data_1I1B
# 
_entry.id   1I1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I1B         
WWPDB D_1000174080 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I1B 
_pdbx_database_status.recvd_initial_deposition_date   1989-12-05 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Finzel, B.C.'     1 
'Watenpaugh, K.D.' 2 
'Einspahr, H.M.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of recombinant human interleukin-1 beta at 2.0 A resolution.' J.Mol.Biol.                       209 779 
791 1989 JMOBAK UK 0022-2836 0070 ? 2585509 '10.1016/0022-2836(89)90606-2' 
1       'Crystallization of Purified Recombinant Human Interleukin-1Beta'                'Proteins: Struct.,Funct.,Genet.' 3   121 
?   1988 PSFGEY US 0887-3585 0867 ? ?       ?                              
2       'Crystallization of Recombinant Human Interleukin 1Beta'                         J.Cryst.Growth                    90  180 
?   1988 JCRGAE NE 0022-0248 0229 ? ?       ?                              
3       'Crystal Structure of the Cytokine Interleukin-1Beta'                            'Embo J.'                         7   339 
?   1988 EMJODG UK 0261-4189 0897 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Finzel, B.C.'        1  
primary 'Clancy, L.L.'        2  
primary 'Holland, D.R.'       3  
primary 'Muchmore, S.W.'      4  
primary 'Watenpaugh, K.D.'    5  
primary 'Einspahr, H.M.'      6  
1       'Carter, D.B.'        7  
1       'Curry, K.A.'         8  
1       'Tomich, C.-S.C.'     9  
1       'Yem, A.W.'           10 
1       'Deibel, M.R.'        11 
1       'Tracey, D.E.'        12 
1       'Paslay, J.W.'        13 
1       'Carter, J.B.'        14 
1       'Theriault, N.Y.'     15 
1       'Harris, P.K.W.'      16 
1       'Reardon, I.M.'       17 
1       'Zurcher-Neely, H.A.' 18 
1       'Heinrikson, R.L.'    19 
1       'Clancy, L.L.'        20 
1       'Muchmore, S.W.'      21 
1       'Watenpaugh, K.D.'    22 
1       'Einspahr, H.M.'      23 
2       'Einspahr, H.'        24 
2       'Clancy, L.L.'        25 
2       'Muchmore, S.W.'      26 
2       'Watenpaugh, K.D.'    27 
2       'Harris, P.K.W.'      28 
2       'Carter, D.B.'        29 
2       'Curry, K.A.'         30 
2       'Tomich, C.-S.C.'     31 
2       'Yem, A.W.'           32 
2       'Deibeljunior, M.R.'  33 
2       'Tracey, D.E.'        34 
2       'Pasley, J.W.'        35 
2       'Staite, N.D.'        36 
2       'Carter, J.B.'        37 
2       'Theriault, N.Y.'     38 
2       'Reardon, I.M.'       39 
2       'Zurcher-Neely, H.A.' 40 
2       'Heinrikson, R.L.'    41 
3       'Priestle, J.P.'      42 
3       'Schaer, H.-P.'       43 
3       'Gruetter, M.G.'      44 
# 
_cell.entry_id           1I1B 
_cell.length_a           54.860 
_cell.length_b           54.860 
_cell.length_c           77.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I1B 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTERLEUKIN-1 BETA' 17395.832 1  ? ? ? ? 
2 water   nat water                18.015    83 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   CYS n 
1 9   THR n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  MET n 
1 21  SER n 
1 22  GLY n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  GLN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  MET n 
1 37  GLU n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  VAL n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  ASN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 ILE n 
1 107 ASN n 
1 108 ASN n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLN n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 ASN n 
1 130 MET n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLY n 
1 140 GLY n 
1 141 GLN n 
1 142 ASP n 
1 143 ILE n 
1 144 THR n 
1 145 ASP n 
1 146 PHE n 
1 147 THR n 
1 148 MET n 
1 149 GLN n 
1 150 PHE n 
1 151 VAL n 
1 152 SER n 
1 153 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 'SK-HEP-1 HEMATOMA CELLS' 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P01584 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAEVPKLASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVP
CPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSM
SFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1I1B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 153 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01584 
_struct_ref_seq.db_align_beg                  117 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I1B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.33 
_exptl_crystal.density_percent_sol   63.06 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1I1B 
_refine.ls_number_reflns_obs                     12318 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1890000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1211 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               1294 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.025 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.047 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.042 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.318 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        2.272 3.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.053 2.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        3.242 4.000 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.020 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.300 0.300 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.200 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.243 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      0.217 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1I1B 
_struct.title                     'CRYSTAL STRUCTURE OF RECOMBINANT HUMAN INTERLEUKIN-1BETA AT 2.0 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           'INTERLEUKIN-1 BETA (IL-1 BETA)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I1B 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 33 ? GLN A 39 ? GLY A 33 GLN A 39 5 ? 7 
HELX_P HELX_P2 2 GLU A 96 ? ARG A 98 ? GLU A 96 ARG A 98 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.57 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BRL ? 7 ? 
L1  ? 2 ? 
L2  ? 2 ? 
L3  ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BRL 1 2 ? anti-parallel 
BRL 2 3 ? anti-parallel 
BRL 3 4 ? anti-parallel 
BRL 4 5 ? anti-parallel 
BRL 5 6 ? anti-parallel 
BRL 6 7 ? anti-parallel 
L1  1 2 ? anti-parallel 
L2  1 2 ? anti-parallel 
L3  1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BRL 1 VAL A 3   ? ASP A 12  ? VAL A 3   ASP A 12  
BRL 2 VAL A 40  ? SER A 52  ? VAL A 40  SER A 52  
BRL 3 LYS A 55  ? LEU A 62  ? LYS A 55  LEU A 62  
BRL 4 VAL A 100 ? ILE A 106 ? VAL A 100 ILE A 106 
BRL 5 ASN A 108 ? SER A 114 ? ASN A 108 SER A 114 
BRL 6 ASP A 142 ? SER A 152 ? ASP A 142 SER A 152 
BRL 7 VAL A 3   ? ASP A 12  ? VAL A 3   ASP A 12  
L1  1 SER A 17  ? SER A 21  ? SER A 17  SER A 21  
L1  2 GLU A 25  ? LEU A 29  ? GLU A 25  LEU A 29  
L2  1 ASN A 66  ? LYS A 74  ? ASN A 66  LYS A 74  
L2  2 LYS A 77  ? VAL A 85  ? LYS A 77  VAL A 85  
L3  1 TRP A 120 ? SER A 125 ? TRP A 120 SER A 125 
L3  2 MET A 130 ? GLY A 135 ? MET A 130 GLY A 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BRL 1 2 N LEU A 6   ? N LEU A 6   O MET A 44  ? O MET A 44  
BRL 2 3 N SER A 43  ? N SER A 43  O GLY A 61  ? O GLY A 61  
BRL 3 4 N VAL A 58  ? N VAL A 58  O PHE A 101 ? O PHE A 101 
BRL 4 5 N ILE A 104 ? N ILE A 104 O GLU A 111 ? O GLU A 111 
BRL 5 6 N LEU A 110 ? N LEU A 110 O PHE A 146 ? O PHE A 146 
BRL 6 7 N THR A 147 ? N THR A 147 O ARG A 11  ? O ARG A 11  
L1  1 2 N VAL A 19  ? N VAL A 19  O LYS A 27  ? O LYS A 27  
L2  1 2 N SER A 70  ? N SER A 70  O GLN A 81  ? O GLN A 81  
L3  1 2 N SER A 123 ? N SER A 123 O PHE A 133 ? O PHE A 133 
# 
_database_PDB_matrix.entry_id          1I1B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I1B 
_atom_sites.fract_transf_matrix[1][1]   0.018228 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018228 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012984 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'RESIDUE 91 IS A CIS PROLINE.'                                                                  
2 'THE SIDE CHAIN ATOMS OF RESIDUES 93 AND 94 ARE DISORDERED AND ARE NOT INCLUDED IN THIS ENTRY.' 
3 'THERE ARE TWO CONFORMATIONS PRESENTED IN THIS ENTRY FOR RESIDUES 63 - 65.'                     
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 3   ? 37.703 -22.105 5.722  1.00 31.01 ? 3   VAL A N   1 
ATOM   2    C CA  . VAL A 1 3   ? 37.362 -21.766 7.098  1.00 30.31 ? 3   VAL A CA  1 
ATOM   3    C C   . VAL A 1 3   ? 36.943 -20.266 7.134  1.00 29.19 ? 3   VAL A C   1 
ATOM   4    O O   . VAL A 1 3   ? 37.523 -19.401 6.494  1.00 28.85 ? 3   VAL A O   1 
ATOM   5    C CB  . VAL A 1 3   ? 38.380 -22.056 8.185  1.00 31.95 ? 3   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 3   ? 39.599 -21.155 8.216  1.00 33.03 ? 3   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 3   ? 37.804 -22.171 9.598  1.00 32.29 ? 3   VAL A CG2 1 
ATOM   8    N N   . ARG A 1 4   ? 35.897 -20.067 7.913  1.00 26.52 ? 4   ARG A N   1 
ATOM   9    C CA  . ARG A 1 4   ? 35.320 -18.747 8.111  1.00 25.87 ? 4   ARG A CA  1 
ATOM   10   C C   . ARG A 1 4   ? 35.877 -18.088 9.381  1.00 24.40 ? 4   ARG A C   1 
ATOM   11   O O   . ARG A 1 4   ? 35.981 -18.770 10.400 1.00 22.74 ? 4   ARG A O   1 
ATOM   12   C CB  . ARG A 1 4   ? 33.843 -18.923 8.264  1.00 27.29 ? 4   ARG A CB  1 
ATOM   13   C CG  . ARG A 1 4   ? 32.992 -19.111 6.959  1.00 29.41 ? 4   ARG A CG  1 
ATOM   14   C CD  . ARG A 1 4   ? 31.681 -19.529 7.667  1.00 30.19 ? 4   ARG A CD  1 
ATOM   15   N NE  . ARG A 1 4   ? 30.514 -18.937 7.118  1.00 30.04 ? 4   ARG A NE  1 
ATOM   16   C CZ  . ARG A 1 4   ? 29.317 -19.126 7.767  1.00 27.47 ? 4   ARG A CZ  1 
ATOM   17   N NH1 . ARG A 1 4   ? 29.248 -19.985 8.788  1.00 25.53 ? 4   ARG A NH1 1 
ATOM   18   N NH2 . ARG A 1 4   ? 28.406 -18.189 7.539  1.00 23.76 ? 4   ARG A NH2 1 
ATOM   19   N N   . SER A 1 5   ? 36.156 -16.825 9.228  1.00 24.30 ? 5   SER A N   1 
ATOM   20   C CA  . SER A 1 5   ? 36.683 -15.949 10.255 1.00 25.17 ? 5   SER A CA  1 
ATOM   21   C C   . SER A 1 5   ? 35.925 -14.646 10.394 1.00 25.77 ? 5   SER A C   1 
ATOM   22   O O   . SER A 1 5   ? 35.177 -14.259 9.489  1.00 26.69 ? 5   SER A O   1 
ATOM   23   C CB  . SER A 1 5   ? 38.141 -15.533 9.943  1.00 24.12 ? 5   SER A CB  1 
ATOM   24   O OG  . SER A 1 5   ? 38.844 -16.799 9.943  1.00 28.07 ? 5   SER A OG  1 
ATOM   25   N N   . LEU A 1 6   ? 36.391 -13.929 11.405 1.00 24.99 ? 6   LEU A N   1 
ATOM   26   C CA  . LEU A 1 6   ? 35.750 -12.602 11.759 1.00 25.00 ? 6   LEU A CA  1 
ATOM   27   C C   . LEU A 1 6   ? 36.776 -11.865 12.627 1.00 23.51 ? 6   LEU A C   1 
ATOM   28   O O   . LEU A 1 6   ? 37.437 -12.564 13.411 1.00 21.39 ? 6   LEU A O   1 
ATOM   29   C CB  . LEU A 1 6   ? 34.789 -13.283 12.772 1.00 28.39 ? 6   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 6   ? 33.692 -12.567 13.372 1.00 30.82 ? 6   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 6   ? 32.588 -12.401 12.312 1.00 31.79 ? 6   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 6   ? 33.216 -13.305 14.590 1.00 32.13 ? 6   LEU A CD2 1 
ATOM   33   N N   . ASN A 1 7   ? 36.953 -10.593 12.485 1.00 23.40 ? 7   ASN A N   1 
ATOM   34   C CA  . ASN A 1 7   ? 37.913 -9.816  13.293 1.00 22.50 ? 7   ASN A CA  1 
ATOM   35   C C   . ASN A 1 7   ? 37.151 -9.237  14.461 1.00 20.47 ? 7   ASN A C   1 
ATOM   36   O O   . ASN A 1 7   ? 35.967 -8.857  14.340 1.00 21.54 ? 7   ASN A O   1 
ATOM   37   C CB  . ASN A 1 7   ? 38.626 -8.734  12.513 1.00 25.85 ? 7   ASN A CB  1 
ATOM   38   C CG  . ASN A 1 7   ? 39.300 -9.314  11.318 1.00 31.14 ? 7   ASN A CG  1 
ATOM   39   O OD1 . ASN A 1 7   ? 40.081 -10.294 11.431 1.00 33.79 ? 7   ASN A OD1 1 
ATOM   40   N ND2 . ASN A 1 7   ? 38.962 -8.790  10.150 1.00 34.08 ? 7   ASN A ND2 1 
ATOM   41   N N   . CYS A 1 8   ? 37.831 -9.150  15.565 1.00 19.26 ? 8   CYS A N   1 
ATOM   42   C CA  . CYS A 1 8   ? 37.145 -8.621  16.774 1.00 18.64 ? 8   CYS A CA  1 
ATOM   43   C C   . CYS A 1 8   ? 38.135 -8.301  17.844 1.00 17.66 ? 8   CYS A C   1 
ATOM   44   O O   . CYS A 1 8   ? 39.315 -8.703  17.775 1.00 17.99 ? 8   CYS A O   1 
ATOM   45   C CB  . CYS A 1 8   ? 36.187 -9.771  17.226 1.00 19.58 ? 8   CYS A CB  1 
ATOM   46   S SG  . CYS A 1 8   ? 37.125 -11.231 17.721 1.00 22.01 ? 8   CYS A SG  1 
ATOM   47   N N   . THR A 1 9   ? 37.670 -7.561  18.832 1.00 16.31 ? 9   THR A N   1 
ATOM   48   C CA  . THR A 1 9   ? 38.511 -7.292  19.982 1.00 14.68 ? 9   THR A CA  1 
ATOM   49   C C   . THR A 1 9   ? 37.716 -7.924  21.119 1.00 15.66 ? 9   THR A C   1 
ATOM   50   O O   . THR A 1 9   ? 36.509 -8.162  20.931 1.00 15.63 ? 9   THR A O   1 
ATOM   51   C CB  . THR A 1 9   ? 38.778 -5.752  20.081 1.00 13.18 ? 9   THR A CB  1 
ATOM   52   O OG1 . THR A 1 9   ? 37.482 -5.138  20.224 1.00 15.86 ? 9   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 9   ? 39.545 -5.178  18.895 1.00 11.46 ? 9   THR A CG2 1 
ATOM   54   N N   . LEU A 1 10  ? 38.343 -8.218  22.228 1.00 16.16 ? 10  LEU A N   1 
ATOM   55   C CA  . LEU A 1 10  ? 37.741 -8.743  23.431 1.00 16.35 ? 10  LEU A CA  1 
ATOM   56   C C   . LEU A 1 10  ? 38.034 -7.704  24.554 1.00 16.01 ? 10  LEU A C   1 
ATOM   57   O O   . LEU A 1 10  ? 39.087 -7.068  24.486 1.00 16.65 ? 10  LEU A O   1 
ATOM   58   C CB  . LEU A 1 10  ? 38.362 -10.107 23.829 1.00 15.23 ? 10  LEU A CB  1 
ATOM   59   C CG  . LEU A 1 10  ? 38.091 -11.187 22.779 1.00 17.56 ? 10  LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 10  ? 38.848 -12.463 23.187 1.00 18.33 ? 10  LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 10  ? 36.606 -11.572 22.853 1.00 16.73 ? 10  LEU A CD2 1 
ATOM   62   N N   . ARG A 1 11  ? 37.121 -7.613  25.448 1.00 15.98 ? 11  ARG A N   1 
ATOM   63   C CA  . ARG A 1 11  ? 37.349 -6.710  26.634 1.00 16.86 ? 11  ARG A CA  1 
ATOM   64   C C   . ARG A 1 11  ? 36.828 -7.549  27.784 1.00 16.28 ? 11  ARG A C   1 
ATOM   65   O O   . ARG A 1 11  ? 35.752 -8.219  27.596 1.00 16.83 ? 11  ARG A O   1 
ATOM   66   C CB  . ARG A 1 11  ? 36.603 -5.452  26.305 1.00 20.17 ? 11  ARG A CB  1 
ATOM   67   C CG  . ARG A 1 11  ? 36.968 -4.270  27.191 1.00 25.93 ? 11  ARG A CG  1 
ATOM   68   C CD  . ARG A 1 11  ? 36.212 -3.074  26.702 1.00 26.60 ? 11  ARG A CD  1 
ATOM   69   N NE  . ARG A 1 11  ? 36.792 -2.692  25.388 1.00 26.94 ? 11  ARG A NE  1 
ATOM   70   C CZ  . ARG A 1 11  ? 35.863 -2.003  24.631 1.00 28.53 ? 11  ARG A CZ  1 
ATOM   71   N NH1 . ARG A 1 11  ? 34.609 -1.814  25.066 1.00 30.48 ? 11  ARG A NH1 1 
ATOM   72   N NH2 . ARG A 1 11  ? 36.246 -1.615  23.451 1.00 27.70 ? 11  ARG A NH2 1 
ATOM   73   N N   . ASP A 1 12  ? 37.486 -7.624  28.881 1.00 16.14 ? 12  ASP A N   1 
ATOM   74   C CA  . ASP A 1 12  ? 37.102 -8.429  30.056 1.00 15.70 ? 12  ASP A CA  1 
ATOM   75   C C   . ASP A 1 12  ? 35.878 -7.775  30.711 1.00 16.64 ? 12  ASP A C   1 
ATOM   76   O O   . ASP A 1 12  ? 35.553 -6.677  30.314 1.00 17.66 ? 12  ASP A O   1 
ATOM   77   C CB  . ASP A 1 12  ? 38.184 -8.842  31.003 1.00 16.53 ? 12  ASP A CB  1 
ATOM   78   C CG  . ASP A 1 12  ? 38.744 -7.772  31.928 1.00 15.15 ? 12  ASP A CG  1 
ATOM   79   O OD1 . ASP A 1 12  ? 38.178 -6.706  32.145 1.00 18.74 ? 12  ASP A OD1 1 
ATOM   80   O OD2 . ASP A 1 12  ? 39.765 -8.037  32.555 1.00 16.62 ? 12  ASP A OD2 1 
ATOM   81   N N   . SER A 1 13  ? 35.213 -8.445  31.644 1.00 15.78 ? 13  SER A N   1 
ATOM   82   C CA  . SER A 1 13  ? 33.968 -7.865  32.196 1.00 17.09 ? 13  SER A CA  1 
ATOM   83   C C   . SER A 1 13  ? 34.264 -6.641  33.025 1.00 19.83 ? 13  SER A C   1 
ATOM   84   O O   . SER A 1 13  ? 33.319 -6.030  33.546 1.00 21.97 ? 13  SER A O   1 
ATOM   85   C CB  . SER A 1 13  ? 33.241 -8.852  33.107 1.00 18.46 ? 13  SER A CB  1 
ATOM   86   O OG  . SER A 1 13  ? 34.154 -9.317  34.057 1.00 22.92 ? 13  SER A OG  1 
ATOM   87   N N   . GLN A 1 14  ? 35.534 -6.322  33.090 1.00 19.80 ? 14  GLN A N   1 
ATOM   88   C CA  . GLN A 1 14  ? 35.900 -5.156  33.925 1.00 20.54 ? 14  GLN A CA  1 
ATOM   89   C C   . GLN A 1 14  ? 36.362 -4.048  32.945 1.00 18.54 ? 14  GLN A C   1 
ATOM   90   O O   . GLN A 1 14  ? 36.975 -3.151  33.496 1.00 21.02 ? 14  GLN A O   1 
ATOM   91   C CB  . GLN A 1 14  ? 37.032 -5.534  34.752 1.00 24.38 ? 14  GLN A CB  1 
ATOM   92   C CG  . GLN A 1 14  ? 37.322 -5.093  36.045 1.00 30.38 ? 14  GLN A CG  1 
ATOM   93   C CD  . GLN A 1 14  ? 36.634 -5.986  37.071 1.00 33.31 ? 14  GLN A CD  1 
ATOM   94   O OE1 . GLN A 1 14  ? 37.389 -6.303  37.987 1.00 37.75 ? 14  GLN A OE1 1 
ATOM   95   N NE2 . GLN A 1 14  ? 35.401 -6.293  36.791 1.00 32.81 ? 14  GLN A NE2 1 
ATOM   96   N N   . GLN A 1 15  ? 36.146 -4.219  31.743 1.00 17.49 ? 15  GLN A N   1 
ATOM   97   C CA  . GLN A 1 15  ? 36.420 -3.244  30.695 1.00 18.84 ? 15  GLN A CA  1 
ATOM   98   C C   . GLN A 1 15  ? 37.875 -3.119  30.415 1.00 18.20 ? 15  GLN A C   1 
ATOM   99   O O   . GLN A 1 15  ? 38.238 -2.052  29.902 1.00 19.32 ? 15  GLN A O   1 
ATOM   100  C CB  . GLN A 1 15  ? 35.849 -1.891  31.104 1.00 20.20 ? 15  GLN A CB  1 
ATOM   101  C CG  . GLN A 1 15  ? 34.382 -2.008  31.513 1.00 25.93 ? 15  GLN A CG  1 
ATOM   102  C CD  . GLN A 1 15  ? 33.531 -2.075  30.274 1.00 30.59 ? 15  GLN A CD  1 
ATOM   103  O OE1 . GLN A 1 15  ? 34.047 -2.106  29.166 1.00 33.48 ? 15  GLN A OE1 1 
ATOM   104  N NE2 . GLN A 1 15  ? 32.239 -1.927  30.507 1.00 34.80 ? 15  GLN A NE2 1 
ATOM   105  N N   . LYS A 1 16  ? 38.647 -4.120  30.809 1.00 18.43 ? 16  LYS A N   1 
ATOM   106  C CA  . LYS A 1 16  ? 40.095 -4.092  30.471 1.00 16.40 ? 16  LYS A CA  1 
ATOM   107  C C   . LYS A 1 16  ? 40.252 -4.569  29.028 1.00 17.16 ? 16  LYS A C   1 
ATOM   108  O O   . LYS A 1 16  ? 39.493 -5.450  28.530 1.00 17.65 ? 16  LYS A O   1 
ATOM   109  C CB  . LYS A 1 16  ? 40.996 -4.789  31.419 1.00 13.89 ? 16  LYS A CB  1 
ATOM   110  C CG  . LYS A 1 16  ? 40.931 -4.270  32.879 1.00 15.01 ? 16  LYS A CG  1 
ATOM   111  C CD  . LYS A 1 16  ? 42.140 -4.779  33.681 1.00 15.25 ? 16  LYS A CD  1 
ATOM   112  C CE  . LYS A 1 16  ? 42.262 -6.259  33.822 1.00 18.21 ? 16  LYS A CE  1 
ATOM   113  N NZ  . LYS A 1 16  ? 41.194 -6.859  34.722 1.00 18.29 ? 16  LYS A NZ  1 
ATOM   114  N N   . SER A 1 17  ? 41.122 -3.991  28.293 1.00 16.91 ? 17  SER A N   1 
ATOM   115  C CA  . SER A 1 17  ? 41.550 -4.223  26.934 1.00 15.93 ? 17  SER A CA  1 
ATOM   116  C C   . SER A 1 17  ? 42.794 -5.121  26.932 1.00 14.94 ? 17  SER A C   1 
ATOM   117  O O   . SER A 1 17  ? 43.442 -5.173  27.944 1.00 14.39 ? 17  SER A O   1 
ATOM   118  C CB  . SER A 1 17  ? 41.845 -2.873  26.212 1.00 15.68 ? 17  SER A CB  1 
ATOM   119  O OG  . SER A 1 17  ? 40.476 -2.362  26.021 1.00 21.49 ? 17  SER A OG  1 
ATOM   120  N N   . LEU A 1 18  ? 43.021 -5.795  25.827 1.00 16.28 ? 18  LEU A N   1 
ATOM   121  C CA  . LEU A 1 18  ? 44.153 -6.750  25.728 1.00 16.16 ? 18  LEU A CA  1 
ATOM   122  C C   . LEU A 1 18  ? 45.173 -6.170  24.742 1.00 17.96 ? 18  LEU A C   1 
ATOM   123  O O   . LEU A 1 18  ? 44.740 -5.591  23.738 1.00 19.21 ? 18  LEU A O   1 
ATOM   124  C CB  . LEU A 1 18  ? 43.620 -8.078  25.243 1.00 14.92 ? 18  LEU A CB  1 
ATOM   125  C CG  . LEU A 1 18  ? 42.466 -8.766  25.946 1.00 15.25 ? 18  LEU A CG  1 
ATOM   126  C CD1 . LEU A 1 18  ? 42.387 -10.224 25.468 1.00 14.74 ? 18  LEU A CD1 1 
ATOM   127  C CD2 . LEU A 1 18  ? 42.641 -8.668  27.415 1.00 16.56 ? 18  LEU A CD2 1 
ATOM   128  N N   . VAL A 1 19  ? 46.424 -6.384  25.083 1.00 19.45 ? 19  VAL A N   1 
ATOM   129  C CA  . VAL A 1 19  ? 47.523 -5.875  24.213 1.00 21.75 ? 19  VAL A CA  1 
ATOM   130  C C   . VAL A 1 19  ? 48.701 -6.889  24.321 1.00 22.12 ? 19  VAL A C   1 
ATOM   131  O O   . VAL A 1 19  ? 48.791 -7.634  25.254 1.00 19.58 ? 19  VAL A O   1 
ATOM   132  C CB  . VAL A 1 19  ? 48.009 -4.515  24.829 1.00 23.94 ? 19  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 19  ? 46.914 -3.528  25.067 1.00 22.49 ? 19  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 19  ? 48.789 -4.785  26.111 1.00 24.28 ? 19  VAL A CG2 1 
ATOM   135  N N   . MET A 1 20  ? 49.570 -6.813  23.378 1.00 26.42 ? 20  MET A N   1 
ATOM   136  C CA  . MET A 1 20  ? 50.813 -7.615  23.215 1.00 30.47 ? 20  MET A CA  1 
ATOM   137  C C   . MET A 1 20  ? 51.913 -7.128  24.133 1.00 32.25 ? 20  MET A C   1 
ATOM   138  O O   . MET A 1 20  ? 52.403 -6.045  23.898 1.00 34.05 ? 20  MET A O   1 
ATOM   139  C CB  . MET A 1 20  ? 51.192 -7.526  21.736 1.00 32.25 ? 20  MET A CB  1 
ATOM   140  C CG  . MET A 1 20  ? 50.371 -8.526  20.929 1.00 34.31 ? 20  MET A CG  1 
ATOM   141  S SD  . MET A 1 20  ? 51.585 -9.845  20.516 1.00 41.81 ? 20  MET A SD  1 
ATOM   142  C CE  . MET A 1 20  ? 52.366 -9.103  19.113 1.00 37.86 ? 20  MET A CE  1 
ATOM   143  N N   . SER A 1 21  ? 52.271 -7.912  25.101 1.00 33.20 ? 21  SER A N   1 
ATOM   144  C CA  . SER A 1 21  ? 53.314 -7.709  26.115 1.00 36.62 ? 21  SER A CA  1 
ATOM   145  C C   . SER A 1 21  ? 54.674 -7.924  25.428 1.00 38.44 ? 21  SER A C   1 
ATOM   146  O O   . SER A 1 21  ? 55.368 -6.901  25.113 1.00 40.61 ? 21  SER A O   1 
ATOM   147  C CB  . SER A 1 21  ? 53.118 -8.653  27.295 1.00 38.21 ? 21  SER A CB  1 
ATOM   148  O OG  . SER A 1 21  ? 54.264 -8.690  28.175 1.00 41.12 ? 21  SER A OG  1 
ATOM   149  N N   . GLY A 1 22  ? 54.985 -9.147  25.116 1.00 37.91 ? 22  GLY A N   1 
ATOM   150  C CA  . GLY A 1 22  ? 56.322 -9.342  24.378 1.00 38.55 ? 22  GLY A CA  1 
ATOM   151  C C   . GLY A 1 22  ? 55.814 -10.032 23.113 1.00 38.43 ? 22  GLY A C   1 
ATOM   152  O O   . GLY A 1 22  ? 54.605 -9.908  22.904 1.00 38.96 ? 22  GLY A O   1 
ATOM   153  N N   . PRO A 1 23  ? 56.678 -10.776 22.482 1.00 38.00 ? 23  PRO A N   1 
ATOM   154  C CA  . PRO A 1 23  ? 56.285 -11.482 21.256 1.00 37.72 ? 23  PRO A CA  1 
ATOM   155  C C   . PRO A 1 23  ? 55.208 -12.545 21.483 1.00 36.32 ? 23  PRO A C   1 
ATOM   156  O O   . PRO A 1 23  ? 54.428 -12.878 20.563 1.00 37.58 ? 23  PRO A O   1 
ATOM   157  C CB  . PRO A 1 23  ? 57.584 -12.196 20.831 1.00 37.90 ? 23  PRO A CB  1 
ATOM   158  C CG  . PRO A 1 23  ? 58.565 -12.044 21.946 1.00 37.89 ? 23  PRO A CG  1 
ATOM   159  C CD  . PRO A 1 23  ? 58.106 -10.935 22.825 1.00 38.01 ? 23  PRO A CD  1 
ATOM   160  N N   . TYR A 1 24  ? 55.202 -13.100 22.685 1.00 33.04 ? 24  TYR A N   1 
ATOM   161  C CA  . TYR A 1 24  ? 54.336 -14.214 23.016 1.00 31.27 ? 24  TYR A CA  1 
ATOM   162  C C   . TYR A 1 24  ? 53.469 -14.128 24.243 1.00 29.24 ? 24  TYR A C   1 
ATOM   163  O O   . TYR A 1 24  ? 53.086 -15.187 24.808 1.00 27.71 ? 24  TYR A O   1 
ATOM   164  C CB  . TYR A 1 24  ? 55.259 -15.461 23.047 1.00 33.93 ? 24  TYR A CB  1 
ATOM   165  C CG  . TYR A 1 24  ? 55.951 -15.794 21.736 1.00 36.83 ? 24  TYR A CG  1 
ATOM   166  C CD1 . TYR A 1 24  ? 57.212 -15.303 21.377 1.00 38.69 ? 24  TYR A CD1 1 
ATOM   167  C CD2 . TYR A 1 24  ? 55.306 -16.659 20.839 1.00 37.52 ? 24  TYR A CD2 1 
ATOM   168  C CE1 . TYR A 1 24  ? 57.799 -15.638 20.130 1.00 38.56 ? 24  TYR A CE1 1 
ATOM   169  C CE2 . TYR A 1 24  ? 55.887 -17.024 19.638 1.00 37.63 ? 24  TYR A CE2 1 
ATOM   170  C CZ  . TYR A 1 24  ? 57.143 -16.519 19.294 1.00 37.50 ? 24  TYR A CZ  1 
ATOM   171  O OH  . TYR A 1 24  ? 57.632 -16.947 18.074 1.00 33.41 ? 24  TYR A OH  1 
ATOM   172  N N   . GLU A 1 25  ? 53.143 -12.951 24.708 1.00 27.51 ? 25  GLU A N   1 
ATOM   173  C CA  . GLU A 1 25  ? 52.277 -12.719 25.816 1.00 27.54 ? 25  GLU A CA  1 
ATOM   174  C C   . GLU A 1 25  ? 51.319 -11.550 25.458 1.00 25.20 ? 25  GLU A C   1 
ATOM   175  O O   . GLU A 1 25  ? 51.700 -10.629 24.749 1.00 26.15 ? 25  GLU A O   1 
ATOM   176  C CB  . GLU A 1 25  ? 52.762 -12.361 27.175 1.00 32.75 ? 25  GLU A CB  1 
ATOM   177  C CG  . GLU A 1 25  ? 53.465 -13.188 28.184 1.00 37.39 ? 25  GLU A CG  1 
ATOM   178  C CD  . GLU A 1 25  ? 53.873 -12.418 29.439 1.00 39.62 ? 25  GLU A CD  1 
ATOM   179  O OE1 . GLU A 1 25  ? 54.158 -11.242 29.435 1.00 40.17 ? 25  GLU A OE1 1 
ATOM   180  O OE2 . GLU A 1 25  ? 53.874 -13.195 30.406 1.00 41.50 ? 25  GLU A OE2 1 
ATOM   181  N N   . LEU A 1 26  ? 50.208 -11.689 26.114 1.00 22.83 ? 26  LEU A N   1 
ATOM   182  C CA  . LEU A 1 26  ? 49.096 -10.733 26.117 1.00 19.81 ? 26  LEU A CA  1 
ATOM   183  C C   . LEU A 1 26  ? 48.950 -10.216 27.566 1.00 18.06 ? 26  LEU A C   1 
ATOM   184  O O   . LEU A 1 26  ? 49.118 -11.008 28.536 1.00 17.93 ? 26  LEU A O   1 
ATOM   185  C CB  . LEU A 1 26  ? 47.854 -11.421 25.626 1.00 18.66 ? 26  LEU A CB  1 
ATOM   186  C CG  . LEU A 1 26  ? 47.307 -11.406 24.244 1.00 20.87 ? 26  LEU A CG  1 
ATOM   187  C CD1 . LEU A 1 26  ? 48.290 -11.512 23.151 1.00 22.51 ? 26  LEU A CD1 1 
ATOM   188  C CD2 . LEU A 1 26  ? 46.283 -12.535 24.105 1.00 20.13 ? 26  LEU A CD2 1 
ATOM   189  N N   . LYS A 1 27  ? 48.590 -8.997  27.657 1.00 17.07 ? 27  LYS A N   1 
ATOM   190  C CA  . LYS A 1 27  ? 48.336 -8.362  28.979 1.00 18.34 ? 27  LYS A CA  1 
ATOM   191  C C   . LYS A 1 27  ? 47.004 -7.628  28.921 1.00 17.52 ? 27  LYS A C   1 
ATOM   192  O O   . LYS A 1 27  ? 46.587 -7.282  27.810 1.00 19.10 ? 27  LYS A O   1 
ATOM   193  C CB  . LYS A 1 27  ? 49.404 -7.421  29.449 1.00 21.44 ? 27  LYS A CB  1 
ATOM   194  C CG  . LYS A 1 27  ? 50.624 -8.233  29.918 1.00 27.60 ? 27  LYS A CG  1 
ATOM   195  C CD  . LYS A 1 27  ? 51.619 -7.212  30.541 1.00 30.76 ? 27  LYS A CD  1 
ATOM   196  C CE  . LYS A 1 27  ? 52.542 -8.115  31.444 1.00 32.95 ? 27  LYS A CE  1 
ATOM   197  N NZ  . LYS A 1 27  ? 53.167 -7.128  32.415 1.00 32.64 ? 27  LYS A NZ  1 
ATOM   198  N N   . ALA A 1 28  ? 46.395 -7.451  30.050 1.00 16.19 ? 28  ALA A N   1 
ATOM   199  C CA  . ALA A 1 28  ? 45.135 -6.763  30.155 1.00 16.59 ? 28  ALA A CA  1 
ATOM   200  C C   . ALA A 1 28  ? 45.362 -5.541  31.103 1.00 16.56 ? 28  ALA A C   1 
ATOM   201  O O   . ALA A 1 28  ? 45.955 -5.650  32.125 1.00 17.53 ? 28  ALA A O   1 
ATOM   202  C CB  . ALA A 1 28  ? 44.009 -7.686  30.640 1.00 14.06 ? 28  ALA A CB  1 
ATOM   203  N N   . LEU A 1 29  ? 44.905 -4.450  30.588 1.00 16.59 ? 29  LEU A N   1 
ATOM   204  C CA  . LEU A 1 29  ? 44.887 -3.136  31.179 1.00 19.27 ? 29  LEU A CA  1 
ATOM   205  C C   . LEU A 1 29  ? 43.686 -2.309  30.732 1.00 19.12 ? 29  LEU A C   1 
ATOM   206  O O   . LEU A 1 29  ? 43.136 -2.508  29.662 1.00 18.61 ? 29  LEU A O   1 
ATOM   207  C CB  . LEU A 1 29  ? 46.182 -2.382  30.974 1.00 21.16 ? 29  LEU A CB  1 
ATOM   208  C CG  . LEU A 1 29  ? 46.840 -2.442  29.611 1.00 25.36 ? 29  LEU A CG  1 
ATOM   209  C CD1 . LEU A 1 29  ? 45.876 -2.223  28.471 1.00 25.96 ? 29  LEU A CD1 1 
ATOM   210  C CD2 . LEU A 1 29  ? 47.789 -1.218  29.627 1.00 27.24 ? 29  LEU A CD2 1 
ATOM   211  N N   . HIS A 1 30  ? 43.355 -1.368  31.597 1.00 20.05 ? 30  HIS A N   1 
ATOM   212  C CA  . HIS A 1 30  ? 42.283 -0.385  31.374 1.00 19.82 ? 30  HIS A CA  1 
ATOM   213  C C   . HIS A 1 30  ? 42.871 0.607   30.372 1.00 21.93 ? 30  HIS A C   1 
ATOM   214  O O   . HIS A 1 30  ? 43.910 1.128   30.719 1.00 24.22 ? 30  HIS A O   1 
ATOM   215  C CB  . HIS A 1 30  ? 41.913 0.345   32.646 1.00 17.54 ? 30  HIS A CB  1 
ATOM   216  C CG  . HIS A 1 30  ? 41.061 -0.491  33.556 1.00 16.44 ? 30  HIS A CG  1 
ATOM   217  N ND1 . HIS A 1 30  ? 41.505 -1.247  34.589 1.00 18.18 ? 30  HIS A ND1 1 
ATOM   218  C CD2 . HIS A 1 30  ? 39.749 -0.769  33.375 1.00 16.07 ? 30  HIS A CD2 1 
ATOM   219  C CE1 . HIS A 1 30  ? 40.457 -1.884  35.116 1.00 18.67 ? 30  HIS A CE1 1 
ATOM   220  N NE2 . HIS A 1 30  ? 39.393 -1.573  34.421 1.00 19.68 ? 30  HIS A NE2 1 
ATOM   221  N N   . LEU A 1 31  ? 42.315 0.742   29.231 1.00 23.43 ? 31  LEU A N   1 
ATOM   222  C CA  . LEU A 1 31  ? 42.878 1.634   28.188 1.00 25.27 ? 31  LEU A CA  1 
ATOM   223  C C   . LEU A 1 31  ? 41.687 2.462   27.700 1.00 26.72 ? 31  LEU A C   1 
ATOM   224  O O   . LEU A 1 31  ? 40.574 1.944   27.729 1.00 25.04 ? 31  LEU A O   1 
ATOM   225  C CB  . LEU A 1 31  ? 43.434 0.581   27.249 1.00 26.61 ? 31  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 31  ? 44.512 0.800   26.244 1.00 27.68 ? 31  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 31  ? 45.779 1.216   27.002 1.00 28.76 ? 31  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 31  ? 44.834 -0.482  25.489 1.00 27.50 ? 31  LEU A CD2 1 
ATOM   229  N N   . GLN A 1 32  ? 41.898 3.712   27.382 1.00 29.21 ? 32  GLN A N   1 
ATOM   230  C CA  . GLN A 1 32  ? 40.810 4.589   26.843 1.00 32.29 ? 32  GLN A CA  1 
ATOM   231  C C   . GLN A 1 32  ? 41.596 5.603   25.986 1.00 34.99 ? 32  GLN A C   1 
ATOM   232  O O   . GLN A 1 32  ? 42.783 5.827   26.292 1.00 35.37 ? 32  GLN A O   1 
ATOM   233  C CB  . GLN A 1 32  ? 39.969 5.284   27.899 1.00 34.51 ? 32  GLN A CB  1 
ATOM   234  C CG  . GLN A 1 32  ? 38.799 6.172   27.562 1.00 34.32 ? 32  GLN A CG  1 
ATOM   235  C CD  . GLN A 1 32  ? 37.995 6.679   28.733 1.00 35.88 ? 32  GLN A CD  1 
ATOM   236  O OE1 . GLN A 1 32  ? 38.477 7.094   29.808 1.00 35.66 ? 32  GLN A OE1 1 
ATOM   237  N NE2 . GLN A 1 32  ? 36.655 6.637   28.683 1.00 34.06 ? 32  GLN A NE2 1 
ATOM   238  N N   . GLY A 1 33  ? 40.925 6.153   25.026 1.00 37.57 ? 33  GLY A N   1 
ATOM   239  C CA  . GLY A 1 33  ? 41.530 7.192   24.182 1.00 41.39 ? 33  GLY A CA  1 
ATOM   240  C C   . GLY A 1 33  ? 42.042 6.590   22.895 1.00 44.45 ? 33  GLY A C   1 
ATOM   241  O O   . GLY A 1 33  ? 41.620 5.526   22.460 1.00 45.46 ? 33  GLY A O   1 
ATOM   242  N N   . GLN A 1 34  ? 42.910 7.358   22.301 1.00 46.80 ? 34  GLN A N   1 
ATOM   243  C CA  . GLN A 1 34  ? 43.578 6.991   21.011 1.00 48.45 ? 34  GLN A CA  1 
ATOM   244  C C   . GLN A 1 34  ? 44.561 5.891   21.386 1.00 47.59 ? 34  GLN A C   1 
ATOM   245  O O   . GLN A 1 34  ? 45.127 5.192   20.543 1.00 47.32 ? 34  GLN A O   1 
ATOM   246  C CB  . GLN A 1 34  ? 44.260 8.314   20.568 1.00 54.66 ? 34  GLN A CB  1 
ATOM   247  C CG  . GLN A 1 34  ? 45.148 8.862   21.698 1.00 60.26 ? 34  GLN A CG  1 
ATOM   248  C CD  . GLN A 1 34  ? 45.446 10.339  21.521 1.00 64.23 ? 34  GLN A CD  1 
ATOM   249  O OE1 . GLN A 1 34  ? 44.731 11.105  20.837 1.00 66.49 ? 34  GLN A OE1 1 
ATOM   250  N NE2 . GLN A 1 34  ? 46.473 10.807  22.237 1.00 65.32 ? 34  GLN A NE2 1 
ATOM   251  N N   . ASP A 1 35  ? 44.638 5.732   22.685 1.00 46.52 ? 35  ASP A N   1 
ATOM   252  C CA  . ASP A 1 35  ? 45.563 4.737   23.313 1.00 46.21 ? 35  ASP A CA  1 
ATOM   253  C C   . ASP A 1 35  ? 44.980 3.342   23.053 1.00 44.99 ? 35  ASP A C   1 
ATOM   254  O O   . ASP A 1 35  ? 45.624 2.293   23.031 1.00 43.12 ? 35  ASP A O   1 
ATOM   255  C CB  . ASP A 1 35  ? 45.623 5.243   24.743 1.00 48.34 ? 35  ASP A CB  1 
ATOM   256  C CG  . ASP A 1 35  ? 46.892 4.956   25.494 1.00 49.74 ? 35  ASP A CG  1 
ATOM   257  O OD1 . ASP A 1 35  ? 46.880 4.560   26.665 1.00 51.66 ? 35  ASP A OD1 1 
ATOM   258  O OD2 . ASP A 1 35  ? 47.943 5.275   24.867 1.00 49.97 ? 35  ASP A OD2 1 
ATOM   259  N N   . MET A 1 36  ? 43.701 3.341   22.691 1.00 44.33 ? 36  MET A N   1 
ATOM   260  C CA  . MET A 1 36  ? 42.950 2.134   22.396 1.00 43.89 ? 36  MET A CA  1 
ATOM   261  C C   . MET A 1 36  ? 43.543 1.446   21.149 1.00 43.29 ? 36  MET A C   1 
ATOM   262  O O   . MET A 1 36  ? 43.261 0.295   20.855 1.00 41.85 ? 36  MET A O   1 
ATOM   263  C CB  . MET A 1 36  ? 41.514 2.541   21.981 1.00 45.12 ? 36  MET A CB  1 
ATOM   264  C CG  . MET A 1 36  ? 40.600 1.349   22.066 1.00 46.79 ? 36  MET A CG  1 
ATOM   265  S SD  . MET A 1 36  ? 40.039 1.318   23.861 1.00 47.23 ? 36  MET A SD  1 
ATOM   266  C CE  . MET A 1 36  ? 39.146 2.884   23.731 1.00 46.65 ? 36  MET A CE  1 
ATOM   267  N N   . GLU A 1 37  ? 44.259 2.215   20.362 1.00 44.37 ? 37  GLU A N   1 
ATOM   268  C CA  . GLU A 1 37  ? 44.830 1.709   19.105 1.00 44.17 ? 37  GLU A CA  1 
ATOM   269  C C   . GLU A 1 37  ? 45.806 0.582   19.410 1.00 41.28 ? 37  GLU A C   1 
ATOM   270  O O   . GLU A 1 37  ? 46.000 -0.199  18.481 1.00 41.89 ? 37  GLU A O   1 
ATOM   271  C CB  . GLU A 1 37  ? 45.611 2.745   18.271 1.00 48.65 ? 37  GLU A CB  1 
ATOM   272  C CG  . GLU A 1 37  ? 46.897 3.343   18.716 1.00 53.79 ? 37  GLU A CG  1 
ATOM   273  C CD  . GLU A 1 37  ? 47.729 4.383   18.045 1.00 57.65 ? 37  GLU A CD  1 
ATOM   274  O OE1 . GLU A 1 37  ? 48.609 4.216   17.178 1.00 58.01 ? 37  GLU A OE1 1 
ATOM   275  O OE2 . GLU A 1 37  ? 47.553 5.566   18.535 1.00 58.57 ? 37  GLU A OE2 1 
ATOM   276  N N   . GLN A 1 38  ? 46.382 0.517   20.574 1.00 39.72 ? 38  GLN A N   1 
ATOM   277  C CA  . GLN A 1 38  ? 47.370 -0.527  20.922 1.00 37.36 ? 38  GLN A CA  1 
ATOM   278  C C   . GLN A 1 38  ? 46.810 -1.861  21.346 1.00 34.69 ? 38  GLN A C   1 
ATOM   279  O O   . GLN A 1 38  ? 47.474 -2.738  21.954 1.00 35.56 ? 38  GLN A O   1 
ATOM   280  C CB  . GLN A 1 38  ? 48.425 -0.012  21.889 1.00 40.18 ? 38  GLN A CB  1 
ATOM   281  C CG  . GLN A 1 38  ? 47.931 0.583   23.181 1.00 43.05 ? 38  GLN A CG  1 
ATOM   282  C CD  . GLN A 1 38  ? 49.046 0.991   24.091 1.00 45.60 ? 38  GLN A CD  1 
ATOM   283  O OE1 . GLN A 1 38  ? 50.207 0.605   23.881 1.00 49.03 ? 38  GLN A OE1 1 
ATOM   284  N NE2 . GLN A 1 38  ? 48.766 1.698   25.155 1.00 46.04 ? 38  GLN A NE2 1 
ATOM   285  N N   . GLN A 1 39  ? 45.576 -2.063  21.113 1.00 30.50 ? 39  GLN A N   1 
ATOM   286  C CA  . GLN A 1 39  ? 44.708 -3.186  21.372 1.00 28.38 ? 39  GLN A CA  1 
ATOM   287  C C   . GLN A 1 39  ? 44.818 -4.225  20.279 1.00 26.68 ? 39  GLN A C   1 
ATOM   288  O O   . GLN A 1 39  ? 44.859 -3.914  19.092 1.00 26.32 ? 39  GLN A O   1 
ATOM   289  C CB  . GLN A 1 39  ? 43.304 -2.560  21.434 1.00 27.99 ? 39  GLN A CB  1 
ATOM   290  C CG  . GLN A 1 39  ? 42.151 -3.398  21.160 1.00 27.82 ? 39  GLN A CG  1 
ATOM   291  C CD  . GLN A 1 39  ? 40.798 -2.717  21.442 1.00 24.24 ? 39  GLN A CD  1 
ATOM   292  O OE1 . GLN A 1 39  ? 40.216 -3.103  22.448 1.00 22.03 ? 39  GLN A OE1 1 
ATOM   293  N NE2 . GLN A 1 39  ? 40.428 -1.862  20.533 1.00 25.67 ? 39  GLN A NE2 1 
ATOM   294  N N   . VAL A 1 40  ? 44.977 -5.470  20.706 1.00 23.72 ? 40  VAL A N   1 
ATOM   295  C CA  . VAL A 1 40  ? 45.070 -6.601  19.771 1.00 21.96 ? 40  VAL A CA  1 
ATOM   296  C C   . VAL A 1 40  ? 43.728 -6.899  19.112 1.00 19.72 ? 40  VAL A C   1 
ATOM   297  O O   . VAL A 1 40  ? 42.707 -7.054  19.825 1.00 19.61 ? 40  VAL A O   1 
ATOM   298  C CB  . VAL A 1 40  ? 45.555 -7.831  20.649 1.00 21.79 ? 40  VAL A CB  1 
ATOM   299  C CG1 . VAL A 1 40  ? 45.501 -9.113  19.863 1.00 23.58 ? 40  VAL A CG1 1 
ATOM   300  C CG2 . VAL A 1 40  ? 46.925 -7.583  21.165 1.00 21.99 ? 40  VAL A CG2 1 
ATOM   301  N N   . VAL A 1 41  ? 43.678 -7.112  17.852 1.00 19.16 ? 41  VAL A N   1 
ATOM   302  C CA  . VAL A 1 41  ? 42.576 -7.501  16.979 1.00 19.13 ? 41  VAL A CA  1 
ATOM   303  C C   . VAL A 1 41  ? 42.799 -9.008  16.688 1.00 18.50 ? 41  VAL A C   1 
ATOM   304  O O   . VAL A 1 41  ? 43.885 -9.378  16.229 1.00 19.27 ? 41  VAL A O   1 
ATOM   305  C CB  . VAL A 1 41  ? 42.457 -6.679  15.691 1.00 18.26 ? 41  VAL A CB  1 
ATOM   306  C CG1 . VAL A 1 41  ? 41.397 -7.184  14.725 1.00 19.44 ? 41  VAL A CG1 1 
ATOM   307  C CG2 . VAL A 1 41  ? 42.092 -5.206  15.979 1.00 20.22 ? 41  VAL A CG2 1 
ATOM   308  N N   . PHE A 1 42  ? 41.853 -9.806  17.085 1.00 17.77 ? 42  PHE A N   1 
ATOM   309  C CA  . PHE A 1 42  ? 41.986 -11.259 16.838 1.00 17.51 ? 42  PHE A CA  1 
ATOM   310  C C   . PHE A 1 42  ? 41.300 -11.579 15.521 1.00 18.55 ? 42  PHE A C   1 
ATOM   311  O O   . PHE A 1 42  ? 40.460 -10.773 15.069 1.00 19.64 ? 42  PHE A O   1 
ATOM   312  C CB  . PHE A 1 42  ? 41.149 -12.062 17.892 1.00 15.70 ? 42  PHE A CB  1 
ATOM   313  C CG  . PHE A 1 42  ? 41.807 -11.931 19.217 1.00 13.79 ? 42  PHE A CG  1 
ATOM   314  C CD1 . PHE A 1 42  ? 41.463 -10.906 20.081 1.00 12.94 ? 42  PHE A CD1 1 
ATOM   315  C CD2 . PHE A 1 42  ? 42.776 -12.849 19.561 1.00 13.78 ? 42  PHE A CD2 1 
ATOM   316  C CE1 . PHE A 1 42  ? 42.134 -10.818 21.313 1.00 15.39 ? 42  PHE A CE1 1 
ATOM   317  C CE2 . PHE A 1 42  ? 43.428 -12.774 20.780 1.00 13.32 ? 42  PHE A CE2 1 
ATOM   318  C CZ  . PHE A 1 42  ? 43.112 -11.758 21.657 1.00 14.01 ? 42  PHE A CZ  1 
ATOM   319  N N   . SER A 1 43  ? 41.666 -12.705 14.977 1.00 18.35 ? 43  SER A N   1 
ATOM   320  C CA  . SER A 1 43  ? 40.939 -13.231 13.811 1.00 17.05 ? 43  SER A CA  1 
ATOM   321  C C   . SER A 1 43  ? 40.296 -14.511 14.417 1.00 17.67 ? 43  SER A C   1 
ATOM   322  O O   . SER A 1 43  ? 41.072 -15.425 14.716 1.00 17.86 ? 43  SER A O   1 
ATOM   323  C CB  . SER A 1 43  ? 41.899 -13.637 12.710 1.00 22.78 ? 43  SER A CB  1 
ATOM   324  O OG  . SER A 1 43  ? 41.006 -14.095 11.671 1.00 29.74 ? 43  SER A OG  1 
ATOM   325  N N   . MET A 1 44  ? 39.049 -14.498 14.721 1.00 17.20 ? 44  MET A N   1 
ATOM   326  C CA  . MET A 1 44  ? 38.333 -15.618 15.318 1.00 16.35 ? 44  MET A CA  1 
ATOM   327  C C   . MET A 1 44  ? 37.821 -16.514 14.211 1.00 17.12 ? 44  MET A C   1 
ATOM   328  O O   . MET A 1 44  ? 37.032 -16.031 13.395 1.00 18.41 ? 44  MET A O   1 
ATOM   329  C CB  . MET A 1 44  ? 37.170 -15.085 16.174 1.00 17.68 ? 44  MET A CB  1 
ATOM   330  C CG  . MET A 1 44  ? 36.409 -16.275 16.729 1.00 18.37 ? 44  MET A CG  1 
ATOM   331  S SD  . MET A 1 44  ? 35.081 -15.732 17.740 1.00 23.81 ? 44  MET A SD  1 
ATOM   332  C CE  . MET A 1 44  ? 35.690 -14.949 19.168 1.00 18.90 ? 44  MET A CE  1 
ATOM   333  N N   . SER A 1 45  ? 38.307 -17.738 14.156 1.00 16.69 ? 45  SER A N   1 
ATOM   334  C CA  . SER A 1 45  ? 37.932 -18.741 13.167 1.00 17.88 ? 45  SER A CA  1 
ATOM   335  C C   . SER A 1 45  ? 36.990 -19.771 13.719 1.00 18.01 ? 45  SER A C   1 
ATOM   336  O O   . SER A 1 45  ? 37.162 -20.222 14.851 1.00 17.28 ? 45  SER A O   1 
ATOM   337  C CB  . SER A 1 45  ? 39.178 -19.506 12.631 1.00 19.31 ? 45  SER A CB  1 
ATOM   338  O OG  . SER A 1 45  ? 39.970 -18.579 11.880 1.00 22.68 ? 45  SER A OG  1 
ATOM   339  N N   . PHE A 1 46  ? 36.021 -20.125 12.916 1.00 20.01 ? 46  PHE A N   1 
ATOM   340  C CA  . PHE A 1 46  ? 35.013 -21.142 13.308 1.00 20.56 ? 46  PHE A CA  1 
ATOM   341  C C   . PHE A 1 46  ? 35.549 -22.484 12.835 1.00 22.29 ? 46  PHE A C   1 
ATOM   342  O O   . PHE A 1 46  ? 35.447 -22.755 11.636 1.00 24.54 ? 46  PHE A O   1 
ATOM   343  C CB  . PHE A 1 46  ? 33.600 -20.745 12.799 1.00 17.96 ? 46  PHE A CB  1 
ATOM   344  C CG  . PHE A 1 46  ? 33.185 -19.444 13.438 1.00 16.35 ? 46  PHE A CG  1 
ATOM   345  C CD1 . PHE A 1 46  ? 33.597 -18.266 12.882 1.00 17.17 ? 46  PHE A CD1 1 
ATOM   346  C CD2 . PHE A 1 46  ? 32.520 -19.440 14.670 1.00 15.84 ? 46  PHE A CD2 1 
ATOM   347  C CE1 . PHE A 1 46  ? 33.343 -17.041 13.449 1.00 17.27 ? 46  PHE A CE1 1 
ATOM   348  C CE2 . PHE A 1 46  ? 32.243 -18.226 15.277 1.00 17.90 ? 46  PHE A CE2 1 
ATOM   349  C CZ  . PHE A 1 46  ? 32.664 -17.017 14.676 1.00 17.65 ? 46  PHE A CZ  1 
ATOM   350  N N   . VAL A 1 47  ? 36.078 -23.293 13.740 1.00 22.89 ? 47  VAL A N   1 
ATOM   351  C CA  . VAL A 1 47  ? 36.700 -24.561 13.354 1.00 24.03 ? 47  VAL A CA  1 
ATOM   352  C C   . VAL A 1 47  ? 35.760 -25.720 13.609 1.00 27.43 ? 47  VAL A C   1 
ATOM   353  O O   . VAL A 1 47  ? 34.617 -25.524 14.085 1.00 26.58 ? 47  VAL A O   1 
ATOM   354  C CB  . VAL A 1 47  ? 38.037 -24.660 14.099 1.00 23.42 ? 47  VAL A CB  1 
ATOM   355  C CG1 . VAL A 1 47  ? 38.931 -23.466 13.808 1.00 21.88 ? 47  VAL A CG1 1 
ATOM   356  C CG2 . VAL A 1 47  ? 37.914 -24.844 15.607 1.00 20.44 ? 47  VAL A CG2 1 
ATOM   357  N N   . GLN A 1 48  ? 36.288 -26.886 13.336 1.00 29.32 ? 48  GLN A N   1 
ATOM   358  C CA  . GLN A 1 48  ? 35.530 -28.155 13.558 1.00 32.44 ? 48  GLN A CA  1 
ATOM   359  C C   . GLN A 1 48  ? 35.692 -28.554 15.009 1.00 33.85 ? 48  GLN A C   1 
ATOM   360  O O   . GLN A 1 48  ? 36.727 -28.297 15.656 1.00 32.53 ? 48  GLN A O   1 
ATOM   361  C CB  . GLN A 1 48  ? 36.171 -29.185 12.625 1.00 37.48 ? 48  GLN A CB  1 
ATOM   362  C CG  . GLN A 1 48  ? 35.702 -30.599 12.873 1.00 42.90 ? 48  GLN A CG  1 
ATOM   363  C CD  . GLN A 1 48  ? 36.590 -31.625 12.184 1.00 47.11 ? 48  GLN A CD  1 
ATOM   364  O OE1 . GLN A 1 48  ? 36.776 -31.565 10.960 1.00 48.63 ? 48  GLN A OE1 1 
ATOM   365  N NE2 . GLN A 1 48  ? 37.136 -32.484 13.061 1.00 47.58 ? 48  GLN A NE2 1 
ATOM   366  N N   . GLY A 1 49  ? 34.713 -29.236 15.571 1.00 36.18 ? 49  GLY A N   1 
ATOM   367  C CA  . GLY A 1 49  ? 34.723 -29.721 16.962 1.00 38.59 ? 49  GLY A CA  1 
ATOM   368  C C   . GLY A 1 49  ? 33.274 -29.994 17.364 1.00 40.92 ? 49  GLY A C   1 
ATOM   369  O O   . GLY A 1 49  ? 32.420 -30.029 16.466 1.00 41.74 ? 49  GLY A O   1 
ATOM   370  N N   . GLU A 1 50  ? 33.012 -30.109 18.636 1.00 43.12 ? 50  GLU A N   1 
ATOM   371  C CA  . GLU A 1 50  ? 31.652 -30.362 19.155 1.00 45.01 ? 50  GLU A CA  1 
ATOM   372  C C   . GLU A 1 50  ? 30.897 -29.042 19.423 1.00 45.36 ? 50  GLU A C   1 
ATOM   373  O O   . GLU A 1 50  ? 31.318 -28.317 20.370 1.00 45.84 ? 50  GLU A O   1 
ATOM   374  C CB  . GLU A 1 50  ? 31.840 -30.938 20.562 1.00 48.20 ? 50  GLU A CB  1 
ATOM   375  C CG  . GLU A 1 50  ? 32.722 -32.153 20.786 1.00 51.50 ? 50  GLU A CG  1 
ATOM   376  C CD  . GLU A 1 50  ? 32.902 -32.474 22.270 1.00 52.87 ? 50  GLU A CD  1 
ATOM   377  O OE1 . GLU A 1 50  ? 33.875 -32.039 22.881 1.00 48.75 ? 50  GLU A OE1 1 
ATOM   378  O OE2 . GLU A 1 50  ? 31.983 -33.172 22.779 1.00 55.53 ? 50  GLU A OE2 1 
ATOM   379  N N   . GLU A 1 51  ? 29.814 -28.776 18.711 1.00 44.57 ? 51  GLU A N   1 
ATOM   380  C CA  . GLU A 1 51  ? 29.033 -27.597 18.897 1.00 45.50 ? 51  GLU A CA  1 
ATOM   381  C C   . GLU A 1 51  ? 27.601 -27.848 19.417 1.00 44.90 ? 51  GLU A C   1 
ATOM   382  O O   . GLU A 1 51  ? 26.961 -28.843 19.163 1.00 45.37 ? 51  GLU A O   1 
ATOM   383  C CB  . GLU A 1 51  ? 28.870 -26.566 17.838 1.00 48.61 ? 51  GLU A CB  1 
ATOM   384  C CG  . GLU A 1 51  ? 28.206 -26.781 16.508 1.00 53.10 ? 51  GLU A CG  1 
ATOM   385  C CD  . GLU A 1 51  ? 27.908 -25.494 15.767 1.00 56.00 ? 51  GLU A CD  1 
ATOM   386  O OE1 . GLU A 1 51  ? 28.511 -25.133 14.783 1.00 57.77 ? 51  GLU A OE1 1 
ATOM   387  O OE2 . GLU A 1 51  ? 26.960 -24.851 16.316 1.00 57.61 ? 51  GLU A OE2 1 
ATOM   388  N N   . SER A 1 52  ? 27.127 -26.836 20.098 1.00 43.32 ? 52  SER A N   1 
ATOM   389  C CA  . SER A 1 52  ? 25.828 -26.649 20.738 1.00 44.73 ? 52  SER A CA  1 
ATOM   390  C C   . SER A 1 52  ? 25.340 -25.235 20.403 1.00 45.87 ? 52  SER A C   1 
ATOM   391  O O   . SER A 1 52  ? 26.089 -24.441 19.757 1.00 46.37 ? 52  SER A O   1 
ATOM   392  C CB  . SER A 1 52  ? 25.962 -26.829 22.239 1.00 45.31 ? 52  SER A CB  1 
ATOM   393  O OG  . SER A 1 52  ? 24.798 -26.349 22.909 1.00 48.04 ? 52  SER A OG  1 
ATOM   394  N N   . ASN A 1 53  ? 24.126 -24.916 20.829 1.00 46.56 ? 53  ASN A N   1 
ATOM   395  C CA  . ASN A 1 53  ? 23.561 -23.578 20.540 1.00 47.39 ? 53  ASN A CA  1 
ATOM   396  C C   . ASN A 1 53  ? 24.427 -22.531 21.299 1.00 46.45 ? 53  ASN A C   1 
ATOM   397  O O   . ASN A 1 53  ? 24.632 -21.412 20.845 1.00 46.63 ? 53  ASN A O   1 
ATOM   398  C CB  . ASN A 1 53  ? 22.094 -23.412 20.772 1.00 50.54 ? 53  ASN A CB  1 
ATOM   399  C CG  . ASN A 1 53  ? 21.130 -24.163 19.899 1.00 53.35 ? 53  ASN A CG  1 
ATOM   400  O OD1 . ASN A 1 53  ? 21.369 -24.435 18.691 1.00 55.33 ? 53  ASN A OD1 1 
ATOM   401  N ND2 . ASN A 1 53  ? 19.978 -24.520 20.507 1.00 54.88 ? 53  ASN A ND2 1 
ATOM   402  N N   . ASP A 1 54  ? 24.860 -22.994 22.437 1.00 44.96 ? 54  ASP A N   1 
ATOM   403  C CA  . ASP A 1 54  ? 25.689 -22.436 23.436 1.00 42.62 ? 54  ASP A CA  1 
ATOM   404  C C   . ASP A 1 54  ? 27.207 -22.539 23.361 1.00 38.76 ? 54  ASP A C   1 
ATOM   405  O O   . ASP A 1 54  ? 27.797 -21.655 24.029 1.00 39.31 ? 54  ASP A O   1 
ATOM   406  C CB  . ASP A 1 54  ? 25.297 -23.043 24.829 1.00 44.89 ? 54  ASP A CB  1 
ATOM   407  C CG  . ASP A 1 54  ? 24.193 -22.217 25.427 1.00 48.08 ? 54  ASP A CG  1 
ATOM   408  O OD1 . ASP A 1 54  ? 23.837 -21.200 24.789 1.00 49.76 ? 54  ASP A OD1 1 
ATOM   409  O OD2 . ASP A 1 54  ? 23.861 -22.584 26.592 1.00 49.39 ? 54  ASP A OD2 1 
ATOM   410  N N   . LYS A 1 55  ? 27.752 -23.601 22.848 1.00 34.98 ? 55  LYS A N   1 
ATOM   411  C CA  . LYS A 1 55  ? 29.135 -23.858 22.684 1.00 31.83 ? 55  LYS A CA  1 
ATOM   412  C C   . LYS A 1 55  ? 29.537 -23.898 21.208 1.00 29.31 ? 55  LYS A C   1 
ATOM   413  O O   . LYS A 1 55  ? 29.106 -24.840 20.532 1.00 32.37 ? 55  LYS A O   1 
ATOM   414  C CB  . LYS A 1 55  ? 29.780 -25.144 23.213 1.00 31.74 ? 55  LYS A CB  1 
ATOM   415  C CG  . LYS A 1 55  ? 30.051 -25.153 24.668 1.00 33.77 ? 55  LYS A CG  1 
ATOM   416  C CD  . LYS A 1 55  ? 30.694 -26.436 25.213 1.00 34.11 ? 55  LYS A CD  1 
ATOM   417  C CE  . LYS A 1 55  ? 31.059 -26.175 26.675 1.00 32.69 ? 55  LYS A CE  1 
ATOM   418  N NZ  . LYS A 1 55  ? 31.768 -27.288 27.305 1.00 30.06 ? 55  LYS A NZ  1 
ATOM   419  N N   . ILE A 1 56  ? 30.411 -22.993 20.882 1.00 24.23 ? 56  ILE A N   1 
ATOM   420  C CA  . ILE A 1 56  ? 30.965 -22.949 19.508 1.00 22.23 ? 56  ILE A CA  1 
ATOM   421  C C   . ILE A 1 56  ? 32.490 -23.016 19.546 1.00 20.73 ? 56  ILE A C   1 
ATOM   422  O O   . ILE A 1 56  ? 33.118 -22.164 20.199 1.00 17.92 ? 56  ILE A O   1 
ATOM   423  C CB  . ILE A 1 56  ? 30.347 -21.684 18.814 1.00 20.88 ? 56  ILE A CB  1 
ATOM   424  C CG1 . ILE A 1 56  ? 28.805 -22.068 18.885 1.00 25.42 ? 56  ILE A CG1 1 
ATOM   425  C CG2 . ILE A 1 56  ? 30.854 -21.448 17.395 1.00 19.43 ? 56  ILE A CG2 1 
ATOM   426  C CD1 . ILE A 1 56  ? 27.782 -21.115 18.344 1.00 27.53 ? 56  ILE A CD1 1 
ATOM   427  N N   . PRO A 1 57  ? 33.050 -24.038 18.935 1.00 19.61 ? 57  PRO A N   1 
ATOM   428  C CA  . PRO A 1 57  ? 34.514 -24.174 18.860 1.00 19.06 ? 57  PRO A CA  1 
ATOM   429  C C   . PRO A 1 57  ? 35.113 -23.104 17.942 1.00 18.98 ? 57  PRO A C   1 
ATOM   430  O O   . PRO A 1 57  ? 34.655 -22.919 16.797 1.00 20.07 ? 57  PRO A O   1 
ATOM   431  C CB  . PRO A 1 57  ? 34.708 -25.601 18.337 1.00 19.51 ? 57  PRO A CB  1 
ATOM   432  C CG  . PRO A 1 57  ? 33.423 -26.001 17.699 1.00 19.58 ? 57  PRO A CG  1 
ATOM   433  C CD  . PRO A 1 57  ? 32.331 -25.099 18.202 1.00 18.65 ? 57  PRO A CD  1 
ATOM   434  N N   . VAL A 1 58  ? 36.149 -22.383 18.470 1.00 15.91 ? 58  VAL A N   1 
ATOM   435  C CA  . VAL A 1 58  ? 36.833 -21.376 17.703 1.00 13.31 ? 58  VAL A CA  1 
ATOM   436  C C   . VAL A 1 58  ? 38.364 -21.548 17.962 1.00 14.50 ? 58  VAL A C   1 
ATOM   437  O O   . VAL A 1 58  ? 38.776 -22.191 18.893 1.00 13.52 ? 58  VAL A O   1 
ATOM   438  C CB  . VAL A 1 58  ? 36.407 -19.938 18.022 1.00 12.44 ? 58  VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 58  ? 34.882 -19.654 17.697 1.00 10.95 ? 58  VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 58  ? 36.698 -19.494 19.434 1.00 9.13  ? 58  VAL A CG2 1 
ATOM   441  N N   . ALA A 1 59  ? 39.046 -20.875 17.066 1.00 13.60 ? 59  ALA A N   1 
ATOM   442  C CA  . ALA A 1 59  ? 40.501 -20.678 17.107 1.00 13.62 ? 59  ALA A CA  1 
ATOM   443  C C   . ALA A 1 59  ? 40.701 -19.174 17.173 1.00 12.88 ? 59  ALA A C   1 
ATOM   444  O O   . ALA A 1 59  ? 39.909 -18.422 16.535 1.00 13.63 ? 59  ALA A O   1 
ATOM   445  C CB  . ALA A 1 59  ? 41.223 -21.419 16.055 1.00 12.48 ? 59  ALA A CB  1 
ATOM   446  N N   . LEU A 1 60  ? 41.615 -18.681 17.978 1.00 12.73 ? 60  LEU A N   1 
ATOM   447  C CA  . LEU A 1 60  ? 41.895 -17.288 18.156 1.00 12.16 ? 60  LEU A CA  1 
ATOM   448  C C   . LEU A 1 60  ? 43.289 -16.955 17.681 1.00 14.08 ? 60  LEU A C   1 
ATOM   449  O O   . LEU A 1 60  ? 44.215 -17.254 18.448 1.00 14.47 ? 60  LEU A O   1 
ATOM   450  C CB  . LEU A 1 60  ? 41.742 -16.915 19.676 1.00 10.19 ? 60  LEU A CB  1 
ATOM   451  C CG  . LEU A 1 60  ? 40.288 -17.111 20.181 1.00 13.38 ? 60  LEU A CG  1 
ATOM   452  C CD1 . LEU A 1 60  ? 40.198 -16.959 21.646 1.00 11.97 ? 60  LEU A CD1 1 
ATOM   453  C CD2 . LEU A 1 60  ? 39.484 -15.982 19.413 1.00 13.89 ? 60  LEU A CD2 1 
ATOM   454  N N   . GLY A 1 61  ? 43.439 -16.326 16.552 1.00 15.73 ? 61  GLY A N   1 
ATOM   455  C CA  . GLY A 1 61  ? 44.813 -15.937 16.097 1.00 16.96 ? 61  GLY A CA  1 
ATOM   456  C C   . GLY A 1 61  ? 44.873 -14.396 16.118 1.00 17.78 ? 61  GLY A C   1 
ATOM   457  O O   . GLY A 1 61  ? 43.834 -13.736 16.382 1.00 18.84 ? 61  GLY A O   1 
ATOM   458  N N   . LEU A 1 62  ? 46.039 -13.833 15.955 1.00 17.19 ? 62  LEU A N   1 
ATOM   459  C CA  . LEU A 1 62  ? 46.215 -12.412 15.899 1.00 19.57 ? 62  LEU A CA  1 
ATOM   460  C C   . LEU A 1 62  ? 45.949 -12.080 14.413 1.00 20.75 ? 62  LEU A C   1 
ATOM   461  O O   . LEU A 1 62  ? 46.405 -12.799 13.500 1.00 21.55 ? 62  LEU A O   1 
ATOM   462  C CB  . LEU A 1 62  ? 47.451 -11.845 16.485 1.00 20.01 ? 62  LEU A CB  1 
ATOM   463  C CG  . LEU A 1 62  ? 47.817 -12.260 17.887 1.00 22.44 ? 62  LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 62  ? 48.949 -11.362 18.404 1.00 22.89 ? 62  LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 62  ? 46.664 -12.410 18.784 1.00 23.85 ? 62  LEU A CD2 1 
ATOM   466  N N   . LYS A 1 63  ? 45.207 -11.043 14.260 1.00 21.91 ? 63  LYS A N   1 
ATOM   467  C CA  . LYS A 1 63  ? 44.791 -10.587 12.907 1.00 24.86 ? 63  LYS A CA  1 
ATOM   468  C C   A LYS A 1 63  ? 46.113 -10.196 12.188 0.60 24.91 ? 63  LYS A C   1 
ATOM   469  C C   B LYS A 1 63  ? 45.805 -10.527 11.824 0.40 25.61 ? 63  LYS A C   1 
ATOM   470  O O   A LYS A 1 63  ? 46.853 -9.376  12.730 0.60 24.50 ? 63  LYS A O   1 
ATOM   471  O O   B LYS A 1 63  ? 45.555 -11.109 10.728 0.40 25.86 ? 63  LYS A O   1 
ATOM   472  C CB  . LYS A 1 63  ? 44.011 -9.282  12.998 1.00 27.51 ? 63  LYS A CB  1 
ATOM   473  C CG  . LYS A 1 63  ? 43.507 -8.950  11.529 1.00 30.75 ? 63  LYS A CG  1 
ATOM   474  C CD  . LYS A 1 63  ? 43.241 -7.458  11.614 1.00 33.08 ? 63  LYS A CD  1 
ATOM   475  C CE  . LYS A 1 63  ? 43.179 -6.788  10.259 1.00 36.63 ? 63  LYS A CE  1 
ATOM   476  N NZ  . LYS A 1 63  ? 43.317 -5.293  10.627 1.00 39.54 ? 63  LYS A NZ  1 
ATOM   477  N N   A GLU A 1 64  ? 46.396 -10.762 11.038 0.60 26.39 ? 64  GLU A N   1 
ATOM   478  N N   B GLU A 1 64  ? 46.934 -9.893  12.047 0.40 26.78 ? 64  GLU A N   1 
ATOM   479  C CA  A GLU A 1 64  ? 47.577 -10.579 10.278 0.60 28.87 ? 64  GLU A CA  1 
ATOM   480  C CA  B GLU A 1 64  ? 47.936 -9.755  10.979 0.40 28.91 ? 64  GLU A CA  1 
ATOM   481  C C   A GLU A 1 64  ? 48.920 -11.100 10.772 0.60 28.76 ? 64  GLU A C   1 
ATOM   482  C C   B GLU A 1 64  ? 49.069 -10.749 10.988 0.40 28.86 ? 64  GLU A C   1 
ATOM   483  O O   A GLU A 1 64  ? 49.957 -10.687 10.176 0.60 28.92 ? 64  GLU A O   1 
ATOM   484  O O   B GLU A 1 64  ? 49.832 -10.890 10.008 0.40 28.99 ? 64  GLU A O   1 
ATOM   485  C CB  A GLU A 1 64  ? 47.898 -9.354  9.485  0.60 32.21 ? 64  GLU A CB  1 
ATOM   486  C CB  B GLU A 1 64  ? 48.549 -8.358  11.160 0.40 32.00 ? 64  GLU A CB  1 
ATOM   487  C CG  A GLU A 1 64  ? 47.489 -9.106  8.111  0.60 36.23 ? 64  GLU A CG  1 
ATOM   488  C CG  B GLU A 1 64  ? 47.468 -7.261  11.370 0.40 35.88 ? 64  GLU A CG  1 
ATOM   489  C CD  A GLU A 1 64  ? 46.139 -8.990  7.583  0.60 39.21 ? 64  GLU A CD  1 
ATOM   490  C CD  B GLU A 1 64  ? 48.124 -5.924  11.106 0.40 38.96 ? 64  GLU A CD  1 
ATOM   491  O OE1 A GLU A 1 64  ? 45.545 -9.893  6.997  0.60 41.34 ? 64  GLU A OE1 1 
ATOM   492  O OE1 B GLU A 1 64  ? 49.140 -5.563  11.655 0.40 40.78 ? 64  GLU A OE1 1 
ATOM   493  O OE2 A GLU A 1 64  ? 45.735 -7.815  7.767  0.60 39.71 ? 64  GLU A OE2 1 
ATOM   494  O OE2 B GLU A 1 64  ? 47.539 -5.374  10.163 0.40 40.53 ? 64  GLU A OE2 1 
ATOM   495  N N   A LYS A 1 65  ? 48.949 -11.897 11.807 0.60 28.06 ? 65  LYS A N   1 
ATOM   496  N N   B LYS A 1 65  ? 49.133 -11.513 12.057 0.40 28.33 ? 65  LYS A N   1 
ATOM   497  C CA  . LYS A 1 65  ? 50.174 -12.467 12.377 1.00 26.58 ? 65  LYS A CA  1 
ATOM   498  C C   . LYS A 1 65  ? 49.914 -13.938 12.431 1.00 25.23 ? 65  LYS A C   1 
ATOM   499  O O   . LYS A 1 65  ? 48.775 -14.351 12.726 1.00 24.70 ? 65  LYS A O   1 
ATOM   500  C CB  . LYS A 1 65  ? 50.564 -12.011 13.808 1.00 26.21 ? 65  LYS A CB  1 
ATOM   501  C CG  . LYS A 1 65  ? 50.925 -10.533 13.818 1.00 28.24 ? 65  LYS A CG  1 
ATOM   502  C CD  . LYS A 1 65  ? 51.434 -10.058 15.137 1.00 30.49 ? 65  LYS A CD  1 
ATOM   503  C CE  . LYS A 1 65  ? 52.086 -8.683  15.057 1.00 33.55 ? 65  LYS A CE  1 
ATOM   504  N NZ  . LYS A 1 65  ? 53.303 -8.717  14.161 1.00 35.76 ? 65  LYS A NZ  1 
ATOM   505  N N   . ASN A 1 66  ? 50.893 -14.707 12.031 1.00 21.67 ? 66  ASN A N   1 
ATOM   506  C CA  . ASN A 1 66  ? 50.764 -16.178 12.078 1.00 20.22 ? 66  ASN A CA  1 
ATOM   507  C C   . ASN A 1 66  ? 50.979 -16.546 13.549 1.00 18.24 ? 66  ASN A C   1 
ATOM   508  O O   . ASN A 1 66  ? 51.965 -17.233 13.741 1.00 19.17 ? 66  ASN A O   1 
ATOM   509  C CB  . ASN A 1 66  ? 51.747 -16.824 11.112 1.00 20.08 ? 66  ASN A CB  1 
ATOM   510  C CG  . ASN A 1 66  ? 53.188 -16.381 11.333 1.00 21.06 ? 66  ASN A CG  1 
ATOM   511  O OD1 . ASN A 1 66  ? 53.496 -15.214 11.534 1.00 23.35 ? 66  ASN A OD1 1 
ATOM   512  N ND2 . ASN A 1 66  ? 54.158 -17.256 11.361 1.00 20.37 ? 66  ASN A ND2 1 
ATOM   513  N N   . LEU A 1 67  ? 50.213 -16.076 14.487 1.00 18.52 ? 67  LEU A N   1 
ATOM   514  C CA  . LEU A 1 67  ? 50.298 -16.317 15.918 1.00 16.87 ? 67  LEU A CA  1 
ATOM   515  C C   . LEU A 1 67  ? 48.921 -16.707 16.484 1.00 16.32 ? 67  LEU A C   1 
ATOM   516  O O   . LEU A 1 67  ? 47.938 -15.978 16.263 1.00 16.56 ? 67  LEU A O   1 
ATOM   517  C CB  . LEU A 1 67  ? 50.914 -15.191 16.700 1.00 15.93 ? 67  LEU A CB  1 
ATOM   518  C CG  . LEU A 1 67  ? 52.340 -14.770 16.626 1.00 18.42 ? 67  LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 67  ? 52.562 -13.432 17.352 1.00 19.50 ? 67  LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 67  ? 53.251 -15.796 17.294 1.00 17.21 ? 67  LEU A CD2 1 
ATOM   521  N N   . TYR A 1 68  ? 48.884 -17.813 17.200 1.00 14.54 ? 68  TYR A N   1 
ATOM   522  C CA  . TYR A 1 68  ? 47.649 -18.314 17.761 1.00 14.29 ? 68  TYR A CA  1 
ATOM   523  C C   . TYR A 1 68  ? 47.729 -18.642 19.225 1.00 13.98 ? 68  TYR A C   1 
ATOM   524  O O   . TYR A 1 68  ? 48.789 -19.099 19.657 1.00 15.44 ? 68  TYR A O   1 
ATOM   525  C CB  . TYR A 1 68  ? 47.317 -19.686 17.058 1.00 15.23 ? 68  TYR A CB  1 
ATOM   526  C CG  . TYR A 1 68  ? 46.770 -19.378 15.694 1.00 18.02 ? 68  TYR A CG  1 
ATOM   527  C CD1 . TYR A 1 68  ? 47.640 -19.211 14.609 1.00 20.45 ? 68  TYR A CD1 1 
ATOM   528  C CD2 . TYR A 1 68  ? 45.391 -19.314 15.491 1.00 17.20 ? 68  TYR A CD2 1 
ATOM   529  C CE1 . TYR A 1 68  ? 47.117 -18.882 13.360 1.00 22.23 ? 68  TYR A CE1 1 
ATOM   530  C CE2 . TYR A 1 68  ? 44.880 -19.008 14.242 1.00 21.18 ? 68  TYR A CE2 1 
ATOM   531  C CZ  . TYR A 1 68  ? 45.735 -18.799 13.191 1.00 23.02 ? 68  TYR A CZ  1 
ATOM   532  O OH  . TYR A 1 68  ? 45.227 -18.466 11.967 1.00 27.12 ? 68  TYR A OH  1 
ATOM   533  N N   . LEU A 1 69  ? 46.614 -18.429 19.905 1.00 13.13 ? 69  LEU A N   1 
ATOM   534  C CA  . LEU A 1 69  ? 46.534 -18.832 21.328 1.00 11.44 ? 69  LEU A CA  1 
ATOM   535  C C   . LEU A 1 69  ? 46.407 -20.396 21.324 1.00 10.91 ? 69  LEU A C   1 
ATOM   536  O O   . LEU A 1 69  ? 45.597 -20.909 20.519 1.00 9.90  ? 69  LEU A O   1 
ATOM   537  C CB  . LEU A 1 69  ? 45.398 -18.152 22.040 1.00 13.64 ? 69  LEU A CB  1 
ATOM   538  C CG  . LEU A 1 69  ? 45.536 -16.669 22.500 1.00 13.35 ? 69  LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 69  ? 45.917 -15.870 21.236 1.00 19.44 ? 69  LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 69  ? 44.083 -16.199 22.761 1.00 13.88 ? 69  LEU A CD2 1 
ATOM   541  N N   . SER A 1 70  ? 47.115 -21.035 22.208 1.00 12.17 ? 70  SER A N   1 
ATOM   542  C CA  . SER A 1 70  ? 47.071 -22.477 22.327 1.00 13.81 ? 70  SER A CA  1 
ATOM   543  C C   . SER A 1 70  ? 47.256 -22.771 23.829 1.00 14.86 ? 70  SER A C   1 
ATOM   544  O O   . SER A 1 70  ? 47.627 -21.864 24.539 1.00 16.12 ? 70  SER A O   1 
ATOM   545  C CB  . SER A 1 70  ? 48.082 -23.262 21.527 1.00 16.15 ? 70  SER A CB  1 
ATOM   546  O OG  . SER A 1 70  ? 49.331 -23.003 21.897 1.00 21.53 ? 70  SER A OG  1 
ATOM   547  N N   . CYS A 1 71  ? 46.794 -23.927 24.193 1.00 15.10 ? 71  CYS A N   1 
ATOM   548  C CA  . CYS A 1 71  ? 46.826 -24.431 25.575 1.00 16.52 ? 71  CYS A CA  1 
ATOM   549  C C   . CYS A 1 71  ? 47.754 -25.649 25.645 1.00 15.40 ? 71  CYS A C   1 
ATOM   550  O O   . CYS A 1 71  ? 47.541 -26.581 24.868 1.00 17.29 ? 71  CYS A O   1 
ATOM   551  C CB  . CYS A 1 71  ? 45.370 -24.879 25.931 1.00 17.86 ? 71  CYS A CB  1 
ATOM   552  S SG  . CYS A 1 71  ? 44.229 -23.464 25.779 1.00 19.96 ? 71  CYS A SG  1 
ATOM   553  N N   . VAL A 1 72  ? 48.744 -25.602 26.509 1.00 16.30 ? 72  VAL A N   1 
ATOM   554  C CA  . VAL A 1 72  ? 49.656 -26.738 26.615 1.00 19.43 ? 72  VAL A CA  1 
ATOM   555  C C   . VAL A 1 72  ? 50.014 -26.902 28.072 1.00 20.66 ? 72  VAL A C   1 
ATOM   556  O O   . VAL A 1 72  ? 49.881 -25.925 28.763 1.00 19.83 ? 72  VAL A O   1 
ATOM   557  C CB  . VAL A 1 72  ? 50.972 -26.409 25.789 1.00 20.94 ? 72  VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 72  ? 50.625 -26.273 24.327 1.00 22.55 ? 72  VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 72  ? 51.609 -25.169 26.342 1.00 21.65 ? 72  VAL A CG2 1 
ATOM   560  N N   . LEU A 1 73  ? 50.432 -28.108 28.438 1.00 22.92 ? 73  LEU A N   1 
ATOM   561  C CA  . LEU A 1 73  ? 50.877 -28.319 29.826 1.00 24.95 ? 73  LEU A CA  1 
ATOM   562  C C   . LEU A 1 73  ? 52.289 -27.734 29.912 1.00 28.23 ? 73  LEU A C   1 
ATOM   563  O O   . LEU A 1 73  ? 53.047 -27.948 28.991 1.00 28.68 ? 73  LEU A O   1 
ATOM   564  C CB  . LEU A 1 73  ? 50.948 -29.810 30.124 1.00 26.98 ? 73  LEU A CB  1 
ATOM   565  C CG  . LEU A 1 73  ? 49.729 -30.579 30.433 1.00 29.06 ? 73  LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 73  ? 50.010 -32.058 30.675 1.00 30.53 ? 73  LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 73  ? 49.153 -29.935 31.723 1.00 29.74 ? 73  LEU A CD2 1 
ATOM   568  N N   . LYS A 1 74  ? 52.630 -27.098 30.955 1.00 31.63 ? 74  LYS A N   1 
ATOM   569  C CA  . LYS A 1 74  ? 53.927 -26.536 31.272 1.00 36.67 ? 74  LYS A CA  1 
ATOM   570  C C   . LYS A 1 74  ? 54.096 -26.759 32.771 1.00 39.76 ? 74  LYS A C   1 
ATOM   571  O O   . LYS A 1 74  ? 53.358 -26.052 33.497 1.00 41.14 ? 74  LYS A O   1 
ATOM   572  C CB  . LYS A 1 74  ? 54.163 -25.093 31.016 1.00 40.74 ? 74  LYS A CB  1 
ATOM   573  C CG  . LYS A 1 74  ? 54.486 -24.617 29.607 1.00 45.14 ? 74  LYS A CG  1 
ATOM   574  C CD  . LYS A 1 74  ? 54.681 -23.082 29.663 1.00 49.10 ? 74  LYS A CD  1 
ATOM   575  C CE  . LYS A 1 74  ? 55.729 -22.651 30.678 1.00 51.76 ? 74  LYS A CE  1 
ATOM   576  N NZ  . LYS A 1 74  ? 55.708 -21.137 30.864 1.00 53.52 ? 74  LYS A NZ  1 
ATOM   577  N N   . ASP A 1 75  ? 54.909 -27.733 33.139 1.00 41.66 ? 75  ASP A N   1 
ATOM   578  C CA  . ASP A 1 75  ? 55.072 -27.963 34.605 1.00 43.34 ? 75  ASP A CA  1 
ATOM   579  C C   . ASP A 1 75  ? 53.804 -28.548 35.180 1.00 42.93 ? 75  ASP A C   1 
ATOM   580  O O   . ASP A 1 75  ? 53.359 -28.133 36.288 1.00 44.09 ? 75  ASP A O   1 
ATOM   581  C CB  . ASP A 1 75  ? 55.563 -26.726 35.325 1.00 49.03 ? 75  ASP A CB  1 
ATOM   582  C CG  . ASP A 1 75  ? 56.930 -26.201 34.969 1.00 54.14 ? 75  ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 75  ? 57.755 -26.777 34.195 1.00 55.89 ? 75  ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 75  ? 57.239 -25.094 35.530 1.00 56.14 ? 75  ASP A OD2 1 
ATOM   585  N N   . ASP A 1 76  ? 53.226 -29.484 34.450 1.00 41.43 ? 76  ASP A N   1 
ATOM   586  C CA  . ASP A 1 76  ? 52.037 -30.221 34.925 1.00 40.54 ? 76  ASP A CA  1 
ATOM   587  C C   . ASP A 1 76  ? 50.816 -29.401 35.202 1.00 38.45 ? 76  ASP A C   1 
ATOM   588  O O   . ASP A 1 76  ? 49.996 -29.776 36.072 1.00 38.29 ? 76  ASP A O   1 
ATOM   589  C CB  . ASP A 1 76  ? 52.507 -31.047 36.196 1.00 43.47 ? 76  ASP A CB  1 
ATOM   590  C CG  . ASP A 1 76  ? 53.784 -31.786 35.676 1.00 46.52 ? 76  ASP A CG  1 
ATOM   591  O OD1 . ASP A 1 76  ? 53.659 -32.737 34.865 1.00 44.07 ? 76  ASP A OD1 1 
ATOM   592  O OD2 . ASP A 1 76  ? 54.895 -31.240 35.985 1.00 48.08 ? 76  ASP A OD2 1 
ATOM   593  N N   . LYS A 1 77  ? 50.695 -28.315 34.448 1.00 36.77 ? 77  LYS A N   1 
ATOM   594  C CA  . LYS A 1 77  ? 49.543 -27.425 34.518 1.00 33.88 ? 77  LYS A CA  1 
ATOM   595  C C   . LYS A 1 77  ? 49.289 -26.831 33.078 1.00 29.78 ? 77  LYS A C   1 
ATOM   596  O O   . LYS A 1 77  ? 50.234 -26.399 32.446 1.00 28.58 ? 77  LYS A O   1 
ATOM   597  C CB  . LYS A 1 77  ? 49.658 -26.221 35.325 1.00 37.79 ? 77  LYS A CB  1 
ATOM   598  C CG  . LYS A 1 77  ? 49.959 -25.900 36.717 1.00 41.27 ? 77  LYS A CG  1 
ATOM   599  C CD  . LYS A 1 77  ? 49.665 -24.378 36.929 1.00 43.01 ? 77  LYS A CD  1 
ATOM   600  C CE  . LYS A 1 77  ? 48.175 -24.136 36.576 1.00 43.74 ? 77  LYS A CE  1 
ATOM   601  N NZ  . LYS A 1 77  ? 47.852 -22.700 36.833 1.00 43.38 ? 77  LYS A NZ  1 
ATOM   602  N N   . PRO A 1 78  ? 47.992 -26.681 32.875 1.00 26.96 ? 78  PRO A N   1 
ATOM   603  C CA  . PRO A 1 78  ? 47.472 -26.074 31.627 1.00 24.80 ? 78  PRO A CA  1 
ATOM   604  C C   . PRO A 1 78  ? 47.949 -24.603 31.698 1.00 22.09 ? 78  PRO A C   1 
ATOM   605  O O   . PRO A 1 78  ? 47.822 -23.971 32.743 1.00 22.52 ? 78  PRO A O   1 
ATOM   606  C CB  . PRO A 1 78  ? 45.955 -26.183 31.712 1.00 24.20 ? 78  PRO A CB  1 
ATOM   607  C CG  . PRO A 1 78  ? 45.791 -27.399 32.648 1.00 24.83 ? 78  PRO A CG  1 
ATOM   608  C CD  . PRO A 1 78  ? 46.875 -27.141 33.696 1.00 25.54 ? 78  PRO A CD  1 
ATOM   609  N N   . THR A 1 79  ? 48.468 -24.167 30.570 1.00 19.37 ? 79  THR A N   1 
ATOM   610  C CA  . THR A 1 79  ? 49.003 -22.843 30.386 1.00 19.54 ? 79  THR A CA  1 
ATOM   611  C C   . THR A 1 79  ? 48.571 -22.300 29.009 1.00 18.02 ? 79  THR A C   1 
ATOM   612  O O   . THR A 1 79  ? 48.688 -23.112 28.067 1.00 17.83 ? 79  THR A O   1 
ATOM   613  C CB  . THR A 1 79  ? 50.600 -22.922 30.343 1.00 22.70 ? 79  THR A CB  1 
ATOM   614  O OG1 . THR A 1 79  ? 50.997 -23.416 31.673 1.00 26.29 ? 79  THR A OG1 1 
ATOM   615  C CG2 . THR A 1 79  ? 51.278 -21.593 30.098 1.00 23.86 ? 79  THR A CG2 1 
ATOM   616  N N   . LEU A 1 80  ? 48.276 -21.050 28.938 1.00 17.86 ? 80  LEU A N   1 
ATOM   617  C CA  . LEU A 1 80  ? 47.931 -20.347 27.711 1.00 17.09 ? 80  LEU A CA  1 
ATOM   618  C C   . LEU A 1 80  ? 49.209 -19.816 27.070 1.00 17.81 ? 80  LEU A C   1 
ATOM   619  O O   . LEU A 1 80  ? 49.962 -19.197 27.804 1.00 18.61 ? 80  LEU A O   1 
ATOM   620  C CB  . LEU A 1 80  ? 47.122 -19.037 28.096 1.00 13.83 ? 80  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 80  ? 46.625 -18.270 26.903 1.00 12.40 ? 80  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 80  ? 45.719 -19.164 26.083 1.00 12.09 ? 80  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 80  ? 45.861 -16.991 27.240 1.00 11.96 ? 80  LEU A CD2 1 
ATOM   624  N N   . GLN A 1 81  ? 49.410 -20.029 25.768 1.00 18.82 ? 81  GLN A N   1 
ATOM   625  C CA  . GLN A 1 81  ? 50.630 -19.366 25.195 1.00 18.95 ? 81  GLN A CA  1 
ATOM   626  C C   . GLN A 1 81  ? 50.257 -18.928 23.773 1.00 17.41 ? 81  GLN A C   1 
ATOM   627  O O   . GLN A 1 81  ? 49.230 -19.335 23.264 1.00 16.20 ? 81  GLN A O   1 
ATOM   628  C CB  . GLN A 1 81  ? 51.797 -20.284 25.051 1.00 21.56 ? 81  GLN A CB  1 
ATOM   629  C CG  . GLN A 1 81  ? 51.494 -21.451 24.150 1.00 27.39 ? 81  GLN A CG  1 
ATOM   630  C CD  . GLN A 1 81  ? 52.782 -22.276 23.965 1.00 31.93 ? 81  GLN A CD  1 
ATOM   631  O OE1 . GLN A 1 81  ? 53.709 -22.106 24.788 1.00 33.34 ? 81  GLN A OE1 1 
ATOM   632  N NE2 . GLN A 1 81  ? 52.743 -23.103 22.916 1.00 32.73 ? 81  GLN A NE2 1 
ATOM   633  N N   . LEU A 1 82  ? 51.142 -18.161 23.208 1.00 17.55 ? 82  LEU A N   1 
ATOM   634  C CA  . LEU A 1 82  ? 50.981 -17.697 21.814 1.00 17.09 ? 82  LEU A CA  1 
ATOM   635  C C   . LEU A 1 82  ? 51.930 -18.619 21.030 1.00 16.61 ? 82  LEU A C   1 
ATOM   636  O O   . LEU A 1 82  ? 53.030 -18.707 21.537 1.00 17.23 ? 82  LEU A O   1 
ATOM   637  C CB  . LEU A 1 82  ? 51.298 -16.246 21.624 1.00 18.32 ? 82  LEU A CB  1 
ATOM   638  C CG  . LEU A 1 82  ? 50.223 -15.280 22.031 1.00 19.55 ? 82  LEU A CG  1 
ATOM   639  C CD1 . LEU A 1 82  ? 50.722 -13.838 21.774 1.00 23.48 ? 82  LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1 82  ? 49.098 -15.506 21.007 1.00 19.13 ? 82  LEU A CD2 1 
ATOM   641  N N   . GLU A 1 83  ? 51.452 -19.123 19.931 1.00 15.66 ? 83  GLU A N   1 
ATOM   642  C CA  . GLU A 1 83  ? 52.411 -20.029 19.216 1.00 16.94 ? 83  GLU A CA  1 
ATOM   643  C C   . GLU A 1 83  ? 52.464 -19.579 17.789 1.00 16.35 ? 83  GLU A C   1 
ATOM   644  O O   . GLU A 1 83  ? 51.455 -19.074 17.316 1.00 16.47 ? 83  GLU A O   1 
ATOM   645  C CB  . GLU A 1 83  ? 51.768 -21.387 19.368 1.00 18.96 ? 83  GLU A CB  1 
ATOM   646  C CG  . GLU A 1 83  ? 52.401 -22.653 18.898 1.00 22.72 ? 83  GLU A CG  1 
ATOM   647  C CD  . GLU A 1 83  ? 51.732 -23.947 19.111 1.00 23.95 ? 83  GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 83  ? 51.127 -24.282 20.098 1.00 25.94 ? 83  GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 83  ? 51.842 -24.684 18.154 1.00 25.89 ? 83  GLU A OE2 1 
ATOM   650  N N   . SER A 1 84  ? 53.579 -19.680 17.156 1.00 17.52 ? 84  SER A N   1 
ATOM   651  C CA  . SER A 1 84  ? 53.797 -19.337 15.736 1.00 16.89 ? 84  SER A CA  1 
ATOM   652  C C   . SER A 1 84  ? 53.392 -20.582 14.942 1.00 19.69 ? 84  SER A C   1 
ATOM   653  O O   . SER A 1 84  ? 53.692 -21.674 15.465 1.00 20.02 ? 84  SER A O   1 
ATOM   654  C CB  . SER A 1 84  ? 55.333 -19.306 15.575 1.00 19.87 ? 84  SER A CB  1 
ATOM   655  O OG  . SER A 1 84  ? 55.769 -18.200 16.278 1.00 25.28 ? 84  SER A OG  1 
ATOM   656  N N   . VAL A 1 85  ? 52.857 -20.390 13.753 1.00 20.77 ? 85  VAL A N   1 
ATOM   657  C CA  . VAL A 1 85  ? 52.447 -21.496 12.876 1.00 20.70 ? 85  VAL A CA  1 
ATOM   658  C C   . VAL A 1 85  ? 52.881 -21.156 11.461 1.00 21.42 ? 85  VAL A C   1 
ATOM   659  O O   . VAL A 1 85  ? 53.181 -20.009 11.212 1.00 20.36 ? 85  VAL A O   1 
ATOM   660  C CB  . VAL A 1 85  ? 50.910 -21.694 12.990 1.00 19.11 ? 85  VAL A CB  1 
ATOM   661  C CG1 . VAL A 1 85  ? 50.559 -22.120 14.431 1.00 16.78 ? 85  VAL A CG1 1 
ATOM   662  C CG2 . VAL A 1 85  ? 50.118 -20.547 12.533 1.00 16.91 ? 85  VAL A CG2 1 
ATOM   663  N N   . ASP A 1 86  ? 52.923 -22.200 10.653 1.00 23.18 ? 86  ASP A N   1 
ATOM   664  C CA  . ASP A 1 86  ? 53.354 -21.939 9.217  1.00 25.45 ? 86  ASP A CA  1 
ATOM   665  C C   . ASP A 1 86  ? 52.273 -20.994 8.657  1.00 25.44 ? 86  ASP A C   1 
ATOM   666  O O   . ASP A 1 86  ? 51.146 -21.437 8.683  1.00 26.34 ? 86  ASP A O   1 
ATOM   667  C CB  . ASP A 1 86  ? 53.401 -23.298 8.597  1.00 28.38 ? 86  ASP A CB  1 
ATOM   668  C CG  . ASP A 1 86  ? 54.030 -23.352 7.233  1.00 31.97 ? 86  ASP A CG  1 
ATOM   669  O OD1 . ASP A 1 86  ? 54.982 -24.153 7.088  1.00 34.59 ? 86  ASP A OD1 1 
ATOM   670  O OD2 . ASP A 1 86  ? 53.568 -22.651 6.342  1.00 33.35 ? 86  ASP A OD2 1 
ATOM   671  N N   . PRO A 1 87  ? 52.664 -19.838 8.142  1.00 24.34 ? 87  PRO A N   1 
ATOM   672  C CA  . PRO A 1 87  ? 51.759 -18.854 7.615  1.00 25.40 ? 87  PRO A CA  1 
ATOM   673  C C   . PRO A 1 87  ? 50.966 -19.287 6.432  1.00 27.87 ? 87  PRO A C   1 
ATOM   674  O O   . PRO A 1 87  ? 49.917 -18.682 6.169  1.00 28.58 ? 87  PRO A O   1 
ATOM   675  C CB  . PRO A 1 87  ? 52.617 -17.617 7.411  1.00 24.91 ? 87  PRO A CB  1 
ATOM   676  C CG  . PRO A 1 87  ? 53.952 -18.208 7.091  1.00 24.62 ? 87  PRO A CG  1 
ATOM   677  C CD  . PRO A 1 87  ? 54.067 -19.390 8.037  1.00 24.58 ? 87  PRO A CD  1 
ATOM   678  N N   . LYS A 1 88  ? 51.357 -20.356 5.777  1.00 30.20 ? 88  LYS A N   1 
ATOM   679  C CA  . LYS A 1 88  ? 50.747 -20.977 4.634  1.00 34.04 ? 88  LYS A CA  1 
ATOM   680  C C   . LYS A 1 88  ? 49.744 -22.074 4.931  1.00 34.53 ? 88  LYS A C   1 
ATOM   681  O O   . LYS A 1 88  ? 48.864 -22.310 4.040  1.00 36.88 ? 88  LYS A O   1 
ATOM   682  C CB  . LYS A 1 88  ? 51.772 -21.458 3.588  1.00 38.07 ? 88  LYS A CB  1 
ATOM   683  C CG  . LYS A 1 88  ? 52.629 -20.306 2.990  1.00 42.88 ? 88  LYS A CG  1 
ATOM   684  C CD  . LYS A 1 88  ? 53.674 -20.914 2.023  1.00 46.56 ? 88  LYS A CD  1 
ATOM   685  C CE  . LYS A 1 88  ? 54.701 -19.948 1.482  1.00 47.35 ? 88  LYS A CE  1 
ATOM   686  N NZ  . LYS A 1 88  ? 55.579 -20.635 0.470  1.00 47.95 ? 88  LYS A NZ  1 
ATOM   687  N N   . ASN A 1 89  ? 49.755 -22.760 6.031  1.00 33.79 ? 89  ASN A N   1 
ATOM   688  C CA  . ASN A 1 89  ? 48.816 -23.814 6.380  1.00 33.29 ? 89  ASN A CA  1 
ATOM   689  C C   . ASN A 1 89  ? 47.651 -23.340 7.249  1.00 31.83 ? 89  ASN A C   1 
ATOM   690  O O   . ASN A 1 89  ? 46.761 -24.169 7.536  1.00 33.07 ? 89  ASN A O   1 
ATOM   691  C CB  . ASN A 1 89  ? 49.508 -24.946 7.128  1.00 37.06 ? 89  ASN A CB  1 
ATOM   692  C CG  . ASN A 1 89  ? 50.513 -25.708 6.310  1.00 42.11 ? 89  ASN A CG  1 
ATOM   693  O OD1 . ASN A 1 89  ? 51.152 -26.653 6.859  1.00 45.92 ? 89  ASN A OD1 1 
ATOM   694  N ND2 . ASN A 1 89  ? 50.639 -25.374 5.035  1.00 42.08 ? 89  ASN A ND2 1 
ATOM   695  N N   . TYR A 1 90  ? 47.695 -22.129 7.719  1.00 28.90 ? 90  TYR A N   1 
ATOM   696  C CA  . TYR A 1 90  ? 46.690 -21.620 8.618  1.00 27.05 ? 90  TYR A CA  1 
ATOM   697  C C   . TYR A 1 90  ? 46.001 -20.351 8.238  1.00 27.63 ? 90  TYR A C   1 
ATOM   698  O O   . TYR A 1 90  ? 46.638 -19.499 7.628  1.00 30.04 ? 90  TYR A O   1 
ATOM   699  C CB  . TYR A 1 90  ? 47.352 -21.347 10.011 1.00 23.00 ? 90  TYR A CB  1 
ATOM   700  C CG  . TYR A 1 90  ? 47.725 -22.625 10.683 1.00 20.92 ? 90  TYR A CG  1 
ATOM   701  C CD1 . TYR A 1 90  ? 46.808 -23.222 11.591 1.00 20.78 ? 90  TYR A CD1 1 
ATOM   702  C CD2 . TYR A 1 90  ? 48.968 -23.211 10.474 1.00 19.75 ? 90  TYR A CD2 1 
ATOM   703  C CE1 . TYR A 1 90  ? 47.154 -24.395 12.252 1.00 21.22 ? 90  TYR A CE1 1 
ATOM   704  C CE2 . TYR A 1 90  ? 49.303 -24.407 11.112 1.00 19.93 ? 90  TYR A CE2 1 
ATOM   705  C CZ  . TYR A 1 90  ? 48.429 -24.973 11.999 1.00 21.63 ? 90  TYR A CZ  1 
ATOM   706  O OH  . TYR A 1 90  ? 48.805 -26.119 12.652 1.00 23.93 ? 90  TYR A OH  1 
ATOM   707  N N   . PRO A 1 91  ? 44.769 -20.173 8.696  1.00 27.43 ? 91  PRO A N   1 
ATOM   708  C CA  . PRO A 1 91  ? 44.036 -21.132 9.533  1.00 27.73 ? 91  PRO A CA  1 
ATOM   709  C C   . PRO A 1 91  ? 43.516 -22.254 8.645  1.00 29.05 ? 91  PRO A C   1 
ATOM   710  O O   . PRO A 1 91  ? 43.592 -22.184 7.387  1.00 29.72 ? 91  PRO A O   1 
ATOM   711  C CB  . PRO A 1 91  ? 42.911 -20.317 10.128 1.00 26.79 ? 91  PRO A CB  1 
ATOM   712  C CG  . PRO A 1 91  ? 42.649 -19.265 9.074  1.00 26.04 ? 91  PRO A CG  1 
ATOM   713  C CD  . PRO A 1 91  ? 44.021 -18.950 8.467  1.00 26.75 ? 91  PRO A CD  1 
ATOM   714  N N   . LYS A 1 92  ? 43.004 -23.259 9.309  1.00 28.63 ? 92  LYS A N   1 
ATOM   715  C CA  . LYS A 1 92  ? 42.400 -24.465 8.736  1.00 28.17 ? 92  LYS A CA  1 
ATOM   716  C C   . LYS A 1 92  ? 41.061 -24.666 9.538  1.00 26.65 ? 92  LYS A C   1 
ATOM   717  O O   . LYS A 1 92  ? 41.005 -24.221 10.660 1.00 25.17 ? 92  LYS A O   1 
ATOM   718  C CB  . LYS A 1 92  ? 43.107 -25.714 9.233  1.00 28.13 ? 92  LYS A CB  1 
ATOM   719  C CG  . LYS A 1 92  ? 44.572 -25.868 8.962  1.00 28.12 ? 92  LYS A CG  1 
ATOM   720  C CD  . LYS A 1 92  ? 44.942 -27.055 9.741  1.00 28.14 ? 92  LYS A CD  1 
ATOM   721  C CE  . LYS A 1 92  ? 46.263 -27.586 9.915  1.00 29.30 ? 92  LYS A CE  1 
ATOM   722  N NZ  . LYS A 1 92  ? 46.111 -28.444 11.206 1.00 29.80 ? 92  LYS A NZ  1 
ATOM   723  N N   . LYS A 1 93  ? 40.216 -25.455 8.933  1.00 26.31 ? 93  LYS A N   1 
ATOM   724  C CA  . LYS A 1 93  ? 38.945 -25.801 9.567  1.00 26.55 ? 93  LYS A CA  1 
ATOM   725  C C   . LYS A 1 93  ? 39.224 -26.853 10.629 1.00 25.67 ? 93  LYS A C   1 
ATOM   726  O O   . LYS A 1 93  ? 38.618 -26.843 11.727 1.00 25.81 ? 93  LYS A O   1 
ATOM   727  C CB  . LYS A 1 93  ? 37.872 -26.263 8.540  1.00 26.09 ? 93  LYS A CB  1 
ATOM   728  N N   . LYS A 1 94  ? 40.151 -27.756 10.326 1.00 25.13 ? 94  LYS A N   1 
ATOM   729  C CA  . LYS A 1 94  ? 40.479 -28.818 11.314 1.00 24.79 ? 94  LYS A CA  1 
ATOM   730  C C   . LYS A 1 94  ? 41.810 -28.482 11.932 1.00 25.34 ? 94  LYS A C   1 
ATOM   731  O O   . LYS A 1 94  ? 42.925 -28.813 11.571 1.00 26.76 ? 94  LYS A O   1 
ATOM   732  C CB  . LYS A 1 94  ? 40.308 -30.181 10.817 1.00 27.20 ? 94  LYS A CB  1 
ATOM   733  N N   . MET A 1 95  ? 41.632 -27.693 12.976 1.00 24.67 ? 95  MET A N   1 
ATOM   734  C CA  . MET A 1 95  ? 42.723 -27.083 13.781 1.00 23.60 ? 95  MET A CA  1 
ATOM   735  C C   . MET A 1 95  ? 43.019 -28.063 14.883 1.00 22.51 ? 95  MET A C   1 
ATOM   736  O O   . MET A 1 95  ? 42.089 -28.795 15.390 1.00 23.10 ? 95  MET A O   1 
ATOM   737  C CB  . MET A 1 95  ? 41.993 -25.823 14.303 1.00 26.39 ? 95  MET A CB  1 
ATOM   738  C CG  . MET A 1 95  ? 42.861 -24.755 14.653 1.00 29.83 ? 95  MET A CG  1 
ATOM   739  S SD  . MET A 1 95  ? 43.599 -23.973 13.134 1.00 27.36 ? 95  MET A SD  1 
ATOM   740  C CE  . MET A 1 95  ? 44.617 -22.835 14.064 1.00 25.54 ? 95  MET A CE  1 
ATOM   741  N N   . GLU A 1 96  ? 44.291 -28.177 15.204 1.00 20.58 ? 96  GLU A N   1 
ATOM   742  C CA  . GLU A 1 96  ? 44.691 -29.104 16.263 1.00 20.20 ? 96  GLU A CA  1 
ATOM   743  C C   . GLU A 1 96  ? 44.034 -28.688 17.568 1.00 20.19 ? 96  GLU A C   1 
ATOM   744  O O   . GLU A 1 96  ? 43.952 -27.480 17.783 1.00 19.48 ? 96  GLU A O   1 
ATOM   745  C CB  . GLU A 1 96  ? 46.183 -28.988 16.526 1.00 19.54 ? 96  GLU A CB  1 
ATOM   746  C CG  . GLU A 1 96  ? 47.105 -29.294 15.413 1.00 23.58 ? 96  GLU A CG  1 
ATOM   747  C CD  . GLU A 1 96  ? 47.084 -28.470 14.170 1.00 26.29 ? 96  GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 96  ? 46.892 -27.296 14.014 1.00 26.95 ? 96  GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 96  ? 47.352 -29.204 13.195 1.00 29.71 ? 96  GLU A OE2 1 
ATOM   750  N N   . LYS A 1 97  ? 43.669 -29.581 18.415 1.00 20.50 ? 97  LYS A N   1 
ATOM   751  C CA  . LYS A 1 97  ? 43.072 -29.321 19.690 1.00 20.71 ? 97  LYS A CA  1 
ATOM   752  C C   . LYS A 1 97  ? 43.631 -28.305 20.606 1.00 18.77 ? 97  LYS A C   1 
ATOM   753  O O   . LYS A 1 97  ? 42.828 -27.727 21.368 1.00 19.04 ? 97  LYS A O   1 
ATOM   754  C CB  . LYS A 1 97  ? 42.987 -30.565 20.544 1.00 27.18 ? 97  LYS A CB  1 
ATOM   755  C CG  . LYS A 1 97  ? 41.758 -31.357 20.527 1.00 33.33 ? 97  LYS A CG  1 
ATOM   756  C CD  . LYS A 1 97  ? 40.655 -30.694 21.394 1.00 36.67 ? 97  LYS A CD  1 
ATOM   757  C CE  . LYS A 1 97  ? 39.557 -31.788 21.534 1.00 38.57 ? 97  LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 97  ? 38.642 -31.357 22.682 1.00 35.86 ? 97  LYS A NZ  1 
ATOM   759  N N   . ARG A 1 98  ? 44.917 -28.176 20.711 1.00 17.78 ? 98  ARG A N   1 
ATOM   760  C CA  . ARG A 1 98  ? 45.510 -27.195 21.631 1.00 16.94 ? 98  ARG A CA  1 
ATOM   761  C C   . ARG A 1 98  ? 45.053 -25.790 21.296 1.00 15.26 ? 98  ARG A C   1 
ATOM   762  O O   . ARG A 1 98  ? 45.138 -24.893 22.130 1.00 14.70 ? 98  ARG A O   1 
ATOM   763  C CB  . ARG A 1 98  ? 47.033 -27.315 21.587 1.00 18.41 ? 98  ARG A CB  1 
ATOM   764  C CG  . ARG A 1 98  ? 47.790 -27.132 20.295 1.00 19.46 ? 98  ARG A CG  1 
ATOM   765  C CD  . ARG A 1 98  ? 49.296 -27.220 20.636 1.00 20.55 ? 98  ARG A CD  1 
ATOM   766  N NE  . ARG A 1 98  ? 49.999 -26.830 19.440 1.00 23.81 ? 98  ARG A NE  1 
ATOM   767  C CZ  . ARG A 1 98  ? 50.103 -27.557 18.325 1.00 25.96 ? 98  ARG A CZ  1 
ATOM   768  N NH1 . ARG A 1 98  ? 49.573 -28.774 18.262 1.00 24.73 ? 98  ARG A NH1 1 
ATOM   769  N NH2 . ARG A 1 98  ? 50.731 -27.058 17.228 1.00 26.31 ? 98  ARG A NH2 1 
ATOM   770  N N   . PHE A 1 99  ? 44.626 -25.588 20.031 1.00 15.74 ? 99  PHE A N   1 
ATOM   771  C CA  . PHE A 1 99  ? 44.268 -24.252 19.560 1.00 15.27 ? 99  PHE A CA  1 
ATOM   772  C C   . PHE A 1 99  ? 42.772 -23.959 19.701 1.00 15.75 ? 99  PHE A C   1 
ATOM   773  O O   . PHE A 1 99  ? 42.415 -22.843 19.290 1.00 15.91 ? 99  PHE A O   1 
ATOM   774  C CB  . PHE A 1 99  ? 44.553 -24.081 18.047 1.00 16.03 ? 99  PHE A CB  1 
ATOM   775  C CG  . PHE A 1 99  ? 45.994 -24.134 17.636 1.00 16.92 ? 99  PHE A CG  1 
ATOM   776  C CD1 . PHE A 1 99  ? 46.502 -25.219 16.920 1.00 16.35 ? 99  PHE A CD1 1 
ATOM   777  C CD2 . PHE A 1 99  ? 46.857 -23.111 18.064 1.00 17.25 ? 99  PHE A CD2 1 
ATOM   778  C CE1 . PHE A 1 99  ? 47.862 -25.208 16.554 1.00 18.04 ? 99  PHE A CE1 1 
ATOM   779  C CE2 . PHE A 1 99  ? 48.234 -23.125 17.724 1.00 17.12 ? 99  PHE A CE2 1 
ATOM   780  C CZ  . PHE A 1 99  ? 48.731 -24.204 16.972 1.00 16.89 ? 99  PHE A CZ  1 
ATOM   781  N N   . VAL A 1 100 ? 41.983 -24.934 20.076 1.00 15.24 ? 100 VAL A N   1 
ATOM   782  C CA  . VAL A 1 100 ? 40.526 -24.771 20.100 1.00 12.64 ? 100 VAL A CA  1 
ATOM   783  C C   . VAL A 1 100 ? 40.006 -24.389 21.494 1.00 13.23 ? 100 VAL A C   1 
ATOM   784  O O   . VAL A 1 100 ? 40.373 -24.933 22.516 1.00 14.66 ? 100 VAL A O   1 
ATOM   785  C CB  . VAL A 1 100 ? 39.947 -26.136 19.619 1.00 11.93 ? 100 VAL A CB  1 
ATOM   786  C CG1 . VAL A 1 100 ? 38.400 -26.183 19.744 1.00 11.00 ? 100 VAL A CG1 1 
ATOM   787  C CG2 . VAL A 1 100 ? 40.333 -26.426 18.205 1.00 10.04 ? 100 VAL A CG2 1 
ATOM   788  N N   . PHE A 1 101 ? 39.132 -23.422 21.448 1.00 13.05 ? 101 PHE A N   1 
ATOM   789  C CA  . PHE A 1 101 ? 38.406 -22.928 22.622 1.00 13.17 ? 101 PHE A CA  1 
ATOM   790  C C   . PHE A 1 101 ? 36.901 -23.117 22.326 1.00 13.20 ? 101 PHE A C   1 
ATOM   791  O O   . PHE A 1 101 ? 36.506 -22.960 21.187 1.00 14.95 ? 101 PHE A O   1 
ATOM   792  C CB  . PHE A 1 101 ? 38.701 -21.426 22.865 1.00 10.89 ? 101 PHE A CB  1 
ATOM   793  C CG  . PHE A 1 101 ? 40.167 -21.215 23.239 1.00 12.49 ? 101 PHE A CG  1 
ATOM   794  C CD1 . PHE A 1 101 ? 41.148 -21.056 22.262 1.00 12.27 ? 101 PHE A CD1 1 
ATOM   795  C CD2 . PHE A 1 101 ? 40.547 -21.290 24.600 1.00 8.42  ? 101 PHE A CD2 1 
ATOM   796  C CE1 . PHE A 1 101 ? 42.480 -20.877 22.633 1.00 11.66 ? 101 PHE A CE1 1 
ATOM   797  C CE2 . PHE A 1 101 ? 41.874 -21.171 24.965 1.00 8.76  ? 101 PHE A CE2 1 
ATOM   798  C CZ  . PHE A 1 101 ? 42.840 -20.942 23.973 1.00 8.61  ? 101 PHE A CZ  1 
ATOM   799  N N   . ASN A 1 102 ? 36.165 -23.299 23.385 1.00 14.05 ? 102 ASN A N   1 
ATOM   800  C CA  . ASN A 1 102 ? 34.654 -23.395 23.205 1.00 14.71 ? 102 ASN A CA  1 
ATOM   801  C C   . ASN A 1 102 ? 34.186 -21.971 23.627 1.00 14.41 ? 102 ASN A C   1 
ATOM   802  O O   . ASN A 1 102 ? 34.478 -21.651 24.801 1.00 15.01 ? 102 ASN A O   1 
ATOM   803  C CB  . ASN A 1 102 ? 34.074 -24.485 24.030 1.00 14.62 ? 102 ASN A CB  1 
ATOM   804  C CG  . ASN A 1 102 ? 34.516 -25.866 23.659 1.00 18.46 ? 102 ASN A CG  1 
ATOM   805  O OD1 . ASN A 1 102 ? 34.880 -26.624 24.617 1.00 22.15 ? 102 ASN A OD1 1 
ATOM   806  N ND2 . ASN A 1 102 ? 34.529 -26.151 22.373 1.00 19.44 ? 102 ASN A ND2 1 
ATOM   807  N N   . LYS A 1 103 ? 33.609 -21.264 22.740 1.00 14.80 ? 103 LYS A N   1 
ATOM   808  C CA  . LYS A 1 103 ? 33.088 -19.919 22.965 1.00 14.77 ? 103 LYS A CA  1 
ATOM   809  C C   . LYS A 1 103 ? 31.667 -20.187 23.498 1.00 17.45 ? 103 LYS A C   1 
ATOM   810  O O   . LYS A 1 103 ? 30.885 -20.845 22.789 1.00 20.10 ? 103 LYS A O   1 
ATOM   811  C CB  . LYS A 1 103 ? 32.999 -19.130 21.686 1.00 13.62 ? 103 LYS A CB  1 
ATOM   812  C CG  . LYS A 1 103 ? 32.454 -17.721 21.839 1.00 13.82 ? 103 LYS A CG  1 
ATOM   813  C CD  . LYS A 1 103 ? 32.484 -16.896 20.580 1.00 15.19 ? 103 LYS A CD  1 
ATOM   814  C CE  . LYS A 1 103 ? 31.559 -17.416 19.481 1.00 17.55 ? 103 LYS A CE  1 
ATOM   815  N NZ  . LYS A 1 103 ? 30.140 -17.365 20.083 1.00 20.53 ? 103 LYS A NZ  1 
ATOM   816  N N   . ILE A 1 104 ? 31.460 -19.813 24.717 1.00 17.93 ? 104 ILE A N   1 
ATOM   817  C CA  . ILE A 1 104 ? 30.207 -20.050 25.411 1.00 21.34 ? 104 ILE A CA  1 
ATOM   818  C C   . ILE A 1 104 ? 29.536 -18.703 25.692 1.00 24.03 ? 104 ILE A C   1 
ATOM   819  O O   . ILE A 1 104 ? 30.245 -17.828 26.244 1.00 22.73 ? 104 ILE A O   1 
ATOM   820  C CB  . ILE A 1 104 ? 30.603 -20.693 26.828 1.00 20.50 ? 104 ILE A CB  1 
ATOM   821  C CG1 . ILE A 1 104 ? 31.360 -21.955 26.530 1.00 21.01 ? 104 ILE A CG1 1 
ATOM   822  C CG2 . ILE A 1 104 ? 29.389 -20.908 27.715 1.00 22.70 ? 104 ILE A CG2 1 
ATOM   823  C CD1 . ILE A 1 104 ? 31.805 -22.764 27.752 1.00 21.63 ? 104 ILE A CD1 1 
ATOM   824  N N   . GLU A 1 105 ? 28.335 -18.596 25.287 1.00 27.55 ? 105 GLU A N   1 
ATOM   825  C CA  . GLU A 1 105 ? 27.515 -17.397 25.502 1.00 33.11 ? 105 GLU A CA  1 
ATOM   826  C C   . GLU A 1 105 ? 26.766 -17.605 26.818 1.00 36.63 ? 105 GLU A C   1 
ATOM   827  O O   . GLU A 1 105 ? 26.126 -18.651 27.028 1.00 37.91 ? 105 GLU A O   1 
ATOM   828  C CB  . GLU A 1 105 ? 26.451 -17.327 24.408 1.00 35.75 ? 105 GLU A CB  1 
ATOM   829  C CG  . GLU A 1 105 ? 27.107 -17.121 23.037 1.00 41.79 ? 105 GLU A CG  1 
ATOM   830  C CD  . GLU A 1 105 ? 26.118 -17.302 21.894 1.00 46.08 ? 105 GLU A CD  1 
ATOM   831  O OE1 . GLU A 1 105 ? 26.050 -18.421 21.346 1.00 47.91 ? 105 GLU A OE1 1 
ATOM   832  O OE2 . GLU A 1 105 ? 25.476 -16.260 21.655 1.00 46.40 ? 105 GLU A OE2 1 
ATOM   833  N N   . ILE A 1 106 ? 26.884 -16.609 27.661 1.00 38.76 ? 106 ILE A N   1 
ATOM   834  C CA  . ILE A 1 106 ? 26.247 -16.603 28.985 1.00 43.85 ? 106 ILE A CA  1 
ATOM   835  C C   . ILE A 1 106 ? 25.784 -15.197 29.327 1.00 46.25 ? 106 ILE A C   1 
ATOM   836  O O   . ILE A 1 106 ? 26.582 -14.461 29.937 1.00 47.38 ? 106 ILE A O   1 
ATOM   837  C CB  . ILE A 1 106 ? 27.161 -17.312 30.023 1.00 46.01 ? 106 ILE A CB  1 
ATOM   838  C CG1 . ILE A 1 106 ? 27.096 -18.858 29.780 1.00 46.96 ? 106 ILE A CG1 1 
ATOM   839  C CG2 . ILE A 1 106 ? 26.993 -16.943 31.496 1.00 46.55 ? 106 ILE A CG2 1 
ATOM   840  C CD1 . ILE A 1 106 ? 28.010 -19.629 30.793 1.00 48.63 ? 106 ILE A CD1 1 
ATOM   841  N N   . ASN A 1 107 ? 24.558 -14.868 28.887 1.00 47.59 ? 107 ASN A N   1 
ATOM   842  C CA  . ASN A 1 107 ? 23.991 -13.558 29.154 1.00 48.47 ? 107 ASN A CA  1 
ATOM   843  C C   . ASN A 1 107 ? 24.795 -12.367 28.711 1.00 47.13 ? 107 ASN A C   1 
ATOM   844  O O   . ASN A 1 107 ? 25.267 -11.545 29.536 1.00 45.53 ? 107 ASN A O   1 
ATOM   845  C CB  . ASN A 1 107 ? 23.301 -13.422 30.514 1.00 53.09 ? 107 ASN A CB  1 
ATOM   846  C CG  . ASN A 1 107 ? 21.802 -13.747 30.448 1.00 56.36 ? 107 ASN A CG  1 
ATOM   847  O OD1 . ASN A 1 107 ? 21.297 -14.506 29.599 1.00 57.81 ? 107 ASN A OD1 1 
ATOM   848  N ND2 . ASN A 1 107 ? 21.045 -13.019 31.309 1.00 57.62 ? 107 ASN A ND2 1 
ATOM   849  N N   . ASN A 1 108 ? 24.882 -12.237 27.394 1.00 46.69 ? 108 ASN A N   1 
ATOM   850  C CA  . ASN A 1 108 ? 25.670 -11.155 26.789 1.00 45.88 ? 108 ASN A CA  1 
ATOM   851  C C   . ASN A 1 108 ? 27.160 -11.274 26.970 1.00 42.64 ? 108 ASN A C   1 
ATOM   852  O O   . ASN A 1 108 ? 27.953 -10.550 26.263 1.00 42.63 ? 108 ASN A O   1 
ATOM   853  C CB  . ASN A 1 108 ? 24.992 -9.809  26.822 1.00 50.53 ? 108 ASN A CB  1 
ATOM   854  C CG  . ASN A 1 108 ? 23.932 -9.829  25.705 1.00 55.75 ? 108 ASN A CG  1 
ATOM   855  O OD1 . ASN A 1 108 ? 23.166 -10.787 25.590 1.00 57.18 ? 108 ASN A OD1 1 
ATOM   856  N ND2 . ASN A 1 108 ? 24.024 -8.813  24.835 1.00 59.02 ? 108 ASN A ND2 1 
ATOM   857  N N   . LYS A 1 109 ? 27.579 -12.191 27.823 1.00 39.02 ? 109 LYS A N   1 
ATOM   858  C CA  . LYS A 1 109 ? 29.028 -12.403 28.011 1.00 34.38 ? 109 LYS A CA  1 
ATOM   859  C C   . LYS A 1 109 ? 29.489 -13.713 27.435 1.00 29.50 ? 109 LYS A C   1 
ATOM   860  O O   . LYS A 1 109 ? 28.701 -14.629 27.228 1.00 30.22 ? 109 LYS A O   1 
ATOM   861  C CB  . LYS A 1 109 ? 29.463 -12.096 29.394 1.00 36.80 ? 109 LYS A CB  1 
ATOM   862  C CG  . LYS A 1 109 ? 29.226 -10.567 29.677 1.00 39.57 ? 109 LYS A CG  1 
ATOM   863  C CD  . LYS A 1 109 ? 29.591 -10.337 31.128 1.00 43.60 ? 109 LYS A CD  1 
ATOM   864  C CE  . LYS A 1 109 ? 29.337 -8.889  31.544 1.00 46.06 ? 109 LYS A CE  1 
ATOM   865  N NZ  . LYS A 1 109 ? 29.645 -8.803  33.035 1.00 48.44 ? 109 LYS A NZ  1 
ATOM   866  N N   . LEU A 1 110 ? 30.772 -13.741 27.115 1.00 24.23 ? 110 LEU A N   1 
ATOM   867  C CA  . LEU A 1 110 ? 31.387 -14.928 26.524 1.00 21.86 ? 110 LEU A CA  1 
ATOM   868  C C   . LEU A 1 110 ? 32.441 -15.457 27.482 1.00 18.82 ? 110 LEU A C   1 
ATOM   869  O O   . LEU A 1 110 ? 33.090 -14.666 28.180 1.00 18.06 ? 110 LEU A O   1 
ATOM   870  C CB  . LEU A 1 110 ? 32.113 -14.529 25.231 1.00 23.37 ? 110 LEU A CB  1 
ATOM   871  C CG  . LEU A 1 110 ? 31.426 -13.647 24.234 1.00 25.26 ? 110 LEU A CG  1 
ATOM   872  C CD1 . LEU A 1 110 ? 32.377 -13.511 23.034 1.00 26.62 ? 110 LEU A CD1 1 
ATOM   873  C CD2 . LEU A 1 110 ? 30.125 -14.268 23.790 1.00 26.32 ? 110 LEU A CD2 1 
ATOM   874  N N   . GLU A 1 111 ? 32.658 -16.690 27.372 1.00 17.84 ? 111 GLU A N   1 
ATOM   875  C CA  . GLU A 1 111 ? 33.662 -17.424 28.119 1.00 16.77 ? 111 GLU A CA  1 
ATOM   876  C C   . GLU A 1 111 ? 34.330 -18.332 27.087 1.00 14.11 ? 111 GLU A C   1 
ATOM   877  O O   . GLU A 1 111 ? 33.651 -18.746 26.158 1.00 14.27 ? 111 GLU A O   1 
ATOM   878  C CB  . GLU A 1 111 ? 33.144 -18.292 29.239 1.00 21.08 ? 111 GLU A CB  1 
ATOM   879  C CG  . GLU A 1 111 ? 32.273 -17.432 30.221 1.00 24.28 ? 111 GLU A CG  1 
ATOM   880  C CD  . GLU A 1 111 ? 31.904 -18.305 31.425 1.00 28.51 ? 111 GLU A CD  1 
ATOM   881  O OE1 . GLU A 1 111 ? 31.712 -19.492 31.344 1.00 29.58 ? 111 GLU A OE1 1 
ATOM   882  O OE2 . GLU A 1 111 ? 31.989 -17.603 32.477 1.00 30.34 ? 111 GLU A OE2 1 
ATOM   883  N N   . PHE A 1 112 ? 35.592 -18.414 27.232 1.00 13.12 ? 112 PHE A N   1 
ATOM   884  C CA  . PHE A 1 112 ? 36.443 -19.219 26.333 1.00 13.38 ? 112 PHE A CA  1 
ATOM   885  C C   . PHE A 1 112 ? 37.099 -20.336 27.160 1.00 13.40 ? 112 PHE A C   1 
ATOM   886  O O   . PHE A 1 112 ? 38.094 -20.098 27.792 1.00 12.58 ? 112 PHE A O   1 
ATOM   887  C CB  . PHE A 1 112 ? 37.562 -18.366 25.699 1.00 12.52 ? 112 PHE A CB  1 
ATOM   888  C CG  . PHE A 1 112 ? 36.965 -17.348 24.788 1.00 13.82 ? 112 PHE A CG  1 
ATOM   889  C CD1 . PHE A 1 112 ? 36.636 -16.082 25.259 1.00 14.22 ? 112 PHE A CD1 1 
ATOM   890  C CD2 . PHE A 1 112 ? 36.691 -17.694 23.440 1.00 14.62 ? 112 PHE A CD2 1 
ATOM   891  C CE1 . PHE A 1 112 ? 36.074 -15.182 24.391 1.00 13.36 ? 112 PHE A CE1 1 
ATOM   892  C CE2 . PHE A 1 112 ? 36.151 -16.781 22.558 1.00 13.23 ? 112 PHE A CE2 1 
ATOM   893  C CZ  . PHE A 1 112 ? 35.866 -15.438 23.071 1.00 15.00 ? 112 PHE A CZ  1 
ATOM   894  N N   . GLU A 1 113 ? 36.565 -21.521 26.934 1.00 15.30 ? 113 GLU A N   1 
ATOM   895  C CA  . GLU A 1 113 ? 37.057 -22.684 27.669 1.00 15.16 ? 113 GLU A CA  1 
ATOM   896  C C   . GLU A 1 113 ? 38.000 -23.445 26.763 1.00 15.02 ? 113 GLU A C   1 
ATOM   897  O O   . GLU A 1 113 ? 37.609 -23.584 25.567 1.00 15.53 ? 113 GLU A O   1 
ATOM   898  C CB  . GLU A 1 113 ? 35.837 -23.703 27.683 1.00 17.96 ? 113 GLU A CB  1 
ATOM   899  C CG  . GLU A 1 113 ? 36.219 -24.879 28.584 1.00 20.45 ? 113 GLU A CG  1 
ATOM   900  C CD  . GLU A 1 113 ? 35.207 -25.996 28.609 1.00 22.50 ? 113 GLU A CD  1 
ATOM   901  O OE1 . GLU A 1 113 ? 35.160 -26.633 29.640 1.00 24.31 ? 113 GLU A OE1 1 
ATOM   902  O OE2 . GLU A 1 113 ? 34.632 -26.209 27.570 1.00 22.90 ? 113 GLU A OE2 1 
ATOM   903  N N   . SER A 1 114 ? 39.015 -23.992 27.330 1.00 14.15 ? 114 SER A N   1 
ATOM   904  C CA  . SER A 1 114 ? 39.912 -24.832 26.462 1.00 15.33 ? 114 SER A CA  1 
ATOM   905  C C   . SER A 1 114 ? 39.216 -26.147 26.120 1.00 17.41 ? 114 SER A C   1 
ATOM   906  O O   . SER A 1 114 ? 38.525 -26.757 26.961 1.00 19.09 ? 114 SER A O   1 
ATOM   907  C CB  . SER A 1 114 ? 41.158 -25.084 27.278 1.00 15.81 ? 114 SER A CB  1 
ATOM   908  O OG  . SER A 1 114 ? 41.877 -26.074 26.627 1.00 19.64 ? 114 SER A OG  1 
ATOM   909  N N   . ALA A 1 115 ? 39.280 -26.537 24.873 1.00 18.51 ? 115 ALA A N   1 
ATOM   910  C CA  . ALA A 1 115 ? 38.660 -27.774 24.372 1.00 20.07 ? 115 ALA A CA  1 
ATOM   911  C C   . ALA A 1 115 ? 39.490 -28.933 24.898 1.00 23.00 ? 115 ALA A C   1 
ATOM   912  O O   . ALA A 1 115 ? 39.006 -30.034 25.195 1.00 27.63 ? 115 ALA A O   1 
ATOM   913  C CB  . ALA A 1 115 ? 38.647 -27.841 22.863 1.00 18.10 ? 115 ALA A CB  1 
ATOM   914  N N   . GLN A 1 116 ? 40.735 -28.660 25.048 1.00 23.19 ? 116 GLN A N   1 
ATOM   915  C CA  . GLN A 1 116 ? 41.742 -29.626 25.536 1.00 24.23 ? 116 GLN A CA  1 
ATOM   916  C C   . GLN A 1 116 ? 41.699 -29.770 27.029 1.00 24.74 ? 116 GLN A C   1 
ATOM   917  O O   . GLN A 1 116 ? 42.011 -30.880 27.533 1.00 26.60 ? 116 GLN A O   1 
ATOM   918  C CB  . GLN A 1 116 ? 43.106 -29.032 25.129 1.00 28.67 ? 116 GLN A CB  1 
ATOM   919  C CG  . GLN A 1 116 ? 44.358 -29.742 25.316 1.00 33.71 ? 116 GLN A CG  1 
ATOM   920  C CD  . GLN A 1 116 ? 44.734 -30.905 24.505 1.00 36.85 ? 116 GLN A CD  1 
ATOM   921  O OE1 . GLN A 1 116 ? 44.758 -30.937 23.278 1.00 39.09 ? 116 GLN A OE1 1 
ATOM   922  N NE2 . GLN A 1 116 ? 45.201 -31.962 25.176 1.00 40.31 ? 116 GLN A NE2 1 
ATOM   923  N N   . PHE A 1 117 ? 41.449 -28.723 27.813 1.00 21.91 ? 117 PHE A N   1 
ATOM   924  C CA  . PHE A 1 117 ? 41.448 -28.846 29.267 1.00 20.36 ? 117 PHE A CA  1 
ATOM   925  C C   . PHE A 1 117 ? 40.078 -28.344 29.760 1.00 20.37 ? 117 PHE A C   1 
ATOM   926  O O   . PHE A 1 117 ? 39.940 -27.142 29.977 1.00 19.66 ? 117 PHE A O   1 
ATOM   927  C CB  . PHE A 1 117 ? 42.567 -28.069 29.991 1.00 20.46 ? 117 PHE A CB  1 
ATOM   928  C CG  . PHE A 1 117 ? 43.916 -28.495 29.448 1.00 22.39 ? 117 PHE A CG  1 
ATOM   929  C CD1 . PHE A 1 117 ? 44.559 -27.677 28.520 1.00 22.07 ? 117 PHE A CD1 1 
ATOM   930  C CD2 . PHE A 1 117 ? 44.492 -29.670 29.858 1.00 21.54 ? 117 PHE A CD2 1 
ATOM   931  C CE1 . PHE A 1 117 ? 45.814 -28.031 28.027 1.00 22.89 ? 117 PHE A CE1 1 
ATOM   932  C CE2 . PHE A 1 117 ? 45.746 -30.035 29.360 1.00 22.82 ? 117 PHE A CE2 1 
ATOM   933  C CZ  . PHE A 1 117 ? 46.424 -29.221 28.420 1.00 22.15 ? 117 PHE A CZ  1 
ATOM   934  N N   . PRO A 1 118 ? 39.173 -29.278 29.874 1.00 20.44 ? 118 PRO A N   1 
ATOM   935  C CA  . PRO A 1 118 ? 37.810 -28.988 30.304 1.00 20.21 ? 118 PRO A CA  1 
ATOM   936  C C   . PRO A 1 118 ? 37.852 -28.146 31.573 1.00 20.54 ? 118 PRO A C   1 
ATOM   937  O O   . PRO A 1 118 ? 38.669 -28.389 32.507 1.00 21.09 ? 118 PRO A O   1 
ATOM   938  C CB  . PRO A 1 118 ? 37.205 -30.372 30.560 1.00 21.28 ? 118 PRO A CB  1 
ATOM   939  C CG  . PRO A 1 118 ? 38.022 -31.351 29.708 1.00 19.49 ? 118 PRO A CG  1 
ATOM   940  C CD  . PRO A 1 118 ? 39.390 -30.718 29.597 1.00 20.41 ? 118 PRO A CD  1 
ATOM   941  N N   . ASN A 1 119 ? 37.005 -27.129 31.569 1.00 20.28 ? 119 ASN A N   1 
ATOM   942  C CA  . ASN A 1 119 ? 36.875 -26.200 32.669 1.00 20.05 ? 119 ASN A CA  1 
ATOM   943  C C   . ASN A 1 119 ? 38.030 -25.281 32.928 1.00 18.44 ? 119 ASN A C   1 
ATOM   944  O O   . ASN A 1 119 ? 38.123 -24.761 34.067 1.00 19.40 ? 119 ASN A O   1 
ATOM   945  C CB  . ASN A 1 119 ? 36.444 -26.969 33.975 1.00 20.76 ? 119 ASN A CB  1 
ATOM   946  C CG  . ASN A 1 119 ? 35.113 -27.635 33.760 1.00 22.65 ? 119 ASN A CG  1 
ATOM   947  O OD1 . ASN A 1 119 ? 34.988 -28.855 33.876 1.00 25.86 ? 119 ASN A OD1 1 
ATOM   948  N ND2 . ASN A 1 119 ? 34.067 -26.937 33.363 1.00 24.18 ? 119 ASN A ND2 1 
ATOM   949  N N   . TRP A 1 120 ? 38.967 -25.136 32.056 1.00 18.18 ? 120 TRP A N   1 
ATOM   950  C CA  . TRP A 1 120 ? 40.064 -24.156 32.096 1.00 16.47 ? 120 TRP A CA  1 
ATOM   951  C C   . TRP A 1 120 ? 39.582 -23.102 31.073 1.00 16.42 ? 120 TRP A C   1 
ATOM   952  O O   . TRP A 1 120 ? 39.259 -23.494 29.931 1.00 16.22 ? 120 TRP A O   1 
ATOM   953  C CB  . TRP A 1 120 ? 41.439 -24.675 31.815 1.00 13.87 ? 120 TRP A CB  1 
ATOM   954  C CG  . TRP A 1 120 ? 41.939 -25.481 32.951 1.00 17.25 ? 120 TRP A CG  1 
ATOM   955  C CD1 . TRP A 1 120 ? 41.467 -26.739 33.329 1.00 17.17 ? 120 TRP A CD1 1 
ATOM   956  C CD2 . TRP A 1 120 ? 42.942 -25.139 33.905 1.00 18.66 ? 120 TRP A CD2 1 
ATOM   957  N NE1 . TRP A 1 120 ? 42.106 -27.148 34.459 1.00 17.90 ? 120 TRP A NE1 1 
ATOM   958  C CE2 . TRP A 1 120 ? 43.033 -26.221 34.835 1.00 17.24 ? 120 TRP A CE2 1 
ATOM   959  C CE3 . TRP A 1 120 ? 43.748 -24.023 34.079 1.00 19.32 ? 120 TRP A CE3 1 
ATOM   960  C CZ2 . TRP A 1 120 ? 43.842 -26.175 35.926 1.00 18.19 ? 120 TRP A CZ2 1 
ATOM   961  C CZ3 . TRP A 1 120 ? 44.649 -24.045 35.156 1.00 20.89 ? 120 TRP A CZ3 1 
ATOM   962  C CH2 . TRP A 1 120 ? 44.702 -25.086 36.054 1.00 19.09 ? 120 TRP A CH2 1 
ATOM   963  N N   . TYR A 1 121 ? 39.595 -21.869 31.522 1.00 17.43 ? 121 TYR A N   1 
ATOM   964  C CA  . TYR A 1 121 ? 39.156 -20.721 30.729 1.00 15.72 ? 121 TYR A CA  1 
ATOM   965  C C   . TYR A 1 121 ? 40.235 -19.643 30.571 1.00 14.34 ? 121 TYR A C   1 
ATOM   966  O O   . TYR A 1 121 ? 41.049 -19.535 31.452 1.00 15.60 ? 121 TYR A O   1 
ATOM   967  C CB  . TYR A 1 121 ? 38.068 -19.977 31.642 1.00 14.05 ? 121 TYR A CB  1 
ATOM   968  C CG  . TYR A 1 121 ? 36.906 -20.957 31.852 1.00 18.47 ? 121 TYR A CG  1 
ATOM   969  C CD1 . TYR A 1 121 ? 36.782 -21.849 32.903 1.00 18.64 ? 121 TYR A CD1 1 
ATOM   970  C CD2 . TYR A 1 121 ? 35.899 -20.925 30.893 1.00 18.89 ? 121 TYR A CD2 1 
ATOM   971  C CE1 . TYR A 1 121 ? 35.670 -22.713 32.961 1.00 20.72 ? 121 TYR A CE1 1 
ATOM   972  C CE2 . TYR A 1 121 ? 34.827 -21.801 30.895 1.00 20.33 ? 121 TYR A CE2 1 
ATOM   973  C CZ  . TYR A 1 121 ? 34.733 -22.701 31.963 1.00 22.97 ? 121 TYR A CZ  1 
ATOM   974  O OH  . TYR A 1 121 ? 33.593 -23.485 31.939 1.00 25.54 ? 121 TYR A OH  1 
ATOM   975  N N   . ILE A 1 122 ? 40.130 -18.901 29.505 1.00 13.22 ? 122 ILE A N   1 
ATOM   976  C CA  . ILE A 1 122 ? 40.966 -17.715 29.289 1.00 13.36 ? 122 ILE A CA  1 
ATOM   977  C C   . ILE A 1 122 ? 40.497 -16.747 30.424 1.00 13.40 ? 122 ILE A C   1 
ATOM   978  O O   . ILE A 1 122 ? 39.317 -16.550 30.561 1.00 13.28 ? 122 ILE A O   1 
ATOM   979  C CB  . ILE A 1 122 ? 40.787 -17.075 27.885 1.00 12.36 ? 122 ILE A CB  1 
ATOM   980  C CG1 . ILE A 1 122 ? 41.315 -18.136 26.844 1.00 11.16 ? 122 ILE A CG1 1 
ATOM   981  C CG2 . ILE A 1 122 ? 41.738 -15.811 27.790 1.00 13.07 ? 122 ILE A CG2 1 
ATOM   982  C CD1 . ILE A 1 122 ? 40.981 -17.548 25.418 1.00 11.17 ? 122 ILE A CD1 1 
ATOM   983  N N   . SER A 1 123 ? 41.474 -16.268 31.180 1.00 13.30 ? 123 SER A N   1 
ATOM   984  C CA  . SER A 1 123 ? 41.197 -15.439 32.314 1.00 13.88 ? 123 SER A CA  1 
ATOM   985  C C   . SER A 1 123 ? 42.105 -14.240 32.399 1.00 14.18 ? 123 SER A C   1 
ATOM   986  O O   . SER A 1 123 ? 43.190 -14.268 31.800 1.00 14.12 ? 123 SER A O   1 
ATOM   987  C CB  . SER A 1 123 ? 41.494 -16.290 33.629 1.00 13.46 ? 123 SER A CB  1 
ATOM   988  O OG  . SER A 1 123 ? 40.837 -17.514 33.445 1.00 18.01 ? 123 SER A OG  1 
ATOM   989  N N   . THR A 1 124 ? 41.555 -13.235 33.109 1.00 13.41 ? 124 THR A N   1 
ATOM   990  C CA  . THR A 1 124 ? 42.431 -12.097 33.321 1.00 14.48 ? 124 THR A CA  1 
ATOM   991  C C   . THR A 1 124 ? 42.422 -11.893 34.847 1.00 16.62 ? 124 THR A C   1 
ATOM   992  O O   . THR A 1 124 ? 41.583 -12.445 35.575 1.00 19.06 ? 124 THR A O   1 
ATOM   993  C CB  . THR A 1 124 ? 42.140 -10.770 32.588 1.00 14.46 ? 124 THR A CB  1 
ATOM   994  O OG1 . THR A 1 124 ? 40.801 -10.448 33.119 1.00 15.71 ? 124 THR A OG1 1 
ATOM   995  C CG2 . THR A 1 124 ? 42.123 -10.861 31.067 1.00 12.51 ? 124 THR A CG2 1 
ATOM   996  N N   . SER A 1 125 ? 43.309 -11.069 35.192 1.00 18.38 ? 125 SER A N   1 
ATOM   997  C CA  . SER A 1 125 ? 43.495 -10.643 36.589 1.00 22.03 ? 125 SER A CA  1 
ATOM   998  C C   . SER A 1 125 ? 42.782 -9.345  36.852 1.00 23.11 ? 125 SER A C   1 
ATOM   999  O O   . SER A 1 125 ? 42.459 -8.478  35.999 1.00 21.78 ? 125 SER A O   1 
ATOM   1000 C CB  . SER A 1 125 ? 45.020 -10.571 36.768 1.00 25.15 ? 125 SER A CB  1 
ATOM   1001 O OG  . SER A 1 125 ? 45.152 -10.032 38.065 1.00 30.59 ? 125 SER A OG  1 
ATOM   1002 N N   . GLN A 1 126 ? 42.506 -9.150  38.123 1.00 26.94 ? 126 GLN A N   1 
ATOM   1003 C CA  . GLN A 1 126 ? 41.780 -7.938  38.638 1.00 26.17 ? 126 GLN A CA  1 
ATOM   1004 C C   . GLN A 1 126 ? 42.680 -6.748  38.551 1.00 25.04 ? 126 GLN A C   1 
ATOM   1005 O O   . GLN A 1 126 ? 42.234 -5.592  38.280 1.00 24.73 ? 126 GLN A O   1 
ATOM   1006 C CB  . GLN A 1 126 ? 41.323 -8.310  40.020 1.00 31.17 ? 126 GLN A CB  1 
ATOM   1007 C CG  . GLN A 1 126 ? 40.107 -7.879  40.694 1.00 36.72 ? 126 GLN A CG  1 
ATOM   1008 C CD  . GLN A 1 126 ? 38.790 -8.506  40.351 1.00 41.45 ? 126 GLN A CD  1 
ATOM   1009 O OE1 . GLN A 1 126 ? 38.296 -9.487  41.023 1.00 43.88 ? 126 GLN A OE1 1 
ATOM   1010 N NE2 . GLN A 1 126 ? 38.085 -8.023  39.327 1.00 40.88 ? 126 GLN A NE2 1 
ATOM   1011 N N   . ALA A 1 127 ? 43.976 -6.981  38.726 1.00 25.41 ? 127 ALA A N   1 
ATOM   1012 C CA  . ALA A 1 127 ? 45.020 -5.902  38.665 1.00 25.37 ? 127 ALA A CA  1 
ATOM   1013 C C   . ALA A 1 127 ? 45.424 -5.574  37.241 1.00 25.65 ? 127 ALA A C   1 
ATOM   1014 O O   . ALA A 1 127 ? 45.316 -6.445  36.336 1.00 24.59 ? 127 ALA A O   1 
ATOM   1015 C CB  . ALA A 1 127 ? 46.248 -6.418  39.412 1.00 24.54 ? 127 ALA A CB  1 
ATOM   1016 N N   . GLU A 1 128 ? 45.931 -4.381  37.034 1.00 25.12 ? 128 GLU A N   1 
ATOM   1017 C CA  . GLU A 1 128 ? 46.372 -3.899  35.729 1.00 24.93 ? 128 GLU A CA  1 
ATOM   1018 C C   . GLU A 1 128 ? 47.633 -4.493  35.187 1.00 24.54 ? 128 GLU A C   1 
ATOM   1019 O O   . GLU A 1 128 ? 48.486 -4.832  36.063 1.00 25.33 ? 128 GLU A O   1 
ATOM   1020 C CB  . GLU A 1 128 ? 46.953 -2.451  36.029 1.00 26.93 ? 128 GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 128 ? 45.839 -1.476  36.351 1.00 29.77 ? 128 GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 128 ? 44.920 -1.261  35.145 1.00 30.98 ? 128 GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 128 ? 45.274 -0.756  34.099 1.00 33.52 ? 128 GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 128 ? 43.795 -1.600  35.470 1.00 29.64 ? 128 GLU A OE2 1 
ATOM   1025 N N   . ASN A 1 129 ? 47.835 -4.566  33.884 1.00 22.87 ? 129 ASN A N   1 
ATOM   1026 C CA  . ASN A 1 129 ? 49.139 -5.091  33.454 1.00 24.06 ? 129 ASN A CA  1 
ATOM   1027 C C   . ASN A 1 129 ? 49.605 -6.452  33.753 1.00 23.08 ? 129 ASN A C   1 
ATOM   1028 O O   . ASN A 1 129 ? 50.867 -6.621  33.671 1.00 24.54 ? 129 ASN A O   1 
ATOM   1029 C CB  . ASN A 1 129 ? 50.238 -4.045  33.787 1.00 29.73 ? 129 ASN A CB  1 
ATOM   1030 C CG  . ASN A 1 129 ? 50.449 -3.208  32.568 1.00 36.04 ? 129 ASN A CG  1 
ATOM   1031 O OD1 . ASN A 1 129 ? 51.194 -3.696  31.660 1.00 39.37 ? 129 ASN A OD1 1 
ATOM   1032 N ND2 . ASN A 1 129 ? 49.860 -2.042  32.440 1.00 39.85 ? 129 ASN A ND2 1 
ATOM   1033 N N   . MET A 1 130 ? 48.762 -7.408  34.042 1.00 20.85 ? 130 MET A N   1 
ATOM   1034 C CA  . MET A 1 130 ? 49.143 -8.803  34.289 1.00 20.38 ? 130 MET A CA  1 
ATOM   1035 C C   . MET A 1 130 ? 48.791 -9.606  33.013 1.00 19.68 ? 130 MET A C   1 
ATOM   1036 O O   . MET A 1 130 ? 47.908 -9.212  32.175 1.00 17.80 ? 130 MET A O   1 
ATOM   1037 C CB  . MET A 1 130 ? 48.396 -9.246  35.534 1.00 24.22 ? 130 MET A CB  1 
ATOM   1038 C CG  . MET A 1 130 ? 48.778 -8.393  36.760 1.00 26.25 ? 130 MET A CG  1 
ATOM   1039 S SD  . MET A 1 130 ? 50.555 -8.652  37.104 1.00 33.49 ? 130 MET A SD  1 
ATOM   1040 C CE  . MET A 1 130 ? 50.693 -10.373 37.436 1.00 32.29 ? 130 MET A CE  1 
ATOM   1041 N N   . PRO A 1 131 ? 49.533 -10.664 32.783 1.00 18.09 ? 131 PRO A N   1 
ATOM   1042 C CA  . PRO A 1 131 ? 49.331 -11.529 31.612 1.00 18.89 ? 131 PRO A CA  1 
ATOM   1043 C C   . PRO A 1 131 ? 47.947 -12.188 31.622 1.00 19.42 ? 131 PRO A C   1 
ATOM   1044 O O   . PRO A 1 131 ? 47.319 -12.333 32.670 1.00 20.02 ? 131 PRO A O   1 
ATOM   1045 C CB  . PRO A 1 131 ? 50.443 -12.548 31.650 1.00 17.80 ? 131 PRO A CB  1 
ATOM   1046 C CG  . PRO A 1 131 ? 51.399 -12.066 32.734 1.00 17.50 ? 131 PRO A CG  1 
ATOM   1047 C CD  . PRO A 1 131 ? 50.583 -11.199 33.676 1.00 18.18 ? 131 PRO A CD  1 
ATOM   1048 N N   . VAL A 1 132 ? 47.481 -12.448 30.431 1.00 19.38 ? 132 VAL A N   1 
ATOM   1049 C CA  . VAL A 1 132 ? 46.181 -13.196 30.242 1.00 18.51 ? 132 VAL A CA  1 
ATOM   1050 C C   . VAL A 1 132 ? 46.679 -14.673 30.428 1.00 18.51 ? 132 VAL A C   1 
ATOM   1051 O O   . VAL A 1 132 ? 47.776 -14.943 30.007 1.00 18.15 ? 132 VAL A O   1 
ATOM   1052 C CB  . VAL A 1 132 ? 45.729 -12.933 28.833 1.00 17.31 ? 132 VAL A CB  1 
ATOM   1053 C CG1 . VAL A 1 132 ? 44.541 -13.840 28.460 1.00 15.44 ? 132 VAL A CG1 1 
ATOM   1054 C CG2 . VAL A 1 132 ? 45.336 -11.444 28.687 1.00 18.29 ? 132 VAL A CG2 1 
ATOM   1055 N N   . PHE A 1 133 ? 45.920 -15.485 31.146 1.00 17.69 ? 133 PHE A N   1 
ATOM   1056 C CA  . PHE A 1 133 ? 46.329 -16.841 31.469 1.00 15.66 ? 133 PHE A CA  1 
ATOM   1057 C C   . PHE A 1 133 ? 45.119 -17.755 31.425 1.00 15.16 ? 133 PHE A C   1 
ATOM   1058 O O   . PHE A 1 133 ? 44.034 -17.294 31.096 1.00 15.14 ? 133 PHE A O   1 
ATOM   1059 C CB  . PHE A 1 133 ? 46.976 -16.872 32.864 1.00 14.85 ? 133 PHE A CB  1 
ATOM   1060 C CG  . PHE A 1 133 ? 46.046 -16.415 33.950 1.00 15.00 ? 133 PHE A CG  1 
ATOM   1061 C CD1 . PHE A 1 133 ? 45.782 -15.050 34.113 1.00 13.38 ? 133 PHE A CD1 1 
ATOM   1062 C CD2 . PHE A 1 133 ? 45.416 -17.324 34.789 1.00 13.47 ? 133 PHE A CD2 1 
ATOM   1063 C CE1 . PHE A 1 133 ? 44.935 -14.631 35.097 1.00 15.23 ? 133 PHE A CE1 1 
ATOM   1064 C CE2 . PHE A 1 133 ? 44.503 -16.930 35.721 1.00 11.69 ? 133 PHE A CE2 1 
ATOM   1065 C CZ  . PHE A 1 133 ? 44.247 -15.533 35.888 1.00 13.93 ? 133 PHE A CZ  1 
ATOM   1066 N N   . LEU A 1 134 ? 45.369 -19.023 31.590 1.00 15.64 ? 134 LEU A N   1 
ATOM   1067 C CA  . LEU A 1 134 ? 44.377 -20.071 31.647 1.00 14.68 ? 134 LEU A CA  1 
ATOM   1068 C C   . LEU A 1 134 ? 44.114 -20.326 33.109 1.00 17.95 ? 134 LEU A C   1 
ATOM   1069 O O   . LEU A 1 134 ? 45.083 -20.679 33.829 1.00 21.06 ? 134 LEU A O   1 
ATOM   1070 C CB  . LEU A 1 134 ? 45.055 -21.267 30.893 1.00 10.33 ? 134 LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 134 ? 43.972 -22.172 30.351 1.00 11.19 ? 134 LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 134 ? 43.273 -21.370 29.218 1.00 9.93  ? 134 LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 134 ? 44.576 -23.470 29.834 1.00 12.61 ? 134 LEU A CD2 1 
ATOM   1074 N N   . GLY A 1 135 ? 42.892 -20.173 33.589 1.00 18.43 ? 135 GLY A N   1 
ATOM   1075 C CA  . GLY A 1 135 ? 42.582 -20.338 35.025 1.00 21.76 ? 135 GLY A CA  1 
ATOM   1076 C C   . GLY A 1 135 ? 41.583 -21.487 35.123 1.00 23.72 ? 135 GLY A C   1 
ATOM   1077 O O   . GLY A 1 135 ? 40.760 -21.608 34.203 1.00 22.41 ? 135 GLY A O   1 
ATOM   1078 N N   . GLY A 1 136 ? 41.652 -22.278 36.164 1.00 26.36 ? 136 GLY A N   1 
ATOM   1079 C CA  . GLY A 1 136 ? 40.763 -23.447 36.306 1.00 30.47 ? 136 GLY A CA  1 
ATOM   1080 C C   . GLY A 1 136 ? 39.626 -23.203 37.234 1.00 34.76 ? 136 GLY A C   1 
ATOM   1081 O O   . GLY A 1 136 ? 38.827 -24.105 37.460 1.00 36.28 ? 136 GLY A O   1 
ATOM   1082 N N   . THR A 1 137 ? 39.521 -22.006 37.785 1.00 38.60 ? 137 THR A N   1 
ATOM   1083 C CA  . THR A 1 137 ? 38.466 -21.605 38.690 1.00 41.72 ? 137 THR A CA  1 
ATOM   1084 C C   . THR A 1 137 ? 37.694 -20.365 38.195 1.00 43.02 ? 137 THR A C   1 
ATOM   1085 O O   . THR A 1 137 ? 38.253 -19.274 37.910 1.00 40.53 ? 137 THR A O   1 
ATOM   1086 C CB  . THR A 1 137 ? 38.931 -21.254 40.166 1.00 45.31 ? 137 THR A CB  1 
ATOM   1087 O OG1 . THR A 1 137 ? 39.599 -22.450 40.700 1.00 48.28 ? 137 THR A OG1 1 
ATOM   1088 C CG2 . THR A 1 137 ? 37.709 -20.858 41.040 1.00 45.97 ? 137 THR A CG2 1 
ATOM   1089 N N   . LYS A 1 138 ? 36.377 -20.573 38.218 1.00 45.16 ? 138 LYS A N   1 
ATOM   1090 C CA  . LYS A 1 138 ? 35.426 -19.453 37.869 1.00 46.83 ? 138 LYS A CA  1 
ATOM   1091 C C   . LYS A 1 138 ? 34.830 -19.150 39.253 1.00 49.06 ? 138 LYS A C   1 
ATOM   1092 O O   . LYS A 1 138 ? 34.607 -20.104 40.029 1.00 50.50 ? 138 LYS A O   1 
ATOM   1093 C CB  . LYS A 1 138 ? 34.340 -19.878 36.935 1.00 46.59 ? 138 LYS A CB  1 
ATOM   1094 C CG  . LYS A 1 138 ? 34.829 -20.074 35.450 1.00 46.03 ? 138 LYS A CG  1 
ATOM   1095 C CD  . LYS A 1 138 ? 33.687 -20.707 34.688 1.00 45.93 ? 138 LYS A CD  1 
ATOM   1096 C CE  . LYS A 1 138 ? 32.306 -20.056 34.773 1.00 46.10 ? 138 LYS A CE  1 
ATOM   1097 N NZ  . LYS A 1 138 ? 31.370 -20.827 33.865 1.00 44.30 ? 138 LYS A NZ  1 
ATOM   1098 N N   . GLY A 1 139 ? 34.655 -17.892 39.539 1.00 50.93 ? 139 GLY A N   1 
ATOM   1099 C CA  . GLY A 1 139 ? 34.109 -17.560 40.893 1.00 53.12 ? 139 GLY A CA  1 
ATOM   1100 C C   . GLY A 1 139 ? 35.088 -16.603 41.606 1.00 54.70 ? 139 GLY A C   1 
ATOM   1101 O O   . GLY A 1 139 ? 36.205 -16.869 42.048 1.00 54.43 ? 139 GLY A O   1 
ATOM   1102 N N   . GLY A 1 140 ? 34.499 -15.412 41.701 1.00 55.76 ? 140 GLY A N   1 
ATOM   1103 C CA  . GLY A 1 140 ? 35.029 -14.205 42.303 1.00 55.62 ? 140 GLY A CA  1 
ATOM   1104 C C   . GLY A 1 140 ? 36.531 -14.239 42.546 1.00 54.07 ? 140 GLY A C   1 
ATOM   1105 O O   . GLY A 1 140 ? 36.981 -14.660 43.660 1.00 55.94 ? 140 GLY A O   1 
ATOM   1106 N N   . GLN A 1 141 ? 37.218 -13.733 41.532 1.00 50.58 ? 141 GLN A N   1 
ATOM   1107 C CA  . GLN A 1 141 ? 38.743 -13.728 41.801 1.00 47.13 ? 141 GLN A CA  1 
ATOM   1108 C C   . GLN A 1 141 ? 39.266 -13.253 40.460 1.00 42.67 ? 141 GLN A C   1 
ATOM   1109 O O   . GLN A 1 141 ? 39.265 -12.037 40.194 1.00 42.94 ? 141 GLN A O   1 
ATOM   1110 C CB  . GLN A 1 141 ? 38.991 -15.123 42.288 1.00 49.83 ? 141 GLN A CB  1 
ATOM   1111 C CG  . GLN A 1 141 ? 40.287 -15.369 43.037 1.00 53.27 ? 141 GLN A CG  1 
ATOM   1112 C CD  . GLN A 1 141 ? 40.178 -16.718 43.743 1.00 55.47 ? 141 GLN A CD  1 
ATOM   1113 O OE1 . GLN A 1 141 ? 39.325 -16.917 44.609 1.00 56.19 ? 141 GLN A OE1 1 
ATOM   1114 N NE2 . GLN A 1 141 ? 41.044 -17.631 43.352 1.00 57.27 ? 141 GLN A NE2 1 
ATOM   1115 N N   . ASP A 1 142 ? 39.576 -14.207 39.636 1.00 37.33 ? 142 ASP A N   1 
ATOM   1116 C CA  . ASP A 1 142 ? 40.013 -13.896 38.245 1.00 31.74 ? 142 ASP A CA  1 
ATOM   1117 C C   . ASP A 1 142 ? 38.766 -13.757 37.399 1.00 28.11 ? 142 ASP A C   1 
ATOM   1118 O O   . ASP A 1 142 ? 37.708 -14.414 37.676 1.00 28.04 ? 142 ASP A O   1 
ATOM   1119 C CB  . ASP A 1 142 ? 40.911 -15.086 37.865 1.00 31.21 ? 142 ASP A CB  1 
ATOM   1120 C CG  . ASP A 1 142 ? 42.099 -14.987 38.843 1.00 29.87 ? 142 ASP A CG  1 
ATOM   1121 O OD1 . ASP A 1 142 ? 42.444 -13.825 39.181 1.00 31.90 ? 142 ASP A OD1 1 
ATOM   1122 O OD2 . ASP A 1 142 ? 42.594 -16.012 39.166 1.00 30.27 ? 142 ASP A OD2 1 
ATOM   1123 N N   . ILE A 1 143 ? 38.926 -12.965 36.358 1.00 23.13 ? 143 ILE A N   1 
ATOM   1124 C CA  . ILE A 1 143 ? 37.808 -12.734 35.424 1.00 18.55 ? 143 ILE A CA  1 
ATOM   1125 C C   . ILE A 1 143 ? 37.884 -13.741 34.313 1.00 17.28 ? 143 ILE A C   1 
ATOM   1126 O O   . ILE A 1 143 ? 38.972 -13.955 33.765 1.00 16.83 ? 143 ILE A O   1 
ATOM   1127 C CB  . ILE A 1 143 ? 38.050 -11.261 34.934 1.00 16.21 ? 143 ILE A CB  1 
ATOM   1128 C CG1 . ILE A 1 143 ? 37.983 -10.407 36.240 1.00 14.77 ? 143 ILE A CG1 1 
ATOM   1129 C CG2 . ILE A 1 143 ? 37.147 -10.818 33.825 1.00 12.79 ? 143 ILE A CG2 1 
ATOM   1130 C CD1 . ILE A 1 143 ? 38.507 -8.989  35.868 1.00 14.92 ? 143 ILE A CD1 1 
ATOM   1131 N N   . THR A 1 144 ? 36.771 -14.311 33.974 1.00 16.73 ? 144 THR A N   1 
ATOM   1132 C CA  . THR A 1 144 ? 36.683 -15.314 32.914 1.00 16.89 ? 144 THR A CA  1 
ATOM   1133 C C   . THR A 1 144 ? 35.685 -14.871 31.924 1.00 15.85 ? 144 THR A C   1 
ATOM   1134 O O   . THR A 1 144 ? 35.484 -15.542 30.906 1.00 17.57 ? 144 THR A O   1 
ATOM   1135 C CB  . THR A 1 144 ? 36.410 -16.761 33.503 1.00 19.02 ? 144 THR A CB  1 
ATOM   1136 O OG1 . THR A 1 144 ? 35.165 -16.634 34.230 1.00 20.17 ? 144 THR A OG1 1 
ATOM   1137 C CG2 . THR A 1 144 ? 37.438 -17.293 34.459 1.00 20.59 ? 144 THR A CG2 1 
ATOM   1138 N N   . ASP A 1 145 ? 35.037 -13.736 32.037 1.00 16.41 ? 145 ASP A N   1 
ATOM   1139 C CA  . ASP A 1 145 ? 34.108 -13.238 31.042 1.00 17.58 ? 145 ASP A CA  1 
ATOM   1140 C C   . ASP A 1 145 ? 34.436 -11.995 30.299 1.00 15.86 ? 145 ASP A C   1 
ATOM   1141 O O   . ASP A 1 145 ? 34.871 -10.987 30.920 1.00 16.75 ? 145 ASP A O   1 
ATOM   1142 C CB  . ASP A 1 145 ? 32.636 -13.461 31.216 1.00 24.57 ? 145 ASP A CB  1 
ATOM   1143 C CG  . ASP A 1 145 ? 32.212 -13.126 32.606 1.00 29.53 ? 145 ASP A CG  1 
ATOM   1144 O OD1 . ASP A 1 145 ? 31.556 -14.084 33.110 1.00 34.32 ? 145 ASP A OD1 1 
ATOM   1145 O OD2 . ASP A 1 145 ? 32.694 -12.090 33.074 1.00 31.17 ? 145 ASP A OD2 1 
ATOM   1146 N N   . PHE A 1 146 ? 34.086 -12.049 29.034 1.00 14.64 ? 146 PHE A N   1 
ATOM   1147 C CA  . PHE A 1 146 ? 34.390 -10.974 28.107 1.00 15.33 ? 146 PHE A CA  1 
ATOM   1148 C C   . PHE A 1 146 ? 33.240 -10.543 27.255 1.00 16.39 ? 146 PHE A C   1 
ATOM   1149 O O   . PHE A 1 146 ? 32.284 -11.252 27.075 1.00 19.44 ? 146 PHE A O   1 
ATOM   1150 C CB  . PHE A 1 146 ? 35.386 -11.643 27.009 1.00 14.04 ? 146 PHE A CB  1 
ATOM   1151 C CG  . PHE A 1 146 ? 36.597 -12.091 27.726 1.00 14.99 ? 146 PHE A CG  1 
ATOM   1152 C CD1 . PHE A 1 146 ? 36.670 -13.360 28.317 1.00 15.93 ? 146 PHE A CD1 1 
ATOM   1153 C CD2 . PHE A 1 146 ? 37.688 -11.265 27.810 1.00 15.06 ? 146 PHE A CD2 1 
ATOM   1154 C CE1 . PHE A 1 146 ? 37.776 -13.721 29.014 1.00 17.75 ? 146 PHE A CE1 1 
ATOM   1155 C CE2 . PHE A 1 146 ? 38.835 -11.622 28.512 1.00 16.92 ? 146 PHE A CE2 1 
ATOM   1156 C CZ  . PHE A 1 146 ? 38.875 -12.845 29.159 1.00 16.09 ? 146 PHE A CZ  1 
ATOM   1157 N N   . THR A 1 147 ? 33.430 -9.463  26.559 1.00 18.04 ? 147 THR A N   1 
ATOM   1158 C CA  . THR A 1 147 ? 32.498 -8.952  25.561 1.00 18.12 ? 147 THR A CA  1 
ATOM   1159 C C   . THR A 1 147 ? 33.421 -8.908  24.301 1.00 18.79 ? 147 THR A C   1 
ATOM   1160 O O   . THR A 1 147 ? 34.670 -8.854  24.467 1.00 17.83 ? 147 THR A O   1 
ATOM   1161 C CB  . THR A 1 147 ? 31.779 -7.607  25.796 1.00 19.92 ? 147 THR A CB  1 
ATOM   1162 O OG1 . THR A 1 147 ? 32.755 -6.563  25.925 1.00 21.24 ? 147 THR A OG1 1 
ATOM   1163 C CG2 . THR A 1 147 ? 30.871 -7.628  27.035 1.00 22.93 ? 147 THR A CG2 1 
ATOM   1164 N N   . MET A 1 148 ? 32.737 -8.948  23.215 1.00 18.75 ? 148 MET A N   1 
ATOM   1165 C CA  . MET A 1 148 ? 33.393 -8.911  21.911 1.00 19.18 ? 148 MET A CA  1 
ATOM   1166 C C   . MET A 1 148 ? 32.906 -7.754  21.107 1.00 19.24 ? 148 MET A C   1 
ATOM   1167 O O   . MET A 1 148 ? 31.723 -7.372  21.152 1.00 19.62 ? 148 MET A O   1 
ATOM   1168 C CB  . MET A 1 148 ? 33.054 -10.275 21.331 1.00 20.19 ? 148 MET A CB  1 
ATOM   1169 C CG  . MET A 1 148 ? 33.434 -10.326 19.915 1.00 25.32 ? 148 MET A CG  1 
ATOM   1170 S SD  . MET A 1 148 ? 33.053 -12.038 19.313 1.00 31.28 ? 148 MET A SD  1 
ATOM   1171 C CE  . MET A 1 148 ? 33.198 -11.634 17.545 1.00 31.49 ? 148 MET A CE  1 
ATOM   1172 N N   . GLN A 1 149 ? 33.746 -7.134  20.291 1.00 19.17 ? 149 GLN A N   1 
ATOM   1173 C CA  . GLN A 1 149 ? 33.346 -6.000  19.448 1.00 19.03 ? 149 GLN A CA  1 
ATOM   1174 C C   . GLN A 1 149 ? 33.764 -6.427  18.056 1.00 21.23 ? 149 GLN A C   1 
ATOM   1175 O O   . GLN A 1 149 ? 34.877 -6.973  17.892 1.00 20.80 ? 149 GLN A O   1 
ATOM   1176 C CB  . GLN A 1 149 ? 34.021 -4.705  19.903 1.00 18.22 ? 149 GLN A CB  1 
ATOM   1177 C CG  . GLN A 1 149 ? 33.891 -4.242  21.302 1.00 18.66 ? 149 GLN A CG  1 
ATOM   1178 C CD  . GLN A 1 149 ? 34.519 -5.013  22.415 1.00 19.31 ? 149 GLN A CD  1 
ATOM   1179 O OE1 . GLN A 1 149 ? 35.713 -5.363  22.325 1.00 18.20 ? 149 GLN A OE1 1 
ATOM   1180 N NE2 . GLN A 1 149 ? 33.834 -5.272  23.516 1.00 20.15 ? 149 GLN A NE2 1 
ATOM   1181 N N   . PHE A 1 150 ? 32.899 -6.243  17.102 1.00 25.32 ? 150 PHE A N   1 
ATOM   1182 C CA  . PHE A 1 150 ? 33.243 -6.549  15.691 1.00 28.69 ? 150 PHE A CA  1 
ATOM   1183 C C   . PHE A 1 150 ? 34.000 -5.318  15.152 1.00 31.96 ? 150 PHE A C   1 
ATOM   1184 O O   . PHE A 1 150 ? 33.765 -4.169  15.544 1.00 35.19 ? 150 PHE A O   1 
ATOM   1185 C CB  . PHE A 1 150 ? 32.084 -6.945  14.844 1.00 26.07 ? 150 PHE A CB  1 
ATOM   1186 C CG  . PHE A 1 150 ? 31.360 -8.145  15.335 1.00 24.61 ? 150 PHE A CG  1 
ATOM   1187 C CD1 . PHE A 1 150 ? 30.545 -8.011  16.460 1.00 26.73 ? 150 PHE A CD1 1 
ATOM   1188 C CD2 . PHE A 1 150 ? 31.443 -9.350  14.719 1.00 27.97 ? 150 PHE A CD2 1 
ATOM   1189 C CE1 . PHE A 1 150 ? 29.870 -9.089  16.985 1.00 26.80 ? 150 PHE A CE1 1 
ATOM   1190 C CE2 . PHE A 1 150 ? 30.787 -10.501 15.194 1.00 27.88 ? 150 PHE A CE2 1 
ATOM   1191 C CZ  . PHE A 1 150 ? 30.015 -10.337 16.351 1.00 28.13 ? 150 PHE A CZ  1 
ATOM   1192 N N   . VAL A 1 151 ? 34.954 -5.638  14.324 1.00 34.69 ? 151 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 151 ? 35.779 -4.592  13.659 1.00 37.64 ? 151 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 151 ? 35.768 -5.006  12.210 1.00 40.72 ? 151 VAL A C   1 
ATOM   1195 O O   . VAL A 1 151 ? 35.501 -6.206  11.964 1.00 40.49 ? 151 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 151 ? 37.054 -4.443  14.434 1.00 37.07 ? 151 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 151 ? 36.838 -4.193  15.909 1.00 37.18 ? 151 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 151 ? 38.022 -5.568  14.195 1.00 37.70 ? 151 VAL A CG2 1 
ATOM   1199 N N   . SER A 1 152 ? 35.997 -4.123  11.256 1.00 46.08 ? 152 SER A N   1 
ATOM   1200 C CA  . SER A 1 152 ? 35.946 -4.536  9.858  1.00 51.27 ? 152 SER A CA  1 
ATOM   1201 C C   . SER A 1 152 ? 37.042 -5.203  9.074  1.00 54.01 ? 152 SER A C   1 
ATOM   1202 O O   . SER A 1 152 ? 38.287 -5.185  9.163  1.00 55.07 ? 152 SER A O   1 
ATOM   1203 C CB  . SER A 1 152 ? 35.310 -3.421  8.989  1.00 53.85 ? 152 SER A CB  1 
ATOM   1204 O OG  . SER A 1 152 ? 35.255 -3.951  7.638  1.00 56.38 ? 152 SER A OG  1 
ATOM   1205 N N   . SER A 1 153 ? 36.488 -5.905  8.074  1.00 56.10 ? 153 SER A N   1 
ATOM   1206 C CA  . SER A 1 153 ? 37.195 -6.615  7.004  1.00 58.35 ? 153 SER A CA  1 
ATOM   1207 C C   . SER A 1 153 ? 36.829 -5.713  5.765  1.00 59.48 ? 153 SER A C   1 
ATOM   1208 O O   . SER A 1 153 ? 37.768 -4.998  5.326  1.00 60.63 ? 153 SER A O   1 
ATOM   1209 C CB  . SER A 1 153 ? 36.786 -8.045  6.797  1.00 59.38 ? 153 SER A CB  1 
ATOM   1210 O OG  . SER A 1 153 ? 37.497 -8.696  5.736  1.00 59.77 ? 153 SER A OG  1 
ATOM   1211 O OXT . SER A 1 153 ? 35.628 -5.718  5.429  1.00 58.90 ? 153 SER A OXT 1 
HETATM 1212 O O   . HOH B 2 .   ? 40.835 -5.435  23.624 1.00 17.41 ? 201 HOH A O   1 
HETATM 1213 O O   . HOH B 2 .   ? 45.751 -7.457  33.984 1.00 19.44 ? 202 HOH A O   1 
HETATM 1214 O O   . HOH B 2 .   ? 42.624 -26.054 23.896 1.00 17.85 ? 203 HOH A O   1 
HETATM 1215 O O   . HOH B 2 .   ? 46.908 -8.279  15.683 0.60 37.67 ? 204 HOH A O   1 
HETATM 1216 O O   . HOH B 2 .   ? 49.381 -14.505 27.476 1.00 18.53 ? 205 HOH A O   1 
HETATM 1217 O O   . HOH B 2 .   ? 38.629 1.580   18.218 0.60 34.83 ? 206 HOH A O   1 
HETATM 1218 O O   . HOH B 2 .   ? 37.112 -2.352  19.144 0.80 21.26 ? 207 HOH A O   1 
HETATM 1219 O O   . HOH B 2 .   ? 41.813 -17.540 13.312 1.00 20.13 ? 208 HOH A O   1 
HETATM 1220 O O   . HOH B 2 .   ? 41.786 -1.387  17.263 0.80 36.48 ? 209 HOH A O   1 
HETATM 1221 O O   . HOH B 2 .   ? 32.606 -27.691 30.522 0.60 25.00 ? 211 HOH A O   1 
HETATM 1222 O O   . HOH B 2 .   ? 43.612 -20.647 19.056 1.00 12.64 ? 212 HOH A O   1 
HETATM 1223 O O   . HOH B 2 .   ? 48.137 -12.802 35.260 0.60 21.90 ? 213 HOH A O   1 
HETATM 1224 O O   . HOH B 2 .   ? 48.083 -29.156 24.587 0.80 19.78 ? 214 HOH A O   1 
HETATM 1225 O O   . HOH B 2 .   ? 50.165 -30.534 26.376 1.00 27.71 ? 215 HOH A O   1 
HETATM 1226 O O   . HOH B 2 .   ? 48.604 -19.587 31.693 1.00 22.38 ? 216 HOH A O   1 
HETATM 1227 O O   . HOH B 2 .   ? 55.790 -20.652 18.896 0.80 23.19 ? 217 HOH A O   1 
HETATM 1228 O O   . HOH B 2 .   ? 36.958 -17.247 29.455 1.00 14.06 ? 218 HOH A O   1 
HETATM 1229 O O   . HOH B 2 .   ? 43.711 -21.134 38.587 0.80 35.59 ? 219 HOH A O   1 
HETATM 1230 O O   . HOH B 2 .   ? 43.200 -15.148 42.999 0.60 41.63 ? 220 HOH A O   1 
HETATM 1231 O O   . HOH B 2 .   ? 47.329 -30.721 19.971 0.80 33.21 ? 221 HOH A O   1 
HETATM 1232 O O   . HOH B 2 .   ? 41.219 -29.185 36.932 0.60 28.91 ? 222 HOH A O   1 
HETATM 1233 O O   . HOH B 2 .   ? 40.310 -5.377  36.820 1.00 23.04 ? 223 HOH A O   1 
HETATM 1234 O O   . HOH B 2 .   ? 36.423 -15.120 6.220  0.40 35.04 ? 224 HOH A O   1 
HETATM 1235 O O   . HOH B 2 .   ? 33.324 -5.861  28.701 0.80 19.90 ? 225 HOH A O   1 
HETATM 1236 O O   . HOH B 2 .   ? 48.693 -4.469  18.712 0.80 36.10 ? 226 HOH A O   1 
HETATM 1237 O O   . HOH B 2 .   ? 55.091 -7.723  20.479 0.80 30.54 ? 227 HOH A O   1 
HETATM 1238 O O   . HOH B 2 .   ? 49.236 -4.522  21.194 1.00 33.18 ? 228 HOH A O   1 
HETATM 1239 O O   . HOH B 2 .   ? 51.196 -3.707  19.799 0.60 35.95 ? 229 HOH A O   1 
HETATM 1240 O O   . HOH B 2 .   ? 41.423 -7.513  21.972 1.00 13.92 ? 230 HOH A O   1 
HETATM 1241 O O   . HOH B 2 .   ? 32.905 -23.550 15.026 1.00 24.57 ? 231 HOH A O   1 
HETATM 1242 O O   . HOH B 2 .   ? 25.459 -21.664 28.451 0.80 48.83 ? 232 HOH A O   1 
HETATM 1243 O O   . HOH B 2 .   ? 44.265 -12.600 9.651  0.80 28.00 ? 233 HOH A O   1 
HETATM 1244 O O   . HOH B 2 .   ? 40.129 -18.596 36.198 1.00 30.04 ? 234 HOH A O   1 
HETATM 1245 O O   . HOH B 2 .   ? 42.398 -11.496 40.126 1.00 31.44 ? 235 HOH A O   1 
HETATM 1246 O O   . HOH B 2 .   ? 39.829 -0.843  28.196 1.00 22.23 ? 236 HOH A O   1 
HETATM 1247 O O   . HOH B 2 .   ? 30.213 -22.573 14.105 0.80 24.38 ? 237 HOH A O   1 
HETATM 1248 O O   . HOH B 2 .   ? 28.996 -19.333 21.612 0.80 20.15 ? 238 HOH A O   1 
HETATM 1249 O O   . HOH B 2 .   ? 52.943 -24.739 12.100 0.80 24.79 ? 239 HOH A O   1 
HETATM 1250 O O   . HOH B 2 .   ? 45.105 -32.669 17.956 0.60 29.37 ? 240 HOH A O   1 
HETATM 1251 O O   . HOH B 2 .   ? 52.215 -29.236 22.426 0.60 33.99 ? 241 HOH A O   1 
HETATM 1252 O O   . HOH B 2 .   ? 28.101 -14.999 21.241 0.60 44.32 ? 242 HOH A O   1 
HETATM 1253 O O   . HOH B 2 .   ? 23.875 -11.521 20.569 0.60 36.39 ? 243 HOH A O   1 
HETATM 1254 O O   . HOH B 2 .   ? 45.477 -10.292 33.423 0.80 18.65 ? 244 HOH A O   1 
HETATM 1255 O O   . HOH B 2 .   ? 45.838 -20.978 37.300 0.60 38.04 ? 245 HOH A O   1 
HETATM 1256 O O   . HOH B 2 .   ? 29.973 -9.451  23.309 0.60 20.66 ? 246 HOH A O   1 
HETATM 1257 O O   . HOH B 2 .   ? 34.591 -6.004  41.262 0.60 31.12 ? 247 HOH A O   1 
HETATM 1258 O O   . HOH B 2 .   ? 32.279 -4.066  40.395 0.80 34.80 ? 248 HOH A O   1 
HETATM 1259 O O   . HOH B 2 .   ? 55.284 -19.934 22.240 0.40 17.71 ? 249 HOH A O   1 
HETATM 1260 O O   . HOH B 2 .   ? 33.823 -26.118 10.542 0.60 38.36 ? 250 HOH A O   1 
HETATM 1261 O O   . HOH B 2 .   ? 29.997 -29.522 28.079 0.60 29.98 ? 251 HOH A O   1 
HETATM 1262 O O   . HOH B 2 .   ? 47.805 -21.592 33.610 0.80 23.86 ? 252 HOH A O   1 
HETATM 1263 O O   . HOH B 2 .   ? 54.072 -14.615 33.484 0.60 39.79 ? 253 HOH A O   1 
HETATM 1264 O O   . HOH B 2 .   ? 54.122 -28.808 24.208 0.60 34.44 ? 254 HOH A O   1 
HETATM 1265 O O   . HOH B 2 .   ? 34.503 -21.880 9.072  0.60 25.35 ? 255 HOH A O   1 
HETATM 1266 O O   . HOH B 2 .   ? 53.395 -17.538 25.089 0.80 22.23 ? 256 HOH A O   1 
HETATM 1267 O O   . HOH B 2 .   ? 35.463 -8.737  10.111 0.80 32.30 ? 257 HOH A O   1 
HETATM 1268 O O   . HOH B 2 .   ? 34.364 -13.342 35.524 0.60 14.74 ? 258 HOH A O   1 
HETATM 1269 O O   . HOH B 2 .   ? 33.223 -14.478 7.753  0.60 27.99 ? 259 HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? 38.784 -32.418 25.414 0.60 29.75 ? 260 HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? 35.039 -28.328 21.160 0.60 26.46 ? 261 HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? 39.204 -28.293 14.548 0.60 25.75 ? 262 HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? 38.377 -2.500  23.946 0.60 25.02 ? 263 HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? 46.740 -3.215  39.725 0.80 28.11 ? 264 HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? 49.886 -16.740 30.984 0.60 22.24 ? 265 HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? 51.863 -16.353 28.664 0.60 25.83 ? 266 HOH A O   1 
HETATM 1277 O O   . HOH B 2 .   ? 39.433 -29.337 35.349 0.60 25.24 ? 267 HOH A O   1 
HETATM 1278 O O   . HOH B 2 .   ? 41.859 -18.870 38.184 0.60 31.23 ? 268 HOH A O   1 
HETATM 1279 O O   . HOH B 2 .   ? 46.141 -14.978 12.702 0.40 25.87 ? 269 HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? 51.170 -8.294  10.368 0.60 29.01 ? 270 HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? 53.163 -26.258 21.341 0.60 27.37 ? 271 HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? 41.252 -25.979 5.506  0.60 28.02 ? 272 HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? 50.768 -27.380 13.868 0.60 27.32 ? 273 HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? 39.530 -30.051 17.741 0.60 32.62 ? 274 HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? 32.906 -24.952 34.162 0.40 24.17 ? 275 HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? 37.175 -29.269 36.632 0.40 21.12 ? 276 HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? 35.319 -3.319  36.988 0.40 28.98 ? 277 HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? 57.163 -22.288 15.238 0.40 21.56 ? 278 HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? 29.639 -20.351 4.098  0.60 34.88 ? 279 HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? 29.428 -7.657  20.501 0.40 19.55 ? 280 HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? 30.712 -3.946  23.289 0.40 24.54 ? 281 HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? 55.137 -30.161 31.682 0.40 37.25 ? 282 HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? 41.411 -28.162 7.247  0.40 26.04 ? 283 HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? 56.593 -13.173 24.912 0.40 31.61 ? 284 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 SER 153 153 153 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  201 201 HOH HOH A . 
B 2 HOH 2  202 202 HOH HOH A . 
B 2 HOH 3  203 203 HOH HOH A . 
B 2 HOH 4  204 204 HOH HOH A . 
B 2 HOH 5  205 205 HOH HOH A . 
B 2 HOH 6  206 206 HOH HOH A . 
B 2 HOH 7  207 207 HOH HOH A . 
B 2 HOH 8  208 208 HOH HOH A . 
B 2 HOH 9  209 209 HOH HOH A . 
B 2 HOH 10 211 211 HOH HOH A . 
B 2 HOH 11 212 212 HOH HOH A . 
B 2 HOH 12 213 213 HOH HOH A . 
B 2 HOH 13 214 214 HOH HOH A . 
B 2 HOH 14 215 215 HOH HOH A . 
B 2 HOH 15 216 216 HOH HOH A . 
B 2 HOH 16 217 217 HOH HOH A . 
B 2 HOH 17 218 218 HOH HOH A . 
B 2 HOH 18 219 219 HOH HOH A . 
B 2 HOH 19 220 220 HOH HOH A . 
B 2 HOH 20 221 221 HOH HOH A . 
B 2 HOH 21 222 222 HOH HOH A . 
B 2 HOH 22 223 223 HOH HOH A . 
B 2 HOH 23 224 224 HOH HOH A . 
B 2 HOH 24 225 225 HOH HOH A . 
B 2 HOH 25 226 226 HOH HOH A . 
B 2 HOH 26 227 227 HOH HOH A . 
B 2 HOH 27 228 228 HOH HOH A . 
B 2 HOH 28 229 229 HOH HOH A . 
B 2 HOH 29 230 230 HOH HOH A . 
B 2 HOH 30 231 231 HOH HOH A . 
B 2 HOH 31 232 232 HOH HOH A . 
B 2 HOH 32 233 233 HOH HOH A . 
B 2 HOH 33 234 234 HOH HOH A . 
B 2 HOH 34 235 235 HOH HOH A . 
B 2 HOH 35 236 236 HOH HOH A . 
B 2 HOH 36 237 237 HOH HOH A . 
B 2 HOH 37 238 238 HOH HOH A . 
B 2 HOH 38 239 239 HOH HOH A . 
B 2 HOH 39 240 240 HOH HOH A . 
B 2 HOH 40 241 241 HOH HOH A . 
B 2 HOH 41 242 242 HOH HOH A . 
B 2 HOH 42 243 243 HOH HOH A . 
B 2 HOH 43 244 244 HOH HOH A . 
B 2 HOH 44 245 245 HOH HOH A . 
B 2 HOH 45 246 246 HOH HOH A . 
B 2 HOH 46 247 247 HOH HOH A . 
B 2 HOH 47 248 248 HOH HOH A . 
B 2 HOH 48 249 249 HOH HOH A . 
B 2 HOH 49 250 250 HOH HOH A . 
B 2 HOH 50 251 251 HOH HOH A . 
B 2 HOH 51 252 252 HOH HOH A . 
B 2 HOH 52 253 253 HOH HOH A . 
B 2 HOH 53 254 254 HOH HOH A . 
B 2 HOH 54 255 255 HOH HOH A . 
B 2 HOH 55 256 256 HOH HOH A . 
B 2 HOH 56 257 257 HOH HOH A . 
B 2 HOH 57 258 258 HOH HOH A . 
B 2 HOH 58 259 259 HOH HOH A . 
B 2 HOH 59 260 260 HOH HOH A . 
B 2 HOH 60 261 261 HOH HOH A . 
B 2 HOH 61 262 262 HOH HOH A . 
B 2 HOH 62 263 263 HOH HOH A . 
B 2 HOH 63 264 264 HOH HOH A . 
B 2 HOH 64 265 265 HOH HOH A . 
B 2 HOH 65 266 266 HOH HOH A . 
B 2 HOH 66 267 267 HOH HOH A . 
B 2 HOH 67 268 268 HOH HOH A . 
B 2 HOH 68 269 269 HOH HOH A . 
B 2 HOH 69 270 270 HOH HOH A . 
B 2 HOH 70 271 271 HOH HOH A . 
B 2 HOH 71 272 272 HOH HOH A . 
B 2 HOH 72 273 273 HOH HOH A . 
B 2 HOH 73 274 274 HOH HOH A . 
B 2 HOH 74 275 275 HOH HOH A . 
B 2 HOH 75 276 276 HOH HOH A . 
B 2 HOH 76 277 277 HOH HOH A . 
B 2 HOH 77 278 278 HOH HOH A . 
B 2 HOH 78 279 279 HOH HOH A . 
B 2 HOH 79 280 280 HOH HOH A . 
B 2 HOH 80 281 281 HOH HOH A . 
B 2 HOH 81 282 282 HOH HOH A . 
B 2 HOH 82 283 283 HOH HOH A . 
B 2 HOH 83 284 284 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1990-01-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THE SHEET PRESENTED AS *BRL* ON SHEET RECORDS BELOW IS
ACTUALLY A SIX-STRANDED BETA-BARREL.  THIS IS
REPRESENTED BY A SEVEN-STRANDED SHEET IN WHICH THE FIRST
AND LAST STRANDS ARE IDENTICAL.
;
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             70 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             70 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.328 
_pdbx_validate_rmsd_bond.bond_target_value         1.418 
_pdbx_validate_rmsd_bond.bond_deviation            -0.090 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 4   ? ? CZ A ARG 4   ? ? NH2 A ARG 4   ? ? 114.82 120.30 -5.48  0.50 N 
2  1 N  A LEU 6   ? ? CA A LEU 6   ? ? CB  A LEU 6   ? ? 91.73  110.40 -18.67 2.00 N 
3  1 CD A ARG 11  ? ? NE A ARG 11  ? ? CZ  A ARG 11  ? ? 110.49 123.60 -13.11 1.40 N 
4  1 NE A ARG 11  ? ? CZ A ARG 11  ? ? NH2 A ARG 11  ? ? 116.61 120.30 -3.69  0.50 N 
5  1 CA A GLN 14  ? ? CB A GLN 14  ? ? CG  A GLN 14  ? ? 127.37 113.40 13.97  2.20 N 
6  1 N  A GLU 25  ? ? CA A GLU 25  ? ? CB  A GLU 25  ? ? 123.48 110.60 12.88  1.80 N 
7  1 CA A GLU 25  ? ? CB A GLU 25  ? ? CG  A GLU 25  ? ? 130.00 113.40 16.60  2.20 N 
8  1 CG A MET 44  ? ? SD A MET 44  ? ? CE  A MET 44  ? ? 110.33 100.20 10.13  1.60 N 
9  1 N  A GLU 51  ? ? CA A GLU 51  ? ? CB  A GLU 51  ? ? 122.70 110.60 12.10  1.80 N 
10 1 N  A LYS 55  ? ? CA A LYS 55  ? ? CB  A LYS 55  ? ? 121.55 110.60 10.95  1.80 N 
11 1 N  A GLU 64  ? A CA A GLU 64  ? A CB  A GLU 64  ? A 124.74 110.60 14.14  1.80 N 
12 1 CB A ASP 75  ? ? CG A ASP 75  ? ? OD1 A ASP 75  ? ? 125.13 118.30 6.83   0.90 N 
13 1 CA A LYS 77  ? ? CB A LYS 77  ? ? CG  A LYS 77  ? ? 136.68 113.40 23.28  2.20 N 
14 1 CB A LYS 92  ? ? CA A LYS 92  ? ? C   A LYS 92  ? ? 97.14  110.40 -13.26 2.00 N 
15 1 CG A GLU 96  ? ? CD A GLU 96  ? ? OE1 A GLU 96  ? ? 130.63 118.30 12.33  2.00 N 
16 1 CB A TYR 121 ? ? CG A TYR 121 ? ? CD2 A TYR 121 ? ? 116.05 121.00 -4.95  0.60 N 
17 1 CB A TYR 121 ? ? CG A TYR 121 ? ? CD1 A TYR 121 ? ? 125.69 121.00 4.69   0.60 N 
18 1 CA A GLN 126 ? ? CB A GLN 126 ? ? CG  A GLN 126 ? ? 127.35 113.40 13.95  2.20 N 
19 1 CB A GLU 128 ? ? CA A GLU 128 ? ? C   A GLU 128 ? ? 97.01  110.40 -13.39 2.00 N 
20 1 CB A ASP 145 ? ? CG A ASP 145 ? ? OD1 A ASP 145 ? ? 110.39 118.30 -7.91  0.90 N 
21 1 CA A SER 152 ? ? C  A SER 152 ? ? O   A SER 152 ? ? 133.11 120.10 13.01  2.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 13  ? ? -68.77 0.55   
2 1 SER A 21  ? ? -74.90 -72.17 
3 1 ASP A 75  ? ? 70.43  42.08  
4 1 ASN A 108 ? ? 68.79  -10.85 
5 1 GLN A 141 ? ? 174.28 -92.89 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     4 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.116 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 93 ? CG ? A LYS 93 CG 
2 1 Y 1 A LYS 93 ? CD ? A LYS 93 CD 
3 1 Y 1 A LYS 93 ? CE ? A LYS 93 CE 
4 1 Y 1 A LYS 93 ? NZ ? A LYS 93 NZ 
5 1 Y 1 A LYS 94 ? CG ? A LYS 94 CG 
6 1 Y 1 A LYS 94 ? CD ? A LYS 94 CD 
7 1 Y 1 A LYS 94 ? CE ? A LYS 94 CE 
8 1 Y 1 A LYS 94 ? NZ ? A LYS 94 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 1 ? A ALA 1 
2 1 Y 1 A PRO 2 ? A PRO 2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#