1 
ATOM   3964 C CD2 . LEU B 1 207 ? 9.385  41.450 82.026  1.00 29.59  ? 207 LEU B CD2 1 
ATOM   3965 N N   . VAL B 1 208 ? 5.132  40.648 84.715  1.00 44.62  ? 208 VAL B N   1 
ATOM   3966 C CA  . VAL B 1 208 ? 4.133  39.791 85.350  1.00 44.62  ? 208 VAL B CA  1 
ATOM   3967 C C   . VAL B 1 208 ? 4.300  38.335 84.900  1.00 44.62  ? 208 VAL B C   1 
ATOM   3968 O O   . VAL B 1 208 ? 4.349  38.054 83.705  1.00 44.62  ? 208 VAL B O   1 
ATOM   3969 C CB  . VAL B 1 208 ? 2.720  40.267 84.988  1.00 41.62  ? 208 VAL B CB  1 
ATOM   3970 C CG1 . VAL B 1 208 ? 1.710  39.724 85.987  0.00 41.62  ? 208 VAL B CG1 1 
ATOM   3971 C CG2 . VAL B 1 208 ? 2.696  41.794 84.939  1.00 41.62  ? 208 VAL B CG2 1 
ATOM   3972 N N   . ARG B 1 209 ? 4.389  37.410 85.853  1.00 45.27  ? 209 ARG B N   1 
ATOM   3973 C CA  . ARG B 1 209 ? 4.549  35.987 85.520  1.00 45.27  ? 209 ARG B CA  1 
ATOM   3974 C C   . ARG B 1 209 ? 3.458  35.489 84.550  1.00 45.27  ? 209 ARG B C   1 
ATOM   3975 O O   . ARG B 1 209 ? 2.294  35.902 84.622  1.00 45.27  ? 209 ARG B O   1 
ATOM   3976 C CB  . ARG B 1 209 ? 4.541  35.142 86.804  1.00 34.94  ? 209 ARG B CB  1 
ATOM   3977 N N   . GLY B 1 210 ? 3.839  34.607 83.634  1.00 39.40  ? 210 GLY B N   1 
ATOM   3978 C CA  . GLY B 1 210 ? 2.874  34.097 82.682  1.00 39.40  ? 210 GLY B CA  1 
ATOM   3979 C C   . GLY B 1 210 ? 2.739  34.939 81.428  1.00 39.40  ? 210 GLY B C   1 
ATOM   3980 O O   . GLY B 1 210 ? 2.256  34.451 80.402  1.00 39.40  ? 210 GLY B O   1 
ATOM   3981 N N   . GLU B 1 211 ? 3.147  36.203 81.495  1.00 48.68  ? 211 GLU B N   1 
ATOM   3982 C CA  . GLU B 1 211 ? 3.066  37.074 80.323  1.00 48.68  ? 211 GLU B CA  1 
ATOM   3983 C C   . GLU B 1 211 ? 4.365  37.073 79.534  1.00 48.68  ? 211 GLU B C   1 
ATOM   3984 O O   . GLU B 1 211 ? 5.446  37.193 80.097  1.00 48.68  ? 211 GLU B O   1 
ATOM   3985 C CB  . GLU B 1 211 ? 2.728  38.495 80.728  1.00 61.36  ? 211 GLU B CB  1 
ATOM   3986 C CG  . GLU B 1 211 ? 1.302  38.658 81.185  1.00 61.36  ? 211 GLU B CG  1 
ATOM   3987 C CD  . GLU B 1 211 ? 1.004  40.078 81.629  1.00 61.36  ? 211 GLU B CD  1 
ATOM   3988 O OE1 . GLU B 1 211 ? -0.121 40.323 82.132  1.00 61.36  ? 211 GLU B OE1 1 
ATOM   3989 O OE2 . GLU B 1 211 ? 1.901  40.946 81.470  1.00 61.36  ? 211 GLU B OE2 1 
ATOM   3990 N N   . PRO B 1 212 ? 4.271  36.924 78.211  1.00 42.30  ? 212 PRO B N   1 
ATOM   3991 C CA  . PRO B 1 212 ? 5.459  36.909 77.364  1.00 42.30  ? 212 PRO B CA  1 
ATOM   3992 C C   . PRO B 1 212 ? 6.042  38.299 77.164  1.00 42.30  ? 212 PRO B C   1 
ATOM   3993 O O   . PRO B 1 212 ? 5.309  39.295 77.171  1.00 42.30  ? 212 PRO B O   1 
ATOM   3994 C CB  . PRO B 1 212 ? 4.940  36.297 76.063  1.00 48.75  ? 212 PRO B CB  1 
ATOM   3995 C CG  . PRO B 1 212 ? 3.553  36.807 76.004  1.00 48.75  ? 212 PRO B CG  1 
ATOM   3996 C CD  . PRO B 1 212 ? 3.063  36.625 77.420  1.00 48.75  ? 212 PRO B CD  1 
ATOM   3997 N N   . ASN B 1 213 ? 7.362  38.358 77.002  1.00 29.63  ? 213 ASN B N   1 
ATOM   3998 C CA  . ASN B 1 213 ? 8.043  39.621 76.780  1.00 29.63  ? 213 ASN B CA  1 
ATOM   3999 C C   . ASN B 1 213 ? 8.996  39.474 75.601  1.00 29.63  ? 213 ASN B C   1 
ATOM   4000 O O   . ASN B 1 213 ? 9.568  38.405 75.387  1.00 29.63  ? 213 ASN B O   1 
ATOM   4001 C CB  . ASN B 1 213 ? 8.790  40.032 78.041  1.00 23.53  ? 213 ASN B CB  1 
ATOM   4002 C CG  . ASN B 1 213 ? 7.869  40.178 79.229  1.00 23.53  ? 213 ASN B CG  1 
ATOM   4003 O OD1 . ASN B 1 213 ? 7.045  41.096 79.288  1.00 23.53  ? 213 ASN B OD1 1 
ATOM   4004 N ND2 . ASN B 1 213 ? 7.991  39.256 80.180  1.00 23.53  ? 213 ASN B ND2 1 
ATOM   4005 N N   . VAL B 1 214 ? 9.141  40.543 74.826  1.00 26.81  ? 214 VAL B N   1 
ATOM   4006 C CA  . VAL B 1 214 ? 10.079 40.505 73.707  1.00 26.81  ? 214 VAL B CA  1 
ATOM   4007 C C   . VAL B 1 214 ? 11.504 40.191 74.176  1.00 26.81  ? 214 VAL B C   1 
ATOM   4008 O O   . VAL B 1 214 ? 11.892 40.452 75.307  1.00 26.81  ? 214 VAL B O   1 
ATOM   4009 C CB  . VAL B 1 214 ? 10.043 41.860 72.999  1.00 21.30  ? 214 VAL B CB  1 
ATOM   4010 C CG1 . VAL B 1 214 ? 8.640  42.126 72.456  1.00 21.30  ? 214 VAL B CG1 1 
ATOM   4011 C CG2 . VAL B 1 214 ? 10.422 42.965 73.969  1.00 21.30  ? 214 VAL B CG2 1 
ATOM   4012 N N   . SER B 1 215 ? 12.283 39.571 73.268  1.00 28.62  ? 215 SER B N   1 
ATOM   4013 C CA  . SER B 1 215 ? 13.621 39.099 73.612  1.00 28.62  ? 215 SER B CA  1 
ATOM   4014 C C   . SER B 1 215 ? 14.704 40.039 73.079  1.00 28.62  ? 215 SER B C   1 
ATOM   4015 O O   . SER B 1 215 ? 15.822 40.103 73.576  1.00 28.62  ? 215 SER B O   1 
ATOM   4016 C CB  . SER B 1 215 ? 13.805 37.705 73.015  1.00 30.12  ? 215 SER B CB  1 
ATOM   4017 O OG  . SER B 1 215 ? 13.657 37.776 71.597  1.00 30.12  ? 215 SER B OG  1 
ATOM   4018 N N   . TYR B 1 216 ? 14.348 40.751 71.995  1.00 29.71  ? 216 TYR B N   1 
ATOM   4019 C CA  . TYR B 1 216 ? 15.281 41.710 71.414  1.00 29.71  ? 216 TYR B CA  1 
ATOM   4020 C C   . TYR B 1 216 ? 15.185 43.066 72.113  1.00 29.71  ? 216 TYR B C   1 
ATOM   4021 O O   . TYR B 1 216 ? 14.718 44.053 71.561  1.00 29.71  ? 216 TYR B O   1 
ATOM   4022 C CB  . TYR B 1 216 ? 14.921 41.871 69.936  1.00 34.42  ? 216 TYR B CB  1 
ATOM   4023 C CG  . TYR B 1 216 ? 13.545 42.430 69.821  1.00 34.42  ? 216 TYR B CG  1 
ATOM   4024 C CD1 . TYR B 1 216 ? 13.324 43.781 70.074  1.00 34.42  ? 216 TYR B CD1 1 
ATOM   4025 C CD2 . TYR B 1 216 ? 12.462 41.592 69.554  1.00 34.42  ? 216 TYR B CD2 1 
ATOM   4026 C CE1 . TYR B 1 216 ? 12.033 44.290 70.070  1.00 34.42  ? 216 TYR B CE1 1 
ATOM   4027 C CE2 . TYR B 1 216 ? 11.170 42.100 69.550  1.00 34.42  ? 216 TYR B CE2 1 
ATOM   4028 C CZ  . TYR B 1 216 ? 10.955 43.442 69.808  1.00 34.42  ? 216 TYR B CZ  1 
ATOM   4029 O OH  . TYR B 1 216 ? 9.675  43.961 69.782  1.00 34.42  ? 216 TYR B OH  1 
ATOM   4030 N N   . ILE B 1 217 ? 15.613 43.086 73.389  1.00 44.24  ? 217 ILE B N   1 
ATOM   4031 C CA  . ILE B 1 217 ? 15.470 44.310 74.169  1.00 44.24  ? 217 ILE B CA  1 
ATOM   4032 C C   . ILE B 1 217 ? 16.809 44.801 74.728  1.00 44.24  ? 217 ILE B C   1 
ATOM   4033 O O   . ILE B 1 217 ? 17.135 45.980 74.702  1.00 44.24  ? 217 ILE B O   1 
ATOM   4034 C CB  . ILE B 1 217 ? 14.486 44.034 75.307  1.00 22.42  ? 217 ILE B CB  1 
ATOM   4035 C CG1 . ILE B 1 217 ? 14.199 45.321 76.084  1.00 22.42  ? 217 ILE B CG1 1 
ATOM   4036 C CG2 . ILE B 1 217 ? 15.093 43.012 76.287  1.00 22.42  ? 217 ILE B CG2 1 
ATOM   4037 C CD1 . ILE B 1 217 ? 13.249 46.254 75.333  1.00 22.42  ? 217 ILE B CD1 1 
ATOM   4038 N N   . CYS B 1 218 ? 17.582 43.850 75.284  1.00 30.97  ? 218 CYS B N   1 
ATOM   4039 C CA  . CYS B 1 218 ? 18.895 44.291 75.739  1.00 30.97  ? 218 CYS B CA  1 
ATOM   4040 C C   . CYS B 1 218 ? 19.830 44.586 74.563  1.00 30.97  ? 218 CYS B C   1 
ATOM   4041 O O   . CYS B 1 218 ? 19.549 44.282 73.411  1.00 30.97  ? 218 CYS B O   1 
ATOM   4042 C CB  . CYS B 1 218 ? 19.492 43.189 76.615  1.00 33.67  ? 218 CYS B CB  1 
ATOM   4043 S SG  . CYS B 1 218 ? 20.537 43.853 77.930  1.00 33.67  ? 218 CYS B SG  1 
ATOM   4044 N N   . SER B 1 219 ? 20.962 45.239 74.887  1.00 27.56  ? 219 SER B N   1 
ATOM   4045 C CA  . SER B 1 219 ? 21.923 45.575 73.844  1.00 27.56  ? 219 SER B CA  1 
ATOM   4046 C C   . SER B 1 219 ? 22.994 44.485 73.765  1.00 27.56  ? 219 SER B C   1 
ATOM   4047 O O   . SER B 1 219 ? 23.093 43.611 74.616  1.00 27.56  ? 219 SER B O   1 
ATOM   4048 C CB  . SER B 1 219 ? 22.455 46.982 74.120  1.00 30.92  ? 219 SER B CB  1 
ATOM   4049 O OG  . SER B 1 219 ? 23.364 46.935 75.220  1.00 30.92  ? 219 SER B OG  1 
ATOM   4050 N N   . ARG B 1 220 ? 23.905 44.455 72.777  1.00 31.13  ? 220 ARG B N   1 
ATOM   4051 C CA  . ARG B 1 220 ? 24.845 43.439 72.307  1.00 31.13  ? 220 ARG B CA  1 
ATOM   4052 C C   . ARG B 1 220 ? 25.558 42.762 73.491  1.00 31.13  ? 220 ARG B C   1 
ATOM   4053 O O   . ARG B 1 220 ? 25.225 41.660 73.909  1.00 31.13  ? 220 ARG B O   1 
ATOM   4054 C CB  . ARG B 1 220 ? 25.871 44.116 71.397  1.00 26.70  ? 220 ARG B CB  1 
ATOM   4055 N N   . TYR B 1 221 ? 26.600 43.449 74.007  1.00 28.91  ? 221 TYR B N   1 
ATOM   4056 C CA  . TYR B 1 221 ? 27.496 42.821 74.983  1.00 28.91  ? 221 TYR B CA  1 
ATOM   4057 C C   . TYR B 1 221 ? 26.809 42.484 76.315  1.00 28.91  ? 221 TYR B C   1 
ATOM   4058 O O   . TYR B 1 221 ? 27.305 41.708 77.121  1.00 28.91  ? 221 TYR B O   1 
ATOM   4059 C CB  . TYR B 1 221 ? 28.669 43.773 75.227  1.00 45.58  ? 221 TYR B CB  1 
ATOM   4060 C CG  . TYR B 1 221 ? 29.272 44.170 73.925  1.00 45.58  ? 221 TYR B CG  1 
ATOM   4061 C CD1 . TYR B 1 221 ? 29.236 43.289 72.848  1.00 45.58  ? 221 TYR B CD1 1 
ATOM   4062 C CD2 . TYR B 1 221 ? 29.876 45.419 73.776  1.00 45.58  ? 221 TYR B CD2 1 
ATOM   4063 C CE1 . TYR B 1 221 ? 29.801 43.649 71.634  1.00 45.58  ? 221 TYR B CE1 1 
ATOM   4064 C CE2 . TYR B 1 221 ? 30.442 45.779 72.562  1.00 45.58  ? 221 TYR B CE2 1 
ATOM   4065 C CZ  . TYR B 1 221 ? 30.407 44.899 71.495  1.00 45.58  ? 221 TYR B CZ  1 
ATOM   4066 O OH  . TYR B 1 221 ? 30.970 45.249 70.283  1.00 45.58  ? 221 TYR B OH  1 
ATOM   4067 N N   . TYR B 1 222 ? 25.637 43.083 76.591  1.00 28.02  ? 222 TYR B N   1 
ATOM   4068 C CA  . TYR B 1 222 ? 25.017 42.855 77.895  1.00 28.02  ? 222 TYR B CA  1 
ATOM   4069 C C   . TYR B 1 222 ? 23.809 41.917 77.812  1.00 28.02  ? 222 TYR B C   1 
ATOM   4070 O O   . TYR B 1 222 ? 23.160 41.608 78.803  1.00 28.02  ? 222 TYR B O   1 
ATOM   4071 C CB  . TYR B 1 222 ? 24.599 44.209 78.465  1.00 23.72  ? 222 TYR B CB  1 
ATOM   4072 C CG  . TYR B 1 222 ? 25.717 45.179 78.311  1.00 23.72  ? 222 TYR B CG  1 
ATOM   4073 C CD1 . TYR B 1 222 ? 25.784 45.982 77.176  1.00 23.72  ? 222 TYR B CD1 1 
ATOM   4074 C CD2 . TYR B 1 222 ? 26.757 45.209 79.240  1.00 23.72  ? 222 TYR B CD2 1 
ATOM   4075 C CE1 . TYR B 1 222 ? 26.887 46.794 76.961  1.00 23.72  ? 222 TYR B CE1 1 
ATOM   4076 C CE2 . TYR B 1 222 ? 27.861 46.021 79.025  1.00 23.72  ? 222 TYR B CE2 1 
ATOM   4077 C CZ  . TYR B 1 222 ? 27.930 46.808 77.889  1.00 23.72  ? 222 TYR B CZ  1 
ATOM   4078 O OH  . TYR B 1 222 ? 29.030 47.610 77.659  1.00 23.72  ? 222 TYR B OH  1 
ATOM   4079 N N   . ARG B 1 223 ? 23.377 41.376 76.660  1.00 24.53  ? 223 ARG B N   1 
ATOM   4080 C CA  . ARG B 1 223 ? 22.227 40.481 76.678  1.00 24.53  ? 223 ARG B CA  1 
ATOM   4081 C C   . ARG B 1 223 ? 22.550 39.164 77.391  1.00 24.53  ? 223 ARG B C   1 
ATOM   4082 O O   . ARG B 1 223 ? 23.540 38.502 77.107  1.00 24.53  ? 223 ARG B O   1 
ATOM   4083 C CB  . ARG B 1 223 ? 21.814 40.212 75.231  1.00 26.99  ? 223 ARG B CB  1 
ATOM   4084 C CG  . ARG B 1 223 ? 21.984 41.446 74.343  1.00 26.99  ? 223 ARG B CG  1 
ATOM   4085 C CD  . ARG B 1 223 ? 21.564 41.177 72.894  1.00 26.99  ? 223 ARG B CD  1 
ATOM   4086 N NE  . ARG B 1 223 ? 20.208 40.623 72.844  1.00 26.99  ? 223 ARG B NE  1 
ATOM   4087 C CZ  . ARG B 1 223 ? 19.995 39.593 72.005  1.00 26.99  ? 223 ARG B CZ  1 
ATOM   4088 N NH1 . ARG B 1 223 ? 20.985 39.123 71.266  1.00 26.99  ? 223 ARG B NH1 1 
ATOM   4089 N NH2 . ARG B 1 223 ? 18.783 39.034 71.940  1.00 26.99  ? 223 ARG B NH2 1 
ATOM   4090 N N   . ALA B 1 224 ? 21.619 38.783 78.255  1.00 17.47  ? 224 ALA B N   1 
ATOM   4091 C CA  . ALA B 1 224 ? 21.740 37.528 78.954  1.00 17.47  ? 224 ALA B CA  1 
ATOM   4092 C C   . ALA B 1 224 ? 21.665 36.408 77.954  1.00 17.47  ? 224 ALA B C   1 
ATOM   4093 O O   . ALA B 1 224 ? 21.072 36.535 76.891  1.00 17.47  ? 224 ALA B O   1 
ATOM   4094 C CB  . ALA B 1 224 ? 20.643 37.383 79.979  1.00 11.85  ? 224 ALA B CB  1 
ATOM   4095 N N   . PRO B 1 225 ? 22.284 35.285 78.281  1.00 28.48  ? 225 PRO B N   1 
ATOM   4096 C CA  . PRO B 1 225 ? 22.224 34.188 77.338  1.00 28.48  ? 225 PRO B CA  1 
ATOM   4097 C C   . PRO B 1 225 ? 20.783 33.821 76.883  1.00 28.48  ? 225 PRO B C   1 
ATOM   4098 O O   . PRO B 1 225 ? 20.528 33.760 75.683  1.00 28.48  ? 225 PRO B O   1 
ATOM   4099 C CB  . PRO B 1 225 ? 23.014 33.105 78.080  1.00 23.08  ? 225 PRO B CB  1 
ATOM   4100 C CG  . PRO B 1 225 ? 22.796 33.413 79.479  1.00 23.08  ? 225 PRO B CG  1 
ATOM   4101 C CD  . PRO B 1 225 ? 23.028 34.885 79.481  1.00 23.08  ? 225 PRO B CD  1 
ATOM   4102 N N   . GLU B 1 226 ? 19.840 33.624 77.802  1.00 30.52  ? 226 GLU B N   1 
ATOM   4103 C CA  . GLU B 1 226 ? 18.461 33.294 77.408  1.00 30.52  ? 226 GLU B CA  1 
ATOM   4104 C C   . GLU B 1 226 ? 17.892 34.283 76.380  1.00 30.52  ? 226 GLU B C   1 
ATOM   4105 O O   . GLU B 1 226 ? 17.102 33.899 75.523  1.00 30.52  ? 226 GLU B O   1 
ATOM   4106 C CB  . GLU B 1 226 ? 17.533 33.249 78.624  1.00 32.28  ? 226 GLU B CB  1 
ATOM   4107 C CG  . GLU B 1 226 ? 17.508 34.535 79.428  1.00 32.28  ? 226 GLU B CG  1 
ATOM   4108 C CD  . GLU B 1 226 ? 18.283 34.415 80.716  1.00 32.28  ? 226 GLU B CD  1 
ATOM   4109 O OE1 . GLU B 1 226 ? 19.417 33.905 80.680  1.00 32.28  ? 226 GLU B OE1 1 
ATOM   4110 O OE2 . GLU B 1 226 ? 17.765 34.833 81.769  1.00 32.28  ? 226 GLU B OE2 1 
ATOM   4111 N N   . LEU B 1 227 ? 18.268 35.556 76.468  1.00 23.55  ? 227 LEU B N   1 
ATOM   4112 C CA  . LEU B 1 227 ? 17.787 36.531 75.489  1.00 23.55  ? 227 LEU B CA  1 
ATOM   4113 C C   . LEU B 1 227 ? 18.331 36.190 74.096  1.00 23.55  ? 227 LEU B C   1 
ATOM   4114 O O   . LEU B 1 227 ? 17.621 36.292 73.095  1.00 23.55  ? 227 LEU B O   1 
ATOM   4115 C CB  . LEU B 1 227 ? 18.220 37.949 75.860  1.00 25.52  ? 227 LEU B CB  1 
ATOM   4116 C CG  . LEU B 1 227 ? 17.671 38.519 77.164  1.00 25.52  ? 227 LEU B CG  1 
ATOM   4117 C CD1 . LEU B 1 227 ? 18.146 39.960 77.310  1.00 25.52  ? 227 LEU B CD1 1 
ATOM   4118 C CD2 . LEU B 1 227 ? 16.154 38.452 77.170  1.00 25.52  ? 227 LEU B CD2 1 
ATOM   4119 N N   . ILE B 1 228 ? 19.595 35.789 74.036  1.00 23.90  ? 228 ILE B N   1 
ATOM   4120 C CA  . ILE B 1 228 ? 20.189 35.431 72.767  1.00 23.90  ? 228 ILE B CA  1 
ATOM   4121 C C   . ILE B 1 228 ? 19.395 34.253 72.203  1.00 23.90  ? 228 ILE B C   1 
ATOM   4122 O O   . ILE B 1 228 ? 19.049 34.232 71.028  1.00 23.90  ? 228 ILE B O   1 
ATOM   4123 C CB  . ILE B 1 228 ? 21.676 35.055 72.937  1.00 17.80  ? 228 ILE B CB  1 
ATOM   4124 C CG1 . ILE B 1 228 ? 22.445 36.244 73.536  1.00 17.80  ? 228 ILE B CG1 1 
ATOM   4125 C CG2 . ILE B 1 228 ? 22.262 34.678 71.598  1.00 17.80  ? 228 ILE B CG2 1 
ATOM   4126 C CD1 . ILE B 1 228 ? 23.931 35.991 73.773  1.00 17.80  ? 228 ILE B CD1 1 
ATOM   4127 N N   . PHE B 1 229 ? 19.087 33.283 73.054  1.00 40.04  ? 229 PHE B N   1 
ATOM   4128 C CA  . PHE B 1 229 ? 18.324 32.126 72.615  1.00 40.04  ? 229 PHE B CA  1 
ATOM   4129 C C   . PHE B 1 229 ? 16.868 32.439 72.304  1.00 40.04  ? 229 PHE B C   1 
ATOM   4130 O O   . PHE B 1 229 ? 16.080 31.527 72.073  1.00 40.04  ? 229 PHE B O   1 
ATOM   4131 C CB  . PHE B 1 229 ? 18.370 31.004 73.650  1.00 26.10  ? 229 PHE B CB  1 
ATOM   4132 C CG  . PHE B 1 229 ? 19.666 30.255 73.676  1.00 26.10  ? 229 PHE B CG  1 
ATOM   4133 C CD1 . PHE B 1 229 ? 20.157 29.623 72.532  1.00 26.10  ? 229 PHE B CD1 1 
ATOM   4134 C CD2 . PHE B 1 229 ? 20.393 30.166 74.845  1.00 26.10  ? 229 PHE B CD2 1 
ATOM   4135 C CE1 . PHE B 1 229 ? 21.352 28.915 72.559  1.00 26.10  ? 229 PHE B CE1 1 
ATOM   4136 C CE2 . PHE B 1 229 ? 21.593 29.457 74.884  1.00 26.10  ? 229 PHE B CE2 1 
ATOM   4137 C CZ  . PHE B 1 229 ? 22.075 28.837 73.754  1.00 26.10  ? 229 PHE B CZ  1 
ATOM   4138 N N   . GLY B 1 230 ? 16.493 33.712 72.311  1.00 35.01  ? 230 GLY B N   1 
ATOM   4139 C CA  . GLY B 1 230 ? 15.123 34.065 71.972  1.00 35.01  ? 230 GLY B CA  1 
ATOM   4140 C C   . GLY B 1 230 ? 13.999 33.814 72.965  1.00 35.01  ? 230 GLY B C   1 
ATOM   4141 O O   . GLY B 1 230 ? 12.833 33.915 72.595  1.00 35.01  ? 230 GLY B O   1 
ATOM   4142 N N   . ALA B 1 231 ? 14.327 33.495 74.212  1.00 26.93  ? 231 ALA B N   1 
ATOM   4143 C CA  . ALA B 1 231 ? 13.311 33.265 75.235  1.00 26.93  ? 231 ALA B CA  1 
ATOM   4144 C C   . ALA B 1 231 ? 12.386 34.471 75.355  1.00 26.93  ? 231 ALA B C   1 
ATOM   4145 O O   . ALA B 1 231 ? 12.765 35.589 75.021  1.00 26.93  ? 231 ALA B O   1 
ATOM   4146 C CB  . ALA B 1 231 ? 13.974 32.991 76.578  1.00 7.70   ? 231 ALA B CB  1 
ATOM   4147 N N   . THR B 1 232 ? 11.176 34.248 75.848  1.00 31.17  ? 232 THR B N   1 
ATOM   4148 C CA  . THR B 1 232 ? 10.208 35.327 75.998  1.00 31.17  ? 232 THR B CA  1 
ATOM   4149 C C   . THR B 1 232 ? 9.579  35.279 77.385  1.00 31.17  ? 232 THR B C   1 
ATOM   4150 O O   . THR B 1 232 ? 8.714  36.095 77.733  1.00 31.17  ? 232 THR B O   1 
ATOM   4151 C CB  . THR B 1 232 ? 9.112  35.196 74.948  1.00 36.16  ? 232 THR B CB  1 
ATOM   4152 O OG1 . THR B 1 232 ? 8.775  33.809 74.811  1.00 36.16  ? 232 THR B OG1 1 
ATOM   4153 C CG2 . THR B 1 232 ? 9.581  35.740 73.603  1.00 36.16  ? 232 THR B CG2 1 
ATOM   4154 N N   . ASP B 1 233 ? 10.034 34.312 78.172  1.00 28.99  ? 233 ASP B N   1 
ATOM   4155 C CA  . ASP B 1 233 ? 9.544  34.114 79.522  1.00 28.99  ? 233 ASP B CA  1 
ATOM   4156 C C   . ASP B 1 233 ? 10.674 34.393 80.506  1.00 28.99  ? 233 ASP B C   1 
ATOM   4157 O O   . ASP B 1 233 ? 10.757 33.763 81.564  1.00 28.99  ? 233 ASP B O   1 
ATOM   4158 C CB  . ASP B 1 233 ? 9.064  32.677 79.678  1.00 34.28  ? 233 ASP B CB  1 
ATOM   4159 C CG  . ASP B 1 233 ? 10.192 31.684 79.618  1.00 34.28  ? 233 ASP B CG  1 
ATOM   4160 O OD1 . ASP B 1 233 ? 11.262 32.011 79.053  1.00 34.28  ? 233 ASP B OD1 1 
ATOM   4161 O OD2 . ASP B 1 233 ? 10.006 30.564 80.131  1.00 34.28  ? 233 ASP B OD2 1 
ATOM   4162 N N   . TYR B 1 234 ? 11.541 35.336 80.149  1.00 31.44  ? 234 TYR B N   1 
ATOM   4163 C CA  . TYR B 1 234 ? 12.668 35.693 80.996  1.00 31.44  ? 234 TYR B CA  1 
ATOM   4164 C C   . TYR B 1 234 ? 12.240 36.504 82.211  1.00 31.44  ? 234 TYR B C   1 
ATOM   4165 O O   . TYR B 1 234 ? 11.190 37.135 82.206  1.00 31.44  ? 234 TYR B O   1 
ATOM   4166 C CB  . TYR B 1 234 ? 13.695 36.480 80.197  1.00 22.01  ? 234 TYR B CB  1 
ATOM   4167 C CG  . TYR B 1 234 ? 13.144 37.722 79.545  1.00 22.01  ? 234 TYR B CG  1 
ATOM   4168 C CD1 . TYR B 1 234 ? 12.596 37.678 78.264  1.00 22.01  ? 234 TYR B CD1 1 
ATOM   4169 C CD2 . TYR B 1 234 ? 13.212 38.956 80.184  1.00 22.01  ? 234 TYR B CD2 1 
ATOM   4170 C CE1 . TYR B 1 234 ? 12.146 38.827 77.637  1.00 22.01  ? 234 TYR B CE1 1 
ATOM   4171 C CE2 . TYR B 1 234 ? 12.757 40.112 79.559  1.00 22.01  ? 234 TYR B CE2 1 
ATOM   4172 C CZ  . TYR B 1 234 ? 12.228 40.036 78.288  1.00 22.01  ? 234 TYR B CZ  1 
ATOM   4173 O OH  . TYR B 1 234 ? 11.754 41.164 77.671  1.00 22.01  ? 234 TYR B OH  1 
ATOM   4174 N N   . THR B 1 235 ? 13.065 36.486 83.252  1.00 26.32  ? 235 THR B N   1 
ATOM   4175 C CA  . THR B 1 235 ? 12.774 37.211 84.482  1.00 26.32  ? 235 THR B CA  1 
ATOM   4176 C C   . THR B 1 235 ? 13.649 38.428 84.646  1.00 26.32  ? 235 THR B C   1 
ATOM   4177 O O   . THR B 1 235 ? 14.346 38.840 83.729  1.00 26.32  ? 235 THR B O   1 
ATOM   4178 C CB  . THR B 1 235 ? 12.981 36.339 85.722  1.00 18.24  ? 235 THR B CB  1 
ATOM   4179 O OG1 . THR B 1 235 ? 14.364 35.999 85.849  1.00 18.24  ? 235 THR B OG1 1 
ATOM   4180 C CG2 . THR B 1 235 ? 12.158 35.081 85.617  1.00 18.24  ? 235 THR B CG2 1 
ATOM   4181 N N   . SER B 1 236 ? 13.614 38.998 85.837  1.00 31.43  ? 236 SER B N   1 
ATOM   4182 C CA  . SER B 1 236 ? 14.402 40.175 86.112  1.00 31.43  ? 236 SER B CA  1 
ATOM   4183 C C   . SER B 1 236 ? 15.882 39.909 86.198  1.00 31.43  ? 236 SER B C   1 
ATOM   4184 O O   . SER B 1 236 ? 16.676 40.822 86.017  1.00 31.43  ? 236 SER B O   1 
ATOM   4185 C CB  . SER B 1 236 ? 13.924 40.818 87.397  1.00 49.49  ? 236 SER B CB  1 
ATOM   4186 O OG  . SER B 1 236 ? 12.705 41.485 87.147  1.00 49.49  ? 236 SER B OG  1 
ATOM   4187 N N   . SER B 1 237 ? 16.256 38.664 86.478  1.00 30.23  ? 237 SER B N   1 
ATOM   4188 C CA  . SER B 1 237 ? 17.650 38.274 86.631  1.00 30.23  ? 237 SER B CA  1 
ATOM   4189 C C   . SER B 1 237 ? 18.473 38.685 85.409  1.00 30.23  ? 237 SER B C   1 
ATOM   4190 O O   . SER B 1 237 ? 19.696 38.643 85.400  1.00 30.23  ? 237 SER B O   1 
ATOM   4191 C CB  . SER B 1 237 ? 17.703 36.757 86.813  1.00 31.67  ? 237 SER B CB  1 
ATOM   4192 O OG  . SER B 1 237 ? 16.897 36.134 85.813  1.00 31.67  ? 237 SER B OG  1 
ATOM   4193 N N   . ILE B 1 238 ? 17.750 39.055 84.335  1.00 19.62  ? 238 ILE B N   1 
ATOM   4194 C CA  . ILE B 1 238 ? 18.435 39.494 83.126  1.00 19.62  ? 238 ILE B CA  1 
ATOM   4195 C C   . ILE B 1 238 ? 19.168 40.819 83.347  1.00 19.62  ? 238 ILE B C   1 
ATOM   4196 O O   . ILE B 1 238 ? 20.184 41.117 82.732  1.00 19.62  ? 238 ILE B O   1 
ATOM   4197 C CB  . ILE B 1 238 ? 17.396 39.636 82.013  1.00 27.89  ? 238 ILE B CB  1 
ATOM   4198 C CG1 . ILE B 1 238 ? 16.362 40.703 82.379  1.00 27.89  ? 238 ILE B CG1 1 
ATOM   4199 C CG2 . ILE B 1 238 ? 16.651 38.301 81.826  1.00 27.89  ? 238 ILE B CG2 1 
ATOM   4200 C CD1 . ILE B 1 238 ? 15.546 41.157 81.169  0.00 27.89  ? 238 ILE B CD1 1 
ATOM   4201 N N   . ASP B 1 239 ? 18.589 41.646 84.238  1.00 28.07  ? 239 ASP B N   1 
ATOM   4202 C CA  . ASP B 1 239 ? 19.275 42.870 84.633  1.00 28.07  ? 239 ASP B CA  1 
ATOM   4203 C C   . ASP B 1 239 ? 20.539 42.545 85.430  1.00 28.07  ? 239 ASP B C   1 
ATOM   4204 O O   . ASP B 1 239 ? 21.525 43.271 85.427  1.00 28.07  ? 239 ASP B O   1 
ATOM   4205 C CB  . ASP B 1 239 ? 18.318 43.689 85.501  1.00 24.72  ? 239 ASP B CB  1 
ATOM   4206 C CG  . ASP B 1 239 ? 17.384 44.489 84.607  1.00 24.72  ? 239 ASP B CG  1 
ATOM   4207 O OD1 . ASP B 1 239 ? 17.682 44.598 83.418  1.00 24.72  ? 239 ASP B OD1 1 
ATOM   4208 O OD2 . ASP B 1 239 ? 16.379 44.988 85.102  1.00 24.72  ? 239 ASP B OD2 1 
ATOM   4209 N N   . VAL B 1 240 ? 20.463 41.417 86.164  1.00 19.83  ? 240 VAL B N   1 
ATOM   4210 C CA  . VAL B 1 240 ? 21.604 40.983 86.959  1.00 19.83  ? 240 VAL B CA  1 
ATOM   4211 C C   . VAL B 1 240 ? 22.764 40.533 86.069  1.00 19.83  ? 240 VAL B C   1 
ATOM   4212 O O   . VAL B 1 240 ? 23.911 40.928 86.237  1.00 19.83  ? 240 VAL B O   1 
ATOM   4213 C CB  . VAL B 1 240 ? 21.149 39.821 87.844  1.00 18.12  ? 240 VAL B CB  1 
ATOM   4214 C CG1 . VAL B 1 240 ? 22.353 39.195 88.543  1.00 18.12  ? 240 VAL B CG1 1 
ATOM   4215 C CG2 . VAL B 1 240 ? 20.166 40.314 88.888  1.00 18.12  ? 240 VAL B CG2 1 
ATOM   4216 N N   . TRP B 1 241 ? 22.437 39.638 85.119  1.00 21.79  ? 241 TRP B N   1 
ATOM   4217 C CA  . TRP B 1 241 ? 23.458 39.179 84.187  1.00 21.79  ? 241 TRP B CA  1 
ATOM   4218 C C   . TRP B 1 241 ? 24.140 40.359 83.494  1.00 21.79  ? 241 TRP B C   1 
ATOM   4219 O O   . TRP B 1 241 ? 25.346 40.391 83.291  1.00 21.79  ? 241 TRP B O   1 
ATOM   4220 C CB  . TRP B 1 241 ? 22.786 38.281 83.147  1.00 24.64  ? 241 TRP B CB  1 
ATOM   4221 C CG  . TRP B 1 241 ? 23.715 38.010 82.026  1.00 24.64  ? 241 TRP B CG  1 
ATOM   4222 C CD1 . TRP B 1 241 ? 23.990 38.859 80.931  1.00 24.64  ? 241 TRP B CD1 1 
ATOM   4223 C CD2 . TRP B 1 241 ? 24.504 36.812 81.827  1.00 24.64  ? 241 TRP B CD2 1 
ATOM   4224 N NE1 . TRP B 1 241 ? 24.878 38.313 80.059  1.00 24.64  ? 241 TRP B NE1 1 
ATOM   4225 C CE2 . TRP B 1 241 ? 25.228 36.984 80.620  1.00 24.64  ? 241 TRP B CE2 1 
ATOM   4226 C CE3 . TRP B 1 241 ? 24.662 35.637 82.556  1.00 24.64  ? 241 TRP B CE3 1 
ATOM   4227 C CZ2 . TRP B 1 241 ? 26.082 35.986 80.177  1.00 24.64  ? 241 TRP B CZ2 1 
ATOM   4228 C CZ3 . TRP B 1 241 ? 25.515 34.639 82.113  1.00 24.64  ? 241 TRP B CZ3 1 
ATOM   4229 C CH2 . TRP B 1 241 ? 26.229 34.817 80.914  1.00 24.64  ? 241 TRP B CH2 1 
ATOM   4230 N N   . SER B 1 242 ? 23.306 41.334 83.087  1.00 16.88  ? 242 SER B N   1 
ATOM   4231 C CA  . SER B 1 242 ? 23.850 42.531 82.456  1.00 16.88  ? 242 SER B CA  1 
ATOM   4232 C C   . SER B 1 242 ? 24.794 43.276 83.400  1.00 16.88  ? 242 SER B C   1 
ATOM   4233 O O   . SER B 1 242 ? 25.876 43.708 83.025  1.00 16.88  ? 242 SER B O   1 
ATOM   4234 C CB  . SER B 1 242 ? 22.681 43.440 82.074  1.00 18.23  ? 242 SER B CB  1 
ATOM   4235 O OG  . SER B 1 242 ? 22.036 42.918 80.912  1.00 18.23  ? 242 SER B OG  1 
ATOM   4236 N N   . ALA B 1 243 ? 24.363 43.386 84.652  1.00 29.48  ? 243 ALA B N   1 
ATOM   4237 C CA  . ALA B 1 243 ? 25.178 44.022 85.677  1.00 29.48  ? 243 ALA B CA  1 
ATOM   4238 C C   . ALA B 1 243 ? 26.497 43.267 85.783  1.00 29.48  ? 243 ALA B C   1 
ATOM   4239 O O   . ALA B 1 243 ? 27.556 43.875 85.901  1.00 29.48  ? 243 ALA B O   1 
ATOM   4240 C CB  . ALA B 1 243 ? 24.462 44.010 86.997  1.00 12.02  ? 243 ALA B CB  1 
ATOM   4241 N N   . GLY B 1 244 ? 26.435 41.941 85.733  1.00 26.93  ? 244 GLY B N   1 
ATOM   4242 C CA  . GLY B 1 244 ? 27.651 41.155 85.798  1.00 26.93  ? 244 GLY B CA  1 
ATOM   4243 C C   . GLY B 1 244 ? 28.591 41.487 84.651  1.00 26.93  ? 244 GLY B C   1 
ATOM   4244 O O   . GLY B 1 244 ? 29.805 41.495 84.822  1.00 26.93  ? 244 GLY B O   1 
ATOM   4245 N N   . CYS B 1 245 ? 28.041 41.755 83.475  1.00 22.38  ? 245 CYS B N   1 
ATOM   4246 C CA  . CYS B 1 245 ? 28.865 42.104 82.320  1.00 22.38  ? 245 CYS B CA  1 
ATOM   4247 C C   . CYS B 1 245 ? 29.507 43.478 82.495  1.00 22.38  ? 245 CYS B C   1 
ATOM   4248 O O   . CYS B 1 245 ? 30.571 43.745 81.955  1.00 22.38  ? 245 CYS B O   1 
ATOM   4249 C CB  . CYS B 1 245 ? 28.035 42.098 81.029  1.00 29.42  ? 245 CYS B CB  1 
ATOM   4250 S SG  . CYS B 1 245 ? 27.454 40.481 80.496  1.00 29.42  ? 245 CYS B SG  1 
ATOM   4251 N N   . VAL B 1 246 ? 28.850 44.360 83.238  1.00 21.80  ? 246 VAL B N   1 
ATOM   4252 C CA  . VAL B 1 246 ? 29.410 45.677 83.460  1.00 21.80  ? 246 VAL B CA  1 
ATOM   4253 C C   . VAL B 1 246 ? 30.540 45.576 84.469  1.00 21.80  ? 246 VAL B C   1 
ATOM   4254 O O   . VAL B 1 246 ? 31.546 46.257 84.329  1.00 21.80  ? 246 VAL B O   1 
ATOM   4255 C CB  . VAL B 1 246 ? 28.363 46.666 83.969  1.00 17.88  ? 246 VAL B CB  1 
ATOM   4256 C CG1 . VAL B 1 246 ? 29.040 47.982 84.338  1.00 17.88  ? 246 VAL B CG1 1 
ATOM   4257 C CG2 . VAL B 1 246 ? 27.305 46.888 82.904  1.00 17.88  ? 246 VAL B CG2 1 
ATOM   4258 N N   . LEU B 1 247 ? 30.376 44.723 85.480  1.00 25.71  ? 247 LEU B N   1 
ATOM   4259 C CA  . LEU B 1 247 ? 31.412 44.524 86.491  1.00 25.71  ? 247 LEU B CA  1 
ATOM   4260 C C   . LEU B 1 247 ? 32.645 43.925 85.832  1.00 25.71  ? 247 LEU B C   1 
ATOM   4261 O O   . LEU B 1 247 ? 33.760 44.382 86.042  1.00 25.71  ? 247 LEU B O   1 
ATOM   4262 C CB  . LEU B 1 247 ? 30.919 43.588 87.598  1.00 19.87  ? 247 LEU B CB  1 
ATOM   4263 C CG  . LEU B 1 247 ? 31.979 42.855 88.428  1.00 19.87  ? 247 LEU B CG  1 
ATOM   4264 C CD1 . LEU B 1 247 ? 32.758 43.811 89.310  1.00 19.87  ? 247 LEU B CD1 1 
ATOM   4265 C CD2 . LEU B 1 247 ? 31.294 41.808 89.259  1.00 19.87  ? 247 LEU B CD2 1 
ATOM   4266 N N   . ALA B 1 248 ? 32.438 42.890 85.033  1.00 32.57  ? 248 ALA B N   1 
ATOM   4267 C CA  . ALA B 1 248 ? 33.543 42.253 84.350  1.00 32.57  ? 248 ALA B CA  1 
ATOM   4268 C C   . ALA B 1 248 ? 34.275 43.276 83.477  1.00 32.57  ? 248 ALA B C   1 
ATOM   4269 O O   . ALA B 1 248 ? 35.502 43.409 83.558  1.00 32.57  ? 248 ALA B O   1 
ATOM   4270 C CB  . ALA B 1 248 ? 33.031 41.102 83.506  1.00 22.47  ? 248 ALA B CB  1 
ATOM   4271 N N   . GLU B 1 249 ? 33.525 44.010 82.656  1.00 30.07  ? 249 GLU B N   1 
ATOM   4272 C CA  . GLU B 1 249 ? 34.115 45.015 81.773  1.00 30.07  ? 249 GLU B CA  1 
ATOM   4273 C C   . GLU B 1 249 ? 34.978 46.014 82.542  1.00 30.07  ? 249 GLU B C   1 
ATOM   4274 O O   . GLU B 1 249 ? 36.026 46.436 82.045  1.00 30.07  ? 249 GLU B O   1 
ATOM   4275 C CB  . GLU B 1 249 ? 33.020 45.766 80.995  1.00 23.84  ? 249 GLU B CB  1 
ATOM   4276 C CG  . GLU B 1 249 ? 33.542 46.725 79.924  1.00 23.84  ? 249 GLU B CG  1 
ATOM   4277 C CD  . GLU B 1 249 ? 32.492 47.106 78.877  1.00 23.84  ? 249 GLU B CD  1 
ATOM   4278 O OE1 . GLU B 1 249 ? 31.435 46.441 78.798  1.00 23.84  ? 249 GLU B OE1 1 
ATOM   4279 O OE2 . GLU B 1 249 ? 32.732 48.064 78.115  1.00 23.84  ? 249 GLU B OE2 1 
ATOM   4280 N N   . LEU B 1 250 ? 34.546 46.393 83.747  1.00 27.10  ? 250 LEU B N   1 
ATOM   4281 C CA  . LEU B 1 250 ? 35.314 47.345 84.539  1.00 27.10  ? 250 LEU B CA  1 
ATOM   4282 C C   . LEU B 1 250 ? 36.603 46.720 85.010  1.00 27.10  ? 250 LEU B C   1 
ATOM   4283 O O   . LEU B 1 250 ? 37.619 47.393 85.130  1.00 27.10  ? 250 LEU B O   1 
ATOM   4284 C CB  . LEU B 1 250 ? 34.521 47.836 85.743  1.00 20.94  ? 250 LEU B CB  1 
ATOM   4285 C CG  . LEU B 1 250 ? 33.316 48.691 85.377  1.00 20.94  ? 250 LEU B CG  1 
ATOM   4286 C CD1 . LEU B 1 250 ? 32.576 49.088 86.638  1.00 20.94  ? 250 LEU B CD1 1 
ATOM   4287 C CD2 . LEU B 1 250 ? 33.783 49.908 84.576  1.00 20.94  ? 250 LEU B CD2 1 
ATOM   4288 N N   . LEU B 1 251 ? 36.563 45.424 85.272  1.00 33.59  ? 251 LEU B N   1 
ATOM   4289 C CA  . LEU B 1 251 ? 37.750 44.735 85.712  1.00 33.59  ? 251 LEU B CA  1 
ATOM   4290 C C   . LEU B 1 251 ? 38.720 44.504 84.537  1.00 33.59  ? 251 LEU B C   1 
ATOM   4291 O O   . LEU B 1 251 ? 39.932 44.647 84.685  1.00 33.59  ? 251 LEU B O   1 
ATOM   4292 C CB  . LEU B 1 251 ? 37.364 43.405 86.350  1.00 20.83  ? 251 LEU B CB  1 
ATOM   4293 C CG  . LEU B 1 251 ? 36.515 43.441 87.618  1.00 20.83  ? 251 LEU B CG  1 
ATOM   4294 C CD1 . LEU B 1 251 ? 36.190 42.019 88.020  1.00 20.83  ? 251 LEU B CD1 1 
ATOM   4295 C CD2 . LEU B 1 251 ? 37.253 44.145 88.745  1.00 20.83  ? 251 LEU B CD2 1 
ATOM   4296 N N   . LEU B 1 252 ? 38.182 44.188 83.363  1.00 29.76  ? 252 LEU B N   1 
ATOM   4297 C CA  . LEU B 1 252 ? 39.003 43.900 82.189  1.00 29.76  ? 252 LEU B CA  1 
ATOM   4298 C C   . LEU B 1 252 ? 39.405 45.066 81.298  1.00 29.76  ? 252 LEU B C   1 
ATOM   4299 O O   . LEU B 1 252 ? 40.381 44.964 80.556  1.00 29.76  ? 252 LEU B O   1 
ATOM   4300 C CB  . LEU B 1 252 ? 38.290 42.872 81.311  1.00 41.19  ? 252 LEU B CB  1 
ATOM   4301 C CG  . LEU B 1 252 ? 38.095 41.469 81.874  1.00 41.19  ? 252 LEU B CG  1 
ATOM   4302 C CD1 . LEU B 1 252 ? 36.941 40.803 81.149  1.00 41.19  ? 252 LEU B CD1 1 
ATOM   4303 C CD2 . LEU B 1 252 ? 39.391 40.673 81.743  1.00 41.19  ? 252 LEU B CD2 1 
ATOM   4304 N N   . GLY B 1 253 ? 38.649 46.155 81.328  1.00 21.90  ? 253 GLY B N   1 
ATOM   4305 C CA  . GLY B 1 253 ? 38.982 47.272 80.470  1.00 21.90  ? 253 GLY B CA  1 
ATOM   4306 C C   . GLY B 1 253 ? 38.396 47.086 79.082  1.00 21.90  ? 253 GLY B C   1 
ATOM   4307 O O   . GLY B 1 253 ? 38.745 47.811 78.149  1.00 21.90  ? 253 GLY B O   1 
ATOM   4308 N N   . GLN B 1 254 ? 37.513 46.101 78.935  1.00 27.16  ? 254 GLN B N   1 
ATOM   4309 C CA  . GLN B 1 254 ? 36.855 45.840 77.659  1.00 27.16  ? 254 GLN B CA  1 
ATOM   4310 C C   . GLN B 1 254 ? 35.671 44.897 77.845  1.00 27.16  ? 254 GLN B C   1 
ATOM   4311 O O   . GLN B 1 254 ? 35.587 44.171 78.827  1.00 27.16  ? 254 GLN B O   1 
ATOM   4312 C CB  . GLN B 1 254 ? 37.847 45.270 76.635  1.00 44.50  ? 254 GLN B CB  1 
ATOM   4313 C CG  . GLN B 1 254 ? 38.381 43.891 76.948  1.00 44.50  ? 254 GLN B CG  1 
ATOM   4314 C CD  . GLN B 1 254 ? 39.390 43.417 75.920  1.00 44.50  ? 254 GLN B CD  1 
ATOM   4315 O OE1 . GLN B 1 254 ? 39.790 42.257 75.918  1.00 44.50  ? 254 GLN B OE1 1 
ATOM   4316 N NE2 . GLN B 1 254 ? 39.808 44.318 75.038  1.00 44.50  ? 254 GLN B NE2 1 
ATOM   4317 N N   . PRO B 1 255 ? 34.727 44.905 76.901  1.00 40.09  ? 255 PRO B N   1 
ATOM   4318 C CA  . PRO B 1 255 ? 33.574 44.017 77.052  1.00 40.09  ? 255 PRO B CA  1 
ATOM   4319 C C   . PRO B 1 255 ? 34.052 42.591 77.256  1.00 40.09  ? 255 PRO B C   1 
ATOM   4320 O O   . PRO B 1 255 ? 35.067 42.206 76.692  1.00 40.09  ? 255 PRO B O   1 
ATOM   4321 C CB  . PRO B 1 255 ? 32.840 44.186 75.724  1.00 24.34  ? 255 PRO B CB  1 
ATOM   4322 C CG  . PRO B 1 255 ? 33.211 45.554 75.302  1.00 24.34  ? 255 PRO B CG  1 
ATOM   4323 C CD  . PRO B 1 255 ? 34.678 45.604 75.611  1.00 24.34  ? 255 PRO B CD  1 
ATOM   4324 N N   . ILE B 1 256 ? 33.343 41.802 78.050  1.00 32.18  ? 256 ILE B N   1 
ATOM   4325 C CA  . ILE B 1 256 ? 33.771 40.425 78.244  1.00 32.18  ? 256 ILE B CA  1 
ATOM   4326 C C   . ILE B 1 256 ? 33.139 39.458 77.244  1.00 32.18  ? 256 ILE B C   1 
ATOM   4327 O O   . ILE B 1 256 ? 33.733 38.443 76.918  1.00 32.18  ? 256 ILE B O   1 
ATOM   4328 C CB  . ILE B 1 256 ? 33.476 39.922 79.678  1.00 27.08  ? 256 ILE B CB  1 
ATOM   4329 C CG1 . ILE B 1 256 ? 33.865 38.445 79.793  1.00 27.08  ? 256 ILE B CG1 1 
ATOM   4330 C CG2 . ILE B 1 256 ? 32.017 40.124 80.011  1.00 27.08  ? 256 ILE B CG2 1 
ATOM   4331 C CD1 . ILE B 1 256 ? 33.659 37.832 81.170  1.00 27.08  ? 256 ILE B CD1 1 
ATOM   4332 N N   . PHE B 1 257 ? 31.946 39.771 76.750  1.00 27.33  ? 257 PHE B N   1 
ATOM   4333 C CA  . PHE B 1 257 ? 31.257 38.891 75.800  1.00 27.33  ? 257 PHE B CA  1 
ATOM   4334 C C   . PHE B 1 257 ? 30.880 39.592 74.504  1.00 27.33  ? 257 PHE B C   1 
ATOM   4335 O O   . PHE B 1 257 ? 29.701 39.733 74.197  1.00 27.33  ? 257 PHE B O   1 
ATOM   4336 C CB  . PHE B 1 257 ? 29.974 38.322 76.418  1.00 25.37  ? 257 PHE B CB  1 
ATOM   4337 C CG  . PHE B 1 257 ? 30.198 37.503 77.639  1.00 25.37  ? 257 PHE B CG  1 
ATOM   4338 C CD1 . PHE B 1 257 ? 31.077 36.430 77.620  1.00 25.37  ? 257 PHE B CD1 1 
ATOM   4339 C CD2 . PHE B 1 257 ? 29.508 37.780 78.806  1.00 25.37  ? 257 PHE B CD2 1 
ATOM   4340 C CE1 . PHE B 1 257 ? 31.262 35.629 78.755  1.00 25.37  ? 257 PHE B CE1 1 
ATOM   4341 C CE2 . PHE B 1 257 ? 29.681 36.992 79.949  1.00 25.37  ? 257 PHE B CE2 1 
ATOM   4342 C CZ  . PHE B 1 257 ? 30.562 35.913 79.921  1.00 25.37  ? 257 PHE B CZ  1 
ATOM   4343 N N   . PRO B 1 258 ? 31.874 40.039 73.726  1.00 27.82  ? 258 PRO B N   1 
ATOM   4344 C CA  . PRO B 1 258 ? 31.596 40.723 72.464  1.00 27.82  ? 258 PRO B CA  1 
ATOM   4345 C C   . PRO B 1 258 ? 31.270 39.739 71.348  1.00 27.82  ? 258 PRO B C   1 
ATOM   4346 O O   . PRO B 1 258 ? 31.434 38.517 71.502  1.00 27.82  ? 258 PRO B O   1 
ATOM   4347 C CB  . PRO B 1 258 ? 32.888 41.465 72.199  1.00 18.96  ? 258 PRO B CB  1 
ATOM   4348 C CG  . PRO B 1 258 ? 33.892 40.478 72.646  1.00 18.96  ? 258 PRO B CG  1 
ATOM   4349 C CD  . PRO B 1 258 ? 33.326 40.006 73.977  1.00 18.96  ? 258 PRO B CD  1 
ATOM   4350 N N   . GLY B 1 259 ? 30.820 40.291 70.226  1.00 32.91  ? 259 GLY B N   1 
ATOM   4351 C CA  . GLY B 1 259 ? 30.470 39.494 69.065  1.00 32.91  ? 259 GLY B CA  1 
ATOM   4352 C C   . GLY B 1 259 ? 29.362 40.156 68.273  1.00 32.91  ? 259 GLY B C   1 
ATOM   4353 O O   . GLY B 1 259 ? 28.355 40.555 68.843  1.00 32.91  ? 259 GLY B O   1 
ATOM   4354 N N   . ASP B 1 260 ? 29.530 40.285 66.963  1.00 29.78  ? 260 ASP B N   1 
ATOM   4355 C CA  . ASP B 1 260 ? 28.498 40.916 66.152  1.00 29.78  ? 260 ASP B CA  1 
ATOM   4356 C C   . ASP B 1 260 ? 27.260 40.038 65.948  1.00 29.78  ? 260 ASP B C   1 
ATOM   4357 O O   . ASP B 1 260 ? 26.215 40.527 65.523  1.00 29.78  ? 260 ASP B O   1 
ATOM   4358 C CB  . ASP B 1 260 ? 29.066 41.337 64.797  1.00 55.97  ? 260 ASP B CB  1 
ATOM   4359 C CG  . ASP B 1 260 ? 30.193 42.338 64.931  1.00 55.97  ? 260 ASP B CG  1 
ATOM   4360 O OD1 . ASP B 1 260 ? 30.044 43.308 65.714  1.00 55.97  ? 260 ASP B OD1 1 
ATOM   4361 O OD2 . ASP B 1 260 ? 31.230 42.161 64.247  1.00 55.97  ? 260 ASP B OD2 1 
ATOM   4362 N N   . SER B 1 261 ? 27.386 38.747 66.243  1.00 27.61  ? 261 SER B N   1 
ATOM   4363 C CA  . SER B 1 261 ? 26.267 37.823 66.108  1.00 27.61  ? 261 SER B CA  1 
ATOM   4364 C C   . SER B 1 261 ? 26.016 37.098 67.437  1.00 27.61  ? 261 SER B C   1 
ATOM   4365 O O   . SER B 1 261 ? 26.881 37.072 68.311  1.00 27.61  ? 261 SER B O   1 
ATOM   4366 C CB  . SER B 1 261 ? 26.557 36.790 65.023  1.00 21.12  ? 261 SER B CB  1 
ATOM   4367 O OG  . SER B 1 261 ? 27.431 35.784 65.504  1.00 21.12  ? 261 SER B OG  1 
ATOM   4368 N N   . GLY B 1 262 ? 24.829 36.519 67.585  1.00 31.64  ? 262 GLY B N   1 
ATOM   4369 C CA  . GLY B 1 262 ? 24.525 35.784 68.798  1.00 31.64  ? 262 GLY B CA  1 
ATOM   4370 C C   . GLY B 1 262 ? 25.488 34.624 68.950  1.00 31.64  ? 262 GLY B C   1 
ATOM   4371 O O   . GLY B 1 262 ? 25.879 34.265 70.060  1.00 31.64  ? 262 GLY B O   1 
ATOM   4372 N N   . VAL B 1 263 ? 25.878 34.035 67.823  1.00 31.86  ? 263 VAL B N   1 
ATOM   4373 C CA  . VAL B 1 263 ? 26.809 32.913 67.819  1.00 31.86  ? 263 VAL B CA  1 
ATOM   4374 C C   . VAL B 1 263 ? 28.136 33.311 68.443  1.00 31.86  ? 263 VAL B C   1 
ATOM   4375 O O   . VAL B 1 263 ? 28.612 32.669 69.380  1.00 31.86  ? 263 VAL B O   1 
ATOM   4376 C CB  . VAL B 1 263 ? 27.089 32.414 66.389  1.00 43.99  ? 263 VAL B CB  1 
ATOM   4377 C CG1 . VAL B 1 263 ? 28.138 31.299 66.419  1.00 43.99  ? 263 VAL B CG1 1 
ATOM   4378 C CG2 . VAL B 1 263 ? 25.826 31.904 65.773  1.00 43.99  ? 263 VAL B CG2 1 
ATOM   4379 N N   . ASP B 1 264 ? 28.742 34.360 67.905  1.00 33.92  ? 264 ASP B N   1 
ATOM   4380 C CA  . ASP B 1 264 ? 30.011 34.816 68.441  1.00 33.92  ? 264 ASP B CA  1 
ATOM   4381 C C   . ASP B 1 264 ? 29.872 35.056 69.940  1.00 33.92  ? 264 ASP B C   1 
ATOM   4382 O O   . ASP B 1 264 ? 30.636 34.511 70.742  1.00 33.92  ? 264 ASP B O   1 
ATOM   4383 C CB  . ASP B 1 264 ? 30.458 36.100 67.747  1.00 58.74  ? 264 ASP B CB  1 
ATOM   4384 C CG  . ASP B 1 264 ? 30.641 35.923 66.251  1.00 58.74  ? 264 ASP B CG  1 
ATOM   4385 O OD1 . ASP B 1 264 ? 31.049 34.827 65.815  1.00 58.74  ? 264 ASP B OD1 1 
ATOM   4386 O OD2 . ASP B 1 264 ? 30.393 36.892 65.506  1.00 58.74  ? 264 ASP B OD2 1 
ATOM   4387 N N   . GLN B 1 265 ? 28.887 35.866 70.309  1.00 28.36  ? 265 GLN B N   1 
ATOM   4388 C CA  . GLN B 1 265 ? 28.634 36.166 71.707  1.00 28.36  ? 265 GLN B CA  1 
ATOM   4389 C C   . GLN B 1 265 ? 28.504 34.876 72.486  1.00 28.36  ? 265 GLN B C   1 
ATOM   4390 O O   . GLN B 1 265 ? 29.003 34.764 73.593  1.00 28.36  ? 265 GLN B O   1 
ATOM   4391 C CB  . GLN B 1 265 ? 27.358 36.989 71.857  1.00 26.30  ? 265 GLN B CB  1 
ATOM   4392 C CG  . GLN B 1 265 ? 27.451 38.354 71.233  1.00 26.30  ? 265 GLN B CG  1 
ATOM   4393 C CD  . GLN B 1 265 ? 26.205 39.162 71.438  1.00 26.30  ? 265 GLN B CD  1 
ATOM   4394 O OE1 . GLN B 1 265 ? 25.103 38.706 71.141  1.00 26.30  ? 265 GLN B OE1 1 
ATOM   4395 N NE2 . GLN B 1 265 ? 26.364 40.377 71.949  0.00 26.30  ? 265 GLN B NE2 1 
ATOM   4396 N N   . LEU B 1 266 ? 27.840 33.898 71.894  1.00 28.75  ? 266 LEU B N   1 
ATOM   4397 C CA  . LEU B 1 266 ? 27.657 32.613 72.543  1.00 28.75  ? 266 LEU B CA  1 
ATOM   4398 C C   . LEU B 1 266 ? 28.976 31.858 72.719  1.00 28.75  ? 266 LEU B C   1 
ATOM   4399 O O   . LEU B 1 266 ? 29.234 31.308 73.781  1.00 28.75  ? 266 LEU B O   1 
ATOM   4400 C CB  . LEU B 1 266 ? 26.662 31.774 71.744  1.00 28.63  ? 266 LEU B CB  1 
ATOM   4401 C CG  . LEU B 1 266 ? 25.330 31.442 72.413  1.00 28.63  ? 266 LEU B CG  1 
ATOM   4402 C CD1 . LEU B 1 266 ? 24.818 32.618 73.192  1.00 28.63  ? 266 LEU B CD1 1 
ATOM   4403 C CD2 . LEU B 1 266 ? 24.329 31.035 71.353  1.00 28.63  ? 266 LEU B CD2 1 
ATOM   4404 N N   . VAL B 1 267 ? 29.823 31.824 71.695  1.00 38.65  ? 267 VAL B N   1 
ATOM   4405 C CA  . VAL B 1 267 ? 31.091 31.110 71.853  1.00 38.65  ? 267 VAL B CA  1 
ATOM   4406 C C   . VAL B 1 267 ? 31.938 31.841 72.886  1.00 38.65  ? 267 VAL B C   1 
ATOM   4407 O O   . VAL B 1 267 ? 32.723 31.226 73.603  1.00 38.65  ? 267 VAL B O   1 
ATOM   4408 C CB  . VAL B 1 267 ? 31.891 30.980 70.513  1.00 39.88  ? 267 VAL B CB  1 
ATOM   4409 C CG1 . VAL B 1 267 ? 31.035 30.323 69.480  1.00 39.88  ? 267 VAL B CG1 1 
ATOM   4410 C CG2 . VAL B 1 267 ? 32.355 32.324 70.014  1.00 39.88  ? 267 VAL B CG2 1 
ATOM   4411 N N   . GLU B 1 268 ? 31.762 33.156 72.963  1.00 36.51  ? 268 GLU B N   1 
ATOM   4412 C CA  . GLU B 1 268 ? 32.499 33.958 73.922  1.00 36.51  ? 268 GLU B CA  1 
ATOM   4413 C C   . GLU B 1 268 ? 32.032 33.598 75.335  1.00 36.51  ? 268 GLU B C   1 
ATOM   4414 O O   . GLU B 1 268 ? 32.842 33.465 76.250  1.00 36.51  ? 268 GLU B O   1 
ATOM   4415 C CB  . GLU B 1 268 ? 32.268 35.450 73.643  1.00 54.53  ? 268 GLU B CB  1 
ATOM   4416 C CG  . GLU B 1 268 ? 33.548 36.277 73.557  1.00 54.53  ? 268 GLU B CG  1 
ATOM   4417 C CD  . GLU B 1 268 ? 34.549 35.674 72.592  1.00 54.53  ? 268 GLU B CD  1 
ATOM   4418 O OE1 . GLU B 1 268 ? 34.132 35.359 71.456  1.00 54.53  ? 268 GLU B OE1 1 
ATOM   4419 O OE2 . GLU B 1 268 ? 35.738 35.512 72.957  1.00 54.53  ? 268 GLU B OE2 1 
ATOM   4420 N N   . ILE B 1 269 ? 30.724 33.431 75.507  1.00 36.11  ? 269 ILE B N   1 
ATOM   4421 C CA  . ILE B 1 269 ? 30.169 33.076 76.807  1.00 36.11  ? 269 ILE B CA  1 
ATOM   4422 C C   . ILE B 1 269 ? 30.553 31.657 77.202  1.00 36.11  ? 269 ILE B C   1 
ATOM   4423 O O   . ILE B 1 269 ? 30.924 31.393 78.353  1.00 36.11  ? 269 ILE B O   1 
ATOM   4424 C CB  . ILE B 1 269 ? 28.638 33.169 76.811  1.00 18.31  ? 269 ILE B CB  1 
ATOM   4425 C CG1 . ILE B 1 269 ? 28.204 34.625 76.758  1.00 18.31  ? 269 ILE B CG1 1 
ATOM   4426 C CG2 . ILE B 1 269 ? 28.081 32.524 78.060  1.00 18.31  ? 269 ILE B CG2 1 
ATOM   4427 C CD1 . ILE B 1 269 ? 26.728 34.796 76.506  1.00 18.31  ? 269 ILE B CD1 1 
ATOM   4428 N N   . ILE B 1 270 ? 30.447 30.744 76.244  1.00 33.52  ? 270 ILE B N   1 
ATOM   4429 C CA  . ILE B 1 270 ? 30.780 29.354 76.483  1.00 33.52  ? 270 ILE B CA  1 
ATOM   4430 C C   . ILE B 1 270 ? 32.253 29.247 76.834  1.00 33.52  ? 270 ILE B C   1 
ATOM   4431 O O   . ILE B 1 270 ? 32.630 28.466 77.702  1.00 33.52  ? 270 ILE B O   1 
ATOM   4432 C CB  . ILE B 1 270 ? 30.484 28.486 75.244  1.00 28.24  ? 270 ILE B CB  1 
ATOM   4433 C CG1 . ILE B 1 270 ? 28.987 28.549 74.915  1.00 28.24  ? 270 ILE B CG1 1 
ATOM   4434 C CG2 . ILE B 1 270 ? 30.925 27.048 75.503  1.00 28.24  ? 270 ILE B CG2 1 
ATOM   4435 C CD1 . ILE B 1 270 ? 28.593 27.813 73.666  1.00 28.24  ? 270 ILE B CD1 1 
ATOM   4436 N N   . LYS B 1 271 ? 33.083 30.041 76.171  1.00 38.26  ? 271 LYS B N   1 
ATOM   4437 C CA  . LYS B 1 271 ? 34.509 30.010 76.456  1.00 38.26  ? 271 LYS B CA  1 
ATOM   4438 C C   . LYS B 1 271 ? 34.784 30.135 77.957  1.00 38.26  ? 271 LYS B C   1 
ATOM   4439 O O   . LYS B 1 271 ? 35.520 29.324 78.535  1.00 38.26  ? 271 LYS B O   1 
ATOM   4440 C CB  . LYS B 1 271 ? 35.245 31.129 75.707  1.00 53.65  ? 271 LYS B CB  1 
ATOM   4441 C CG  . LYS B 1 271 ? 35.912 30.693 74.408  1.00 53.65  ? 271 LYS B CG  1 
ATOM   4442 C CD  . LYS B 1 271 ? 36.435 31.900 73.617  1.00 53.65  ? 271 LYS B CD  1 
ATOM   4443 C CE  . LYS B 1 271 ? 37.134 31.464 72.321  1.00 53.65  ? 271 LYS B CE  1 
ATOM   4444 N NZ  . LYS B 1 271 ? 37.221 32.531 71.253  1.00 53.65  ? 271 LYS B NZ  1 
ATOM   4445 N N   . VAL B 1 272 ? 34.194 31.131 78.607  1.00 44.83  ? 272 VAL B N   1 
ATOM   4446 C CA  . VAL B 1 272 ? 34.464 31.271 80.026  1.00 44.83  ? 272 VAL B CA  1 
ATOM   4447 C C   . VAL B 1 272 ? 33.527 30.498 80.939  1.00 44.83  ? 272 VAL B C   1 
ATOM   4448 O O   . VAL B 1 272 ? 33.924 30.143 82.039  1.00 44.83  ? 272 VAL B O   1 
ATOM   4449 C CB  . VAL B 1 272 ? 34.538 32.765 80.453  1.00 28.34  ? 272 VAL B CB  1 
ATOM   4450 C CG1 . VAL B 1 272 ? 34.172 33.656 79.276  1.00 28.34  ? 272 VAL B CG1 1 
ATOM   4451 C CG2 . VAL B 1 272 ? 33.662 33.023 81.678  1.00 28.34  ? 272 VAL B CG2 1 
ATOM   4452 N N   . LEU B 1 273 ? 32.303 30.208 80.514  1.00 41.39  ? 273 LEU B N   1 
ATOM   4453 C CA  . LEU B 1 273 ? 31.414 29.450 81.400  1.00 41.39  ? 273 LEU B CA  1 
ATOM   4454 C C   . LEU B 1 273 ? 31.427 27.955 81.083  1.00 41.39  ? 273 LEU B C   1 
ATOM   4455 O O   . LEU B 1 273 ? 30.767 27.164 81.746  1.00 41.39  ? 273 LEU B O   1 
ATOM   4456 C CB  . LEU B 1 273 ? 29.967 29.947 81.306  1.00 34.53  ? 273 LEU B CB  1 
ATOM   4457 C CG  . LEU B 1 273 ? 29.619 31.415 81.542  1.00 34.53  ? 273 LEU B CG  1 
ATOM   4458 C CD1 . LEU B 1 273 ? 28.145 31.488 81.883  1.00 34.53  ? 273 LEU B CD1 1 
ATOM   4459 C CD2 . LEU B 1 273 ? 30.436 32.007 82.671  1.00 34.53  ? 273 LEU B CD2 1 
ATOM   4460 N N   . GLY B 1 274 ? 32.185 27.554 80.075  1.00 42.38  ? 274 GLY B N   1 
ATOM   4461 C CA  . GLY B 1 274 ? 32.188 26.147 79.724  1.00 42.38  ? 274 GLY B CA  1 
ATOM   4462 C C   . GLY B 1 274 ? 30.885 25.899 78.981  1.00 42.38  ? 274 GLY B C   1 
ATOM   4463 O O   . GLY B 1 274 ? 30.004 26.753 79.011  1.00 42.38  ? 274 GLY B O   1 
ATOM   4464 N N   . THR B 1 275 ? 30.751 24.764 78.296  1.00 39.88  ? 275 THR B N   1 
ATOM   4465 C CA  . THR B 1 275 ? 29.528 24.479 77.537  1.00 39.88  ? 275 THR B CA  1 
ATOM   4466 C C   . THR B 1 275 ? 28.324 24.418 78.497  1.00 39.88  ? 275 THR B C   1 
ATOM   4467 O O   . THR B 1 275 ? 28.463 24.185 79.677  1.00 39.88  ? 275 THR B O   1 
ATOM   4468 C CB  . THR B 1 275 ? 29.571 23.103 76.792  1.00 66.35  ? 275 THR B CB  1 
ATOM   4469 O OG1 . THR B 1 275 ? 30.918 22.733 76.458  1.00 66.35  ? 275 THR B OG1 1 
ATOM   4470 C CG2 . THR B 1 275 ? 28.741 23.178 75.512  1.00 66.35  ? 275 THR B CG2 1 
ATOM   4471 N N   . PRO B 1 276 ? 27.117 24.620 77.983  1.00 61.18  ? 276 PRO B N   1 
ATOM   4472 C CA  . PRO B 1 276 ? 25.963 24.559 78.890  1.00 61.18  ? 276 PRO B CA  1 
ATOM   4473 C C   . PRO B 1 276 ? 25.533 23.112 78.966  1.00 61.18  ? 276 PRO B C   1 
ATOM   4474 O O   . PRO B 1 276 ? 25.862 22.338 78.071  1.00 61.18  ? 276 PRO B O   1 
ATOM   4475 C CB  . PRO B 1 276 ? 24.909 25.410 78.205  1.00 58.97  ? 276 PRO B CB  1 
ATOM   4476 C CG  . PRO B 1 276 ? 25.574 25.950 76.991  1.00 58.97  ? 276 PRO B CG  1 
ATOM   4477 C CD  . PRO B 1 276 ? 26.751 25.148 76.667  1.00 58.97  ? 276 PRO B CD  1 
ATOM   4478 N N   . THR B 1 277 ? 24.820 22.756 80.030  1.00 61.20  ? 277 THR B N   1 
ATOM   4479 C CA  . THR B 1 277 ? 24.340 21.410 80.262  1.00 61.20  ? 277 THR B CA  1 
ATOM   4480 C C   . THR B 1 277 ? 22.928 21.439 79.766  1.00 61.20  ? 277 THR B C   1 
ATOM   4481 O O   . THR B 1 277 ? 22.373 22.520 79.559  1.00 61.20  ? 277 THR B O   1 
ATOM   4482 C CB  . THR B 1 277 ? 24.294 21.099 81.740  1.00 67.39  ? 277 THR B CB  1 
ATOM   4483 O OG1 . THR B 1 277 ? 23.608 19.868 81.950  1.00 67.39  ? 277 THR B OG1 1 
ATOM   4484 C CG2 . THR B 1 277 ? 23.554 22.149 82.456  0.00 67.39  ? 277 THR B CG2 1 
ATOM   4485 N N   . ARG B 1 278 ? 22.340 20.263 79.590  1.00 59.77  ? 278 ARG B N   1 
ATOM   4486 C CA  . ARG B 1 278 ? 20.988 20.191 79.053  1.00 59.77  ? 278 ARG B CA  1 
ATOM   4487 C C   . ARG B 1 278 ? 20.048 20.894 80.006  1.00 59.77  ? 278 ARG B C   1 
ATOM   4488 O O   . ARG B 1 278 ? 19.128 21.607 79.619  1.00 59.77  ? 278 ARG B O   1 
ATOM   4489 C CB  . ARG B 1 278 ? 20.579 18.722 78.865  1.00 80.99  ? 278 ARG B CB  1 
ATOM   4490 N N   . GLU B 1 279 ? 20.280 20.720 81.281  0.00 74.44  ? 279 GLU B N   1 
ATOM   4491 C CA  . GLU B 1 279 ? 19.394 21.370 82.194  1.00 74.44  ? 279 GLU B CA  1 
ATOM   4492 C C   . GLU B 1 279 ? 19.417 22.906 82.055  1.00 74.44  ? 279 GLU B C   1 
ATOM   4493 O O   . GLU B 1 279 ? 18.381 23.576 82.213  1.00 74.44  ? 279 GLU B O   1 
ATOM   4494 C CB  . GLU B 1 279 ? 19.770 20.956 83.616  1.00 100.00 ? 279 GLU B CB  1 
ATOM   4495 C CG  . GLU B 1 279 ? 18.855 21.511 84.709  1.00 100.00 ? 279 GLU B CG  1 
ATOM   4496 C CD  . GLU B 1 279 ? 19.242 20.978 86.092  1.00 100.00 ? 279 GLU B CD  1 
ATOM   4497 O OE1 . GLU B 1 279 ? 18.578 21.359 87.112  1.00 100.00 ? 279 GLU B OE1 1 
ATOM   4498 O OE2 . GLU B 1 279 ? 20.222 20.166 86.169  1.00 100.00 ? 279 GLU B OE2 1 
ATOM   4499 N N   . GLN B 1 280 ? 20.597 23.451 81.762  1.00 49.40  ? 280 GLN B N   1 
ATOM   4500 C CA  . GLN B 1 280 ? 20.767 24.886 81.689  1.00 49.40  ? 280 GLN B CA  1 
ATOM   4501 C C   . GLN B 1 280 ? 20.126 25.436 80.448  1.00 49.40  ? 280 GLN B C   1 
ATOM   4502 O O   . GLN B 1 280 ? 19.741 26.602 80.394  0.00 49.40  ? 280 GLN B O   1 
ATOM   4503 C CB  . GLN B 1 280 ? 22.245 25.240 81.736  1.00 52.20  ? 280 GLN B CB  1 
ATOM   4504 C CG  . GLN B 1 280 ? 22.919 24.978 83.083  1.00 52.20  ? 280 GLN B CG  1 
ATOM   4505 C CD  . GLN B 1 280 ? 24.418 25.173 82.983  1.00 52.20  ? 280 GLN B CD  1 
ATOM   4506 O OE1 . GLN B 1 280 ? 25.154 25.010 83.952  1.00 52.20  ? 280 GLN B OE1 1 
ATOM   4507 N NE2 . GLN B 1 280 ? 24.879 25.536 81.791  1.00 52.20  ? 280 GLN B NE2 1 
ATOM   4508 N N   . ILE B 1 281 ? 19.995 24.569 79.455  1.00 75.99  ? 281 ILE B N   1 
ATOM   4509 C CA  . ILE B 1 281 ? 19.383 24.970 78.211  1.00 75.99  ? 281 ILE B CA  1 
ATOM   4510 C C   . ILE B 1 281 ? 17.863 25.073 78.359  1.00 75.99  ? 281 ILE B C   1 
ATOM   4511 O O   . ILE B 1 281 ? 17.278 26.075 77.926  1.00 75.99  ? 281 ILE B O   1 
ATOM   4512 C CB  . ILE B 1 281 ? 19.740 23.994 77.077  0.00 79.77  ? 281 ILE B CB  1 
ATOM   4513 C CG1 . ILE B 1 281 ? 19.001 24.353 75.802  1.00 79.77  ? 281 ILE B CG1 1 
ATOM   4514 C CG2 . ILE B 1 281 ? 19.320 22.628 77.425  1.00 79.77  ? 281 ILE B CG2 1 
ATOM   4515 C CD1 . ILE B 1 281 ? 19.305 23.354 74.681  1.00 79.77  ? 281 ILE B CD1 1 
ATOM   4516 N N   . ARG B 1 282 ? 17.216 24.071 78.972  1.00 75.81  ? 282 ARG B N   1 
ATOM   4517 C CA  . ARG B 1 282 ? 15.753 24.119 79.111  1.00 75.81  ? 282 ARG B CA  1 
ATOM   4518 C C   . ARG B 1 282 ? 15.419 25.333 79.945  1.00 75.81  ? 282 ARG B C   1 
ATOM   4519 O O   . ARG B 1 282 ? 14.409 26.018 79.758  1.00 75.81  ? 282 ARG B O   1 
ATOM   4520 C CB  . ARG B 1 282 ? 15.204 22.820 79.803  1.00 70.19  ? 282 ARG B CB  1 
ATOM   4521 N N   . GLU B 1 283 ? 16.327 25.621 80.846  1.00 65.28  ? 283 GLU B N   1 
ATOM   4522 C CA  . GLU B 1 283 ? 16.118 26.712 81.735  1.00 65.28  ? 283 GLU B CA  1 
ATOM   4523 C C   . GLU B 1 283 ? 16.499 28.038 81.093  1.00 65.28  ? 283 GLU B C   1 
ATOM   4524 O O   . GLU B 1 283 ? 16.196 29.121 81.608  1.00 65.28  ? 283 GLU B O   1 
ATOM   4525 C CB  . GLU B 1 283 ? 16.957 26.457 82.935  1.00 100.00 ? 283 GLU B CB  1 
ATOM   4526 C CG  . GLU B 1 283 ? 16.909 27.617 83.791  1.00 100.00 ? 283 GLU B CG  1 
ATOM   4527 C CD  . GLU B 1 283 ? 17.816 27.474 84.974  1.00 100.00 ? 283 GLU B CD  1 
ATOM   4528 O OE1 . GLU B 1 283 ? 17.846 28.420 85.822  1.00 100.00 ? 283 GLU B OE1 1 
ATOM   4529 O OE2 . GLU B 1 283 ? 18.512 26.416 85.080  1.00 100.00 ? 283 GLU B OE2 1 
ATOM   4530 N N   . MET B 1 284 ? 17.138 27.918 79.937  1.00 100.00 ? 284 MET B N   1 
ATOM   4531 C CA  . MET B 1 284 ? 17.596 29.044 79.174  1.00 100.00 ? 284 MET B CA  1 
ATOM   4532 C C   . MET B 1 284 ? 16.739 29.353 77.925  1.00 100.00 ? 284 MET B C   1 
ATOM   4533 O O   . MET B 1 284 ? 16.206 30.470 77.799  1.00 100.00 ? 284 MET B O   1 
ATOM   4534 C CB  . MET B 1 284 ? 19.013 28.762 78.783  0.00 72.50  ? 284 MET B CB  1 
ATOM   4535 C CG  . MET B 1 284 ? 19.646 29.896 78.189  1.00 72.50  ? 284 MET B CG  1 
ATOM   4536 S SD  . MET B 1 284 ? 21.389 29.541 78.241  1.00 72.50  ? 284 MET B SD  1 
ATOM   4537 C CE  . MET B 1 284 ? 21.842 31.052 77.167  1.00 72.50  ? 284 MET B CE  1 
ATOM   4538 N N   . ASN B 1 285 ? 16.601 28.397 77.005  1.00 87.37  ? 285 ASN B N   1 
ATOM   4539 C CA  . ASN B 1 285 ? 15.819 28.618 75.787  1.00 87.37  ? 285 ASN B CA  1 
ATOM   4540 C C   . ASN B 1 285 ? 14.346 28.250 75.967  1.00 87.37  ? 285 ASN B C   1 
ATOM   4541 O O   . ASN B 1 285 ? 14.012 27.369 76.775  1.00 87.37  ? 285 ASN B O   1 
ATOM   4542 C CB  . ASN B 1 285 ? 16.429 27.804 74.639  1.00 72.72  ? 285 ASN B CB  1 
ATOM   4543 N N   . PHE B 1 291 ? 20.827 23.254 69.045  1.00 66.65  ? 291 PHE B N   1 
ATOM   4544 C CA  . PHE B 1 291 ? 22.007 23.681 69.787  1.00 66.65  ? 291 PHE B CA  1 
ATOM   4545 C C   . PHE B 1 291 ? 23.179 22.717 69.586  1.00 66.65  ? 291 PHE B C   1 
ATOM   4546 O O   . PHE B 1 291 ? 23.154 21.563 69.994  1.00 66.65  ? 291 PHE B O   1 
ATOM   4547 C CB  . PHE B 1 291 ? 21.640 23.751 71.270  1.00 50.75  ? 291 PHE B CB  1 
ATOM   4548 C CG  . PHE B 1 291 ? 22.851 24.114 72.076  1.00 50.75  ? 291 PHE B CG  1 
ATOM   4549 C CD1 . PHE B 1 291 ? 23.267 25.439 72.133  1.00 50.75  ? 291 PHE B CD1 1 
ATOM   4550 C CD2 . PHE B 1 291 ? 23.557 23.130 72.748  0.00 50.75  ? 291 PHE B CD2 1 
ATOM   4551 C CE1 . PHE B 1 291 ? 24.395 25.776 72.867  1.00 50.75  ? 291 PHE B CE1 1 
ATOM   4552 C CE2 . PHE B 1 291 ? 24.688 23.476 73.482  0.00 50.75  ? 291 PHE B CE2 1 
ATOM   4553 C CZ  . PHE B 1 291 ? 25.111 24.798 73.545  1.00 50.75  ? 291 PHE B CZ  1 
ATOM   4554 N N   . LYS B 1 292 ? 24.217 23.219 68.892  1.00 91.46  ? 292 LYS B N   1 
ATOM   4555 C CA  . LYS B 1 292 ? 25.388 22.386 68.644  1.00 91.46  ? 292 LYS B CA  1 
ATOM   4556 C C   . LYS B 1 292 ? 26.633 23.233 68.369  1.00 91.46  ? 292 LYS B C   1 
ATOM   4557 O O   . LYS B 1 292 ? 27.082 23.389 67.241  1.00 91.46  ? 292 LYS B O   1 
ATOM   4558 C CB  . LYS B 1 292 ? 25.091 21.491 67.441  1.00 56.32  ? 292 LYS B CB  1 
ATOM   4559 N N   . PHE B 1 293 ? 27.171 23.823 69.453  1.00 98.94  ? 293 PHE B N   1 
ATOM   4560 C CA  . PHE B 1 293 ? 28.358 24.656 69.303  1.00 98.94  ? 293 PHE B CA  1 
ATOM   4561 C C   . PHE B 1 293 ? 29.643 23.845 69.485  1.00 98.94  ? 293 PHE B C   1 
ATOM   4562 O O   . PHE B 1 293 ? 30.391 23.600 68.548  1.00 98.94  ? 293 PHE B O   1 
ATOM   4563 C CB  . PHE B 1 293 ? 28.294 25.770 70.349  1.00 52.03  ? 293 PHE B CB  1 
ATOM   4564 C CG  . PHE B 1 293 ? 27.212 26.744 69.987  1.00 52.03  ? 293 PHE B CG  1 
ATOM   4565 C CD1 . PHE B 1 293 ? 25.881 26.349 70.055  1.00 52.03  ? 293 PHE B CD1 1 
ATOM   4566 C CD2 . PHE B 1 293 ? 27.542 28.026 69.580  1.00 52.03  ? 293 PHE B CD2 1 
ATOM   4567 C CE1 . PHE B 1 293 ? 24.878 27.245 69.712  0.00 52.03  ? 293 PHE B CE1 1 
ATOM   4568 C CE2 . PHE B 1 293 ? 26.529 28.919 69.238  1.00 52.03  ? 293 PHE B CE2 1 
ATOM   4569 C CZ  . PHE B 1 293 ? 25.197 28.533 69.303  0.00 52.03  ? 293 PHE B CZ  1 
ATOM   4570 N N   . PRO B 1 294 ? 29.901 23.463 70.749  1.00 96.91  ? 294 PRO B N   1 
ATOM   4571 C CA  . PRO B 1 294 ? 31.101 22.686 71.036  1.00 96.91  ? 294 PRO B CA  1 
ATOM   4572 C C   . PRO B 1 294 ? 30.970 21.912 72.350  1.00 96.91  ? 294 PRO B C   1 
ATOM   4573 O O   . PRO B 1 294 ? 31.094 22.458 73.438  1.00 96.91  ? 294 PRO B O   1 
ATOM   4574 N N   . GLN B 1 295 ? 30.676 20.606 72.204  1.00 72.54  ? 295 GLN B N   1 
ATOM   4575 C CA  . GLN B 1 295 ? 30.534 19.764 73.385  1.00 72.54  ? 295 GLN B CA  1 
ATOM   4576 C C   . GLN B 1 295 ? 31.679 19.984 74.376  1.00 72.54  ? 295 GLN B C   1 
ATOM   4577 O O   . GLN B 1 295 ? 31.713 19.419 75.461  1.00 72.54  ? 295 GLN B O   1 
ATOM   4578 N N   . ILE B 1 296 ? 32.732 20.771 74.154  1.00 83.25  ? 296 ILE B N   1 
ATOM   4579 C CA  . ILE B 1 296 ? 33.771 20.911 75.161  1.00 83.25  ? 296 ILE B CA  1 
ATOM   4580 C C   . ILE B 1 296 ? 34.046 22.373 75.497  1.00 83.25  ? 296 ILE B C   1 
ATOM   4581 O O   . ILE B 1 296 ? 33.124 23.192 75.645  1.00 83.25  ? 296 ILE B O   1 
ATOM   4582 N N   . LYS B 1 297 ? 35.323 22.714 75.628  1.00 100.00 ? 297 LYS B N   1 
ATOM   4583 C CA  . LYS B 1 297 ? 35.776 24.074 75.881  1.00 100.00 ? 297 LYS B CA  1 
ATOM   4584 C C   . LYS B 1 297 ? 35.342 24.559 77.265  1.00 100.00 ? 297 LYS B C   1 
ATOM   4585 O O   . LYS B 1 297 ? 34.427 25.356 77.421  1.00 100.00 ? 297 LYS B O   1 
ATOM   4586 C CB  . LYS B 1 297 ? 35.185 24.981 74.801  1.00 46.14  ? 297 LYS B CB  1 
ATOM   4587 N N   . ALA B 1 298 ? 36.009 24.012 78.299  1.00 100.00 ? 298 ALA B N   1 
ATOM   4588 C CA  . ALA B 1 298 ? 35.710 24.455 79.655  1.00 100.00 ? 298 ALA B CA  1 
ATOM   4589 C C   . ALA B 1 298 ? 36.015 25.946 79.825  1.00 100.00 ? 298 ALA B C   1 
ATOM   4590 O O   . ALA B 1 298 ? 36.598 26.595 78.967  1.00 100.00 ? 298 ALA B O   1 
ATOM   4591 C CB  . ALA B 1 298 ? 36.557 23.632 80.626  1.00 63.79  ? 298 ALA B CB  1 
ATOM   4592 N N   . HIS B 1 299 ? 35.561 26.502 80.964  1.00 82.91  ? 299 HIS B N   1 
ATOM   4593 C CA  . HIS B 1 299 ? 35.772 27.926 81.186  1.00 82.91  ? 299 HIS B CA  1 
ATOM   4594 C C   . HIS B 1 299 ? 36.526 28.201 82.489  1.00 82.91  ? 299 HIS B C   1 
ATOM   4595 O O   . HIS B 1 299 ? 36.146 27.770 83.571  1.00 82.91  ? 299 HIS B O   1 
ATOM   4596 N N   . PRO B 1 300 ? 37.664 28.907 82.350  1.00 100.00 ? 300 PRO B N   1 
ATOM   4597 C CA  . PRO B 1 300 ? 38.436 29.352 83.494  1.00 100.00 ? 300 PRO B CA  1 
ATOM   4598 C C   . PRO B 1 300 ? 37.888 30.671 84.041  1.00 100.00 ? 300 PRO B C   1 
ATOM   4599 O O   . PRO B 1 300 ? 37.218 31.433 83.357  1.00 100.00 ? 300 PRO B O   1 
ATOM   4600 C CB  . PRO B 1 300 ? 39.870 29.552 83.011  1.00 82.31  ? 300 PRO B CB  1 
ATOM   4601 C CG  . PRO B 1 300 ? 39.851 29.659 81.484  1.00 82.31  ? 300 PRO B CG  1 
ATOM   4602 C CD  . PRO B 1 300 ? 38.324 29.323 81.125  1.00 82.31  ? 300 PRO B CD  1 
ATOM   4603 N N   . TRP B 1 301 ? 38.160 30.914 85.335  1.00 95.69  ? 301 TRP B N   1 
ATOM   4604 C CA  . TRP B 1 301 ? 37.677 32.149 85.941  1.00 95.69  ? 301 TRP B CA  1 
ATOM   4605 C C   . TRP B 1 301 ? 38.829 33.028 86.429  1.00 95.69  ? 301 TRP B C   1 
ATOM   4606 O O   . TRP B 1 301 ? 38.988 34.178 86.044  1.00 95.69  ? 301 TRP B O   1 
ATOM   4607 C CB  . TRP B 1 301 ? 36.772 31.782 87.118  1.00 45.45  ? 301 TRP B CB  1 
ATOM   4608 C CG  . TRP B 1 301 ? 35.352 31.991 86.756  1.00 45.45  ? 301 TRP B CG  1 
ATOM   4609 C CD1 . TRP B 1 301 ? 34.281 31.100 86.991  1.00 45.45  ? 301 TRP B CD1 1 
ATOM   4610 C CD2 . TRP B 1 301 ? 34.795 33.122 86.040  1.00 45.45  ? 301 TRP B CD2 1 
ATOM   4611 N NE1 . TRP B 1 301 ? 33.105 31.554 86.487  1.00 45.45  ? 301 TRP B NE1 1 
ATOM   4612 C CE2 . TRP B 1 301 ? 33.413 32.863 85.862  1.00 45.45  ? 301 TRP B CE2 1 
ATOM   4613 C CE3 . TRP B 1 301 ? 35.341 34.298 85.534  1.00 45.45  ? 301 TRP B CE3 1 
ATOM   4614 C CZ2 . TRP B 1 301 ? 32.622 33.771 85.178  1.00 45.45  ? 301 TRP B CZ2 1 
ATOM   4615 C CZ3 . TRP B 1 301 ? 34.549 35.205 84.849  1.00 45.45  ? 301 TRP B CZ3 1 
ATOM   4616 C CH2 . TRP B 1 301 ? 33.181 34.937 84.668  1.00 45.45  ? 301 TRP B CH2 1 
ATOM   4617 N N   . THR B 1 302 ? 39.628 32.453 87.343  1.00 65.12  ? 302 THR B N   1 
ATOM   4618 C CA  . THR B 1 302 ? 40.725 33.217 87.921  1.00 65.12  ? 302 THR B CA  1 
ATOM   4619 C C   . THR B 1 302 ? 41.698 33.709 86.847  1.00 65.12  ? 302 THR B C   1 
ATOM   4620 O O   . THR B 1 302 ? 42.475 34.631 87.051  1.00 65.12  ? 302 THR B O   1 
ATOM   4621 C CB  . THR B 1 302 ? 41.448 32.311 88.917  1.00 68.67  ? 302 THR B CB  1 
ATOM   4622 O OG1 . THR B 1 302 ? 40.515 31.885 89.913  1.00 68.67  ? 302 THR B OG1 1 
ATOM   4623 C CG2 . THR B 1 302 ? 42.585 33.076 89.600  1.00 68.67  ? 302 THR B CG2 1 
ATOM   4624 N N   . LYS B 1 303 ? 41.603 33.065 85.680  1.00 67.32  ? 303 LYS B N   1 
ATOM   4625 C CA  . LYS B 1 303 ? 42.473 33.398 84.555  1.00 67.32  ? 303 LYS B CA  1 
ATOM   4626 C C   . LYS B 1 303 ? 41.890 34.337 83.500  1.00 67.32  ? 303 LYS B C   1 
ATOM   4627 O O   . LYS B 1 303 ? 42.567 34.689 82.530  1.00 67.32  ? 303 LYS B O   1 
ATOM   4628 C CB  . LYS B 1 303 ? 42.972 32.108 83.903  1.00 63.31  ? 303 LYS B CB  1 
ATOM   4629 C CG  . LYS B 1 303 ? 43.843 31.267 84.859  1.00 63.31  ? 303 LYS B CG  1 
ATOM   4630 C CD  . LYS B 1 303 ? 44.373 30.011 84.190  0.00 63.31  ? 303 LYS B CD  1 
ATOM   4631 C CE  . LYS B 1 303 ? 45.238 29.210 85.152  0.00 63.31  ? 303 LYS B CE  1 
ATOM   4632 N NZ  . LYS B 1 303 ? 45.742 27.946 84.547  0.00 63.31  ? 303 LYS B NZ  1 
ATOM   4633 N N   . VAL B 1 304 ? 40.645 34.755 83.696  1.00 48.89  ? 304 VAL B N   1 
ATOM   4634 C CA  . VAL B 1 304 ? 40.009 35.671 82.765  1.00 48.89  ? 304 VAL B CA  1 
ATOM   4635 C C   . VAL B 1 304 ? 40.552 37.086 83.002  1.00 48.89  ? 304 VAL B C   1 
ATOM   4636 O O   . VAL B 1 304 ? 40.678 37.874 82.065  1.00 48.89  ? 304 VAL B O   1 
ATOM   4637 C CB  . VAL B 1 304 ? 38.474 35.714 82.979  1.00 35.95  ? 304 VAL B CB  1 
ATOM   4638 C CG1 . VAL B 1 304 ? 37.831 36.609 81.934  0.00 35.95  ? 304 VAL B CG1 1 
ATOM   4639 C CG2 . VAL B 1 304 ? 37.887 34.318 82.926  1.00 35.95  ? 304 VAL B CG2 1 
ATOM   4640 N N   . PHE B 1 305 ? 40.892 37.391 84.255  1.00 43.83  ? 305 PHE B N   1 
ATOM   4641 C CA  . PHE B 1 305 ? 41.367 38.726 84.634  1.00 43.83  ? 305 PHE B CA  1 
ATOM   4642 C C   . PHE B 1 305 ? 42.864 38.877 84.911  1.00 43.83  ? 305 PHE B C   1 
ATOM   4643 O O   . PHE B 1 305 ? 43.594 37.898 84.940  1.00 43.83  ? 305 PHE B O   1 
ATOM   4644 C CB  . PHE B 1 305 ? 40.594 39.176 85.864  1.00 32.65  ? 305 PHE B CB  1 
ATOM   4645 C CG  . PHE B 1 305 ? 39.112 39.002 85.734  1.00 32.65  ? 305 PHE B CG  1 
ATOM   4646 C CD1 . PHE B 1 305 ? 38.348 39.937 85.060  1.00 32.65  ? 305 PHE B CD1 1 
ATOM   4647 C CD2 . PHE B 1 305 ? 38.484 37.884 86.261  1.00 32.65  ? 305 PHE B CD2 1 
ATOM   4648 C CE1 . PHE B 1 305 ? 36.988 39.765 84.921  1.00 32.65  ? 305 PHE B CE1 1 
ATOM   4649 C CE2 . PHE B 1 305 ? 37.117 37.707 86.122  1.00 32.65  ? 305 PHE B CE2 1 
ATOM   4650 C CZ  . PHE B 1 305 ? 36.371 38.645 85.449  1.00 32.65  ? 305 PHE B CZ  1 
ATOM   4651 N N   . ARG B 1 306 ? 43.311 40.119 85.113  1.00 44.90  ? 306 ARG B N   1 
ATOM   4652 C CA  . ARG B 1 306 ? 44.719 40.404 85.405  1.00 44.90  ? 306 ARG B CA  1 
ATOM   4653 C C   . ARG B 1 306 ? 45.061 39.663 86.690  1.00 44.90  ? 306 ARG B C   1 
ATOM   4654 O O   . ARG B 1 306 ? 44.194 39.443 87.537  1.00 44.90  ? 306 ARG B O   1 
ATOM   4655 C CB  . ARG B 1 306 ? 44.933 41.903 85.587  1.00 23.70  ? 306 ARG B CB  1 
ATOM   4656 N N   . PRO B 1 307 ? 46.334 39.274 86.862  1.00 56.05  ? 307 PRO B N   1 
ATOM   4657 C CA  . PRO B 1 307 ? 46.732 38.542 88.080  1.00 56.05  ? 307 PRO B CA  1 
ATOM   4658 C C   . PRO B 1 307 ? 46.495 39.330 89.371  1.00 56.05  ? 307 PRO B C   1 
ATOM   4659 O O   . PRO B 1 307 ? 46.385 38.749 90.455  1.00 56.05  ? 307 PRO B O   1 
ATOM   4660 C CB  . PRO B 1 307 ? 48.219 38.247 87.845  1.00 73.61  ? 307 PRO B CB  1 
ATOM   4661 C CG  . PRO B 1 307 ? 48.380 38.348 86.318  1.00 73.61  ? 307 PRO B CG  1 
ATOM   4662 C CD  . PRO B 1 307 ? 47.497 39.529 85.990  1.00 73.61  ? 307 PRO B CD  1 
ATOM   4663 N N   . ARG B 1 308 ? 46.415 40.653 89.251  1.00 45.08  ? 308 ARG B N   1 
ATOM   4664 C CA  . ARG B 1 308 ? 46.178 41.504 90.416  1.00 45.08  ? 308 ARG B CA  1 
ATOM   4665 C C   . ARG B 1 308 ? 44.723 41.680 90.864  1.00 45.08  ? 308 ARG B C   1 
ATOM   4666 O O   . ARG B 1 308 ? 44.454 42.225 91.936  1.00 45.08  ? 308 ARG B O   1 
ATOM   4667 C CB  . ARG B 1 308 ? 46.482 42.956 90.063  0.00 35.69  ? 308 ARG B CB  1 
ATOM   4668 N N   . THR B 1 309 ? 43.792 41.362 89.986  1.00 47.61  ? 309 THR B N   1 
ATOM   4669 C CA  . THR B 1 309 ? 42.351 41.277 90.259  1.00 47.61  ? 309 THR B CA  1 
ATOM   4670 C C   . THR B 1 309 ? 41.907 40.592 91.547  1.00 47.61  ? 309 THR B C   1 
ATOM   4671 O O   . THR B 1 309 ? 42.059 39.387 91.709  1.00 47.61  ? 309 THR B O   1 
ATOM   4672 C CB  . THR B 1 309 ? 41.626 40.590 89.116  1.00 35.64  ? 309 THR B CB  1 
ATOM   4673 O OG1 . THR B 1 309 ? 42.081 41.136 87.877  1.00 35.64  ? 309 THR B OG1 1 
ATOM   4674 C CG2 . THR B 1 309 ? 40.142 40.823 89.236  1.00 35.64  ? 309 THR B CG2 1 
ATOM   4675 N N   . PRO B 1 310 ? 41.323 41.364 92.471  1.00 44.91  ? 310 PRO B N   1 
ATOM   4676 C CA  . PRO B 1 310 ? 40.840 40.868 93.761  1.00 44.91  ? 310 PRO B CA  1 
ATOM   4677 C C   . PRO B 1 310 ? 39.954 39.646 93.597  1.00 44.91  ? 310 PRO B C   1 
ATOM   4678 O O   . PRO B 1 310 ? 38.952 39.693 92.884  1.00 44.91  ? 310 PRO B O   1 
ATOM   4679 C CB  . PRO B 1 310 ? 40.064 42.052 94.308  1.00 31.40  ? 310 PRO B CB  1 
ATOM   4680 C CG  . PRO B 1 310 ? 40.810 43.216 93.764  1.00 31.40  ? 310 PRO B CG  1 
ATOM   4681 C CD  . PRO B 1 310 ? 41.055 42.807 92.335  1.00 31.40  ? 310 PRO B CD  1 
ATOM   4682 N N   . PRO B 1 311 ? 40.304 38.534 94.264  1.00 45.87  ? 311 PRO B N   1 
ATOM   4683 C CA  . PRO B 1 311 ? 39.508 37.308 94.167  1.00 45.87  ? 311 PRO B CA  1 
ATOM   4684 C C   . PRO B 1 311 ? 38.003 37.493 94.358  1.00 45.87  ? 311 PRO B C   1 
ATOM   4685 O O   . PRO B 1 311 ? 37.223 37.148 93.473  1.00 45.87  ? 311 PRO B O   1 
ATOM   4686 C CB  . PRO B 1 311 ? 40.130 36.404 95.234  1.00 36.21  ? 311 PRO B CB  1 
ATOM   4687 C CG  . PRO B 1 311 ? 40.725 37.364 96.205  1.00 36.21  ? 311 PRO B CG  1 
ATOM   4688 C CD  . PRO B 1 311 ? 41.352 38.381 95.285  1.00 36.21  ? 311 PRO B CD  1 
ATOM   4689 N N   . GLU B 1 312 ? 37.578 38.033 95.493  1.00 41.29  ? 312 GLU B N   1 
ATOM   4690 C CA  . GLU B 1 312 ? 36.142 38.187 95.692  1.00 41.29  ? 312 GLU B CA  1 
ATOM   4691 C C   . GLU B 1 312 ? 35.477 39.038 94.602  1.00 41.29  ? 312 GLU B C   1 
ATOM   4692 O O   . GLU B 1 312 ? 34.262 38.974 94.408  1.00 41.29  ? 312 GLU B O   1 
ATOM   4693 C CB  . GLU B 1 312 ? 35.817 38.715 97.103  1.00 70.73  ? 312 GLU B CB  1 
ATOM   4694 C CG  . GLU B 1 312 ? 36.611 39.903 97.573  1.00 70.73  ? 312 GLU B CG  1 
ATOM   4695 C CD  . GLU B 1 312 ? 38.084 39.596 97.653  1.00 70.73  ? 312 GLU B CD  1 
ATOM   4696 O OE1 . GLU B 1 312 ? 38.793 39.856 96.647  1.00 70.73  ? 312 GLU B OE1 1 
ATOM   4697 O OE2 . GLU B 1 312 ? 38.522 39.079 98.711  1.00 70.73  ? 312 GLU B OE2 1 
ATOM   4698 N N   . ALA B 1 313 ? 36.268 39.825 93.882  1.00 36.56  ? 313 ALA B N   1 
ATOM   4699 C CA  . ALA B 1 313 ? 35.714 40.612 92.789  1.00 36.56  ? 313 ALA B CA  1 
ATOM   4700 C C   . ALA B 1 313 ? 35.435 39.590 91.694  1.00 36.56  ? 313 ALA B C   1 
ATOM   4701 O O   . ALA B 1 313 ? 34.479 39.710 90.936  1.00 36.56  ? 313 ALA B O   1 
ATOM   4702 C CB  . ALA B 1 313 ? 36.723 41.637 92.302  1.00 44.46  ? 313 ALA B CB  1 
ATOM   4703 N N   . ILE B 1 314 ? 36.292 38.578 91.624  1.00 33.59  ? 314 ILE B N   1 
ATOM   4704 C CA  . ILE B 1 314 ? 36.146 37.513 90.649  1.00 33.59  ? 314 ILE B CA  1 
ATOM   4705 C C   . ILE B 1 314 ? 35.054 36.531 91.068  1.00 33.59  ? 314 ILE B C   1 
ATOM   4706 O O   . ILE B 1 314 ? 34.269 36.076 90.234  1.00 33.59  ? 314 ILE B O   1 
ATOM   4707 C CB  . ILE B 1 314 ? 37.471 36.758 90.472  1.00 40.76  ? 314 ILE B CB  1 
ATOM   4708 C CG1 . ILE B 1 314 ? 38.474 37.684 89.781  1.00 40.76  ? 314 ILE B CG1 1 
ATOM   4709 C CG2 . ILE B 1 314 ? 37.254 35.460 89.697  1.00 40.76  ? 314 ILE B CG2 1 
ATOM   4710 C CD1 . ILE B 1 314 ? 39.771 37.015 89.370  1.00 40.76  ? 314 ILE B CD1 1 
ATOM   4711 N N   . ALA B 1 315 ? 35.002 36.205 92.357  1.00 35.68  ? 315 ALA B N   1 
ATOM   4712 C CA  . ALA B 1 315 ? 33.996 35.283 92.865  1.00 35.68  ? 315 ALA B CA  1 
ATOM   4713 C C   . ALA B 1 315 ? 32.615 35.820 92.547  1.00 35.68  ? 315 ALA B C   1 
ATOM   4714 O O   . ALA B 1 315 ? 31.750 35.094 92.049  1.00 35.68  ? 315 ALA B O   1 
ATOM   4715 C CB  . ALA B 1 315 ? 34.145 35.131 94.345  1.00 29.50  ? 315 ALA B CB  1 
ATOM   4716 N N   . LEU B 1 316 ? 32.418 37.103 92.841  1.00 42.05  ? 316 LEU B N   1 
ATOM   4717 C CA  . LEU B 1 316 ? 31.149 37.780 92.608  1.00 42.05  ? 316 LEU B CA  1 
ATOM   4718 C C   . LEU B 1 316 ? 30.718 37.686 91.151  1.00 42.05  ? 316 LEU B C   1 
ATOM   4719 O O   . LEU B 1 316 ? 29.540 37.509 90.860  1.00 42.05  ? 316 LEU B O   1 
ATOM   4720 C CB  . LEU B 1 316 ? 31.254 39.248 93.034  1.00 30.04  ? 316 LEU B CB  1 
ATOM   4721 C CG  . LEU B 1 316 ? 30.075 40.155 92.684  1.00 30.04  ? 316 LEU B CG  1 
ATOM   4722 C CD1 . LEU B 1 316 ? 28.821 39.677 93.384  1.00 30.04  ? 316 LEU B CD1 1 
ATOM   4723 C CD2 . LEU B 1 316 ? 30.405 41.573 93.084  1.00 30.04  ? 316 LEU B CD2 1 
ATOM   4724 N N   . CYS B 1 317 ? 31.663 37.807 90.229  1.00 48.54  ? 317 CYS B N   1 
ATOM   4725 C CA  . CYS B 1 317 ? 31.316 37.702 88.816  1.00 48.54  ? 317 CYS B CA  1 
ATOM   4726 C C   . CYS B 1 317 ? 30.669 36.367 88.464  1.00 48.54  ? 317 CYS B C   1 
ATOM   4727 O O   . CYS B 1 317 ? 29.641 36.324 87.776  1.00 48.54  ? 317 CYS B O   1 
ATOM   4728 C CB  . CYS B 1 317 ? 32.552 37.868 87.947  1.00 54.56  ? 317 CYS B CB  1 
ATOM   4729 S SG  . CYS B 1 317 ? 32.625 39.460 87.158  1.00 54.56  ? 317 CYS B SG  1 
ATOM   4730 N N   . SER B 1 318 ? 31.275 35.278 88.928  1.00 34.00  ? 318 SER B N   1 
ATOM   4731 C CA  . SER B 1 318 ? 30.761 33.956 88.632  1.00 34.00  ? 318 SER B CA  1 
ATOM   4732 C C   . SER B 1 318 ? 29.398 33.695 89.254  1.00 34.00  ? 318 SER B C   1 
ATOM   4733 O O   . SER B 1 318 ? 28.716 32.734 88.871  1.00 34.00  ? 318 SER B O   1 
ATOM   4734 C CB  . SER B 1 318 ? 31.739 32.901 89.114  1.00 51.64  ? 318 SER B CB  1 
ATOM   4735 O OG  . SER B 1 318 ? 31.894 32.999 90.514  1.00 51.64  ? 318 SER B OG  1 
ATOM   4736 N N   . ARG B 1 319 ? 28.999 34.523 90.218  1.00 30.97  ? 319 ARG B N   1 
ATOM   4737 C CA  . ARG B 1 319 ? 27.698 34.332 90.841  1.00 30.97  ? 319 ARG B CA  1 
ATOM   4738 C C   . ARG B 1 319 ? 26.650 35.192 90.160  1.00 30.97  ? 319 ARG B C   1 
ATOM   4739 O O   . ARG B 1 319 ? 25.461 35.158 90.509  1.00 30.97  ? 319 ARG B O   1 
ATOM   4740 C CB  . ARG B 1 319 ? 27.748 34.640 92.334  1.00 36.64  ? 319 ARG B CB  1 
ATOM   4741 C CG  . ARG B 1 319 ? 28.523 33.620 93.147  1.00 36.64  ? 319 ARG B CG  1 
ATOM   4742 C CD  . ARG B 1 319 ? 28.176 32.183 92.747  1.00 36.64  ? 319 ARG B CD  1 
ATOM   4743 N NE  . ARG B 1 319 ? 26.740 31.947 92.594  1.00 36.64  ? 319 ARG B NE  1 
ATOM   4744 C CZ  . ARG B 1 319 ? 25.860 31.946 93.590  1.00 36.64  ? 319 ARG B CZ  1 
ATOM   4745 N NH1 . ARG B 1 319 ? 26.254 32.172 94.836  1.00 36.64  ? 319 ARG B NH1 1 
ATOM   4746 N NH2 . ARG B 1 319 ? 24.578 31.707 93.335  1.00 36.64  ? 319 ARG B NH2 1 
ATOM   4747 N N   . LEU B 1 320 ? 27.110 35.968 89.182  1.00 33.21  ? 320 LEU B N   1 
ATOM   4748 C CA  . LEU B 1 320 ? 26.234 36.823 88.386  1.00 33.21  ? 320 LEU B CA  1 
ATOM   4749 C C   . LEU B 1 320 ? 26.120 36.179 86.993  1.00 33.21  ? 320 LEU B C   1 
ATOM   4750 O O   . LEU B 1 320 ? 25.026 35.820 86.543  1.00 33.21  ? 320 LEU B O   1 
ATOM   4751 C CB  . LEU B 1 320 ? 26.821 38.241 88.275  1.00 28.69  ? 320 LEU B CB  1 
ATOM   4752 C CG  . LEU B 1 320 ? 26.952 38.986 89.612  1.00 28.69  ? 320 LEU B CG  1 
ATOM   4753 C CD1 . LEU B 1 320 ? 27.668 40.317 89.446  1.00 28.69  ? 320 LEU B CD1 1 
ATOM   4754 C CD2 . LEU B 1 320 ? 25.569 39.212 90.180  1.00 28.69  ? 320 LEU B CD2 1 
ATOM   4755 N N   . LEU B 1 321 ? 27.267 36.008 86.334  1.00 29.93  ? 321 LEU B N   1 
ATOM   4756 C CA  . LEU B 1 321 ? 27.310 35.424 85.005  1.00 29.93  ? 321 LEU B CA  1 
ATOM   4757 C C   . LEU B 1 321 ? 27.126 33.910 85.111  1.00 29.93  ? 321 LEU B C   1 
ATOM   4758 O O   . LEU B 1 321 ? 28.070 33.124 85.004  1.00 29.93  ? 321 LEU B O   1 
ATOM   4759 C CB  . LEU B 1 321 ? 28.629 35.821 84.340  1.00 27.53  ? 321 LEU B CB  1 
ATOM   4760 C CG  . LEU B 1 321 ? 28.716 37.358 84.294  1.00 27.53  ? 321 LEU B CG  1 
ATOM   4761 C CD1 . LEU B 1 321 ? 29.968 37.828 83.591  1.00 27.53  ? 321 LEU B CD1 1 
ATOM   4762 C CD2 . LEU B 1 321 ? 27.488 37.900 83.586  1.00 27.53  ? 321 LEU B CD2 1 
ATOM   4763 N N   . GLU B 1 322 ? 25.870 33.526 85.314  1.00 33.10  ? 322 GLU B N   1 
ATOM   4764 C CA  . GLU B 1 322 ? 25.467 32.144 85.504  1.00 33.10  ? 322 GLU B CA  1 
ATOM   4765 C C   . GLU B 1 322 ? 24.362 31.775 84.545  1.00 33.10  ? 322 GLU B C   1 
ATOM   4766 O O   . GLU B 1 322 ? 23.367 32.489 84.456  1.00 33.10  ? 322 GLU B O   1 
ATOM   4767 C CB  . GLU B 1 322 ? 24.929 31.983 86.913  1.00 49.43  ? 322 GLU B CB  1 
ATOM   4768 C CG  . GLU B 1 322 ? 25.064 30.611 87.481  1.00 49.43  ? 322 GLU B CG  1 
ATOM   4769 C CD  . GLU B 1 322 ? 26.169 30.549 88.492  1.00 49.43  ? 322 GLU B CD  1 
ATOM   4770 O OE1 . GLU B 1 322 ? 26.012 31.176 89.567  1.00 49.43  ? 322 GLU B OE1 1 
ATOM   4771 O OE2 . GLU B 1 322 ? 27.194 29.890 88.210  1.00 49.43  ? 322 GLU B OE2 1 
ATOM   4772 N N   . TYR B 1 323 ? 24.514 30.653 83.849  1.00 32.76  ? 323 TYR B N   1 
ATOM   4773 C CA  . TYR B 1 323 ? 23.506 30.198 82.897  1.00 32.76  ? 323 TYR B CA  1 
ATOM   4774 C C   . TYR B 1 323 ? 22.083 30.186 83.454  1.00 32.76  ? 323 TYR B C   1 
ATOM   4775 O O   . TYR B 1 323 ? 21.196 30.836 82.928  1.00 32.76  ? 323 TYR B O   1 
ATOM   4776 C CB  . TYR B 1 323 ? 23.859 28.795 82.395  1.00 34.11  ? 323 TYR B CB  1 
ATOM   4777 C CG  . TYR B 1 323 ? 24.926 28.776 81.330  1.00 34.11  ? 323 TYR B CG  1 
ATOM   4778 C CD1 . TYR B 1 323 ? 24.779 29.514 80.162  1.00 34.11  ? 323 TYR B CD1 1 
ATOM   4779 C CD2 . TYR B 1 323 ? 26.083 28.017 81.487  1.00 34.11  ? 323 TYR B CD2 1 
ATOM   4780 C CE1 . TYR B 1 323 ? 25.766 29.495 79.179  1.00 34.11  ? 323 TYR B CE1 1 
ATOM   4781 C CE2 . TYR B 1 323 ? 27.077 27.989 80.506  1.00 34.11  ? 323 TYR B CE2 1 
ATOM   4782 C CZ  . TYR B 1 323 ? 26.911 28.728 79.363  1.00 34.11  ? 323 TYR B CZ  1 
ATOM   4783 O OH  . TYR B 1 323 ? 27.897 28.706 78.417  1.00 34.11  ? 323 TYR B OH  1 
ATOM   4784 N N   . THR B 1 324 ? 21.887 29.430 84.521  1.00 28.09  ? 324 THR B N   1 
ATOM   4785 C CA  . THR B 1 324 ? 20.607 29.266 85.204  1.00 28.09  ? 324 THR B CA  1 
ATOM   4786 C C   . THR B 1 324 ? 20.200 30.584 85.847  1.00 28.09  ? 324 THR B C   1 
ATOM   4787 O O   . THR B 1 324 ? 20.772 30.975 86.850  1.00 28.09  ? 324 THR B O   1 
ATOM   4788 C CB  . THR B 1 324 ? 20.800 28.120 86.240  1.00 39.41  ? 324 THR B CB  1 
ATOM   4789 O OG1 . THR B 1 324 ? 20.698 26.874 85.543  1.00 39.41  ? 324 THR B OG1 1 
ATOM   4790 C CG2 . THR B 1 324 ? 19.828 28.199 87.455  1.00 39.41  ? 324 THR B CG2 1 
ATOM   4791 N N   . PRO B 1 325 ? 19.230 31.310 85.254  1.00 38.29  ? 325 PRO B N   1 
ATOM   4792 C CA  . PRO B 1 325 ? 18.811 32.592 85.843  1.00 38.29  ? 325 PRO B CA  1 
ATOM   4793 C C   . PRO B 1 325 ? 18.619 32.508 87.352  1.00 38.29  ? 325 PRO B C   1 
ATOM   4794 O O   . PRO B 1 325 ? 19.221 33.265 88.131  1.00 38.29  ? 325 PRO B O   1 
ATOM   4795 C CB  . PRO B 1 325 ? 17.504 32.904 85.111  1.00 33.50  ? 325 PRO B CB  1 
ATOM   4796 C CG  . PRO B 1 325 ? 17.756 32.345 83.741  1.00 33.50  ? 325 PRO B CG  1 
ATOM   4797 C CD  . PRO B 1 325 ? 18.442 31.009 84.043  1.00 33.50  ? 325 PRO B CD  1 
ATOM   4798 N N   . THR B 1 326 ? 17.779 31.565 87.756  1.00 37.45  ? 326 THR B N   1 
ATOM   4799 C CA  . THR B 1 326 ? 17.493 31.366 89.167  1.00 37.45  ? 326 THR B CA  1 
ATOM   4800 C C   . THR B 1 326 ? 18.735 31.103 89.999  1.00 37.45  ? 326 THR B C   1 
ATOM   4801 O O   . THR B 1 326 ? 18.666 31.113 91.221  1.00 37.45  ? 326 THR B O   1 
ATOM   4802 C CB  . THR B 1 326 ? 16.520 30.202 89.375  1.00 32.11  ? 326 THR B CB  1 
ATOM   4803 O OG1 . THR B 1 326 ? 16.986 29.061 88.650  1.00 32.11  ? 326 THR B OG1 1 
ATOM   4804 C CG2 . THR B 1 326 ? 15.131 30.576 88.889  1.00 32.11  ? 326 THR B CG2 1 
ATOM   4805 N N   . ALA B 1 327 ? 19.870 30.867 89.357  1.00 27.18  ? 327 ALA B N   1 
ATOM   4806 C CA  . ALA B 1 327 ? 21.079 30.606 90.119  1.00 27.18  ? 327 ALA B CA  1 
ATOM   4807 C C   . ALA B 1 327 ? 21.866 31.887 90.319  1.00 27.18  ? 327 ALA B C   1 
ATOM   4808 O O   . ALA B 1 327 ? 22.786 31.949 91.131  1.00 27.18  ? 327 ALA B O   1 
ATOM   4809 C CB  . ALA B 1 327 ? 21.928 29.582 89.413  1.00 13.76  ? 327 ALA B CB  1 
ATOM   4810 N N   . ARG B 1 328 ? 21.502 32.916 89.568  1.00 31.26  ? 328 ARG B N   1 
ATOM   4811 C CA  . ARG B 1 328 ? 22.193 34.192 89.660  1.00 31.26  ? 328 ARG B CA  1 
ATOM   4812 C C   . ARG B 1 328 ? 21.819 34.903 90.939  1.00 31.26  ? 328 ARG B C   1 
ATOM   4813 O O   . ARG B 1 328 ? 20.665 34.882 91.343  1.00 31.26  ? 328 ARG B O   1 
ATOM   4814 C CB  . ARG B 1 328 ? 21.815 35.073 88.480  1.00 27.28  ? 328 ARG B CB  1 
ATOM   4815 C CG  . ARG B 1 328 ? 22.131 34.458 87.153  1.00 27.28  ? 328 ARG B CG  1 
ATOM   4816 C CD  . ARG B 1 328 ? 21.522 35.230 85.997  1.00 27.28  ? 328 ARG B CD  1 
ATOM   4817 N NE  . ARG B 1 328 ? 21.710 34.480 84.763  1.00 27.28  ? 328 ARG B NE  1 
ATOM   4818 C CZ  . ARG B 1 328 ? 20.940 34.584 83.691  1.00 27.28  ? 328 ARG B CZ  1 
ATOM   4819 N NH1 . ARG B 1 328 ? 19.910 35.419 83.674  1.00 27.28  ? 328 ARG B NH1 1 
ATOM   4820 N NH2 . ARG B 1 328 ? 21.202 33.830 82.640  1.00 27.28  ? 328 ARG B NH2 1 
ATOM   4821 N N   . LEU B 1 329 ? 22.798 35.528 91.580  1.00 27.49  ? 329 LEU B N   1 
ATOM   4822 C CA  . LEU B 1 329 ? 22.535 36.285 92.796  1.00 27.49  ? 329 LEU B CA  1 
ATOM   4823 C C   . LEU B 1 329 ? 21.405 37.287 92.542  1.00 27.49  ? 329 LEU B C   1 
ATOM   4824 O O   . LEU B 1 329 ? 21.132 37.665 91.407  1.00 27.49  ? 329 LEU B O   1 
ATOM   4825 C CB  . LEU B 1 329 ? 23.790 37.046 93.211  1.00 20.62  ? 329 LEU B CB  1 
ATOM   4826 C CG  . LEU B 1 329 ? 24.734 36.415 94.230  1.00 20.62  ? 329 LEU B CG  1 
ATOM   4827 C CD1 . LEU B 1 329 ? 24.805 34.914 94.029  1.00 20.62  ? 329 LEU B CD1 1 
ATOM   4828 C CD2 . LEU B 1 329 ? 26.101 37.061 94.096  1.00 20.62  ? 329 LEU B CD2 1 
ATOM   4829 N N   . THR B 1 330 ? 20.726 37.697 93.601  1.00 30.40  ? 330 THR B N   1 
ATOM   4830 C CA  . THR B 1 330 ? 19.672 38.689 93.462  1.00 30.40  ? 330 THR B CA  1 
ATOM   4831 C C   . THR B 1 330 ? 20.386 40.012 93.727  1.00 30.40  ? 330 THR B C   1 
ATOM   4832 O O   . THR B 1 330 ? 21.402 40.042 94.407  1.00 30.40  ? 330 THR B O   1 
ATOM   4833 C CB  . THR B 1 330 ? 18.553 38.472 94.492  1.00 29.69  ? 330 THR B CB  1 
ATOM   4834 O OG1 . THR B 1 330 ? 19.054 38.746 95.801  1.00 29.69  ? 330 THR B OG1 1 
ATOM   4835 C CG2 . THR B 1 330 ? 18.049 37.039 94.434  0.00 29.69  ? 330 THR B CG2 1 
ATOM   4836 N N   . PRO B 1 331 ? 19.883 41.115 93.175  1.00 22.73  ? 331 PRO B N   1 
ATOM   4837 C CA  . PRO B 1 331 ? 20.533 42.406 93.393  1.00 22.73  ? 331 PRO B CA  1 
ATOM   4838 C C   . PRO B 1 331 ? 20.918 42.659 94.848  1.00 22.73  ? 331 PRO B C   1 
ATOM   4839 O O   . PRO B 1 331 ? 22.038 43.087 95.148  1.00 22.73  ? 331 PRO B O   1 
ATOM   4840 C CB  . PRO B 1 331 ? 19.494 43.392 92.892  1.00 23.90  ? 331 PRO B CB  1 
ATOM   4841 C CG  . PRO B 1 331 ? 18.882 42.654 91.771  1.00 23.90  ? 331 PRO B CG  1 
ATOM   4842 C CD  . PRO B 1 331 ? 18.677 41.270 92.350  1.00 23.90  ? 331 PRO B CD  1 
ATOM   4843 N N   . LEU B 1 332 ? 19.985 42.370 95.751  1.00 37.71  ? 332 LEU B N   1 
ATOM   4844 C CA  . LEU B 1 332 ? 20.204 42.591 97.174  1.00 37.71  ? 332 LEU B CA  1 
ATOM   4845 C C   . LEU B 1 332 ? 21.293 41.690 97.718  1.00 37.71  ? 332 LEU B C   1 
ATOM   4846 O O   . LEU B 1 332 ? 22.073 42.109 98.574  1.00 37.71  ? 332 LEU B O   1 
ATOM   4847 C CB  . LEU B 1 332 ? 18.911 42.360 97.953  1.00 28.88  ? 332 LEU B CB  1 
ATOM   4848 C CG  . LEU B 1 332 ? 18.872 43.032 99.324  1.00 28.88  ? 332 LEU B CG  1 
ATOM   4849 C CD1 . LEU B 1 332 ? 18.844 44.524 99.135  1.00 28.88  ? 332 LEU B CD1 1 
ATOM   4850 C CD2 . LEU B 1 332 ? 17.647 42.598 100.097 1.00 28.88  ? 332 LEU B CD2 1 
ATOM   4851 N N   . GLU B 1 333 ? 21.340 40.452 97.232  1.00 29.59  ? 333 GLU B N   1 
ATOM   4852 C CA  . GLU B 1 333 ? 22.359 39.512 97.682  1.00 29.59  ? 333 GLU B CA  1 
ATOM   4853 C C   . GLU B 1 333 ? 23.692 40.014 97.190  1.00 29.59  ? 333 GLU B C   1 
ATOM   4854 O O   . GLU B 1 333 ? 24.692 39.908 97.879  1.00 29.59  ? 333 GLU B O   1 
ATOM   4855 C CB  . GLU B 1 333 ? 22.110 38.108 97.131  1.00 45.27  ? 333 GLU B CB  1 
ATOM   4856 C CG  . GLU B 1 333 ? 20.891 37.404 97.706  1.00 45.27  ? 333 GLU B CG  1 
ATOM   4857 C CD  . GLU B 1 333 ? 20.557 36.131 96.943  1.00 45.27  ? 333 GLU B CD  1 
ATOM   4858 O OE1 . GLU B 1 333 ? 20.941 36.048 95.752  1.00 45.27  ? 333 GLU B OE1 1 
ATOM   4859 O OE2 . GLU B 1 333 ? 19.901 35.222 97.512  1.00 45.27  ? 333 GLU B OE2 1 
ATOM   4860 N N   . ALA B 1 334 ? 23.698 40.571 95.990  1.00 30.95  ? 334 ALA B N   1 
ATOM   4861 C CA  . ALA B 1 334 ? 24.915 41.106 95.414  1.00 30.95  ? 334 ALA B CA  1 
ATOM   4862 C C   . ALA B 1 334 ? 25.469 42.237 96.293  1.00 30.95  ? 334 ALA B C   1 
ATOM   4863 O O   . ALA B 1 334 ? 26.674 42.319 96.535  1.00 30.95  ? 334 ALA B O   1 
ATOM   4864 C CB  . ALA B 1 334 ? 24.632 41.610 94.000  1.00 48.94  ? 334 ALA B CB  1 
ATOM   4865 N N   . CYS B 1 335 ? 24.587 43.103 96.772  1.00 29.48  ? 335 CYS B N   1 
ATOM   4866 C CA  . CYS B 1 335 ? 25.008 44.201 97.626  1.00 29.48  ? 335 CYS B CA  1 
ATOM   4867 C C   . CYS B 1 335 ? 25.680 43.692 98.899  1.00 29.48  ? 335 CYS B C   1 
ATOM   4868 O O   . CYS B 1 335 ? 26.563 44.349 99.449  1.00 29.48  ? 335 CYS B O   1 
ATOM   4869 C CB  . CYS B 1 335 ? 23.809 45.067 98.005  1.00 30.52  ? 335 CYS B CB  1 
ATOM   4870 S SG  . CYS B 1 335 ? 23.177 46.115 96.668  1.00 30.52  ? 335 CYS B SG  1 
ATOM   4871 N N   . ALA B 1 336 ? 25.278 42.513 99.356  1.00 28.04  ? 336 ALA B N   1 
ATOM   4872 C CA  . ALA B 1 336 ? 25.826 41.953 100.576 1.00 28.04  ? 336 ALA B CA  1 
ATOM   4873 C C   . ALA B 1 336 ? 27.040 41.064 100.375 1.00 28.04  ? 336 ALA B C   1 
ATOM   4874 O O   . ALA B 1 336 ? 27.432 40.334 101.285 1.00 28.04  ? 336 ALA B O   1 
ATOM   4875 C CB  . ALA B 1 336 ? 24.746 41.184 101.314 1.00 27.36  ? 336 ALA B CB  1 
ATOM   4876 N N   . HIS B 1 337 ? 27.641 41.133 99.196  1.00 28.78  ? 337 HIS B N   1 
ATOM   4877 C CA  . HIS B 1 337 ? 28.813 40.322 98.870  1.00 28.78  ? 337 HIS B CA  1 
ATOM   4878 C C   . HIS B 1 337 ? 30.114 40.906 99.455  1.00 28.78  ? 337 HIS B C   1 
ATOM   4879 O O   . HIS B 1 337 ? 30.266 42.121 99.595  1.00 28.78  ? 337 HIS B O   1 
ATOM   4880 C CB  . HIS B 1 337 ? 28.899 40.192 97.348  1.00 32.11  ? 337 HIS B CB  1 
ATOM   4881 C CG  . HIS B 1 337 ? 29.796 39.093 96.871  1.00 32.11  ? 337 HIS B CG  1 
ATOM   4882 N ND1 . HIS B 1 337 ? 31.166 39.234 96.781  1.00 32.11  ? 337 HIS B ND1 1 
ATOM   4883 C CD2 . HIS B 1 337 ? 29.514 37.848 96.431  1.00 32.11  ? 337 HIS B CD2 1 
ATOM   4884 C CE1 . HIS B 1 337 ? 31.686 38.121 96.303  1.00 32.11  ? 337 HIS B CE1 1 
ATOM   4885 N NE2 . HIS B 1 337 ? 30.707 37.261 96.081  1.00 32.11  ? 337 HIS B NE2 1 
ATOM   4886 N N   . SER B 1 338 ? 31.049 40.030 99.802  1.00 34.64  ? 338 SER B N   1 
ATOM   4887 C CA  . SER B 1 338 ? 32.325 40.448 100.383 1.00 34.64  ? 338 SER B CA  1 
ATOM   4888 C C   . SER B 1 338 ? 33.040 41.528 99.585  1.00 34.64  ? 338 SER B C   1 
ATOM   4889 O O   . SER B 1 338 ? 33.648 42.441 100.144 1.00 34.64  ? 338 SER B O   1 
ATOM   4890 C CB  . SER B 1 338 ? 33.248 39.248 100.505 1.00 44.51  ? 338 SER B CB  1 
ATOM   4891 O OG  . SER B 1 338 ? 32.578 38.205 101.179 1.00 44.51  ? 338 SER B OG  1 
ATOM   4892 N N   . PHE B 1 339 ? 32.975 41.410 98.267  1.00 32.14  ? 339 PHE B N   1 
ATOM   4893 C CA  . PHE B 1 339 ? 33.630 42.368 97.403  1.00 32.14  ? 339 PHE B CA  1 
ATOM   4894 C C   . PHE B 1 339 ? 33.272 43.805 97.768  1.00 32.14  ? 339 PHE B C   1 
ATOM   4895 O O   . PHE B 1 339 ? 34.001 44.733 97.436  1.00 32.14  ? 339 PHE B O   1 
ATOM   4896 C CB  . PHE B 1 339 ? 33.262 42.078 95.948  1.00 36.64  ? 339 PHE B CB  1 
ATOM   4897 C CG  . PHE B 1 339 ? 33.869 43.037 94.973  1.00 36.64  ? 339 PHE B CG  1 
ATOM   4898 C CD1 . PHE B 1 339 ? 35.251 43.240 94.943  1.00 36.64  ? 339 PHE B CD1 1 
ATOM   4899 C CD2 . PHE B 1 339 ? 33.063 43.785 94.120  1.00 36.64  ? 339 PHE B CD2 1 
ATOM   4900 C CE1 . PHE B 1 339 ? 35.819 44.185 94.084  1.00 36.64  ? 339 PHE B CE1 1 
ATOM   4901 C CE2 . PHE B 1 339 ? 33.623 44.730 93.258  1.00 36.64  ? 339 PHE B CE2 1 
ATOM   4902 C CZ  . PHE B 1 339 ? 35.003 44.929 93.242  1.00 36.64  ? 339 PHE B CZ  1 
ATOM   4903 N N   . PHE B 1 340 ? 32.162 43.990 98.472  1.00 31.47  ? 340 PHE B N   1 
ATOM   4904 C CA  . PHE B 1 340 ? 31.731 45.329 98.843  1.00 31.47  ? 340 PHE B CA  1 
ATOM   4905 C C   . PHE B 1 340 ? 31.962 45.655 100.318 1.00 31.47  ? 340 PHE B C   1 
ATOM   4906 O O   . PHE B 1 340 ? 31.581 46.727 100.790 1.00 31.47  ? 340 PHE B O   1 
ATOM   4907 C CB  . PHE B 1 340 ? 30.253 45.507 98.488  1.00 26.64  ? 340 PHE B CB  1 
ATOM   4908 C CG  . PHE B 1 340 ? 29.964 45.430 97.001  1.00 26.64  ? 340 PHE B CG  1 
ATOM   4909 C CD1 . PHE B 1 340 ? 30.567 46.319 96.111  1.00 26.64  ? 340 PHE B CD1 1 
ATOM   4910 C CD2 . PHE B 1 340 ? 29.084 44.479 96.492  1.00 26.64  ? 340 PHE B CD2 1 
ATOM   4911 C CE1 . PHE B 1 340 ? 30.297 46.258 94.754  1.00 26.64  ? 340 PHE B CE1 1 
ATOM   4912 C CE2 . PHE B 1 340 ? 28.813 44.419 95.129  1.00 26.64  ? 340 PHE B CE2 1 
ATOM   4913 C CZ  . PHE B 1 340 ? 29.418 45.306 94.266  1.00 26.64  ? 340 PHE B CZ  1 
ATOM   4914 N N   . ASP B 1 341 ? 32.606 44.737 101.034 1.00 32.86  ? 341 ASP B N   1 
ATOM   4915 C CA  . ASP B 1 341 ? 32.881 44.920 102.455 1.00 32.86  ? 341 ASP B CA  1 
ATOM   4916 C C   . ASP B 1 341 ? 33.642 46.211 102.736 1.00 32.86  ? 341 ASP B C   1 
ATOM   4917 O O   . ASP B 1 341 ? 33.342 46.914 103.697 1.00 32.86  ? 341 ASP B O   1 
ATOM   4918 C CB  . ASP B 1 341 ? 33.675 43.733 103.017 1.00 37.27  ? 341 ASP B CB  1 
ATOM   4919 C CG  . ASP B 1 341 ? 32.860 42.449 103.078 1.00 37.27  ? 341 ASP B CG  1 
ATOM   4920 O OD1 . ASP B 1 341 ? 31.631 42.494 102.863 1.00 37.27  ? 341 ASP B OD1 1 
ATOM   4921 O OD2 . ASP B 1 341 ? 33.448 41.387 103.354 1.00 37.27  ? 341 ASP B OD2 1 
ATOM   4922 N N   . GLU B 1 342 ? 34.627 46.530 101.913 1.00 26.18  ? 342 GLU B N   1 
ATOM   4923 C CA  . GLU B 1 342 ? 35.378 47.752 102.130 1.00 26.18  ? 342 GLU B CA  1 
ATOM   4924 C C   . GLU B 1 342 ? 34.472 48.972 102.191 1.00 26.18  ? 342 GLU B C   1 
ATOM   4925 O O   . GLU B 1 342 ? 34.774 49.953 102.868 1.00 26.18  ? 342 GLU B O   1 
ATOM   4926 C CB  . GLU B 1 342 ? 36.405 47.953 101.024 1.00 50.98  ? 342 GLU B CB  1 
ATOM   4927 C CG  . GLU B 1 342 ? 36.912 49.371 100.949 1.00 50.98  ? 342 GLU B CG  1 
ATOM   4928 C CD  . GLU B 1 342 ? 38.091 49.527 100.013 1.00 50.98  ? 342 GLU B CD  1 
ATOM   4929 O OE1 . GLU B 1 342 ? 38.063 48.924 98.917  1.00 50.98  ? 342 GLU B OE1 1 
ATOM   4930 O OE2 . GLU B 1 342 ? 39.044 50.264 100.371 1.00 50.98  ? 342 GLU B OE2 1 
ATOM   4931 N N   . LEU B 1 343 ? 33.358 48.927 101.475 1.00 34.06  ? 343 LEU B N   1 
ATOM   4932 C CA  . LEU B 1 343 ? 32.474 50.070 101.485 1.00 34.06  ? 343 LEU B CA  1 
ATOM   4933 C C   . LEU B 1 343 ? 31.814 50.187 102.838 1.00 34.06  ? 343 LEU B C   1 
ATOM   4934 O O   . LEU B 1 343 ? 31.289 51.240 103.192 1.00 34.06  ? 343 LEU B O   1 
ATOM   4935 C CB  . LEU B 1 343 ? 31.414 49.933 100.404 1.00 24.96  ? 343 LEU B CB  1 
ATOM   4936 C CG  . LEU B 1 343 ? 31.901 49.837 98.966  1.00 24.96  ? 343 LEU B CG  1 
ATOM   4937 C CD1 . LEU B 1 343 ? 30.687 49.878 98.062  1.00 24.96  ? 343 LEU B CD1 1 
ATOM   4938 C CD2 . LEU B 1 343 ? 32.850 50.977 98.638  1.00 24.96  ? 343 LEU B CD2 1 
ATOM   4939 N N   . ARG B 1 344 ? 31.842 49.104 103.604 1.00 39.71  ? 344 ARG B N   1 
ATOM   4940 C CA  . ARG B 1 344 ? 31.225 49.120 104.920 1.00 39.71  ? 344 ARG B CA  1 
ATOM   4941 C C   . ARG B 1 344 ? 32.187 49.511 106.043 1.00 39.71  ? 344 ARG B C   1 
ATOM   4942 O O   . ARG B 1 344 ? 31.788 49.624 107.213 1.00 39.71  ? 344 ARG B O   1 
ATOM   4943 C CB  . ARG B 1 344 ? 30.571 47.764 105.206 1.00 27.83  ? 344 ARG B CB  1 
ATOM   4944 C CG  . ARG B 1 344 ? 29.214 47.610 104.535 1.00 27.83  ? 344 ARG B CG  1 
ATOM   4945 C CD  . ARG B 1 344 ? 28.552 46.304 104.894 1.00 27.83  ? 344 ARG B CD  1 
ATOM   4946 N NE  . ARG B 1 344 ? 29.096 45.169 104.150 1.00 27.83  ? 344 ARG B NE  1 
ATOM   4947 C CZ  . ARG B 1 344 ? 28.827 44.909 102.874 1.00 27.83  ? 344 ARG B CZ  1 
ATOM   4948 N NH1 . ARG B 1 344 ? 28.017 45.701 102.186 1.00 27.83  ? 344 ARG B NH1 1 
ATOM   4949 N NH2 . ARG B 1 344 ? 29.358 43.850 102.287 1.00 27.83  ? 344 ARG B NH2 1 
ATOM   4950 N N   . ASP B 1 345 ? 33.449 49.726 105.679 1.00 40.61  ? 345 ASP B N   1 
ATOM   4951 C CA  . ASP B 1 345 ? 34.462 50.118 106.642 1.00 40.61  ? 345 ASP B CA  1 
ATOM   4952 C C   . ASP B 1 345 ? 34.264 51.577 107.004 1.00 40.61  ? 345 ASP B C   1 
ATOM   4953 O O   . ASP B 1 345 ? 34.430 52.453 106.153 1.00 40.61  ? 345 ASP B O   1 
ATOM   4954 C CB  . ASP B 1 345 ? 35.862 49.966 106.056 1.00 75.95  ? 345 ASP B CB  1 
ATOM   4955 C CG  . ASP B 1 345 ? 36.951 50.326 107.063 1.00 75.95  ? 345 ASP B CG  1 
ATOM   4956 O OD1 . ASP B 1 345 ? 37.513 49.393 107.685 1.00 75.95  ? 345 ASP B OD1 1 
ATOM   4957 O OD2 . ASP B 1 345 ? 37.226 51.539 107.248 1.00 75.95  ? 345 ASP B OD2 1 
ATOM   4958 N N   . PRO B 1 346 ? 33.925 51.864 108.273 1.00 38.56  ? 346 PRO B N   1 
ATOM   4959 C CA  . PRO B 1 346 ? 33.709 53.245 108.732 1.00 38.56  ? 346 PRO B CA  1 
ATOM   4960 C C   . PRO B 1 346 ? 34.832 54.219 108.355 1.00 38.56  ? 346 PRO B C   1 
ATOM   4961 O O   . PRO B 1 346 ? 34.630 55.433 108.333 1.00 38.56  ? 346 PRO B O   1 
ATOM   4962 C CB  . PRO B 1 346 ? 33.534 53.090 110.244 1.00 38.64  ? 346 PRO B CB  1 
ATOM   4963 C CG  . PRO B 1 346 ? 34.215 51.760 110.561 1.00 38.64  ? 346 PRO B CG  1 
ATOM   4964 C CD  . PRO B 1 346 ? 33.818 50.911 109.390 1.00 38.64  ? 346 PRO B CD  1 
ATOM   4965 N N   . ASN B 1 347 ? 36.007 53.687 108.036 1.00 46.79  ? 347 ASN B N   1 
ATOM   4966 C CA  . ASN B 1 347 ? 37.134 54.529 107.647 1.00 46.79  ? 347 ASN B CA  1 
ATOM   4967 C C   . ASN B 1 347 ? 37.246 54.724 106.137 1.00 46.79  ? 347 ASN B C   1 
ATOM   4968 O O   . ASN B 1 347 ? 38.087 55.494 105.683 1.00 46.79  ? 347 ASN B O   1 
ATOM   4969 C CB  . ASN B 1 347 ? 38.451 53.925 108.137 1.00 61.20  ? 347 ASN B CB  1 
ATOM   4970 C CG  . ASN B 1 347 ? 38.593 53.963 109.649 1.00 61.20  ? 347 ASN B CG  1 
ATOM   4971 O OD1 . ASN B 1 347 ? 38.934 52.953 110.270 1.00 61.20  ? 347 ASN B OD1 1 
ATOM   4972 N ND2 . ASN B 1 347 ? 38.346 55.135 110.251 1.00 61.20  ? 347 ASN B ND2 1 
ATOM   4973 N N   . VAL B 1 348 ? 36.428 54.030 105.349 1.00 41.91  ? 348 VAL B N   1 
ATOM   4974 C CA  . VAL B 1 348 ? 36.543 54.181 103.903 1.00 41.91  ? 348 VAL B CA  1 
ATOM   4975 C C   . VAL B 1 348 ? 36.306 55.630 103.548 1.00 41.91  ? 348 VAL B C   1 
ATOM   4976 O O   . VAL B 1 348 ? 35.518 56.314 104.194 1.00 41.91  ? 348 VAL B O   1 
ATOM   4977 C CB  . VAL B 1 348 ? 35.557 53.271 103.122 1.00 64.67  ? 348 VAL B CB  1 
ATOM   4978 C CG1 . VAL B 1 348 ? 34.114 53.726 103.325 1.00 64.67  ? 348 VAL B CG1 1 
ATOM   4979 C CG2 . VAL B 1 348 ? 35.918 53.290 101.656 1.00 64.67  ? 348 VAL B CG2 1 
ATOM   4980 N N   . LYS B 1 349 ? 37.005 56.091 102.524 1.00 28.60  ? 349 LYS B N   1 
ATOM   4981 C CA  . LYS B 1 349 ? 36.925 57.476 102.083 1.00 28.60  ? 349 LYS B CA  1 
ATOM   4982 C C   . LYS B 1 349 ? 37.144 57.452 100.573 1.00 28.60  ? 349 LYS B C   1 
ATOM   4983 O O   . LYS B 1 349 ? 37.487 56.403 100.013 1.00 28.60  ? 349 LYS B O   1 
ATOM   4984 C CB  . LYS B 1 349 ? 38.055 58.268 102.758 1.00 44.54  ? 349 LYS B CB  1 
ATOM   4985 C CG  . LYS B 1 349 ? 37.668 59.588 103.429 1.00 44.54  ? 349 LYS B CG  1 
ATOM   4986 C CD  . LYS B 1 349 ? 36.807 59.365 104.642 1.00 44.54  ? 349 LYS B CD  1 
ATOM   4987 C CE  . LYS B 1 349 ? 36.492 60.677 105.339 1.00 44.54  ? 349 LYS B CE  1 
ATOM   4988 N NZ  . LYS B 1 349 ? 35.555 60.486 106.503 1.00 44.54  ? 349 LYS B NZ  1 
ATOM   4989 N N   . LEU B 1 350 ? 36.947 58.582 99.901  1.00 36.18  ? 350 LEU B N   1 
ATOM   4990 C CA  . LEU B 1 350 ? 37.182 58.618 98.449  1.00 36.18  ? 350 LEU B CA  1 
ATOM   4991 C C   . LEU B 1 350 ? 38.595 59.111 98.182  1.00 36.18  ? 350 LEU B C   1 
ATOM   4992 O O   . LEU B 1 350 ? 39.129 59.889 98.958  1.00 36.18  ? 350 LEU B O   1 
ATOM   4993 C CB  . LEU B 1 350 ? 36.194 59.553 97.750  1.00 17.38  ? 350 LEU B CB  1 
ATOM   4994 C CG  . LEU B 1 350 ? 34.728 59.116 97.829  1.00 17.38  ? 350 LEU B CG  1 
ATOM   4995 C CD1 . LEU B 1 350 ? 33.837 60.106 97.099  1.00 17.38  ? 350 LEU B CD1 1 
ATOM   4996 C CD2 . LEU B 1 350 ? 34.576 57.735 97.223  1.00 17.38  ? 350 LEU B CD2 1 
ATOM   4997 N N   . PRO B 1 351 ? 39.235 58.647 97.099  1.00 39.56  ? 351 PRO B N   1 
ATOM   4998 C CA  . PRO B 1 351 ? 40.597 59.115 96.807  1.00 39.56  ? 351 PRO B CA  1 
ATOM   4999 C C   . PRO B 1 351 ? 40.536 60.636 96.726  1.00 39.56  ? 351 PRO B C   1 
ATOM   5000 O O   . PRO B 1 351 ? 41.532 61.349 96.749  1.00 39.56  ? 351 PRO B O   1 
ATOM   5001 C CB  . PRO B 1 351 ? 40.909 58.456 95.464  1.00 37.60  ? 351 PRO B CB  1 
ATOM   5002 C CG  . PRO B 1 351 ? 39.558 58.185 94.880  1.00 37.60  ? 351 PRO B CG  1 
ATOM   5003 C CD  . PRO B 1 351 ? 38.760 57.727 96.057  1.00 37.60  ? 351 PRO B CD  1 
ATOM   5004 N N   . ASN B 1 352 ? 39.306 61.098 96.652  1.00 35.58  ? 352 ASN B N   1 
ATOM   5005 C CA  . ASN B 1 352 ? 38.936 62.496 96.588  1.00 35.58  ? 352 ASN B CA  1 
ATOM   5006 C C   . ASN B 1 352 ? 39.244 63.163 97.934  1.00 35.58  ? 352 ASN B C   1 
ATOM   5007 O O   . ASN B 1 352 ? 39.546 64.354 98.023  1.00 35.58  ? 352 ASN B O   1 
ATOM   5008 C CB  . ASN B 1 352 ? 37.433 62.533 96.340  1.00 47.59  ? 352 ASN B CB  1 
ATOM   5009 C CG  . ASN B 1 352 ? 36.962 63.848 95.871  1.00 47.59  ? 352 ASN B CG  1 
ATOM   5010 O OD1 . ASN B 1 352 ? 35.765 64.091 95.821  1.00 47.59  ? 352 ASN B OD1 1 
ATOM   5011 N ND2 . ASN B 1 352 ? 37.893 64.720 95.504  1.00 47.59  ? 352 ASN B ND2 1 
ATOM   5012 N N   . GLY B 1 353 ? 39.135 62.371 98.989  1.00 33.34  ? 353 GLY B N   1 
ATOM   5013 C CA  . GLY B 1 353 ? 39.371 62.879 100.318 1.00 33.34  ? 353 GLY B CA  1 
ATOM   5014 C C   . GLY B 1 353 ? 38.032 63.055 100.996 1.00 33.34  ? 353 GLY B C   1 
ATOM   5015 O O   . GLY B 1 353 ? 37.930 63.006 102.221 1.00 33.34  ? 353 GLY B O   1 
ATOM   5016 N N   . ARG B 1 354 ? 36.996 63.252 100.192 1.00 30.07  ? 354 ARG B N   1 
ATOM   5017 C CA  . ARG B 1 354 ? 35.676 63.443 100.751 1.00 30.07  ? 354 ARG B CA  1 
ATOM   5018 C C   . ARG B 1 354 ? 34.939 62.131 101.015 1.00 30.07  ? 354 ARG B C   1 
ATOM   5019 O O   . ARG B 1 354 ? 35.330 61.077 100.537 1.00 30.07  ? 354 ARG B O   1 
ATOM   5020 C CB  . ARG B 1 354 ? 34.846 64.377 99.853  1.00 49.54  ? 354 ARG B CB  1 
ATOM   5021 C CG  . ARG B 1 354 ? 34.388 63.798 98.538  1.00 49.54  ? 354 ARG B CG  1 
ATOM   5022 C CD  . ARG B 1 354 ? 33.411 64.742 97.847  1.00 49.54  ? 354 ARG B CD  1 
ATOM   5023 N NE  . ARG B 1 354 ? 34.067 65.898 97.239  1.00 49.54  ? 354 ARG B NE  1 
ATOM   5024 C CZ  . ARG B 1 354 ? 33.420 66.860 96.580  1.00 49.54  ? 354 ARG B CZ  1 
ATOM   5025 N NH1 . ARG B 1 354 ? 32.092 66.809 96.449  1.00 49.54  ? 354 ARG B NH1 1 
ATOM   5026 N NH2 . ARG B 1 354 ? 34.099 67.864 96.035  1.00 49.54  ? 354 ARG B NH2 1 
ATOM   5027 N N   . ASP B 1 355 ? 33.879 62.213 101.809 1.00 49.23  ? 355 ASP B N   1 
ATOM   5028 C CA  . ASP B 1 355 ? 33.065 61.056 102.176 1.00 49.23  ? 355 ASP B CA  1 
ATOM   5029 C C   . ASP B 1 355 ? 32.365 60.300 101.057 1.00 49.23  ? 355 ASP B C   1 
ATOM   5030 O O   . ASP B 1 355 ? 31.963 60.890 100.041 1.00 49.23  ? 355 ASP B O   1 
ATOM   5031 C CB  . ASP B 1 355 ? 31.984 61.472 103.161 1.00 56.92  ? 355 ASP B CB  1 
ATOM   5032 C CG  . ASP B 1 355 ? 32.476 61.513 104.572 1.00 56.92  ? 355 ASP B CG  1 
ATOM   5033 O OD1 . ASP B 1 355 ? 31.641 61.735 105.475 1.00 56.92  ? 355 ASP B OD1 1 
ATOM   5034 O OD2 . ASP B 1 355 ? 33.694 61.323 104.783 1.00 56.92  ? 355 ASP B OD2 1 
ATOM   5035 N N   . THR B 1 356 ? 32.198 58.993 101.276 1.00 26.81  ? 356 THR B N   1 
ATOM   5036 C CA  . THR B 1 356 ? 31.490 58.151 100.326 1.00 26.81  ? 356 THR B CA  1 
ATOM   5037 C C   . THR B 1 356 ? 30.038 58.613 100.351 1.00 26.81  ? 356 THR B C   1 
ATOM   5038 O O   . THR B 1 356 ? 29.563 59.173 101.345 1.00 26.81  ? 356 THR B O   1 
ATOM   5039 C CB  . THR B 1 356 ? 31.516 56.657 100.716 1.00 34.33  ? 356 THR B CB  1 
ATOM   5040 O OG1 . THR B 1 356 ? 31.109 56.518 102.076 1.00 34.33  ? 356 THR B OG1 1 
ATOM   5041 C CG2 . THR B 1 356 ? 32.901 56.064 100.537 1.00 34.33  ? 356 THR B CG2 1 
ATOM   5042 N N   . PRO B 1 357 ? 29.313 58.391 99.252  1.00 29.88  ? 357 PRO B N   1 
ATOM   5043 C CA  . PRO B 1 357 ? 27.917 58.813 99.219  1.00 29.88  ? 357 PRO B CA  1 
ATOM   5044 C C   . PRO B 1 357 ? 27.040 57.896 100.062 1.00 29.88  ? 357 PRO B C   1 
ATOM   5045 O O   . PRO B 1 357 ? 27.538 56.970 100.716 1.00 29.88  ? 357 PRO B O   1 
ATOM   5046 C CB  . PRO B 1 357 ? 27.588 58.736 97.739  1.00 26.18  ? 357 PRO B CB  1 
ATOM   5047 C CG  . PRO B 1 357 ? 28.363 57.520 97.317  1.00 26.18  ? 357 PRO B CG  1 
ATOM   5048 C CD  . PRO B 1 357 ? 29.703 57.761 97.977  1.00 26.18  ? 357 PRO B CD  1 
ATOM   5049 N N   . ALA B 1 358 ? 25.738 58.180 100.046 1.00 21.54  ? 358 ALA B N   1 
ATOM   5050 C CA  . ALA B 1 358 ? 24.739 57.390 100.758 1.00 21.54  ? 358 ALA B CA  1 
ATOM   5051 C C   . ALA B 1 358 ? 24.842 55.973 100.243 1.00 21.54  ? 358 ALA B C   1 
ATOM   5052 O O   . ALA B 1 358 ? 24.737 55.724 99.044  1.00 21.54  ? 358 ALA B O   1 
ATOM   5053 C CB  . ALA B 1 358 ? 23.354 57.931 100.490 1.00 14.47  ? 358 ALA B CB  1 
ATOM   5054 N N   . LEU B 1 359 ? 25.043 55.041 101.154 1.00 24.66  ? 359 LEU B N   1 
ATOM   5055 C CA  . LEU B 1 359 ? 25.196 53.659 100.779 1.00 24.66  ? 359 LEU B CA  1 
ATOM   5056 C C   . LEU B 1 359 ? 24.280 52.758 101.583 1.00 24.66  ? 359 LEU B C   1 
ATOM   5057 O O   . LEU B 1 359 ? 23.837 51.718 101.102 1.00 24.66  ? 359 LEU B O   1 
ATOM   5058 C CB  . LEU B 1 359 ? 26.652 53.256 101.019 1.00 26.46  ? 359 LEU B CB  1 
ATOM   5059 C CG  . LEU B 1 359 ? 27.612 53.079 99.843  1.00 26.46  ? 359 LEU B CG  1 
ATOM   5060 C CD1 . LEU B 1 359 ? 27.368 54.115 98.774  1.00 26.46  ? 359 LEU B CD1 1 
ATOM   5061 C CD2 . LEU B 1 359 ? 29.036 53.150 100.365 1.00 26.46  ? 359 LEU B CD2 1 
ATOM   5062 N N   . PHE B 1 360 ? 23.977 53.185 102.803 1.00 28.43  ? 360 PHE B N   1 
ATOM   5063 C CA  . PHE B 1 360 ? 23.195 52.376 103.720 1.00 28.43  ? 360 PHE B CA  1 
ATOM   5064 C C   . PHE B 1 360 ? 21.784 52.820 104.085 1.00 28.43  ? 360 PHE B C   1 
ATOM   5065 O O   . PHE B 1 360 ? 21.155 52.225 104.959 1.00 28.43  ? 360 PHE B O   1 
ATOM   5066 C CB  . PHE B 1 360 ? 24.021 52.192 104.994 1.00 28.12  ? 360 PHE B CB  1 
ATOM   5067 C CG  . PHE B 1 360 ? 25.465 51.928 104.728 1.00 28.12  ? 360 PHE B CG  1 
ATOM   5068 C CD1 . PHE B 1 360 ? 25.880 50.706 104.213 1.00 28.12  ? 360 PHE B CD1 1 
ATOM   5069 C CD2 . PHE B 1 360 ? 26.415 52.919 104.964 1.00 28.12  ? 360 PHE B CD2 1 
ATOM   5070 C CE1 . PHE B 1 360 ? 27.218 50.479 103.916 1.00 28.12  ? 360 PHE B CE1 1 
ATOM   5071 C CE2 . PHE B 1 360 ? 27.752 52.706 104.673 1.00 28.12  ? 360 PHE B CE2 1 
ATOM   5072 C CZ  . PHE B 1 360 ? 28.161 51.478 104.153 1.00 28.12  ? 360 PHE B CZ  1 
ATOM   5073 N N   . ASN B 1 361 ? 21.265 53.845 103.428 1.00 25.80  ? 361 ASN B N   1 
ATOM   5074 C CA  . ASN B 1 361 ? 19.919 54.294 103.750 1.00 25.80  ? 361 ASN B CA  1 
ATOM   5075 C C   . ASN B 1 361 ? 18.838 53.423 103.102 1.00 25.80  ? 361 ASN B C   1 
ATOM   5076 O O   . ASN B 1 361 ? 18.014 53.907 102.347 1.00 25.80  ? 361 ASN B O   1 
ATOM   5077 C CB  . ASN B 1 361 ? 19.754 55.749 103.329 1.00 26.59  ? 361 ASN B CB  1 
ATOM   5078 C CG  . ASN B 1 361 ? 20.045 55.957 101.879 1.00 26.59  ? 361 ASN B CG  1 
ATOM   5079 O OD1 . ASN B 1 361 ? 20.901 55.285 101.308 1.00 26.59  ? 361 ASN B OD1 1 
ATOM   5080 N ND2 . ASN B 1 361 ? 19.339 56.892 101.264 1.00 26.59  ? 361 ASN B ND2 1 
ATOM   5081 N N   . PHE B 1 362 ? 18.847 52.136 103.417 1.00 24.90  ? 362 PHE B N   1 
ATOM   5082 C CA  . PHE B 1 362 ? 17.879 51.199 102.879 1.00 24.90  ? 362 PHE B CA  1 
ATOM   5083 C C   . PHE B 1 362 ? 16.496 51.424 103.445 1.00 24.90  ? 362 PHE B C   1 
ATOM   5084 O O   . PHE B 1 362 ? 16.357 51.817 104.601 1.00 24.90  ? 362 PHE B O   1 
ATOM   5085 C CB  . PHE B 1 362 ? 18.300 49.781 103.231 1.00 31.54  ? 362 PHE B CB  1 
ATOM   5086 C CG  . PHE B 1 362 ? 19.409 49.252 102.398 1.00 31.54  ? 362 PHE B CG  1 
ATOM   5087 C CD1 . PHE B 1 362 ? 19.150 48.670 101.170 1.00 31.54  ? 362 PHE B CD1 1 
ATOM   5088 C CD2 . PHE B 1 362 ? 20.715 49.294 102.856 1.00 31.54  ? 362 PHE B CD2 1 
ATOM   5089 C CE1 . PHE B 1 362 ? 20.178 48.128 100.409 1.00 31.54  ? 362 PHE B CE1 1 
ATOM   5090 C CE2 . PHE B 1 362 ? 21.758 48.755 102.100 1.00 31.54  ? 362 PHE B CE2 1 
ATOM   5091 C CZ  . PHE B 1 362 ? 21.483 48.169 100.875 1.00 31.54  ? 362 PHE B CZ  1 
ATOM   5092 N N   . THR B 1 363 ? 15.474 51.170 102.633 1.00 39.25  ? 363 THR B N   1 
ATOM   5093 C CA  . THR B 1 363 ? 14.080 51.285 103.085 1.00 39.25  ? 363 THR B CA  1 
ATOM   5094 C C   . THR B 1 363 ? 13.514 49.868 103.089 1.00 39.25  ? 363 THR B C   1 
ATOM   5095 O O   . THR B 1 363 ? 14.111 48.950 102.510 1.00 39.25  ? 363 THR B O   1 
ATOM   5096 C CB  . THR B 1 363 ? 13.184 52.137 102.146 1.00 19.80  ? 363 THR B CB  1 
ATOM   5097 O OG1 . THR B 1 363 ? 13.108 51.516 100.857 1.00 19.80  ? 363 THR B OG1 1 
ATOM   5098 C CG2 . THR B 1 363 ? 13.709 53.540 102.025 1.00 19.80  ? 363 THR B CG2 1 
ATOM   5099 N N   . THR B 1 364 ? 12.364 49.690 103.736 1.00 32.91  ? 364 THR B N   1 
ATOM   5100 C CA  . THR B 1 364 ? 11.729 48.379 103.811 1.00 32.91  ? 364 THR B CA  1 
ATOM   5101 C C   . THR B 1 364 ? 11.472 47.855 102.401 1.00 32.91  ? 364 THR B C   1 
ATOM   5102 O O   . THR B 1 364 ? 11.810 46.723 102.081 1.00 32.91  ? 364 THR B O   1 
ATOM   5103 C CB  . THR B 1 364 ? 10.385 48.447 104.552 1.00 34.16  ? 364 THR B CB  1 
ATOM   5104 O OG1 . THR B 1 364 ? 10.515 49.282 105.705 1.00 34.16  ? 364 THR B OG1 1 
ATOM   5105 C CG2 . THR B 1 364 ? 9.962  47.073 105.001 1.00 34.16  ? 364 THR B CG2 1 
ATOM   5106 N N   . GLN B 1 365 ? 10.877 48.689 101.561 1.00 28.22  ? 365 GLN B N   1 
ATOM   5107 C CA  . GLN B 1 365 ? 10.584 48.288 100.204 1.00 28.22  ? 365 GLN B CA  1 
ATOM   5108 C C   . GLN B 1 365 ? 11.825 47.743 99.513  1.00 28.22  ? 365 GLN B C   1 
ATOM   5109 O O   . GLN B 1 365 ? 11.779 46.738 98.806  1.00 28.22  ? 365 GLN B O   1 
ATOM   5110 C CB  . GLN B 1 365 ? 10.039 49.478 99.414  1.00 40.21  ? 365 GLN B CB  1 
ATOM   5111 C CG  . GLN B 1 365 ? 9.985  49.244 97.917  1.00 40.21  ? 365 GLN B CG  1 
ATOM   5112 C CD  . GLN B 1 365 ? 9.154  48.032 97.541  1.00 40.21  ? 365 GLN B CD  1 
ATOM   5113 O OE1 . GLN B 1 365 ? 8.027  48.167 97.092  1.00 40.21  ? 365 GLN B OE1 1 
ATOM   5114 N NE2 . GLN B 1 365 ? 9.708  46.845 97.730  0.00 40.21  ? 365 GLN B NE2 1 
ATOM   5115 N N   . GLU B 1 366 ? 12.949 48.407 99.729  1.00 36.17  ? 366 GLU B N   1 
ATOM   5116 C CA  . GLU B 1 366 ? 14.186 48.002 99.089  1.00 36.17  ? 366 GLU B CA  1 
ATOM   5117 C C   . GLU B 1 366 ? 14.749 46.708 99.637  1.00 36.17  ? 366 GLU B C   1 
ATOM   5118 O O   . GLU B 1 366 ? 15.452 45.982 98.930  1.00 36.17  ? 366 GLU B O   1 
ATOM   5119 C CB  . GLU B 1 366 ? 15.200 49.133 99.227  1.00 39.37  ? 366 GLU B CB  1 
ATOM   5120 C CG  . GLU B 1 366 ? 16.539 48.858 98.589  1.00 39.37  ? 366 GLU B CG  1 
ATOM   5121 C CD  . GLU B 1 366 ? 17.368 50.110 98.518  1.00 39.37  ? 366 GLU B CD  1 
ATOM   5122 O OE1 . GLU B 1 366 ? 17.099 51.014 99.345  1.00 39.37  ? 366 GLU B OE1 1 
ATOM   5123 O OE2 . GLU B 1 366 ? 18.271 50.185 97.654  1.00 39.37  ? 366 GLU B OE2 1 
ATOM   5124 N N   . LEU B 1 367 ? 14.430 46.421 100.897 1.00 31.88  ? 367 LEU B N   1 
ATOM   5125 C CA  . LEU B 1 367 ? 14.909 45.213 101.568 1.00 31.88  ? 367 LEU B CA  1 
ATOM   5126 C C   . LEU B 1 367 ? 13.912 44.074 101.504 1.00 31.88  ? 367 LEU B C   1 
ATOM   5127 O O   . LEU B 1 367 ? 14.239 42.934 101.835 1.00 31.88  ? 367 LEU B O   1 
ATOM   5128 C CB  . LEU B 1 367 ? 15.175 45.509 103.036 1.00 41.02  ? 367 LEU B CB  1 
ATOM   5129 C CG  . LEU B 1 367 ? 16.157 46.626 103.361 1.00 41.02  ? 367 LEU B CG  1 
ATOM   5130 C CD1 . LEU B 1 367 ? 15.908 47.131 104.785 1.00 41.02  ? 367 LEU B CD1 1 
ATOM   5131 C CD2 . LEU B 1 367 ? 17.573 46.108 103.186 1.00 41.02  ? 367 LEU B CD2 1 
ATOM   5132 N N   . SER B 1 368 ? 12.694 44.395 101.087 1.00 37.83  ? 368 SER B N   1 
ATOM   5133 C CA  . SER B 1 368 ? 11.615 43.423 101.018 1.00 37.83  ? 368 SER B CA  1 
ATOM   5134 C C   . SER B 1 368 ? 11.963 42.072 100.406 1.00 37.83  ? 368 SER B C   1 
ATOM   5135 O O   . SER B 1 368 ? 11.341 41.069 100.743 1.00 37.83  ? 368 SER B O   1 
ATOM   5136 C CB  . SER B 1 368 ? 10.417 44.031 100.295 1.00 55.37  ? 368 SER B CB  1 
ATOM   5137 O OG  . SER B 1 368 ? 10.784 44.520 99.016  1.00 55.37  ? 368 SER B OG  1 
ATOM   5138 N N   . SER B 1 369 ? 12.949 42.030 99.517  1.00 38.48  ? 369 SER B N   1 
ATOM   5139 C CA  . SER B 1 369 ? 13.333 40.759 98.909  1.00 38.48  ? 369 SER B CA  1 
ATOM   5140 C C   . SER B 1 369 ? 13.920 39.803 99.934  1.00 38.48  ? 369 SER B C   1 
ATOM   5141 O O   . SER B 1 369 ? 13.703 38.612 99.845  1.00 38.48  ? 369 SER B O   1 
ATOM   5142 C CB  . SER B 1 369 ? 14.335 40.976 97.770  1.00 42.54  ? 369 SER B CB  1 
ATOM   5143 O OG  . SER B 1 369 ? 15.371 41.878 98.128  1.00 42.54  ? 369 SER B OG  1 
ATOM   5144 N N   . ASN B 1 370 ? 14.654 40.325 100.907 1.00 25.59  ? 370 ASN B N   1 
ATOM   5145 C CA  . ASN B 1 370 ? 15.260 39.486 101.934 1.00 25.59  ? 370 ASN B CA  1 
ATOM   5146 C C   . ASN B 1 370 ? 15.723 40.333 103.126 1.00 25.59  ? 370 ASN B C   1 
ATOM   5147 O O   . ASN B 1 370 ? 16.901 40.665 103.260 1.00 25.59  ? 370 ASN B O   1 
ATOM   5148 C CB  . ASN B 1 370 ? 16.426 38.710 101.328 1.00 36.57  ? 370 ASN B CB  1 
ATOM   5149 C CG  . ASN B 1 370 ? 17.109 37.794 102.323 1.00 36.57  ? 370 ASN B CG  1 
ATOM   5150 O OD1 . ASN B 1 370 ? 17.918 36.951 101.940 1.00 36.57  ? 370 ASN B OD1 1 
ATOM   5151 N ND2 . ASN B 1 370 ? 16.802 37.957 103.600 1.00 36.57  ? 370 ASN B ND2 1 
ATOM   5152 N N   . PRO B 1 371 ? 14.781 40.681 104.018 1.00 38.05  ? 371 PRO B N   1 
ATOM   5153 C CA  . PRO B 1 371 ? 15.011 41.494 105.223 1.00 38.05  ? 371 PRO B CA  1 
ATOM   5154 C C   . PRO B 1 371 ? 16.213 41.088 106.080 1.00 38.05  ? 371 PRO B C   1 
ATOM   5155 O O   . PRO B 1 371 ? 16.988 41.938 106.515 1.00 38.05  ? 371 PRO B O   1 
ATOM   5156 C CB  . PRO B 1 371 ? 13.687 41.370 105.976 1.00 25.90  ? 371 PRO B CB  1 
ATOM   5157 C CG  . PRO B 1 371 ? 12.691 41.261 104.865 1.00 25.90  ? 371 PRO B CG  1 
ATOM   5158 C CD  . PRO B 1 371 ? 13.362 40.279 103.926 1.00 25.90  ? 371 PRO B CD  1 
ATOM   5159 N N   . PRO B 1 372 ? 16.373 39.786 106.350 1.00 37.48  ? 372 PRO B N   1 
ATOM   5160 C CA  . PRO B 1 372 ? 17.512 39.362 107.165 1.00 37.48  ? 372 PRO B CA  1 
ATOM   5161 C C   . PRO B 1 372 ? 18.813 40.066 106.790 1.00 37.48  ? 372 PRO B C   1 
ATOM   5162 O O   . PRO B 1 372 ? 19.637 40.353 107.655 1.00 37.48  ? 372 PRO B O   1 
ATOM   5163 C CB  . PRO B 1 372 ? 17.561 37.861 106.916 1.00 28.16  ? 372 PRO B CB  1 
ATOM   5164 C CG  . PRO B 1 372 ? 16.107 37.510 106.847 1.00 28.16  ? 372 PRO B CG  1 
ATOM   5165 C CD  . PRO B 1 372 ? 15.508 38.637 106.015 1.00 28.16  ? 372 PRO B CD  1 
ATOM   5166 N N   . LEU B 1 373 ? 18.983 40.353 105.502 1.00 34.53  ? 373 LEU B N   1 
ATOM   5167 C CA  . LEU B 1 373 ? 20.185 41.014 104.993 1.00 34.53  ? 373 LEU B CA  1 
ATOM   5168 C C   . LEU B 1 373 ? 20.564 42.320 105.678 1.00 34.53  ? 373 LEU B C   1 
ATOM   5169 O O   . LEU B 1 373 ? 21.746 42.646 105.759 1.00 34.53  ? 373 LEU B O   1 
ATOM   5170 C CB  . LEU B 1 373 ? 20.039 41.262 103.491 1.00 37.09  ? 373 LEU B CB  1 
ATOM   5171 C CG  . LEU B 1 373 ? 20.376 40.102 102.545 1.00 37.09  ? 373 LEU B CG  1 
ATOM   5172 C CD1 . LEU B 1 373 ? 19.965 38.797 103.191 1.00 37.09  ? 373 LEU B CD1 1 
ATOM   5173 C CD2 . LEU B 1 373 ? 19.686 40.290 101.186 1.00 37.09  ? 373 LEU B CD2 1 
ATOM   5174 N N   . ALA B 1 374 ? 19.573 43.061 106.171 1.00 31.16  ? 374 ALA B N   1 
ATOM   5175 C CA  . ALA B 1 374 ? 19.822 44.346 106.828 1.00 31.16  ? 374 ALA B CA  1 
ATOM   5176 C C   . ALA B 1 374 ? 21.016 44.270 107.749 1.00 31.16  ? 374 ALA B C   1 
ATOM   5177 O O   . ALA B 1 374 ? 21.763 45.235 107.899 1.00 31.16  ? 374 ALA B O   1 
ATOM   5178 C CB  . ALA B 1 374 ? 18.593 44.798 107.611 1.00 26.64  ? 374 ALA B CB  1 
ATOM   5179 N N   . THR B 1 375 ? 21.201 43.105 108.353 1.00 37.11  ? 375 THR B N   1 
ATOM   5180 C CA  . THR B 1 375 ? 22.305 42.889 109.278 1.00 37.11  ? 375 THR B CA  1 
ATOM   5181 C C   . THR B 1 375 ? 23.662 43.066 108.650 1.00 37.11  ? 375 THR B C   1 
ATOM   5182 O O   . THR B 1 375 ? 24.616 43.399 109.339 1.00 37.11  ? 375 THR B O   1 
ATOM   5183 C CB  . THR B 1 375 ? 22.228 41.505 109.896 1.00 34.79  ? 375 THR B CB  1 
ATOM   5184 O OG1 . THR B 1 375 ? 21.188 41.505 110.877 1.00 34.79  ? 375 THR B OG1 1 
ATOM   5185 C CG2 . THR B 1 375 ? 23.552 41.123 110.549 1.00 34.79  ? 375 THR B CG2 1 
ATOM   5186 N N   . ILE B 1 376 ? 23.756 42.827 107.348 1.00 41.34  ? 376 ILE B N   1 
ATOM   5187 C CA  . ILE B 1 376 ? 25.025 43.001 106.663 1.00 41.34  ? 376 ILE B CA  1 
ATOM   5188 C C   . ILE B 1 376 ? 24.978 44.320 105.908 1.00 41.34  ? 376 ILE B C   1 
ATOM   5189 O O   . ILE B 1 376 ? 25.906 45.116 105.978 1.00 41.34  ? 376 ILE B O   1 
ATOM   5190 C CB  . ILE B 1 376 ? 25.305 41.868 105.671 1.00 31.14  ? 376 ILE B CB  1 
ATOM   5191 C CG1 . ILE B 1 376 ? 25.202 40.521 106.374 1.00 31.14  ? 376 ILE B CG1 1 
ATOM   5192 C CG2 . ILE B 1 376 ? 26.698 42.021 105.113 1.00 31.14  ? 376 ILE B CG2 1 
ATOM   5193 C CD1 . ILE B 1 376 ? 25.472 39.332 105.465 1.00 31.14  ? 376 ILE B CD1 1 
ATOM   5194 N N   . LEU B 1 377 ? 23.882 44.542 105.195 1.00 27.23  ? 377 LEU B N   1 
ATOM   5195 C CA  . LEU B 1 377 ? 23.687 45.764 104.430 1.00 27.23  ? 377 LEU B CA  1 
ATOM   5196 C C   . LEU B 1 377 ? 23.908 47.025 105.268 1.00 27.23  ? 377 LEU B C   1 
ATOM   5197 O O   . LEU B 1 377 ? 24.431 48.024 104.774 1.00 27.23  ? 377 LEU B O   1 
ATOM   5198 C CB  . LEU B 1 377 ? 22.274 45.768 103.839 1.00 32.98  ? 377 LEU B CB  1 
ATOM   5199 C CG  . LEU B 1 377 ? 22.142 45.157 102.442 1.00 32.98  ? 377 LEU B CG  1 
ATOM   5200 C CD1 . LEU B 1 377 ? 23.117 44.008 102.269 1.00 32.98  ? 377 LEU B CD1 1 
ATOM   5201 C CD2 . LEU B 1 377 ? 20.699 44.714 102.206 1.00 32.98  ? 377 LEU B CD2 1 
ATOM   5202 N N   . ILE B 1 378 ? 23.512 46.970 106.534 1.00 33.35  ? 378 ILE B N   1 
ATOM   5203 C CA  . ILE B 1 378 ? 23.660 48.106 107.427 1.00 33.35  ? 378 ILE B CA  1 
ATOM   5204 C C   . ILE B 1 378 ? 24.732 47.826 108.477 1.00 33.35  ? 378 ILE B C   1 
ATOM   5205 O O   . ILE B 1 378 ? 24.494 47.127 109.447 1.00 33.35  ? 378 ILE B O   1 
ATOM   5206 C CB  . ILE B 1 378 ? 22.321 48.427 108.090 1.00 39.29  ? 378 ILE B CB  1 
ATOM   5207 C CG1 . ILE B 1 378 ? 21.334 48.876 107.012 1.00 39.29  ? 378 ILE B CG1 1 
ATOM   5208 C CG2 . ILE B 1 378 ? 22.497 49.505 109.130 1.00 39.29  ? 378 ILE B CG2 1 
ATOM   5209 C CD1 . ILE B 1 378 ? 19.913 49.057 107.493 1.00 39.29  ? 378 ILE B CD1 1 
ATOM   5210 N N   . PRO B 1 379 ? 25.933 48.394 108.290 1.00 45.99  ? 379 PRO B N   1 
ATOM   5211 C CA  . PRO B 1 379 ? 27.063 48.209 109.199 1.00 45.99  ? 379 PRO B CA  1 
ATOM   5212 C C   . PRO B 1 379 ? 26.803 48.864 110.545 1.00 45.99  ? 379 PRO B C   1 
ATOM   5213 O O   . PRO B 1 379 ? 26.045 49.833 110.636 1.00 45.99  ? 379 PRO B O   1 
ATOM   5214 C CB  . PRO B 1 379 ? 28.202 48.870 108.448 1.00 44.90  ? 379 PRO B CB  1 
ATOM   5215 C CG  . PRO B 1 379 ? 27.507 50.080 107.882 1.00 44.90  ? 379 PRO B CG  1 
ATOM   5216 C CD  . PRO B 1 379 ? 26.211 49.490 107.341 1.00 44.90  ? 379 PRO B CD  1 
ATOM   5217 N N   . PRO B 1 380 ? 27.451 48.348 111.602 1.00 54.40  ? 380 PRO B N   1 
ATOM   5218 C CA  . PRO B 1 380 ? 27.346 48.816 112.987 1.00 54.40  ? 380 PRO B CA  1 
ATOM   5219 C C   . PRO B 1 380 ? 27.403 50.333 113.166 1.00 54.40  ? 380 PRO B C   1 
ATOM   5220 O O   . PRO B 1 380 ? 26.720 50.875 114.035 1.00 54.40  ? 380 PRO B O   1 
ATOM   5221 C CB  . PRO B 1 380 ? 28.511 48.109 113.679 1.00 51.12  ? 380 PRO B CB  1 
ATOM   5222 C CG  . PRO B 1 380 ? 28.643 46.836 112.910 1.00 51.12  ? 380 PRO B CG  1 
ATOM   5223 C CD  . PRO B 1 380 ? 28.491 47.307 111.484 1.00 51.12  ? 380 PRO B CD  1 
ATOM   5224 N N   . HIS B 1 381 ? 28.203 51.028 112.364 1.00 39.13  ? 381 HIS B N   1 
ATOM   5225 C CA  . HIS B 1 381 ? 28.278 52.477 112.525 1.00 39.13  ? 381 HIS B CA  1 
ATOM   5226 C C   . HIS B 1 381 ? 27.184 53.206 111.738 1.00 39.13  ? 381 HIS B C   1 
ATOM   5227 O O   . HIS B 1 381 ? 26.837 54.330 112.069 1.00 39.13  ? 381 HIS B O   1 
ATOM   5228 C CB  . HIS B 1 381 ? 29.656 52.978 112.100 1.00 45.13  ? 381 HIS B CB  1 
ATOM   5229 C CG  . HIS B 1 381 ? 29.992 52.648 110.684 1.00 45.13  ? 381 HIS B CG  1 
ATOM   5230 N ND1 . HIS B 1 381 ? 29.624 53.451 109.624 1.00 45.13  ? 381 HIS B ND1 1 
ATOM   5231 C CD2 . HIS B 1 381 ? 30.605 51.568 110.143 1.00 45.13  ? 381 HIS B CD2 1 
ATOM   5232 C CE1 . HIS B 1 381 ? 29.998 52.883 108.491 1.00 45.13  ? 381 HIS B CE1 1 
ATOM   5233 N NE2 . HIS B 1 381 ? 30.596 51.738 108.780 1.00 45.13  ? 381 HIS B NE2 1 
ATOM   5234 N N   . ALA B 1 382 ? 26.643 52.572 110.700 1.00 53.09  ? 382 ALA B N   1 
ATOM   5235 C CA  . ALA B 1 382 ? 25.598 53.204 109.891 1.00 53.09  ? 382 ALA B CA  1 
ATOM   5236 C C   . ALA B 1 382 ? 24.438 53.694 110.753 1.00 53.09  ? 382 ALA B C   1 
ATOM   5237 O O   . ALA B 1 382 ? 24.217 53.183 111.859 1.00 53.09  ? 382 ALA B O   1 
ATOM   5238 C CB  . ALA B 1 382 ? 25.085 52.230 108.851 0.00 35.69  ? 382 ALA B CB  1 
HETATM 5239 P P   . PO4 C 2 .   ? 20.855 25.652 63.621  1.00 84.35  ? 421 PO4 A P   1 
HETATM 5240 O O1  . PO4 C 2 .   ? 20.939 26.503 64.776  1.00 84.35  ? 421 PO4 A O1  1 
HETATM 5241 O O2  . PO4 C 2 .   ? 20.692 24.267 64.090  1.00 84.35  ? 421 PO4 A O2  1 
HETATM 5242 O O3  . PO4 C 2 .   ? 22.103 25.807 62.865  1.00 84.35  ? 421 PO4 A O3  1 
HETATM 5243 O O4  . PO4 C 2 .   ? 19.672 26.051 62.776  1.00 84.35  ? 421 PO4 A O4  1 
HETATM 5244 P P   . PO4 D 2 .   ? 14.872 32.932 47.919  1.00 66.00  ? 422 PO4 A P   1 
HETATM 5245 O O1  . PO4 D 2 .   ? 14.128 34.220 47.710  1.00 66.00  ? 422 PO4 A O1  1 
HETATM 5246 O O2  . PO4 D 2 .   ? 14.605 32.419 49.305  1.00 66.00  ? 422 PO4 A O2  1 
HETATM 5247 O O3  . PO4 D 2 .   ? 16.325 33.159 47.739  1.00 66.00  ? 422 PO4 A O3  1 
HETATM 5248 O O4  . PO4 D 2 .   ? 14.413 31.927 46.921  1.00 66.00  ? 422 PO4 A O4  1 
HETATM 5249 P P   . PO4 E 2 .   ? 6.674  44.717 75.601  1.00 100.00 ? 421 PO4 B P   1 
HETATM 5250 O O1  . PO4 E 2 .   ? 5.864  45.844 75.197  1.00 100.00 ? 421 PO4 B O1  1 
HETATM 5251 O O2  . PO4 E 2 .   ? 6.533  44.553 77.054  1.00 100.00 ? 421 PO4 B O2  1 
HETATM 5252 O O3  . PO4 E 2 .   ? 8.069  45.007 75.230  1.00 100.00 ? 421 PO4 B O3  1 
HETATM 5253 O O4  . PO4 E 2 .   ? 6.207  43.462 74.899  1.00 100.00 ? 421 PO4 B O4  1 
HETATM 5254 P P   . PO4 F 2 .   ? 15.879 39.372 90.825  1.00 70.83  ? 422 PO4 B P   1 
HETATM 5255 O O1  . PO4 F 2 .   ? 14.867 40.478 90.860  1.00 70.83  ? 422 PO4 B O1  1 
HETATM 5256 O O2  . PO4 F 2 .   ? 16.157 38.910 92.226  1.00 70.83  ? 422 PO4 B O2  1 
HETATM 5257 O O3  . PO4 F 2 .   ? 17.150 39.862 90.202  1.00 70.83  ? 422 PO4 B O3  1 
HETATM 5258 O O4  . PO4 F 2 .   ? 15.337 38.231 90.020  1.00 70.83  ? 422 PO4 B O4  1 
HETATM 5259 O O   . HOH G 3 .   ? 9.191  37.329 44.636  1.00 49.67  ? 423 HOH A O   1 
HETATM 5260 O O   . HOH G 3 .   ? 19.402 41.863 66.281  1.00 28.26  ? 424 HOH A O   1 
HETATM 5261 O O   . HOH G 3 .   ? 12.462 34.455 55.823  1.00 27.03  ? 425 HOH A O   1 
HETATM 5262 O O   . HOH G 3 .   ? 27.998 31.207 56.576  1.00 32.82  ? 426 HOH A O   1 
HETATM 5263 O O   . HOH G 3 .   ? 22.489 36.839 55.671  1.00 18.10  ? 427 HOH A O   1 
HETATM 5264 O O   . HOH G 3 .   ? 22.210 39.688 33.394  1.00 29.50  ? 428 HOH A O   1 
HETATM 5265 O O   . HOH G 3 .   ? 14.011 28.741 52.236  1.00 20.48  ? 429 HOH A O   1 
HETATM 5266 O O   . HOH G 3 .   ? 22.113 48.057 58.719  1.00 17.07  ? 430 HOH A O   1 
HETATM 5267 O O   . HOH G 3 .   ? 12.181 36.442 48.562  1.00 33.87  ? 431 HOH A O   1 
HETATM 5268 O O   . HOH G 3 .   ? 18.905 45.022 58.992  1.00 38.17  ? 432 HOH A O   1 
HETATM 5269 O O   . HOH G 3 .   ? 29.225 36.586 38.097  1.00 30.20  ? 433 HOH A O   1 
HETATM 5270 O O   . HOH G 3 .   ? 19.258 38.337 57.570  1.00 28.48  ? 434 HOH A O   1 
HETATM 5271 O O   . HOH G 3 .   ? 15.962 30.757 67.920  1.00 41.75  ? 435 HOH A O   1 
HETATM 5272 O O   . HOH G 3 .   ? 10.967 48.375 50.863  1.00 35.33  ? 436 HOH A O   1 
HETATM 5273 O O   . HOH G 3 .   ? 6.505  43.542 52.898  1.00 41.84  ? 437 HOH A O   1 
HETATM 5274 O O   . HOH G 3 .   ? 13.752 46.755 37.095  1.00 26.83  ? 438 HOH A O   1 
HETATM 5275 O O   . HOH G 3 .   ? 16.682 33.443 42.693  1.00 38.86  ? 439 HOH A O   1 
HETATM 5276 O O   . HOH G 3 .   ? 28.049 29.694 63.259  1.00 40.22  ? 440 HOH A O   1 
HETATM 5277 O O   . HOH G 3 .   ? 7.836  46.108 53.542  1.00 29.68  ? 441 HOH A O   1 
HETATM 5278 O O   . HOH G 3 .   ? 27.869 25.677 57.946  1.00 14.67  ? 442 HOH A O   1 
HETATM 5279 O O   . HOH G 3 .   ? 29.546 33.027 59.435  1.00 24.04  ? 443 HOH A O   1 
HETATM 5280 O O   . HOH G 3 .   ? 30.800 35.677 62.119  1.00 46.57  ? 444 HOH A O   1 
HETATM 5281 O O   . HOH G 3 .   ? 18.389 30.071 43.481  1.00 31.90  ? 445 HOH A O   1 
HETATM 5282 O O   . HOH H 3 .   ? 15.038 50.827 80.223  1.00 21.84  ? 423 HOH B O   1 
HETATM 5283 O O   . HOH H 3 .   ? 20.267 40.502 79.708  1.00 24.44  ? 424 HOH B O   1 
HETATM 5284 O O   . HOH H 3 .   ? 26.076 47.256 102.637 1.00 22.06  ? 425 HOH B O   1 
HETATM 5285 O O   . HOH H 3 .   ? 19.478 44.435 81.151  1.00 26.60  ? 426 HOH B O   1 
HETATM 5286 O O   . HOH H 3 .   ? 19.068 37.507 89.791  1.00 28.09  ? 427 HOH B O   1 
HETATM 5287 O O   . HOH H 3 .   ? 23.639 53.938 97.457  1.00 23.00  ? 428 HOH B O   1 
HETATM 5288 O O   . HOH H 3 .   ? 9.251  51.644 79.293  1.00 27.54  ? 429 HOH B O   1 
HETATM 5289 O O   . HOH H 3 .   ? 17.953 60.685 92.504  1.00 29.75  ? 430 HOH B O   1 
HETATM 5290 O O   . HOH H 3 .   ? 5.362  47.793 82.405  1.00 37.81  ? 431 HOH B O   1 
HETATM 5291 O O   . HOH H 3 .   ? 31.088 43.222 79.519  1.00 29.72  ? 432 HOH B O   1 
HETATM 5292 O O   . HOH H 3 .   ? 15.632 35.357 83.246  1.00 25.61  ? 433 HOH B O   1 
HETATM 5293 O O   . HOH H 3 .   ? 24.906 60.578 98.815  1.00 29.46  ? 434 HOH B O   1 
HETATM 5294 O O   . HOH H 3 .   ? 30.348 41.575 77.756  1.00 14.18  ? 435 HOH B O   1 
HETATM 5295 O O   . HOH H 3 .   ? 2.239  50.498 79.907  1.00 28.29  ? 436 HOH B O   1 
HETATM 5296 O O   . HOH H 3 .   ? 23.104 58.041 78.414  1.00 40.94  ? 437 HOH B O   1 
HETATM 5297 O O   . HOH H 3 .   ? 15.467 33.678 87.085  1.00 32.59  ? 438 HOH B O   1 
HETATM 5298 O O   . HOH H 3 .   ? 17.338 41.559 95.186  1.00 24.45  ? 439 HOH B O   1 
HETATM 5299 O O   . HOH H 3 .   ? 26.087 39.010 77.232  1.00 27.43  ? 440 HOH B O   1 
HETATM 5300 O O   . HOH H 3 .   ? 14.262 55.977 75.096  1.00 32.77  ? 441 HOH B O   1 
HETATM 5301 O O   . HOH H 3 .   ? 16.537 51.554 77.202  1.00 26.04  ? 442 HOH B O   1 
HETATM 5302 O O   . HOH H 3 .   ? 7.552  54.446 76.907  1.00 33.82  ? 443 HOH B O   1 
HETATM 5303 O O   . HOH H 3 .   ? 11.611 50.753 74.054  1.00 44.65  ? 444 HOH B O   1 
HETATM 5304 O O   . HOH H 3 .   ? 4.009  49.944 84.253  1.00 44.06  ? 445 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   ARG 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  PHE 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  CYS 14  14  ?   ?   ?   A . n 
A 1 15  LYS 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  PRO 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  PHE 23  23  ?   ?   ?   A . n 
A 1 24  GLY 24  24  ?   ?   ?   A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 MET 101 101 101 MET MET A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 GLU 121 121 ?   ?   ?   A . n 
A 1 122 LYS 122 122 ?   ?   ?   A . n 
A 1 123 LYS 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 GLU 125 125 ?   ?   ?   A . n 
A 1 126 VAL 126 126 ?   ?   ?   A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 TYR 157 157 157 TYR TYR A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 TYR 216 216 216 TYR TYR A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 CYS 218 218 218 CYS CYS A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 TRP 241 241 241 TRP TRP A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 GLN 280 280 280 GLN GLN A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 MET 284 284 284 MET MET A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 PRO 286 286 ?   ?   ?   A . n 
A 1 287 ASN 287 287 ?   ?   ?   A . n 
A 1 288 TYR 288 288 ?   ?   ?   A . n 
A 1 289 THR 289 289 ?   ?   ?   A . n 
A 1 290 GLU 290 290 ?   ?   ?   A . n 
A 1 291 PHE 291 291 ?   ?   ?   A . n 
A 1 292 LYS 292 292 ?   ?   ?   A . n 
A 1 293 PHE 293 293 ?   ?   ?   A . n 
A 1 294 PRO 294 294 ?   ?   ?   A . n 
A 1 295 GLN 295 295 ?   ?   ?   A . n 
A 1 296 ILE 296 296 ?   ?   ?   A . n 
A 1 297 LYS 297 297 ?   ?   ?   A . n 
A 1 298 ALA 298 298 ?   ?   ?   A . n 
A 1 299 HIS 299 299 ?   ?   ?   A . n 
A 1 300 PRO 300 300 ?   ?   ?   A . n 
A 1 301 TRP 301 301 301 TRP TRP A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 LYS 303 303 303 LYS LYS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 PHE 305 305 305 PHE PHE A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 PRO 307 307 307 PRO PRO A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 CYS 317 317 317 CYS CYS A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 ARG 319 319 319 ARG ARG A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 CYS 335 335 335 CYS CYS A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 HIS 337 337 337 HIS HIS A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 ASP 345 345 345 ASP ASP A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 ASN 347 347 347 ASN ASN A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 ASN 352 352 352 ASN ASN A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 ASP 355 355 355 ASP ASP A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 PRO 357 357 357 PRO PRO A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 PHE 360 360 360 PHE PHE A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 LEU 367 367 367 LEU LEU A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 PRO 371 371 371 PRO PRO A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 THR 375 375 375 THR THR A . n 
A 1 376 ILE 376 376 376 ILE ILE A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ILE 378 378 378 ILE ILE A . n 
A 1 379 PRO 379 379 379 PRO PRO A . n 
A 1 380 PRO 380 380 380 PRO PRO A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 ALA 382 382 382 ALA ALA A . n 
A 1 383 ARG 383 383 383 ARG ARG A . n 
A 1 384 ILE 384 384 384 ILE ILE A . n 
A 1 385 GLN 385 385 ?   ?   ?   A . n 
A 1 386 ALA 386 386 ?   ?   ?   A . n 
A 1 387 ALA 387 387 ?   ?   ?   A . n 
A 1 388 ALA 388 388 ?   ?   ?   A . n 
A 1 389 SER 389 389 ?   ?   ?   A . n 
A 1 390 THR 390 390 ?   ?   ?   A . n 
A 1 391 PRO 391 391 ?   ?   ?   A . n 
A 1 392 THR 392 392 ?   ?   ?   A . n 
A 1 393 ASN 393 393 ?   ?   ?   A . n 
A 1 394 ALA 394 394 ?   ?   ?   A . n 
A 1 395 THR 395 395 ?   ?   ?   A . n 
A 1 396 ALA 396 396 ?   ?   ?   A . n 
A 1 397 ALA 397 397 ?   ?   ?   A . n 
A 1 398 SER 398 398 ?   ?   ?   A . n 
A 1 399 ASP 399 399 ?   ?   ?   A . n 
A 1 400 ALA 400 400 ?   ?   ?   A . n 
A 1 401 ASN 401 401 ?   ?   ?   A . n 
A 1 402 THR 402 402 ?   ?   ?   A . n 
A 1 403 GLY 403 403 ?   ?   ?   A . n 
A 1 404 ASP 404 404 ?   ?   ?   A . n 
A 1 405 ARG 405 405 ?   ?   ?   A . n 
A 1 406 GLY 406 406 ?   ?   ?   A . n 
A 1 407 GLN 407 407 ?   ?   ?   A . n 
A 1 408 THR 408 408 ?   ?   ?   A . n 
A 1 409 ASN 409 409 ?   ?   ?   A . n 
A 1 410 ASN 410 410 ?   ?   ?   A . n 
A 1 411 ALA 411 411 ?   ?   ?   A . n 
A 1 412 ALA 412 412 ?   ?   ?   A . n 
A 1 413 SER 413 413 ?   ?   ?   A . n 
A 1 414 ALA 414 414 ?   ?   ?   A . n 
A 1 415 SER 415 415 ?   ?   ?   A . n 
A 1 416 ALA 416 416 ?   ?   ?   A . n 
A 1 417 SER 417 417 ?   ?   ?   A . n 
A 1 418 ASN 418 418 ?   ?   ?   A . n 
A 1 419 SER 419 419 ?   ?   ?   A . n 
A 1 420 THR 420 420 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   GLY 3   3   ?   ?   ?   B . n 
B 1 4   ARG 4   4   ?   ?   ?   B . n 
B 1 5   PRO 5   5   ?   ?   ?   B . n 
B 1 6   ARG 6   6   ?   ?   ?   B . n 
B 1 7   THR 7   7   ?   ?   ?   B . n 
B 1 8   THR 8   8   ?   ?   ?   B . n 
B 1 9   SER 9   9   ?   ?   ?   B . n 
B 1 10  PHE 10  10  ?   ?   ?   B . n 
B 1 11  ALA 11  11  ?   ?   ?   B . n 
B 1 12  GLU 12  12  ?   ?   ?   B . n 
B 1 13  SER 13  13  ?   ?   ?   B . n 
B 1 14  CYS 14  14  ?   ?   ?   B . n 
B 1 15  LYS 15  15  ?   ?   ?   B . n 
B 1 16  PRO 16  16  ?   ?   ?   B . n 
B 1 17  VAL 17  17  ?   ?   ?   B . n 
B 1 18  GLN 18  18  ?   ?   ?   B . n 
B 1 19  GLN 19  19  ?   ?   ?   B . n 
B 1 20  PRO 20  20  ?   ?   ?   B . n 
B 1 21  SER 21  21  ?   ?   ?   B . n 
B 1 22  ALA 22  22  ?   ?   ?   B . n 
B 1 23  PHE 23  23  ?   ?   ?   B . n 
B 1 24  GLY 24  24  ?   ?   ?   B . n 
B 1 25  SER 25  25  ?   ?   ?   B . n 
B 1 26  MET 26  26  ?   ?   ?   B . n 
B 1 27  LYS 27  27  ?   ?   ?   B . n 
B 1 28  VAL 28  28  ?   ?   ?   B . n 
B 1 29  SER 29  29  ?   ?   ?   B . n 
B 1 30  ARG 30  30  ?   ?   ?   B . n 
B 1 31  ASP 31  31  ?   ?   ?   B . n 
B 1 32  LYS 32  32  ?   ?   ?   B . n 
B 1 33  ASP 33  33  ?   ?   ?   B . n 
B 1 34  GLY 34  34  ?   ?   ?   B . n 
B 1 35  SER 35  35  ?   ?   ?   B . n 
B 1 36  LYS 36  36  ?   ?   ?   B . n 
B 1 37  VAL 37  37  37  VAL VAL B . n 
B 1 38  THR 38  38  38  THR THR B . n 
B 1 39  THR 39  39  39  THR THR B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  THR 43  43  43  THR THR B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  GLN 46  46  46  GLN GLN B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  PRO 48  48  48  PRO PRO B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  ARG 50  50  50  ARG ARG B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  GLN 52  52  52  GLN GLN B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  TYR 56  56  56  TYR TYR B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  ASP 58  58  58  ASP ASP B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  GLY 65  65  65  GLY GLY B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  PHE 67  67  67  PHE PHE B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  TYR 71  71  71  TYR TYR B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  LYS 74  74  74  LYS LYS B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  CYS 76  76  76  CYS CYS B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  VAL 82  82  82  VAL VAL B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  LYS 85  85  85  LYS LYS B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  ASP 90  90  90  ASP ASP B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  ASN 95  95  95  ASN ASN B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 MET 101 101 101 MET MET B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 HIS 106 106 106 HIS HIS B . n 
B 1 107 CYS 107 107 107 CYS CYS B . n 
B 1 108 ASN 108 108 108 ASN ASN B . n 
B 1 109 ILE 109 109 109 ILE ILE B . n 
B 1 110 VAL 110 110 110 VAL VAL B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 PHE 115 115 115 PHE PHE B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 TYR 117 117 117 TYR TYR B . n 
B 1 118 SER 118 118 118 SER SER B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 LYS 122 122 122 LYS LYS B . n 
B 1 123 LYS 123 123 123 LYS LYS B . n 
B 1 124 ASP 124 124 124 ASP ASP B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 TYR 127 127 127 TYR TYR B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ASN 129 129 129 ASN ASN B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 PRO 136 136 136 PRO PRO B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 TYR 140 140 140 TYR TYR B . n 
B 1 141 ARG 141 141 141 ARG ARG B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 ARG 144 144 144 ARG ARG B . n 
B 1 145 HIS 145 145 145 HIS HIS B . n 
B 1 146 TYR 146 146 146 TYR TYR B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 ARG 148 148 148 ARG ARG B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 THR 152 152 152 THR THR B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 TYR 157 157 157 TYR TYR B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 TYR 161 161 161 TYR TYR B . n 
B 1 162 MET 162 162 162 MET MET B . n 
B 1 163 TYR 163 163 163 TYR TYR B . n 
B 1 164 GLN 164 164 164 GLN GLN B . n 
B 1 165 LEU 165 165 165 LEU LEU B . n 
B 1 166 PHE 166 166 166 PHE PHE B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 SER 168 168 168 SER SER B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 ALA 170 170 170 ALA ALA B . n 
B 1 171 TYR 171 171 171 TYR TYR B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 HIS 173 173 173 HIS HIS B . n 
B 1 174 SER 174 174 174 SER SER B . n 
B 1 175 PHE 175 175 175 PHE PHE B . n 
B 1 176 GLY 176 176 176 GLY GLY B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 CYS 178 178 178 CYS CYS B . n 
B 1 179 HIS 179 179 179 HIS HIS B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 ILE 182 182 182 ILE ILE B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 LEU 188 188 188 LEU LEU B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ALA 194 194 194 ALA ALA B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 LYS 197 197 197 LYS LYS B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 CYS 199 199 199 CYS CYS B . n 
B 1 200 ASP 200 200 200 ASP ASP B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 LYS 205 205 205 LYS LYS B . n 
B 1 206 GLN 206 206 206 GLN GLN B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 ARG 209 209 209 ARG ARG B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 GLU 211 211 211 GLU GLU B . n 
B 1 212 PRO 212 212 212 PRO PRO B . n 
B 1 213 ASN 213 213 213 ASN ASN B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 TYR 216 216 216 TYR TYR B . n 
B 1 217 ILE 217 217 217 ILE ILE B . n 
B 1 218 CYS 218 218 218 CYS CYS B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 TYR 222 222 222 TYR TYR B . n 
B 1 223 ARG 223 223 223 ARG ARG B . n 
B 1 224 ALA 224 224 224 ALA ALA B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 GLU 226 226 226 GLU GLU B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 ILE 228 228 228 ILE ILE B . n 
B 1 229 PHE 229 229 229 PHE PHE B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 ALA 231 231 231 ALA ALA B . n 
B 1 232 THR 232 232 232 THR THR B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 TYR 234 234 234 TYR TYR B . n 
B 1 235 THR 235 235 235 THR THR B . n 
B 1 236 SER 236 236 236 SER SER B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 ILE 238 238 238 ILE ILE B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 VAL 240 240 240 VAL VAL B . n 
B 1 241 TRP 241 241 241 TRP TRP B . n 
B 1 242 SER 242 242 242 SER SER B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 GLY 244 244 244 GLY GLY B . n 
B 1 245 CYS 245 245 245 CYS CYS B . n 
B 1 246 VAL 246 246 246 VAL VAL B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 GLU 249 249 249 GLU GLU B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 GLN 254 254 254 GLN GLN B . n 
B 1 255 PRO 255 255 255 PRO PRO B . n 
B 1 256 ILE 256 256 256 ILE ILE B . n 
B 1 257 PHE 257 257 257 PHE PHE B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 GLY 259 259 259 GLY GLY B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 GLY 262 262 262 GLY GLY B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 ASP 264 264 264 ASP ASP B . n 
B 1 265 GLN 265 265 265 GLN GLN B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 VAL 267 267 267 VAL VAL B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 ILE 269 269 269 ILE ILE B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 LYS 271 271 271 LYS LYS B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 PRO 276 276 276 PRO PRO B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 ARG 278 278 278 ARG ARG B . n 
B 1 279 GLU 279 279 279 GLU GLU B . n 
B 1 280 GLN 280 280 280 GLN GLN B . n 
B 1 281 ILE 281 281 281 ILE ILE B . n 
B 1 282 ARG 282 282 282 ARG ARG B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 MET 284 284 284 MET MET B . n 
B 1 285 ASN 285 285 285 ASN ASN B . n 
B 1 286 PRO 286 286 ?   ?   ?   B . n 
B 1 287 ASN 287 287 ?   ?   ?   B . n 
B 1 288 TYR 288 288 ?   ?   ?   B . n 
B 1 289 THR 289 289 ?   ?   ?   B . n 
B 1 290 GLU 290 290 ?   ?   ?   B . n 
B 1 291 PHE 291 291 291 PHE PHE B . n 
B 1 292 LYS 292 292 292 LYS LYS B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 ILE 296 296 296 ILE ILE B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 HIS 299 299 299 HIS HIS B . n 
B 1 300 PRO 300 300 300 PRO PRO B . n 
B 1 301 TRP 301 301 301 TRP TRP B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 LYS 303 303 303 LYS LYS B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 PHE 305 305 305 PHE PHE B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 PRO 307 307 307 PRO PRO B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 THR 309 309 309 THR THR B . n 
B 1 310 PRO 310 310 310 PRO PRO B . n 
B 1 311 PRO 311 311 311 PRO PRO B . n 
B 1 312 GLU 312 312 312 GLU GLU B . n 
B 1 313 ALA 313 313 313 ALA ALA B . n 
B 1 314 ILE 314 314 314 ILE ILE B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 CYS 317 317 317 CYS CYS B . n 
B 1 318 SER 318 318 318 SER SER B . n 
B 1 319 ARG 319 319 319 ARG ARG B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 GLU 322 322 322 GLU GLU B . n 
B 1 323 TYR 323 323 323 TYR TYR B . n 
B 1 324 THR 324 324 324 THR THR B . n 
B 1 325 PRO 325 325 325 PRO PRO B . n 
B 1 326 THR 326 326 326 THR THR B . n 
B 1 327 ALA 327 327 327 ALA ALA B . n 
B 1 328 ARG 328 328 328 ARG ARG B . n 
B 1 329 LEU 329 329 329 LEU LEU B . n 
B 1 330 THR 330 330 330 THR THR B . n 
B 1 331 PRO 331 331 331 PRO PRO B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 GLU 333 333 333 GLU GLU B . n 
B 1 334 ALA 334 334 334 ALA ALA B . n 
B 1 335 CYS 335 335 335 CYS CYS B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 HIS 337 337 337 HIS HIS B . n 
B 1 338 SER 338 338 338 SER SER B . n 
B 1 339 PHE 339 339 339 PHE PHE B . n 
B 1 340 PHE 340 340 340 PHE PHE B . n 
B 1 341 ASP 341 341 341 ASP ASP B . n 
B 1 342 GLU 342 342 342 GLU GLU B . n 
B 1 343 LEU 343 343 343 LEU LEU B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 ASP 345 345 345 ASP ASP B . n 
B 1 346 PRO 346 346 346 PRO PRO B . n 
B 1 347 ASN 347 347 347 ASN ASN B . n 
B 1 348 VAL 348 348 348 VAL VAL B . n 
B 1 349 LYS 349 349 349 LYS LYS B . n 
B 1 350 LEU 350 350 350 LEU LEU B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 ASN 352 352 352 ASN ASN B . n 
B 1 353 GLY 353 353 353 GLY GLY B . n 
B 1 354 ARG 354 354 354 ARG ARG B . n 
B 1 355 ASP 355 355 355 ASP ASP B . n 
B 1 356 THR 356 356 356 THR THR B . n 
B 1 357 PRO 357 357 357 PRO PRO B . n 
B 1 358 ALA 358 358 358 ALA ALA B . n 
B 1 359 LEU 359 359 359 LEU LEU B . n 
B 1 360 PHE 360 360 360 PHE PHE B . n 
B 1 361 ASN 361 361 361 ASN ASN B . n 
B 1 362 PHE 362 362 362 PHE PHE B . n 
B 1 363 THR 363 363 363 THR THR B . n 
B 1 364 THR 364 364 364 THR THR B . n 
B 1 365 GLN 365 365 365 GLN GLN B . n 
B 1 366 GLU 366 366 366 GLU GLU B . n 
B 1 367 LEU 367 367 367 LEU LEU B . n 
B 1 368 SER 368 368 368 SER SER B . n 
B 1 369 SER 369 369 369 SER SER B . n 
B 1 370 ASN 370 370 370 ASN ASN B . n 
B 1 371 PRO 371 371 371 PRO PRO B . n 
B 1 372 PRO 372 372 372 PRO PRO B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 THR 375 375 375 THR THR B . n 
B 1 376 ILE 376 376 376 ILE ILE B . n 
B 1 377 LEU 377 377 377 LEU LEU B . n 
B 1 378 ILE 378 378 378 ILE ILE B . n 
B 1 379 PRO 379 379 379 PRO PRO B . n 
B 1 380 PRO 380 380 380 PRO PRO B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 ALA 382 382 382 ALA ALA B . n 
B 1 383 ARG 383 383 ?   ?   ?   B . n 
B 1 384 ILE 384 384 ?   ?   ?   B . n 
B 1 385 GLN 385 385 ?   ?   ?   B . n 
B 1 386 ALA 386 386 ?   ?   ?   B . n 
B 1 387 ALA 387 387 ?   ?   ?   B . n 
B 1 388 ALA 388 388 ?   ?   ?   B . n 
B 1 389 SER 389 389 ?   ?   ?   B . n 
B 1 390 THR 390 390 ?   ?   ?   B . n 
B 1 391 PRO 391 391 ?   ?   ?   B . n 
B 1 392 THR 392 392 ?   ?   ?   B . n 
B 1 393 ASN 393 393 ?   ?   ?   B . n 
B 1 394 ALA 394 394 ?   ?   ?   B . n 
B 1 395 THR 395 395 ?   ?   ?   B . n 
B 1 396 ALA 396 396 ?   ?   ?   B . n 
B 1 397 ALA 397 397 ?   ?   ?   B . n 
B 1 398 SER 398 398 ?   ?   ?   B . n 
B 1 399 ASP 399 399 ?   ?   ?   B . n 
B 1 400 ALA 400 400 ?   ?   ?   B . n 
B 1 401 ASN 401 401 ?   ?   ?   B . n 
B 1 402 THR 402 402 ?   ?   ?   B . n 
B 1 403 GLY 403 403 ?   ?   ?   B . n 
B 1 404 ASP 404 404 ?   ?   ?   B . n 
B 1 405 ARG 405 405 ?   ?   ?   B . n 
B 1 406 GLY 406 406 ?   ?   ?   B . n 
B 1 407 GLN 407 407 ?   ?   ?   B . n 
B 1 408 THR 408 408 ?   ?   ?   B . n 
B 1 409 ASN 409 409 ?   ?   ?   B . n 
B 1 410 ASN 410 410 ?   ?   ?   B . n 
B 1 411 ALA 411 411 ?   ?   ?   B . n 
B 1 412 ALA 412 412 ?   ?   ?   B . n 
B 1 413 SER 413 413 ?   ?   ?   B . n 
B 1 414 ALA 414 414 ?   ?   ?   B . n 
B 1 415 SER 415 415 ?   ?   ?   B . n 
B 1 416 ALA 416 416 ?   ?   ?   B . n 
B 1 417 SER 417 417 ?   ?   ?   B . n 
B 1 418 ASN 418 418 ?   ?   ?   B . n 
B 1 419 SER 419 419 ?   ?   ?   B . n 
B 1 420 THR 420 420 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-01-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE  phasing          .         ? 1 
CNX    refinement       .         ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The authors have analyzed the GSK3b sequences 
(expressed sequence tags databases) carefully 
and came to the conclusion that there is an 
error in P49841 sequence.  HIS 350 should be 
a LEU.  It is definitely a LEU in crystal
structure sequence.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ASN 64  ? ? O   A GLY 65  ? ? 1.79 
2 1 O A SER 215 ? ? NH2 A ARG 223 ? ? 1.89 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE1 A TRP 301 ? ? CE2 A TRP 301 ? ? 1.485 1.371 0.114 0.013 N 
2 1 NE1 B TRP 241 ? ? CE2 B TRP 241 ? ? 1.484 1.371 0.113 0.013 N 
3 1 NE1 B TRP 301 ? ? CE2 B TRP 301 ? ? 1.483 1.371 0.112 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A GLN 72  ? ? C  A GLN 72  ? ? N   A ALA 73  ? ? 112.84 122.70 -9.86  1.60 Y 
2 1 O  A TYR 221 ? ? C  A TYR 221 ? ? N   A TYR 222 ? ? 111.75 122.70 -10.95 1.60 Y 
3 1 CG A ARG 223 ? ? CD A ARG 223 ? ? NE  A ARG 223 ? ? 127.89 111.80 16.09  2.10 N 
4 1 NE A ARG 223 ? ? CZ A ARG 223 ? ? NH1 A ARG 223 ? ? 128.81 120.30 8.51   0.50 N 
5 1 NE A ARG 223 ? ? CZ A ARG 223 ? ? NH2 A ARG 223 ? ? 109.96 120.30 -10.34 0.50 N 
6 1 CA B ILE 100 ? ? CB B ILE 100 ? ? CG1 B ILE 100 ? ? 126.30 111.00 15.30  1.90 N 
7 1 O  B LYS 123 ? ? C  B LYS 123 ? ? N   B ASP 124 ? ? 111.51 122.70 -11.19 1.60 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 32  ? ? 69.42   66.32   
2  1 ASP A 33  ? ? 57.22   88.76   
3  1 ASP A 49  ? ? -59.36  102.10  
4  1 PRO A 51  ? ? -34.51  156.60  
5  1 VAL A 61  ? ? -63.04  59.40   
6  1 ASP A 77  ? ? -82.61  -73.40  
7  1 LEU A 88  ? ? -69.78  79.32   
8  1 PHE A 93  ? ? 177.80  -179.62 
9  1 CYS A 107 ? ? -66.62  0.05    
10 1 LYS A 150 ? ? 44.05   29.76   
11 1 ARG A 180 ? ? 76.06   -6.11   
12 1 ASP A 181 ? ? -141.98 48.89   
13 1 PRO A 184 ? ? -39.85  -38.42  
14 1 ASP A 200 ? ? 55.31   78.24   
15 1 ARG A 220 ? ? -43.43  -74.88  
16 1 TYR A 221 ? ? -57.92  -5.44   
17 1 SER A 236 ? ? -58.52  -1.87   
18 1 MET A 284 ? ? -76.09  -77.29  
19 1 ASN A 370 ? ? -167.02 72.70   
20 1 ASP B 49  ? ? -47.60  89.17   
21 1 ASP B 77  ? ? -67.57  -80.02  
22 1 LYS B 91  ? ? -39.93  -37.15  
23 1 PRO B 136 ? ? -50.15  -72.84  
24 1 TYR B 171 ? ? -59.55  -74.51  
25 1 ASP B 181 ? ? -157.23 64.46   
26 1 ASP B 200 ? ? 61.75   84.00   
27 1 ARG B 220 ? ? -44.16  -80.97  
28 1 THR B 235 ? ? -107.37 -168.38 
29 1 LYS B 292 ? ? -157.09 74.74   
30 1 PHE B 293 ? ? -91.23  -72.11  
31 1 GLN B 295 ? ? -46.62  -4.65   
32 1 ILE B 296 ? ? -127.09 -137.67 
33 1 LYS B 297 ? ? 66.75   72.93   
34 1 PRO B 346 ? ? -49.59  -19.32  
35 1 ASN B 370 ? ? -164.71 80.94   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     223 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.157 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 0 A SER 25  ? O   ? A SER 25  O   
2   1 Y 0 A LYS 27  ? CD  ? A LYS 27  CD  
3   1 Y 0 A LYS 27  ? CE  ? A LYS 27  CE  
4   1 Y 0 A VAL 28  ? CG1 ? A VAL 28  CG1 
5   1 Y 1 A SER 29  ? CB  ? A SER 29  CB  
6   1 Y 1 A SER 29  ? OG  ? A SER 29  OG  
7   1 Y 0 A ARG 30  ? NH1 ? A ARG 30  NH1 
8   1 Y 1 A ASP 31  ? CB  ? A ASP 31  CB  
9   1 Y 1 A ASP 31  ? CG  ? A ASP 31  CG  
10  1 Y 1 A ASP 31  ? OD1 ? A ASP 31  OD1 
11  1 Y 1 A ASP 31  ? OD2 ? A ASP 31  OD2 
12  1 Y 0 A ASP 31  ? CA  ? A ASP 31  CA  
13  1 Y 1 A LYS 32  ? CB  ? A LYS 32  CB  
14  1 Y 1 A LYS 32  ? CG  ? A LYS 32  CG  
15  1 Y 1 A LYS 32  ? CD  ? A LYS 32  CD  
16  1 Y 1 A LYS 32  ? CE  ? A LYS 32  CE  
17  1 Y 1 A LYS 32  ? NZ  ? A LYS 32  NZ  
18  1 Y 1 A ASP 33  ? CB  ? A ASP 33  CB  
19  1 Y 1 A ASP 33  ? CG  ? A ASP 33  CG  
20  1 Y 1 A ASP 33  ? OD1 ? A ASP 33  OD1 
21  1 Y 1 A ASP 33  ? OD2 ? A ASP 33  OD2 
22  1 Y 0 A GLY 34  ? CA  ? A GLY 34  CA  
23  1 Y 0 A GLY 34  ? C   ? A GLY 34  C   
24  1 Y 0 A GLY 34  ? O   ? A GLY 34  O   
25  1 Y 1 A SER 35  ? CB  ? A SER 35  CB  
26  1 Y 1 A SER 35  ? OG  ? A SER 35  OG  
27  1 Y 0 A LYS 36  ? NZ  ? A LYS 36  NZ  
28  1 Y 0 A VAL 37  ? O   ? A VAL 37  O   
29  1 Y 0 A VAL 40  ? CG2 ? A VAL 40  CG2 
30  1 Y 1 A GLN 46  ? CG  ? A GLN 46  CG  
31  1 Y 1 A GLN 46  ? CD  ? A GLN 46  CD  
32  1 Y 1 A GLN 46  ? OE1 ? A GLN 46  OE1 
33  1 Y 1 A GLN 46  ? NE2 ? A GLN 46  NE2 
34  1 Y 0 A ARG 50  ? NH1 ? A ARG 50  NH1 
35  1 Y 0 A GLN 52  ? CB  ? A GLN 52  CB  
36  1 Y 0 A GLN 52  ? CG  ? A GLN 52  CG  
37  1 Y 0 A THR 57  ? CG2 ? A THR 57  CG2 
38  1 Y 0 A VAL 61  ? CG1 ? A VAL 61  CG1 
39  1 Y 0 A VAL 61  ? CG2 ? A VAL 61  CG2 
40  1 Y 0 A ASN 64  ? ND2 ? A ASN 64  ND2 
41  1 Y 0 A PHE 67  ? CE1 ? A PHE 67  CE1 
42  1 Y 0 A VAL 69  ? CG1 ? A VAL 69  CG1 
43  1 Y 0 A VAL 70  ? CG2 ? A VAL 70  CG2 
44  1 Y 0 A GLN 72  ? CG  ? A GLN 72  CG  
45  1 Y 0 A LYS 74  ? CE  ? A LYS 74  CE  
46  1 Y 0 A LYS 74  ? NZ  ? A LYS 74  NZ  
47  1 Y 0 A LYS 86  ? CG  ? A LYS 86  CG  
48  1 Y 0 A LYS 86  ? CD  ? A LYS 86  CD  
49  1 Y 0 A LYS 86  ? CE  ? A LYS 86  CE  
50  1 Y 0 A VAL 87  ? CG2 ? A VAL 87  CG2 
51  1 Y 0 A LEU 88  ? CD1 ? A LEU 88  CD1 
52  1 Y 1 A GLN 89  ? CG  ? A GLN 89  CG  
53  1 Y 1 A GLN 89  ? CD  ? A GLN 89  CD  
54  1 Y 1 A GLN 89  ? OE1 ? A GLN 89  OE1 
55  1 Y 1 A GLN 89  ? NE2 ? A GLN 89  NE2 
56  1 Y 0 A GLN 89  ? CB  ? A GLN 89  CB  
57  1 Y 1 A ASP 90  ? CG  ? A ASP 90  CG  
58  1 Y 1 A ASP 90  ? OD1 ? A ASP 90  OD1 
59  1 Y 1 A ASP 90  ? OD2 ? A ASP 90  OD2 
60  1 Y 0 A ASP 90  ? O   ? A ASP 90  O   
61  1 Y 1 A LYS 91  ? CG  ? A LYS 91  CG  
62  1 Y 1 A LYS 91  ? CD  ? A LYS 91  CD  
63  1 Y 1 A LYS 91  ? CE  ? A LYS 91  CE  
64  1 Y 1 A LYS 91  ? NZ  ? A LYS 91  NZ  
65  1 Y 1 A ARG 92  ? CG  ? A ARG 92  CG  
66  1 Y 1 A ARG 92  ? CD  ? A ARG 92  CD  
67  1 Y 1 A ARG 92  ? NE  ? A ARG 92  NE  
68  1 Y 1 A ARG 92  ? CZ  ? A ARG 92  CZ  
69  1 Y 1 A ARG 92  ? NH1 ? A ARG 92  NH1 
70  1 Y 1 A ARG 92  ? NH2 ? A ARG 92  NH2 
71  1 Y 1 A PHE 93  ? CG  ? A PHE 93  CG  
72  1 Y 1 A PHE 93  ? CD1 ? A PHE 93  CD1 
73  1 Y 1 A PHE 93  ? CD2 ? A PHE 93  CD2 
74  1 Y 1 A PHE 93  ? CE1 ? A PHE 93  CE1 
75  1 Y 1 A PHE 93  ? CE2 ? A PHE 93  CE2 
76  1 Y 1 A PHE 93  ? CZ  ? A PHE 93  CZ  
77  1 Y 0 A PHE 93  ? CB  ? A PHE 93  CB  
78  1 Y 1 A LYS 94  ? CG  ? A LYS 94  CG  
79  1 Y 1 A LYS 94  ? CD  ? A LYS 94  CD  
80  1 Y 1 A LYS 94  ? CE  ? A LYS 94  CE  
81  1 Y 1 A LYS 94  ? NZ  ? A LYS 94  NZ  
82  1 Y 0 A LYS 94  ? CB  ? A LYS 94  CB  
83  1 Y 0 A GLN 99  ? CG  ? A GLN 99  CG  
84  1 Y 0 A ARG 102 ? NH2 ? A ARG 102 NH2 
85  1 Y 0 A ASP 105 ? CB  ? A ASP 105 CB  
86  1 Y 0 A ILE 109 ? CD1 ? A ILE 109 CD1 
87  1 Y 1 A TYR 127 ? CG  ? A TYR 127 CG  
88  1 Y 1 A TYR 127 ? CD1 ? A TYR 127 CD1 
89  1 Y 1 A TYR 127 ? CD2 ? A TYR 127 CD2 
90  1 Y 1 A TYR 127 ? CE1 ? A TYR 127 CE1 
91  1 Y 1 A TYR 127 ? CE2 ? A TYR 127 CE2 
92  1 Y 1 A TYR 127 ? CZ  ? A TYR 127 CZ  
93  1 Y 1 A TYR 127 ? OH  ? A TYR 127 OH  
94  1 Y 0 A ARG 144 ? NE  ? A ARG 144 NE  
95  1 Y 0 A ARG 144 ? CZ  ? A ARG 144 CZ  
96  1 Y 0 A ARG 144 ? NH1 ? A ARG 144 NH1 
97  1 Y 0 A ARG 144 ? NH2 ? A ARG 144 NH2 
98  1 Y 0 A ARG 148 ? NE  ? A ARG 148 NE  
99  1 Y 0 A ARG 148 ? CZ  ? A ARG 148 CZ  
100 1 Y 0 A ARG 148 ? NH1 ? A ARG 148 NH1 
101 1 Y 0 A ARG 148 ? NH2 ? A ARG 148 NH2 
102 1 Y 0 A LYS 150 ? CD  ? A LYS 150 CD  
103 1 Y 0 A THR 152 ? CG2 ? A THR 152 CG2 
104 1 Y 0 A VAL 155 ? CG1 ? A VAL 155 CG1 
105 1 Y 0 A VAL 155 ? CG2 ? A VAL 155 CG2 
106 1 Y 0 A LYS 183 ? NZ  ? A LYS 183 NZ  
107 1 Y 0 A LEU 189 ? CD2 ? A LEU 189 CD2 
108 1 Y 0 A LEU 198 ? CD2 ? A LEU 198 CD2 
109 1 Y 0 A ARG 209 ? CG  ? A ARG 209 CG  
110 1 Y 0 A ARG 209 ? CD  ? A ARG 209 CD  
111 1 Y 0 A SER 219 ? OG  ? A SER 219 OG  
112 1 Y 0 A ARG 220 ? CB  ? A ARG 220 CB  
113 1 Y 0 A ARG 220 ? CG  ? A ARG 220 CG  
114 1 Y 0 A ARG 220 ? CD  ? A ARG 220 CD  
115 1 Y 0 A ARG 220 ? NH1 ? A ARG 220 NH1 
116 1 Y 0 A LEU 252 ? CD1 ? A LEU 252 CD1 
117 1 Y 0 A LEU 252 ? CD2 ? A LEU 252 CD2 
118 1 Y 0 A LYS 271 ? CE  ? A LYS 271 CE  
119 1 Y 0 A LYS 271 ? NZ  ? A LYS 271 NZ  
120 1 Y 0 A LEU 273 ? CD2 ? A LEU 273 CD2 
121 1 Y 1 A ARG 278 ? CG  ? A ARG 278 CG  
122 1 Y 1 A ARG 278 ? CD  ? A ARG 278 CD  
123 1 Y 1 A ARG 278 ? NE  ? A ARG 278 NE  
124 1 Y 1 A ARG 278 ? CZ  ? A ARG 278 CZ  
125 1 Y 1 A ARG 278 ? NH1 ? A ARG 278 NH1 
126 1 Y 1 A ARG 278 ? NH2 ? A ARG 278 NH2 
127 1 Y 0 A ARG 278 ? CB  ? A ARG 278 CB  
128 1 Y 1 A ARG 282 ? CG  ? A ARG 282 CG  
129 1 Y 1 A ARG 282 ? CD  ? A ARG 282 CD  
130 1 Y 1 A ARG 282 ? NE  ? A ARG 282 NE  
131 1 Y 1 A ARG 282 ? CZ  ? A ARG 282 CZ  
132 1 Y 1 A ARG 282 ? NH1 ? A ARG 282 NH1 
133 1 Y 1 A ARG 282 ? NH2 ? A ARG 282 NH2 
134 1 Y 0 A GLU 283 ? CB  ? A GLU 283 CB  
135 1 Y 0 A GLU 283 ? CG  ? A GLU 283 CG  
136 1 Y 1 A ASN 285 ? CB  ? A ASN 285 CB  
137 1 Y 1 A ASN 285 ? CG  ? A ASN 285 CG  
138 1 Y 1 A ASN 285 ? OD1 ? A ASN 285 OD1 
139 1 Y 1 A ASN 285 ? ND2 ? A ASN 285 ND2 
140 1 Y 0 A THR 302 ? CG2 ? A THR 302 CG2 
141 1 Y 1 A LYS 303 ? CG  ? A LYS 303 CG  
142 1 Y 1 A LYS 303 ? CD  ? A LYS 303 CD  
143 1 Y 1 A LYS 303 ? CE  ? A LYS 303 CE  
144 1 Y 1 A LYS 303 ? NZ  ? A LYS 303 NZ  
145 1 Y 1 A ARG 308 ? CG  ? A ARG 308 CG  
146 1 Y 1 A ARG 308 ? CD  ? A ARG 308 CD  
147 1 Y 1 A ARG 308 ? NE  ? A ARG 308 NE  
148 1 Y 1 A ARG 308 ? CZ  ? A ARG 308 CZ  
149 1 Y 1 A ARG 308 ? NH1 ? A ARG 308 NH1 
150 1 Y 1 A ARG 308 ? NH2 ? A ARG 308 NH2 
151 1 Y 0 A ARG 308 ? CB  ? A ARG 308 CB  
152 1 Y 0 A ILE 314 ? CG1 ? A ILE 314 CG1 
153 1 Y 0 A ILE 314 ? CD1 ? A ILE 314 CD1 
154 1 Y 0 A ASN 347 ? CB  ? A ASN 347 CB  
155 1 Y 0 A ALA 358 ? CB  ? A ALA 358 CB  
156 1 Y 0 A THR 364 ? OG1 ? A THR 364 OG1 
157 1 Y 0 A LEU 373 ? CD1 ? A LEU 373 CD1 
158 1 Y 0 A ILE 376 ? CD1 ? A ILE 376 CD1 
159 1 Y 0 B VAL 37  ? CG2 ? B VAL 37  CG2 
160 1 Y 0 B VAL 40  ? CG2 ? B VAL 40  CG2 
161 1 Y 0 B VAL 41  ? CG1 ? B VAL 41  CG1 
162 1 Y 1 B GLN 46  ? CG  ? B GLN 46  CG  
163 1 Y 1 B GLN 46  ? CD  ? B GLN 46  CD  
164 1 Y 1 B GLN 46  ? OE1 ? B GLN 46  OE1 
165 1 Y 1 B GLN 46  ? NE2 ? B GLN 46  NE2 
166 1 Y 0 B GLN 46  ? CB  ? B GLN 46  CB  
167 1 Y 0 B GLY 47  ? CA  ? B GLY 47  CA  
168 1 Y 0 B PRO 48  ? CG  ? B PRO 48  CG  
169 1 Y 0 B PRO 48  ? CD  ? B PRO 48  CD  
170 1 Y 0 B ARG 50  ? NH1 ? B ARG 50  NH1 
171 1 Y 0 B GLN 52  ? NE2 ? B GLN 52  NE2 
172 1 Y 0 B LYS 60  ? CD  ? B LYS 60  CD  
173 1 Y 0 B LYS 60  ? CE  ? B LYS 60  CE  
174 1 Y 0 B LYS 60  ? NZ  ? B LYS 60  NZ  
175 1 Y 0 B GLY 65  ? O   ? B GLY 65  O   
176 1 Y 0 B VAL 69  ? CG2 ? B VAL 69  CG2 
177 1 Y 0 B LEU 75  ? CD1 ? B LEU 75  CD1 
178 1 Y 0 B LYS 86  ? NZ  ? B LYS 86  NZ  
179 1 Y 0 B LEU 88  ? CD2 ? B LEU 88  CD2 
180 1 Y 0 B GLN 89  ? CB  ? B GLN 89  CB  
181 1 Y 1 B LYS 91  ? CG  ? B LYS 91  CG  
182 1 Y 1 B LYS 91  ? CD  ? B LYS 91  CD  
183 1 Y 1 B LYS 91  ? CE  ? B LYS 91  CE  
184 1 Y 1 B LYS 91  ? NZ  ? B LYS 91  NZ  
185 1 Y 0 B LYS 91  ? CB  ? B LYS 91  CB  
186 1 Y 1 B ARG 92  ? CG  ? B ARG 92  CG  
187 1 Y 1 B ARG 92  ? CD  ? B ARG 92  CD  
188 1 Y 1 B ARG 92  ? NE  ? B ARG 92  NE  
189 1 Y 1 B ARG 92  ? CZ  ? B ARG 92  CZ  
190 1 Y 1 B ARG 92  ? NH1 ? B ARG 92  NH1 
191 1 Y 1 B ARG 92  ? NH2 ? B ARG 92  NH2 
192 1 Y 0 B ARG 92  ? CB  ? B ARG 92  CB  
193 1 Y 1 B PHE 93  ? CG  ? B PHE 93  CG  
194 1 Y 1 B PHE 93  ? CD1 ? B PHE 93  CD1 
195 1 Y 1 B PHE 93  ? CD2 ? B PHE 93  CD2 
196 1 Y 1 B PHE 93  ? CE1 ? B PHE 93  CE1 
197 1 Y 1 B PHE 93  ? CE2 ? B PHE 93  CE2 
198 1 Y 1 B PHE 93  ? CZ  ? B PHE 93  CZ  
199 1 Y 0 B PHE 93  ? CB  ? B PHE 93  CB  
200 1 Y 0 B LYS 94  ? CD  ? B LYS 94  CD  
201 1 Y 0 B LYS 94  ? CE  ? B LYS 94  CE  
202 1 Y 0 B LYS 94  ? NZ  ? B LYS 94  NZ  
203 1 Y 0 B ARG 111 ? NH1 ? B ARG 111 NH1 
204 1 Y 1 B GLU 121 ? CG  ? B GLU 121 CG  
205 1 Y 1 B GLU 121 ? CD  ? B GLU 121 CD  
206 1 Y 1 B GLU 121 ? OE1 ? B GLU 121 OE1 
207 1 Y 1 B GLU 121 ? OE2 ? B GLU 121 OE2 
208 1 Y 1 B LYS 122 ? CG  ? B LYS 122 CG  
209 1 Y 1 B LYS 122 ? CD  ? B LYS 122 CD  
210 1 Y 1 B LYS 122 ? CE  ? B LYS 122 CE  
211 1 Y 1 B LYS 122 ? NZ  ? B LYS 122 NZ  
212 1 Y 0 B LYS 122 ? CB  ? B LYS 122 CB  
213 1 Y 1 B LYS 123 ? CG  ? B LYS 123 CG  
214 1 Y 1 B LYS 123 ? CD  ? B LYS 123 CD  
215 1 Y 1 B LYS 123 ? CE  ? B LYS 123 CE  
216 1 Y 1 B LYS 123 ? NZ  ? B LYS 123 NZ  
217 1 Y 1 B ASP 124 ? CG  ? B ASP 124 CG  
218 1 Y 1 B ASP 124 ? OD1 ? B ASP 124 OD1 
219 1 Y 1 B ASP 124 ? OD2 ? B ASP 124 OD2 
220 1 Y 0 B ASP 124 ? O   ? B ASP 124 O   
221 1 Y 0 B ASP 124 ? CB  ? B ASP 124 CB  
222 1 Y 0 B GLU 137 ? CG  ? B GLU 137 CG  
223 1 Y 0 B ARG 148 ? CD  ? B ARG 148 CD  
224 1 Y 1 B LYS 150 ? CG  ? B LYS 150 CG  
225 1 Y 1 B LYS 150 ? CD  ? B LYS 150 CD  
226 1 Y 1 B LYS 150 ? CE  ? B LYS 150 CE  
227 1 Y 1 B LYS 150 ? NZ  ? B LYS 150 NZ  
228 1 Y 0 B GLN 151 ? CG  ? B GLN 151 CG  
229 1 Y 0 B GLN 151 ? OE1 ? B GLN 151 OE1 
230 1 Y 0 B GLN 151 ? NE2 ? B GLN 151 NE2 
231 1 Y 0 B LEU 160 ? CD2 ? B LEU 160 CD2 
232 1 Y 0 B GLN 185 ? NE2 ? B GLN 185 NE2 
233 1 Y 0 B LEU 189 ? CD1 ? B LEU 189 CD1 
234 1 Y 0 B PRO 191 ? CB  ? B PRO 191 CB  
235 1 Y 0 B VAL 208 ? CG1 ? B VAL 208 CG1 
236 1 Y 1 B ARG 209 ? CG  ? B ARG 209 CG  
237 1 Y 1 B ARG 209 ? CD  ? B ARG 209 CD  
238 1 Y 1 B ARG 209 ? NE  ? B ARG 209 NE  
239 1 Y 1 B ARG 209 ? CZ  ? B ARG 209 CZ  
240 1 Y 1 B ARG 209 ? NH1 ? B ARG 209 NH1 
241 1 Y 1 B ARG 209 ? NH2 ? B ARG 209 NH2 
242 1 Y 1 B ARG 220 ? CG  ? B ARG 220 CG  
243 1 Y 1 B ARG 220 ? CD  ? B ARG 220 CD  
244 1 Y 1 B ARG 220 ? NE  ? B ARG 220 NE  
245 1 Y 1 B ARG 220 ? CZ  ? B ARG 220 CZ  
246 1 Y 1 B ARG 220 ? NH1 ? B ARG 220 NH1 
247 1 Y 1 B ARG 220 ? NH2 ? B ARG 220 NH2 
248 1 Y 0 B ILE 238 ? CD1 ? B ILE 238 CD1 
249 1 Y 0 B GLN 265 ? NE2 ? B GLN 265 NE2 
250 1 Y 0 B THR 277 ? CG2 ? B THR 277 CG2 
251 1 Y 1 B ARG 278 ? CG  ? B ARG 278 CG  
252 1 Y 1 B ARG 278 ? CD  ? B ARG 278 CD  
253 1 Y 1 B ARG 278 ? NE  ? B ARG 278 NE  
254 1 Y 1 B ARG 278 ? CZ  ? B ARG 278 CZ  
255 1 Y 1 B ARG 278 ? NH1 ? B ARG 278 NH1 
256 1 Y 1 B ARG 278 ? NH2 ? B ARG 278 NH2 
257 1 Y 0 B GLU 279 ? N   ? B GLU 279 N   
258 1 Y 0 B GLN 280 ? O   ? B GLN 280 O   
259 1 Y 0 B ILE 281 ? CB  ? B ILE 281 CB  
260 1 Y 1 B ARG 282 ? CG  ? B ARG 282 CG  
261 1 Y 1 B ARG 282 ? CD  ? B ARG 282 CD  
262 1 Y 1 B ARG 282 ? NE  ? B ARG 282 NE  
263 1 Y 1 B ARG 282 ? CZ  ? B ARG 282 CZ  
264 1 Y 1 B ARG 282 ? NH1 ? B ARG 282 NH1 
265 1 Y 1 B ARG 282 ? NH2 ? B ARG 282 NH2 
266 1 Y 0 B MET 284 ? CB  ? B MET 284 CB  
267 1 Y 1 B ASN 285 ? CG  ? B ASN 285 CG  
268 1 Y 1 B ASN 285 ? OD1 ? B ASN 285 OD1 
269 1 Y 1 B ASN 285 ? ND2 ? B ASN 285 ND2 
270 1 Y 0 B PHE 291 ? CD2 ? B PHE 291 CD2 
271 1 Y 0 B PHE 291 ? CE2 ? B PHE 291 CE2 
272 1 Y 1 B LYS 292 ? CG  ? B LYS 292 CG  
273 1 Y 1 B LYS 292 ? CD  ? B LYS 292 CD  
274 1 Y 1 B LYS 292 ? CE  ? B LYS 292 CE  
275 1 Y 1 B LYS 292 ? NZ  ? B LYS 292 NZ  
276 1 Y 0 B PHE 293 ? CE1 ? B PHE 293 CE1 
277 1 Y 0 B PHE 293 ? CZ  ? B PHE 293 CZ  
278 1 Y 1 B PRO 294 ? CB  ? B PRO 294 CB  
279 1 Y 1 B PRO 294 ? CG  ? B PRO 294 CG  
280 1 Y 1 B PRO 294 ? CD  ? B PRO 294 CD  
281 1 Y 1 B GLN 295 ? CB  ? B GLN 295 CB  
282 1 Y 1 B GLN 295 ? CG  ? B GLN 295 CG  
283 1 Y 1 B GLN 295 ? CD  ? B GLN 295 CD  
284 1 Y 1 B GLN 295 ? OE1 ? B GLN 295 OE1 
285 1 Y 1 B GLN 295 ? NE2 ? B GLN 295 NE2 
286 1 Y 1 B ILE 296 ? CB  ? B ILE 296 CB  
287 1 Y 1 B ILE 296 ? CG1 ? B ILE 296 CG1 
288 1 Y 1 B ILE 296 ? CG2 ? B ILE 296 CG2 
289 1 Y 1 B ILE 296 ? CD1 ? B ILE 296 CD1 
290 1 Y 1 B LYS 297 ? CG  ? B LYS 297 CG  
291 1 Y 1 B LYS 297 ? CD  ? B LYS 297 CD  
292 1 Y 1 B LYS 297 ? CE  ? B LYS 297 CE  
293 1 Y 1 B LYS 297 ? NZ  ? B LYS 297 NZ  
294 1 Y 1 B HIS 299 ? CB  ? B HIS 299 CB  
295 1 Y 1 B HIS 299 ? CG  ? B HIS 299 CG  
296 1 Y 1 B HIS 299 ? ND1 ? B HIS 299 ND1 
297 1 Y 1 B HIS 299 ? CD2 ? B HIS 299 CD2 
298 1 Y 1 B HIS 299 ? CE1 ? B HIS 299 CE1 
299 1 Y 1 B HIS 299 ? NE2 ? B HIS 299 NE2 
300 1 Y 0 B LYS 303 ? CD  ? B LYS 303 CD  
301 1 Y 0 B LYS 303 ? CE  ? B LYS 303 CE  
302 1 Y 0 B LYS 303 ? NZ  ? B LYS 303 NZ  
303 1 Y 0 B VAL 304 ? CG1 ? B VAL 304 CG1 
304 1 Y 1 B ARG 306 ? CG  ? B ARG 306 CG  
305 1 Y 1 B ARG 306 ? CD  ? B ARG 306 CD  
306 1 Y 1 B ARG 306 ? NE  ? B ARG 306 NE  
307 1 Y 1 B ARG 306 ? CZ  ? B ARG 306 CZ  
308 1 Y 1 B ARG 306 ? NH1 ? B ARG 306 NH1 
309 1 Y 1 B ARG 306 ? NH2 ? B ARG 306 NH2 
310 1 Y 1 B ARG 308 ? CG  ? B ARG 308 CG  
311 1 Y 1 B ARG 308 ? CD  ? B ARG 308 CD  
312 1 Y 1 B ARG 308 ? NE  ? B ARG 308 NE  
313 1 Y 1 B ARG 308 ? CZ  ? B ARG 308 CZ  
314 1 Y 1 B ARG 308 ? NH1 ? B ARG 308 NH1 
315 1 Y 1 B ARG 308 ? NH2 ? B ARG 308 NH2 
316 1 Y 0 B ARG 308 ? CB  ? B ARG 308 CB  
317 1 Y 0 B THR 330 ? CG2 ? B THR 330 CG2 
318 1 Y 0 B GLN 365 ? NE2 ? B GLN 365 NE2 
319 1 Y 0 B ALA 382 ? CB  ? B ALA 382 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ARG 4   ? A ARG 4   
5   1 Y 1 A PRO 5   ? A PRO 5   
6   1 Y 1 A ARG 6   ? A ARG 6   
7   1 Y 1 A THR 7   ? A THR 7   
8   1 Y 1 A THR 8   ? A THR 8   
9   1 Y 1 A SER 9   ? A SER 9   
10  1 Y 1 A PHE 10  ? A PHE 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A GLU 12  ? A GLU 12  
13  1 Y 1 A SER 13  ? A SER 13  
14  1 Y 1 A CYS 14  ? A CYS 14  
15  1 Y 1 A LYS 15  ? A LYS 15  
16  1 Y 1 A PRO 16  ? A PRO 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A GLN 18  ? A GLN 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A PRO 20  ? A PRO 20  
21  1 Y 1 A SER 21  ? A SER 21  
22  1 Y 1 A ALA 22  ? A ALA 22  
23  1 Y 1 A PHE 23  ? A PHE 23  
24  1 Y 1 A GLY 24  ? A GLY 24  
25  1 Y 1 A GLY 120 ? A GLY 120 
26  1 Y 1 A GLU 121 ? A GLU 121 
27  1 Y 1 A LYS 122 ? A LYS 122 
28  1 Y 1 A LYS 123 ? A LYS 123 
29  1 Y 1 A ASP 124 ? A ASP 124 
30  1 Y 1 A GLU 125 ? A GLU 125 
31  1 Y 1 A VAL 126 ? A VAL 126 
32  1 Y 1 A PRO 286 ? A PRO 286 
33  1 Y 1 A ASN 287 ? A ASN 287 
34  1 Y 1 A TYR 288 ? A TYR 288 
35  1 Y 1 A THR 289 ? A THR 289 
36  1 Y 1 A GLU 290 ? A GLU 290 
37  1 Y 1 A PHE 291 ? A PHE 291 
38  1 Y 1 A LYS 292 ? A LYS 292 
39  1 Y 1 A PHE 293 ? A PHE 293 
40  1 Y 1 A PRO 294 ? A PRO 294 
41  1 Y 1 A GLN 295 ? A GLN 295 
42  1 Y 1 A ILE 296 ? A ILE 296 
43  1 Y 1 A LYS 297 ? A LYS 297 
44  1 Y 1 A ALA 298 ? A ALA 298 
45  1 Y 1 A HIS 299 ? A HIS 299 
46  1 Y 1 A PRO 300 ? A PRO 300 
47  1 Y 1 A GLN 385 ? A GLN 385 
48  1 Y 1 A ALA 386 ? A ALA 386 
49  1 Y 1 A ALA 387 ? A ALA 387 
50  1 Y 1 A ALA 388 ? A ALA 388 
51  1 Y 1 A SER 389 ? A SER 389 
52  1 Y 1 A THR 390 ? A THR 390 
53  1 Y 1 A PRO 391 ? A PRO 391 
54  1 Y 1 A THR 392 ? A THR 392 
55  1 Y 1 A ASN 393 ? A ASN 393 
56  1 Y 1 A ALA 394 ? A ALA 394 
57  1 Y 1 A THR 395 ? A THR 395 
58  1 Y 1 A ALA 396 ? A ALA 396 
59  1 Y 1 A ALA 397 ? A ALA 397 
60  1 Y 1 A SER 398 ? A SER 398 
61  1 Y 1 A ASP 399 ? A ASP 399 
62  1 Y 1 A ALA 400 ? A ALA 400 
63  1 Y 1 A ASN 401 ? A ASN 401 
64  1 Y 1 A THR 402 ? A THR 402 
65  1 Y 1 A GLY 403 ? A GLY 403 
66  1 Y 1 A ASP 404 ? A ASP 404 
67  1 Y 1 A ARG 405 ? A ARG 405 
68  1 Y 1 A GLY 406 ? A GLY 406 
69  1 Y 1 A GLN 407 ? A GLN 407 
70  1 Y 1 A THR 408 ? A THR 408 
71  1 Y 1 A ASN 409 ? A ASN 409 
72  1 Y 1 A ASN 410 ? A ASN 410 
73  1 Y 1 A ALA 411 ? A ALA 411 
74  1 Y 1 A ALA 412 ? A ALA 412 
75  1 Y 1 A SER 413 ? A SER 413 
76  1 Y 1 A ALA 414 ? A ALA 414 
77  1 Y 1 A SER 415 ? A SER 415 
78  1 Y 1 A ALA 416 ? A ALA 416 
79  1 Y 1 A SER 417 ? A SER 417 
80  1 Y 1 A ASN 418 ? A ASN 418 
81  1 Y 1 A SER 419 ? A SER 419 
82  1 Y 1 A THR 420 ? A THR 420 
83  1 Y 1 B MET 1   ? B MET 1   
84  1 Y 1 B SER 2   ? B SER 2   
85  1 Y 1 B GLY 3   ? B GLY 3   
86  1 Y 1 B ARG 4   ? B ARG 4   
87  1 Y 1 B PRO 5   ? B PRO 5   
88  1 Y 1 B ARG 6   ? B ARG 6   
89  1 Y 1 B THR 7   ? B THR 7   
90  1 Y 1 B THR 8   ? B THR 8   
91  1 Y 1 B SER 9   ? B SER 9   
92  1 Y 1 B PHE 10  ? B PHE 10  
93  1 Y 1 B ALA 11  ? B ALA 11  
94  1 Y 1 B GLU 12  ? B GLU 12  
95  1 Y 1 B SER 13  ? B SER 13  
96  1 Y 1 B CYS 14  ? B CYS 14  
97  1 Y 1 B LYS 15  ? B LYS 15  
98  1 Y 1 B PRO 16  ? B PRO 16  
99  1 Y 1 B VAL 17  ? B VAL 17  
100 1 Y 1 B GLN 18  ? B GLN 18  
101 1 Y 1 B GLN 19  ? B GLN 19  
102 1 Y 1 B PRO 20  ? B PRO 20  
103 1 Y 1 B SER 21  ? B SER 21  
104 1 Y 1 B ALA 22  ? B ALA 22  
105 1 Y 1 B PHE 23  ? B PHE 23  
106 1 Y 1 B GLY 24  ? B GLY 24  
107 1 Y 1 B SER 25  ? B SER 25  
108 1 Y 1 B MET 26  ? B MET 26  
109 1 Y 1 B LYS 27  ? B LYS 27  
110 1 Y 1 B VAL 28  ? B VAL 28  
111 1 Y 1 B SER 29  ? B SER 29  
112 1 Y 1 B ARG 30  ? B ARG 30  
113 1 Y 1 B ASP 31  ? B ASP 31  
114 1 Y 1 B LYS 32  ? B LYS 32  
115 1 Y 1 B ASP 33  ? B ASP 33  
116 1 Y 1 B GLY 34  ? B GLY 34  
117 1 Y 1 B SER 35  ? B SER 35  
118 1 Y 1 B LYS 36  ? B LYS 36  
119 1 Y 1 B PRO 286 ? B PRO 286 
120 1 Y 1 B ASN 287 ? B ASN 287 
121 1 Y 1 B TYR 288 ? B TYR 288 
122 1 Y 1 B THR 289 ? B THR 289 
123 1 Y 1 B GLU 290 ? B GLU 290 
124 1 Y 1 B ARG 383 ? B ARG 383 
125 1 Y 1 B ILE 384 ? B ILE 384 
126 1 Y 1 B GLN 385 ? B GLN 385 
127 1 Y 1 B ALA 386 ? B ALA 386 
128 1 Y 1 B ALA 387 ? B ALA 387 
129 1 Y 1 B ALA 388 ? B ALA 388 
130 1 Y 1 B SER 389 ? B SER 389 
131 1 Y 1 B THR 390 ? B THR 390 
132 1 Y 1 B PRO 391 ? B PRO 391 
133 1 Y 1 B THR 392 ? B THR 392 
134 1 Y 1 B ASN 393 ? B ASN 393 
135 1 Y 1 B ALA 394 ? B ALA 394 
136 1 Y 1 B THR 395 ? B THR 395 
137 1 Y 1 B ALA 396 ? B ALA 396 
138 1 Y 1 B ALA 397 ? B ALA 397 
139 1 Y 1 B SER 398 ? B SER 398 
140 1 Y 1 B ASP 399 ? B ASP 399 
141 1 Y 1 B ALA 400 ? B ALA 400 
142 1 Y 1 B ASN 401 ? B ASN 401 
143 1 Y 1 B THR 402 ? B THR 402 
144 1 Y 1 B GLY 403 ? B GLY 403 
145 1 Y 1 B ASP 404 ? B ASP 404 
146 1 Y 1 B ARG 405 ? B ARG 405 
147 1 Y 1 B GLY 406 ? B GLY 406 
148 1 Y 1 B GLN 407 ? B GLN 407 
149 1 Y 1 B THR 408 ? B THR 408 
150 1 Y 1 B ASN 409 ? B ASN 409 
151 1 Y 1 B ASN 410 ? B ASN 410 
152 1 Y 1 B ALA 411 ? B ALA 411 
153 1 Y 1 B ALA 412 ? B ALA 412 
154 1 Y 1 B SER 413 ? B SER 413 
155 1 Y 1 B ALA 414 ? B ALA 414 
156 1 Y 1 B SER 415 ? B SER 415 
157 1 Y 1 B ALA 416 ? B ALA 416 
158 1 Y 1 B SER 417 ? B SER 417 
159 1 Y 1 B ASN 418 ? B ASN 418 
160 1 Y 1 B SER 419 ? B SER 419 
161 1 Y 1 B THR 420 ? B THR 420 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PO4 1  421 102 PO4 PO4 A . 
D 2 PO4 1  422 103 PO4 PO4 A . 
E 2 PO4 1  421 101 PO4 PO4 B . 
F 2 PO4 1  422 104 PO4 PO4 B . 
G 3 HOH 1  423 1   HOH HOH A . 
G 3 HOH 2  424 3   HOH HOH A . 
G 3 HOH 3  425 7   HOH HOH A . 
G 3 HOH 4  426 8   HOH HOH A . 
G 3 HOH 5  427 10  HOH HOH A . 
G 3 HOH 6  428 12  HOH HOH A . 
G 3 HOH 7  429 14  HOH HOH A . 
G 3 HOH 8  430 15  HOH HOH A . 
G 3 HOH 9  431 20  HOH HOH A . 
G 3 HOH 10 432 25  HOH HOH A . 
G 3 HOH 11 433 26  HOH HOH A . 
G 3 HOH 12 434 27  HOH HOH A . 
G 3 HOH 13 435 31  HOH HOH A . 
G 3 HOH 14 436 32  HOH HOH A . 
G 3 HOH 15 437 33  HOH HOH A . 
G 3 HOH 16 438 34  HOH HOH A . 
G 3 HOH 17 439 35  HOH HOH A . 
G 3 HOH 18 440 39  HOH HOH A . 
G 3 HOH 19 441 42  HOH HOH A . 
G 3 HOH 20 442 43  HOH HOH A . 
G 3 HOH 21 443 44  HOH HOH A . 
G 3 HOH 22 444 45  HOH HOH A . 
G 3 HOH 23 445 46  HOH HOH A . 
H 3 HOH 1  423 2   HOH HOH B . 
H 3 HOH 2  424 4   HOH HOH B . 
H 3 HOH 3  425 5   HOH HOH B . 
H 3 HOH 4  426 6   HOH HOH B . 
H 3 HOH 5  427 9   HOH HOH B . 
H 3 HOH 6  428 11  HOH HOH B . 
H 3 HOH 7  429 13  HOH HOH B . 
H 3 HOH 8  430 16  HOH HOH B . 
H 3 HOH 9  431 17  HOH HOH B . 
H 3 HOH 10 432 18  HOH HOH B . 
H 3 HOH 11 433 19  HOH HOH B . 
H 3 HOH 12 434 21  HOH HOH B . 
H 3 HOH 13 435 22  HOH HOH B . 
H 3 HOH 14 436 23  HOH HOH B . 
H 3 HOH 15 437 24  HOH HOH B . 
H 3 HOH 16 438 28  HOH HOH B . 
H 3 HOH 17 439 29  HOH HOH B . 
H 3 HOH 18 440 30  HOH HOH B . 
H 3 HOH 19 441 36  HOH HOH B . 
H 3 HOH 20 442 37  HOH HOH B . 
H 3 HOH 21 443 38  HOH HOH B . 
H 3 HOH 22 444 40  HOH HOH B . 
H 3 HOH 23 445 41  HOH HOH B . 
#