data_1I3O
# 
_entry.id   1I3O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1I3O         pdb_00001i3o 10.2210/pdb1i3o/pdb 
RCSB  RCSB012863   ?            ?                   
WWPDB D_1000012863 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1C9Q '1C9Q IS THE NMR structure of XIAP-BIR2'   unspecified 
PDB 1PAU '1PAU IS DEVD aldehyde bound to caspase 3' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I3O 
_pdbx_database_status.recvd_initial_deposition_date   2001-02-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Riedl, S.J.'         1 
'Renatus, M.'         2 
'Schwarzenbacher, R.' 3 
'Zhou, Q.'            4 
'Sun, C.'             5 
'Fesik, S.W.'         6 
'Liddington, R.C.'    7 
'Salvesen, G.S.'      8 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for the inhibition of caspase-3 by XIAP.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            104 
_citation.page_first                791 
_citation.page_last                 800 
_citation.year                      2001 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11257232 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(01)00274-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Riedl, S.J.'         1 ? 
primary 'Renatus, M.'         2 ? 
primary 'Schwarzenbacher, R.' 3 ? 
primary 'Zhou, Q.'            4 ? 
primary 'Sun, C.'             5 ? 
primary 'Fesik, S.W.'         6 ? 
primary 'Liddington, R.C.'    7 ? 
primary 'Salvesen, G.S.'      8 ? 
# 
_cell.entry_id           1I3O 
_cell.length_a           70.700 
_cell.length_b           95.500 
_cell.length_c           144.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I3O 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CASPASE 3'                                   19727.279 2  3.4.22.- C285A          'APOPAIN P17 SUBUNIT' ? 
2 polymer     man 'CASPASE 3'                                   12981.756 2  3.4.22.- ?              'APOPAIN P12 SUBUNIT' ? 
3 polymer     man 'BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 4' 13993.578 2  ?        'C202A, C213G' XIAP-BIR2             ? 
4 non-polymer syn 'ZINC ION'                                    65.409    2  ?        ?              ?                     ? 
5 water       nat water                                         18.015    13 ?        ?              ?                     ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'X-LINKED IAP' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN
LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
QAARGTELDCGIETD
;
;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN
LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
QAARGTELDCGIETD
;
A,C ? 
2 'polypeptide(L)' no no 
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYHLEHHHHHH
;
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYHLEHHHHHH
;
B,D ? 
3 'polypeptide(L)' no no 
;GSHMRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQ
CFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE
;
;GSHMRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQ
CFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE
;
E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ASN n 
1 4   THR n 
1 5   GLU n 
1 6   ASN n 
1 7   SER n 
1 8   VAL n 
1 9   ASP n 
1 10  SER n 
1 11  LYS n 
1 12  SER n 
1 13  ILE n 
1 14  LYS n 
1 15  ASN n 
1 16  LEU n 
1 17  GLU n 
1 18  PRO n 
1 19  LYS n 
1 20  ILE n 
1 21  ILE n 
1 22  HIS n 
1 23  GLY n 
1 24  SER n 
1 25  GLU n 
1 26  SER n 
1 27  MET n 
1 28  ASP n 
1 29  SER n 
1 30  GLY n 
1 31  ILE n 
1 32  SER n 
1 33  LEU n 
1 34  ASP n 
1 35  ASN n 
1 36  SER n 
1 37  TYR n 
1 38  LYS n 
1 39  MET n 
1 40  ASP n 
1 41  TYR n 
1 42  PRO n 
1 43  GLU n 
1 44  MET n 
1 45  GLY n 
1 46  LEU n 
1 47  CYS n 
1 48  ILE n 
1 49  ILE n 
1 50  ILE n 
1 51  ASN n 
1 52  ASN n 
1 53  LYS n 
1 54  ASN n 
1 55  PHE n 
1 56  HIS n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLY n 
1 61  MET n 
1 62  THR n 
1 63  SER n 
1 64  ARG n 
1 65  SER n 
1 66  GLY n 
1 67  THR n 
1 68  ASP n 
1 69  VAL n 
1 70  ASP n 
1 71  ALA n 
1 72  ALA n 
1 73  ASN n 
1 74  LEU n 
1 75  ARG n 
1 76  GLU n 
1 77  THR n 
1 78  PHE n 
1 79  ARG n 
1 80  ASN n 
1 81  LEU n 
1 82  LYS n 
1 83  TYR n 
1 84  GLU n 
1 85  VAL n 
1 86  ARG n 
1 87  ASN n 
1 88  LYS n 
1 89  ASN n 
1 90  ASP n 
1 91  LEU n 
1 92  THR n 
1 93  ARG n 
1 94  GLU n 
1 95  GLU n 
1 96  ILE n 
1 97  VAL n 
1 98  GLU n 
1 99  LEU n 
1 100 MET n 
1 101 ARG n 
1 102 ASP n 
1 103 VAL n 
1 104 SER n 
1 105 LYS n 
1 106 GLU n 
1 107 ASP n 
1 108 HIS n 
1 109 SER n 
1 110 LYS n 
1 111 ARG n 
1 112 SER n 
1 113 SER n 
1 114 PHE n 
1 115 VAL n 
1 116 CYS n 
1 117 VAL n 
1 118 LEU n 
1 119 LEU n 
1 120 SER n 
1 121 HIS n 
1 122 GLY n 
1 123 GLU n 
1 124 GLU n 
1 125 GLY n 
1 126 ILE n 
1 127 ILE n 
1 128 PHE n 
1 129 GLY n 
1 130 THR n 
1 131 ASN n 
1 132 GLY n 
1 133 PRO n 
1 134 VAL n 
1 135 ASP n 
1 136 LEU n 
1 137 LYS n 
1 138 LYS n 
1 139 ILE n 
1 140 THR n 
1 141 ASN n 
1 142 PHE n 
1 143 PHE n 
1 144 ARG n 
1 145 GLY n 
1 146 ASP n 
1 147 ARG n 
1 148 CYS n 
1 149 ARG n 
1 150 SER n 
1 151 LEU n 
1 152 THR n 
1 153 GLY n 
1 154 LYS n 
1 155 PRO n 
1 156 LYS n 
1 157 LEU n 
1 158 PHE n 
1 159 ILE n 
1 160 ILE n 
1 161 GLN n 
1 162 ALA n 
1 163 ALA n 
1 164 ARG n 
1 165 GLY n 
1 166 THR n 
1 167 GLU n 
1 168 LEU n 
1 169 ASP n 
1 170 CYS n 
1 171 GLY n 
1 172 ILE n 
1 173 GLU n 
1 174 THR n 
1 175 ASP n 
2 1   SER n 
2 2   GLY n 
2 3   VAL n 
2 4   ASP n 
2 5   ASP n 
2 6   ASP n 
2 7   MET n 
2 8   ALA n 
2 9   CYS n 
2 10  HIS n 
2 11  LYS n 
2 12  ILE n 
2 13  PRO n 
2 14  VAL n 
2 15  GLU n 
2 16  ALA n 
2 17  ASP n 
2 18  PHE n 
2 19  LEU n 
2 20  TYR n 
2 21  ALA n 
2 22  TYR n 
2 23  SER n 
2 24  THR n 
2 25  ALA n 
2 26  PRO n 
2 27  GLY n 
2 28  TYR n 
2 29  TYR n 
2 30  SER n 
2 31  TRP n 
2 32  ARG n 
2 33  ASN n 
2 34  SER n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  SER n 
2 39  TRP n 
2 40  PHE n 
2 41  ILE n 
2 42  GLN n 
2 43  SER n 
2 44  LEU n 
2 45  CYS n 
2 46  ALA n 
2 47  MET n 
2 48  LEU n 
2 49  LYS n 
2 50  GLN n 
2 51  TYR n 
2 52  ALA n 
2 53  ASP n 
2 54  LYS n 
2 55  LEU n 
2 56  GLU n 
2 57  PHE n 
2 58  MET n 
2 59  HIS n 
2 60  ILE n 
2 61  LEU n 
2 62  THR n 
2 63  ARG n 
2 64  VAL n 
2 65  ASN n 
2 66  ARG n 
2 67  LYS n 
2 68  VAL n 
2 69  ALA n 
2 70  THR n 
2 71  GLU n 
2 72  PHE n 
2 73  GLU n 
2 74  SER n 
2 75  PHE n 
2 76  SER n 
2 77  PHE n 
2 78  ASP n 
2 79  ALA n 
2 80  THR n 
2 81  PHE n 
2 82  HIS n 
2 83  ALA n 
2 84  LYS n 
2 85  LYS n 
2 86  GLN n 
2 87  ILE n 
2 88  PRO n 
2 89  CYS n 
2 90  ILE n 
2 91  VAL n 
2 92  SER n 
2 93  MET n 
2 94  LEU n 
2 95  THR n 
2 96  LYS n 
2 97  GLU n 
2 98  LEU n 
2 99  TYR n 
2 100 PHE n 
2 101 TYR n 
2 102 HIS n 
2 103 LEU n 
2 104 GLU n 
2 105 HIS n 
2 106 HIS n 
2 107 HIS n 
2 108 HIS n 
2 109 HIS n 
2 110 HIS n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   ARG n 
3 6   ASP n 
3 7   HIS n 
3 8   PHE n 
3 9   ALA n 
3 10  LEU n 
3 11  ASP n 
3 12  ARG n 
3 13  PRO n 
3 14  SER n 
3 15  GLU n 
3 16  THR n 
3 17  HIS n 
3 18  ALA n 
3 19  ASP n 
3 20  TYR n 
3 21  LEU n 
3 22  LEU n 
3 23  ARG n 
3 24  THR n 
3 25  GLY n 
3 26  GLN n 
3 27  VAL n 
3 28  VAL n 
3 29  ASP n 
3 30  ILE n 
3 31  SER n 
3 32  ASP n 
3 33  THR n 
3 34  ILE n 
3 35  TYR n 
3 36  PRO n 
3 37  ARG n 
3 38  ASN n 
3 39  PRO n 
3 40  ALA n 
3 41  MET n 
3 42  TYR n 
3 43  SER n 
3 44  GLU n 
3 45  GLU n 
3 46  ALA n 
3 47  ARG n 
3 48  LEU n 
3 49  LYS n 
3 50  SER n 
3 51  PHE n 
3 52  GLN n 
3 53  ASN n 
3 54  TRP n 
3 55  PRO n 
3 56  ASP n 
3 57  TYR n 
3 58  ALA n 
3 59  HIS n 
3 60  LEU n 
3 61  THR n 
3 62  PRO n 
3 63  ARG n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  SER n 
3 68  ALA n 
3 69  GLY n 
3 70  LEU n 
3 71  TYR n 
3 72  TYR n 
3 73  THR n 
3 74  GLY n 
3 75  ILE n 
3 76  GLY n 
3 77  ASP n 
3 78  GLN n 
3 79  VAL n 
3 80  GLN n 
3 81  CYS n 
3 82  PHE n 
3 83  ALA n 
3 84  CYS n 
3 85  GLY n 
3 86  GLY n 
3 87  LYS n 
3 88  LEU n 
3 89  LYS n 
3 90  ASN n 
3 91  TRP n 
3 92  GLU n 
3 93  PRO n 
3 94  GLY n 
3 95  ASP n 
3 96  ARG n 
3 97  ALA n 
3 98  TRP n 
3 99  SER n 
3 100 GLU n 
3 101 HIS n 
3 102 ARG n 
3 103 ARG n 
3 104 HIS n 
3 105 PHE n 
3 106 PRO n 
3 107 ASN n 
3 108 CYS n 
3 109 PHE n 
3 110 PHE n 
3 111 VAL n 
3 112 LEU n 
3 113 GLY n 
3 114 ARG n 
3 115 ASN n 
3 116 LEU n 
3 117 ASN n 
3 118 ILE n 
3 119 ARG n 
3 120 SER n 
3 121 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo I39005 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET23B ? ? 
2 1 sample ? ? ? human Homo I39005 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET23B ? ? 
3 1 sample ? ? ? human Homo U32974 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET15B ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CASP3_HUMAN 1 
;MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRN
LKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
QACRGTELDCGIETD
;
1   P42574 ? 
2 UNP CASP3_HUMAN 2 
;SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDAT
FHAKKQIPCIVSMLTKELYFYH
;
176 P42574 ? 
3 UNP BIRC4_HUMAN 3 
;RDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCC
GGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
;
124 P98170 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I3O A 1 ? 175 ? P42574 1   ? 175 ? 117 297 
2 1 1I3O C 1 ? 175 ? P42574 1   ? 175 ? 117 297 
3 2 1I3O B 1 ? 102 ? P42574 176 ? 277 ? 310 402 
4 2 1I3O D 1 ? 102 ? P42574 176 ? 277 ? 310 402 
5 3 1I3O E 5 ? 121 ? P98170 124 ? 240 ? 124 240 
6 3 1I3O F 5 ? 121 ? P98170 124 ? 240 ? 124 240 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1I3O ALA A 163 ? UNP P42574 CYS 163 'engineered mutation' 285 1  
3 1I3O LEU B 103 ? UNP P42574 ?   ?   'expression tag'      403 2  
3 1I3O GLU B 104 ? UNP P42574 ?   ?   'expression tag'      404 3  
3 1I3O HIS B 105 ? UNP P42574 ?   ?   'expression tag'      405 4  
3 1I3O HIS B 106 ? UNP P42574 ?   ?   'expression tag'      406 5  
3 1I3O HIS B 107 ? UNP P42574 ?   ?   'expression tag'      407 6  
3 1I3O HIS B 108 ? UNP P42574 ?   ?   'expression tag'      408 7  
3 1I3O HIS B 109 ? UNP P42574 ?   ?   'expression tag'      409 8  
3 1I3O HIS B 110 ? UNP P42574 ?   ?   'expression tag'      410 9  
2 1I3O ALA C 163 ? UNP P42574 CYS 163 'engineered mutation' 285 10 
4 1I3O LEU D 103 ? UNP P42574 ?   ?   'expression tag'      403 11 
4 1I3O GLU D 104 ? UNP P42574 ?   ?   'expression tag'      404 12 
4 1I3O HIS D 105 ? UNP P42574 ?   ?   'expression tag'      405 13 
4 1I3O HIS D 106 ? UNP P42574 ?   ?   'expression tag'      406 14 
4 1I3O HIS D 107 ? UNP P42574 ?   ?   'expression tag'      407 15 
4 1I3O HIS D 108 ? UNP P42574 ?   ?   'expression tag'      408 16 
4 1I3O HIS D 109 ? UNP P42574 ?   ?   'expression tag'      409 17 
4 1I3O HIS D 110 ? UNP P42574 ?   ?   'expression tag'      410 18 
5 1I3O GLY E 1   ? UNP P98170 ?   ?   'cloning artifact'    120 19 
5 1I3O SER E 2   ? UNP P98170 ?   ?   'cloning artifact'    121 20 
5 1I3O HIS E 3   ? UNP P98170 ?   ?   'cloning artifact'    122 21 
5 1I3O MET E 4   ? UNP P98170 ?   ?   'cloning artifact'    123 22 
5 1I3O ALA E 83  ? UNP P98170 CYS 202 'engineered mutation' 202 23 
5 1I3O GLY E 94  ? UNP P98170 CYS 213 'engineered mutation' 213 24 
6 1I3O GLY F 1   ? UNP P98170 ?   ?   'cloning artifact'    120 25 
6 1I3O SER F 2   ? UNP P98170 ?   ?   'cloning artifact'    121 26 
6 1I3O HIS F 3   ? UNP P98170 ?   ?   'cloning artifact'    122 27 
6 1I3O MET F 4   ? UNP P98170 ?   ?   'cloning artifact'    123 28 
6 1I3O ALA F 83  ? UNP P98170 CYS 202 'engineered mutation' 202 29 
6 1I3O GLY F 94  ? UNP P98170 CYS 213 'engineered mutation' 213 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1I3O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   60.14 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pdbx_details    'sodium formate, sodium acetate, pH 5.2, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     1I3O 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             500 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   27119 
_reflns.number_all                   174633 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.0620000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        30.0 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.4240000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2649 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I3O 
_refine.ls_number_reflns_obs                     27070 
_refine.ls_number_reflns_all                     27472 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             500 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2480000 
_refine.ls_R_factor_R_free                       0.2780000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1244 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               29.938 
_refine.aniso_B[1][1]                            -32.569 
_refine.aniso_B[2][2]                            13.718 
_refine.aniso_B[3][3]                            18.850 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'CNS BULK SOLVENT' 
_refine.solvent_model_param_ksol                 0.321299 
_refine.solvent_model_param_bsol                 33.0707 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  MLF 
_refine.pdbx_starting_model                      'PDB ENTRY 1PAU and PDB ENTRY 1C9Q' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5662 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               5677 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008574 ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30329  ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it             ?        ? ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it            ?        ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein_rep.top 'X-RAY DIFFRACTION' 
2 ion.param         ion.top         'X-RAY DIFFRACTION' 
3 water_rep.param   water_rep.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1I3O 
_struct.title                     'CRYSTAL STRUCTURE OF THE COMPLEX OF XIAP-BIR2 AND CASPASE 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I3O 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'complex, IAP, caspase, Apoptosis' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 66  ? ASN A 80  ? GLY A 181 ASN A 195 1 ? 15 
HELX_P HELX_P2  2  THR A 92  ? LYS A 105 ? THR A 207 LYS A 220 1 ? 14 
HELX_P HELX_P3  3  GLU A 106 ? GLU A 106 ? GLU A 221 GLU A 221 5 ? 1  
HELX_P HELX_P4  4  ASP A 107 ? SER A 109 ? ASP A 222 SER A 225 5 ? 3  
HELX_P HELX_P5  5  LEU A 136 ? PHE A 142 ? LEU A 258 PHE A 264 1 ? 7  
HELX_P HELX_P6  6  CYS A 148 ? THR A 152 ? CYS A 270 THR A 274 5 ? 5  
HELX_P HELX_P7  7  ASP B 5   ? CYS B 9   ? ASP B 314 CYS B 318 5 ? 5  
HELX_P HELX_P8  8  SER B 38  ? ALA B 52  ? SER B 347 ALA B 361 1 ? 15 
HELX_P HELX_P9  9  GLU B 56  ? PHE B 72  ? GLU B 365 PHE B 380 1 ? 17 
HELX_P HELX_P10 10 GLY C 66  ? ASN C 80  ? GLY C 181 ASN C 195 1 ? 15 
HELX_P HELX_P11 11 THR C 92  ? LYS C 105 ? THR C 207 LYS C 220 1 ? 14 
HELX_P HELX_P12 12 GLU C 106 ? GLU C 106 ? GLU C 221 GLU C 221 5 ? 1  
HELX_P HELX_P13 13 ASP C 107 ? SER C 109 ? ASP C 222 SER C 225 5 ? 3  
HELX_P HELX_P14 14 LEU C 136 ? PHE C 142 ? LEU C 258 PHE C 264 1 ? 7  
HELX_P HELX_P15 15 CYS C 148 ? THR C 152 ? CYS C 270 THR C 274 5 ? 5  
HELX_P HELX_P16 16 ASP D 4   ? CYS D 9   ? ASP D 313 CYS D 318 5 ? 6  
HELX_P HELX_P17 17 SER D 38  ? ALA D 52  ? SER D 347 ALA D 361 1 ? 15 
HELX_P HELX_P18 18 GLU D 56  ? PHE D 72  ? GLU D 365 PHE D 380 1 ? 17 
HELX_P HELX_P19 19 ASP D 78  E HIS D 82  I ASP D 381 HIS D 381 5 ? 5  
HELX_P HELX_P20 20 THR E 16  ? THR E 24  ? THR E 135 THR E 143 1 ? 9  
HELX_P HELX_P21 21 ILE E 30  ? ILE E 34  ? ILE E 149 ILE E 153 5 ? 5  
HELX_P HELX_P22 22 ASN E 38  ? TYR E 42  ? ASN E 157 TYR E 161 5 ? 5  
HELX_P HELX_P23 23 SER E 43  ? LYS E 49  ? SER E 162 LYS E 168 1 ? 7  
HELX_P HELX_P24 24 THR E 61  ? ALA E 68  ? THR E 180 ALA E 187 1 ? 8  
HELX_P HELX_P25 25 ARG E 96  ? PHE E 105 ? ARG E 215 PHE E 224 1 ? 10 
HELX_P HELX_P26 26 CYS E 108 ? GLY E 113 ? CYS E 227 GLY E 232 1 ? 6  
HELX_P HELX_P27 27 THR F 16  ? THR F 24  ? THR F 135 THR F 143 1 ? 9  
HELX_P HELX_P28 28 ILE F 30  ? ILE F 34  ? ILE F 149 ILE F 153 5 ? 5  
HELX_P HELX_P29 29 ASN F 38  ? TYR F 42  ? ASN F 157 TYR F 161 5 ? 5  
HELX_P HELX_P30 30 SER F 43  ? LYS F 49  ? SER F 162 LYS F 168 1 ? 7  
HELX_P HELX_P31 31 THR F 61  ? ALA F 68  ? THR F 180 ALA F 187 1 ? 8  
HELX_P HELX_P32 32 ARG F 96  ? PHE F 105 ? ARG F 215 PHE F 224 1 ? 10 
HELX_P HELX_P33 33 CYS F 108 ? GLY F 113 ? CYS F 227 GLY F 232 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? G ZN . ZN ? ? ? 1_555 E CYS 81  SG  ? ? E ZN 1 E CYS 200 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc2 metalc ? ? G ZN . ZN ? ? ? 1_555 E CYS 84  SG  ? ? E ZN 1 E CYS 203 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc3 metalc ? ? G ZN . ZN ? ? ? 1_555 E HIS 101 NE2 ? ? E ZN 1 E HIS 220 1_555 ? ? ? ? ? ? ? 2.210 ? ? 
metalc4 metalc ? ? G ZN . ZN ? ? ? 1_555 E CYS 108 SG  ? ? E ZN 1 E CYS 227 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc5 metalc ? ? H ZN . ZN ? ? ? 1_555 F CYS 81  SG  ? ? F ZN 2 F CYS 200 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc6 metalc ? ? H ZN . ZN ? ? ? 1_555 F CYS 84  SG  ? ? F ZN 2 F CYS 203 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc7 metalc ? ? H ZN . ZN ? ? ? 1_555 F HIS 101 NE2 ? ? F ZN 2 F HIS 220 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc8 metalc ? ? H ZN . ZN ? ? ? 1_555 F CYS 108 SG  ? ? F ZN 2 F CYS 227 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 35 E . ? TYR 154 E PRO 36 E ? PRO 155 E 1 -0.24 
2 TYR 35 F . ? TYR 154 F PRO 36 F ? PRO 155 F 1 -0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 3  ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 3  ? 
G ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLU A 84  ? ASN A 89  ? GLU A 199 ASN A 204 
A 2  GLU A 43  ? ASN A 51  ? GLU A 162 ASN A 169 
A 3  ARG A 111 ? LEU A 119 ? ARG A 227 LEU A 235 
A 4  LYS A 156 ? GLN A 161 ? LYS A 278 GLN A 283 
A 5  PHE B 18  ? TYR B 22  ? PHE B 327 TYR B 331 
A 6  CYS B 89  ? SER B 92  ? CYS B 388 SER B 392 
A 7  CYS D 89  ? SER D 92  ? CYS D 388 SER D 392 
A 8  PHE D 18  ? TYR D 22  ? PHE D 327 TYR D 331 
A 9  LYS C 156 ? GLN C 161 ? LYS C 278 GLN C 283 
A 10 ARG C 111 ? LEU C 119 ? ARG C 227 LEU C 235 
A 11 GLU C 43  ? ASN C 51  ? GLU C 162 ASN C 169 
A 12 GLU C 84  ? ASN C 89  ? GLU C 199 ASN C 204 
B 1  GLY A 122 ? GLU A 123 ? GLY A 238 GLU A 239 
B 2  ILE A 126 ? GLY A 129 ? ILE A 242 GLY A 245 
B 3  GLY A 132 ? ASP A 135 ? GLY A 254 ASP A 257 
C 1  ILE A 172 ? GLU A 173 ? ILE A 294 GLU A 295 
C 2  LYS D 11  ? ILE D 12  ? LYS D 320 ILE D 321 
D 1  LYS B 11  ? ILE B 12  ? LYS B 320 ILE B 321 
D 2  ILE C 172 ? GLU C 173 ? ILE C 294 GLU C 295 
E 1  GLY C 122 ? GLU C 123 ? GLY C 238 GLU C 239 
E 2  ILE C 126 ? GLY C 129 ? ILE C 242 GLY C 245 
E 3  GLY C 132 ? ASP C 135 ? GLY C 254 ASP C 257 
F 1  LEU E 70  ? ILE E 75  ? LEU E 189 ILE E 194 
F 2  GLN E 78  ? CYS E 81  ? GLN E 197 CYS E 200 
F 3  LYS E 87  ? LEU E 88  ? LYS E 206 LEU E 207 
G 1  LEU F 70  ? ILE F 75  ? LEU F 189 ILE F 194 
G 2  GLN F 78  ? CYS F 81  ? GLN F 197 CYS F 200 
G 3  LYS F 87  ? LEU F 88  ? LYS F 206 LEU F 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N GLU A 84  ? N GLU A 199 O GLY A 45  ? O GLY A 163 
A 2  3  O GLU A 43  ? O GLU A 162 N SER A 112 ? N SER A 228 
A 3  4  O PHE A 114 ? O PHE A 230 N LEU A 157 ? N LEU A 279 
A 4  5  N PHE A 158 ? N PHE A 280 O LEU B 19  ? O LEU B 328 
A 5  6  O TYR B 22  ? O TYR B 331 N CYS B 89  ? N CYS B 388 
A 6  7  O SER B 92  ? O SER B 392 N ILE D 90  ? N ILE D 389 
A 7  8  O VAL D 91  ? O VAL D 390 N TYR D 20  ? N TYR D 329 
A 8  9  N LEU D 19  ? N LEU D 328 O LYS C 156 ? O LYS C 278 
A 9  10 N LEU C 157 ? N LEU C 279 O PHE C 114 ? O PHE C 230 
A 10 11 N SER C 112 ? N SER C 228 O GLU C 43  ? O GLU C 162 
A 11 12 O GLY C 45  ? O GLY C 163 N GLU C 84  ? N GLU C 199 
B 1  2  O GLU A 123 ? O GLU A 239 N ILE A 126 ? N ILE A 242 
B 2  3  N GLY A 129 ? N GLY A 245 O GLY A 132 ? O GLY A 254 
C 1  2  O ILE A 172 ? O ILE A 294 N ILE D 12  ? N ILE D 321 
D 1  2  N ILE B 12  ? N ILE B 321 O ILE C 172 ? O ILE C 294 
E 1  2  O GLU C 123 ? O GLU C 239 N ILE C 126 ? N ILE C 242 
E 2  3  N GLY C 129 ? N GLY C 245 O GLY C 132 ? O GLY C 254 
F 1  2  O ILE E 75  ? O ILE E 194 N GLN E 78  ? N GLN E 197 
F 2  3  N VAL E 79  ? N VAL E 198 O LEU E 88  ? O LEU E 207 
G 1  2  O ILE F 75  ? O ILE F 194 N GLN F 78  ? N GLN F 197 
G 2  3  O VAL F 79  ? O VAL F 198 N LEU F 88  ? N LEU F 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software E ZN 1 ? 4 'BINDING SITE FOR RESIDUE ZN E 1' 
AC2 Software F ZN 2 ? 4 'BINDING SITE FOR RESIDUE ZN F 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS E 81  ? CYS E 200 . ? 1_555 ? 
2 AC1 4 CYS E 84  ? CYS E 203 . ? 1_555 ? 
3 AC1 4 HIS E 101 ? HIS E 220 . ? 1_555 ? 
4 AC1 4 CYS E 108 ? CYS E 227 . ? 1_555 ? 
5 AC2 4 CYS F 81  ? CYS F 200 . ? 1_555 ? 
6 AC2 4 CYS F 84  ? CYS F 203 . ? 1_555 ? 
7 AC2 4 HIS F 101 ? HIS F 220 . ? 1_555 ? 
8 AC2 4 CYS F 108 ? CYS F 227 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I3O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I3O 
_atom_sites.fract_transf_matrix[1][1]   0.014144 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010471 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006935 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 32  ? 6.017   29.319 6.812   1.00 87.69 ? 148 SER A N   1 
ATOM   2    C  CA  . SER A 1 32  ? 6.346   30.612 6.126   1.00 88.01 ? 148 SER A CA  1 
ATOM   3    C  C   . SER A 1 32  ? 7.399   30.396 5.026   1.00 87.91 ? 148 SER A C   1 
ATOM   4    O  O   . SER A 1 32  ? 7.336   29.418 4.270   1.00 87.56 ? 148 SER A O   1 
ATOM   5    C  CB  . SER A 1 32  ? 6.870   31.642 7.153   1.00 87.93 ? 148 SER A CB  1 
ATOM   6    O  OG  . SER A 1 32  ? 7.185   32.898 6.548   1.00 87.74 ? 148 SER A OG  1 
ATOM   7    N  N   . LEU A 1 33  ? 8.348   31.335 4.959   1.00 87.84 ? 149 LEU A N   1 
ATOM   8    C  CA  . LEU A 1 33  ? 9.468   31.346 4.005   1.00 86.88 ? 149 LEU A CA  1 
ATOM   9    C  C   . LEU A 1 33  ? 10.188  32.696 4.110   1.00 86.05 ? 149 LEU A C   1 
ATOM   10   O  O   . LEU A 1 33  ? 9.547   33.760 4.242   1.00 85.98 ? 149 LEU A O   1 
ATOM   11   C  CB  . LEU A 1 33  ? 9.006   31.191 2.533   1.00 87.16 ? 149 LEU A CB  1 
ATOM   12   C  CG  . LEU A 1 33  ? 8.488   29.903 1.860   1.00 87.19 ? 149 LEU A CG  1 
ATOM   13   C  CD1 . LEU A 1 33  ? 8.424   30.156 0.335   1.00 86.62 ? 149 LEU A CD1 1 
ATOM   14   C  CD2 . LEU A 1 33  ? 9.393   28.698 2.162   1.00 86.29 ? 149 LEU A CD2 1 
ATOM   15   N  N   . ASP A 1 34  ? 11.518  32.645 4.063   1.00 84.31 ? 150 ASP A N   1 
ATOM   16   C  CA  . ASP A 1 34  ? 12.337  33.861 4.073   1.00 82.37 ? 150 ASP A CA  1 
ATOM   17   C  C   . ASP A 1 34  ? 12.045  34.880 5.195   1.00 79.25 ? 150 ASP A C   1 
ATOM   18   O  O   . ASP A 1 34  ? 11.611  36.013 4.912   1.00 78.52 ? 150 ASP A O   1 
ATOM   19   C  CB  . ASP A 1 34  ? 12.196  34.559 2.695   1.00 84.50 ? 150 ASP A CB  1 
ATOM   20   C  CG  . ASP A 1 34  ? 13.484  35.262 2.237   1.00 86.45 ? 150 ASP A CG  1 
ATOM   21   O  OD1 . ASP A 1 34  ? 14.504  35.221 2.990   1.00 87.00 ? 150 ASP A OD1 1 
ATOM   22   O  OD2 . ASP A 1 34  ? 13.463  35.852 1.117   1.00 86.77 ? 150 ASP A OD2 1 
ATOM   23   N  N   . ASN A 1 35  ? 12.271  34.480 6.454   1.00 75.15 ? 151 ASN A N   1 
ATOM   24   C  CA  . ASN A 1 35  ? 12.077  35.396 7.594   1.00 70.45 ? 151 ASN A CA  1 
ATOM   25   C  C   . ASN A 1 35  ? 13.385  35.467 8.387   1.00 65.97 ? 151 ASN A C   1 
ATOM   26   O  O   . ASN A 1 35  ? 13.445  35.998 9.496   1.00 64.67 ? 151 ASN A O   1 
ATOM   27   C  CB  . ASN A 1 35  ? 10.905  34.952 8.483   1.00 71.90 ? 151 ASN A CB  1 
ATOM   28   C  CG  . ASN A 1 35  ? 11.029  33.516 8.934   1.00 73.34 ? 151 ASN A CG  1 
ATOM   29   O  OD1 . ASN A 1 35  ? 11.926  33.179 9.721   1.00 74.57 ? 151 ASN A OD1 1 
ATOM   30   N  ND2 . ASN A 1 35  ? 10.136  32.651 8.433   1.00 73.26 ? 151 ASN A ND2 1 
ATOM   31   N  N   . SER A 1 36  ? 14.431  34.919 7.779   1.00 61.50 ? 152 SER A N   1 
ATOM   32   C  CA  . SER A 1 36  ? 15.771  34.942 8.337   1.00 57.50 ? 152 SER A CA  1 
ATOM   33   C  C   . SER A 1 36  ? 16.696  35.137 7.121   1.00 55.94 ? 152 SER A C   1 
ATOM   34   O  O   . SER A 1 36  ? 16.411  34.638 6.030   1.00 54.77 ? 152 SER A O   1 
ATOM   35   C  CB  . SER A 1 36  ? 16.077  33.636 9.082   1.00 55.71 ? 152 SER A CB  1 
ATOM   36   O  OG  . SER A 1 36  ? 16.661  32.674 8.236   1.00 54.52 ? 152 SER A OG  1 
ATOM   37   N  N   . TYR A 1 37  ? 17.779  35.891 7.299   1.00 54.82 ? 153 TYR A N   1 
ATOM   38   C  CA  . TYR A 1 37  ? 18.707  36.155 6.206   1.00 53.44 ? 153 TYR A CA  1 
ATOM   39   C  C   . TYR A 1 37  ? 19.303  34.886 5.607   1.00 53.09 ? 153 TYR A C   1 
ATOM   40   O  O   . TYR A 1 37  ? 19.518  33.901 6.298   1.00 53.68 ? 153 TYR A O   1 
ATOM   41   C  CB  . TYR A 1 37  ? 19.852  37.072 6.669   1.00 52.43 ? 153 TYR A CB  1 
ATOM   42   C  CG  . TYR A 1 37  ? 19.462  38.510 6.938   1.00 52.14 ? 153 TYR A CG  1 
ATOM   43   C  CD1 . TYR A 1 37  ? 19.111  38.931 8.224   1.00 50.93 ? 153 TYR A CD1 1 
ATOM   44   C  CD2 . TYR A 1 37  ? 19.430  39.451 5.902   1.00 51.05 ? 153 TYR A CD2 1 
ATOM   45   C  CE1 . TYR A 1 37  ? 18.739  40.245 8.473   1.00 50.40 ? 153 TYR A CE1 1 
ATOM   46   C  CE2 . TYR A 1 37  ? 19.057  40.765 6.139   1.00 50.80 ? 153 TYR A CE2 1 
ATOM   47   C  CZ  . TYR A 1 37  ? 18.710  41.158 7.429   1.00 50.93 ? 153 TYR A CZ  1 
ATOM   48   O  OH  . TYR A 1 37  ? 18.312  42.451 7.672   1.00 49.46 ? 153 TYR A OH  1 
ATOM   49   N  N   . LYS A 1 38  ? 19.574  34.929 4.310   1.00 53.10 ? 154 LYS A N   1 
ATOM   50   C  CA  . LYS A 1 38  ? 20.167  33.808 3.602   1.00 54.34 ? 154 LYS A CA  1 
ATOM   51   C  C   . LYS A 1 38  ? 21.663  33.848 3.874   1.00 55.11 ? 154 LYS A C   1 
ATOM   52   O  O   . LYS A 1 38  ? 22.318  34.833 3.558   1.00 55.16 ? 154 LYS A O   1 
ATOM   53   C  CB  . LYS A 1 38  ? 19.926  33.961 2.103   1.00 54.77 ? 154 LYS A CB  1 
ATOM   54   C  CG  . LYS A 1 38  ? 20.515  32.853 1.247   1.00 57.88 ? 154 LYS A CG  1 
ATOM   55   C  CD  . LYS A 1 38  ? 20.491  33.211 -0.255  1.00 59.05 ? 154 LYS A CD  1 
ATOM   56   C  CE  . LYS A 1 38  ? 20.692  31.976 -1.159  1.00 59.67 ? 154 LYS A CE  1 
ATOM   57   N  NZ  . LYS A 1 38  ? 21.858  31.119 -0.766  1.00 60.28 ? 154 LYS A NZ  1 
ATOM   58   N  N   . MET A 1 39  ? 22.212  32.791 4.461   1.00 56.14 ? 155 MET A N   1 
ATOM   59   C  CA  . MET A 1 39  ? 23.642  32.770 4.745   1.00 57.45 ? 155 MET A CA  1 
ATOM   60   C  C   . MET A 1 39  ? 24.394  31.688 3.956   1.00 59.90 ? 155 MET A C   1 
ATOM   61   O  O   . MET A 1 39  ? 25.553  31.385 4.271   1.00 60.39 ? 155 MET A O   1 
ATOM   62   C  CB  . MET A 1 39  ? 23.877  32.582 6.244   1.00 56.17 ? 155 MET A CB  1 
ATOM   63   C  CG  . MET A 1 39  ? 23.194  33.649 7.116   1.00 56.80 ? 155 MET A CG  1 
ATOM   64   S  SD  . MET A 1 39  ? 23.788  35.353 6.821   1.00 56.38 ? 155 MET A SD  1 
ATOM   65   C  CE  . MET A 1 39  ? 25.333  35.325 7.740   1.00 55.72 ? 155 MET A CE  1 
ATOM   66   N  N   . ASP A 1 40  ? 23.746  31.122 2.928   1.00 61.09 ? 156 ASP A N   1 
ATOM   67   C  CA  . ASP A 1 40  ? 24.354  30.083 2.088   1.00 61.48 ? 156 ASP A CA  1 
ATOM   68   C  C   . ASP A 1 40  ? 25.462  30.597 1.189   1.00 62.16 ? 156 ASP A C   1 
ATOM   69   O  O   . ASP A 1 40  ? 26.495  29.957 1.058   1.00 63.42 ? 156 ASP A O   1 
ATOM   70   C  CB  . ASP A 1 40  ? 23.342  29.432 1.153   1.00 62.34 ? 156 ASP A CB  1 
ATOM   71   C  CG  . ASP A 1 40  ? 22.105  28.969 1.858   1.00 63.43 ? 156 ASP A CG  1 
ATOM   72   O  OD1 . ASP A 1 40  ? 21.119  29.740 1.897   1.00 64.00 ? 156 ASP A OD1 1 
ATOM   73   O  OD2 . ASP A 1 40  ? 22.124  27.832 2.369   1.00 63.53 ? 156 ASP A OD2 1 
ATOM   74   N  N   . TYR A 1 41  A 25.234  31.730 0.535   1.00 62.26 ? 156 TYR A N   1 
ATOM   75   C  CA  . TYR A 1 41  A 26.227  32.288 -0.382  1.00 62.22 ? 156 TYR A CA  1 
ATOM   76   C  C   . TYR A 1 41  A 27.637  31.739 -0.152  1.00 61.84 ? 156 TYR A C   1 
ATOM   77   O  O   . TYR A 1 41  A 28.068  31.532 0.982   1.00 61.39 ? 156 TYR A O   1 
ATOM   78   C  CB  . TYR A 1 41  A 26.279  33.826 -0.289  1.00 61.69 ? 156 TYR A CB  1 
ATOM   79   C  CG  . TYR A 1 41  A 25.011  34.562 -0.683  1.00 60.54 ? 156 TYR A CG  1 
ATOM   80   C  CD1 . TYR A 1 41  A 23.903  34.594 0.166   1.00 59.39 ? 156 TYR A CD1 1 
ATOM   81   C  CD2 . TYR A 1 41  A 24.944  35.273 -1.879  1.00 59.18 ? 156 TYR A CD2 1 
ATOM   82   C  CE1 . TYR A 1 41  A 22.769  35.322 -0.160  1.00 59.07 ? 156 TYR A CE1 1 
ATOM   83   C  CE2 . TYR A 1 41  A 23.808  36.004 -2.217  1.00 58.90 ? 156 TYR A CE2 1 
ATOM   84   C  CZ  . TYR A 1 41  A 22.727  36.028 -1.352  1.00 59.49 ? 156 TYR A CZ  1 
ATOM   85   O  OH  . TYR A 1 41  A 21.616  36.787 -1.657  1.00 59.96 ? 156 TYR A OH  1 
ATOM   86   N  N   . PRO A 1 42  ? 28.375  31.506 -1.242  1.00 62.14 ? 161 PRO A N   1 
ATOM   87   C  CA  . PRO A 1 42  ? 29.741  30.987 -1.168  1.00 62.21 ? 161 PRO A CA  1 
ATOM   88   C  C   . PRO A 1 42  ? 30.492  31.517 0.054   1.00 62.39 ? 161 PRO A C   1 
ATOM   89   O  O   . PRO A 1 42  ? 30.699  30.793 1.021   1.00 62.46 ? 161 PRO A O   1 
ATOM   90   C  CB  . PRO A 1 42  ? 30.359  31.476 -2.472  1.00 62.47 ? 161 PRO A CB  1 
ATOM   91   C  CG  . PRO A 1 42  ? 29.199  31.381 -3.432  1.00 62.39 ? 161 PRO A CG  1 
ATOM   92   C  CD  . PRO A 1 42  ? 28.028  31.910 -2.619  1.00 62.00 ? 161 PRO A CD  1 
ATOM   93   N  N   . GLU A 1 43  ? 30.890  32.784 0.003   1.00 62.82 ? 162 GLU A N   1 
ATOM   94   C  CA  . GLU A 1 43  ? 31.627  33.404 1.098   1.00 62.94 ? 162 GLU A CA  1 
ATOM   95   C  C   . GLU A 1 43  ? 30.705  33.907 2.228   1.00 62.88 ? 162 GLU A C   1 
ATOM   96   O  O   . GLU A 1 43  ? 29.533  34.251 1.998   1.00 62.31 ? 162 GLU A O   1 
ATOM   97   C  CB  . GLU A 1 43  ? 32.463  34.565 0.554   1.00 63.08 ? 162 GLU A CB  1 
ATOM   98   C  CG  . GLU A 1 43  ? 33.575  34.157 -0.394  1.00 64.72 ? 162 GLU A CG  1 
ATOM   99   C  CD  . GLU A 1 43  ? 34.266  35.366 -1.032  1.00 67.39 ? 162 GLU A CD  1 
ATOM   100  O  OE1 . GLU A 1 43  ? 34.767  36.240 -0.284  1.00 69.79 ? 162 GLU A OE1 1 
ATOM   101  O  OE2 . GLU A 1 43  ? 34.315  35.457 -2.282  1.00 68.91 ? 162 GLU A OE2 1 
ATOM   102  N  N   . MET A 1 44  A 31.243  33.949 3.447   1.00 61.90 ? 162 MET A N   1 
ATOM   103  C  CA  . MET A 1 44  A 30.483  34.421 4.600   1.00 60.62 ? 162 MET A CA  1 
ATOM   104  C  C   . MET A 1 44  A 30.458  35.954 4.604   1.00 59.72 ? 162 MET A C   1 
ATOM   105  O  O   . MET A 1 44  A 29.501  36.569 5.091   1.00 60.40 ? 162 MET A O   1 
ATOM   106  C  CB  . MET A 1 44  A 31.119  33.919 5.899   1.00 59.66 ? 162 MET A CB  1 
ATOM   107  C  CG  . MET A 1 44  A 30.241  34.117 7.122   1.00 59.26 ? 162 MET A CG  1 
ATOM   108  S  SD  . MET A 1 44  A 28.736  33.104 7.093   1.00 57.86 ? 162 MET A SD  1 
ATOM   109  C  CE  . MET A 1 44  A 28.872  32.278 8.676   1.00 60.29 ? 162 MET A CE  1 
ATOM   110  N  N   . GLY A 1 45  ? 31.519  36.557 4.065   1.00 57.66 ? 163 GLY A N   1 
ATOM   111  C  CA  . GLY A 1 45  ? 31.611  38.004 4.002   1.00 53.62 ? 163 GLY A CA  1 
ATOM   112  C  C   . GLY A 1 45  ? 32.866  38.561 4.642   1.00 51.98 ? 163 GLY A C   1 
ATOM   113  O  O   . GLY A 1 45  ? 33.621  37.859 5.309   1.00 50.84 ? 163 GLY A O   1 
ATOM   114  N  N   . LEU A 1 46  ? 33.084  39.849 4.428   1.00 51.35 ? 164 LEU A N   1 
ATOM   115  C  CA  . LEU A 1 46  ? 34.234  40.543 4.981   1.00 50.16 ? 164 LEU A CA  1 
ATOM   116  C  C   . LEU A 1 46  ? 34.002  40.966 6.436   1.00 49.87 ? 164 LEU A C   1 
ATOM   117  O  O   . LEU A 1 46  ? 32.868  41.181 6.869   1.00 49.80 ? 164 LEU A O   1 
ATOM   118  C  CB  . LEU A 1 46  ? 34.522  41.792 4.145   1.00 50.25 ? 164 LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 46  ? 35.567  41.787 3.026   1.00 51.57 ? 164 LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 46  ? 35.604  40.456 2.298   1.00 52.34 ? 164 LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 46  ? 35.241  42.920 2.064   1.00 50.96 ? 164 LEU A CD2 1 
ATOM   122  N  N   . CYS A 1 47  ? 35.094  41.075 7.185   1.00 49.50 ? 165 CYS A N   1 
ATOM   123  C  CA  . CYS A 1 47  ? 35.053  41.528 8.567   1.00 48.99 ? 165 CYS A CA  1 
ATOM   124  C  C   . CYS A 1 47  ? 36.217  42.494 8.758   1.00 49.63 ? 165 CYS A C   1 
ATOM   125  O  O   . CYS A 1 47  ? 37.288  42.106 9.215   1.00 50.37 ? 165 CYS A O   1 
ATOM   126  C  CB  . CYS A 1 47  ? 35.197  40.362 9.546   1.00 48.40 ? 165 CYS A CB  1 
ATOM   127  S  SG  . CYS A 1 47  ? 35.293  40.886 11.282  1.00 44.16 ? 165 CYS A SG  1 
ATOM   128  N  N   . ILE A 1 48  ? 36.005  43.750 8.386   1.00 49.55 ? 166 ILE A N   1 
ATOM   129  C  CA  . ILE A 1 48  ? 37.033  44.771 8.521   1.00 49.47 ? 166 ILE A CA  1 
ATOM   130  C  C   . ILE A 1 48  ? 37.142  45.195 9.981   1.00 49.84 ? 166 ILE A C   1 
ATOM   131  O  O   . ILE A 1 48  ? 36.167  45.635 10.580  1.00 50.97 ? 166 ILE A O   1 
ATOM   132  C  CB  . ILE A 1 48  ? 36.689  46.020 7.685   1.00 49.61 ? 166 ILE A CB  1 
ATOM   133  C  CG1 . ILE A 1 48  ? 36.337  45.618 6.250   1.00 50.67 ? 166 ILE A CG1 1 
ATOM   134  C  CG2 . ILE A 1 48  ? 37.855  46.983 7.693   1.00 48.61 ? 166 ILE A CG2 1 
ATOM   135  C  CD1 . ILE A 1 48  ? 37.492  45.021 5.474   1.00 51.41 ? 166 ILE A CD1 1 
ATOM   136  N  N   . ILE A 1 49  ? 38.335  45.063 10.547  1.00 50.12 ? 167 ILE A N   1 
ATOM   137  C  CA  . ILE A 1 49  ? 38.591  45.442 11.931  1.00 49.51 ? 167 ILE A CA  1 
ATOM   138  C  C   . ILE A 1 49  ? 39.560  46.620 11.986  1.00 49.50 ? 167 ILE A C   1 
ATOM   139  O  O   . ILE A 1 49  ? 40.747  46.465 11.721  1.00 50.35 ? 167 ILE A O   1 
ATOM   140  C  CB  . ILE A 1 49  ? 39.207  44.264 12.712  1.00 49.25 ? 167 ILE A CB  1 
ATOM   141  C  CG1 . ILE A 1 49  ? 38.149  43.191 12.950  1.00 49.58 ? 167 ILE A CG1 1 
ATOM   142  C  CG2 . ILE A 1 49  ? 39.795  44.750 14.025  1.00 49.21 ? 167 ILE A CG2 1 
ATOM   143  C  CD1 . ILE A 1 49  ? 38.619  42.066 13.848  1.00 48.41 ? 167 ILE A CD1 1 
ATOM   144  N  N   . ILE A 1 50  ? 39.060  47.801 12.318  1.00 49.41 ? 168 ILE A N   1 
ATOM   145  C  CA  . ILE A 1 50  ? 39.926  48.968 12.399  1.00 49.73 ? 168 ILE A CA  1 
ATOM   146  C  C   . ILE A 1 50  ? 40.369  49.165 13.841  1.00 50.96 ? 168 ILE A C   1 
ATOM   147  O  O   . ILE A 1 50  ? 39.586  49.555 14.704  1.00 51.58 ? 168 ILE A O   1 
ATOM   148  C  CB  . ILE A 1 50  ? 39.220  50.231 11.912  1.00 49.26 ? 168 ILE A CB  1 
ATOM   149  C  CG1 . ILE A 1 50  ? 38.743  50.026 10.480  1.00 49.33 ? 168 ILE A CG1 1 
ATOM   150  C  CG2 . ILE A 1 50  ? 40.175  51.417 11.972  1.00 48.76 ? 168 ILE A CG2 1 
ATOM   151  C  CD1 . ILE A 1 50  ? 38.079  51.248 9.880   1.00 51.92 ? 168 ILE A CD1 1 
ATOM   152  N  N   . ASN A 1 51  ? 41.644  48.900 14.082  1.00 51.92 ? 169 ASN A N   1 
ATOM   153  C  CA  . ASN A 1 51  ? 42.227  48.995 15.405  1.00 52.19 ? 169 ASN A CA  1 
ATOM   154  C  C   . ASN A 1 51  ? 43.155  50.206 15.557  1.00 53.01 ? 169 ASN A C   1 
ATOM   155  O  O   . ASN A 1 51  ? 44.332  50.127 15.208  1.00 53.35 ? 169 ASN A O   1 
ATOM   156  C  CB  . ASN A 1 51  ? 43.001  47.710 15.661  1.00 51.75 ? 169 ASN A CB  1 
ATOM   157  C  CG  . ASN A 1 51  ? 43.594  47.659 17.028  1.00 51.75 ? 169 ASN A CG  1 
ATOM   158  O  OD1 . ASN A 1 51  ? 44.480  46.854 17.296  1.00 52.55 ? 169 ASN A OD1 1 
ATOM   159  N  ND2 . ASN A 1 51  ? 43.109  48.513 17.914  1.00 51.87 ? 169 ASN A ND2 1 
ATOM   160  N  N   . ASN A 1 52  ? 42.623  51.313 16.081  1.00 53.27 ? 170 ASN A N   1 
ATOM   161  C  CA  . ASN A 1 52  ? 43.388  52.548 16.288  1.00 52.93 ? 170 ASN A CA  1 
ATOM   162  C  C   . ASN A 1 52  ? 43.924  52.655 17.713  1.00 54.31 ? 170 ASN A C   1 
ATOM   163  O  O   . ASN A 1 52  ? 43.164  52.915 18.645  1.00 54.71 ? 170 ASN A O   1 
ATOM   164  C  CB  . ASN A 1 52  ? 42.520  53.768 15.992  1.00 51.49 ? 170 ASN A CB  1 
ATOM   165  C  CG  . ASN A 1 52  ? 42.456  54.083 14.521  1.00 52.34 ? 170 ASN A CG  1 
ATOM   166  O  OD1 . ASN A 1 52  ? 43.279  53.610 13.752  1.00 52.77 ? 170 ASN A OD1 1 
ATOM   167  N  ND2 . ASN A 1 52  ? 41.492  54.906 14.121  1.00 52.20 ? 170 ASN A ND2 1 
ATOM   168  N  N   . LYS A 1 53  ? 45.239  52.489 17.866  1.00 55.38 ? 171 LYS A N   1 
ATOM   169  C  CA  . LYS A 1 53  ? 45.891  52.526 19.175  1.00 54.46 ? 171 LYS A CA  1 
ATOM   170  C  C   . LYS A 1 53  ? 46.652  53.799 19.509  1.00 53.40 ? 171 LYS A C   1 
ATOM   171  O  O   . LYS A 1 53  ? 46.578  54.268 20.634  1.00 53.87 ? 171 LYS A O   1 
ATOM   172  C  CB  . LYS A 1 53  ? 46.830  51.329 19.310  1.00 55.81 ? 171 LYS A CB  1 
ATOM   173  C  CG  . LYS A 1 53  ? 47.669  51.292 20.589  1.00 57.13 ? 171 LYS A CG  1 
ATOM   174  C  CD  . LYS A 1 53  ? 48.441  49.974 20.682  1.00 58.95 ? 171 LYS A CD  1 
ATOM   175  C  CE  . LYS A 1 53  ? 49.249  49.721 19.397  1.00 62.00 ? 171 LYS A CE  1 
ATOM   176  N  NZ  . LYS A 1 53  ? 49.861  48.361 19.329  1.00 62.42 ? 171 LYS A NZ  1 
ATOM   177  N  N   . ASN A 1 54  ? 47.388  54.356 18.554  1.00 52.52 ? 172 ASN A N   1 
ATOM   178  C  CA  . ASN A 1 54  ? 48.146  55.580 18.820  1.00 51.79 ? 172 ASN A CA  1 
ATOM   179  C  C   . ASN A 1 54  ? 47.621  56.769 18.024  1.00 51.44 ? 172 ASN A C   1 
ATOM   180  O  O   . ASN A 1 54  ? 47.272  56.632 16.854  1.00 51.14 ? 172 ASN A O   1 
ATOM   181  C  CB  . ASN A 1 54  ? 49.621  55.370 18.496  1.00 51.56 ? 172 ASN A CB  1 
ATOM   182  C  CG  . ASN A 1 54  ? 50.116  54.019 18.936  1.00 51.82 ? 172 ASN A CG  1 
ATOM   183  O  OD1 . ASN A 1 54  ? 50.123  53.065 18.151  1.00 53.29 ? 172 ASN A OD1 1 
ATOM   184  N  ND2 . ASN A 1 54  ? 50.514  53.915 20.199  1.00 50.47 ? 172 ASN A ND2 1 
ATOM   185  N  N   . PHE A 1 55  ? 47.580  57.940 18.657  1.00 51.41 ? 173 PHE A N   1 
ATOM   186  C  CA  . PHE A 1 55  ? 47.074  59.133 17.995  1.00 51.64 ? 173 PHE A CA  1 
ATOM   187  C  C   . PHE A 1 55  ? 48.086  60.281 17.969  1.00 52.31 ? 173 PHE A C   1 
ATOM   188  O  O   . PHE A 1 55  ? 48.927  60.400 18.864  1.00 52.58 ? 173 PHE A O   1 
ATOM   189  C  CB  . PHE A 1 55  ? 45.775  59.580 18.685  1.00 51.35 ? 173 PHE A CB  1 
ATOM   190  C  CG  . PHE A 1 55  ? 44.721  58.507 18.744  1.00 49.63 ? 173 PHE A CG  1 
ATOM   191  C  CD1 . PHE A 1 55  ? 44.851  57.434 19.618  1.00 49.69 ? 173 PHE A CD1 1 
ATOM   192  C  CD2 . PHE A 1 55  ? 43.638  58.532 17.873  1.00 48.66 ? 173 PHE A CD2 1 
ATOM   193  C  CE1 . PHE A 1 55  ? 43.924  56.395 19.622  1.00 48.88 ? 173 PHE A CE1 1 
ATOM   194  C  CE2 . PHE A 1 55  ? 42.704  57.502 17.867  1.00 48.81 ? 173 PHE A CE2 1 
ATOM   195  C  CZ  . PHE A 1 55  ? 42.850  56.429 18.743  1.00 49.15 ? 173 PHE A CZ  1 
ATOM   196  N  N   . HIS A 1 56  ? 48.002  61.107 16.927  1.00 53.13 ? 174 HIS A N   1 
ATOM   197  C  CA  . HIS A 1 56  ? 48.878  62.265 16.757  1.00 54.99 ? 174 HIS A CA  1 
ATOM   198  C  C   . HIS A 1 56  ? 48.794  63.178 17.975  1.00 55.63 ? 174 HIS A C   1 
ATOM   199  O  O   . HIS A 1 56  ? 47.711  63.345 18.551  1.00 56.16 ? 174 HIS A O   1 
ATOM   200  C  CB  . HIS A 1 56  ? 48.438  63.098 15.550  1.00 57.41 ? 174 HIS A CB  1 
ATOM   201  C  CG  . HIS A 1 56  ? 48.605  62.414 14.234  1.00 58.66 ? 174 HIS A CG  1 
ATOM   202  N  ND1 . HIS A 1 56  ? 48.320  61.079 14.048  1.00 59.96 ? 174 HIS A ND1 1 
ATOM   203  C  CD2 . HIS A 1 56  ? 48.981  62.892 13.024  1.00 59.40 ? 174 HIS A CD2 1 
ATOM   204  C  CE1 . HIS A 1 56  ? 48.514  60.763 12.779  1.00 59.99 ? 174 HIS A CE1 1 
ATOM   205  N  NE2 . HIS A 1 56  ? 48.914  61.845 12.136  1.00 59.33 ? 174 HIS A NE2 1 
ATOM   206  N  N   . LYS A 1 57  ? 49.916  63.798 18.346  1.00 55.45 ? 175 LYS A N   1 
ATOM   207  C  CA  . LYS A 1 57  ? 49.906  64.709 19.486  1.00 54.94 ? 175 LYS A CA  1 
ATOM   208  C  C   . LYS A 1 57  ? 48.901  65.830 19.214  1.00 53.82 ? 175 LYS A C   1 
ATOM   209  O  O   . LYS A 1 57  ? 48.334  66.412 20.142  1.00 54.00 ? 175 LYS A O   1 
ATOM   210  C  CB  . LYS A 1 57  ? 51.304  65.279 19.740  0.00 55.01 ? 175 LYS A CB  1 
ATOM   211  C  CG  . LYS A 1 57  ? 52.304  64.230 20.220  0.00 55.14 ? 175 LYS A CG  1 
ATOM   212  C  CD  . LYS A 1 57  ? 53.694  64.819 20.429  0.00 55.26 ? 175 LYS A CD  1 
ATOM   213  C  CE  . LYS A 1 57  ? 54.730  63.725 20.669  0.00 55.34 ? 175 LYS A CE  1 
ATOM   214  N  NZ  . LYS A 1 57  ? 56.126  64.257 20.685  0.00 55.43 ? 175 LYS A NZ  1 
ATOM   215  N  N   . SER A 1 58  A 48.652  66.092 17.933  1.00 52.62 ? 175 SER A N   1 
ATOM   216  C  CA  . SER A 1 58  A 47.717  67.138 17.516  1.00 52.39 ? 175 SER A CA  1 
ATOM   217  C  C   . SER A 1 58  A 46.269  66.889 17.935  1.00 51.84 ? 175 SER A C   1 
ATOM   218  O  O   . SER A 1 58  A 45.473  67.824 17.986  1.00 52.26 ? 175 SER A O   1 
ATOM   219  C  CB  . SER A 1 58  A 47.756  67.302 15.994  1.00 52.82 ? 175 SER A CB  1 
ATOM   220  O  OG  . SER A 1 58  A 47.244  66.151 15.331  1.00 54.37 ? 175 SER A OG  1 
ATOM   221  N  N   . THR A 1 59  B 45.927  65.635 18.222  1.00 50.32 ? 175 THR A N   1 
ATOM   222  C  CA  . THR A 1 59  B 44.566  65.298 18.605  1.00 49.13 ? 175 THR A CA  1 
ATOM   223  C  C   . THR A 1 59  B 44.360  65.499 20.091  1.00 49.96 ? 175 THR A C   1 
ATOM   224  O  O   . THR A 1 59  B 43.255  65.810 20.545  1.00 49.49 ? 175 THR A O   1 
ATOM   225  C  CB  . THR A 1 59  B 44.234  63.834 18.263  1.00 48.45 ? 175 THR A CB  1 
ATOM   226  O  OG1 . THR A 1 59  B 45.141  62.976 18.953  1.00 48.38 ? 175 THR A OG1 1 
ATOM   227  C  CG2 . THR A 1 59  B 44.348  63.579 16.766  1.00 47.36 ? 175 THR A CG2 1 
ATOM   228  N  N   . GLY A 1 60  C 45.438  65.327 20.846  1.00 50.56 ? 175 GLY A N   1 
ATOM   229  C  CA  . GLY A 1 60  C 45.347  65.476 22.286  1.00 50.94 ? 175 GLY A CA  1 
ATOM   230  C  C   . GLY A 1 60  C 44.856  64.195 22.929  1.00 50.74 ? 175 GLY A C   1 
ATOM   231  O  O   . GLY A 1 60  C 44.805  64.085 24.151  1.00 51.30 ? 175 GLY A O   1 
ATOM   232  N  N   . MET A 1 61  ? 44.499  63.226 22.094  1.00 50.22 ? 176 MET A N   1 
ATOM   233  C  CA  . MET A 1 61  ? 44.009  61.941 22.554  1.00 50.31 ? 176 MET A CA  1 
ATOM   234  C  C   . MET A 1 61  ? 45.149  61.015 23.003  1.00 50.30 ? 176 MET A C   1 
ATOM   235  O  O   . MET A 1 61  ? 46.190  60.925 22.348  1.00 50.75 ? 176 MET A O   1 
ATOM   236  C  CB  . MET A 1 61  ? 43.222  61.292 21.427  1.00 50.56 ? 176 MET A CB  1 
ATOM   237  C  CG  . MET A 1 61  ? 42.086  62.150 20.914  1.00 49.88 ? 176 MET A CG  1 
ATOM   238  S  SD  . MET A 1 61  ? 40.769  62.296 22.104  1.00 51.73 ? 176 MET A SD  1 
ATOM   239  C  CE  . MET A 1 61  ? 40.187  63.929 21.786  1.00 49.80 ? 176 MET A CE  1 
ATOM   240  N  N   . THR A 1 62  ? 44.947  60.329 24.121  1.00 48.63 ? 177 THR A N   1 
ATOM   241  C  CA  . THR A 1 62  ? 45.946  59.420 24.633  1.00 48.55 ? 177 THR A CA  1 
ATOM   242  C  C   . THR A 1 62  ? 45.821  58.081 23.940  1.00 49.03 ? 177 THR A C   1 
ATOM   243  O  O   . THR A 1 62  ? 44.834  57.809 23.270  1.00 48.48 ? 177 THR A O   1 
ATOM   244  C  CB  . THR A 1 62  ? 45.765  59.189 26.130  1.00 49.69 ? 177 THR A CB  1 
ATOM   245  O  OG1 . THR A 1 62  ? 44.507  58.539 26.370  1.00 49.85 ? 177 THR A OG1 1 
ATOM   246  C  CG2 . THR A 1 62  ? 45.810  60.515 26.873  1.00 49.51 ? 177 THR A CG2 1 
ATOM   247  N  N   . SER A 1 63  ? 46.826  57.236 24.120  1.00 50.37 ? 178 SER A N   1 
ATOM   248  C  CA  . SER A 1 63  ? 46.830  55.918 23.513  1.00 51.22 ? 178 SER A CA  1 
ATOM   249  C  C   . SER A 1 63  ? 45.741  55.040 24.125  1.00 52.01 ? 178 SER A C   1 
ATOM   250  O  O   . SER A 1 63  ? 45.226  55.314 25.217  1.00 52.57 ? 178 SER A O   1 
ATOM   251  C  CB  . SER A 1 63  ? 48.188  55.252 23.717  1.00 51.89 ? 178 SER A CB  1 
ATOM   252  O  OG  . SER A 1 63  ? 48.355  54.870 25.074  1.00 54.54 ? 178 SER A OG  1 
ATOM   253  N  N   . ARG A 1 64  ? 45.395  53.979 23.410  1.00 52.23 ? 179 ARG A N   1 
ATOM   254  C  CA  . ARG A 1 64  ? 44.383  53.050 23.872  1.00 52.39 ? 179 ARG A CA  1 
ATOM   255  C  C   . ARG A 1 64  ? 45.029  51.689 24.072  1.00 53.31 ? 179 ARG A C   1 
ATOM   256  O  O   . ARG A 1 64  ? 44.675  50.705 23.423  1.00 54.10 ? 179 ARG A O   1 
ATOM   257  C  CB  . ARG A 1 64  ? 43.242  52.978 22.858  1.00 51.36 ? 179 ARG A CB  1 
ATOM   258  C  CG  . ARG A 1 64  ? 42.536  54.313 22.684  1.00 51.20 ? 179 ARG A CG  1 
ATOM   259  C  CD  . ARG A 1 64  ? 41.398  54.267 21.667  1.00 52.38 ? 179 ARG A CD  1 
ATOM   260  N  NE  . ARG A 1 64  ? 40.308  53.372 22.063  1.00 52.06 ? 179 ARG A NE  1 
ATOM   261  C  CZ  . ARG A 1 64  ? 40.122  52.140 21.592  1.00 50.56 ? 179 ARG A CZ  1 
ATOM   262  N  NH1 . ARG A 1 64  ? 40.945  51.623 20.695  1.00 47.90 ? 179 ARG A NH1 1 
ATOM   263  N  NH2 . ARG A 1 64  ? 39.097  51.426 22.022  1.00 52.43 ? 179 ARG A NH2 1 
ATOM   264  N  N   . SER A 1 65  ? 46.002  51.651 24.974  1.00 54.55 ? 180 SER A N   1 
ATOM   265  C  CA  . SER A 1 65  ? 46.711  50.413 25.279  1.00 55.68 ? 180 SER A CA  1 
ATOM   266  C  C   . SER A 1 65  ? 45.691  49.325 25.588  1.00 54.58 ? 180 SER A C   1 
ATOM   267  O  O   . SER A 1 65  ? 44.622  49.597 26.128  1.00 52.76 ? 180 SER A O   1 
ATOM   268  C  CB  . SER A 1 65  ? 47.618  50.617 26.486  1.00 57.01 ? 180 SER A CB  1 
ATOM   269  O  OG  . SER A 1 65  ? 46.846  51.080 27.583  1.00 57.56 ? 180 SER A OG  1 
ATOM   270  N  N   . GLY A 1 66  ? 46.031  48.091 25.236  1.00 54.81 ? 181 GLY A N   1 
ATOM   271  C  CA  . GLY A 1 66  ? 45.127  46.981 25.472  1.00 53.74 ? 181 GLY A CA  1 
ATOM   272  C  C   . GLY A 1 66  ? 44.158  46.781 24.317  1.00 53.04 ? 181 GLY A C   1 
ATOM   273  O  O   . GLY A 1 66  ? 43.424  45.796 24.274  1.00 52.71 ? 181 GLY A O   1 
ATOM   274  N  N   . THR A 1 67  ? 44.155  47.713 23.372  1.00 51.94 ? 182 THR A N   1 
ATOM   275  C  CA  . THR A 1 67  ? 43.257  47.617 22.233  1.00 50.93 ? 182 THR A CA  1 
ATOM   276  C  C   . THR A 1 67  ? 43.583  46.404 21.358  1.00 51.31 ? 182 THR A C   1 
ATOM   277  O  O   . THR A 1 67  ? 42.688  45.819 20.741  1.00 51.38 ? 182 THR A O   1 
ATOM   278  C  CB  . THR A 1 67  ? 43.309  48.903 21.374  1.00 50.00 ? 182 THR A CB  1 
ATOM   279  O  OG1 . THR A 1 67  ? 42.243  48.878 20.417  1.00 49.77 ? 182 THR A OG1 1 
ATOM   280  C  CG2 . THR A 1 67  ? 44.644  49.017 20.646  1.00 50.52 ? 182 THR A CG2 1 
ATOM   281  N  N   . ASP A 1 68  ? 44.860  46.024 21.317  1.00 50.76 ? 183 ASP A N   1 
ATOM   282  C  CA  . ASP A 1 68  ? 45.295  44.884 20.514  1.00 49.86 ? 183 ASP A CA  1 
ATOM   283  C  C   . ASP A 1 68  ? 44.678  43.549 20.968  1.00 48.74 ? 183 ASP A C   1 
ATOM   284  O  O   . ASP A 1 68  ? 44.364  42.683 20.145  1.00 48.85 ? 183 ASP A O   1 
ATOM   285  C  CB  . ASP A 1 68  ? 46.824  44.811 20.527  1.00 51.37 ? 183 ASP A CB  1 
ATOM   286  C  CG  . ASP A 1 68  ? 47.473  45.951 19.740  1.00 53.55 ? 183 ASP A CG  1 
ATOM   287  O  OD1 . ASP A 1 68  ? 48.714  46.096 19.821  1.00 53.97 ? 183 ASP A OD1 1 
ATOM   288  O  OD2 . ASP A 1 68  ? 46.751  46.695 19.032  1.00 53.10 ? 183 ASP A OD2 1 
ATOM   289  N  N   . VAL A 1 69  ? 44.496  43.376 22.271  1.00 46.80 ? 184 VAL A N   1 
ATOM   290  C  CA  . VAL A 1 69  ? 43.889  42.149 22.769  1.00 46.21 ? 184 VAL A CA  1 
ATOM   291  C  C   . VAL A 1 69  ? 42.527  41.994 22.101  1.00 47.55 ? 184 VAL A C   1 
ATOM   292  O  O   . VAL A 1 69  ? 42.127  40.886 21.730  1.00 47.26 ? 184 VAL A O   1 
ATOM   293  C  CB  . VAL A 1 69  ? 43.693  42.191 24.290  1.00 44.37 ? 184 VAL A CB  1 
ATOM   294  C  CG1 . VAL A 1 69  ? 42.976  40.956 24.744  1.00 43.07 ? 184 VAL A CG1 1 
ATOM   295  C  CG2 . VAL A 1 69  ? 45.023  42.303 24.976  1.00 42.66 ? 184 VAL A CG2 1 
ATOM   296  N  N   . ASP A 1 70  ? 41.820  43.116 21.952  1.00 47.73 ? 185 ASP A N   1 
ATOM   297  C  CA  . ASP A 1 70  ? 40.511  43.117 21.310  1.00 48.23 ? 185 ASP A CA  1 
ATOM   298  C  C   . ASP A 1 70  ? 40.674  42.725 19.849  1.00 48.06 ? 185 ASP A C   1 
ATOM   299  O  O   . ASP A 1 70  ? 40.078  41.755 19.381  1.00 47.95 ? 185 ASP A O   1 
ATOM   300  C  CB  . ASP A 1 70  ? 39.868  44.504 21.371  1.00 50.16 ? 185 ASP A CB  1 
ATOM   301  C  CG  . ASP A 1 70  ? 39.163  44.782 22.684  1.00 51.08 ? 185 ASP A CG  1 
ATOM   302  O  OD1 . ASP A 1 70  ? 39.008  43.854 23.509  1.00 51.82 ? 185 ASP A OD1 1 
ATOM   303  O  OD2 . ASP A 1 70  ? 38.753  45.947 22.875  1.00 51.34 ? 185 ASP A OD2 1 
ATOM   304  N  N   . ALA A 1 71  ? 41.489  43.497 19.136  1.00 48.28 ? 186 ALA A N   1 
ATOM   305  C  CA  . ALA A 1 71  ? 41.750  43.262 17.720  1.00 48.52 ? 186 ALA A CA  1 
ATOM   306  C  C   . ALA A 1 71  ? 42.092  41.810 17.500  1.00 48.66 ? 186 ALA A C   1 
ATOM   307  O  O   . ALA A 1 71  ? 41.677  41.201 16.518  1.00 48.78 ? 186 ALA A O   1 
ATOM   308  C  CB  . ALA A 1 71  ? 42.888  44.126 17.250  1.00 48.15 ? 186 ALA A CB  1 
ATOM   309  N  N   . ALA A 1 72  ? 42.859  41.255 18.425  1.00 49.30 ? 187 ALA A N   1 
ATOM   310  C  CA  . ALA A 1 72  ? 43.240  39.868 18.322  1.00 49.19 ? 187 ALA A CA  1 
ATOM   311  C  C   . ALA A 1 72  ? 41.997  39.008 18.490  1.00 49.67 ? 187 ALA A C   1 
ATOM   312  O  O   . ALA A 1 72  ? 41.592  38.306 17.560  1.00 50.00 ? 187 ALA A O   1 
ATOM   313  C  CB  . ALA A 1 72  ? 44.262  39.535 19.386  1.00 47.64 ? 187 ALA A CB  1 
ATOM   314  N  N   . ASN A 1 73  ? 41.381  39.094 19.668  1.00 50.51 ? 188 ASN A N   1 
ATOM   315  C  CA  . ASN A 1 73  ? 40.198  38.300 19.987  1.00 51.37 ? 188 ASN A CA  1 
ATOM   316  C  C   . ASN A 1 73  ? 39.116  38.309 18.908  1.00 51.97 ? 188 ASN A C   1 
ATOM   317  O  O   . ASN A 1 73  ? 38.552  37.259 18.567  1.00 51.39 ? 188 ASN A O   1 
ATOM   318  C  CB  . ASN A 1 73  ? 39.603  38.756 21.312  1.00 51.57 ? 188 ASN A CB  1 
ATOM   319  C  CG  . ASN A 1 73  ? 38.659  37.737 21.888  1.00 53.13 ? 188 ASN A CG  1 
ATOM   320  O  OD1 . ASN A 1 73  ? 38.084  37.932 22.958  1.00 54.94 ? 188 ASN A OD1 1 
ATOM   321  N  ND2 . ASN A 1 73  ? 38.493  36.627 21.177  1.00 55.04 ? 188 ASN A ND2 1 
ATOM   322  N  N   . LEU A 1 74  ? 38.822  39.492 18.379  1.00 52.55 ? 189 LEU A N   1 
ATOM   323  C  CA  . LEU A 1 74  ? 37.826  39.619 17.330  1.00 53.21 ? 189 LEU A CA  1 
ATOM   324  C  C   . LEU A 1 74  ? 38.254  38.810 16.109  1.00 54.18 ? 189 LEU A C   1 
ATOM   325  O  O   . LEU A 1 74  ? 37.465  38.050 15.547  1.00 55.32 ? 189 LEU A O   1 
ATOM   326  C  CB  . LEU A 1 74  ? 37.661  41.082 16.952  1.00 53.13 ? 189 LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 74  ? 36.817  41.911 17.912  1.00 52.23 ? 189 LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 74  ? 37.106  43.375 17.707  1.00 53.55 ? 189 LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 74  ? 35.352  41.610 17.686  1.00 52.11 ? 189 LEU A CD2 1 
ATOM   330  N  N   . ARG A 1 75  ? 39.510  38.969 15.705  1.00 54.73 ? 190 ARG A N   1 
ATOM   331  C  CA  . ARG A 1 75  ? 40.028  38.237 14.560  1.00 56.11 ? 190 ARG A CA  1 
ATOM   332  C  C   . ARG A 1 75  ? 39.762  36.730 14.710  1.00 56.08 ? 190 ARG A C   1 
ATOM   333  O  O   . ARG A 1 75  ? 39.167  36.110 13.829  1.00 55.80 ? 190 ARG A O   1 
ATOM   334  C  CB  . ARG A 1 75  ? 41.529  38.495 14.400  1.00 57.31 ? 190 ARG A CB  1 
ATOM   335  C  CG  . ARG A 1 75  ? 42.067  37.993 13.081  1.00 59.25 ? 190 ARG A CG  1 
ATOM   336  C  CD  . ARG A 1 75  ? 43.564  38.131 12.926  1.00 60.91 ? 190 ARG A CD  1 
ATOM   337  N  NE  . ARG A 1 75  ? 43.932  37.634 11.599  1.00 64.37 ? 190 ARG A NE  1 
ATOM   338  C  CZ  . ARG A 1 75  ? 45.172  37.388 11.173  1.00 65.79 ? 190 ARG A CZ  1 
ATOM   339  N  NH1 . ARG A 1 75  ? 45.351  36.936 9.941   1.00 65.43 ? 190 ARG A NH1 1 
ATOM   340  N  NH2 . ARG A 1 75  ? 46.231  37.583 11.965  1.00 66.52 ? 190 ARG A NH2 1 
ATOM   341  N  N   . GLU A 1 76  ? 40.194  36.146 15.826  1.00 56.13 ? 191 GLU A N   1 
ATOM   342  C  CA  . GLU A 1 76  ? 39.975  34.719 16.064  1.00 57.65 ? 191 GLU A CA  1 
ATOM   343  C  C   . GLU A 1 76  ? 38.488  34.397 15.979  1.00 56.73 ? 191 GLU A C   1 
ATOM   344  O  O   . GLU A 1 76  ? 38.065  33.494 15.240  1.00 55.33 ? 191 GLU A O   1 
ATOM   345  C  CB  . GLU A 1 76  ? 40.497  34.305 17.451  1.00 59.37 ? 191 GLU A CB  1 
ATOM   346  C  CG  . GLU A 1 76  ? 40.151  32.862 17.838  1.00 63.89 ? 191 GLU A CG  1 
ATOM   347  C  CD  . GLU A 1 76  ? 40.578  32.482 19.276  1.00 67.85 ? 191 GLU A CD  1 
ATOM   348  O  OE1 . GLU A 1 76  ? 40.140  33.148 20.262  1.00 69.08 ? 191 GLU A OE1 1 
ATOM   349  O  OE2 . GLU A 1 76  ? 41.354  31.502 19.422  1.00 69.65 ? 191 GLU A OE2 1 
ATOM   350  N  N   . THR A 1 77  ? 37.705  35.156 16.743  1.00 56.27 ? 192 THR A N   1 
ATOM   351  C  CA  . THR A 1 77  ? 36.264  34.967 16.804  1.00 55.26 ? 192 THR A CA  1 
ATOM   352  C  C   . THR A 1 77  ? 35.600  34.891 15.445  1.00 55.11 ? 192 THR A C   1 
ATOM   353  O  O   . THR A 1 77  ? 34.924  33.908 15.139  1.00 55.72 ? 192 THR A O   1 
ATOM   354  C  CB  . THR A 1 77  ? 35.585  36.090 17.608  1.00 54.91 ? 192 THR A CB  1 
ATOM   355  O  OG1 . THR A 1 77  ? 36.079  36.078 18.952  1.00 54.18 ? 192 THR A OG1 1 
ATOM   356  C  CG2 . THR A 1 77  ? 34.066  35.893 17.629  1.00 53.89 ? 192 THR A CG2 1 
ATOM   357  N  N   . PHE A 1 78  ? 35.794  35.927 14.636  1.00 54.01 ? 193 PHE A N   1 
ATOM   358  C  CA  . PHE A 1 78  ? 35.180  35.971 13.322  1.00 54.29 ? 193 PHE A CA  1 
ATOM   359  C  C   . PHE A 1 78  ? 35.815  35.063 12.282  1.00 55.18 ? 193 PHE A C   1 
ATOM   360  O  O   . PHE A 1 78  ? 35.194  34.753 11.270  1.00 55.01 ? 193 PHE A O   1 
ATOM   361  C  CB  . PHE A 1 78  ? 35.104  37.412 12.819  1.00 51.35 ? 193 PHE A CB  1 
ATOM   362  C  CG  . PHE A 1 78  ? 34.020  38.211 13.477  1.00 49.15 ? 193 PHE A CG  1 
ATOM   363  C  CD1 . PHE A 1 78  ? 34.206  38.756 14.737  1.00 49.19 ? 193 PHE A CD1 1 
ATOM   364  C  CD2 . PHE A 1 78  ? 32.782  38.354 12.869  1.00 49.02 ? 193 PHE A CD2 1 
ATOM   365  C  CE1 . PHE A 1 78  ? 33.173  39.429 15.384  1.00 48.17 ? 193 PHE A CE1 1 
ATOM   366  C  CE2 . PHE A 1 78  ? 31.742  39.023 13.509  1.00 47.43 ? 193 PHE A CE2 1 
ATOM   367  C  CZ  . PHE A 1 78  ? 31.938  39.559 14.767  1.00 47.81 ? 193 PHE A CZ  1 
ATOM   368  N  N   . ARG A 1 79  ? 37.048  34.634 12.514  1.00 57.22 ? 194 ARG A N   1 
ATOM   369  C  CA  . ARG A 1 79  ? 37.661  33.716 11.568  1.00 59.40 ? 194 ARG A CA  1 
ATOM   370  C  C   . ARG A 1 79  ? 36.919  32.408 11.793  1.00 59.09 ? 194 ARG A C   1 
ATOM   371  O  O   . ARG A 1 79  ? 36.444  31.782 10.848  1.00 59.54 ? 194 ARG A O   1 
ATOM   372  C  CB  . ARG A 1 79  ? 39.161  33.535 11.837  1.00 60.70 ? 194 ARG A CB  1 
ATOM   373  C  CG  . ARG A 1 79  ? 40.029  34.705 11.355  1.00 63.91 ? 194 ARG A CG  1 
ATOM   374  C  CD  . ARG A 1 79  ? 41.487  34.566 11.807  1.00 66.92 ? 194 ARG A CD  1 
ATOM   375  N  NE  . ARG A 1 79  ? 42.151  33.436 11.160  1.00 70.04 ? 194 ARG A NE  1 
ATOM   376  C  CZ  . ARG A 1 79  ? 42.520  33.423 9.879   1.00 71.20 ? 194 ARG A CZ  1 
ATOM   377  N  NH1 . ARG A 1 79  ? 42.293  34.493 9.115   1.00 71.64 ? 194 ARG A NH1 1 
ATOM   378  N  NH2 . ARG A 1 79  ? 43.093  32.338 9.357   1.00 70.08 ? 194 ARG A NH2 1 
ATOM   379  N  N   . ASN A 1 80  ? 36.783  32.018 13.053  1.00 58.34 ? 195 ASN A N   1 
ATOM   380  C  CA  . ASN A 1 80  ? 36.082  30.784 13.369  1.00 58.41 ? 195 ASN A CA  1 
ATOM   381  C  C   . ASN A 1 80  ? 34.679  30.805 12.797  1.00 57.50 ? 195 ASN A C   1 
ATOM   382  O  O   . ASN A 1 80  ? 34.061  29.759 12.635  1.00 57.99 ? 195 ASN A O   1 
ATOM   383  C  CB  . ASN A 1 80  ? 36.034  30.568 14.884  1.00 60.61 ? 195 ASN A CB  1 
ATOM   384  C  CG  . ASN A 1 80  ? 37.425  30.327 15.489  1.00 62.86 ? 195 ASN A CG  1 
ATOM   385  O  OD1 . ASN A 1 80  ? 37.620  30.442 16.711  1.00 65.08 ? 195 ASN A OD1 1 
ATOM   386  N  ND2 . ASN A 1 80  ? 38.394  29.981 14.637  1.00 61.99 ? 195 ASN A ND2 1 
ATOM   387  N  N   . LEU A 1 81  ? 34.178  31.994 12.477  1.00 56.51 ? 196 LEU A N   1 
ATOM   388  C  CA  . LEU A 1 81  ? 32.835  32.120 11.911  1.00 55.62 ? 196 LEU A CA  1 
ATOM   389  C  C   . LEU A 1 81  ? 32.881  32.095 10.390  1.00 54.53 ? 196 LEU A C   1 
ATOM   390  O  O   . LEU A 1 81  ? 31.865  32.289 9.714   1.00 54.26 ? 196 LEU A O   1 
ATOM   391  C  CB  . LEU A 1 81  ? 32.151  33.402 12.420  1.00 55.80 ? 196 LEU A CB  1 
ATOM   392  C  CG  . LEU A 1 81  ? 31.815  33.366 13.923  1.00 55.83 ? 196 LEU A CG  1 
ATOM   393  C  CD1 . LEU A 1 81  ? 31.194  34.677 14.368  1.00 54.57 ? 196 LEU A CD1 1 
ATOM   394  C  CD2 . LEU A 1 81  ? 30.868  32.209 14.203  1.00 54.92 ? 196 LEU A CD2 1 
ATOM   395  N  N   . LYS A 1 82  ? 34.077  31.848 9.868   1.00 53.69 ? 197 LYS A N   1 
ATOM   396  C  CA  . LYS A 1 82  ? 34.313  31.755 8.432   1.00 53.67 ? 197 LYS A CA  1 
ATOM   397  C  C   . LYS A 1 82  ? 34.269  33.078 7.683   1.00 52.68 ? 197 LYS A C   1 
ATOM   398  O  O   . LYS A 1 82  ? 33.979  33.114 6.480   1.00 53.09 ? 197 LYS A O   1 
ATOM   399  C  CB  . LYS A 1 82  ? 33.332  30.761 7.796   1.00 54.56 ? 197 LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 82  ? 33.459  29.361 8.371   1.00 56.37 ? 197 LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 82  ? 34.897  28.887 8.270   1.00 58.54 ? 197 LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 82  ? 35.217  27.809 9.287   1.00 61.32 ? 197 LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 82  ? 36.702  27.660 9.429   1.00 63.51 ? 197 LYS A NZ  1 
ATOM   404  N  N   . TYR A 1 83  ? 34.558  34.164 8.389   1.00 50.65 ? 198 TYR A N   1 
ATOM   405  C  CA  . TYR A 1 83  ? 34.581  35.472 7.758   1.00 48.22 ? 198 TYR A CA  1 
ATOM   406  C  C   . TYR A 1 83  ? 35.978  35.719 7.205   1.00 47.96 ? 198 TYR A C   1 
ATOM   407  O  O   . TYR A 1 83  ? 36.952  35.134 7.677   1.00 47.24 ? 198 TYR A O   1 
ATOM   408  C  CB  . TYR A 1 83  ? 34.235  36.573 8.764   1.00 46.43 ? 198 TYR A CB  1 
ATOM   409  C  CG  . TYR A 1 83  ? 32.761  36.848 8.892   1.00 44.75 ? 198 TYR A CG  1 
ATOM   410  C  CD1 . TYR A 1 83  ? 31.991  36.201 9.852   1.00 44.29 ? 198 TYR A CD1 1 
ATOM   411  C  CD2 . TYR A 1 83  ? 32.121  37.739 8.019   1.00 44.38 ? 198 TYR A CD2 1 
ATOM   412  C  CE1 . TYR A 1 83  ? 30.618  36.430 9.938   1.00 44.98 ? 198 TYR A CE1 1 
ATOM   413  C  CE2 . TYR A 1 83  ? 30.753  37.973 8.098   1.00 43.23 ? 198 TYR A CE2 1 
ATOM   414  C  CZ  . TYR A 1 83  ? 30.011  37.313 9.058   1.00 44.00 ? 198 TYR A CZ  1 
ATOM   415  O  OH  . TYR A 1 83  ? 28.662  37.513 9.129   1.00 45.41 ? 198 TYR A OH  1 
ATOM   416  N  N   . GLU A 1 84  ? 36.072  36.568 6.190   1.00 48.32 ? 199 GLU A N   1 
ATOM   417  C  CA  . GLU A 1 84  ? 37.365  36.900 5.621   1.00 49.70 ? 199 GLU A CA  1 
ATOM   418  C  C   . GLU A 1 84  ? 37.815  38.125 6.398   1.00 50.04 ? 199 GLU A C   1 
ATOM   419  O  O   . GLU A 1 84  ? 37.465  39.242 6.048   1.00 51.85 ? 199 GLU A O   1 
ATOM   420  C  CB  . GLU A 1 84  ? 37.241  37.233 4.132   1.00 50.49 ? 199 GLU A CB  1 
ATOM   421  C  CG  . GLU A 1 84  ? 38.559  37.730 3.526   1.00 53.91 ? 199 GLU A CG  1 
ATOM   422  C  CD  . GLU A 1 84  ? 38.407  38.291 2.122   1.00 55.75 ? 199 GLU A CD  1 
ATOM   423  O  OE1 . GLU A 1 84  ? 39.252  39.124 1.726   1.00 56.72 ? 199 GLU A OE1 1 
ATOM   424  O  OE2 . GLU A 1 84  ? 37.451  37.895 1.413   1.00 58.64 ? 199 GLU A OE2 1 
ATOM   425  N  N   . VAL A 1 85  ? 38.582  37.917 7.459   1.00 50.49 ? 200 VAL A N   1 
ATOM   426  C  CA  . VAL A 1 85  ? 39.026  39.023 8.296   1.00 51.44 ? 200 VAL A CA  1 
ATOM   427  C  C   . VAL A 1 85  ? 40.171  39.841 7.723   1.00 52.01 ? 200 VAL A C   1 
ATOM   428  O  O   . VAL A 1 85  ? 41.079  39.302 7.096   1.00 52.12 ? 200 VAL A O   1 
ATOM   429  C  CB  . VAL A 1 85  ? 39.443  38.517 9.677   1.00 51.50 ? 200 VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 85  ? 39.880  39.682 10.555  1.00 51.21 ? 200 VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 85  ? 38.286  37.774 10.311  1.00 52.55 ? 200 VAL A CG2 1 
ATOM   432  N  N   . ARG A 1 86  ? 40.119  41.150 7.942   1.00 52.30 ? 201 ARG A N   1 
ATOM   433  C  CA  . ARG A 1 86  ? 41.161  42.052 7.467   1.00 53.36 ? 201 ARG A CA  1 
ATOM   434  C  C   . ARG A 1 86  ? 41.440  43.106 8.535   1.00 54.48 ? 201 ARG A C   1 
ATOM   435  O  O   . ARG A 1 86  ? 40.626  44.005 8.746   1.00 55.77 ? 201 ARG A O   1 
ATOM   436  C  CB  . ARG A 1 86  ? 40.733  42.754 6.170   1.00 51.48 ? 201 ARG A CB  1 
ATOM   437  C  CG  . ARG A 1 86  ? 40.386  41.831 5.008   1.00 50.64 ? 201 ARG A CG  1 
ATOM   438  C  CD  . ARG A 1 86  ? 40.137  42.628 3.734   1.00 48.69 ? 201 ARG A CD  1 
ATOM   439  N  NE  . ARG A 1 86  ? 39.428  41.846 2.724   1.00 48.64 ? 201 ARG A NE  1 
ATOM   440  C  CZ  . ARG A 1 86  ? 38.985  42.342 1.569   1.00 49.76 ? 201 ARG A CZ  1 
ATOM   441  N  NH1 . ARG A 1 86  ? 39.184  43.620 1.275   1.00 48.75 ? 201 ARG A NH1 1 
ATOM   442  N  NH2 . ARG A 1 86  ? 38.322  41.570 0.713   1.00 49.98 ? 201 ARG A NH2 1 
ATOM   443  N  N   . ASN A 1 87  ? 42.579  43.003 9.209   1.00 54.82 ? 202 ASN A N   1 
ATOM   444  C  CA  . ASN A 1 87  ? 42.908  43.978 10.238  1.00 55.97 ? 202 ASN A CA  1 
ATOM   445  C  C   . ASN A 1 87  ? 43.601  45.214 9.689   1.00 56.44 ? 202 ASN A C   1 
ATOM   446  O  O   . ASN A 1 87  ? 44.342  45.140 8.708   1.00 56.77 ? 202 ASN A O   1 
ATOM   447  C  CB  . ASN A 1 87  ? 43.782  43.346 11.313  1.00 57.09 ? 202 ASN A CB  1 
ATOM   448  C  CG  . ASN A 1 87  ? 43.125  42.150 11.953  1.00 59.66 ? 202 ASN A CG  1 
ATOM   449  O  OD1 . ASN A 1 87  ? 42.940  41.109 11.306  1.00 62.64 ? 202 ASN A OD1 1 
ATOM   450  N  ND2 . ASN A 1 87  ? 42.753  42.286 13.224  1.00 58.97 ? 202 ASN A ND2 1 
ATOM   451  N  N   . LYS A 1 88  ? 43.344  46.349 10.331  1.00 56.24 ? 203 LYS A N   1 
ATOM   452  C  CA  . LYS A 1 88  ? 43.940  47.621 9.943   1.00 57.02 ? 203 LYS A CA  1 
ATOM   453  C  C   . LYS A 1 88  ? 44.315  48.337 11.226  1.00 57.45 ? 203 LYS A C   1 
ATOM   454  O  O   . LYS A 1 88  ? 43.597  48.231 12.222  1.00 58.52 ? 203 LYS A O   1 
ATOM   455  C  CB  . LYS A 1 88  ? 42.934  48.455 9.146   1.00 57.58 ? 203 LYS A CB  1 
ATOM   456  C  CG  . LYS A 1 88  ? 42.491  47.808 7.834   1.00 58.41 ? 203 LYS A CG  1 
ATOM   457  C  CD  . LYS A 1 88  ? 43.647  47.675 6.857   1.00 59.29 ? 203 LYS A CD  1 
ATOM   458  C  CE  . LYS A 1 88  ? 43.183  47.076 5.534   1.00 60.05 ? 203 LYS A CE  1 
ATOM   459  N  NZ  . LYS A 1 88  ? 44.318  46.802 4.597   1.00 61.19 ? 203 LYS A NZ  1 
ATOM   460  N  N   . ASN A 1 89  ? 45.432  49.056 11.228  1.00 57.04 ? 204 ASN A N   1 
ATOM   461  C  CA  . ASN A 1 89  ? 45.827  49.745 12.451  1.00 57.17 ? 204 ASN A CA  1 
ATOM   462  C  C   . ASN A 1 89  ? 46.230  51.201 12.284  1.00 56.68 ? 204 ASN A C   1 
ATOM   463  O  O   . ASN A 1 89  ? 46.799  51.606 11.272  1.00 57.61 ? 204 ASN A O   1 
ATOM   464  C  CB  . ASN A 1 89  ? 46.944  48.969 13.160  1.00 56.56 ? 204 ASN A CB  1 
ATOM   465  C  CG  . ASN A 1 89  ? 46.530  47.550 13.507  1.00 57.43 ? 204 ASN A CG  1 
ATOM   466  O  OD1 . ASN A 1 89  ? 46.413  46.702 12.631  1.00 58.00 ? 204 ASN A OD1 1 
ATOM   467  N  ND2 . ASN A 1 89  ? 46.288  47.292 14.785  1.00 57.75 ? 204 ASN A ND2 1 
ATOM   468  N  N   . ASP A 1 90  ? 45.909  51.988 13.299  1.00 56.05 ? 205 ASP A N   1 
ATOM   469  C  CA  . ASP A 1 90  ? 46.228  53.399 13.304  1.00 55.28 ? 205 ASP A CA  1 
ATOM   470  C  C   . ASP A 1 90  ? 46.006  54.097 11.957  1.00 53.93 ? 205 ASP A C   1 
ATOM   471  O  O   . ASP A 1 90  ? 46.901  54.745 11.429  1.00 54.47 ? 205 ASP A O   1 
ATOM   472  C  CB  . ASP A 1 90  ? 47.670  53.582 13.774  1.00 55.50 ? 205 ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 90  ? 47.921  52.931 15.116  1.00 55.63 ? 205 ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 90  ? 47.144  53.198 16.060  1.00 55.69 ? 205 ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 90  ? 48.894  52.155 15.224  1.00 55.75 ? 205 ASP A OD2 1 
ATOM   476  N  N   . LEU A 1 91  ? 44.807  53.963 11.405  1.00 51.52 ? 206 LEU A N   1 
ATOM   477  C  CA  . LEU A 1 91  ? 44.490  54.614 10.149  1.00 50.90 ? 206 LEU A CA  1 
ATOM   478  C  C   . LEU A 1 91  ? 44.062  56.053 10.456  1.00 51.33 ? 206 LEU A C   1 
ATOM   479  O  O   . LEU A 1 91  ? 43.693  56.373 11.586  1.00 51.71 ? 206 LEU A O   1 
ATOM   480  C  CB  . LEU A 1 91  ? 43.364  53.861 9.425   1.00 49.63 ? 206 LEU A CB  1 
ATOM   481  C  CG  . LEU A 1 91  ? 43.691  52.489 8.811   1.00 48.34 ? 206 LEU A CG  1 
ATOM   482  C  CD1 . LEU A 1 91  ? 44.197  51.554 9.870   1.00 48.91 ? 206 LEU A CD1 1 
ATOM   483  C  CD2 . LEU A 1 91  ? 42.467  51.903 8.166   1.00 45.36 ? 206 LEU A CD2 1 
ATOM   484  N  N   . THR A 1 92  ? 44.140  56.925 9.460   1.00 50.80 ? 207 THR A N   1 
ATOM   485  C  CA  . THR A 1 92  ? 43.743  58.313 9.640   1.00 50.68 ? 207 THR A CA  1 
ATOM   486  C  C   . THR A 1 92  ? 42.297  58.414 9.182   1.00 50.20 ? 207 THR A C   1 
ATOM   487  O  O   . THR A 1 92  ? 41.785  57.485 8.562   1.00 50.49 ? 207 THR A O   1 
ATOM   488  C  CB  . THR A 1 92  ? 44.609  59.244 8.784   1.00 51.75 ? 207 THR A CB  1 
ATOM   489  O  OG1 . THR A 1 92  ? 44.625  58.762 7.430   1.00 52.15 ? 207 THR A OG1 1 
ATOM   490  C  CG2 . THR A 1 92  ? 46.026  59.305 9.331   1.00 49.84 ? 207 THR A CG2 1 
ATOM   491  N  N   . ARG A 1 93  ? 41.631  59.519 9.485   1.00 49.42 ? 208 ARG A N   1 
ATOM   492  C  CA  . ARG A 1 93  ? 40.245  59.660 9.061   1.00 50.59 ? 208 ARG A CA  1 
ATOM   493  C  C   . ARG A 1 93  ? 40.155  59.447 7.559   1.00 50.44 ? 208 ARG A C   1 
ATOM   494  O  O   . ARG A 1 93  ? 39.257  58.761 7.072   1.00 49.46 ? 208 ARG A O   1 
ATOM   495  C  CB  . ARG A 1 93  ? 39.700  61.041 9.443   1.00 50.79 ? 208 ARG A CB  1 
ATOM   496  C  CG  . ARG A 1 93  ? 40.667  62.161 9.219   1.00 52.13 ? 208 ARG A CG  1 
ATOM   497  C  CD  . ARG A 1 93  ? 40.405  63.255 10.201  1.00 53.73 ? 208 ARG A CD  1 
ATOM   498  N  NE  . ARG A 1 93  ? 39.516  64.278 9.677   1.00 55.99 ? 208 ARG A NE  1 
ATOM   499  C  CZ  . ARG A 1 93  ? 38.900  65.180 10.438  1.00 59.32 ? 208 ARG A CZ  1 
ATOM   500  N  NH1 . ARG A 1 93  ? 39.076  65.168 11.757  1.00 62.97 ? 208 ARG A NH1 1 
ATOM   501  N  NH2 . ARG A 1 93  ? 38.124  66.109 9.890   1.00 59.49 ? 208 ARG A NH2 1 
ATOM   502  N  N   . GLU A 1 94  ? 41.106  60.020 6.829   1.00 50.95 ? 209 GLU A N   1 
ATOM   503  C  CA  . GLU A 1 94  ? 41.127  59.878 5.381   1.00 52.34 ? 209 GLU A CA  1 
ATOM   504  C  C   . GLU A 1 94  ? 41.267  58.404 5.014   1.00 53.26 ? 209 GLU A C   1 
ATOM   505  O  O   . GLU A 1 94  ? 40.473  57.863 4.236   1.00 52.63 ? 209 GLU A O   1 
ATOM   506  C  CB  . GLU A 1 94  ? 42.282  60.675 4.775   1.00 51.34 ? 209 GLU A CB  1 
ATOM   507  C  CG  . GLU A 1 94  ? 42.221  62.166 5.026   1.00 51.88 ? 209 GLU A CG  1 
ATOM   508  C  CD  . GLU A 1 94  ? 42.593  62.543 6.446   1.00 53.11 ? 209 GLU A CD  1 
ATOM   509  O  OE1 . GLU A 1 94  ? 42.458  63.737 6.798   1.00 53.69 ? 209 GLU A OE1 1 
ATOM   510  O  OE2 . GLU A 1 94  ? 43.026  61.649 7.204   1.00 52.11 ? 209 GLU A OE2 1 
ATOM   511  N  N   . GLU A 1 95  ? 42.273  57.753 5.584   1.00 54.21 ? 210 GLU A N   1 
ATOM   512  C  CA  . GLU A 1 95  ? 42.499  56.342 5.300   1.00 55.94 ? 210 GLU A CA  1 
ATOM   513  C  C   . GLU A 1 95  ? 41.239  55.515 5.553   1.00 56.11 ? 210 GLU A C   1 
ATOM   514  O  O   . GLU A 1 95  ? 40.890  54.646 4.751   1.00 56.55 ? 210 GLU A O   1 
ATOM   515  C  CB  . GLU A 1 95  ? 43.677  55.826 6.136   1.00 56.51 ? 210 GLU A CB  1 
ATOM   516  C  CG  . GLU A 1 95  ? 44.989  56.440 5.693   1.00 59.06 ? 210 GLU A CG  1 
ATOM   517  C  CD  . GLU A 1 95  ? 46.162  56.109 6.588   1.00 60.74 ? 210 GLU A CD  1 
ATOM   518  O  OE1 . GLU A 1 95  ? 47.291  56.516 6.238   1.00 62.08 ? 210 GLU A OE1 1 
ATOM   519  O  OE2 . GLU A 1 95  ? 45.970  55.456 7.635   1.00 62.54 ? 210 GLU A OE2 1 
ATOM   520  N  N   . ILE A 1 96  ? 40.550  55.796 6.658   1.00 55.51 ? 211 ILE A N   1 
ATOM   521  C  CA  . ILE A 1 96  ? 39.331  55.071 6.991   1.00 54.41 ? 211 ILE A CA  1 
ATOM   522  C  C   . ILE A 1 96  ? 38.282  55.332 5.925   1.00 54.22 ? 211 ILE A C   1 
ATOM   523  O  O   . ILE A 1 96  ? 37.733  54.404 5.356   1.00 53.66 ? 211 ILE A O   1 
ATOM   524  C  CB  . ILE A 1 96  ? 38.769  55.504 8.363   1.00 54.41 ? 211 ILE A CB  1 
ATOM   525  C  CG1 . ILE A 1 96  ? 39.746  55.106 9.475   1.00 55.72 ? 211 ILE A CG1 1 
ATOM   526  C  CG2 . ILE A 1 96  ? 37.398  54.870 8.593   1.00 53.78 ? 211 ILE A CG2 1 
ATOM   527  C  CD1 . ILE A 1 96  ? 39.307  55.520 10.867  1.00 54.12 ? 211 ILE A CD1 1 
ATOM   528  N  N   . VAL A 1 97  ? 38.004  56.602 5.658   1.00 54.54 ? 212 VAL A N   1 
ATOM   529  C  CA  . VAL A 1 97  ? 37.016  56.955 4.649   1.00 55.32 ? 212 VAL A CA  1 
ATOM   530  C  C   . VAL A 1 97  ? 37.371  56.244 3.352   1.00 56.29 ? 212 VAL A C   1 
ATOM   531  O  O   . VAL A 1 97  ? 36.515  55.643 2.698   1.00 56.22 ? 212 VAL A O   1 
ATOM   532  C  CB  . VAL A 1 97  ? 36.998  58.473 4.368   1.00 55.26 ? 212 VAL A CB  1 
ATOM   533  C  CG1 . VAL A 1 97  ? 35.999  58.782 3.263   1.00 53.37 ? 212 VAL A CG1 1 
ATOM   534  C  CG2 . VAL A 1 97  ? 36.646  59.232 5.633   1.00 55.35 ? 212 VAL A CG2 1 
ATOM   535  N  N   . GLU A 1 98  ? 38.648  56.327 2.991   1.00 56.69 ? 213 GLU A N   1 
ATOM   536  C  CA  . GLU A 1 98  ? 39.143  55.703 1.780   1.00 56.92 ? 213 GLU A CA  1 
ATOM   537  C  C   . GLU A 1 98  ? 38.978  54.188 1.837   1.00 55.59 ? 213 GLU A C   1 
ATOM   538  O  O   . GLU A 1 98  ? 38.479  53.575 0.892   1.00 54.89 ? 213 GLU A O   1 
ATOM   539  C  CB  . GLU A 1 98  ? 40.615  56.062 1.566   1.00 59.73 ? 213 GLU A CB  1 
ATOM   540  C  CG  . GLU A 1 98  ? 41.269  55.251 0.445   1.00 65.23 ? 213 GLU A CG  1 
ATOM   541  C  CD  . GLU A 1 98  ? 42.744  55.585 0.235   1.00 68.69 ? 213 GLU A CD  1 
ATOM   542  O  OE1 . GLU A 1 98  ? 43.508  55.616 1.239   1.00 70.41 ? 213 GLU A OE1 1 
ATOM   543  O  OE2 . GLU A 1 98  ? 43.138  55.802 -0.942  1.00 70.30 ? 213 GLU A OE2 1 
ATOM   544  N  N   . LEU A 1 99  ? 39.394  53.588 2.947   1.00 54.02 ? 214 LEU A N   1 
ATOM   545  C  CA  . LEU A 1 99  ? 39.278  52.147 3.106   1.00 52.76 ? 214 LEU A CA  1 
ATOM   546  C  C   . LEU A 1 99  ? 37.841  51.696 2.894   1.00 53.63 ? 214 LEU A C   1 
ATOM   547  O  O   . LEU A 1 99  ? 37.576  50.807 2.092   1.00 53.46 ? 214 LEU A O   1 
ATOM   548  C  CB  . LEU A 1 99  ? 39.752  51.716 4.488   1.00 51.29 ? 214 LEU A CB  1 
ATOM   549  C  CG  . LEU A 1 99  ? 39.450  50.248 4.789   1.00 50.56 ? 214 LEU A CG  1 
ATOM   550  C  CD1 . LEU A 1 99  ? 39.961  49.394 3.660   1.00 49.27 ? 214 LEU A CD1 1 
ATOM   551  C  CD2 . LEU A 1 99  ? 40.093  49.828 6.102   1.00 50.75 ? 214 LEU A CD2 1 
ATOM   552  N  N   . MET A 1 100 ? 36.911  52.312 3.613   1.00 54.86 ? 215 MET A N   1 
ATOM   553  C  CA  . MET A 1 100 ? 35.505  51.962 3.473   1.00 56.36 ? 215 MET A CA  1 
ATOM   554  C  C   . MET A 1 100 ? 35.056  52.121 2.015   1.00 57.40 ? 215 MET A C   1 
ATOM   555  O  O   . MET A 1 100 ? 34.489  51.191 1.435   1.00 58.45 ? 215 MET A O   1 
ATOM   556  C  CB  . MET A 1 100 ? 34.629  52.835 4.386   1.00 56.05 ? 215 MET A CB  1 
ATOM   557  C  CG  . MET A 1 100 ? 34.848  52.624 5.874   1.00 55.73 ? 215 MET A CG  1 
ATOM   558  S  SD  . MET A 1 100 ? 34.526  50.933 6.422   1.00 56.93 ? 215 MET A SD  1 
ATOM   559  C  CE  . MET A 1 100 ? 36.206  50.275 6.391   1.00 56.89 ? 215 MET A CE  1 
ATOM   560  N  N   . ARG A 1 101 ? 35.319  53.286 1.422   1.00 57.55 ? 216 ARG A N   1 
ATOM   561  C  CA  . ARG A 1 101 ? 34.925  53.546 0.032   1.00 57.50 ? 216 ARG A CA  1 
ATOM   562  C  C   . ARG A 1 101 ? 35.390  52.426 -0.899  1.00 57.01 ? 216 ARG A C   1 
ATOM   563  O  O   . ARG A 1 101 ? 34.635  51.943 -1.747  1.00 56.34 ? 216 ARG A O   1 
ATOM   564  C  CB  . ARG A 1 101 ? 35.509  54.875 -0.460  1.00 58.30 ? 216 ARG A CB  1 
ATOM   565  C  CG  . ARG A 1 101 ? 35.054  55.265 -1.858  1.00 59.22 ? 216 ARG A CG  1 
ATOM   566  C  CD  . ARG A 1 101 ? 36.077  56.146 -2.563  1.00 61.53 ? 216 ARG A CD  1 
ATOM   567  N  NE  . ARG A 1 101 ? 36.447  57.319 -1.772  1.00 62.86 ? 216 ARG A NE  1 
ATOM   568  C  CZ  . ARG A 1 101 ? 35.604  58.286 -1.409  1.00 62.82 ? 216 ARG A CZ  1 
ATOM   569  N  NH1 . ARG A 1 101 ? 34.318  58.235 -1.764  1.00 61.19 ? 216 ARG A NH1 1 
ATOM   570  N  NH2 . ARG A 1 101 ? 36.050  59.307 -0.679  1.00 61.25 ? 216 ARG A NH2 1 
ATOM   571  N  N   . ASP A 1 102 ? 36.641  52.015 -0.745  1.00 56.64 ? 217 ASP A N   1 
ATOM   572  C  CA  . ASP A 1 102 ? 37.169  50.957 -1.588  1.00 56.41 ? 217 ASP A CA  1 
ATOM   573  C  C   . ASP A 1 102 ? 36.401  49.668 -1.348  1.00 55.87 ? 217 ASP A C   1 
ATOM   574  O  O   . ASP A 1 102 ? 35.869  49.071 -2.284  1.00 55.49 ? 217 ASP A O   1 
ATOM   575  C  CB  . ASP A 1 102 ? 38.655  50.736 -1.298  1.00 58.26 ? 217 ASP A CB  1 
ATOM   576  C  CG  . ASP A 1 102 ? 39.522  51.897 -1.755  1.00 59.90 ? 217 ASP A CG  1 
ATOM   577  O  OD1 . ASP A 1 102 ? 40.687  51.967 -1.308  1.00 60.67 ? 217 ASP A OD1 1 
ATOM   578  O  OD2 . ASP A 1 102 ? 39.050  52.733 -2.561  1.00 61.37 ? 217 ASP A OD2 1 
ATOM   579  N  N   . VAL A 1 103 ? 36.334  49.248 -0.087  1.00 54.42 ? 218 VAL A N   1 
ATOM   580  C  CA  . VAL A 1 103 ? 35.636  48.015 0.257   1.00 53.14 ? 218 VAL A CA  1 
ATOM   581  C  C   . VAL A 1 103 ? 34.176  48.046 -0.191  1.00 52.93 ? 218 VAL A C   1 
ATOM   582  O  O   . VAL A 1 103 ? 33.606  47.018 -0.544  1.00 52.90 ? 218 VAL A O   1 
ATOM   583  C  CB  . VAL A 1 103 ? 35.684  47.750 1.774   1.00 52.22 ? 218 VAL A CB  1 
ATOM   584  C  CG1 . VAL A 1 103 ? 35.127  46.383 2.074   1.00 51.60 ? 218 VAL A CG1 1 
ATOM   585  C  CG2 . VAL A 1 103 ? 37.104  47.853 2.274   1.00 51.48 ? 218 VAL A CG2 1 
ATOM   586  N  N   . SER A 1 104 ? 33.576  49.230 -0.189  1.00 52.52 ? 219 SER A N   1 
ATOM   587  C  CA  . SER A 1 104 ? 32.182  49.362 -0.585  1.00 52.30 ? 219 SER A CA  1 
ATOM   588  C  C   . SER A 1 104 ? 32.035  49.138 -2.072  1.00 52.83 ? 219 SER A C   1 
ATOM   589  O  O   . SER A 1 104 ? 30.933  48.921 -2.571  1.00 51.95 ? 219 SER A O   1 
ATOM   590  C  CB  . SER A 1 104 ? 31.656  50.752 -0.245  1.00 51.36 ? 219 SER A CB  1 
ATOM   591  O  OG  . SER A 1 104 ? 32.279  51.721 -1.056  1.00 49.29 ? 219 SER A OG  1 
ATOM   592  N  N   . LYS A 1 105 ? 33.151  49.191 -2.784  1.00 53.67 ? 220 LYS A N   1 
ATOM   593  C  CA  . LYS A 1 105 ? 33.116  49.015 -4.229  1.00 54.72 ? 220 LYS A CA  1 
ATOM   594  C  C   . LYS A 1 105 ? 33.543  47.625 -4.714  1.00 54.87 ? 220 LYS A C   1 
ATOM   595  O  O   . LYS A 1 105 ? 33.568  47.369 -5.921  1.00 54.80 ? 220 LYS A O   1 
ATOM   596  C  CB  . LYS A 1 105 ? 33.957  50.102 -4.901  1.00 54.75 ? 220 LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 105 ? 33.379  51.492 -4.736  1.00 56.59 ? 220 LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 105 ? 34.250  52.521 -5.438  1.00 59.63 ? 220 LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 105 ? 33.607  53.913 -5.418  1.00 62.11 ? 220 LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 105 ? 34.479  54.967 -6.031  1.00 61.96 ? 220 LYS A NZ  1 
ATOM   601  N  N   . GLU A 1 106 ? 33.892  46.738 -3.779  1.00 54.16 ? 221 GLU A N   1 
ATOM   602  C  CA  . GLU A 1 106 ? 34.260  45.376 -4.142  1.00 52.61 ? 221 GLU A CA  1 
ATOM   603  C  C   . GLU A 1 106 ? 32.953  44.738 -4.579  1.00 52.72 ? 221 GLU A C   1 
ATOM   604  O  O   . GLU A 1 106 ? 31.904  45.377 -4.536  1.00 51.65 ? 221 GLU A O   1 
ATOM   605  C  CB  . GLU A 1 106 ? 34.825  44.608 -2.945  1.00 51.41 ? 221 GLU A CB  1 
ATOM   606  C  CG  . GLU A 1 106 ? 36.260  44.955 -2.578  1.00 52.43 ? 221 GLU A CG  1 
ATOM   607  C  CD  . GLU A 1 106 ? 36.799  44.138 -1.391  1.00 53.68 ? 221 GLU A CD  1 
ATOM   608  O  OE1 . GLU A 1 106 ? 36.305  43.010 -1.140  1.00 53.88 ? 221 GLU A OE1 1 
ATOM   609  O  OE2 . GLU A 1 106 ? 37.737  44.620 -0.717  1.00 53.26 ? 221 GLU A OE2 1 
ATOM   610  N  N   . ASP A 1 107 ? 33.009  43.484 -5.002  1.00 53.97 ? 222 ASP A N   1 
ATOM   611  C  CA  . ASP A 1 107 ? 31.810  42.787 -5.436  1.00 54.17 ? 222 ASP A CA  1 
ATOM   612  C  C   . ASP A 1 107 ? 31.407  41.701 -4.431  1.00 53.81 ? 222 ASP A C   1 
ATOM   613  O  O   . ASP A 1 107 ? 31.860  40.562 -4.499  1.00 53.27 ? 222 ASP A O   1 
ATOM   614  C  CB  . ASP A 1 107 ? 32.043  42.196 -6.827  1.00 55.06 ? 222 ASP A CB  1 
ATOM   615  C  CG  . ASP A 1 107 ? 31.006  41.160 -7.196  1.00 57.00 ? 222 ASP A CG  1 
ATOM   616  O  OD1 . ASP A 1 107 ? 29.810  41.396 -6.927  1.00 56.42 ? 222 ASP A OD1 1 
ATOM   617  O  OD2 . ASP A 1 107 ? 31.391  40.112 -7.759  1.00 59.44 ? 222 ASP A OD2 1 
ATOM   618  N  N   . HIS A 1 108 ? 30.546  42.077 -3.496  1.00 54.32 ? 224 HIS A N   1 
ATOM   619  C  CA  . HIS A 1 108 ? 30.064  41.181 -2.447  1.00 54.34 ? 224 HIS A CA  1 
ATOM   620  C  C   . HIS A 1 108 ? 28.983  40.217 -2.923  1.00 55.10 ? 224 HIS A C   1 
ATOM   621  O  O   . HIS A 1 108 ? 28.309  39.596 -2.103  1.00 57.05 ? 224 HIS A O   1 
ATOM   622  C  CB  . HIS A 1 108 ? 29.506  42.012 -1.297  1.00 53.35 ? 224 HIS A CB  1 
ATOM   623  C  CG  . HIS A 1 108 ? 30.468  43.031 -0.770  1.00 53.30 ? 224 HIS A CG  1 
ATOM   624  N  ND1 . HIS A 1 108 ? 31.422  42.737 0.181   1.00 52.41 ? 224 HIS A ND1 1 
ATOM   625  C  CD2 . HIS A 1 108 ? 30.651  44.330 -1.098  1.00 52.05 ? 224 HIS A CD2 1 
ATOM   626  C  CE1 . HIS A 1 108 ? 32.151  43.811 0.415   1.00 51.36 ? 224 HIS A CE1 1 
ATOM   627  N  NE2 . HIS A 1 108 ? 31.705  44.791 -0.350  1.00 51.59 ? 224 HIS A NE2 1 
ATOM   628  N  N   . SER A 1 109 ? 28.814  40.089 -4.236  1.00 55.24 ? 225 SER A N   1 
ATOM   629  C  CA  . SER A 1 109 ? 27.797  39.199 -4.794  1.00 55.09 ? 225 SER A CA  1 
ATOM   630  C  C   . SER A 1 109 ? 27.774  37.800 -4.196  1.00 54.75 ? 225 SER A C   1 
ATOM   631  O  O   . SER A 1 109 ? 26.713  37.282 -3.873  1.00 54.54 ? 225 SER A O   1 
ATOM   632  C  CB  . SER A 1 109 ? 27.966  39.076 -6.306  1.00 55.15 ? 225 SER A CB  1 
ATOM   633  O  OG  . SER A 1 109 ? 27.604  40.276 -6.968  1.00 56.50 ? 225 SER A OG  1 
ATOM   634  N  N   . LYS A 1 110 ? 28.939  37.187 -4.038  1.00 55.53 ? 226 LYS A N   1 
ATOM   635  C  CA  . LYS A 1 110 ? 28.986  35.838 -3.503  1.00 56.89 ? 226 LYS A CA  1 
ATOM   636  C  C   . LYS A 1 110 ? 29.151  35.798 -1.987  1.00 56.76 ? 226 LYS A C   1 
ATOM   637  O  O   . LYS A 1 110 ? 29.334  34.718 -1.400  1.00 57.52 ? 226 LYS A O   1 
ATOM   638  C  CB  . LYS A 1 110 ? 30.102  35.045 -4.211  1.00 59.68 ? 226 LYS A CB  1 
ATOM   639  C  CG  . LYS A 1 110 ? 29.928  34.998 -5.754  1.00 61.50 ? 226 LYS A CG  1 
ATOM   640  C  CD  . LYS A 1 110 ? 31.080  34.293 -6.475  1.00 63.83 ? 226 LYS A CD  1 
ATOM   641  C  CE  . LYS A 1 110 ? 30.979  32.755 -6.388  1.00 66.67 ? 226 LYS A CE  1 
ATOM   642  N  NZ  . LYS A 1 110 ? 29.831  32.172 -7.188  1.00 67.20 ? 226 LYS A NZ  1 
ATOM   643  N  N   . ARG A 1 111 ? 29.063  36.973 -1.358  1.00 55.20 ? 227 ARG A N   1 
ATOM   644  C  CA  . ARG A 1 111 ? 29.190  37.106 0.098   1.00 53.67 ? 227 ARG A CA  1 
ATOM   645  C  C   . ARG A 1 111 ? 27.825  37.300 0.783   1.00 53.14 ? 227 ARG A C   1 
ATOM   646  O  O   . ARG A 1 111 ? 27.001  38.095 0.326   1.00 52.00 ? 227 ARG A O   1 
ATOM   647  C  CB  . ARG A 1 111 ? 30.093  38.287 0.421   1.00 53.46 ? 227 ARG A CB  1 
ATOM   648  C  CG  . ARG A 1 111 ? 31.524  38.105 -0.020  1.00 53.57 ? 227 ARG A CG  1 
ATOM   649  C  CD  . ARG A 1 111 ? 32.218  39.445 -0.168  1.00 53.36 ? 227 ARG A CD  1 
ATOM   650  N  NE  . ARG A 1 111 ? 33.647  39.281 -0.405  1.00 54.04 ? 227 ARG A NE  1 
ATOM   651  C  CZ  . ARG A 1 111 ? 34.454  40.245 -0.838  1.00 55.53 ? 227 ARG A CZ  1 
ATOM   652  N  NH1 . ARG A 1 111 ? 33.972  41.460 -1.095  1.00 55.16 ? 227 ARG A NH1 1 
ATOM   653  N  NH2 . ARG A 1 111 ? 35.753  39.999 -0.993  1.00 56.41 ? 227 ARG A NH2 1 
ATOM   654  N  N   . SER A 1 112 ? 27.610  36.580 1.887   1.00 52.13 ? 228 SER A N   1 
ATOM   655  C  CA  . SER A 1 112 ? 26.351  36.629 2.639   1.00 50.68 ? 228 SER A CA  1 
ATOM   656  C  C   . SER A 1 112 ? 26.133  37.870 3.501   1.00 49.53 ? 228 SER A C   1 
ATOM   657  O  O   . SER A 1 112 ? 24.988  38.265 3.751   1.00 49.98 ? 228 SER A O   1 
ATOM   658  C  CB  . SER A 1 112 ? 26.226  35.396 3.545   1.00 51.49 ? 228 SER A CB  1 
ATOM   659  O  OG  . SER A 1 112 ? 26.111  34.199 2.797   1.00 54.82 ? 228 SER A OG  1 
ATOM   660  N  N   . SER A 1 113 ? 27.218  38.480 3.965   1.00 47.15 ? 229 SER A N   1 
ATOM   661  C  CA  . SER A 1 113 ? 27.094  39.646 4.820   1.00 45.12 ? 229 SER A CA  1 
ATOM   662  C  C   . SER A 1 113 ? 28.333  40.527 4.841   1.00 44.99 ? 229 SER A C   1 
ATOM   663  O  O   . SER A 1 113 ? 29.276  40.341 4.075   1.00 43.74 ? 229 SER A O   1 
ATOM   664  C  CB  . SER A 1 113 ? 26.791  39.195 6.244   1.00 45.10 ? 229 SER A CB  1 
ATOM   665  O  OG  . SER A 1 113 ? 27.881  38.454 6.762   1.00 43.60 ? 229 SER A OG  1 
ATOM   666  N  N   . PHE A 1 114 ? 28.311  41.501 5.738   1.00 44.98 ? 230 PHE A N   1 
ATOM   667  C  CA  . PHE A 1 114 ? 29.433  42.409 5.896   1.00 45.40 ? 230 PHE A CA  1 
ATOM   668  C  C   . PHE A 1 114 ? 29.540  42.863 7.335   1.00 46.04 ? 230 PHE A C   1 
ATOM   669  O  O   . PHE A 1 114 ? 28.541  43.220 7.956   1.00 46.77 ? 230 PHE A O   1 
ATOM   670  C  CB  . PHE A 1 114 ? 29.273  43.637 5.020   1.00 44.84 ? 230 PHE A CB  1 
ATOM   671  C  CG  . PHE A 1 114 ? 30.344  44.649 5.230   1.00 44.49 ? 230 PHE A CG  1 
ATOM   672  C  CD1 . PHE A 1 114 ? 31.642  44.384 4.840   1.00 45.73 ? 230 PHE A CD1 1 
ATOM   673  C  CD2 . PHE A 1 114 ? 30.064  45.862 5.827   1.00 44.87 ? 230 PHE A CD2 1 
ATOM   674  C  CE1 . PHE A 1 114 ? 32.647  45.316 5.040   1.00 45.95 ? 230 PHE A CE1 1 
ATOM   675  C  CE2 . PHE A 1 114 ? 31.062  46.798 6.030   1.00 43.87 ? 230 PHE A CE2 1 
ATOM   676  C  CZ  . PHE A 1 114 ? 32.353  46.525 5.636   1.00 44.16 ? 230 PHE A CZ  1 
ATOM   677  N  N   . VAL A 1 115 ? 30.759  42.863 7.855   1.00 46.01 ? 231 VAL A N   1 
ATOM   678  C  CA  . VAL A 1 115 ? 31.000  43.280 9.230   1.00 46.54 ? 231 VAL A CA  1 
ATOM   679  C  C   . VAL A 1 115 ? 32.185  44.242 9.326   1.00 46.53 ? 231 VAL A C   1 
ATOM   680  O  O   . VAL A 1 115 ? 33.230  44.019 8.710   1.00 47.10 ? 231 VAL A O   1 
ATOM   681  C  CB  . VAL A 1 115 ? 31.270  42.061 10.123  1.00 45.76 ? 231 VAL A CB  1 
ATOM   682  C  CG1 . VAL A 1 115 ? 31.553  42.504 11.531  1.00 45.01 ? 231 VAL A CG1 1 
ATOM   683  C  CG2 . VAL A 1 115 ? 30.082  41.141 10.090  1.00 46.50 ? 231 VAL A CG2 1 
ATOM   684  N  N   . CYS A 1 116 ? 32.011  45.310 10.095  1.00 44.80 ? 232 CYS A N   1 
ATOM   685  C  CA  . CYS A 1 116 ? 33.056  46.308 10.291  1.00 44.41 ? 232 CYS A CA  1 
ATOM   686  C  C   . CYS A 1 116 ? 33.145  46.590 11.774  1.00 44.46 ? 232 CYS A C   1 
ATOM   687  O  O   . CYS A 1 116 ? 32.146  46.913 12.407  1.00 45.11 ? 232 CYS A O   1 
ATOM   688  C  CB  . CYS A 1 116 ? 32.717  47.598 9.550   1.00 43.82 ? 232 CYS A CB  1 
ATOM   689  S  SG  . CYS A 1 116 ? 33.945  48.896 9.729   1.00 45.03 ? 232 CYS A SG  1 
ATOM   690  N  N   . VAL A 1 117 ? 34.339  46.461 12.332  1.00 44.58 ? 233 VAL A N   1 
ATOM   691  C  CA  . VAL A 1 117 ? 34.533  46.688 13.754  1.00 45.31 ? 233 VAL A CA  1 
ATOM   692  C  C   . VAL A 1 117 ? 35.466  47.863 13.968  1.00 45.52 ? 233 VAL A C   1 
ATOM   693  O  O   . VAL A 1 117 ? 36.608  47.840 13.519  1.00 46.81 ? 233 VAL A O   1 
ATOM   694  C  CB  . VAL A 1 117 ? 35.123  45.433 14.437  1.00 45.73 ? 233 VAL A CB  1 
ATOM   695  C  CG1 . VAL A 1 117 ? 35.418  45.722 15.904  1.00 46.32 ? 233 VAL A CG1 1 
ATOM   696  C  CG2 . VAL A 1 117 ? 34.148  44.277 14.313  1.00 44.52 ? 233 VAL A CG2 1 
ATOM   697  N  N   . LEU A 1 118 ? 34.976  48.889 14.658  1.00 44.69 ? 234 LEU A N   1 
ATOM   698  C  CA  . LEU A 1 118 ? 35.772  50.081 14.919  1.00 43.47 ? 234 LEU A CA  1 
ATOM   699  C  C   . LEU A 1 118 ? 36.214  50.130 16.366  1.00 42.96 ? 234 LEU A C   1 
ATOM   700  O  O   . LEU A 1 118 ? 35.396  50.000 17.261  1.00 43.39 ? 234 LEU A O   1 
ATOM   701  C  CB  . LEU A 1 118 ? 34.955  51.329 14.583  1.00 43.24 ? 234 LEU A CB  1 
ATOM   702  C  CG  . LEU A 1 118 ? 34.566  51.454 13.112  1.00 41.98 ? 234 LEU A CG  1 
ATOM   703  C  CD1 . LEU A 1 118 ? 33.499  52.487 12.952  1.00 41.33 ? 234 LEU A CD1 1 
ATOM   704  C  CD2 . LEU A 1 118 ? 35.783  51.802 12.292  1.00 42.65 ? 234 LEU A CD2 1 
ATOM   705  N  N   . LEU A 1 119 ? 37.511  50.301 16.588  1.00 41.80 ? 235 LEU A N   1 
ATOM   706  C  CA  . LEU A 1 119 ? 38.057  50.383 17.936  1.00 41.96 ? 235 LEU A CA  1 
ATOM   707  C  C   . LEU A 1 119 ? 38.835  51.681 17.970  1.00 42.64 ? 235 LEU A C   1 
ATOM   708  O  O   . LEU A 1 119 ? 39.910  51.761 17.396  1.00 44.32 ? 235 LEU A O   1 
ATOM   709  C  CB  . LEU A 1 119 ? 39.003  49.215 18.199  1.00 41.80 ? 235 LEU A CB  1 
ATOM   710  C  CG  . LEU A 1 119 ? 38.541  47.815 17.772  1.00 41.22 ? 235 LEU A CG  1 
ATOM   711  C  CD1 . LEU A 1 119 ? 39.703  46.850 17.891  1.00 40.11 ? 235 LEU A CD1 1 
ATOM   712  C  CD2 . LEU A 1 119 ? 37.373  47.355 18.616  1.00 39.95 ? 235 LEU A CD2 1 
ATOM   713  N  N   . SER A 1 120 ? 38.302  52.698 18.638  1.00 42.86 ? 236 SER A N   1 
ATOM   714  C  CA  . SER A 1 120 ? 38.965  54.001 18.681  1.00 43.10 ? 236 SER A CA  1 
ATOM   715  C  C   . SER A 1 120 ? 38.280  54.937 19.682  1.00 43.14 ? 236 SER A C   1 
ATOM   716  O  O   . SER A 1 120 ? 37.353  54.541 20.370  1.00 45.22 ? 236 SER A O   1 
ATOM   717  C  CB  . SER A 1 120 ? 38.928  54.607 17.271  1.00 42.32 ? 236 SER A CB  1 
ATOM   718  O  OG  . SER A 1 120 ? 39.412  55.932 17.233  1.00 45.38 ? 236 SER A OG  1 
ATOM   719  N  N   . HIS A 1 121 ? 38.748  56.172 19.784  1.00 42.82 ? 237 HIS A N   1 
ATOM   720  C  CA  . HIS A 1 121 ? 38.113  57.137 20.670  1.00 41.80 ? 237 HIS A CA  1 
ATOM   721  C  C   . HIS A 1 121 ? 36.852  57.599 19.976  1.00 41.56 ? 237 HIS A C   1 
ATOM   722  O  O   . HIS A 1 121 ? 36.674  57.366 18.782  1.00 40.93 ? 237 HIS A O   1 
ATOM   723  C  CB  . HIS A 1 121 ? 39.004  58.353 20.878  1.00 42.86 ? 237 HIS A CB  1 
ATOM   724  C  CG  . HIS A 1 121 ? 40.230  58.069 21.677  1.00 42.44 ? 237 HIS A CG  1 
ATOM   725  N  ND1 . HIS A 1 121 ? 40.179  57.681 22.995  1.00 42.02 ? 237 HIS A ND1 1 
ATOM   726  C  CD2 . HIS A 1 121 ? 41.539  58.113 21.344  1.00 42.05 ? 237 HIS A CD2 1 
ATOM   727  C  CE1 . HIS A 1 121 ? 41.406  57.495 23.441  1.00 43.74 ? 237 HIS A CE1 1 
ATOM   728  N  NE2 . HIS A 1 121 ? 42.250  57.750 22.457  1.00 44.34 ? 237 HIS A NE2 1 
ATOM   729  N  N   . GLY A 1 122 ? 35.980  58.262 20.719  1.00 41.47 ? 238 GLY A N   1 
ATOM   730  C  CA  . GLY A 1 122 ? 34.763  58.757 20.116  1.00 41.21 ? 238 GLY A CA  1 
ATOM   731  C  C   . GLY A 1 122 ? 33.820  59.452 21.066  1.00 40.38 ? 238 GLY A C   1 
ATOM   732  O  O   . GLY A 1 122 ? 34.051  59.514 22.264  1.00 40.47 ? 238 GLY A O   1 
ATOM   733  N  N   . GLU A 1 123 ? 32.758  60.001 20.501  1.00 40.55 ? 239 GLU A N   1 
ATOM   734  C  CA  . GLU A 1 123 ? 31.720  60.668 21.260  1.00 41.27 ? 239 GLU A CA  1 
ATOM   735  C  C   . GLU A 1 123 ? 30.469  60.534 20.424  1.00 41.45 ? 239 GLU A C   1 
ATOM   736  O  O   . GLU A 1 123 ? 30.519  59.968 19.341  1.00 42.55 ? 239 GLU A O   1 
ATOM   737  C  CB  . GLU A 1 123 ? 32.058  62.132 21.494  1.00 40.83 ? 239 GLU A CB  1 
ATOM   738  C  CG  . GLU A 1 123 ? 32.781  62.801 20.353  1.00 43.45 ? 239 GLU A CG  1 
ATOM   739  C  CD  . GLU A 1 123 ? 33.012  64.265 20.629  1.00 44.37 ? 239 GLU A CD  1 
ATOM   740  O  OE1 . GLU A 1 123 ? 32.054  65.058 20.498  1.00 44.43 ? 239 GLU A OE1 1 
ATOM   741  O  OE2 . GLU A 1 123 ? 34.145  64.616 21.000  1.00 43.91 ? 239 GLU A OE2 1 
ATOM   742  N  N   . GLU A 1 124 ? 29.352  61.040 20.927  1.00 41.34 ? 240 GLU A N   1 
ATOM   743  C  CA  . GLU A 1 124 ? 28.090  60.945 20.215  1.00 41.93 ? 240 GLU A CA  1 
ATOM   744  C  C   . GLU A 1 124 ? 28.275  61.054 18.696  1.00 41.11 ? 240 GLU A C   1 
ATOM   745  O  O   . GLU A 1 124 ? 28.623  62.113 18.185  1.00 41.67 ? 240 GLU A O   1 
ATOM   746  C  CB  . GLU A 1 124 ? 27.129  62.032 20.699  1.00 43.69 ? 240 GLU A CB  1 
ATOM   747  C  CG  . GLU A 1 124 ? 26.875  62.082 22.221  1.00 51.06 ? 240 GLU A CG  1 
ATOM   748  C  CD  . GLU A 1 124 ? 27.896  62.933 23.048  1.00 53.29 ? 240 GLU A CD  1 
ATOM   749  O  OE1 . GLU A 1 124 ? 27.525  63.358 24.165  1.00 53.77 ? 240 GLU A OE1 1 
ATOM   750  O  OE2 . GLU A 1 124 ? 29.053  63.171 22.615  1.00 54.70 ? 240 GLU A OE2 1 
ATOM   751  N  N   . GLY A 1 125 ? 28.074  59.938 17.994  1.00 39.41 ? 241 GLY A N   1 
ATOM   752  C  CA  . GLY A 1 125 ? 28.172  59.908 16.544  1.00 37.47 ? 241 GLY A CA  1 
ATOM   753  C  C   . GLY A 1 125 ? 29.511  60.121 15.879  1.00 37.58 ? 241 GLY A C   1 
ATOM   754  O  O   . GLY A 1 125 ? 29.578  60.326 14.678  1.00 37.02 ? 241 GLY A O   1 
ATOM   755  N  N   . ILE A 1 126 ? 30.583  60.053 16.645  1.00 38.21 ? 242 ILE A N   1 
ATOM   756  C  CA  . ILE A 1 126 ? 31.909  60.265 16.097  1.00 39.04 ? 242 ILE A CA  1 
ATOM   757  C  C   . ILE A 1 126 ? 32.880  59.170 16.493  1.00 39.91 ? 242 ILE A C   1 
ATOM   758  O  O   . ILE A 1 126 ? 32.766  58.585 17.558  1.00 40.50 ? 242 ILE A O   1 
ATOM   759  C  CB  . ILE A 1 126 ? 32.475  61.610 16.577  1.00 39.02 ? 242 ILE A CB  1 
ATOM   760  C  CG1 . ILE A 1 126 ? 31.662  62.748 15.973  1.00 39.70 ? 242 ILE A CG1 1 
ATOM   761  C  CG2 . ILE A 1 126 ? 33.933  61.732 16.216  1.00 38.82 ? 242 ILE A CG2 1 
ATOM   762  C  CD1 . ILE A 1 126 ? 32.111  64.125 16.411  1.00 42.50 ? 242 ILE A CD1 1 
ATOM   763  N  N   . ILE A 1 127 ? 33.827  58.889 15.610  1.00 41.41 ? 243 ILE A N   1 
ATOM   764  C  CA  . ILE A 1 127 ? 34.859  57.897 15.869  1.00 42.64 ? 243 ILE A CA  1 
ATOM   765  C  C   . ILE A 1 127 ? 36.139  58.587 15.420  1.00 41.92 ? 243 ILE A C   1 
ATOM   766  O  O   . ILE A 1 127 ? 36.114  59.412 14.512  1.00 40.10 ? 243 ILE A O   1 
ATOM   767  C  CB  . ILE A 1 127 ? 34.663  56.616 15.047  1.00 44.85 ? 243 ILE A CB  1 
ATOM   768  C  CG1 . ILE A 1 127 ? 35.720  55.598 15.445  1.00 47.61 ? 243 ILE A CG1 1 
ATOM   769  C  CG2 . ILE A 1 127 ? 34.797  56.912 13.554  1.00 46.69 ? 243 ILE A CG2 1 
ATOM   770  C  CD1 . ILE A 1 127 ? 35.973  54.540 14.396  1.00 50.85 ? 243 ILE A CD1 1 
ATOM   771  N  N   . PHE A 1 128 ? 37.257  58.252 16.053  1.00 42.90 ? 244 PHE A N   1 
ATOM   772  C  CA  . PHE A 1 128 ? 38.521  58.888 15.717  1.00 42.39 ? 244 PHE A CA  1 
ATOM   773  C  C   . PHE A 1 128 ? 39.488  58.131 14.840  1.00 42.61 ? 244 PHE A C   1 
ATOM   774  O  O   . PHE A 1 128 ? 39.674  56.924 14.957  1.00 41.26 ? 244 PHE A O   1 
ATOM   775  C  CB  . PHE A 1 128 ? 39.292  59.270 16.978  1.00 42.21 ? 244 PHE A CB  1 
ATOM   776  C  CG  . PHE A 1 128 ? 38.935  60.613 17.538  1.00 44.32 ? 244 PHE A CG  1 
ATOM   777  C  CD1 . PHE A 1 128 ? 37.769  60.794 18.284  1.00 45.74 ? 244 PHE A CD1 1 
ATOM   778  C  CD2 . PHE A 1 128 ? 39.793  61.691 17.365  1.00 44.04 ? 244 PHE A CD2 1 
ATOM   779  C  CE1 . PHE A 1 128 ? 37.473  62.030 18.853  1.00 47.02 ? 244 PHE A CE1 1 
ATOM   780  C  CE2 . PHE A 1 128 ? 39.508  62.918 17.922  1.00 44.42 ? 244 PHE A CE2 1 
ATOM   781  C  CZ  . PHE A 1 128 ? 38.345  63.091 18.671  1.00 46.50 ? 244 PHE A CZ  1 
ATOM   782  N  N   . GLY A 1 129 ? 40.105  58.887 13.950  1.00 43.61 ? 245 GLY A N   1 
ATOM   783  C  CA  . GLY A 1 129 ? 41.145  58.361 13.102  1.00 45.54 ? 245 GLY A CA  1 
ATOM   784  C  C   . GLY A 1 129 ? 42.353  58.874 13.870  1.00 47.17 ? 245 GLY A C   1 
ATOM   785  O  O   . GLY A 1 129 ? 42.223  59.832 14.635  1.00 48.52 ? 245 GLY A O   1 
ATOM   786  N  N   . THR A 1 130 ? 43.518  58.270 13.698  1.00 48.05 ? 246 THR A N   1 
ATOM   787  C  CA  . THR A 1 130 ? 44.693  58.716 14.440  1.00 48.68 ? 246 THR A CA  1 
ATOM   788  C  C   . THR A 1 130 ? 44.956  60.222 14.406  1.00 49.11 ? 246 THR A C   1 
ATOM   789  O  O   . THR A 1 130 ? 45.640  60.750 15.279  1.00 49.85 ? 246 THR A O   1 
ATOM   790  C  CB  . THR A 1 130 ? 45.940  58.008 13.935  1.00 49.53 ? 246 THR A CB  1 
ATOM   791  O  OG1 . THR A 1 130 ? 46.156  58.355 12.558  1.00 48.95 ? 246 THR A OG1 1 
ATOM   792  C  CG2 . THR A 1 130 ? 45.770  56.496 14.067  1.00 46.76 ? 246 THR A CG2 1 
ATOM   793  N  N   . ASN A 1 131 ? 44.401  60.912 13.414  1.00 48.87 ? 247 ASN A N   1 
ATOM   794  C  CA  . ASN A 1 131 ? 44.608  62.350 13.270  1.00 48.45 ? 247 ASN A CA  1 
ATOM   795  C  C   . ASN A 1 131 ? 43.341  63.195 13.449  1.00 48.60 ? 247 ASN A C   1 
ATOM   796  O  O   . ASN A 1 131 ? 43.360  64.401 13.197  1.00 49.15 ? 247 ASN A O   1 
ATOM   797  C  CB  . ASN A 1 131 ? 45.173  62.640 11.891  1.00 47.91 ? 247 ASN A CB  1 
ATOM   798  C  CG  . ASN A 1 131 ? 44.209  62.253 10.797  1.00 48.86 ? 247 ASN A CG  1 
ATOM   799  O  OD1 . ASN A 1 131 ? 44.309  62.720 9.668   1.00 50.42 ? 247 ASN A OD1 1 
ATOM   800  N  ND2 . ASN A 1 131 ? 43.262  61.388 11.129  1.00 49.37 ? 247 ASN A ND2 1 
ATOM   801  N  N   . GLY A 1 132 ? 42.241  62.583 13.863  1.00 47.57 ? 254 GLY A N   1 
ATOM   802  C  CA  . GLY A 1 132 ? 41.030  63.362 14.040  1.00 47.39 ? 254 GLY A CA  1 
ATOM   803  C  C   . GLY A 1 132 ? 39.725  62.593 13.958  1.00 47.20 ? 254 GLY A C   1 
ATOM   804  O  O   . GLY A 1 132 ? 39.704  61.420 13.598  1.00 47.22 ? 254 GLY A O   1 
ATOM   805  N  N   . PRO A 1 133 ? 38.606  63.250 14.277  1.00 46.97 ? 255 PRO A N   1 
ATOM   806  C  CA  . PRO A 1 133 ? 37.269  62.663 14.259  1.00 46.72 ? 255 PRO A CA  1 
ATOM   807  C  C   . PRO A 1 133 ? 36.661  62.536 12.868  1.00 47.06 ? 255 PRO A C   1 
ATOM   808  O  O   . PRO A 1 133 ? 37.060  63.234 11.940  1.00 47.03 ? 255 PRO A O   1 
ATOM   809  C  CB  . PRO A 1 133 ? 36.481  63.630 15.119  1.00 46.98 ? 255 PRO A CB  1 
ATOM   810  C  CG  . PRO A 1 133 ? 37.059  64.946 14.697  1.00 46.32 ? 255 PRO A CG  1 
ATOM   811  C  CD  . PRO A 1 133 ? 38.545  64.651 14.735  1.00 47.26 ? 255 PRO A CD  1 
ATOM   812  N  N   . VAL A 1 134 ? 35.683  61.640 12.750  1.00 46.56 ? 256 VAL A N   1 
ATOM   813  C  CA  . VAL A 1 134 ? 34.959  61.401 11.507  1.00 46.54 ? 256 VAL A CA  1 
ATOM   814  C  C   . VAL A 1 134 ? 33.540  61.039 11.900  1.00 47.30 ? 256 VAL A C   1 
ATOM   815  O  O   . VAL A 1 134 ? 33.329  60.431 12.947  1.00 47.64 ? 256 VAL A O   1 
ATOM   816  C  CB  . VAL A 1 134 ? 35.491  60.194 10.737  1.00 46.84 ? 256 VAL A CB  1 
ATOM   817  C  CG1 . VAL A 1 134 ? 34.964  60.228 9.328   1.00 46.52 ? 256 VAL A CG1 1 
ATOM   818  C  CG2 . VAL A 1 134 ? 36.983  60.177 10.753  1.00 48.14 ? 256 VAL A CG2 1 
ATOM   819  N  N   . ASP A 1 135 ? 32.565  61.398 11.078  1.00 47.00 ? 257 ASP A N   1 
ATOM   820  C  CA  . ASP A 1 135 ? 31.200  61.033 11.403  1.00 48.75 ? 257 ASP A CA  1 
ATOM   821  C  C   . ASP A 1 135 ? 30.953  59.571 11.040  1.00 49.03 ? 257 ASP A C   1 
ATOM   822  O  O   . ASP A 1 135 ? 31.229  59.136 9.926   1.00 47.72 ? 257 ASP A O   1 
ATOM   823  C  CB  . ASP A 1 135 ? 30.211  61.907 10.656  1.00 52.07 ? 257 ASP A CB  1 
ATOM   824  C  CG  . ASP A 1 135 ? 30.109  63.297 11.239  1.00 57.38 ? 257 ASP A CG  1 
ATOM   825  O  OD1 . ASP A 1 135 ? 29.358  64.113 10.660  1.00 61.62 ? 257 ASP A OD1 1 
ATOM   826  O  OD2 . ASP A 1 135 ? 30.764  63.588 12.268  1.00 57.74 ? 257 ASP A OD2 1 
ATOM   827  N  N   . LEU A 1 136 ? 30.440  58.808 11.994  1.00 49.05 ? 258 LEU A N   1 
ATOM   828  C  CA  . LEU A 1 136 ? 30.153  57.411 11.753  1.00 49.21 ? 258 LEU A CA  1 
ATOM   829  C  C   . LEU A 1 136 ? 29.294  57.332 10.514  1.00 49.56 ? 258 LEU A C   1 
ATOM   830  O  O   . LEU A 1 136 ? 29.484  56.458 9.671   1.00 50.59 ? 258 LEU A O   1 
ATOM   831  C  CB  . LEU A 1 136 ? 29.411  56.808 12.943  1.00 49.48 ? 258 LEU A CB  1 
ATOM   832  C  CG  . LEU A 1 136 ? 30.152  55.640 13.593  1.00 50.44 ? 258 LEU A CG  1 
ATOM   833  C  CD1 . LEU A 1 136 ? 29.456  55.196 14.866  1.00 50.60 ? 258 LEU A CD1 1 
ATOM   834  C  CD2 . LEU A 1 136 ? 30.228  54.508 12.597  1.00 50.59 ? 258 LEU A CD2 1 
ATOM   835  N  N   . LYS A 1 137 ? 28.356  58.270 10.402  1.00 50.08 ? 259 LYS A N   1 
ATOM   836  C  CA  . LYS A 1 137 ? 27.447  58.318 9.267   1.00 50.50 ? 259 LYS A CA  1 
ATOM   837  C  C   . LYS A 1 137 ? 28.217  58.315 7.949   1.00 50.18 ? 259 LYS A C   1 
ATOM   838  O  O   . LYS A 1 137 ? 27.841  57.618 7.012   1.00 50.94 ? 259 LYS A O   1 
ATOM   839  C  CB  . LYS A 1 137 ? 26.559  59.552 9.359   1.00 51.17 ? 259 LYS A CB  1 
ATOM   840  C  CG  . LYS A 1 137 ? 25.337  59.509 8.460   1.00 54.03 ? 259 LYS A CG  1 
ATOM   841  C  CD  . LYS A 1 137 ? 24.371  58.379 8.839   1.00 55.23 ? 259 LYS A CD  1 
ATOM   842  C  CE  . LYS A 1 137 ? 23.138  58.367 7.912   1.00 58.22 ? 259 LYS A CE  1 
ATOM   843  N  NZ  . LYS A 1 137 ? 22.176  57.254 8.175   1.00 56.78 ? 259 LYS A NZ  1 
ATOM   844  N  N   . LYS A 1 138 ? 29.297  59.082 7.874   1.00 48.97 ? 260 LYS A N   1 
ATOM   845  C  CA  . LYS A 1 138 ? 30.083  59.108 6.654   1.00 48.12 ? 260 LYS A CA  1 
ATOM   846  C  C   . LYS A 1 138 ? 30.653  57.728 6.346   1.00 47.30 ? 260 LYS A C   1 
ATOM   847  O  O   . LYS A 1 138 ? 30.658  57.310 5.194   1.00 49.92 ? 260 LYS A O   1 
ATOM   848  C  CB  . LYS A 1 138 ? 31.214  60.137 6.743   1.00 48.39 ? 260 LYS A CB  1 
ATOM   849  C  CG  . LYS A 1 138 ? 32.262  59.969 5.648   1.00 50.20 ? 260 LYS A CG  1 
ATOM   850  C  CD  . LYS A 1 138 ? 33.161  61.174 5.512   1.00 51.12 ? 260 LYS A CD  1 
ATOM   851  C  CE  . LYS A 1 138 ? 32.431  62.299 4.828   1.00 53.37 ? 260 LYS A CE  1 
ATOM   852  N  NZ  . LYS A 1 138 ? 33.310  63.499 4.670   1.00 57.41 ? 260 LYS A NZ  1 
ATOM   853  N  N   . ILE A 1 139 ? 31.137  57.021 7.361   1.00 45.57 ? 261 ILE A N   1 
ATOM   854  C  CA  . ILE A 1 139 ? 31.673  55.678 7.157   1.00 44.53 ? 261 ILE A CA  1 
ATOM   855  C  C   . ILE A 1 139 ? 30.542  54.754 6.724   1.00 45.59 ? 261 ILE A C   1 
ATOM   856  O  O   . ILE A 1 139 ? 30.654  54.008 5.762   1.00 46.70 ? 261 ILE A O   1 
ATOM   857  C  CB  . ILE A 1 139 ? 32.249  55.096 8.449   1.00 43.51 ? 261 ILE A CB  1 
ATOM   858  C  CG1 . ILE A 1 139 ? 33.503  55.865 8.857   1.00 42.86 ? 261 ILE A CG1 1 
ATOM   859  C  CG2 . ILE A 1 139 ? 32.520  53.604 8.273   1.00 41.16 ? 261 ILE A CG2 1 
ATOM   860  C  CD1 . ILE A 1 139 ? 34.130  55.341 10.126  1.00 40.91 ? 261 ILE A CD1 1 
ATOM   861  N  N   . THR A 1 140 ? 29.448  54.826 7.463   1.00 45.62 ? 262 THR A N   1 
ATOM   862  C  CA  . THR A 1 140 ? 28.270  54.025 7.227   1.00 45.89 ? 262 THR A CA  1 
ATOM   863  C  C   . THR A 1 140 ? 27.618  54.185 5.860   1.00 47.17 ? 262 THR A C   1 
ATOM   864  O  O   . THR A 1 140 ? 27.260  53.195 5.227   1.00 47.58 ? 262 THR A O   1 
ATOM   865  C  CB  . THR A 1 140 ? 27.236  54.325 8.323   1.00 46.03 ? 262 THR A CB  1 
ATOM   866  O  OG1 . THR A 1 140 ? 27.214  53.237 9.254   1.00 48.39 ? 262 THR A OG1 1 
ATOM   867  C  CG2 . THR A 1 140 ? 25.846  54.558 7.739   1.00 47.12 ? 262 THR A CG2 1 
ATOM   868  N  N   . ASN A 1 141 ? 27.456  55.422 5.405   1.00 47.71 ? 263 ASN A N   1 
ATOM   869  C  CA  . ASN A 1 141 ? 26.798  55.673 4.131   1.00 49.16 ? 263 ASN A CA  1 
ATOM   870  C  C   . ASN A 1 141 ? 27.328  54.913 2.929   1.00 48.53 ? 263 ASN A C   1 
ATOM   871  O  O   . ASN A 1 141 ? 26.569  54.603 2.012   1.00 47.67 ? 263 ASN A O   1 
ATOM   872  C  CB  . ASN A 1 141 ? 26.810  57.164 3.804   1.00 52.82 ? 263 ASN A CB  1 
ATOM   873  C  CG  . ASN A 1 141 ? 25.799  57.944 4.613   1.00 55.85 ? 263 ASN A CG  1 
ATOM   874  O  OD1 . ASN A 1 141 ? 24.835  57.375 5.169   1.00 57.04 ? 263 ASN A OD1 1 
ATOM   875  N  ND2 . ASN A 1 141 ? 25.998  59.263 4.675   1.00 56.48 ? 263 ASN A ND2 1 
ATOM   876  N  N   . PHE A 1 142 ? 28.624  54.619 2.919   1.00 47.67 ? 264 PHE A N   1 
ATOM   877  C  CA  . PHE A 1 142 ? 29.201  53.903 1.793   1.00 46.88 ? 264 PHE A CA  1 
ATOM   878  C  C   . PHE A 1 142 ? 28.491  52.593 1.504   1.00 47.17 ? 264 PHE A C   1 
ATOM   879  O  O   . PHE A 1 142 ? 28.567  52.092 0.381   1.00 48.48 ? 264 PHE A O   1 
ATOM   880  C  CB  . PHE A 1 142 ? 30.683  53.638 2.024   1.00 45.62 ? 264 PHE A CB  1 
ATOM   881  C  CG  . PHE A 1 142 ? 31.530  54.850 1.867   1.00 45.07 ? 264 PHE A CG  1 
ATOM   882  C  CD1 . PHE A 1 142 ? 32.303  55.317 2.923   1.00 43.06 ? 264 PHE A CD1 1 
ATOM   883  C  CD2 . PHE A 1 142 ? 31.540  55.547 0.663   1.00 43.42 ? 264 PHE A CD2 1 
ATOM   884  C  CE1 . PHE A 1 142 ? 33.071  56.458 2.782   1.00 43.07 ? 264 PHE A CE1 1 
ATOM   885  C  CE2 . PHE A 1 142 ? 32.307  56.692 0.517   1.00 42.59 ? 264 PHE A CE2 1 
ATOM   886  C  CZ  . PHE A 1 142 ? 33.072  57.149 1.575   1.00 42.13 ? 264 PHE A CZ  1 
ATOM   887  N  N   . PHE A 1 143 ? 27.791  52.050 2.499   1.00 45.43 ? 265 PHE A N   1 
ATOM   888  C  CA  . PHE A 1 143 ? 27.097  50.792 2.313   1.00 43.82 ? 265 PHE A CA  1 
ATOM   889  C  C   . PHE A 1 143 ? 25.592  50.888 2.197   1.00 43.99 ? 265 PHE A C   1 
ATOM   890  O  O   . PHE A 1 143 ? 24.914  49.870 2.258   1.00 44.24 ? 265 PHE A O   1 
ATOM   891  C  CB  . PHE A 1 143 ? 27.467  49.823 3.428   1.00 42.27 ? 265 PHE A CB  1 
ATOM   892  C  CG  . PHE A 1 143 ? 28.932  49.551 3.514   1.00 41.22 ? 265 PHE A CG  1 
ATOM   893  C  CD1 . PHE A 1 143 ? 29.777  50.446 4.133   1.00 41.46 ? 265 PHE A CD1 1 
ATOM   894  C  CD2 . PHE A 1 143 ? 29.472  48.421 2.929   1.00 41.08 ? 265 PHE A CD2 1 
ATOM   895  C  CE1 . PHE A 1 143 ? 31.141  50.222 4.168   1.00 42.84 ? 265 PHE A CE1 1 
ATOM   896  C  CE2 . PHE A 1 143 ? 30.838  48.186 2.954   1.00 42.27 ? 265 PHE A CE2 1 
ATOM   897  C  CZ  . PHE A 1 143 ? 31.675  49.086 3.574   1.00 42.50 ? 265 PHE A CZ  1 
ATOM   898  N  N   . ARG A 1 144 ? 25.069  52.101 2.030   1.00 44.87 ? 266 ARG A N   1 
ATOM   899  C  CA  . ARG A 1 144 ? 23.627  52.288 1.875   1.00 46.69 ? 266 ARG A CA  1 
ATOM   900  C  C   . ARG A 1 144 ? 23.123  51.375 0.755   1.00 48.12 ? 266 ARG A C   1 
ATOM   901  O  O   . ARG A 1 144 ? 23.806  51.161 -0.254  1.00 46.72 ? 266 ARG A O   1 
ATOM   902  C  CB  . ARG A 1 144 ? 23.303  53.744 1.533   1.00 47.29 ? 266 ARG A CB  1 
ATOM   903  C  CG  . ARG A 1 144 ? 22.756  54.534 2.686   1.00 48.51 ? 266 ARG A CG  1 
ATOM   904  C  CD  . ARG A 1 144 ? 23.337  55.948 2.730   1.00 53.61 ? 266 ARG A CD  1 
ATOM   905  N  NE  . ARG A 1 144 ? 22.380  56.974 2.318   1.00 57.52 ? 266 ARG A NE  1 
ATOM   906  C  CZ  . ARG A 1 144 ? 21.930  57.115 1.076   1.00 57.53 ? 266 ARG A CZ  1 
ATOM   907  N  NH1 . ARG A 1 144 ? 22.360  56.302 0.128   1.00 59.33 ? 266 ARG A NH1 1 
ATOM   908  N  NH2 . ARG A 1 144 ? 21.042  58.051 0.784   1.00 58.51 ? 266 ARG A NH2 1 
ATOM   909  N  N   . GLY A 1 145 ? 21.918  50.846 0.941   1.00 49.87 ? 267 GLY A N   1 
ATOM   910  C  CA  . GLY A 1 145 ? 21.333  49.944 -0.033  1.00 52.44 ? 267 GLY A CA  1 
ATOM   911  C  C   . GLY A 1 145 ? 21.427  50.381 -1.484  1.00 54.88 ? 267 GLY A C   1 
ATOM   912  O  O   . GLY A 1 145 ? 21.316  49.554 -2.387  1.00 56.84 ? 267 GLY A O   1 
ATOM   913  N  N   . ASP A 1 146 ? 21.647  51.670 -1.720  1.00 55.41 ? 268 ASP A N   1 
ATOM   914  C  CA  . ASP A 1 146 ? 21.718  52.188 -3.079  1.00 54.98 ? 268 ASP A CA  1 
ATOM   915  C  C   . ASP A 1 146 ? 23.141  52.560 -3.508  1.00 55.27 ? 268 ASP A C   1 
ATOM   916  O  O   . ASP A 1 146 ? 23.372  52.927 -4.662  1.00 56.04 ? 268 ASP A O   1 
ATOM   917  C  CB  . ASP A 1 146 ? 20.811  53.410 -3.190  1.00 54.98 ? 268 ASP A CB  1 
ATOM   918  C  CG  . ASP A 1 146 ? 21.256  54.541 -2.291  1.00 55.69 ? 268 ASP A CG  1 
ATOM   919  O  OD1 . ASP A 1 146 ? 20.642  55.631 -2.345  1.00 56.93 ? 268 ASP A OD1 1 
ATOM   920  O  OD2 . ASP A 1 146 ? 22.224  54.337 -1.528  1.00 56.18 ? 268 ASP A OD2 1 
ATOM   921  N  N   . ARG A 1 147 ? 24.090  52.472 -2.580  1.00 54.43 ? 269 ARG A N   1 
ATOM   922  C  CA  . ARG A 1 147 ? 25.477  52.807 -2.877  1.00 53.23 ? 269 ARG A CA  1 
ATOM   923  C  C   . ARG A 1 147 ? 26.374  51.580 -2.913  1.00 52.09 ? 269 ARG A C   1 
ATOM   924  O  O   . ARG A 1 147 ? 27.547  51.675 -3.258  1.00 52.74 ? 269 ARG A O   1 
ATOM   925  C  CB  . ARG A 1 147 ? 26.013  53.810 -1.848  1.00 54.56 ? 269 ARG A CB  1 
ATOM   926  C  CG  . ARG A 1 147 ? 25.933  55.263 -2.300  1.00 56.36 ? 269 ARG A CG  1 
ATOM   927  C  CD  . ARG A 1 147 ? 24.913  56.084 -1.532  1.00 58.56 ? 269 ARG A CD  1 
ATOM   928  N  NE  . ARG A 1 147 ? 25.558  57.063 -0.660  1.00 60.40 ? 269 ARG A NE  1 
ATOM   929  C  CZ  . ARG A 1 147 ? 24.999  58.206 -0.261  1.00 61.84 ? 269 ARG A CZ  1 
ATOM   930  N  NH1 . ARG A 1 147 ? 23.775  58.532 -0.653  1.00 62.83 ? 269 ARG A NH1 1 
ATOM   931  N  NH2 . ARG A 1 147 ? 25.664  59.037 0.528   1.00 62.49 ? 269 ARG A NH2 1 
ATOM   932  N  N   . CYS A 1 148 ? 25.824  50.429 -2.537  1.00 51.02 ? 270 CYS A N   1 
ATOM   933  C  CA  . CYS A 1 148 ? 26.577  49.182 -2.555  1.00 48.39 ? 270 CYS A CA  1 
ATOM   934  C  C   . CYS A 1 148 ? 25.613  48.060 -2.897  1.00 47.78 ? 270 CYS A C   1 
ATOM   935  O  O   . CYS A 1 148 ? 25.347  47.195 -2.077  1.00 48.20 ? 270 CYS A O   1 
ATOM   936  C  CB  . CYS A 1 148 ? 27.208  48.926 -1.199  1.00 46.46 ? 270 CYS A CB  1 
ATOM   937  S  SG  . CYS A 1 148 ? 28.224  47.470 -1.217  1.00 46.67 ? 270 CYS A SG  1 
ATOM   938  N  N   . ARG A 1 149 ? 25.102  48.089 -4.123  1.00 47.23 ? 271 ARG A N   1 
ATOM   939  C  CA  . ARG A 1 149 ? 24.118  47.125 -4.605  1.00 46.04 ? 271 ARG A CA  1 
ATOM   940  C  C   . ARG A 1 149 ? 24.475  45.690 -4.312  1.00 45.08 ? 271 ARG A C   1 
ATOM   941  O  O   . ARG A 1 149 ? 23.607  44.855 -4.101  1.00 45.77 ? 271 ARG A O   1 
ATOM   942  C  CB  . ARG A 1 149 ? 23.904  47.313 -6.103  1.00 45.26 ? 271 ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 149 ? 23.477  48.711 -6.485  0.00 45.99 ? 271 ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 149 ? 23.486  48.889 -7.991  0.00 46.13 ? 271 ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 149 ? 22.908  50.170 -8.382  0.00 46.28 ? 271 ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 149 ? 21.639  50.505 -8.174  0.00 46.37 ? 271 ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 149 ? 20.816  49.651 -7.580  0.00 46.38 ? 271 ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 149 ? 21.193  51.694 -8.557  0.00 46.38 ? 271 ARG A NH2 1 
ATOM   949  N  N   . SER A 1 150 ? 25.763  45.410 -4.285  1.00 44.73 ? 272 SER A N   1 
ATOM   950  C  CA  . SER A 1 150 ? 26.242  44.070 -4.022  1.00 44.32 ? 272 SER A CA  1 
ATOM   951  C  C   . SER A 1 150 ? 25.817  43.544 -2.642  1.00 44.94 ? 272 SER A C   1 
ATOM   952  O  O   . SER A 1 150 ? 25.762  42.329 -2.422  1.00 45.17 ? 272 SER A O   1 
ATOM   953  C  CB  . SER A 1 150 ? 27.756  44.068 -4.140  1.00 43.77 ? 272 SER A CB  1 
ATOM   954  O  OG  . SER A 1 150 ? 28.249  42.760 -4.062  1.00 48.41 ? 272 SER A OG  1 
ATOM   955  N  N   . LEU A 1 151 ? 25.513  44.459 -1.720  1.00 45.21 ? 273 LEU A N   1 
ATOM   956  C  CA  . LEU A 1 151 ? 25.115  44.094 -0.361  1.00 44.60 ? 273 LEU A CA  1 
ATOM   957  C  C   . LEU A 1 151 ? 23.649  44.336 -0.060  1.00 45.06 ? 273 LEU A C   1 
ATOM   958  O  O   . LEU A 1 151 ? 23.177  44.004 1.026   1.00 46.71 ? 273 LEU A O   1 
ATOM   959  C  CB  . LEU A 1 151 ? 25.971  44.842 0.664   1.00 43.96 ? 273 LEU A CB  1 
ATOM   960  C  CG  . LEU A 1 151 ? 27.430  44.376 0.754   1.00 45.79 ? 273 LEU A CG  1 
ATOM   961  C  CD1 . LEU A 1 151 ? 28.264  45.310 1.616   1.00 45.22 ? 273 LEU A CD1 1 
ATOM   962  C  CD2 . LEU A 1 151 ? 27.456  42.978 1.329   1.00 46.23 ? 273 LEU A CD2 1 
ATOM   963  N  N   . THR A 1 152 ? 22.922  44.906 -1.012  1.00 43.53 ? 274 THR A N   1 
ATOM   964  C  CA  . THR A 1 152 ? 21.506  45.173 -0.801  1.00 43.53 ? 274 THR A CA  1 
ATOM   965  C  C   . THR A 1 152 ? 20.773  43.941 -0.316  1.00 44.49 ? 274 THR A C   1 
ATOM   966  O  O   . THR A 1 152 ? 20.967  42.861 -0.853  1.00 45.94 ? 274 THR A O   1 
ATOM   967  C  CB  . THR A 1 152 ? 20.826  45.635 -2.083  1.00 41.72 ? 274 THR A CB  1 
ATOM   968  O  OG1 . THR A 1 152 ? 21.473  46.816 -2.545  1.00 41.00 ? 274 THR A OG1 1 
ATOM   969  C  CG2 . THR A 1 152 ? 19.366  45.937 -1.831  1.00 38.61 ? 274 THR A CG2 1 
ATOM   970  N  N   . GLY A 1 153 ? 19.929  44.111 0.698   1.00 45.02 ? 275 GLY A N   1 
ATOM   971  C  CA  . GLY A 1 153 ? 19.166  42.994 1.216   1.00 43.29 ? 275 GLY A CA  1 
ATOM   972  C  C   . GLY A 1 153 ? 19.988  42.072 2.078   1.00 43.57 ? 275 GLY A C   1 
ATOM   973  O  O   . GLY A 1 153 ? 19.475  41.089 2.600   1.00 46.01 ? 275 GLY A O   1 
ATOM   974  N  N   . LYS A 1 154 ? 21.269  42.373 2.225   1.00 42.56 ? 276 LYS A N   1 
ATOM   975  C  CA  . LYS A 1 154 ? 22.138  41.549 3.058   1.00 43.23 ? 276 LYS A CA  1 
ATOM   976  C  C   . LYS A 1 154 ? 22.463  42.318 4.329   1.00 42.37 ? 276 LYS A C   1 
ATOM   977  O  O   . LYS A 1 154 ? 22.599  43.536 4.297   1.00 42.55 ? 276 LYS A O   1 
ATOM   978  C  CB  . LYS A 1 154 ? 23.419  41.202 2.309   1.00 43.06 ? 276 LYS A CB  1 
ATOM   979  C  CG  . LYS A 1 154 ? 23.177  40.410 1.037   1.00 44.28 ? 276 LYS A CG  1 
ATOM   980  C  CD  . LYS A 1 154 ? 24.469  40.237 0.260   1.00 45.24 ? 276 LYS A CD  1 
ATOM   981  C  CE  . LYS A 1 154 ? 24.311  39.310 -0.923  1.00 44.32 ? 276 LYS A CE  1 
ATOM   982  N  NZ  . LYS A 1 154 ? 25.586  39.257 -1.688  1.00 46.43 ? 276 LYS A NZ  1 
ATOM   983  N  N   . PRO A 1 155 ? 22.600  41.617 5.464   1.00 41.81 ? 277 PRO A N   1 
ATOM   984  C  CA  . PRO A 1 155 ? 22.904  42.297 6.723   1.00 40.92 ? 277 PRO A CA  1 
ATOM   985  C  C   . PRO A 1 155 ? 24.282  42.924 6.786   1.00 41.09 ? 277 PRO A C   1 
ATOM   986  O  O   . PRO A 1 155 ? 25.297  42.276 6.545   1.00 40.13 ? 277 PRO A O   1 
ATOM   987  C  CB  . PRO A 1 155 ? 22.722  41.200 7.755   1.00 41.06 ? 277 PRO A CB  1 
ATOM   988  C  CG  . PRO A 1 155 ? 23.197  39.996 7.014   1.00 41.49 ? 277 PRO A CG  1 
ATOM   989  C  CD  . PRO A 1 155 ? 22.547  40.159 5.661   1.00 41.56 ? 277 PRO A CD  1 
ATOM   990  N  N   . LYS A 1 156 ? 24.288  44.204 7.123   1.00 41.10 ? 278 LYS A N   1 
ATOM   991  C  CA  . LYS A 1 156 ? 25.498  44.985 7.262   1.00 41.63 ? 278 LYS A CA  1 
ATOM   992  C  C   . LYS A 1 156 ? 25.639  45.288 8.761   1.00 42.87 ? 278 LYS A C   1 
ATOM   993  O  O   . LYS A 1 156 ? 24.842  46.042 9.325   1.00 44.18 ? 278 LYS A O   1 
ATOM   994  C  CB  . LYS A 1 156 ? 25.348  46.272 6.450   1.00 41.27 ? 278 LYS A CB  1 
ATOM   995  C  CG  . LYS A 1 156 ? 25.205  46.023 4.959   1.00 40.98 ? 278 LYS A CG  1 
ATOM   996  C  CD  . LYS A 1 156 ? 24.716  47.250 4.211   1.00 41.00 ? 278 LYS A CD  1 
ATOM   997  C  CE  . LYS A 1 156 ? 23.194  47.305 4.132   1.00 39.55 ? 278 LYS A CE  1 
ATOM   998  N  NZ  . LYS A 1 156 ? 22.629  46.269 3.232   1.00 40.32 ? 278 LYS A NZ  1 
ATOM   999  N  N   . LEU A 1 157 ? 26.650  44.703 9.403   1.00 42.18 ? 279 LEU A N   1 
ATOM   1000 C  CA  . LEU A 1 157 ? 26.853  44.896 10.834  1.00 42.02 ? 279 LEU A CA  1 
ATOM   1001 C  C   . LEU A 1 157 ? 28.044  45.767 11.221  1.00 41.51 ? 279 LEU A C   1 
ATOM   1002 O  O   . LEU A 1 157 ? 29.165  45.502 10.807  1.00 42.27 ? 279 LEU A O   1 
ATOM   1003 C  CB  . LEU A 1 157 ? 27.014  43.534 11.505  1.00 43.09 ? 279 LEU A CB  1 
ATOM   1004 C  CG  . LEU A 1 157 ? 25.983  42.481 11.118  1.00 44.89 ? 279 LEU A CG  1 
ATOM   1005 C  CD1 . LEU A 1 157 ? 26.198  41.223 11.936  1.00 46.34 ? 279 LEU A CD1 1 
ATOM   1006 C  CD2 . LEU A 1 157 ? 24.597  43.013 11.362  1.00 46.28 ? 279 LEU A CD2 1 
ATOM   1007 N  N   . PHE A 1 158 ? 27.805  46.793 12.030  1.00 39.60 ? 280 PHE A N   1 
ATOM   1008 C  CA  . PHE A 1 158 ? 28.884  47.659 12.486  1.00 39.07 ? 280 PHE A CA  1 
ATOM   1009 C  C   . PHE A 1 158 ? 29.015  47.576 13.990  1.00 39.39 ? 280 PHE A C   1 
ATOM   1010 O  O   . PHE A 1 158 ? 28.075  47.867 14.724  1.00 40.16 ? 280 PHE A O   1 
ATOM   1011 C  CB  . PHE A 1 158 ? 28.639  49.104 12.081  1.00 38.64 ? 280 PHE A CB  1 
ATOM   1012 C  CG  . PHE A 1 158 ? 28.676  49.327 10.608  1.00 38.89 ? 280 PHE A CG  1 
ATOM   1013 C  CD1 . PHE A 1 158 ? 27.577  49.022 9.820   1.00 37.93 ? 280 PHE A CD1 1 
ATOM   1014 C  CD2 . PHE A 1 158 ? 29.815  49.829 10.005  1.00 40.10 ? 280 PHE A CD2 1 
ATOM   1015 C  CE1 . PHE A 1 158 ? 27.606  49.213 8.464   1.00 38.19 ? 280 PHE A CE1 1 
ATOM   1016 C  CE2 . PHE A 1 158 ? 29.857  50.024 8.638   1.00 41.87 ? 280 PHE A CE2 1 
ATOM   1017 C  CZ  . PHE A 1 158 ? 28.748  49.716 7.865   1.00 41.54 ? 280 PHE A CZ  1 
ATOM   1018 N  N   . ILE A 1 159 ? 30.195  47.184 14.445  1.00 39.17 ? 281 ILE A N   1 
ATOM   1019 C  CA  . ILE A 1 159 ? 30.452  47.035 15.865  1.00 39.82 ? 281 ILE A CA  1 
ATOM   1020 C  C   . ILE A 1 159 ? 31.371  48.161 16.319  1.00 41.13 ? 281 ILE A C   1 
ATOM   1021 O  O   . ILE A 1 159 ? 32.507  48.272 15.862  1.00 42.83 ? 281 ILE A O   1 
ATOM   1022 C  CB  . ILE A 1 159 ? 31.074  45.657 16.120  1.00 39.00 ? 281 ILE A CB  1 
ATOM   1023 C  CG1 . ILE A 1 159 ? 30.105  44.581 15.614  1.00 39.67 ? 281 ILE A CG1 1 
ATOM   1024 C  CG2 . ILE A 1 159 ? 31.365  45.472 17.585  1.00 38.05 ? 281 ILE A CG2 1 
ATOM   1025 C  CD1 . ILE A 1 159 ? 30.672  43.182 15.517  1.00 38.91 ? 281 ILE A CD1 1 
ATOM   1026 N  N   . ILE A 1 160 ? 30.875  49.005 17.216  1.00 40.40 ? 282 ILE A N   1 
ATOM   1027 C  CA  . ILE A 1 160 ? 31.653  50.143 17.678  1.00 40.11 ? 282 ILE A CA  1 
ATOM   1028 C  C   . ILE A 1 160 ? 32.052  50.147 19.130  1.00 39.22 ? 282 ILE A C   1 
ATOM   1029 O  O   . ILE A 1 160 ? 31.215  50.300 20.003  1.00 41.09 ? 282 ILE A O   1 
ATOM   1030 C  CB  . ILE A 1 160 ? 30.912  51.483 17.430  1.00 40.26 ? 282 ILE A CB  1 
ATOM   1031 C  CG1 . ILE A 1 160 ? 30.635  51.669 15.940  1.00 40.22 ? 282 ILE A CG1 1 
ATOM   1032 C  CG2 . ILE A 1 160 ? 31.732  52.642 17.974  1.00 37.78 ? 282 ILE A CG2 1 
ATOM   1033 C  CD1 . ILE A 1 160 ? 29.238  51.356 15.571  1.00 40.04 ? 282 ILE A CD1 1 
ATOM   1034 N  N   . GLN A 1 161 ? 33.343  50.001 19.380  1.00 38.83 ? 283 GLN A N   1 
ATOM   1035 C  CA  . GLN A 1 161 ? 33.865  50.047 20.734  1.00 39.07 ? 283 GLN A CA  1 
ATOM   1036 C  C   . GLN A 1 161 ? 34.522  51.407 20.881  1.00 39.45 ? 283 GLN A C   1 
ATOM   1037 O  O   . GLN A 1 161 ? 35.697  51.584 20.568  1.00 40.28 ? 283 GLN A O   1 
ATOM   1038 C  CB  . GLN A 1 161 ? 34.888  48.940 20.968  1.00 39.25 ? 283 GLN A CB  1 
ATOM   1039 C  CG  . GLN A 1 161 ? 35.755  49.138 22.204  1.00 40.79 ? 283 GLN A CG  1 
ATOM   1040 C  CD  . GLN A 1 161 ? 34.968  49.449 23.471  1.00 43.89 ? 283 GLN A CD  1 
ATOM   1041 O  OE1 . GLN A 1 161 ? 34.063  48.706 23.862  1.00 45.99 ? 283 GLN A OE1 1 
ATOM   1042 N  NE2 . GLN A 1 161 ? 35.325  50.550 24.131  1.00 45.83 ? 283 GLN A NE2 1 
ATOM   1043 N  N   . ALA A 1 162 ? 33.736  52.375 21.335  1.00 38.31 ? 284 ALA A N   1 
ATOM   1044 C  CA  . ALA A 1 162 ? 34.214  53.728 21.519  1.00 36.36 ? 284 ALA A CA  1 
ATOM   1045 C  C   . ALA A 1 162 ? 33.235  54.494 22.389  1.00 36.40 ? 284 ALA A C   1 
ATOM   1046 O  O   . ALA A 1 162 ? 32.080  54.109 22.522  1.00 35.63 ? 284 ALA A O   1 
ATOM   1047 C  CB  . ALA A 1 162 ? 34.363  54.406 20.171  1.00 34.24 ? 284 ALA A CB  1 
ATOM   1048 N  N   . ALA A 1 163 ? 33.710  55.576 22.990  1.00 37.46 ? 285 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 163 ? 32.868  56.400 23.839  1.00 38.58 ? 285 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 163 ? 31.878  57.171 22.983  1.00 39.63 ? 285 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 163 ? 32.133  57.438 21.818  1.00 40.51 ? 285 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 163 ? 33.715  57.362 24.636  1.00 36.23 ? 285 ALA A CB  1 
ATOM   1053 N  N   . ARG A 1 164 ? 30.743  57.518 23.577  1.00 41.01 ? 286 ARG A N   1 
ATOM   1054 C  CA  . ARG A 1 164 ? 29.692  58.269 22.908  1.00 40.04 ? 286 ARG A CA  1 
ATOM   1055 C  C   . ARG A 1 164 ? 29.367  59.454 23.802  1.00 39.85 ? 286 ARG A C   1 
ATOM   1056 O  O   . ARG A 1 164 ? 28.251  59.938 23.831  1.00 40.14 ? 286 ARG A O   1 
ATOM   1057 C  CB  . ARG A 1 164 ? 28.451  57.392 22.730  1.00 38.24 ? 286 ARG A CB  1 
ATOM   1058 C  CG  . ARG A 1 164 ? 28.731  56.074 22.041  1.00 38.08 ? 286 ARG A CG  1 
ATOM   1059 C  CD  . ARG A 1 164 ? 27.486  55.220 21.928  1.00 37.11 ? 286 ARG A CD  1 
ATOM   1060 N  NE  . ARG A 1 164 ? 26.531  55.768 20.986  1.00 37.13 ? 286 ARG A NE  1 
ATOM   1061 C  CZ  . ARG A 1 164 ? 25.315  55.282 20.800  1.00 38.56 ? 286 ARG A CZ  1 
ATOM   1062 N  NH1 . ARG A 1 164 ? 24.907  54.236 21.497  1.00 38.72 ? 286 ARG A NH1 1 
ATOM   1063 N  NH2 . ARG A 1 164 ? 24.508  55.843 19.920  1.00 36.72 ? 286 ARG A NH2 1 
ATOM   1064 N  N   . GLY A 1 165 ? 30.366  59.915 24.532  1.00 39.40 ? 287 GLY A N   1 
ATOM   1065 C  CA  . GLY A 1 165 ? 30.165  61.022 25.438  1.00 41.49 ? 287 GLY A CA  1 
ATOM   1066 C  C   . GLY A 1 165 ? 30.996  60.801 26.680  1.00 41.75 ? 287 GLY A C   1 
ATOM   1067 O  O   . GLY A 1 165 ? 31.855  59.927 26.699  1.00 43.11 ? 287 GLY A O   1 
ATOM   1068 N  N   . THR A 1 166 ? 30.743  61.574 27.727  1.00 43.84 ? 288 THR A N   1 
ATOM   1069 C  CA  . THR A 1 166 ? 31.514  61.428 28.954  1.00 45.92 ? 288 THR A CA  1 
ATOM   1070 C  C   . THR A 1 166 ? 30.683  61.081 30.193  1.00 47.01 ? 288 THR A C   1 
ATOM   1071 O  O   . THR A 1 166 ? 31.183  61.094 31.314  1.00 48.20 ? 288 THR A O   1 
ATOM   1072 C  CB  . THR A 1 166 ? 32.330  62.694 29.230  1.00 46.61 ? 288 THR A CB  1 
ATOM   1073 O  OG1 . THR A 1 166 ? 31.447  63.814 29.350  1.00 46.00 ? 288 THR A OG1 1 
ATOM   1074 C  CG2 . THR A 1 166 ? 33.309  62.944 28.093  1.00 46.67 ? 288 THR A CG2 1 
ATOM   1075 N  N   . GLU A 1 167 ? 29.412  60.770 29.992  1.00 47.45 ? 289 GLU A N   1 
ATOM   1076 C  CA  . GLU A 1 167 ? 28.546  60.389 31.093  1.00 47.42 ? 289 GLU A CA  1 
ATOM   1077 C  C   . GLU A 1 167 ? 29.012  59.069 31.687  1.00 45.87 ? 289 GLU A C   1 
ATOM   1078 O  O   . GLU A 1 167 ? 29.542  58.220 30.985  1.00 45.45 ? 289 GLU A O   1 
ATOM   1079 C  CB  . GLU A 1 167 ? 27.115  60.210 30.595  1.00 50.71 ? 289 GLU A CB  1 
ATOM   1080 C  CG  . GLU A 1 167 ? 26.258  61.432 30.706  1.00 55.58 ? 289 GLU A CG  1 
ATOM   1081 C  CD  . GLU A 1 167 ? 26.222  61.931 32.123  1.00 60.13 ? 289 GLU A CD  1 
ATOM   1082 O  OE1 . GLU A 1 167 ? 27.155  62.681 32.501  1.00 63.06 ? 289 GLU A OE1 1 
ATOM   1083 O  OE2 . GLU A 1 167 ? 25.279  61.550 32.865  1.00 61.55 ? 289 GLU A OE2 1 
ATOM   1084 N  N   . LEU A 1 168 ? 28.805  58.890 32.980  1.00 45.01 ? 290 LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 168 ? 29.188  57.645 33.619  1.00 44.90 ? 290 LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 168 ? 27.971  57.052 34.323  1.00 46.01 ? 290 LEU A C   1 
ATOM   1087 O  O   . LEU A 1 168 ? 27.197  57.763 34.952  1.00 44.43 ? 290 LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 168 ? 30.316  57.883 34.625  1.00 44.76 ? 290 LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 168 ? 31.661  58.371 34.085  1.00 44.33 ? 290 LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 168 ? 32.608  58.581 35.228  1.00 44.24 ? 290 LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 168 ? 32.237  57.368 33.118  1.00 44.93 ? 290 LEU A CD2 1 
ATOM   1092 N  N   . ASP A 1 169 ? 27.787  55.745 34.203  1.00 48.26 ? 291 ASP A N   1 
ATOM   1093 C  CA  . ASP A 1 169 ? 26.657  55.113 34.852  1.00 50.67 ? 291 ASP A CA  1 
ATOM   1094 C  C   . ASP A 1 169 ? 27.072  54.805 36.281  1.00 52.46 ? 291 ASP A C   1 
ATOM   1095 O  O   . ASP A 1 169 ? 27.985  54.011 36.506  1.00 52.61 ? 291 ASP A O   1 
ATOM   1096 C  CB  . ASP A 1 169 ? 26.275  53.828 34.124  1.00 50.83 ? 291 ASP A CB  1 
ATOM   1097 C  CG  . ASP A 1 169 ? 24.892  53.344 34.497  1.00 51.95 ? 291 ASP A CG  1 
ATOM   1098 O  OD1 . ASP A 1 169 ? 24.030  53.231 33.602  1.00 52.79 ? 291 ASP A OD1 1 
ATOM   1099 O  OD2 . ASP A 1 169 ? 24.657  53.081 35.691  1.00 52.26 ? 291 ASP A OD2 1 
ATOM   1100 N  N   . CYS A 1 170 ? 26.412  55.445 37.244  1.00 54.76 ? 292 CYS A N   1 
ATOM   1101 C  CA  . CYS A 1 170 ? 26.723  55.242 38.657  1.00 56.53 ? 292 CYS A CA  1 
ATOM   1102 C  C   . CYS A 1 170 ? 26.177  53.886 39.117  1.00 56.28 ? 292 CYS A C   1 
ATOM   1103 O  O   . CYS A 1 170 ? 26.591  53.337 40.138  1.00 56.01 ? 292 CYS A O   1 
ATOM   1104 C  CB  . CYS A 1 170 ? 26.108  56.368 39.495  1.00 58.13 ? 292 CYS A CB  1 
ATOM   1105 S  SG  . CYS A 1 170 ? 24.268  56.323 39.552  1.00 64.84 ? 292 CYS A SG  1 
ATOM   1106 N  N   . GLY A 1 171 ? 25.238  53.350 38.351  1.00 55.98 ? 293 GLY A N   1 
ATOM   1107 C  CA  . GLY A 1 171 ? 24.666  52.066 38.697  1.00 56.32 ? 293 GLY A CA  1 
ATOM   1108 C  C   . GLY A 1 171 ? 23.658  52.148 39.824  1.00 56.69 ? 293 GLY A C   1 
ATOM   1109 O  O   . GLY A 1 171 ? 23.478  53.206 40.444  1.00 55.78 ? 293 GLY A O   1 
ATOM   1110 N  N   . ILE A 1 172 ? 22.980  51.026 40.063  1.00 57.36 ? 294 ILE A N   1 
ATOM   1111 C  CA  . ILE A 1 172 ? 21.989  50.916 41.132  1.00 58.56 ? 294 ILE A CA  1 
ATOM   1112 C  C   . ILE A 1 172 ? 22.119  49.560 41.808  1.00 59.71 ? 294 ILE A C   1 
ATOM   1113 O  O   . ILE A 1 172 ? 22.436  48.555 41.175  1.00 58.81 ? 294 ILE A O   1 
ATOM   1114 C  CB  . ILE A 1 172 ? 20.528  51.076 40.612  1.00 57.77 ? 294 ILE A CB  1 
ATOM   1115 C  CG1 . ILE A 1 172 ? 19.552  51.041 41.783  1.00 57.21 ? 294 ILE A CG1 1 
ATOM   1116 C  CG2 . ILE A 1 172 ? 20.179  49.953 39.653  1.00 56.66 ? 294 ILE A CG2 1 
ATOM   1117 C  CD1 . ILE A 1 172 ? 19.929  51.969 42.917  1.00 58.18 ? 294 ILE A CD1 1 
ATOM   1118 N  N   . GLU A 1 173 ? 21.872  49.546 43.107  1.00 63.31 ? 295 GLU A N   1 
ATOM   1119 C  CA  . GLU A 1 173 ? 21.958  48.325 43.900  1.00 66.23 ? 295 GLU A CA  1 
ATOM   1120 C  C   . GLU A 1 173 ? 20.775  47.397 43.613  1.00 67.00 ? 295 GLU A C   1 
ATOM   1121 O  O   . GLU A 1 173 ? 19.676  47.854 43.300  1.00 66.90 ? 295 GLU A O   1 
ATOM   1122 C  CB  . GLU A 1 173 ? 21.959  48.698 45.376  1.00 68.10 ? 295 GLU A CB  1 
ATOM   1123 C  CG  . GLU A 1 173 ? 22.460  47.613 46.306  1.00 72.30 ? 295 GLU A CG  1 
ATOM   1124 C  CD  . GLU A 1 173 ? 23.977  47.551 46.339  1.00 73.52 ? 295 GLU A CD  1 
ATOM   1125 O  OE1 . GLU A 1 173 ? 24.593  48.624 46.090  1.00 73.67 ? 295 GLU A OE1 1 
ATOM   1126 O  OE2 . GLU A 1 173 ? 24.532  46.449 46.625  1.00 73.13 ? 295 GLU A OE2 1 
ATOM   1127 N  N   . THR A 1 174 ? 21.018  46.099 43.745  1.00 69.28 ? 296 THR A N   1 
ATOM   1128 C  CA  . THR A 1 174 ? 20.035  45.031 43.525  1.00 72.20 ? 296 THR A CA  1 
ATOM   1129 C  C   . THR A 1 174 ? 20.713  43.981 42.657  1.00 73.37 ? 296 THR A C   1 
ATOM   1130 O  O   . THR A 1 174 ? 20.807  44.230 41.432  1.00 73.64 ? 296 THR A O   1 
ATOM   1131 C  CB  . THR A 1 174 ? 18.735  45.497 42.779  1.00 73.40 ? 296 THR A CB  1 
ATOM   1132 O  OG1 . THR A 1 174 ? 17.842  46.163 43.696  1.00 73.79 ? 296 THR A OG1 1 
ATOM   1133 C  CG2 . THR A 1 174 ? 18.006  44.280 42.168  1.00 74.25 ? 296 THR A CG2 1 
ATOM   1134 N  N   . SER B 2 1   ? 8.601   63.930 -15.267 1.00 52.02 ? 310 SER B N   1 
ATOM   1135 C  CA  . SER B 2 1   ? 7.196   63.677 -14.851 1.00 51.26 ? 310 SER B CA  1 
ATOM   1136 C  C   . SER B 2 1   ? 7.079   62.196 -14.572 1.00 51.14 ? 310 SER B C   1 
ATOM   1137 O  O   . SER B 2 1   ? 7.901   61.413 -15.041 1.00 51.07 ? 310 SER B O   1 
ATOM   1138 C  CB  . SER B 2 1   ? 6.225   64.062 -15.969 1.00 51.24 ? 310 SER B CB  1 
ATOM   1139 O  OG  . SER B 2 1   ? 6.215   63.084 -16.985 1.00 50.92 ? 310 SER B OG  1 
ATOM   1140 N  N   . GLY B 2 2   ? 6.053   61.813 -13.822 1.00 51.09 ? 311 GLY B N   1 
ATOM   1141 C  CA  . GLY B 2 2   ? 5.879   60.414 -13.488 1.00 51.64 ? 311 GLY B CA  1 
ATOM   1142 C  C   . GLY B 2 2   ? 4.744   59.701 -14.193 1.00 52.48 ? 311 GLY B C   1 
ATOM   1143 O  O   . GLY B 2 2   ? 3.874   60.330 -14.783 1.00 54.93 ? 311 GLY B O   1 
ATOM   1144 N  N   . VAL B 2 3   ? 4.738   58.378 -14.108 1.00 52.01 ? 312 VAL B N   1 
ATOM   1145 C  CA  . VAL B 2 3   ? 3.714   57.582 -14.755 1.00 51.94 ? 312 VAL B CA  1 
ATOM   1146 C  C   . VAL B 2 3   ? 2.984   56.697 -13.750 1.00 54.37 ? 312 VAL B C   1 
ATOM   1147 O  O   . VAL B 2 3   ? 3.430   56.527 -12.622 1.00 55.58 ? 312 VAL B O   1 
ATOM   1148 C  CB  . VAL B 2 3   ? 4.353   56.711 -15.848 1.00 49.59 ? 312 VAL B CB  1 
ATOM   1149 C  CG1 . VAL B 2 3   ? 3.390   55.700 -16.331 1.00 49.57 ? 312 VAL B CG1 1 
ATOM   1150 C  CG2 . VAL B 2 3   ? 4.788   57.573 -16.997 1.00 48.24 ? 312 VAL B CG2 1 
ATOM   1151 N  N   . ASP B 2 4   ? 1.844   56.156 -14.160 1.00 56.63 ? 313 ASP B N   1 
ATOM   1152 C  CA  . ASP B 2 4   ? 1.065   55.259 -13.317 1.00 59.07 ? 313 ASP B CA  1 
ATOM   1153 C  C   . ASP B 2 4   ? 1.783   53.912 -13.247 1.00 59.19 ? 313 ASP B C   1 
ATOM   1154 O  O   . ASP B 2 4   ? 1.171   52.879 -13.514 1.00 60.41 ? 313 ASP B O   1 
ATOM   1155 C  CB  . ASP B 2 4   ? -0.320  55.034 -13.937 1.00 61.87 ? 313 ASP B CB  1 
ATOM   1156 C  CG  . ASP B 2 4   ? -1.346  56.050 -13.471 1.00 65.71 ? 313 ASP B CG  1 
ATOM   1157 O  OD1 . ASP B 2 4   ? -0.949  57.218 -13.198 1.00 68.05 ? 313 ASP B OD1 1 
ATOM   1158 O  OD2 . ASP B 2 4   ? -2.552  55.684 -13.388 1.00 65.89 ? 313 ASP B OD2 1 
ATOM   1159 N  N   . ASP B 2 5   ? 3.070   53.900 -12.909 1.00 58.55 ? 314 ASP B N   1 
ATOM   1160 C  CA  . ASP B 2 5   ? 3.785   52.634 -12.852 1.00 58.18 ? 314 ASP B CA  1 
ATOM   1161 C  C   . ASP B 2 5   ? 4.345   52.322 -11.476 1.00 59.05 ? 314 ASP B C   1 
ATOM   1162 O  O   . ASP B 2 5   ? 5.022   51.316 -11.282 1.00 59.48 ? 314 ASP B O   1 
ATOM   1163 C  CB  . ASP B 2 5   ? 4.905   52.607 -13.891 1.00 56.45 ? 314 ASP B CB  1 
ATOM   1164 C  CG  . ASP B 2 5   ? 5.894   53.729 -13.705 1.00 56.91 ? 314 ASP B CG  1 
ATOM   1165 O  OD1 . ASP B 2 5   ? 6.893   53.759 -14.445 1.00 57.36 ? 314 ASP B OD1 1 
ATOM   1166 O  OD2 . ASP B 2 5   ? 5.679   54.584 -12.821 1.00 56.16 ? 314 ASP B OD2 1 
ATOM   1167 N  N   . ASP B 2 6   ? 4.061   53.177 -10.509 1.00 60.00 ? 315 ASP B N   1 
ATOM   1168 C  CA  . ASP B 2 6   ? 4.546   52.928 -9.161  1.00 61.84 ? 315 ASP B CA  1 
ATOM   1169 C  C   . ASP B 2 6   ? 4.355   51.457 -8.813  1.00 62.17 ? 315 ASP B C   1 
ATOM   1170 O  O   . ASP B 2 6   ? 5.332   50.739 -8.579  1.00 63.45 ? 315 ASP B O   1 
ATOM   1171 C  CB  . ASP B 2 6   ? 3.795   53.811 -8.177  1.00 62.02 ? 315 ASP B CB  1 
ATOM   1172 C  CG  . ASP B 2 6   ? 4.097   55.278 -8.392  1.00 62.86 ? 315 ASP B CG  1 
ATOM   1173 O  OD1 . ASP B 2 6   ? 3.153   56.110 -8.297  1.00 61.98 ? 315 ASP B OD1 1 
ATOM   1174 O  OD2 . ASP B 2 6   ? 5.289   55.584 -8.655  1.00 61.61 ? 315 ASP B OD2 1 
ATOM   1175 N  N   . MET B 2 7   ? 3.103   51.008 -8.825  1.00 61.89 ? 316 MET B N   1 
ATOM   1176 C  CA  . MET B 2 7   ? 2.758   49.622 -8.512  1.00 61.92 ? 316 MET B CA  1 
ATOM   1177 C  C   . MET B 2 7   ? 3.564   48.580 -9.285  1.00 60.52 ? 316 MET B C   1 
ATOM   1178 O  O   . MET B 2 7   ? 3.489   47.393 -8.998  1.00 59.20 ? 316 MET B O   1 
ATOM   1179 C  CB  . MET B 2 7   ? 1.268   49.403 -8.765  1.00 63.71 ? 316 MET B CB  1 
ATOM   1180 C  CG  . MET B 2 7   ? 0.366   50.359 -7.968  1.00 66.89 ? 316 MET B CG  1 
ATOM   1181 S  SD  . MET B 2 7   ? 0.378   50.086 -6.147  1.00 69.78 ? 316 MET B SD  1 
ATOM   1182 C  CE  . MET B 2 7   ? 1.723   51.327 -5.556  1.00 69.05 ? 316 MET B CE  1 
ATOM   1183 N  N   . ALA B 2 8   ? 4.355   49.027 -10.248 1.00 59.97 ? 317 ALA B N   1 
ATOM   1184 C  CA  . ALA B 2 8   ? 5.140   48.106 -11.050 1.00 60.63 ? 317 ALA B CA  1 
ATOM   1185 C  C   . ALA B 2 8   ? 6.603   48.015 -10.648 1.00 61.55 ? 317 ALA B C   1 
ATOM   1186 O  O   . ALA B 2 8   ? 7.420   47.440 -11.371 1.00 61.86 ? 317 ALA B O   1 
ATOM   1187 C  CB  . ALA B 2 8   ? 5.036   48.490 -12.517 1.00 60.32 ? 317 ALA B CB  1 
ATOM   1188 N  N   . CYS B 2 9   ? 6.944   48.570 -9.495  1.00 62.20 ? 318 CYS B N   1 
ATOM   1189 C  CA  . CYS B 2 9   ? 8.328   48.532 -9.053  1.00 63.06 ? 318 CYS B CA  1 
ATOM   1190 C  C   . CYS B 2 9   ? 8.420   48.488 -7.533  1.00 61.53 ? 318 CYS B C   1 
ATOM   1191 O  O   . CYS B 2 9   ? 7.825   49.313 -6.848  1.00 61.84 ? 318 CYS B O   1 
ATOM   1192 C  CB  . CYS B 2 9   ? 9.064   49.766 -9.573  1.00 65.86 ? 318 CYS B CB  1 
ATOM   1193 S  SG  . CYS B 2 9   ? 10.734  49.921 -8.884  1.00 72.02 ? 318 CYS B SG  1 
ATOM   1194 N  N   . HIS B 2 10  ? 9.188   47.549 -7.004  1.00 58.92 ? 319 HIS B N   1 
ATOM   1195 C  CA  . HIS B 2 10  ? 9.317   47.426 -5.559  1.00 56.63 ? 319 HIS B CA  1 
ATOM   1196 C  C   . HIS B 2 10  ? 10.652  47.912 -4.981  1.00 54.09 ? 319 HIS B C   1 
ATOM   1197 O  O   . HIS B 2 10  ? 11.721  47.653 -5.535  1.00 53.70 ? 319 HIS B O   1 
ATOM   1198 C  CB  . HIS B 2 10  ? 9.090   45.976 -5.167  1.00 58.24 ? 319 HIS B CB  1 
ATOM   1199 C  CG  . HIS B 2 10  ? 9.314   45.709 -3.720  1.00 59.49 ? 319 HIS B CG  1 
ATOM   1200 N  ND1 . HIS B 2 10  ? 8.762   46.492 -2.728  1.00 60.14 ? 319 HIS B ND1 1 
ATOM   1201 C  CD2 . HIS B 2 10  ? 10.053  44.763 -3.091  1.00 59.25 ? 319 HIS B CD2 1 
ATOM   1202 C  CE1 . HIS B 2 10  ? 9.150   46.038 -1.549  1.00 60.17 ? 319 HIS B CE1 1 
ATOM   1203 N  NE2 . HIS B 2 10  ? 9.935   44.990 -1.742  1.00 60.91 ? 319 HIS B NE2 1 
ATOM   1204 N  N   . LYS B 2 11  ? 10.589  48.604 -3.848  1.00 51.21 ? 320 LYS B N   1 
ATOM   1205 C  CA  . LYS B 2 11  ? 11.803  49.119 -3.211  1.00 48.62 ? 320 LYS B CA  1 
ATOM   1206 C  C   . LYS B 2 11  ? 11.914  48.809 -1.728  1.00 47.17 ? 320 LYS B C   1 
ATOM   1207 O  O   . LYS B 2 11  ? 10.927  48.492 -1.076  1.00 47.47 ? 320 LYS B O   1 
ATOM   1208 C  CB  . LYS B 2 11  ? 11.887  50.639 -3.371  1.00 47.73 ? 320 LYS B CB  1 
ATOM   1209 C  CG  . LYS B 2 11  ? 12.072  51.121 -4.795  1.00 48.91 ? 320 LYS B CG  1 
ATOM   1210 C  CD  . LYS B 2 11  ? 12.314  52.617 -4.855  1.00 47.50 ? 320 LYS B CD  1 
ATOM   1211 C  CE  . LYS B 2 11  ? 11.099  53.409 -4.448  1.00 47.76 ? 320 LYS B CE  1 
ATOM   1212 N  NZ  . LYS B 2 11  ? 11.374  54.853 -4.606  1.00 47.97 ? 320 LYS B NZ  1 
ATOM   1213 N  N   . ILE B 2 12  ? 13.134  48.895 -1.208  1.00 45.17 ? 321 ILE B N   1 
ATOM   1214 C  CA  . ILE B 2 12  ? 13.383  48.707 0.217   1.00 43.84 ? 321 ILE B CA  1 
ATOM   1215 C  C   . ILE B 2 12  ? 14.186  49.929 0.645   1.00 42.73 ? 321 ILE B C   1 
ATOM   1216 O  O   . ILE B 2 12  ? 14.915  50.508 -0.152  1.00 40.52 ? 321 ILE B O   1 
ATOM   1217 C  CB  . ILE B 2 12  ? 14.210  47.446 0.529   1.00 42.77 ? 321 ILE B CB  1 
ATOM   1218 C  CG1 . ILE B 2 12  ? 15.617  47.584 -0.052  1.00 40.90 ? 321 ILE B CG1 1 
ATOM   1219 C  CG2 . ILE B 2 12  ? 13.499  46.233 -0.006  1.00 42.70 ? 321 ILE B CG2 1 
ATOM   1220 C  CD1 . ILE B 2 12  ? 16.546  46.466 0.319   1.00 38.02 ? 321 ILE B CD1 1 
ATOM   1221 N  N   . PRO B 2 13  ? 14.054  50.342 1.909   1.00 42.61 ? 322 PRO B N   1 
ATOM   1222 C  CA  . PRO B 2 13  ? 14.786  51.507 2.402   1.00 41.54 ? 322 PRO B CA  1 
ATOM   1223 C  C   . PRO B 2 13  ? 16.284  51.356 2.226   1.00 40.99 ? 322 PRO B C   1 
ATOM   1224 O  O   . PRO B 2 13  ? 16.840  50.296 2.487   1.00 42.35 ? 322 PRO B O   1 
ATOM   1225 C  CB  . PRO B 2 13  ? 14.376  51.562 3.859   1.00 41.70 ? 322 PRO B CB  1 
ATOM   1226 C  CG  . PRO B 2 13  ? 12.992  51.056 3.820   1.00 41.41 ? 322 PRO B CG  1 
ATOM   1227 C  CD  . PRO B 2 13  ? 13.118  49.854 2.930   1.00 42.06 ? 322 PRO B CD  1 
ATOM   1228 N  N   . VAL B 2 14  ? 16.937  52.420 1.778   1.00 39.90 ? 323 VAL B N   1 
ATOM   1229 C  CA  . VAL B 2 14  ? 18.379  52.384 1.572   1.00 40.86 ? 323 VAL B CA  1 
ATOM   1230 C  C   . VAL B 2 14  ? 19.087  52.293 2.910   1.00 40.65 ? 323 VAL B C   1 
ATOM   1231 O  O   . VAL B 2 14  ? 20.270  51.989 2.979   1.00 41.38 ? 323 VAL B O   1 
ATOM   1232 C  CB  . VAL B 2 14  ? 18.900  53.655 0.857   1.00 40.80 ? 323 VAL B CB  1 
ATOM   1233 C  CG1 . VAL B 2 14  ? 18.226  53.812 -0.473  1.00 39.85 ? 323 VAL B CG1 1 
ATOM   1234 C  CG2 . VAL B 2 14  ? 18.668  54.882 1.731   1.00 39.87 ? 323 VAL B CG2 1 
ATOM   1235 N  N   . GLU B 2 15  ? 18.343  52.558 3.970   1.00 41.38 ? 324 GLU B N   1 
ATOM   1236 C  CA  . GLU B 2 15  ? 18.885  52.555 5.312   1.00 42.57 ? 324 GLU B CA  1 
ATOM   1237 C  C   . GLU B 2 15  ? 18.567  51.251 6.031   1.00 42.40 ? 324 GLU B C   1 
ATOM   1238 O  O   . GLU B 2 15  ? 19.016  51.020 7.145   1.00 41.66 ? 324 GLU B O   1 
ATOM   1239 C  CB  . GLU B 2 15  ? 18.301  53.744 6.076   1.00 44.60 ? 324 GLU B CB  1 
ATOM   1240 C  CG  . GLU B 2 15  ? 19.238  54.346 7.091   1.00 48.32 ? 324 GLU B CG  1 
ATOM   1241 C  CD  . GLU B 2 15  ? 20.302  55.217 6.459   1.00 50.78 ? 324 GLU B CD  1 
ATOM   1242 O  OE1 . GLU B 2 15  ? 19.995  56.371 6.098   1.00 51.57 ? 324 GLU B OE1 1 
ATOM   1243 O  OE2 . GLU B 2 15  ? 21.450  54.745 6.323   1.00 52.64 ? 324 GLU B OE2 1 
ATOM   1244 N  N   . ALA B 2 16  ? 17.795  50.398 5.373   1.00 43.28 ? 325 ALA B N   1 
ATOM   1245 C  CA  . ALA B 2 16  ? 17.404  49.122 5.946   1.00 44.03 ? 325 ALA B CA  1 
ATOM   1246 C  C   . ALA B 2 16  ? 18.540  48.121 5.932   1.00 44.53 ? 325 ALA B C   1 
ATOM   1247 O  O   . ALA B 2 16  ? 19.519  48.297 5.220   1.00 45.23 ? 325 ALA B O   1 
ATOM   1248 C  CB  . ALA B 2 16  ? 16.222  48.561 5.192   1.00 44.21 ? 325 ALA B CB  1 
ATOM   1249 N  N   . ASP B 2 17  ? 18.396  47.074 6.737   1.00 45.39 ? 326 ASP B N   1 
ATOM   1250 C  CA  . ASP B 2 17  ? 19.378  46.006 6.836   1.00 45.11 ? 326 ASP B CA  1 
ATOM   1251 C  C   . ASP B 2 17  ? 20.690  46.393 7.473   1.00 44.66 ? 326 ASP B C   1 
ATOM   1252 O  O   . ASP B 2 17  ? 21.722  45.809 7.169   1.00 45.18 ? 326 ASP B O   1 
ATOM   1253 C  CB  . ASP B 2 17  ? 19.632  45.413 5.458   1.00 46.68 ? 326 ASP B CB  1 
ATOM   1254 C  CG  . ASP B 2 17  ? 18.413  44.732 4.896   1.00 48.61 ? 326 ASP B CG  1 
ATOM   1255 O  OD1 . ASP B 2 17  ? 18.186  44.836 3.672   1.00 51.62 ? 326 ASP B OD1 1 
ATOM   1256 O  OD2 . ASP B 2 17  ? 17.683  44.086 5.677   1.00 49.97 ? 326 ASP B OD2 1 
ATOM   1257 N  N   . PHE B 2 18  ? 20.657  47.380 8.355   1.00 44.00 ? 327 PHE B N   1 
ATOM   1258 C  CA  . PHE B 2 18  ? 21.865  47.805 9.053   1.00 43.85 ? 327 PHE B CA  1 
ATOM   1259 C  C   . PHE B 2 18  ? 21.733  47.452 10.525  1.00 43.72 ? 327 PHE B C   1 
ATOM   1260 O  O   . PHE B 2 18  ? 20.637  47.501 11.084  1.00 43.56 ? 327 PHE B O   1 
ATOM   1261 C  CB  . PHE B 2 18  ? 22.074  49.318 8.959   1.00 42.87 ? 327 PHE B CB  1 
ATOM   1262 C  CG  . PHE B 2 18  ? 22.826  49.762 7.753   1.00 40.71 ? 327 PHE B CG  1 
ATOM   1263 C  CD1 . PHE B 2 18  ? 22.165  50.044 6.569   1.00 41.70 ? 327 PHE B CD1 1 
ATOM   1264 C  CD2 . PHE B 2 18  ? 24.198  49.928 7.805   1.00 40.09 ? 327 PHE B CD2 1 
ATOM   1265 C  CE1 . PHE B 2 18  ? 22.867  50.491 5.455   1.00 39.40 ? 327 PHE B CE1 1 
ATOM   1266 C  CE2 . PHE B 2 18  ? 24.905  50.372 6.701   1.00 37.78 ? 327 PHE B CE2 1 
ATOM   1267 C  CZ  . PHE B 2 18  ? 24.240  50.654 5.528   1.00 37.61 ? 327 PHE B CZ  1 
ATOM   1268 N  N   . LEU B 2 19  ? 22.845  47.095 11.154  1.00 43.27 ? 328 LEU B N   1 
ATOM   1269 C  CA  . LEU B 2 19  ? 22.822  46.792 12.575  1.00 43.65 ? 328 LEU B CA  1 
ATOM   1270 C  C   . LEU B 2 19  ? 24.032  47.406 13.216  1.00 43.34 ? 328 LEU B C   1 
ATOM   1271 O  O   . LEU B 2 19  ? 25.158  47.108 12.833  1.00 43.96 ? 328 LEU B O   1 
ATOM   1272 C  CB  . LEU B 2 19  ? 22.839  45.292 12.842  1.00 45.79 ? 328 LEU B CB  1 
ATOM   1273 C  CG  . LEU B 2 19  ? 22.921  44.963 14.338  1.00 45.59 ? 328 LEU B CG  1 
ATOM   1274 C  CD1 . LEU B 2 19  ? 21.738  45.537 15.060  1.00 46.60 ? 328 LEU B CD1 1 
ATOM   1275 C  CD2 . LEU B 2 19  ? 22.929  43.482 14.524  1.00 49.08 ? 328 LEU B CD2 1 
ATOM   1276 N  N   . TYR B 2 20  ? 23.792  48.273 14.186  1.00 42.71 ? 329 TYR B N   1 
ATOM   1277 C  CA  . TYR B 2 20  ? 24.872  48.936 14.890  1.00 43.11 ? 329 TYR B CA  1 
ATOM   1278 C  C   . TYR B 2 20  ? 24.929  48.420 16.314  1.00 42.57 ? 329 TYR B C   1 
ATOM   1279 O  O   . TYR B 2 20  ? 24.034  48.673 17.110  1.00 43.27 ? 329 TYR B O   1 
ATOM   1280 C  CB  . TYR B 2 20  ? 24.654  50.450 14.911  1.00 44.18 ? 329 TYR B CB  1 
ATOM   1281 C  CG  . TYR B 2 20  ? 24.370  51.062 13.559  1.00 45.85 ? 329 TYR B CG  1 
ATOM   1282 C  CD1 . TYR B 2 20  ? 23.094  51.006 13.006  1.00 46.00 ? 329 TYR B CD1 1 
ATOM   1283 C  CD2 . TYR B 2 20  ? 25.380  51.684 12.825  1.00 46.08 ? 329 TYR B CD2 1 
ATOM   1284 C  CE1 . TYR B 2 20  ? 22.827  51.550 11.761  1.00 47.01 ? 329 TYR B CE1 1 
ATOM   1285 C  CE2 . TYR B 2 20  ? 25.125  52.236 11.573  1.00 46.33 ? 329 TYR B CE2 1 
ATOM   1286 C  CZ  . TYR B 2 20  ? 23.845  52.164 11.048  1.00 47.82 ? 329 TYR B CZ  1 
ATOM   1287 O  OH  . TYR B 2 20  ? 23.571  52.706 9.806   1.00 49.49 ? 329 TYR B OH  1 
ATOM   1288 N  N   . ALA B 2 21  ? 25.976  47.679 16.631  1.00 41.72 ? 330 ALA B N   1 
ATOM   1289 C  CA  . ALA B 2 21  ? 26.127  47.152 17.972  1.00 40.87 ? 330 ALA B CA  1 
ATOM   1290 C  C   . ALA B 2 21  ? 27.076  48.068 18.708  1.00 40.54 ? 330 ALA B C   1 
ATOM   1291 O  O   . ALA B 2 21  ? 28.282  47.950 18.575  1.00 41.94 ? 330 ALA B O   1 
ATOM   1292 C  CB  . ALA B 2 21  ? 26.679  45.745 17.925  1.00 39.69 ? 330 ALA B CB  1 
ATOM   1293 N  N   . TYR B 2 22  ? 26.519  49.000 19.467  1.00 40.21 ? 331 TYR B N   1 
ATOM   1294 C  CA  . TYR B 2 22  ? 27.312  49.946 20.237  1.00 39.77 ? 331 TYR B CA  1 
ATOM   1295 C  C   . TYR B 2 22  ? 27.725  49.372 21.598  1.00 40.00 ? 331 TYR B C   1 
ATOM   1296 O  O   . TYR B 2 22  ? 26.982  48.619 22.216  1.00 38.88 ? 331 TYR B O   1 
ATOM   1297 C  CB  . TYR B 2 22  ? 26.522  51.247 20.459  1.00 39.80 ? 331 TYR B CB  1 
ATOM   1298 C  CG  . TYR B 2 22  ? 26.325  52.128 19.238  1.00 38.31 ? 331 TYR B CG  1 
ATOM   1299 C  CD1 . TYR B 2 22  ? 25.140  52.092 18.516  1.00 38.91 ? 331 TYR B CD1 1 
ATOM   1300 C  CD2 . TYR B 2 22  ? 27.303  53.039 18.843  1.00 37.58 ? 331 TYR B CD2 1 
ATOM   1301 C  CE1 . TYR B 2 22  ? 24.927  52.946 17.441  1.00 37.65 ? 331 TYR B CE1 1 
ATOM   1302 C  CE2 . TYR B 2 22  ? 27.100  53.888 17.774  1.00 37.61 ? 331 TYR B CE2 1 
ATOM   1303 C  CZ  . TYR B 2 22  ? 25.909  53.841 17.081  1.00 37.48 ? 331 TYR B CZ  1 
ATOM   1304 O  OH  . TYR B 2 22  ? 25.685  54.724 16.058  1.00 36.61 ? 331 TYR B OH  1 
ATOM   1305 N  N   . SER B 2 23  ? 28.908  49.752 22.063  1.00 40.75 ? 332 SER B N   1 
ATOM   1306 C  CA  . SER B 2 23  ? 29.413  49.288 23.347  1.00 41.87 ? 332 SER B CA  1 
ATOM   1307 C  C   . SER B 2 23  ? 28.796  49.990 24.560  1.00 42.69 ? 332 SER B C   1 
ATOM   1308 O  O   . SER B 2 23  ? 28.765  49.422 25.644  1.00 44.24 ? 332 SER B O   1 
ATOM   1309 C  CB  . SER B 2 23  ? 30.927  49.459 23.403  1.00 41.09 ? 332 SER B CB  1 
ATOM   1310 O  OG  . SER B 2 23  ? 31.270  50.829 23.418  1.00 41.55 ? 332 SER B OG  1 
ATOM   1311 N  N   . THR B 2 24  ? 28.311  51.216 24.379  1.00 42.57 ? 333 THR B N   1 
ATOM   1312 C  CA  . THR B 2 24  ? 27.724  51.976 25.478  1.00 42.49 ? 333 THR B CA  1 
ATOM   1313 C  C   . THR B 2 24  ? 26.503  52.773 25.030  1.00 42.67 ? 333 THR B C   1 
ATOM   1314 O  O   . THR B 2 24  ? 26.352  53.076 23.854  1.00 43.97 ? 333 THR B O   1 
ATOM   1315 C  CB  . THR B 2 24  ? 28.752  52.964 26.072  1.00 42.15 ? 333 THR B CB  1 
ATOM   1316 O  OG1 . THR B 2 24  ? 28.217  53.564 27.257  1.00 43.00 ? 333 THR B OG1 1 
ATOM   1317 C  CG2 . THR B 2 24  ? 29.076  54.059 25.062  1.00 41.11 ? 333 THR B CG2 1 
ATOM   1318 N  N   . ALA B 2 25  ? 25.640  53.120 25.978  1.00 41.81 ? 334 ALA B N   1 
ATOM   1319 C  CA  . ALA B 2 25  ? 24.446  53.892 25.676  1.00 41.82 ? 334 ALA B CA  1 
ATOM   1320 C  C   . ALA B 2 25  ? 24.849  55.263 25.147  1.00 42.35 ? 334 ALA B C   1 
ATOM   1321 O  O   . ALA B 2 25  ? 25.943  55.747 25.427  1.00 42.20 ? 334 ALA B O   1 
ATOM   1322 C  CB  . ALA B 2 25  ? 23.603  54.049 26.924  1.00 40.60 ? 334 ALA B CB  1 
ATOM   1323 N  N   . PRO B 2 26  ? 23.965  55.911 24.373  1.00 42.38 ? 335 PRO B N   1 
ATOM   1324 C  CA  . PRO B 2 26  ? 24.272  57.232 23.826  1.00 42.31 ? 335 PRO B CA  1 
ATOM   1325 C  C   . PRO B 2 26  ? 24.700  58.191 24.938  1.00 42.30 ? 335 PRO B C   1 
ATOM   1326 O  O   . PRO B 2 26  ? 24.227  58.100 26.064  1.00 43.65 ? 335 PRO B O   1 
ATOM   1327 C  CB  . PRO B 2 26  ? 22.954  57.649 23.192  1.00 39.73 ? 335 PRO B CB  1 
ATOM   1328 C  CG  . PRO B 2 26  ? 22.344  56.384 22.819  1.00 40.23 ? 335 PRO B CG  1 
ATOM   1329 C  CD  . PRO B 2 26  ? 22.604  55.505 23.988  1.00 42.60 ? 335 PRO B CD  1 
ATOM   1330 N  N   . GLY B 2 27  ? 25.608  59.097 24.619  1.00 42.92 ? 336 GLY B N   1 
ATOM   1331 C  CA  . GLY B 2 27  ? 26.057  60.061 25.600  1.00 43.21 ? 336 GLY B CA  1 
ATOM   1332 C  C   . GLY B 2 27  ? 26.983  59.527 26.666  1.00 43.81 ? 336 GLY B C   1 
ATOM   1333 O  O   . GLY B 2 27  ? 27.599  60.308 27.387  1.00 43.80 ? 336 GLY B O   1 
ATOM   1334 N  N   . TYR B 2 28  ? 27.103  58.209 26.774  1.00 44.37 ? 337 TYR B N   1 
ATOM   1335 C  CA  . TYR B 2 28  ? 27.965  57.634 27.800  1.00 45.00 ? 337 TYR B CA  1 
ATOM   1336 C  C   . TYR B 2 28  ? 29.383  57.279 27.389  1.00 44.73 ? 337 TYR B C   1 
ATOM   1337 O  O   . TYR B 2 28  ? 29.696  57.143 26.217  1.00 46.78 ? 337 TYR B O   1 
ATOM   1338 C  CB  . TYR B 2 28  ? 27.312  56.400 28.413  1.00 44.66 ? 337 TYR B CB  1 
ATOM   1339 C  CG  . TYR B 2 28  ? 26.236  56.734 29.401  1.00 45.08 ? 337 TYR B CG  1 
ATOM   1340 C  CD1 . TYR B 2 28  ? 24.947  57.053 28.979  1.00 44.45 ? 337 TYR B CD1 1 
ATOM   1341 C  CD2 . TYR B 2 28  ? 26.511  56.759 30.761  1.00 44.67 ? 337 TYR B CD2 1 
ATOM   1342 C  CE1 . TYR B 2 28  ? 23.956  57.389 29.891  1.00 43.61 ? 337 TYR B CE1 1 
ATOM   1343 C  CE2 . TYR B 2 28  ? 25.536  57.094 31.678  1.00 45.24 ? 337 TYR B CE2 1 
ATOM   1344 C  CZ  . TYR B 2 28  ? 24.259  57.411 31.242  1.00 44.85 ? 337 TYR B CZ  1 
ATOM   1345 O  OH  . TYR B 2 28  ? 23.302  57.784 32.164  1.00 46.00 ? 337 TYR B OH  1 
ATOM   1346 N  N   . TYR B 2 29  ? 30.238  57.137 28.386  1.00 43.50 ? 338 TYR B N   1 
ATOM   1347 C  CA  . TYR B 2 29  ? 31.629  56.780 28.187  1.00 42.06 ? 338 TYR B CA  1 
ATOM   1348 C  C   . TYR B 2 29  ? 31.661  55.258 27.955  1.00 42.08 ? 338 TYR B C   1 
ATOM   1349 O  O   . TYR B 2 29  ? 30.671  54.570 28.192  1.00 41.12 ? 338 TYR B O   1 
ATOM   1350 C  CB  . TYR B 2 29  ? 32.402  57.156 29.449  1.00 40.28 ? 338 TYR B CB  1 
ATOM   1351 C  CG  . TYR B 2 29  ? 33.891  57.000 29.368  1.00 39.39 ? 338 TYR B CG  1 
ATOM   1352 C  CD1 . TYR B 2 29  ? 34.652  57.842 28.571  1.00 40.36 ? 338 TYR B CD1 1 
ATOM   1353 C  CD2 . TYR B 2 29  ? 34.545  56.029 30.112  1.00 39.43 ? 338 TYR B CD2 1 
ATOM   1354 C  CE1 . TYR B 2 29  ? 36.030  57.727 28.518  1.00 40.39 ? 338 TYR B CE1 1 
ATOM   1355 C  CE2 . TYR B 2 29  ? 35.920  55.903 30.068  1.00 39.38 ? 338 TYR B CE2 1 
ATOM   1356 C  CZ  . TYR B 2 29  ? 36.660  56.757 29.269  1.00 40.52 ? 338 TYR B CZ  1 
ATOM   1357 O  OH  . TYR B 2 29  ? 38.030  56.647 29.230  1.00 40.42 ? 338 TYR B OH  1 
ATOM   1358 N  N   . SER B 2 30  ? 32.785  54.737 27.479  1.00 41.04 ? 339 SER B N   1 
ATOM   1359 C  CA  . SER B 2 30  ? 32.920  53.304 27.238  1.00 42.04 ? 339 SER B CA  1 
ATOM   1360 C  C   . SER B 2 30  ? 34.231  52.864 27.875  1.00 43.14 ? 339 SER B C   1 
ATOM   1361 O  O   . SER B 2 30  ? 35.287  53.399 27.549  1.00 45.43 ? 339 SER B O   1 
ATOM   1362 C  CB  . SER B 2 30  ? 32.938  53.013 25.738  1.00 42.64 ? 339 SER B CB  1 
ATOM   1363 O  OG  . SER B 2 30  ? 32.911  51.624 25.494  1.00 41.96 ? 339 SER B OG  1 
ATOM   1364 N  N   . TRP B 2 31  ? 34.164  51.876 28.758  1.00 42.64 ? 340 TRP B N   1 
ATOM   1365 C  CA  . TRP B 2 31  ? 35.337  51.420 29.492  1.00 43.12 ? 340 TRP B CA  1 
ATOM   1366 C  C   . TRP B 2 31  ? 36.298  50.440 28.846  1.00 44.87 ? 340 TRP B C   1 
ATOM   1367 O  O   . TRP B 2 31  ? 35.902  49.593 28.065  1.00 46.94 ? 340 TRP B O   1 
ATOM   1368 C  CB  . TRP B 2 31  ? 34.900  50.836 30.837  1.00 41.49 ? 340 TRP B CB  1 
ATOM   1369 C  CG  . TRP B 2 31  ? 34.315  51.827 31.785  1.00 37.78 ? 340 TRP B CG  1 
ATOM   1370 C  CD1 . TRP B 2 31  ? 33.017  52.237 31.850  1.00 36.50 ? 340 TRP B CD1 1 
ATOM   1371 C  CD2 . TRP B 2 31  ? 35.016  52.546 32.803  1.00 35.87 ? 340 TRP B CD2 1 
ATOM   1372 N  NE1 . TRP B 2 31  ? 32.862  53.168 32.852  1.00 35.27 ? 340 TRP B NE1 1 
ATOM   1373 C  CE2 . TRP B 2 31  ? 34.075  53.377 33.451  1.00 34.64 ? 340 TRP B CE2 1 
ATOM   1374 C  CE3 . TRP B 2 31  ? 36.352  52.569 33.231  1.00 34.79 ? 340 TRP B CE3 1 
ATOM   1375 C  CZ2 . TRP B 2 31  ? 34.426  54.222 34.499  1.00 33.42 ? 340 TRP B CZ2 1 
ATOM   1376 C  CZ3 . TRP B 2 31  ? 36.702  53.408 34.272  1.00 33.82 ? 340 TRP B CZ3 1 
ATOM   1377 C  CH2 . TRP B 2 31  ? 35.743  54.224 34.895  1.00 35.47 ? 340 TRP B CH2 1 
ATOM   1378 N  N   . ARG B 2 32  ? 37.573  50.560 29.205  1.00 47.40 ? 341 ARG B N   1 
ATOM   1379 C  CA  . ARG B 2 32  ? 38.629  49.674 28.712  1.00 49.50 ? 341 ARG B CA  1 
ATOM   1380 C  C   . ARG B 2 32  ? 39.413  49.163 29.925  1.00 50.25 ? 341 ARG B C   1 
ATOM   1381 O  O   . ARG B 2 32  ? 39.566  49.872 30.907  1.00 50.55 ? 341 ARG B O   1 
ATOM   1382 C  CB  . ARG B 2 32  ? 39.577  50.429 27.768  1.00 48.92 ? 341 ARG B CB  1 
ATOM   1383 C  CG  . ARG B 2 32  ? 38.952  50.798 26.444  1.00 50.22 ? 341 ARG B CG  1 
ATOM   1384 C  CD  . ARG B 2 32  ? 39.932  51.434 25.477  1.00 50.62 ? 341 ARG B CD  1 
ATOM   1385 N  NE  . ARG B 2 32  ? 40.301  52.788 25.870  1.00 51.95 ? 341 ARG B NE  1 
ATOM   1386 C  CZ  . ARG B 2 32  ? 41.424  53.102 26.511  1.00 52.86 ? 341 ARG B CZ  1 
ATOM   1387 N  NH1 . ARG B 2 32  ? 42.292  52.153 26.830  1.00 53.92 ? 341 ARG B NH1 1 
ATOM   1388 N  NH2 . ARG B 2 32  ? 41.685  54.366 26.825  1.00 51.96 ? 341 ARG B NH2 1 
ATOM   1389 N  N   . ASN B 2 33  ? 39.896  47.931 29.882  1.00 51.81 ? 342 ASN B N   1 
ATOM   1390 C  CA  . ASN B 2 33  ? 40.669  47.436 31.013  1.00 53.56 ? 342 ASN B CA  1 
ATOM   1391 C  C   . ASN B 2 33  ? 42.083  47.937 30.851  1.00 55.83 ? 342 ASN B C   1 
ATOM   1392 O  O   . ASN B 2 33  ? 42.605  47.949 29.732  1.00 57.64 ? 342 ASN B O   1 
ATOM   1393 C  CB  . ASN B 2 33  ? 40.697  45.906 31.061  1.00 53.06 ? 342 ASN B CB  1 
ATOM   1394 C  CG  . ASN B 2 33  ? 39.359  45.307 31.452  1.00 53.41 ? 342 ASN B CG  1 
ATOM   1395 O  OD1 . ASN B 2 33  ? 38.797  45.625 32.511  1.00 51.28 ? 342 ASN B OD1 1 
ATOM   1396 N  ND2 . ASN B 2 33  ? 38.838  44.425 30.594  1.00 53.45 ? 342 ASN B ND2 1 
ATOM   1397 N  N   . SER B 2 34  ? 42.696  48.350 31.960  1.00 56.48 ? 343 SER B N   1 
ATOM   1398 C  CA  . SER B 2 34  ? 44.069  48.839 31.962  1.00 57.68 ? 343 SER B CA  1 
ATOM   1399 C  C   . SER B 2 34  ? 44.882  48.279 30.777  1.00 58.06 ? 343 SER B C   1 
ATOM   1400 O  O   . SER B 2 34  ? 45.535  49.035 30.053  1.00 57.88 ? 343 SER B O   1 
ATOM   1401 C  CB  . SER B 2 34  ? 44.727  48.470 33.286  1.00 58.47 ? 343 SER B CB  1 
ATOM   1402 O  OG  . SER B 2 34  ? 46.081  48.885 33.333  1.00 62.09 ? 343 SER B OG  1 
ATOM   1403 N  N   . LYS B 2 35  ? 44.839  46.965 30.570  1.00 58.94 ? 344 LYS B N   1 
ATOM   1404 C  CA  . LYS B 2 35  ? 45.553  46.375 29.441  1.00 60.05 ? 344 LYS B CA  1 
ATOM   1405 C  C   . LYS B 2 35  ? 44.944  45.070 28.908  1.00 60.40 ? 344 LYS B C   1 
ATOM   1406 O  O   . LYS B 2 35  ? 45.495  44.459 27.998  1.00 61.00 ? 344 LYS B O   1 
ATOM   1407 C  CB  . LYS B 2 35  ? 47.021  46.144 29.812  0.00 60.04 ? 344 LYS B CB  1 
ATOM   1408 C  CG  . LYS B 2 35  ? 47.912  45.855 28.613  0.00 60.13 ? 344 LYS B CG  1 
ATOM   1409 C  CD  . LYS B 2 35  ? 49.379  45.781 28.998  0.00 60.23 ? 344 LYS B CD  1 
ATOM   1410 C  CE  . LYS B 2 35  ? 50.251  45.570 27.770  0.00 60.38 ? 344 LYS B CE  1 
ATOM   1411 N  NZ  . LYS B 2 35  ? 51.699  45.526 28.110  0.00 60.47 ? 344 LYS B NZ  1 
ATOM   1412 N  N   . ASP B 2 36  ? 43.795  44.665 29.443  1.00 60.64 ? 345 ASP B N   1 
ATOM   1413 C  CA  . ASP B 2 36  ? 43.141  43.416 29.036  1.00 59.86 ? 345 ASP B CA  1 
ATOM   1414 C  C   . ASP B 2 36  ? 41.949  43.595 28.077  1.00 58.15 ? 345 ASP B C   1 
ATOM   1415 O  O   . ASP B 2 36  ? 40.961  42.869 28.164  1.00 57.92 ? 345 ASP B O   1 
ATOM   1416 C  CB  . ASP B 2 36  ? 42.683  42.663 30.292  1.00 62.55 ? 345 ASP B CB  1 
ATOM   1417 C  CG  . ASP B 2 36  ? 42.084  41.304 29.983  1.00 65.15 ? 345 ASP B CG  1 
ATOM   1418 O  OD1 . ASP B 2 36  ? 41.334  40.781 30.847  1.00 65.59 ? 345 ASP B OD1 1 
ATOM   1419 O  OD2 . ASP B 2 36  ? 42.372  40.760 28.883  1.00 68.03 ? 345 ASP B OD2 1 
ATOM   1420 N  N   . GLY B 2 37  ? 42.036  44.555 27.162  1.00 55.99 ? 346 GLY B N   1 
ATOM   1421 C  CA  . GLY B 2 37  ? 40.943  44.753 26.219  1.00 51.71 ? 346 GLY B CA  1 
ATOM   1422 C  C   . GLY B 2 37  ? 39.801  45.575 26.777  1.00 48.99 ? 346 GLY B C   1 
ATOM   1423 O  O   . GLY B 2 37  ? 39.936  46.230 27.811  1.00 48.05 ? 346 GLY B O   1 
ATOM   1424 N  N   . SER B 2 38  ? 38.664  45.551 26.096  1.00 45.37 ? 347 SER B N   1 
ATOM   1425 C  CA  . SER B 2 38  ? 37.518  46.325 26.561  1.00 42.33 ? 347 SER B CA  1 
ATOM   1426 C  C   . SER B 2 38  ? 36.396  45.431 27.035  1.00 41.12 ? 347 SER B C   1 
ATOM   1427 O  O   . SER B 2 38  ? 36.249  44.305 26.563  1.00 40.60 ? 347 SER B O   1 
ATOM   1428 C  CB  . SER B 2 38  ? 37.004  47.223 25.449  1.00 40.63 ? 347 SER B CB  1 
ATOM   1429 O  OG  . SER B 2 38  ? 36.619  46.456 24.331  1.00 39.97 ? 347 SER B OG  1 
ATOM   1430 N  N   . TRP B 2 39  ? 35.608  45.937 27.978  1.00 39.80 ? 348 TRP B N   1 
ATOM   1431 C  CA  . TRP B 2 39  ? 34.476  45.194 28.528  1.00 39.66 ? 348 TRP B CA  1 
ATOM   1432 C  C   . TRP B 2 39  ? 33.572  44.582 27.444  1.00 40.58 ? 348 TRP B C   1 
ATOM   1433 O  O   . TRP B 2 39  ? 33.289  43.383 27.462  1.00 41.37 ? 348 TRP B O   1 
ATOM   1434 C  CB  . TRP B 2 39  ? 33.617  46.113 29.390  1.00 38.14 ? 348 TRP B CB  1 
ATOM   1435 C  CG  . TRP B 2 39  ? 34.242  46.606 30.654  1.00 37.54 ? 348 TRP B CG  1 
ATOM   1436 C  CD1 . TRP B 2 39  ? 35.532  46.437 31.064  1.00 37.11 ? 348 TRP B CD1 1 
ATOM   1437 C  CD2 . TRP B 2 39  ? 33.584  47.341 31.692  1.00 36.12 ? 348 TRP B CD2 1 
ATOM   1438 N  NE1 . TRP B 2 39  ? 35.715  47.019 32.295  1.00 35.58 ? 348 TRP B NE1 1 
ATOM   1439 C  CE2 . TRP B 2 39  ? 34.533  47.580 32.702  1.00 35.80 ? 348 TRP B CE2 1 
ATOM   1440 C  CE3 . TRP B 2 39  ? 32.280  47.819 31.865  1.00 36.30 ? 348 TRP B CE3 1 
ATOM   1441 C  CZ2 . TRP B 2 39  ? 34.218  48.279 33.873  1.00 35.77 ? 348 TRP B CZ2 1 
ATOM   1442 C  CZ3 . TRP B 2 39  ? 31.971  48.514 33.032  1.00 35.53 ? 348 TRP B CZ3 1 
ATOM   1443 C  CH2 . TRP B 2 39  ? 32.934  48.735 34.016  1.00 34.48 ? 348 TRP B CH2 1 
ATOM   1444 N  N   . PHE B 2 40  ? 33.117  45.428 26.521  1.00 39.41 ? 349 PHE B N   1 
ATOM   1445 C  CA  . PHE B 2 40  ? 32.238  45.050 25.426  1.00 38.29 ? 349 PHE B CA  1 
ATOM   1446 C  C   . PHE B 2 40  ? 32.815  44.002 24.485  1.00 40.26 ? 349 PHE B C   1 
ATOM   1447 O  O   . PHE B 2 40  ? 32.259  42.920 24.327  1.00 41.73 ? 349 PHE B O   1 
ATOM   1448 C  CB  . PHE B 2 40  ? 31.895  46.292 24.624  1.00 36.53 ? 349 PHE B CB  1 
ATOM   1449 C  CG  . PHE B 2 40  ? 30.930  46.053 23.518  1.00 33.17 ? 349 PHE B CG  1 
ATOM   1450 C  CD1 . PHE B 2 40  ? 29.641  45.636 23.791  1.00 32.34 ? 349 PHE B CD1 1 
ATOM   1451 C  CD2 . PHE B 2 40  ? 31.295  46.293 22.202  1.00 33.36 ? 349 PHE B CD2 1 
ATOM   1452 C  CE1 . PHE B 2 40  ? 28.717  45.464 22.769  1.00 34.09 ? 349 PHE B CE1 1 
ATOM   1453 C  CE2 . PHE B 2 40  ? 30.380  46.126 21.164  1.00 34.22 ? 349 PHE B CE2 1 
ATOM   1454 C  CZ  . PHE B 2 40  ? 29.084  45.710 21.448  1.00 35.51 ? 349 PHE B CZ  1 
ATOM   1455 N  N   . ILE B 2 41  ? 33.923  44.322 23.837  1.00 40.88 ? 350 ILE B N   1 
ATOM   1456 C  CA  . ILE B 2 41  ? 34.528  43.385 22.913  1.00 41.25 ? 350 ILE B CA  1 
ATOM   1457 C  C   . ILE B 2 41  ? 34.777  42.054 23.602  1.00 41.68 ? 350 ILE B C   1 
ATOM   1458 O  O   . ILE B 2 41  ? 34.519  40.997 23.042  1.00 42.46 ? 350 ILE B O   1 
ATOM   1459 C  CB  . ILE B 2 41  ? 35.837  43.939 22.364  1.00 41.45 ? 350 ILE B CB  1 
ATOM   1460 C  CG1 . ILE B 2 41  ? 35.556  45.211 21.553  1.00 41.75 ? 350 ILE B CG1 1 
ATOM   1461 C  CG2 . ILE B 2 41  ? 36.516  42.899 21.512  1.00 41.13 ? 350 ILE B CG2 1 
ATOM   1462 C  CD1 . ILE B 2 41  ? 34.554  45.021 20.427  1.00 40.45 ? 350 ILE B CD1 1 
ATOM   1463 N  N   . GLN B 2 42  ? 35.268  42.112 24.830  1.00 42.42 ? 351 GLN B N   1 
ATOM   1464 C  CA  . GLN B 2 42  ? 35.538  40.909 25.606  1.00 43.11 ? 351 GLN B CA  1 
ATOM   1465 C  C   . GLN B 2 42  ? 34.281  40.049 25.714  1.00 42.40 ? 351 GLN B C   1 
ATOM   1466 O  O   . GLN B 2 42  ? 34.326  38.849 25.490  1.00 43.15 ? 351 GLN B O   1 
ATOM   1467 C  CB  . GLN B 2 42  ? 36.042  41.302 26.995  1.00 44.98 ? 351 GLN B CB  1 
ATOM   1468 C  CG  . GLN B 2 42  ? 36.353  40.150 27.928  1.00 48.84 ? 351 GLN B CG  1 
ATOM   1469 C  CD  . GLN B 2 42  ? 37.109  40.624 29.163  1.00 51.93 ? 351 GLN B CD  1 
ATOM   1470 O  OE1 . GLN B 2 42  ? 38.212  41.173 29.050  1.00 52.10 ? 351 GLN B OE1 1 
ATOM   1471 N  NE2 . GLN B 2 42  ? 36.518  40.425 30.347  1.00 53.22 ? 351 GLN B NE2 1 
ATOM   1472 N  N   . SER B 2 43  ? 33.158  40.667 26.039  1.00 41.45 ? 352 SER B N   1 
ATOM   1473 C  CA  . SER B 2 43  ? 31.910  39.940 26.165  1.00 42.20 ? 352 SER B CA  1 
ATOM   1474 C  C   . SER B 2 43  ? 31.366  39.507 24.814  1.00 43.43 ? 352 SER B C   1 
ATOM   1475 O  O   . SER B 2 43  ? 30.810  38.412 24.681  1.00 44.59 ? 352 SER B O   1 
ATOM   1476 C  CB  . SER B 2 43  ? 30.873  40.801 26.872  1.00 42.18 ? 352 SER B CB  1 
ATOM   1477 O  OG  . SER B 2 43  ? 31.333  41.176 28.150  1.00 45.25 ? 352 SER B OG  1 
ATOM   1478 N  N   . LEU B 2 44  ? 31.511  40.371 23.815  1.00 42.92 ? 353 LEU B N   1 
ATOM   1479 C  CA  . LEU B 2 44  ? 31.036  40.068 22.470  1.00 42.82 ? 353 LEU B CA  1 
ATOM   1480 C  C   . LEU B 2 44  ? 31.623  38.746 22.008  1.00 44.49 ? 353 LEU B C   1 
ATOM   1481 O  O   . LEU B 2 44  ? 30.895  37.801 21.707  1.00 45.43 ? 353 LEU B O   1 
ATOM   1482 C  CB  . LEU B 2 44  ? 31.444  41.179 21.496  1.00 40.77 ? 353 LEU B CB  1 
ATOM   1483 C  CG  . LEU B 2 44  ? 31.020  41.060 20.033  1.00 37.63 ? 353 LEU B CG  1 
ATOM   1484 C  CD1 . LEU B 2 44  ? 29.534  40.862 19.924  1.00 34.18 ? 353 LEU B CD1 1 
ATOM   1485 C  CD2 . LEU B 2 44  ? 31.443  42.301 19.299  1.00 35.36 ? 353 LEU B CD2 1 
ATOM   1486 N  N   . CYS B 2 45  ? 32.945  38.676 21.960  1.00 45.00 ? 354 CYS B N   1 
ATOM   1487 C  CA  . CYS B 2 45  ? 33.600  37.454 21.535  1.00 46.60 ? 354 CYS B CA  1 
ATOM   1488 C  C   . CYS B 2 45  ? 33.126  36.267 22.380  1.00 47.27 ? 354 CYS B C   1 
ATOM   1489 O  O   . CYS B 2 45  ? 32.728  35.229 21.846  1.00 48.31 ? 354 CYS B O   1 
ATOM   1490 C  CB  . CYS B 2 45  ? 35.122  37.607 21.632  1.00 45.77 ? 354 CYS B CB  1 
ATOM   1491 S  SG  . CYS B 2 45  ? 35.817  38.805 20.487  1.00 44.65 ? 354 CYS B SG  1 
ATOM   1492 N  N   . ALA B 2 46  ? 33.156  36.422 23.698  1.00 47.06 ? 355 ALA B N   1 
ATOM   1493 C  CA  . ALA B 2 46  ? 32.734  35.348 24.586  1.00 46.22 ? 355 ALA B CA  1 
ATOM   1494 C  C   . ALA B 2 46  ? 31.386  34.812 24.155  1.00 46.95 ? 355 ALA B C   1 
ATOM   1495 O  O   . ALA B 2 46  ? 31.246  33.624 23.891  1.00 47.06 ? 355 ALA B O   1 
ATOM   1496 C  CB  . ALA B 2 46  ? 32.663  35.842 26.016  1.00 44.88 ? 355 ALA B CB  1 
ATOM   1497 N  N   . MET B 2 47  ? 30.393  35.687 24.067  1.00 47.19 ? 356 MET B N   1 
ATOM   1498 C  CA  . MET B 2 47  ? 29.074  35.236 23.671  1.00 48.12 ? 356 MET B CA  1 
ATOM   1499 C  C   . MET B 2 47  ? 29.031  34.686 22.240  1.00 48.50 ? 356 MET B C   1 
ATOM   1500 O  O   . MET B 2 47  ? 28.311  33.721 21.956  1.00 47.70 ? 356 MET B O   1 
ATOM   1501 C  CB  . MET B 2 47  ? 28.056  36.361 23.855  1.00 49.33 ? 356 MET B CB  1 
ATOM   1502 C  CG  . MET B 2 47  ? 27.954  36.859 25.293  1.00 51.00 ? 356 MET B CG  1 
ATOM   1503 S  SD  . MET B 2 47  ? 28.005  35.526 26.554  1.00 54.94 ? 356 MET B SD  1 
ATOM   1504 C  CE  . MET B 2 47  ? 26.316  35.344 26.971  1.00 52.09 ? 356 MET B CE  1 
ATOM   1505 N  N   . LEU B 2 48  ? 29.791  35.287 21.332  1.00 48.27 ? 357 LEU B N   1 
ATOM   1506 C  CA  . LEU B 2 48  ? 29.800  34.793 19.961  1.00 48.83 ? 357 LEU B CA  1 
ATOM   1507 C  C   . LEU B 2 48  ? 30.373  33.387 19.943  1.00 50.22 ? 357 LEU B C   1 
ATOM   1508 O  O   . LEU B 2 48  ? 29.880  32.521 19.228  1.00 49.82 ? 357 LEU B O   1 
ATOM   1509 C  CB  . LEU B 2 48  ? 30.621  35.706 19.050  1.00 47.59 ? 357 LEU B CB  1 
ATOM   1510 C  CG  . LEU B 2 48  ? 29.897  36.937 18.505  1.00 45.38 ? 357 LEU B CG  1 
ATOM   1511 C  CD1 . LEU B 2 48  ? 30.820  37.749 17.628  1.00 44.39 ? 357 LEU B CD1 1 
ATOM   1512 C  CD2 . LEU B 2 48  ? 28.694  36.481 17.717  1.00 45.00 ? 357 LEU B CD2 1 
ATOM   1513 N  N   . LYS B 2 49  ? 31.403  33.159 20.752  1.00 52.46 ? 358 LYS B N   1 
ATOM   1514 C  CA  . LYS B 2 49  ? 32.047  31.849 20.830  1.00 53.61 ? 358 LYS B CA  1 
ATOM   1515 C  C   . LYS B 2 49  ? 31.083  30.778 21.345  1.00 53.20 ? 358 LYS B C   1 
ATOM   1516 O  O   . LYS B 2 49  ? 30.984  29.710 20.764  1.00 52.59 ? 358 LYS B O   1 
ATOM   1517 C  CB  . LYS B 2 49  ? 33.279  31.916 21.734  1.00 55.23 ? 358 LYS B CB  1 
ATOM   1518 C  CG  . LYS B 2 49  ? 34.137  30.667 21.683  1.00 60.18 ? 358 LYS B CG  1 
ATOM   1519 C  CD  . LYS B 2 49  ? 34.479  30.125 23.083  1.00 64.04 ? 358 LYS B CD  1 
ATOM   1520 C  CE  . LYS B 2 49  ? 35.262  31.149 23.926  1.00 67.11 ? 358 LYS B CE  1 
ATOM   1521 N  NZ  . LYS B 2 49  ? 35.736  30.591 25.247  1.00 69.04 ? 358 LYS B NZ  1 
ATOM   1522 N  N   . GLN B 2 50  ? 30.366  31.069 22.426  1.00 53.71 ? 359 GLN B N   1 
ATOM   1523 C  CA  . GLN B 2 50  ? 29.412  30.114 22.988  1.00 54.41 ? 359 GLN B CA  1 
ATOM   1524 C  C   . GLN B 2 50  ? 28.134  29.913 22.180  1.00 54.84 ? 359 GLN B C   1 
ATOM   1525 O  O   . GLN B 2 50  ? 27.698  28.773 21.988  1.00 56.30 ? 359 GLN B O   1 
ATOM   1526 C  CB  . GLN B 2 50  ? 28.960  30.523 24.389  1.00 54.47 ? 359 GLN B CB  1 
ATOM   1527 C  CG  . GLN B 2 50  ? 30.048  30.730 25.399  1.00 58.70 ? 359 GLN B CG  1 
ATOM   1528 C  CD  . GLN B 2 50  ? 29.488  30.979 26.796  1.00 60.76 ? 359 GLN B CD  1 
ATOM   1529 O  OE1 . GLN B 2 50  ? 30.225  31.359 27.723  1.00 61.39 ? 359 GLN B OE1 1 
ATOM   1530 N  NE2 . GLN B 2 50  ? 28.175  30.759 26.959  1.00 60.76 ? 359 GLN B NE2 1 
ATOM   1531 N  N   . TYR B 2 51  ? 27.527  31.002 21.703  1.00 54.17 ? 360 TYR B N   1 
ATOM   1532 C  CA  . TYR B 2 51  ? 26.249  30.876 21.003  1.00 52.96 ? 360 TYR B CA  1 
ATOM   1533 C  C   . TYR B 2 51  ? 26.123  31.074 19.491  1.00 52.23 ? 360 TYR B C   1 
ATOM   1534 O  O   . TYR B 2 51  ? 25.054  30.832 18.933  1.00 50.30 ? 360 TYR B O   1 
ATOM   1535 C  CB  . TYR B 2 51  ? 25.220  31.767 21.694  1.00 53.10 ? 360 TYR B CB  1 
ATOM   1536 C  CG  . TYR B 2 51  ? 25.196  31.640 23.200  1.00 53.81 ? 360 TYR B CG  1 
ATOM   1537 C  CD1 . TYR B 2 51  ? 25.964  32.482 24.004  1.00 53.54 ? 360 TYR B CD1 1 
ATOM   1538 C  CD2 . TYR B 2 51  ? 24.376  30.708 23.821  1.00 55.16 ? 360 TYR B CD2 1 
ATOM   1539 C  CE1 . TYR B 2 51  ? 25.906  32.406 25.387  1.00 54.96 ? 360 TYR B CE1 1 
ATOM   1540 C  CE2 . TYR B 2 51  ? 24.308  30.616 25.209  1.00 56.35 ? 360 TYR B CE2 1 
ATOM   1541 C  CZ  . TYR B 2 51  ? 25.072  31.470 25.989  1.00 57.05 ? 360 TYR B CZ  1 
ATOM   1542 O  OH  . TYR B 2 51  ? 24.986  31.392 27.365  1.00 56.47 ? 360 TYR B OH  1 
ATOM   1543 N  N   . ALA B 2 52  ? 27.188  31.498 18.823  1.00 52.96 ? 361 ALA B N   1 
ATOM   1544 C  CA  . ALA B 2 52  ? 27.122  31.712 17.380  1.00 54.53 ? 361 ALA B CA  1 
ATOM   1545 C  C   . ALA B 2 52  ? 26.379  30.588 16.658  1.00 56.64 ? 361 ALA B C   1 
ATOM   1546 O  O   . ALA B 2 52  ? 25.621  30.832 15.714  1.00 57.53 ? 361 ALA B O   1 
ATOM   1547 C  CB  . ALA B 2 52  ? 28.519  31.851 16.804  1.00 52.27 ? 361 ALA B CB  1 
ATOM   1548 N  N   . ASP B 2 53  ? 26.579  29.360 17.121  1.00 58.63 ? 362 ASP B N   1 
ATOM   1549 C  CA  . ASP B 2 53  ? 25.964  28.180 16.505  1.00 60.18 ? 362 ASP B CA  1 
ATOM   1550 C  C   . ASP B 2 53  ? 24.613  27.750 17.061  1.00 59.84 ? 362 ASP B C   1 
ATOM   1551 O  O   . ASP B 2 53  ? 24.126  26.673 16.724  1.00 59.06 ? 362 ASP B O   1 
ATOM   1552 C  CB  . ASP B 2 53  ? 26.920  26.988 16.614  1.00 62.06 ? 362 ASP B CB  1 
ATOM   1553 C  CG  . ASP B 2 53  ? 27.285  26.670 18.060  1.00 65.08 ? 362 ASP B CG  1 
ATOM   1554 O  OD1 . ASP B 2 53  ? 26.350  26.419 18.877  1.00 64.83 ? 362 ASP B OD1 1 
ATOM   1555 O  OD2 . ASP B 2 53  ? 28.508  26.685 18.372  1.00 67.13 ? 362 ASP B OD2 1 
ATOM   1556 N  N   . LYS B 2 54  ? 23.989  28.567 17.897  1.00 59.94 ? 363 LYS B N   1 
ATOM   1557 C  CA  . LYS B 2 54  ? 22.708  28.145 18.445  1.00 60.43 ? 363 LYS B CA  1 
ATOM   1558 C  C   . LYS B 2 54  ? 21.774  29.251 18.883  1.00 59.54 ? 363 LYS B C   1 
ATOM   1559 O  O   . LYS B 2 54  ? 20.798  28.990 19.583  1.00 60.29 ? 363 LYS B O   1 
ATOM   1560 C  CB  . LYS B 2 54  ? 22.937  27.177 19.617  1.00 62.76 ? 363 LYS B CB  1 
ATOM   1561 C  CG  . LYS B 2 54  ? 23.902  27.685 20.707  1.00 65.14 ? 363 LYS B CG  1 
ATOM   1562 C  CD  . LYS B 2 54  ? 24.126  26.628 21.795  1.00 67.64 ? 363 LYS B CD  1 
ATOM   1563 C  CE  . LYS B 2 54  ? 22.812  26.281 22.515  1.00 69.73 ? 363 LYS B CE  1 
ATOM   1564 N  NZ  . LYS B 2 54  ? 22.954  25.126 23.458  1.00 70.91 ? 363 LYS B NZ  1 
ATOM   1565 N  N   . LEU B 2 55  ? 22.067  30.482 18.482  1.00 57.84 ? 364 LEU B N   1 
ATOM   1566 C  CA  . LEU B 2 55  ? 21.222  31.616 18.841  1.00 55.40 ? 364 LEU B CA  1 
ATOM   1567 C  C   . LEU B 2 55  ? 21.179  32.662 17.749  1.00 54.54 ? 364 LEU B C   1 
ATOM   1568 O  O   . LEU B 2 55  ? 22.118  32.805 16.972  1.00 54.65 ? 364 LEU B O   1 
ATOM   1569 C  CB  . LEU B 2 55  ? 21.711  32.273 20.128  1.00 54.56 ? 364 LEU B CB  1 
ATOM   1570 C  CG  . LEU B 2 55  ? 21.383  31.556 21.434  1.00 55.11 ? 364 LEU B CG  1 
ATOM   1571 C  CD1 . LEU B 2 55  ? 21.778  32.436 22.601  1.00 54.94 ? 364 LEU B CD1 1 
ATOM   1572 C  CD2 . LEU B 2 55  ? 19.897  31.263 21.496  1.00 56.12 ? 364 LEU B CD2 1 
ATOM   1573 N  N   . GLU B 2 56  ? 20.068  33.384 17.693  1.00 54.12 ? 365 GLU B N   1 
ATOM   1574 C  CA  . GLU B 2 56  ? 19.884  34.448 16.715  1.00 52.56 ? 365 GLU B CA  1 
ATOM   1575 C  C   . GLU B 2 56  ? 20.767  35.604 17.209  1.00 51.15 ? 365 GLU B C   1 
ATOM   1576 O  O   . GLU B 2 56  ? 20.990  35.752 18.414  1.00 50.62 ? 365 GLU B O   1 
ATOM   1577 C  CB  . GLU B 2 56  ? 18.399  34.831 16.670  1.00 53.08 ? 365 GLU B CB  1 
ATOM   1578 C  CG  . GLU B 2 56  ? 17.971  35.607 15.443  1.00 53.10 ? 365 GLU B CG  1 
ATOM   1579 C  CD  . GLU B 2 56  ? 18.232  37.087 15.585  1.00 53.47 ? 365 GLU B CD  1 
ATOM   1580 O  OE1 . GLU B 2 56  ? 18.921  37.651 14.711  1.00 53.80 ? 365 GLU B OE1 1 
ATOM   1581 O  OE2 . GLU B 2 56  ? 17.742  37.684 16.571  1.00 52.52 ? 365 GLU B OE2 1 
ATOM   1582 N  N   . PHE B 2 57  ? 21.277  36.410 16.289  1.00 49.59 ? 366 PHE B N   1 
ATOM   1583 C  CA  . PHE B 2 57  ? 22.169  37.504 16.658  1.00 49.50 ? 366 PHE B CA  1 
ATOM   1584 C  C   . PHE B 2 57  ? 21.650  38.442 17.763  1.00 49.70 ? 366 PHE B C   1 
ATOM   1585 O  O   . PHE B 2 57  ? 22.380  38.737 18.714  1.00 49.58 ? 366 PHE B O   1 
ATOM   1586 C  CB  . PHE B 2 57  ? 22.559  38.297 15.397  1.00 48.79 ? 366 PHE B CB  1 
ATOM   1587 C  CG  . PHE B 2 57  ? 23.809  39.118 15.556  1.00 47.94 ? 366 PHE B CG  1 
ATOM   1588 C  CD1 . PHE B 2 57  ? 24.898  38.624 16.268  1.00 47.86 ? 366 PHE B CD1 1 
ATOM   1589 C  CD2 . PHE B 2 57  ? 23.899  40.383 15.001  1.00 47.83 ? 366 PHE B CD2 1 
ATOM   1590 C  CE1 . PHE B 2 57  ? 26.052  39.381 16.427  1.00 47.40 ? 366 PHE B CE1 1 
ATOM   1591 C  CE2 . PHE B 2 57  ? 25.050  41.147 15.155  1.00 47.91 ? 366 PHE B CE2 1 
ATOM   1592 C  CZ  . PHE B 2 57  ? 26.126  40.646 15.869  1.00 47.66 ? 366 PHE B CZ  1 
ATOM   1593 N  N   . MET B 2 58  ? 20.401  38.898 17.647  1.00 50.00 ? 367 MET B N   1 
ATOM   1594 C  CA  . MET B 2 58  ? 19.805  39.791 18.644  1.00 49.48 ? 367 MET B CA  1 
ATOM   1595 C  C   . MET B 2 58  ? 19.917  39.206 20.029  1.00 49.80 ? 367 MET B C   1 
ATOM   1596 O  O   . MET B 2 58  ? 20.258  39.899 20.982  1.00 49.10 ? 367 MET B O   1 
ATOM   1597 C  CB  . MET B 2 58  ? 18.334  40.027 18.348  1.00 49.43 ? 367 MET B CB  1 
ATOM   1598 C  CG  . MET B 2 58  ? 18.097  40.822 17.105  1.00 51.53 ? 367 MET B CG  1 
ATOM   1599 S  SD  . MET B 2 58  ? 18.837  42.444 17.253  1.00 53.32 ? 367 MET B SD  1 
ATOM   1600 C  CE  . MET B 2 58  ? 20.376  42.170 16.372  1.00 52.45 ? 367 MET B CE  1 
ATOM   1601 N  N   . HIS B 2 59  ? 19.620  37.918 20.136  1.00 51.23 ? 368 HIS B N   1 
ATOM   1602 C  CA  . HIS B 2 59  ? 19.684  37.236 21.415  1.00 51.65 ? 368 HIS B CA  1 
ATOM   1603 C  C   . HIS B 2 59  ? 21.121  37.119 21.874  1.00 50.62 ? 368 HIS B C   1 
ATOM   1604 O  O   . HIS B 2 59  ? 21.412  37.232 23.058  1.00 50.67 ? 368 HIS B O   1 
ATOM   1605 C  CB  . HIS B 2 59  ? 19.007  35.873 21.309  1.00 54.72 ? 368 HIS B CB  1 
ATOM   1606 C  CG  . HIS B 2 59  ? 17.528  35.966 21.065  1.00 59.78 ? 368 HIS B CG  1 
ATOM   1607 N  ND1 . HIS B 2 59  ? 16.741  34.866 20.790  1.00 61.24 ? 368 HIS B ND1 1 
ATOM   1608 C  CD2 . HIS B 2 59  ? 16.695  37.037 21.053  1.00 60.43 ? 368 HIS B CD2 1 
ATOM   1609 C  CE1 . HIS B 2 59  ? 15.490  35.256 20.618  1.00 61.85 ? 368 HIS B CE1 1 
ATOM   1610 N  NE2 . HIS B 2 59  ? 15.434  36.569 20.772  1.00 61.23 ? 368 HIS B NE2 1 
ATOM   1611 N  N   . ILE B 2 60  ? 22.036  36.919 20.942  1.00 49.37 ? 369 ILE B N   1 
ATOM   1612 C  CA  . ILE B 2 60  ? 23.421  36.837 21.342  1.00 49.16 ? 369 ILE B CA  1 
ATOM   1613 C  C   . ILE B 2 60  ? 23.823  38.179 21.907  1.00 48.98 ? 369 ILE B C   1 
ATOM   1614 O  O   . ILE B 2 60  ? 24.360  38.253 23.007  1.00 49.70 ? 369 ILE B O   1 
ATOM   1615 C  CB  . ILE B 2 60  ? 24.314  36.498 20.170  1.00 50.08 ? 369 ILE B CB  1 
ATOM   1616 C  CG1 . ILE B 2 60  ? 23.857  35.170 19.576  1.00 50.36 ? 369 ILE B CG1 1 
ATOM   1617 C  CG2 . ILE B 2 60  ? 25.761  36.400 20.628  1.00 50.25 ? 369 ILE B CG2 1 
ATOM   1618 C  CD1 . ILE B 2 60  ? 24.600  34.775 18.354  1.00 51.34 ? 369 ILE B CD1 1 
ATOM   1619 N  N   . LEU B 2 61  ? 23.544  39.247 21.165  1.00 48.50 ? 370 LEU B N   1 
ATOM   1620 C  CA  . LEU B 2 61  ? 23.894  40.588 21.623  1.00 47.63 ? 370 LEU B CA  1 
ATOM   1621 C  C   . LEU B 2 61  ? 23.133  40.973 22.887  1.00 46.79 ? 370 LEU B C   1 
ATOM   1622 O  O   . LEU B 2 61  ? 23.552  41.875 23.613  1.00 47.30 ? 370 LEU B O   1 
ATOM   1623 C  CB  . LEU B 2 61  ? 23.663  41.622 20.510  1.00 47.37 ? 370 LEU B CB  1 
ATOM   1624 C  CG  . LEU B 2 61  ? 24.614  41.564 19.302  1.00 47.60 ? 370 LEU B CG  1 
ATOM   1625 C  CD1 . LEU B 2 61  ? 24.178  42.566 18.254  1.00 48.28 ? 370 LEU B CD1 1 
ATOM   1626 C  CD2 . LEU B 2 61  ? 26.033  41.858 19.737  1.00 47.04 ? 370 LEU B CD2 1 
ATOM   1627 N  N   . THR B 2 62  ? 22.020  40.295 23.159  1.00 45.07 ? 371 THR B N   1 
ATOM   1628 C  CA  . THR B 2 62  ? 21.267  40.580 24.372  1.00 44.36 ? 371 THR B CA  1 
ATOM   1629 C  C   . THR B 2 62  ? 21.994  39.867 25.506  1.00 45.27 ? 371 THR B C   1 
ATOM   1630 O  O   . THR B 2 62  ? 21.910  40.240 26.670  1.00 44.88 ? 371 THR B O   1 
ATOM   1631 C  CB  . THR B 2 62  ? 19.831  40.077 24.278  1.00 43.15 ? 371 THR B CB  1 
ATOM   1632 O  OG1 . THR B 2 62  ? 19.187  40.714 23.172  1.00 42.93 ? 371 THR B OG1 1 
ATOM   1633 C  CG2 . THR B 2 62  ? 19.061  40.409 25.551  1.00 41.32 ? 371 THR B CG2 1 
ATOM   1634 N  N   . ARG B 2 63  ? 22.728  38.830 25.149  1.00 46.61 ? 372 ARG B N   1 
ATOM   1635 C  CA  . ARG B 2 63  ? 23.506  38.095 26.130  1.00 47.40 ? 372 ARG B CA  1 
ATOM   1636 C  C   . ARG B 2 63  ? 24.648  39.007 26.545  1.00 45.95 ? 372 ARG B C   1 
ATOM   1637 O  O   . ARG B 2 63  ? 24.984  39.105 27.720  1.00 45.19 ? 372 ARG B O   1 
ATOM   1638 C  CB  . ARG B 2 63  ? 24.086  36.831 25.503  1.00 50.60 ? 372 ARG B CB  1 
ATOM   1639 C  CG  . ARG B 2 63  ? 23.109  35.701 25.291  1.00 55.43 ? 372 ARG B CG  1 
ATOM   1640 C  CD  . ARG B 2 63  ? 22.764  35.045 26.598  1.00 59.51 ? 372 ARG B CD  1 
ATOM   1641 N  NE  . ARG B 2 63  ? 22.153  33.732 26.387  1.00 63.83 ? 372 ARG B NE  1 
ATOM   1642 C  CZ  . ARG B 2 63  ? 21.971  32.835 27.355  1.00 64.87 ? 372 ARG B CZ  1 
ATOM   1643 N  NH1 . ARG B 2 63  ? 22.358  33.110 28.603  1.00 64.84 ? 372 ARG B NH1 1 
ATOM   1644 N  NH2 . ARG B 2 63  ? 21.396  31.671 27.076  1.00 64.79 ? 372 ARG B NH2 1 
ATOM   1645 N  N   . VAL B 2 64  ? 25.244  39.663 25.551  1.00 45.20 ? 373 VAL B N   1 
ATOM   1646 C  CA  . VAL B 2 64  ? 26.358  40.573 25.766  1.00 44.38 ? 373 VAL B CA  1 
ATOM   1647 C  C   . VAL B 2 64  ? 25.923  41.713 26.673  1.00 45.49 ? 373 VAL B C   1 
ATOM   1648 O  O   . VAL B 2 64  ? 26.661  42.135 27.556  1.00 46.62 ? 373 VAL B O   1 
ATOM   1649 C  CB  . VAL B 2 64  ? 26.859  41.149 24.429  1.00 43.12 ? 373 VAL B CB  1 
ATOM   1650 C  CG1 . VAL B 2 64  ? 28.144  41.915 24.637  1.00 41.94 ? 373 VAL B CG1 1 
ATOM   1651 C  CG2 . VAL B 2 64  ? 27.087  40.039 23.443  1.00 41.23 ? 373 VAL B CG2 1 
ATOM   1652 N  N   . ASN B 2 65  ? 24.715  42.208 26.455  1.00 45.95 ? 374 ASN B N   1 
ATOM   1653 C  CA  . ASN B 2 65  ? 24.206  43.290 27.274  1.00 47.20 ? 374 ASN B CA  1 
ATOM   1654 C  C   . ASN B 2 65  ? 24.197  42.858 28.728  1.00 47.85 ? 374 ASN B C   1 
ATOM   1655 O  O   . ASN B 2 65  ? 24.672  43.583 29.605  1.00 47.61 ? 374 ASN B O   1 
ATOM   1656 C  CB  . ASN B 2 65  ? 22.788  43.676 26.841  1.00 47.59 ? 374 ASN B CB  1 
ATOM   1657 C  CG  . ASN B 2 65  ? 22.776  44.597 25.645  1.00 48.11 ? 374 ASN B CG  1 
ATOM   1658 O  OD1 . ASN B 2 65  ? 23.815  44.886 25.062  1.00 49.32 ? 374 ASN B OD1 1 
ATOM   1659 N  ND2 . ASN B 2 65  ? 21.594  45.068 25.274  1.00 49.03 ? 374 ASN B ND2 1 
ATOM   1660 N  N   . ARG B 2 66  ? 23.662  41.669 28.987  1.00 47.91 ? 375 ARG B N   1 
ATOM   1661 C  CA  . ARG B 2 66  ? 23.604  41.185 30.354  1.00 48.65 ? 375 ARG B CA  1 
ATOM   1662 C  C   . ARG B 2 66  ? 24.990  40.947 30.914  1.00 47.10 ? 375 ARG B C   1 
ATOM   1663 O  O   . ARG B 2 66  ? 25.263  41.294 32.062  1.00 47.19 ? 375 ARG B O   1 
ATOM   1664 C  CB  . ARG B 2 66  ? 22.785  39.904 30.452  1.00 50.78 ? 375 ARG B CB  1 
ATOM   1665 C  CG  . ARG B 2 66  ? 22.609  39.421 31.880  1.00 54.45 ? 375 ARG B CG  1 
ATOM   1666 C  CD  . ARG B 2 66  ? 21.313  38.655 32.036  1.00 59.62 ? 375 ARG B CD  1 
ATOM   1667 N  NE  . ARG B 2 66  ? 21.269  37.478 31.172  1.00 64.26 ? 375 ARG B NE  1 
ATOM   1668 C  CZ  . ARG B 2 66  ? 21.683  36.270 31.539  1.00 66.53 ? 375 ARG B CZ  1 
ATOM   1669 N  NH1 . ARG B 2 66  ? 22.164  36.095 32.766  1.00 67.88 ? 375 ARG B NH1 1 
ATOM   1670 N  NH2 . ARG B 2 66  ? 21.619  35.245 30.684  1.00 66.99 ? 375 ARG B NH2 1 
ATOM   1671 N  N   . LYS B 2 67  ? 25.874  40.377 30.106  1.00 45.09 ? 376 LYS B N   1 
ATOM   1672 C  CA  . LYS B 2 67  ? 27.223  40.102 30.574  1.00 44.94 ? 376 LYS B CA  1 
ATOM   1673 C  C   . LYS B 2 67  ? 27.913  41.379 31.010  1.00 44.31 ? 376 LYS B C   1 
ATOM   1674 O  O   . LYS B 2 67  ? 28.451  41.451 32.114  1.00 42.94 ? 376 LYS B O   1 
ATOM   1675 C  CB  . LYS B 2 67  ? 28.055  39.426 29.484  1.00 46.83 ? 376 LYS B CB  1 
ATOM   1676 C  CG  . LYS B 2 67  ? 29.271  38.661 30.016  1.00 45.97 ? 376 LYS B CG  1 
ATOM   1677 C  CD  . LYS B 2 67  ? 30.208  38.221 28.901  1.00 45.48 ? 376 LYS B CD  1 
ATOM   1678 C  CE  . LYS B 2 67  ? 31.157  37.147 29.380  1.00 45.63 ? 376 LYS B CE  1 
ATOM   1679 N  NZ  . LYS B 2 67  ? 31.765  37.476 30.687  1.00 46.52 ? 376 LYS B NZ  1 
ATOM   1680 N  N   . VAL B 2 68  ? 27.896  42.388 30.143  1.00 44.18 ? 377 VAL B N   1 
ATOM   1681 C  CA  . VAL B 2 68  ? 28.529  43.666 30.454  1.00 43.57 ? 377 VAL B CA  1 
ATOM   1682 C  C   . VAL B 2 68  ? 27.841  44.350 31.626  1.00 43.89 ? 377 VAL B C   1 
ATOM   1683 O  O   . VAL B 2 68  ? 28.495  44.881 32.510  1.00 44.29 ? 377 VAL B O   1 
ATOM   1684 C  CB  . VAL B 2 68  ? 28.514  44.616 29.240  1.00 41.95 ? 377 VAL B CB  1 
ATOM   1685 C  CG1 . VAL B 2 68  ? 29.058  45.975 29.635  1.00 39.73 ? 377 VAL B CG1 1 
ATOM   1686 C  CG2 . VAL B 2 68  ? 29.346  44.026 28.112  1.00 42.72 ? 377 VAL B CG2 1 
ATOM   1687 N  N   . ALA B 2 69  ? 26.517  44.318 31.640  1.00 45.03 ? 378 ALA B N   1 
ATOM   1688 C  CA  . ALA B 2 69  ? 25.752  44.956 32.707  1.00 46.51 ? 378 ALA B CA  1 
ATOM   1689 C  C   . ALA B 2 69  ? 25.916  44.279 34.060  1.00 47.18 ? 378 ALA B C   1 
ATOM   1690 O  O   . ALA B 2 69  ? 25.942  44.938 35.103  1.00 47.39 ? 378 ALA B O   1 
ATOM   1691 C  CB  . ALA B 2 69  ? 24.278  44.982 32.330  1.00 46.81 ? 378 ALA B CB  1 
ATOM   1692 N  N   . THR B 2 70  ? 26.030  42.955 34.024  1.00 48.06 ? 379 THR B N   1 
ATOM   1693 C  CA  . THR B 2 70  ? 26.147  42.123 35.217  1.00 47.41 ? 379 THR B CA  1 
ATOM   1694 C  C   . THR B 2 70  ? 27.536  41.849 35.793  1.00 47.19 ? 379 THR B C   1 
ATOM   1695 O  O   . THR B 2 70  ? 27.769  42.024 36.992  1.00 47.18 ? 379 THR B O   1 
ATOM   1696 C  CB  . THR B 2 70  ? 25.475  40.777 34.950  1.00 46.60 ? 379 THR B CB  1 
ATOM   1697 O  OG1 . THR B 2 70  ? 24.072  40.918 35.144  1.00 47.56 ? 379 THR B OG1 1 
ATOM   1698 C  CG2 . THR B 2 70  ? 26.001  39.705 35.864  1.00 47.08 ? 379 THR B CG2 1 
ATOM   1699 N  N   . GLU B 2 71  A 28.453  41.408 34.944  1.00 46.54 ? 379 GLU B N   1 
ATOM   1700 C  CA  . GLU B 2 71  A 29.788  41.064 35.398  1.00 45.55 ? 379 GLU B CA  1 
ATOM   1701 C  C   . GLU B 2 71  A 30.844  42.165 35.471  1.00 44.80 ? 379 GLU B C   1 
ATOM   1702 O  O   . GLU B 2 71  A 31.949  41.916 35.953  1.00 44.32 ? 379 GLU B O   1 
ATOM   1703 C  CB  . GLU B 2 71  A 30.302  39.917 34.542  1.00 45.85 ? 379 GLU B CB  1 
ATOM   1704 C  CG  . GLU B 2 71  A 29.435  38.674 34.642  1.00 45.70 ? 379 GLU B CG  1 
ATOM   1705 C  CD  . GLU B 2 71  A 29.695  37.685 33.525  1.00 47.12 ? 379 GLU B CD  1 
ATOM   1706 O  OE1 . GLU B 2 71  A 30.850  37.605 33.046  1.00 46.24 ? 379 GLU B OE1 1 
ATOM   1707 O  OE2 . GLU B 2 71  A 28.741  36.982 33.134  1.00 47.23 ? 379 GLU B OE2 1 
ATOM   1708 N  N   . PHE B 2 72  ? 30.519  43.378 35.024  1.00 42.99 ? 380 PHE B N   1 
ATOM   1709 C  CA  . PHE B 2 72  ? 31.498  44.465 35.057  1.00 40.61 ? 380 PHE B CA  1 
ATOM   1710 C  C   . PHE B 2 72  ? 31.146  45.679 35.908  1.00 41.13 ? 380 PHE B C   1 
ATOM   1711 O  O   . PHE B 2 72  ? 29.994  46.099 35.985  1.00 42.06 ? 380 PHE B O   1 
ATOM   1712 C  CB  . PHE B 2 72  ? 31.811  44.951 33.639  1.00 38.21 ? 380 PHE B CB  1 
ATOM   1713 C  CG  . PHE B 2 72  ? 32.454  43.923 32.767  1.00 37.90 ? 380 PHE B CG  1 
ATOM   1714 C  CD1 . PHE B 2 72  ? 31.702  42.919 32.179  1.00 36.54 ? 380 PHE B CD1 1 
ATOM   1715 C  CD2 . PHE B 2 72  ? 33.816  43.962 32.524  1.00 36.95 ? 380 PHE B CD2 1 
ATOM   1716 C  CE1 . PHE B 2 72  ? 32.299  41.972 31.363  1.00 36.03 ? 380 PHE B CE1 1 
ATOM   1717 C  CE2 . PHE B 2 72  ? 34.420  43.015 31.705  1.00 35.70 ? 380 PHE B CE2 1 
ATOM   1718 C  CZ  . PHE B 2 72  ? 33.659  42.020 31.125  1.00 35.77 ? 380 PHE B CZ  1 
ATOM   1719 N  N   . GLU B 2 73  ? 32.177  46.232 36.538  1.00 41.70 ? 381 GLU B N   1 
ATOM   1720 C  CA  . GLU B 2 73  ? 32.099  47.433 37.371  1.00 43.59 ? 381 GLU B CA  1 
ATOM   1721 C  C   . GLU B 2 73  ? 33.534  47.960 37.430  1.00 44.18 ? 381 GLU B C   1 
ATOM   1722 O  O   . GLU B 2 73  ? 34.464  47.199 37.687  1.00 44.90 ? 381 GLU B O   1 
ATOM   1723 C  CB  . GLU B 2 73  ? 31.589  47.108 38.769  1.00 42.91 ? 381 GLU B CB  1 
ATOM   1724 C  CG  . GLU B 2 73  ? 31.756  48.239 39.754  1.00 46.40 ? 381 GLU B CG  1 
ATOM   1725 C  CD  . GLU B 2 73  ? 31.010  47.985 41.044  1.00 48.80 ? 381 GLU B CD  1 
ATOM   1726 O  OE1 . GLU B 2 73  ? 31.412  48.530 42.088  1.00 50.97 ? 381 GLU B OE1 1 
ATOM   1727 O  OE2 . GLU B 2 73  ? 30.008  47.245 41.014  1.00 50.97 ? 381 GLU B OE2 1 
ATOM   1728 N  N   . SER B 2 74  A 33.721  49.250 37.184  1.00 44.17 ? 381 SER B N   1 
ATOM   1729 C  CA  . SER B 2 74  A 35.066  49.804 37.155  1.00 44.22 ? 381 SER B CA  1 
ATOM   1730 C  C   . SER B 2 74  A 35.753  49.911 38.500  1.00 45.94 ? 381 SER B C   1 
ATOM   1731 O  O   . SER B 2 74  A 35.122  49.847 39.561  1.00 46.72 ? 381 SER B O   1 
ATOM   1732 C  CB  . SER B 2 74  A 35.057  51.186 36.520  1.00 42.72 ? 381 SER B CB  1 
ATOM   1733 O  OG  . SER B 2 74  A 34.485  52.127 37.407  1.00 38.65 ? 381 SER B OG  1 
ATOM   1734 N  N   . PHE B 2 75  B 37.068  50.076 38.440  1.00 46.30 ? 381 PHE B N   1 
ATOM   1735 C  CA  . PHE B 2 75  B 37.866  50.244 39.633  1.00 46.54 ? 381 PHE B CA  1 
ATOM   1736 C  C   . PHE B 2 75  B 38.884  51.336 39.371  1.00 47.49 ? 381 PHE B C   1 
ATOM   1737 O  O   . PHE B 2 75  B 39.743  51.195 38.512  1.00 47.04 ? 381 PHE B O   1 
ATOM   1738 C  CB  . PHE B 2 75  B 38.612  48.967 40.000  1.00 46.67 ? 381 PHE B CB  1 
ATOM   1739 C  CG  . PHE B 2 75  B 39.294  49.043 41.337  1.00 47.11 ? 381 PHE B CG  1 
ATOM   1740 C  CD1 . PHE B 2 75  B 38.724  48.452 42.464  1.00 46.66 ? 381 PHE B CD1 1 
ATOM   1741 C  CD2 . PHE B 2 75  B 40.482  49.747 41.482  1.00 46.48 ? 381 PHE B CD2 1 
ATOM   1742 C  CE1 . PHE B 2 75  B 39.328  48.562 43.716  1.00 45.47 ? 381 PHE B CE1 1 
ATOM   1743 C  CE2 . PHE B 2 75  B 41.093  49.865 42.726  1.00 47.14 ? 381 PHE B CE2 1 
ATOM   1744 C  CZ  . PHE B 2 75  B 40.513  49.268 43.848  1.00 46.80 ? 381 PHE B CZ  1 
ATOM   1745 N  N   . SER B 2 76  C 38.780  52.428 40.110  1.00 48.40 ? 381 SER B N   1 
ATOM   1746 C  CA  . SER B 2 76  C 39.725  53.520 39.973  1.00 49.33 ? 381 SER B CA  1 
ATOM   1747 C  C   . SER B 2 76  C 40.072  54.033 41.352  1.00 49.59 ? 381 SER B C   1 
ATOM   1748 O  O   . SER B 2 76  C 39.258  53.936 42.272  1.00 49.26 ? 381 SER B O   1 
ATOM   1749 C  CB  . SER B 2 76  C 39.119  54.656 39.161  1.00 50.65 ? 381 SER B CB  1 
ATOM   1750 O  OG  . SER B 2 76  C 40.029  55.738 39.077  1.00 51.51 ? 381 SER B OG  1 
ATOM   1751 N  N   . PHE B 2 77  D 41.276  54.572 41.507  1.00 49.79 ? 381 PHE B N   1 
ATOM   1752 C  CA  . PHE B 2 77  D 41.672  55.114 42.802  1.00 50.25 ? 381 PHE B CA  1 
ATOM   1753 C  C   . PHE B 2 77  D 41.043  56.500 42.942  1.00 51.78 ? 381 PHE B C   1 
ATOM   1754 O  O   . PHE B 2 77  D 41.004  57.069 44.043  1.00 52.86 ? 381 PHE B O   1 
ATOM   1755 C  CB  . PHE B 2 77  D 43.196  55.200 42.914  1.00 49.02 ? 381 PHE B CB  1 
ATOM   1756 C  CG  . PHE B 2 77  D 43.865  53.868 43.067  1.00 48.18 ? 381 PHE B CG  1 
ATOM   1757 C  CD1 . PHE B 2 77  D 44.829  53.439 42.153  1.00 46.27 ? 381 PHE B CD1 1 
ATOM   1758 C  CD2 . PHE B 2 77  D 43.533  53.034 44.132  1.00 48.42 ? 381 PHE B CD2 1 
ATOM   1759 C  CE1 . PHE B 2 77  D 45.449  52.204 42.298  1.00 44.44 ? 381 PHE B CE1 1 
ATOM   1760 C  CE2 . PHE B 2 77  D 44.151  51.794 44.282  1.00 46.77 ? 381 PHE B CE2 1 
ATOM   1761 C  CZ  . PHE B 2 77  D 45.111  51.382 43.363  1.00 45.29 ? 381 PHE B CZ  1 
ATOM   1762 N  N   . ASP B 2 78  E 40.554  57.041 41.823  1.00 51.53 ? 381 ASP B N   1 
ATOM   1763 C  CA  . ASP B 2 78  E 39.884  58.336 41.826  1.00 51.84 ? 381 ASP B CA  1 
ATOM   1764 C  C   . ASP B 2 78  E 38.381  58.073 41.970  1.00 51.14 ? 381 ASP B C   1 
ATOM   1765 O  O   . ASP B 2 78  E 37.765  57.495 41.085  1.00 51.92 ? 381 ASP B O   1 
ATOM   1766 C  CB  . ASP B 2 78  E 40.183  59.074 40.520  1.00 52.94 ? 381 ASP B CB  1 
ATOM   1767 C  CG  . ASP B 2 78  E 39.532  60.454 40.457  1.00 54.58 ? 381 ASP B CG  1 
ATOM   1768 O  OD1 . ASP B 2 78  E 39.941  61.250 39.587  1.00 56.71 ? 381 ASP B OD1 1 
ATOM   1769 O  OD2 . ASP B 2 78  E 38.611  60.744 41.256  1.00 54.56 ? 381 ASP B OD2 1 
ATOM   1770 N  N   . ALA B 2 79  F 37.798  58.487 43.090  1.00 50.10 ? 381 ALA B N   1 
ATOM   1771 C  CA  . ALA B 2 79  F 36.377  58.257 43.342  1.00 49.84 ? 381 ALA B CA  1 
ATOM   1772 C  C   . ALA B 2 79  F 35.476  58.663 42.183  1.00 50.10 ? 381 ALA B C   1 
ATOM   1773 O  O   . ALA B 2 79  F 34.408  58.084 41.972  1.00 51.20 ? 381 ALA B O   1 
ATOM   1774 C  CB  . ALA B 2 79  F 35.950  58.984 44.600  1.00 47.84 ? 381 ALA B CB  1 
ATOM   1775 N  N   . THR B 2 80  G 35.913  59.656 41.425  1.00 49.59 ? 381 THR B N   1 
ATOM   1776 C  CA  . THR B 2 80  G 35.133  60.146 40.301  1.00 50.19 ? 381 THR B CA  1 
ATOM   1777 C  C   . THR B 2 80  G 34.842  59.088 39.246  1.00 49.07 ? 381 THR B C   1 
ATOM   1778 O  O   . THR B 2 80  G 33.817  59.145 38.569  1.00 48.37 ? 381 THR B O   1 
ATOM   1779 C  CB  . THR B 2 80  G 35.854  61.301 39.599  1.00 52.33 ? 381 THR B CB  1 
ATOM   1780 O  OG1 . THR B 2 80  G 36.159  62.329 40.549  1.00 54.54 ? 381 THR B OG1 1 
ATOM   1781 C  CG2 . THR B 2 80  G 34.978  61.879 38.494  1.00 54.49 ? 381 THR B CG2 1 
ATOM   1782 N  N   . PHE B 2 81  H 35.741  58.123 39.112  1.00 47.80 ? 381 PHE B N   1 
ATOM   1783 C  CA  . PHE B 2 81  H 35.589  57.083 38.107  1.00 47.58 ? 381 PHE B CA  1 
ATOM   1784 C  C   . PHE B 2 81  H 35.442  55.678 38.656  1.00 47.14 ? 381 PHE B C   1 
ATOM   1785 O  O   . PHE B 2 81  H 35.358  54.721 37.896  1.00 47.42 ? 381 PHE B O   1 
ATOM   1786 C  CB  . PHE B 2 81  H 36.793  57.120 37.188  1.00 46.99 ? 381 PHE B CB  1 
ATOM   1787 C  CG  . PHE B 2 81  H 37.157  58.492 36.741  1.00 48.32 ? 381 PHE B CG  1 
ATOM   1788 C  CD1 . PHE B 2 81  H 38.461  58.942 36.856  1.00 48.16 ? 381 PHE B CD1 1 
ATOM   1789 C  CD2 . PHE B 2 81  H 36.199  59.333 36.193  1.00 48.27 ? 381 PHE B CD2 1 
ATOM   1790 C  CE1 . PHE B 2 81  H 38.813  60.209 36.431  1.00 49.64 ? 381 PHE B CE1 1 
ATOM   1791 C  CE2 . PHE B 2 81  H 36.537  60.600 35.764  1.00 49.54 ? 381 PHE B CE2 1 
ATOM   1792 C  CZ  . PHE B 2 81  H 37.849  61.045 35.882  1.00 49.67 ? 381 PHE B CZ  1 
ATOM   1793 N  N   . HIS B 2 82  I 35.398  55.556 39.973  1.00 46.60 ? 381 HIS B N   1 
ATOM   1794 C  CA  . HIS B 2 82  I 35.303  54.252 40.613  1.00 46.97 ? 381 HIS B CA  1 
ATOM   1795 C  C   . HIS B 2 82  I 33.903  53.636 40.701  1.00 46.49 ? 381 HIS B C   1 
ATOM   1796 O  O   . HIS B 2 82  I 32.917  54.339 40.890  1.00 46.37 ? 381 HIS B O   1 
ATOM   1797 C  CB  . HIS B 2 82  I 35.890  54.343 42.021  1.00 46.84 ? 381 HIS B CB  1 
ATOM   1798 C  CG  . HIS B 2 82  I 35.830  53.056 42.778  1.00 46.39 ? 381 HIS B CG  1 
ATOM   1799 N  ND1 . HIS B 2 82  I 36.653  51.988 42.494  1.00 46.32 ? 381 HIS B ND1 1 
ATOM   1800 C  CD2 . HIS B 2 82  I 35.022  52.652 43.784  1.00 45.35 ? 381 HIS B CD2 1 
ATOM   1801 C  CE1 . HIS B 2 82  I 36.355  50.983 43.296  1.00 45.68 ? 381 HIS B CE1 1 
ATOM   1802 N  NE2 . HIS B 2 82  I 35.368  51.360 44.088  1.00 45.22 ? 381 HIS B NE2 1 
ATOM   1803 N  N   . ALA B 2 83  ? 33.837  52.315 40.575  1.00 44.89 ? 382 ALA B N   1 
ATOM   1804 C  CA  . ALA B 2 83  ? 32.583  51.586 40.679  1.00 45.95 ? 382 ALA B CA  1 
ATOM   1805 C  C   . ALA B 2 83  ? 31.531  51.965 39.635  1.00 45.65 ? 382 ALA B C   1 
ATOM   1806 O  O   . ALA B 2 83  ? 30.328  51.925 39.908  1.00 45.87 ? 382 ALA B O   1 
ATOM   1807 C  CB  . ALA B 2 83  ? 32.002  51.763 42.087  1.00 44.64 ? 382 ALA B CB  1 
ATOM   1808 N  N   . LYS B 2 84  ? 31.971  52.319 38.436  1.00 44.43 ? 383 LYS B N   1 
ATOM   1809 C  CA  . LYS B 2 84  ? 31.023  52.696 37.401  1.00 43.58 ? 383 LYS B CA  1 
ATOM   1810 C  C   . LYS B 2 84  ? 30.571  51.489 36.604  1.00 43.83 ? 383 LYS B C   1 
ATOM   1811 O  O   . LYS B 2 84  ? 31.302  50.509 36.489  1.00 43.87 ? 383 LYS B O   1 
ATOM   1812 C  CB  . LYS B 2 84  ? 31.642  53.738 36.482  1.00 43.11 ? 383 LYS B CB  1 
ATOM   1813 C  CG  . LYS B 2 84  ? 32.123  54.951 37.224  1.00 42.69 ? 383 LYS B CG  1 
ATOM   1814 C  CD  . LYS B 2 84  ? 31.006  55.528 38.072  1.00 42.13 ? 383 LYS B CD  1 
ATOM   1815 C  CE  . LYS B 2 84  ? 31.510  56.677 38.907  1.00 40.81 ? 383 LYS B CE  1 
ATOM   1816 N  NZ  . LYS B 2 84  ? 30.424  57.237 39.721  1.00 41.22 ? 383 LYS B NZ  1 
ATOM   1817 N  N   . LYS B 2 85  ? 29.355  51.565 36.069  1.00 43.31 ? 384 LYS B N   1 
ATOM   1818 C  CA  . LYS B 2 85  ? 28.784  50.477 35.287  1.00 43.15 ? 384 LYS B CA  1 
ATOM   1819 C  C   . LYS B 2 85  ? 28.632  50.861 33.819  1.00 42.86 ? 384 LYS B C   1 
ATOM   1820 O  O   . LYS B 2 85  ? 28.973  51.975 33.433  1.00 43.90 ? 384 LYS B O   1 
ATOM   1821 C  CB  . LYS B 2 85  ? 27.437  50.078 35.877  1.00 43.43 ? 384 LYS B CB  1 
ATOM   1822 C  CG  . LYS B 2 85  ? 27.533  49.606 37.327  1.00 43.99 ? 384 LYS B CG  1 
ATOM   1823 C  CD  . LYS B 2 85  ? 28.146  48.213 37.465  1.00 41.63 ? 384 LYS B CD  1 
ATOM   1824 C  CE  . LYS B 2 85  ? 27.156  47.141 37.040  1.00 40.17 ? 384 LYS B CE  1 
ATOM   1825 N  NZ  . LYS B 2 85  ? 27.657  45.780 37.313  1.00 39.26 ? 384 LYS B NZ  1 
ATOM   1826 N  N   . GLN B 2 86  ? 28.124  49.934 33.012  1.00 41.90 ? 385 GLN B N   1 
ATOM   1827 C  CA  . GLN B 2 86  ? 27.956  50.163 31.586  1.00 40.61 ? 385 GLN B CA  1 
ATOM   1828 C  C   . GLN B 2 86  ? 26.927  49.229 30.964  1.00 40.38 ? 385 GLN B C   1 
ATOM   1829 O  O   . GLN B 2 86  ? 26.830  48.062 31.332  1.00 39.92 ? 385 GLN B O   1 
ATOM   1830 C  CB  . GLN B 2 86  ? 29.297  49.962 30.882  1.00 39.34 ? 385 GLN B CB  1 
ATOM   1831 C  CG  . GLN B 2 86  ? 29.270  50.225 29.395  1.00 39.63 ? 385 GLN B CG  1 
ATOM   1832 C  CD  . GLN B 2 86  ? 30.635  50.090 28.764  1.00 39.93 ? 385 GLN B CD  1 
ATOM   1833 O  OE1 . GLN B 2 86  ? 31.593  50.714 29.207  1.00 40.71 ? 385 GLN B OE1 1 
ATOM   1834 N  NE2 . GLN B 2 86  ? 30.732  49.276 27.725  1.00 37.76 ? 385 GLN B NE2 1 
ATOM   1835 N  N   . ILE B 2 87  ? 26.155  49.748 30.018  1.00 39.72 ? 386 ILE B N   1 
ATOM   1836 C  CA  . ILE B 2 87  ? 25.162  48.933 29.326  1.00 39.59 ? 386 ILE B CA  1 
ATOM   1837 C  C   . ILE B 2 87  ? 25.395  49.105 27.829  1.00 39.68 ? 386 ILE B C   1 
ATOM   1838 O  O   . ILE B 2 87  ? 25.434  50.218 27.332  1.00 39.79 ? 386 ILE B O   1 
ATOM   1839 C  CB  . ILE B 2 87  ? 23.709  49.356 29.690  1.00 37.77 ? 386 ILE B CB  1 
ATOM   1840 C  CG1 . ILE B 2 87  ? 22.713  48.432 29.001  1.00 38.05 ? 386 ILE B CG1 1 
ATOM   1841 C  CG2 . ILE B 2 87  ? 23.437  50.758 29.259  1.00 37.15 ? 386 ILE B CG2 1 
ATOM   1842 C  CD1 . ILE B 2 87  ? 22.710  47.027 29.552  1.00 37.06 ? 386 ILE B CD1 1 
ATOM   1843 N  N   . PRO B 2 88  ? 25.591  48.009 27.094  1.00 40.34 ? 387 PRO B N   1 
ATOM   1844 C  CA  . PRO B 2 88  ? 25.811  48.201 25.659  1.00 41.00 ? 387 PRO B CA  1 
ATOM   1845 C  C   . PRO B 2 88  ? 24.527  48.679 25.002  1.00 41.72 ? 387 PRO B C   1 
ATOM   1846 O  O   . PRO B 2 88  ? 23.481  48.752 25.652  1.00 42.82 ? 387 PRO B O   1 
ATOM   1847 C  CB  . PRO B 2 88  ? 26.229  46.820 25.188  1.00 41.78 ? 387 PRO B CB  1 
ATOM   1848 C  CG  . PRO B 2 88  ? 26.882  46.240 26.405  1.00 42.78 ? 387 PRO B CG  1 
ATOM   1849 C  CD  . PRO B 2 88  ? 25.926  46.639 27.493  1.00 41.69 ? 387 PRO B CD  1 
ATOM   1850 N  N   . CYS B 2 89  ? 24.594  49.002 23.719  1.00 40.39 ? 388 CYS B N   1 
ATOM   1851 C  CA  . CYS B 2 89  ? 23.412  49.493 23.035  1.00 38.60 ? 388 CYS B CA  1 
ATOM   1852 C  C   . CYS B 2 89  ? 23.222  48.876 21.658  1.00 37.90 ? 388 CYS B C   1 
ATOM   1853 O  O   . CYS B 2 89  ? 24.011  49.099 20.755  1.00 39.82 ? 388 CYS B O   1 
ATOM   1854 C  CB  . CYS B 2 89  ? 23.499  51.011 22.931  1.00 39.01 ? 388 CYS B CB  1 
ATOM   1855 S  SG  . CYS B 2 89  ? 22.123  51.789 22.158  1.00 40.04 ? 388 CYS B SG  1 
ATOM   1856 N  N   . ILE B 2 90  ? 22.165  48.093 21.512  1.00 35.29 ? 389 ILE B N   1 
ATOM   1857 C  CA  . ILE B 2 90  ? 21.856  47.439 20.258  1.00 35.39 ? 389 ILE B CA  1 
ATOM   1858 C  C   . ILE B 2 90  ? 20.931  48.311 19.414  1.00 36.54 ? 389 ILE B C   1 
ATOM   1859 O  O   . ILE B 2 90  ? 19.847  48.676 19.855  1.00 36.43 ? 389 ILE B O   1 
ATOM   1860 C  CB  . ILE B 2 90  ? 21.169  46.097 20.517  1.00 35.33 ? 389 ILE B CB  1 
ATOM   1861 C  CG1 . ILE B 2 90  ? 22.034  45.262 21.460  1.00 35.71 ? 389 ILE B CG1 1 
ATOM   1862 C  CG2 . ILE B 2 90  ? 20.945  45.360 19.207  1.00 34.40 ? 389 ILE B CG2 1 
ATOM   1863 C  CD1 . ILE B 2 90  ? 21.426  43.960 21.846  1.00 33.85 ? 389 ILE B CD1 1 
ATOM   1864 N  N   . VAL B 2 91  ? 21.365  48.648 18.203  1.00 36.21 ? 390 VAL B N   1 
ATOM   1865 C  CA  . VAL B 2 91  ? 20.562  49.469 17.309  1.00 36.97 ? 390 VAL B CA  1 
ATOM   1866 C  C   . VAL B 2 91  ? 20.337  48.692 16.035  1.00 37.49 ? 390 VAL B C   1 
ATOM   1867 O  O   . VAL B 2 91  ? 21.142  48.754 15.124  1.00 38.01 ? 390 VAL B O   1 
ATOM   1868 C  CB  . VAL B 2 91  ? 21.263  50.791 16.962  1.00 36.05 ? 390 VAL B CB  1 
ATOM   1869 C  CG1 . VAL B 2 91  ? 20.414  51.578 16.016  1.00 37.22 ? 390 VAL B CG1 1 
ATOM   1870 C  CG2 . VAL B 2 91  ? 21.504  51.602 18.212  1.00 35.44 ? 390 VAL B CG2 1 
ATOM   1871 N  N   . SER B 2 92  ? 19.238  47.957 15.972  1.00 39.80 ? 392 SER B N   1 
ATOM   1872 C  CA  . SER B 2 92  ? 18.935  47.141 14.803  1.00 40.96 ? 392 SER B CA  1 
ATOM   1873 C  C   . SER B 2 92  ? 17.914  47.719 13.856  1.00 42.91 ? 392 SER B C   1 
ATOM   1874 O  O   . SER B 2 92  ? 16.873  48.227 14.266  1.00 43.67 ? 392 SER B O   1 
ATOM   1875 C  CB  . SER B 2 92  ? 18.450  45.763 15.228  1.00 40.27 ? 392 SER B CB  1 
ATOM   1876 O  OG  . SER B 2 92  ? 17.996  45.037 14.107  1.00 40.65 ? 392 SER B OG  1 
ATOM   1877 N  N   . MET B 2 93  ? 18.223  47.617 12.571  1.00 44.61 ? 393 MET B N   1 
ATOM   1878 C  CA  . MET B 2 93  ? 17.337  48.089 11.526  1.00 45.39 ? 393 MET B CA  1 
ATOM   1879 C  C   . MET B 2 93  ? 17.266  46.957 10.533  1.00 45.91 ? 393 MET B C   1 
ATOM   1880 O  O   . MET B 2 93  ? 17.008  47.144 9.355   1.00 46.79 ? 393 MET B O   1 
ATOM   1881 C  CB  . MET B 2 93  ? 17.900  49.361 10.917  1.00 47.08 ? 393 MET B CB  1 
ATOM   1882 C  CG  . MET B 2 93  ? 18.024  50.425 11.990  1.00 49.85 ? 393 MET B CG  1 
ATOM   1883 S  SD  . MET B 2 93  ? 18.571  52.025 11.457  1.00 52.80 ? 393 MET B SD  1 
ATOM   1884 C  CE  . MET B 2 93  ? 19.759  52.372 12.736  1.00 50.70 ? 393 MET B CE  1 
ATOM   1885 N  N   . LEU B 2 94  ? 17.506  45.762 11.058  1.00 46.73 ? 394 LEU B N   1 
ATOM   1886 C  CA  . LEU B 2 94  ? 17.474  44.536 10.290  1.00 46.56 ? 394 LEU B CA  1 
ATOM   1887 C  C   . LEU B 2 94  ? 16.029  44.188 9.974   1.00 47.32 ? 394 LEU B C   1 
ATOM   1888 O  O   . LEU B 2 94  ? 15.116  44.587 10.690  1.00 47.78 ? 394 LEU B O   1 
ATOM   1889 C  CB  . LEU B 2 94  ? 18.115  43.402 11.093  1.00 44.56 ? 394 LEU B CB  1 
ATOM   1890 C  CG  . LEU B 2 94  ? 19.563  43.580 11.559  1.00 42.82 ? 394 LEU B CG  1 
ATOM   1891 C  CD1 . LEU B 2 94  ? 20.079  42.275 12.123  1.00 38.17 ? 394 LEU B CD1 1 
ATOM   1892 C  CD2 . LEU B 2 94  ? 20.430  44.018 10.404  1.00 41.39 ? 394 LEU B CD2 1 
ATOM   1893 N  N   . THR B 2 95  ? 15.824  43.442 8.898   1.00 48.57 ? 395 THR B N   1 
ATOM   1894 C  CA  . THR B 2 95  ? 14.482  43.038 8.496   1.00 48.61 ? 395 THR B CA  1 
ATOM   1895 C  C   . THR B 2 95  ? 14.241  41.547 8.695   1.00 48.29 ? 395 THR B C   1 
ATOM   1896 O  O   . THR B 2 95  ? 13.104  41.096 8.667   1.00 48.61 ? 395 THR B O   1 
ATOM   1897 C  CB  . THR B 2 95  ? 14.223  43.400 7.034   1.00 48.73 ? 395 THR B CB  1 
ATOM   1898 O  OG1 . THR B 2 95  ? 15.410  43.159 6.272   1.00 49.80 ? 395 THR B OG1 1 
ATOM   1899 C  CG2 . THR B 2 95  ? 13.839  44.857 6.913   1.00 47.51 ? 395 THR B CG2 1 
ATOM   1900 N  N   . LYS B 2 96  ? 15.314  40.793 8.912   1.00 49.17 ? 396 LYS B N   1 
ATOM   1901 C  CA  . LYS B 2 96  ? 15.226  39.346 9.129   1.00 49.03 ? 396 LYS B CA  1 
ATOM   1902 C  C   . LYS B 2 96  ? 16.108  38.914 10.300  1.00 49.33 ? 396 LYS B C   1 
ATOM   1903 O  O   . LYS B 2 96  ? 16.875  39.706 10.829  1.00 49.30 ? 396 LYS B O   1 
ATOM   1904 C  CB  . LYS B 2 96  ? 15.671  38.601 7.871   1.00 48.21 ? 396 LYS B CB  1 
ATOM   1905 C  CG  . LYS B 2 96  ? 14.784  38.814 6.658   1.00 47.84 ? 396 LYS B CG  1 
ATOM   1906 C  CD  . LYS B 2 96  ? 15.391  38.173 5.427   1.00 48.05 ? 396 LYS B CD  1 
ATOM   1907 C  CE  . LYS B 2 96  ? 14.562  38.459 4.190   1.00 47.94 ? 396 LYS B CE  1 
ATOM   1908 N  NZ  . LYS B 2 96  ? 15.397  38.506 2.951   1.00 48.04 ? 396 LYS B NZ  1 
ATOM   1909 N  N   . GLU B 2 97  ? 15.995  37.658 10.711  1.00 50.45 ? 397 GLU B N   1 
ATOM   1910 C  CA  . GLU B 2 97  ? 16.816  37.161 11.807  1.00 50.53 ? 397 GLU B CA  1 
ATOM   1911 C  C   . GLU B 2 97  ? 18.141  36.695 11.238  1.00 50.97 ? 397 GLU B C   1 
ATOM   1912 O  O   . GLU B 2 97  ? 18.213  36.227 10.102  1.00 51.36 ? 397 GLU B O   1 
ATOM   1913 C  CB  . GLU B 2 97  ? 16.110  36.021 12.522  1.00 50.65 ? 397 GLU B CB  1 
ATOM   1914 C  CG  . GLU B 2 97  ? 14.858  36.485 13.222  1.00 53.30 ? 397 GLU B CG  1 
ATOM   1915 C  CD  . GLU B 2 97  ? 13.988  35.342 13.684  1.00 55.58 ? 397 GLU B CD  1 
ATOM   1916 O  OE1 . GLU B 2 97  ? 12.836  35.611 14.105  1.00 57.24 ? 397 GLU B OE1 1 
ATOM   1917 O  OE2 . GLU B 2 97  ? 14.455  34.178 13.626  1.00 56.49 ? 397 GLU B OE2 1 
ATOM   1918 N  N   . LEU B 2 98  ? 19.198  36.827 12.026  1.00 51.14 ? 398 LEU B N   1 
ATOM   1919 C  CA  . LEU B 2 98  ? 20.523  36.453 11.562  1.00 50.51 ? 398 LEU B CA  1 
ATOM   1920 C  C   . LEU B 2 98  ? 21.148  35.331 12.360  1.00 50.96 ? 398 LEU B C   1 
ATOM   1921 O  O   . LEU B 2 98  ? 21.488  35.509 13.531  1.00 50.77 ? 398 LEU B O   1 
ATOM   1922 C  CB  . LEU B 2 98  ? 21.429  37.685 11.586  1.00 49.14 ? 398 LEU B CB  1 
ATOM   1923 C  CG  . LEU B 2 98  ? 22.950  37.561 11.504  1.00 50.10 ? 398 LEU B CG  1 
ATOM   1924 C  CD1 . LEU B 2 98  ? 23.343  36.445 10.569  1.00 48.94 ? 398 LEU B CD1 1 
ATOM   1925 C  CD2 . LEU B 2 98  ? 23.541  38.907 11.050  1.00 48.65 ? 398 LEU B CD2 1 
ATOM   1926 N  N   . TYR B 2 99  ? 21.285  34.168 11.727  1.00 50.98 ? 399 TYR B N   1 
ATOM   1927 C  CA  . TYR B 2 99  ? 21.915  33.026 12.379  1.00 51.13 ? 399 TYR B CA  1 
ATOM   1928 C  C   . TYR B 2 99  ? 23.237  32.809 11.692  1.00 52.43 ? 399 TYR B C   1 
ATOM   1929 O  O   . TYR B 2 99  ? 23.298  32.827 10.473  1.00 52.56 ? 399 TYR B O   1 
ATOM   1930 C  CB  . TYR B 2 99  ? 21.061  31.778 12.245  1.00 47.85 ? 399 TYR B CB  1 
ATOM   1931 C  CG  . TYR B 2 99  ? 19.710  31.917 12.888  1.00 45.22 ? 399 TYR B CG  1 
ATOM   1932 C  CD1 . TYR B 2 99  ? 18.635  32.439 12.185  1.00 43.26 ? 399 TYR B CD1 1 
ATOM   1933 C  CD2 . TYR B 2 99  ? 19.517  31.556 14.217  1.00 43.69 ? 399 TYR B CD2 1 
ATOM   1934 C  CE1 . TYR B 2 99  ? 17.405  32.596 12.791  1.00 42.97 ? 399 TYR B CE1 1 
ATOM   1935 C  CE2 . TYR B 2 99  ? 18.291  31.714 14.829  1.00 41.55 ? 399 TYR B CE2 1 
ATOM   1936 C  CZ  . TYR B 2 99  ? 17.245  32.233 14.116  1.00 41.70 ? 399 TYR B CZ  1 
ATOM   1937 O  OH  . TYR B 2 99  ? 16.043  32.410 14.739  1.00 43.10 ? 399 TYR B OH  1 
ATOM   1938 N  N   . PHE B 2 100 ? 24.306  32.627 12.456  1.00 55.59 ? 400 PHE B N   1 
ATOM   1939 C  CA  . PHE B 2 100 ? 25.606  32.417 11.829  1.00 58.64 ? 400 PHE B CA  1 
ATOM   1940 C  C   . PHE B 2 100 ? 25.805  30.962 11.399  1.00 61.19 ? 400 PHE B C   1 
ATOM   1941 O  O   . PHE B 2 100 ? 26.652  30.660 10.561  1.00 61.70 ? 400 PHE B O   1 
ATOM   1942 C  CB  . PHE B 2 100 ? 26.729  32.860 12.764  1.00 58.51 ? 400 PHE B CB  1 
ATOM   1943 C  CG  . PHE B 2 100 ? 26.867  34.351 12.868  1.00 59.24 ? 400 PHE B CG  1 
ATOM   1944 C  CD1 . PHE B 2 100 ? 26.424  35.032 14.005  1.00 59.87 ? 400 PHE B CD1 1 
ATOM   1945 C  CD2 . PHE B 2 100 ? 27.413  35.083 11.816  1.00 58.36 ? 400 PHE B CD2 1 
ATOM   1946 C  CE1 . PHE B 2 100 ? 26.525  36.425 14.088  1.00 59.37 ? 400 PHE B CE1 1 
ATOM   1947 C  CE2 . PHE B 2 100 ? 27.517  36.468 11.890  1.00 58.76 ? 400 PHE B CE2 1 
ATOM   1948 C  CZ  . PHE B 2 100 ? 27.072  37.142 13.027  1.00 59.98 ? 400 PHE B CZ  1 
ATOM   1949 N  N   . TYR B 2 101 ? 25.017  30.063 11.977  1.00 63.11 ? 401 TYR B N   1 
ATOM   1950 C  CA  . TYR B 2 101 ? 25.095  28.658 11.637  1.00 64.66 ? 401 TYR B CA  1 
ATOM   1951 C  C   . TYR B 2 101 ? 24.162  28.379 10.453  1.00 65.90 ? 401 TYR B C   1 
ATOM   1952 O  O   . TYR B 2 101 ? 23.835  29.352 9.729   1.00 66.23 ? 401 TYR B O   1 
ATOM   1953 C  CB  . TYR B 2 101 ? 24.716  27.811 12.854  1.00 66.06 ? 401 TYR B CB  1 
ATOM   1954 C  CG  . TYR B 2 101 ? 23.290  27.961 13.362  1.00 67.96 ? 401 TYR B CG  1 
ATOM   1955 C  CD1 . TYR B 2 101 ? 22.229  27.289 12.739  1.00 68.46 ? 401 TYR B CD1 1 
ATOM   1956 C  CD2 . TYR B 2 101 ? 23.014  28.693 14.526  1.00 67.89 ? 401 TYR B CD2 1 
ATOM   1957 C  CE1 . TYR B 2 101 ? 20.932  27.328 13.273  1.00 69.22 ? 401 TYR B CE1 1 
ATOM   1958 C  CE2 . TYR B 2 101 ? 21.720  28.745 15.068  1.00 68.73 ? 401 TYR B CE2 1 
ATOM   1959 C  CZ  . TYR B 2 101 ? 20.684  28.055 14.439  1.00 69.54 ? 401 TYR B CZ  1 
ATOM   1960 O  OH  . TYR B 2 101 ? 19.407  28.072 14.980  1.00 70.02 ? 401 TYR B OH  1 
ATOM   1961 N  N   . SER C 1 32  ? 15.373  29.713 30.686  1.00 80.25 ? 148 SER C N   1 
ATOM   1962 C  CA  . SER C 1 32  ? 16.362  29.275 31.723  1.00 81.10 ? 148 SER C CA  1 
ATOM   1963 C  C   . SER C 1 32  ? 16.817  30.480 32.556  1.00 81.72 ? 148 SER C C   1 
ATOM   1964 O  O   . SER C 1 32  ? 16.440  31.628 32.263  1.00 81.77 ? 148 SER C O   1 
ATOM   1965 C  CB  . SER C 1 32  ? 17.574  28.596 31.053  1.00 80.86 ? 148 SER C CB  1 
ATOM   1966 O  OG  . SER C 1 32  ? 18.683  28.469 31.941  1.00 79.92 ? 148 SER C OG  1 
ATOM   1967 N  N   . LEU C 1 33  ? 17.624  30.212 33.589  1.00 81.82 ? 149 LEU C N   1 
ATOM   1968 C  CA  . LEU C 1 33  ? 18.116  31.259 34.490  1.00 81.13 ? 149 LEU C CA  1 
ATOM   1969 C  C   . LEU C 1 33  ? 18.575  32.489 33.712  1.00 80.66 ? 149 LEU C C   1 
ATOM   1970 O  O   . LEU C 1 33  ? 19.412  32.389 32.795  1.00 80.94 ? 149 LEU C O   1 
ATOM   1971 C  CB  . LEU C 1 33  ? 19.275  30.736 35.355  1.00 81.52 ? 149 LEU C CB  1 
ATOM   1972 C  CG  . LEU C 1 33  ? 19.211  29.282 35.864  1.00 82.17 ? 149 LEU C CG  1 
ATOM   1973 C  CD1 . LEU C 1 33  ? 20.157  29.121 37.084  1.00 80.62 ? 149 LEU C CD1 1 
ATOM   1974 C  CD2 . LEU C 1 33  ? 17.761  28.903 36.231  1.00 81.57 ? 149 LEU C CD2 1 
ATOM   1975 N  N   . ASP C 1 34  ? 18.011  33.641 34.072  1.00 79.37 ? 150 ASP C N   1 
ATOM   1976 C  CA  . ASP C 1 34  ? 18.356  34.905 33.426  1.00 77.64 ? 150 ASP C CA  1 
ATOM   1977 C  C   . ASP C 1 34  ? 18.334  34.853 31.887  1.00 76.63 ? 150 ASP C C   1 
ATOM   1978 O  O   . ASP C 1 34  ? 19.101  35.553 31.215  1.00 77.02 ? 150 ASP C O   1 
ATOM   1979 C  CB  . ASP C 1 34  ? 19.730  35.371 33.909  0.00 77.30 ? 150 ASP C CB  1 
ATOM   1980 C  CG  . ASP C 1 34  ? 19.773  35.603 35.407  0.00 76.96 ? 150 ASP C CG  1 
ATOM   1981 O  OD1 . ASP C 1 34  ? 19.536  34.640 36.167  0.00 76.83 ? 150 ASP C OD1 1 
ATOM   1982 O  OD2 . ASP C 1 34  ? 20.043  36.748 35.825  0.00 76.83 ? 150 ASP C OD2 1 
ATOM   1983 N  N   . ASN C 1 35  ? 17.469  34.019 31.320  1.00 74.55 ? 151 ASN C N   1 
ATOM   1984 C  CA  . ASN C 1 35  ? 17.372  33.963 29.869  1.00 71.83 ? 151 ASN C CA  1 
ATOM   1985 C  C   . ASN C 1 35  ? 16.345  35.034 29.500  1.00 69.48 ? 151 ASN C C   1 
ATOM   1986 O  O   . ASN C 1 35  ? 16.605  35.896 28.663  1.00 69.67 ? 151 ASN C O   1 
ATOM   1987 C  CB  . ASN C 1 35  ? 16.875  32.587 29.387  1.00 73.75 ? 151 ASN C CB  1 
ATOM   1988 C  CG  . ASN C 1 35  ? 17.947  31.475 29.482  1.00 75.95 ? 151 ASN C CG  1 
ATOM   1989 O  OD1 . ASN C 1 35  ? 17.732  30.350 28.989  1.00 75.78 ? 151 ASN C OD1 1 
ATOM   1990 N  ND2 . ASN C 1 35  ? 19.092  31.780 30.110  1.00 77.08 ? 151 ASN C ND2 1 
ATOM   1991 N  N   . SER C 1 36  ? 15.191  35.002 30.162  1.00 66.73 ? 152 SER C N   1 
ATOM   1992 C  CA  . SER C 1 36  ? 14.118  35.949 29.865  1.00 64.87 ? 152 SER C CA  1 
ATOM   1993 C  C   . SER C 1 36  ? 13.453  36.638 31.066  1.00 63.86 ? 152 SER C C   1 
ATOM   1994 O  O   . SER C 1 36  ? 13.353  36.080 32.148  1.00 63.01 ? 152 SER C O   1 
ATOM   1995 C  CB  . SER C 1 36  ? 13.042  35.233 29.062  1.00 64.51 ? 152 SER C CB  1 
ATOM   1996 O  OG  . SER C 1 36  ? 12.415  34.262 29.870  1.00 63.44 ? 152 SER C OG  1 
ATOM   1997 N  N   . TYR C 1 37  ? 12.979  37.857 30.858  1.00 63.02 ? 153 TYR C N   1 
ATOM   1998 C  CA  . TYR C 1 37  ? 12.324  38.591 31.927  1.00 63.34 ? 153 TYR C CA  1 
ATOM   1999 C  C   . TYR C 1 37  ? 11.176  37.808 32.561  1.00 64.01 ? 153 TYR C C   1 
ATOM   2000 O  O   . TYR C 1 37  ? 10.499  37.022 31.900  1.00 64.61 ? 153 TYR C O   1 
ATOM   2001 C  CB  . TYR C 1 37  ? 11.773  39.929 31.414  1.00 62.13 ? 153 TYR C CB  1 
ATOM   2002 C  CG  . TYR C 1 37  ? 12.819  40.966 31.074  1.00 60.67 ? 153 TYR C CG  1 
ATOM   2003 C  CD1 . TYR C 1 37  ? 13.330  41.079 29.781  1.00 60.89 ? 153 TYR C CD1 1 
ATOM   2004 C  CD2 . TYR C 1 37  ? 13.309  41.820 32.049  1.00 59.77 ? 153 TYR C CD2 1 
ATOM   2005 C  CE1 . TYR C 1 37  ? 14.307  42.021 29.471  1.00 59.97 ? 153 TYR C CE1 1 
ATOM   2006 C  CE2 . TYR C 1 37  ? 14.285  42.762 31.756  1.00 60.53 ? 153 TYR C CE2 1 
ATOM   2007 C  CZ  . TYR C 1 37  ? 14.783  42.859 30.467  1.00 60.06 ? 153 TYR C CZ  1 
ATOM   2008 O  OH  . TYR C 1 37  ? 15.773  43.776 30.195  1.00 57.69 ? 153 TYR C OH  1 
ATOM   2009 N  N   . LYS C 1 38  ? 10.964  38.043 33.853  1.00 65.01 ? 154 LYS C N   1 
ATOM   2010 C  CA  . LYS C 1 38  ? 9.888   37.402 34.607  1.00 65.11 ? 154 LYS C CA  1 
ATOM   2011 C  C   . LYS C 1 38  ? 8.605   38.182 34.308  1.00 64.50 ? 154 LYS C C   1 
ATOM   2012 O  O   . LYS C 1 38  ? 8.527   39.384 34.566  1.00 63.28 ? 154 LYS C O   1 
ATOM   2013 C  CB  . LYS C 1 38  ? 10.189  37.471 36.111  1.00 65.22 ? 154 LYS C CB  1 
ATOM   2014 C  CG  . LYS C 1 38  ? 9.135   36.829 37.005  1.00 66.01 ? 154 LYS C CG  1 
ATOM   2015 C  CD  . LYS C 1 38  ? 9.317   37.246 38.495  1.00 66.88 ? 154 LYS C CD  1 
ATOM   2016 C  CE  . LYS C 1 38  ? 8.542   36.332 39.468  1.00 65.67 ? 154 LYS C CE  1 
ATOM   2017 N  NZ  . LYS C 1 38  ? 7.109   36.146 39.090  1.00 65.31 ? 154 LYS C NZ  1 
ATOM   2018 N  N   . MET C 1 39  ? 7.604   37.508 33.762  1.00 64.19 ? 155 MET C N   1 
ATOM   2019 C  CA  . MET C 1 39  ? 6.357   38.189 33.460  1.00 64.98 ? 155 MET C CA  1 
ATOM   2020 C  C   . MET C 1 39  ? 5.177   37.657 34.283  1.00 66.70 ? 155 MET C C   1 
ATOM   2021 O  O   . MET C 1 39  ? 4.025   37.929 33.944  1.00 67.61 ? 155 MET C O   1 
ATOM   2022 C  CB  . MET C 1 39  ? 6.045   38.065 31.967  1.00 63.93 ? 155 MET C CB  1 
ATOM   2023 C  CG  . MET C 1 39  ? 7.143   38.596 31.054  1.00 62.60 ? 155 MET C CG  1 
ATOM   2024 S  SD  . MET C 1 39  ? 7.422   40.358 31.300  1.00 62.07 ? 155 MET C SD  1 
ATOM   2025 C  CE  . MET C 1 39  ? 6.113   41.054 30.316  1.00 61.82 ? 155 MET C CE  1 
ATOM   2026 N  N   . ASP C 1 40  ? 5.463   36.912 35.357  1.00 67.34 ? 156 ASP C N   1 
ATOM   2027 C  CA  . ASP C 1 40  ? 4.421   36.351 36.224  1.00 66.76 ? 156 ASP C CA  1 
ATOM   2028 C  C   . ASP C 1 40  ? 3.723   37.386 37.072  1.00 66.41 ? 156 ASP C C   1 
ATOM   2029 O  O   . ASP C 1 40  ? 2.507   37.338 37.217  1.00 66.87 ? 156 ASP C O   1 
ATOM   2030 C  CB  . ASP C 1 40  ? 4.982   35.329 37.204  1.00 67.67 ? 156 ASP C CB  1 
ATOM   2031 C  CG  . ASP C 1 40  ? 5.810   34.290 36.539  1.00 69.40 ? 156 ASP C CG  1 
ATOM   2032 O  OD1 . ASP C 1 40  ? 7.052   34.475 36.496  1.00 70.51 ? 156 ASP C OD1 1 
ATOM   2033 O  OD2 . ASP C 1 40  ? 5.216   33.296 36.055  1.00 70.28 ? 156 ASP C OD2 1 
ATOM   2034 N  N   . TYR C 1 41  A 4.491   38.297 37.661  1.00 65.86 ? 156 TYR C N   1 
ATOM   2035 C  CA  . TYR C 1 41  A 3.913   39.315 38.539  1.00 66.69 ? 156 TYR C CA  1 
ATOM   2036 C  C   . TYR C 1 41  A 2.405   39.536 38.320  1.00 66.98 ? 156 TYR C C   1 
ATOM   2037 O  O   . TYR C 1 41  A 1.907   39.517 37.190  1.00 67.40 ? 156 TYR C O   1 
ATOM   2038 C  CB  . TYR C 1 41  A 4.637   40.664 38.387  1.00 65.58 ? 156 TYR C CB  1 
ATOM   2039 C  CG  . TYR C 1 41  A 6.104   40.679 38.787  1.00 64.41 ? 156 TYR C CG  1 
ATOM   2040 C  CD1 . TYR C 1 41  A 7.075   40.110 37.965  1.00 63.83 ? 156 TYR C CD1 1 
ATOM   2041 C  CD2 . TYR C 1 41  A 6.526   41.326 39.953  1.00 63.83 ? 156 TYR C CD2 1 
ATOM   2042 C  CE1 . TYR C 1 41  A 8.425   40.192 38.283  1.00 63.01 ? 156 TYR C CE1 1 
ATOM   2043 C  CE2 . TYR C 1 41  A 7.879   41.410 40.280  1.00 63.16 ? 156 TYR C CE2 1 
ATOM   2044 C  CZ  . TYR C 1 41  A 8.820   40.843 39.434  1.00 62.93 ? 156 TYR C CZ  1 
ATOM   2045 O  OH  . TYR C 1 41  A 10.161  40.957 39.712  1.00 63.18 ? 156 TYR C OH  1 
ATOM   2046 N  N   . PRO C 1 42  ? 1.665   39.757 39.409  1.00 67.04 ? 161 PRO C N   1 
ATOM   2047 C  CA  . PRO C 1 42  ? 0.223   39.982 39.334  1.00 67.07 ? 161 PRO C CA  1 
ATOM   2048 C  C   . PRO C 1 42  ? -0.174  40.740 38.071  1.00 67.06 ? 161 PRO C C   1 
ATOM   2049 O  O   . PRO C 1 42  ? -0.708  40.158 37.134  1.00 66.47 ? 161 PRO C O   1 
ATOM   2050 C  CB  . PRO C 1 42  ? -0.057  40.786 40.600  1.00 67.60 ? 161 PRO C CB  1 
ATOM   2051 C  CG  . PRO C 1 42  ? 0.903   40.184 41.578  1.00 67.98 ? 161 PRO C CG  1 
ATOM   2052 C  CD  . PRO C 1 42  ? 2.176   40.010 40.769  1.00 67.40 ? 161 PRO C CD  1 
ATOM   2053 N  N   . GLU C 1 43  ? 0.102   42.042 38.058  1.00 67.56 ? 162 GLU C N   1 
ATOM   2054 C  CA  . GLU C 1 43  ? -0.226  42.899 36.920  1.00 68.10 ? 162 GLU C CA  1 
ATOM   2055 C  C   . GLU C 1 43  ? 0.811   42.818 35.790  1.00 68.03 ? 162 GLU C C   1 
ATOM   2056 O  O   . GLU C 1 43  ? 1.995   42.513 36.028  1.00 68.30 ? 162 GLU C O   1 
ATOM   2057 C  CB  . GLU C 1 43  ? -0.363  44.349 37.386  1.00 68.48 ? 162 GLU C CB  1 
ATOM   2058 C  CG  . GLU C 1 43  ? -1.512  44.585 38.353  1.00 70.19 ? 162 GLU C CG  1 
ATOM   2059 C  CD  . GLU C 1 43  ? -1.509  46.001 38.930  1.00 72.64 ? 162 GLU C CD  1 
ATOM   2060 O  OE1 . GLU C 1 43  ? -1.540  46.982 38.131  1.00 73.98 ? 162 GLU C OE1 1 
ATOM   2061 O  OE2 . GLU C 1 43  ? -1.472  46.139 40.184  1.00 73.14 ? 162 GLU C OE2 1 
ATOM   2062 N  N   . MET C 1 44  A 0.360   43.091 34.562  1.00 66.91 ? 162 MET C N   1 
ATOM   2063 C  CA  . MET C 1 44  A 1.244   43.050 33.393  1.00 65.09 ? 162 MET C CA  1 
ATOM   2064 C  C   . MET C 1 44  A 2.042   44.347 33.307  1.00 63.68 ? 162 MET C C   1 
ATOM   2065 O  O   . MET C 1 44  A 3.182   44.370 32.824  1.00 62.91 ? 162 MET C O   1 
ATOM   2066 C  CB  . MET C 1 44  A 0.430   42.859 32.115  1.00 64.92 ? 162 MET C CB  1 
ATOM   2067 C  CG  . MET C 1 44  A 1.277   42.536 30.903  1.00 64.85 ? 162 MET C CG  1 
ATOM   2068 S  SD  . MET C 1 44  A 2.022   40.915 31.062  1.00 65.57 ? 162 MET C SD  1 
ATOM   2069 C  CE  . MET C 1 44  A 1.524   40.141 29.475  1.00 65.63 ? 162 MET C CE  1 
ATOM   2070 N  N   . GLY C 1 45  ? 1.428   45.422 33.794  1.00 62.84 ? 163 GLY C N   1 
ATOM   2071 C  CA  . GLY C 1 45  ? 2.072   46.723 33.799  1.00 60.28 ? 163 GLY C CA  1 
ATOM   2072 C  C   . GLY C 1 45  ? 1.259   47.799 33.112  1.00 59.91 ? 163 GLY C C   1 
ATOM   2073 O  O   . GLY C 1 45  ? 0.254   47.528 32.440  1.00 58.89 ? 163 GLY C O   1 
ATOM   2074 N  N   . LEU C 1 46  ? 1.705   49.036 33.283  1.00 59.77 ? 164 LEU C N   1 
ATOM   2075 C  CA  . LEU C 1 46  ? 1.049   50.187 32.676  1.00 59.93 ? 164 LEU C CA  1 
ATOM   2076 C  C   . LEU C 1 46  ? 1.452   50.364 31.204  1.00 60.71 ? 164 LEU C C   1 
ATOM   2077 O  O   . LEU C 1 46  ? 2.542   49.956 30.783  1.00 61.34 ? 164 LEU C O   1 
ATOM   2078 C  CB  . LEU C 1 46  ? 1.433   51.446 33.443  1.00 59.76 ? 164 LEU C CB  1 
ATOM   2079 C  CG  . LEU C 1 46  ? 0.539   52.000 34.551  1.00 60.45 ? 164 LEU C CG  1 
ATOM   2080 C  CD1 . LEU C 1 46  ? -0.145  50.894 35.336  1.00 60.84 ? 164 LEU C CD1 1 
ATOM   2081 C  CD2 . LEU C 1 46  ? 1.405   52.859 35.454  1.00 60.72 ? 164 LEU C CD2 1 
ATOM   2082 N  N   . CYS C 1 47  ? 0.558   50.969 30.426  1.00 60.53 ? 165 CYS C N   1 
ATOM   2083 C  CA  . CYS C 1 47  ? 0.804   51.254 29.022  1.00 59.60 ? 165 CYS C CA  1 
ATOM   2084 C  C   . CYS C 1 47  ? 0.266   52.651 28.761  1.00 59.42 ? 165 CYS C C   1 
ATOM   2085 O  O   . CYS C 1 47  ? -0.854  52.813 28.281  1.00 59.38 ? 165 CYS C O   1 
ATOM   2086 C  CB  . CYS C 1 47  ? 0.094   50.252 28.114  1.00 59.67 ? 165 CYS C CB  1 
ATOM   2087 S  SG  . CYS C 1 47  ? 0.246   50.621 26.321  1.00 60.65 ? 165 CYS C SG  1 
ATOM   2088 N  N   . ILE C 1 48  ? 1.066   53.657 29.104  1.00 59.18 ? 166 ILE C N   1 
ATOM   2089 C  CA  . ILE C 1 48  ? 0.692   55.049 28.894  1.00 58.99 ? 166 ILE C CA  1 
ATOM   2090 C  C   . ILE C 1 48  ? 0.805   55.405 27.409  1.00 59.39 ? 166 ILE C C   1 
ATOM   2091 O  O   . ILE C 1 48  ? 1.878   55.283 26.821  1.00 59.99 ? 166 ILE C O   1 
ATOM   2092 C  CB  . ILE C 1 48  ? 1.614   55.989 29.669  1.00 58.38 ? 166 ILE C CB  1 
ATOM   2093 C  CG1 . ILE C 1 48  ? 1.729   55.515 31.118  1.00 57.90 ? 166 ILE C CG1 1 
ATOM   2094 C  CG2 . ILE C 1 48  ? 1.081   57.415 29.600  1.00 57.03 ? 166 ILE C CG2 1 
ATOM   2095 C  CD1 . ILE C 1 48  ? 0.458   55.646 31.897  1.00 57.77 ? 166 ILE C CD1 1 
ATOM   2096 N  N   . ILE C 1 49  ? -0.306  55.845 26.818  1.00 58.78 ? 167 ILE C N   1 
ATOM   2097 C  CA  . ILE C 1 49  ? -0.354  56.236 25.413  1.00 56.79 ? 167 ILE C CA  1 
ATOM   2098 C  C   . ILE C 1 49  ? -0.610  57.739 25.286  1.00 56.48 ? 167 ILE C C   1 
ATOM   2099 O  O   . ILE C 1 49  ? -1.712  58.208 25.538  1.00 55.98 ? 167 ILE C O   1 
ATOM   2100 C  CB  . ILE C 1 49  ? -1.476  55.481 24.677  1.00 56.34 ? 167 ILE C CB  1 
ATOM   2101 C  CG1 . ILE C 1 49  ? -1.097  54.012 24.515  1.00 55.47 ? 167 ILE C CG1 1 
ATOM   2102 C  CG2 . ILE C 1 49  ? -1.740  56.130 23.331  1.00 57.17 ? 167 ILE C CG2 1 
ATOM   2103 C  CD1 . ILE C 1 49  ? -2.047  53.227 23.649  1.00 54.64 ? 167 ILE C CD1 1 
ATOM   2104 N  N   . ILE C 1 50  ? 0.412   58.495 24.908  1.00 57.21 ? 168 ILE C N   1 
ATOM   2105 C  CA  . ILE C 1 50  ? 0.259   59.941 24.755  1.00 56.94 ? 168 ILE C CA  1 
ATOM   2106 C  C   . ILE C 1 50  ? -0.042  60.265 23.304  1.00 58.09 ? 168 ILE C C   1 
ATOM   2107 O  O   . ILE C 1 50  ? 0.825   60.170 22.431  1.00 57.22 ? 168 ILE C O   1 
ATOM   2108 C  CB  . ILE C 1 50  ? 1.513   60.696 25.181  1.00 55.66 ? 168 ILE C CB  1 
ATOM   2109 C  CG1 . ILE C 1 50  ? 1.843   60.353 26.631  1.00 54.10 ? 168 ILE C CG1 1 
ATOM   2110 C  CG2 . ILE C 1 50  ? 1.281   62.186 25.030  1.00 54.86 ? 168 ILE C CG2 1 
ATOM   2111 C  CD1 . ILE C 1 50  ? 3.034   61.109 27.194  1.00 54.61 ? 168 ILE C CD1 1 
ATOM   2112 N  N   . ASN C 1 51  ? -1.285  60.660 23.064  1.00 59.57 ? 169 ASN C N   1 
ATOM   2113 C  CA  . ASN C 1 51  ? -1.763  60.962 21.728  1.00 60.81 ? 169 ASN C CA  1 
ATOM   2114 C  C   . ASN C 1 51  ? -1.953  62.459 21.495  1.00 61.35 ? 169 ASN C C   1 
ATOM   2115 O  O   . ASN C 1 51  ? -3.005  62.992 21.827  1.00 62.40 ? 169 ASN C O   1 
ATOM   2116 C  CB  . ASN C 1 51  ? -3.085  60.224 21.525  1.00 60.97 ? 169 ASN C CB  1 
ATOM   2117 C  CG  . ASN C 1 51  ? -3.653  60.410 20.145  1.00 62.24 ? 169 ASN C CG  1 
ATOM   2118 O  OD1 . ASN C 1 51  ? -4.820  60.111 19.905  1.00 63.04 ? 169 ASN C OD1 1 
ATOM   2119 N  ND2 . ASN C 1 51  ? -2.832  60.895 19.222  1.00 63.38 ? 169 ASN C ND2 1 
ATOM   2120 N  N   . ASN C 1 52  ? -0.944  63.124 20.923  1.00 61.63 ? 170 ASN C N   1 
ATOM   2121 C  CA  . ASN C 1 52  ? -1.000  64.567 20.638  1.00 62.34 ? 170 ASN C CA  1 
ATOM   2122 C  C   . ASN C 1 52  ? -1.427  64.861 19.206  1.00 63.45 ? 170 ASN C C   1 
ATOM   2123 O  O   . ASN C 1 52  ? -0.648  64.666 18.266  1.00 64.31 ? 170 ASN C O   1 
ATOM   2124 C  CB  . ASN C 1 52  ? 0.358   65.223 20.882  1.00 62.46 ? 170 ASN C CB  1 
ATOM   2125 C  CG  . ASN C 1 52  ? 0.585   65.545 22.333  1.00 63.41 ? 170 ASN C CG  1 
ATOM   2126 O  OD1 . ASN C 1 52  ? -0.365  65.576 23.118  1.00 64.17 ? 170 ASN C OD1 1 
ATOM   2127 N  ND2 . ASN C 1 52  ? 1.838   65.804 22.705  1.00 63.24 ? 170 ASN C ND2 1 
ATOM   2128 N  N   . LYS C 1 53  ? -2.650  65.364 19.046  1.00 64.09 ? 171 LYS C N   1 
ATOM   2129 C  CA  . LYS C 1 53  ? -3.203  65.653 17.722  1.00 63.19 ? 171 LYS C CA  1 
ATOM   2130 C  C   . LYS C 1 53  ? -3.215  67.110 17.306  1.00 62.57 ? 171 LYS C C   1 
ATOM   2131 O  O   . LYS C 1 53  ? -2.897  67.413 16.159  1.00 62.71 ? 171 LYS C O   1 
ATOM   2132 C  CB  . LYS C 1 53  ? -4.617  65.087 17.634  1.00 64.24 ? 171 LYS C CB  1 
ATOM   2133 C  CG  . LYS C 1 53  ? -5.381  65.412 16.353  1.00 65.66 ? 171 LYS C CG  1 
ATOM   2134 C  CD  . LYS C 1 53  ? -6.712  64.632 16.308  1.00 66.26 ? 171 LYS C CD  1 
ATOM   2135 C  CE  . LYS C 1 53  ? -7.526  64.885 17.570  0.00 66.08 ? 171 LYS C CE  1 
ATOM   2136 N  NZ  . LYS C 1 53  ? -8.730  64.017 17.666  0.00 66.30 ? 171 LYS C NZ  1 
ATOM   2137 N  N   . ASN C 1 54  ? -3.575  68.013 18.215  1.00 62.03 ? 172 ASN C N   1 
ATOM   2138 C  CA  . ASN C 1 54  ? -3.621  69.438 17.871  1.00 61.68 ? 172 ASN C CA  1 
ATOM   2139 C  C   . ASN C 1 54  ? -2.569  70.235 18.614  1.00 60.77 ? 172 ASN C C   1 
ATOM   2140 O  O   . ASN C 1 54  ? -2.318  69.995 19.791  1.00 61.17 ? 172 ASN C O   1 
ATOM   2141 C  CB  . ASN C 1 54  ? -5.002  70.017 18.184  1.00 63.62 ? 172 ASN C CB  1 
ATOM   2142 C  CG  . ASN C 1 54  ? -6.125  69.064 17.822  1.00 65.68 ? 172 ASN C CG  1 
ATOM   2143 O  OD1 . ASN C 1 54  ? -6.587  68.270 18.654  1.00 66.48 ? 172 ASN C OD1 1 
ATOM   2144 N  ND2 . ASN C 1 54  ? -6.556  69.119 16.566  1.00 66.83 ? 172 ASN C ND2 1 
ATOM   2145 N  N   . PHE C 1 55  ? -1.968  71.201 17.930  1.00 60.70 ? 173 PHE C N   1 
ATOM   2146 C  CA  . PHE C 1 55  ? -0.919  72.024 18.532  1.00 61.54 ? 173 PHE C CA  1 
ATOM   2147 C  C   . PHE C 1 55  ? -1.205  73.533 18.492  1.00 62.51 ? 173 PHE C C   1 
ATOM   2148 O  O   . PHE C 1 55  ? -1.873  74.030 17.583  1.00 61.74 ? 173 PHE C O   1 
ATOM   2149 C  CB  . PHE C 1 55  ? 0.426   71.725 17.846  1.00 60.41 ? 173 PHE C CB  1 
ATOM   2150 C  CG  . PHE C 1 55  ? 0.802   70.262 17.865  1.00 59.78 ? 173 PHE C CG  1 
ATOM   2151 C  CD1 . PHE C 1 55  ? 0.147   69.351 17.042  1.00 59.72 ? 173 PHE C CD1 1 
ATOM   2152 C  CD2 . PHE C 1 55  ? 1.756   69.787 18.758  1.00 59.12 ? 173 PHE C CD2 1 
ATOM   2153 C  CE1 . PHE C 1 55  ? 0.426   67.996 17.113  1.00 59.37 ? 173 PHE C CE1 1 
ATOM   2154 C  CE2 . PHE C 1 55  ? 2.041   68.434 18.837  1.00 59.73 ? 173 PHE C CE2 1 
ATOM   2155 C  CZ  . PHE C 1 55  ? 1.371   67.533 18.010  1.00 59.65 ? 173 PHE C CZ  1 
ATOM   2156 N  N   . HIS C 1 56  ? -0.694  74.249 19.492  1.00 64.01 ? 174 HIS C N   1 
ATOM   2157 C  CA  . HIS C 1 56  ? -0.878  75.694 19.604  1.00 66.23 ? 174 HIS C CA  1 
ATOM   2158 C  C   . HIS C 1 56  ? -0.367  76.371 18.349  1.00 67.54 ? 174 HIS C C   1 
ATOM   2159 O  O   . HIS C 1 56  ? 0.630   75.935 17.772  1.00 67.54 ? 174 HIS C O   1 
ATOM   2160 C  CB  . HIS C 1 56  ? -0.084  76.251 20.785  1.00 67.91 ? 174 HIS C CB  1 
ATOM   2161 C  CG  . HIS C 1 56  ? -0.576  75.800 22.123  1.00 69.50 ? 174 HIS C CG  1 
ATOM   2162 N  ND1 . HIS C 1 56  ? -1.015  74.514 22.366  1.00 70.23 ? 174 HIS C ND1 1 
ATOM   2163 C  CD2 . HIS C 1 56  ? -0.648  76.453 23.309  1.00 70.86 ? 174 HIS C CD2 1 
ATOM   2164 C  CE1 . HIS C 1 56  ? -1.334  74.394 23.644  1.00 71.03 ? 174 HIS C CE1 1 
ATOM   2165 N  NE2 . HIS C 1 56  ? -1.119  75.556 24.239  1.00 71.77 ? 174 HIS C NE2 1 
ATOM   2166 N  N   . LYS C 1 57  ? -1.026  77.450 17.934  1.00 68.87 ? 175 LYS C N   1 
ATOM   2167 C  CA  . LYS C 1 57  ? -0.579  78.161 16.739  1.00 69.56 ? 175 LYS C CA  1 
ATOM   2168 C  C   . LYS C 1 57  ? 0.852   78.654 16.974  1.00 68.99 ? 175 LYS C C   1 
ATOM   2169 O  O   . LYS C 1 57  ? 1.618   78.851 16.038  1.00 68.28 ? 175 LYS C O   1 
ATOM   2170 C  CB  . LYS C 1 57  ? -1.520  79.341 16.430  1.00 71.13 ? 175 LYS C CB  1 
ATOM   2171 C  CG  . LYS C 1 57  ? -2.921  78.908 15.979  1.00 73.03 ? 175 LYS C CG  1 
ATOM   2172 C  CD  . LYS C 1 57  ? -3.836  80.099 15.702  1.00 74.32 ? 175 LYS C CD  1 
ATOM   2173 C  CE  . LYS C 1 57  ? -5.301  79.661 15.529  1.00 74.95 ? 175 LYS C CE  1 
ATOM   2174 N  NZ  . LYS C 1 57  ? -6.256  80.831 15.475  1.00 74.68 ? 175 LYS C NZ  1 
ATOM   2175 N  N   . SER C 1 58  A 1.207   78.825 18.240  1.00 69.21 ? 175 SER C N   1 
ATOM   2176 C  CA  . SER C 1 58  A 2.541   79.294 18.614  1.00 69.77 ? 175 SER C CA  1 
ATOM   2177 C  C   . SER C 1 58  A 3.668   78.335 18.219  1.00 69.19 ? 175 SER C C   1 
ATOM   2178 O  O   . SER C 1 58  A 4.826   78.749 18.093  1.00 68.30 ? 175 SER C O   1 
ATOM   2179 C  CB  . SER C 1 58  A 2.611   79.524 20.131  1.00 71.15 ? 175 SER C CB  1 
ATOM   2180 O  OG  . SER C 1 58  A 2.462   78.292 20.844  1.00 72.76 ? 175 SER C OG  1 
ATOM   2181 N  N   . THR C 1 59  B 3.337   77.057 18.040  1.00 68.63 ? 175 THR C N   1 
ATOM   2182 C  CA  . THR C 1 59  B 4.345   76.058 17.688  1.00 67.87 ? 175 THR C CA  1 
ATOM   2183 C  C   . THR C 1 59  B 4.600   76.038 16.196  1.00 67.35 ? 175 THR C C   1 
ATOM   2184 O  O   . THR C 1 59  B 5.698   75.715 15.749  1.00 67.07 ? 175 THR C O   1 
ATOM   2185 C  CB  . THR C 1 59  B 3.918   74.640 18.106  1.00 67.56 ? 175 THR C CB  1 
ATOM   2186 O  OG1 . THR C 1 59  B 2.699   74.302 17.434  1.00 68.26 ? 175 THR C OG1 1 
ATOM   2187 C  CG2 . THR C 1 59  B 3.705   74.555 19.622  1.00 67.46 ? 175 THR C CG2 1 
ATOM   2188 N  N   . GLY C 1 60  C 3.576   76.382 15.426  1.00 67.27 ? 175 GLY C N   1 
ATOM   2189 C  CA  . GLY C 1 60  C 3.716   76.397 13.978  1.00 66.68 ? 175 GLY C CA  1 
ATOM   2190 C  C   . GLY C 1 60  C 3.475   75.018 13.399  1.00 66.38 ? 175 GLY C C   1 
ATOM   2191 O  O   . GLY C 1 60  C 3.423   74.830 12.183  1.00 65.80 ? 175 GLY C O   1 
ATOM   2192 N  N   . MET C 1 61  ? 3.321   74.047 14.291  1.00 66.24 ? 176 MET C N   1 
ATOM   2193 C  CA  . MET C 1 61  ? 3.090   72.660 13.905  1.00 65.35 ? 176 MET C CA  1 
ATOM   2194 C  C   . MET C 1 61  ? 1.646   72.414 13.491  1.00 65.21 ? 176 MET C C   1 
ATOM   2195 O  O   . MET C 1 61  ? 0.708   72.875 14.142  1.00 66.38 ? 176 MET C O   1 
ATOM   2196 C  CB  . MET C 1 61  ? 3.441   71.740 15.072  1.00 64.36 ? 176 MET C CB  1 
ATOM   2197 C  CG  . MET C 1 61  ? 4.871   71.877 15.544  1.00 63.96 ? 176 MET C CG  1 
ATOM   2198 S  SD  . MET C 1 61  ? 6.061   71.312 14.292  1.00 61.71 ? 176 MET C SD  1 
ATOM   2199 C  CE  . MET C 1 61  ? 7.417   72.511 14.588  1.00 63.48 ? 176 MET C CE  1 
ATOM   2200 N  N   . THR C 1 62  ? 1.468   71.673 12.408  1.00 65.38 ? 177 THR C N   1 
ATOM   2201 C  CA  . THR C 1 62  ? 0.134   71.349 11.922  1.00 65.06 ? 177 THR C CA  1 
ATOM   2202 C  C   . THR C 1 62  ? -0.426  70.160 12.685  1.00 64.57 ? 177 THR C C   1 
ATOM   2203 O  O   . THR C 1 62  ? 0.298   69.452 13.384  1.00 65.22 ? 177 THR C O   1 
ATOM   2204 C  CB  . THR C 1 62  ? 0.156   70.978 10.441  1.00 65.65 ? 177 THR C CB  1 
ATOM   2205 O  OG1 . THR C 1 62  ? 0.938   69.788 10.257  1.00 63.85 ? 177 THR C OG1 1 
ATOM   2206 C  CG2 . THR C 1 62  ? 0.755   72.124 9.634   1.00 67.55 ? 177 THR C CG2 1 
ATOM   2207 N  N   . SER C 1 63  ? -1.721  69.933 12.527  1.00 63.40 ? 178 SER C N   1 
ATOM   2208 C  CA  . SER C 1 63  ? -2.380  68.838 13.206  1.00 63.15 ? 178 SER C CA  1 
ATOM   2209 C  C   . SER C 1 63  ? -1.899  67.503 12.661  1.00 62.33 ? 178 SER C C   1 
ATOM   2210 O  O   . SER C 1 63  ? -1.361  67.428 11.560  1.00 62.64 ? 178 SER C O   1 
ATOM   2211 C  CB  . SER C 1 63  ? -3.887  68.946 13.014  1.00 63.60 ? 178 SER C CB  1 
ATOM   2212 O  OG  . SER C 1 63  ? -4.237  68.612 11.679  1.00 65.77 ? 178 SER C OG  1 
ATOM   2213 N  N   . ARG C 1 64  ? -2.103  66.453 13.445  1.00 61.67 ? 179 ARG C N   1 
ATOM   2214 C  CA  . ARG C 1 64  ? -1.702  65.120 13.048  1.00 61.74 ? 179 ARG C CA  1 
ATOM   2215 C  C   . ARG C 1 64  ? -2.951  64.264 12.911  1.00 62.18 ? 179 ARG C C   1 
ATOM   2216 O  O   . ARG C 1 64  ? -3.157  63.285 13.632  1.00 61.10 ? 179 ARG C O   1 
ATOM   2217 C  CB  . ARG C 1 64  ? -0.724  64.537 14.073  1.00 60.72 ? 179 ARG C CB  1 
ATOM   2218 C  CG  . ARG C 1 64  ? 0.571   65.334 14.161  1.00 59.90 ? 179 ARG C CG  1 
ATOM   2219 C  CD  . ARG C 1 64  ? 1.543   64.777 15.208  1.00 60.42 ? 179 ARG C CD  1 
ATOM   2220 N  NE  . ARG C 1 64  ? 2.039   63.435 14.886  1.00 59.65 ? 179 ARG C NE  1 
ATOM   2221 C  CZ  . ARG C 1 64  ? 1.573   62.300 15.404  1.00 58.03 ? 179 ARG C CZ  1 
ATOM   2222 N  NH1 . ARG C 1 64  ? 0.582   62.307 16.287  1.00 56.03 ? 179 ARG C NH1 1 
ATOM   2223 N  NH2 . ARG C 1 64  ? 2.115   61.151 15.034  1.00 58.06 ? 179 ARG C NH2 1 
ATOM   2224 N  N   . SER C 1 65  ? -3.799  64.664 11.975  1.00 63.57 ? 180 SER C N   1 
ATOM   2225 C  CA  . SER C 1 65  ? -5.037  63.942 11.718  1.00 65.14 ? 180 SER C CA  1 
ATOM   2226 C  C   . SER C 1 65  ? -4.709  62.474 11.483  1.00 66.20 ? 180 SER C C   1 
ATOM   2227 O  O   . SER C 1 65  ? -3.647  62.144 10.933  1.00 67.58 ? 180 SER C O   1 
ATOM   2228 C  CB  . SER C 1 65  ? -5.738  64.532 10.490  1.00 64.42 ? 180 SER C CB  1 
ATOM   2229 O  OG  . SER C 1 65  ? -4.861  64.548 9.378   1.00 65.40 ? 180 SER C OG  1 
ATOM   2230 N  N   . GLY C 1 66  ? -5.614  61.596 11.904  1.00 66.58 ? 181 GLY C N   1 
ATOM   2231 C  CA  . GLY C 1 66  ? -5.388  60.168 11.722  1.00 66.97 ? 181 GLY C CA  1 
ATOM   2232 C  C   . GLY C 1 66  ? -4.643  59.559 12.891  1.00 66.52 ? 181 GLY C C   1 
ATOM   2233 O  O   . GLY C 1 66  ? -4.529  58.336 12.989  1.00 66.99 ? 181 GLY C O   1 
ATOM   2234 N  N   . THR C 1 67  ? -4.144  60.410 13.785  1.00 65.58 ? 182 THR C N   1 
ATOM   2235 C  CA  . THR C 1 67  ? -3.400  59.936 14.944  1.00 64.65 ? 182 THR C CA  1 
ATOM   2236 C  C   . THR C 1 67  ? -4.277  59.093 15.870  1.00 64.12 ? 182 THR C C   1 
ATOM   2237 O  O   . THR C 1 67  ? -3.784  58.178 16.535  1.00 65.28 ? 182 THR C O   1 
ATOM   2238 C  CB  . THR C 1 67  ? -2.802  61.121 15.741  1.00 64.52 ? 182 THR C CB  1 
ATOM   2239 O  OG1 . THR C 1 67  ? -1.860  60.625 16.702  1.00 64.59 ? 182 THR C OG1 1 
ATOM   2240 C  CG2 . THR C 1 67  ? -3.903  61.904 16.452  1.00 62.79 ? 182 THR C CG2 1 
ATOM   2241 N  N   . ASP C 1 68  ? -5.575  59.393 15.902  1.00 63.12 ? 183 ASP C N   1 
ATOM   2242 C  CA  . ASP C 1 68  ? -6.515  58.659 16.755  1.00 61.90 ? 183 ASP C CA  1 
ATOM   2243 C  C   . ASP C 1 68  ? -6.662  57.177 16.375  1.00 60.23 ? 183 ASP C C   1 
ATOM   2244 O  O   . ASP C 1 68  ? -6.849  56.322 17.239  1.00 58.96 ? 183 ASP C O   1 
ATOM   2245 C  CB  . ASP C 1 68  ? -7.878  59.356 16.734  1.00 63.60 ? 183 ASP C CB  1 
ATOM   2246 C  CG  . ASP C 1 68  ? -7.858  60.703 17.451  1.00 65.90 ? 183 ASP C CG  1 
ATOM   2247 O  OD1 . ASP C 1 68  ? -8.857  61.450 17.365  1.00 67.98 ? 183 ASP C OD1 1 
ATOM   2248 O  OD2 . ASP C 1 68  ? -6.845  61.026 18.112  1.00 67.43 ? 183 ASP C OD2 1 
ATOM   2249 N  N   . VAL C 1 69  ? -6.579  56.870 15.087  1.00 58.41 ? 184 VAL C N   1 
ATOM   2250 C  CA  . VAL C 1 69  ? -6.677  55.484 14.662  1.00 58.22 ? 184 VAL C CA  1 
ATOM   2251 C  C   . VAL C 1 69  ? -5.555  54.705 15.352  1.00 58.17 ? 184 VAL C C   1 
ATOM   2252 O  O   . VAL C 1 69  ? -5.746  53.561 15.773  1.00 58.49 ? 184 VAL C O   1 
ATOM   2253 C  CB  . VAL C 1 69  ? -6.506  55.342 13.142  1.00 58.94 ? 184 VAL C CB  1 
ATOM   2254 C  CG1 . VAL C 1 69  ? -6.510  53.874 12.752  1.00 58.37 ? 184 VAL C CG1 1 
ATOM   2255 C  CG2 . VAL C 1 69  ? -7.606  56.088 12.423  1.00 59.09 ? 184 VAL C CG2 1 
ATOM   2256 N  N   . ASP C 1 70  ? -4.379  55.324 15.451  1.00 57.28 ? 185 ASP C N   1 
ATOM   2257 C  CA  . ASP C 1 70  ? -3.245  54.695 16.114  1.00 55.79 ? 185 ASP C CA  1 
ATOM   2258 C  C   . ASP C 1 70  ? -3.592  54.523 17.583  1.00 55.28 ? 185 ASP C C   1 
ATOM   2259 O  O   . ASP C 1 70  ? -3.601  53.408 18.099  1.00 54.41 ? 185 ASP C O   1 
ATOM   2260 C  CB  . ASP C 1 70  ? -1.989  55.562 16.007  1.00 55.54 ? 185 ASP C CB  1 
ATOM   2261 C  CG  . ASP C 1 70  ? -1.260  55.384 14.689  1.00 54.84 ? 185 ASP C CG  1 
ATOM   2262 O  OD1 . ASP C 1 70  ? -1.609  54.453 13.934  1.00 53.14 ? 185 ASP C OD1 1 
ATOM   2263 O  OD2 . ASP C 1 70  ? -0.330  56.177 14.419  1.00 54.22 ? 185 ASP C OD2 1 
ATOM   2264 N  N   . ALA C 1 71  ? -3.878  55.643 18.246  1.00 54.86 ? 186 ALA C N   1 
ATOM   2265 C  CA  . ALA C 1 71  ? -4.224  55.643 19.667  1.00 55.83 ? 186 ALA C CA  1 
ATOM   2266 C  C   . ALA C 1 71  ? -5.245  54.554 19.967  1.00 55.95 ? 186 ALA C C   1 
ATOM   2267 O  O   . ALA C 1 71  ? -5.177  53.862 20.990  1.00 55.98 ? 186 ALA C O   1 
ATOM   2268 C  CB  . ALA C 1 71  ? -4.778  57.007 20.067  1.00 55.32 ? 186 ALA C CB  1 
ATOM   2269 N  N   . ALA C 1 72  ? -6.200  54.405 19.061  1.00 56.12 ? 187 ALA C N   1 
ATOM   2270 C  CA  . ALA C 1 72  ? -7.219  53.397 19.227  1.00 55.85 ? 187 ALA C CA  1 
ATOM   2271 C  C   . ALA C 1 72  ? -6.564  52.021 19.116  1.00 55.84 ? 187 ALA C C   1 
ATOM   2272 O  O   . ALA C 1 72  ? -6.545  51.256 20.074  1.00 55.40 ? 187 ALA C O   1 
ATOM   2273 C  CB  . ALA C 1 72  ? -8.285  53.568 18.161  1.00 55.01 ? 187 ALA C CB  1 
ATOM   2274 N  N   . ASN C 1 73  ? -5.997  51.730 17.948  1.00 56.47 ? 188 ASN C N   1 
ATOM   2275 C  CA  . ASN C 1 73  ? -5.372  50.438 17.690  1.00 56.87 ? 188 ASN C CA  1 
ATOM   2276 C  C   . ASN C 1 73  ? -4.414  49.972 18.784  1.00 58.53 ? 188 ASN C C   1 
ATOM   2277 O  O   . ASN C 1 73  ? -4.428  48.799 19.169  1.00 59.44 ? 188 ASN C O   1 
ATOM   2278 C  CB  . ASN C 1 73  ? -4.643  50.463 16.352  1.00 54.45 ? 188 ASN C CB  1 
ATOM   2279 C  CG  . ASN C 1 73  ? -4.336  49.072 15.836  1.00 54.47 ? 188 ASN C CG  1 
ATOM   2280 O  OD1 . ASN C 1 73  ? -3.747  48.910 14.762  1.00 53.47 ? 188 ASN C OD1 1 
ATOM   2281 N  ND2 . ASN C 1 73  ? -4.739  48.051 16.599  1.00 54.14 ? 188 ASN C ND2 1 
ATOM   2282 N  N   . LEU C 1 74  ? -3.573  50.880 19.273  1.00 59.60 ? 189 LEU C N   1 
ATOM   2283 C  CA  . LEU C 1 74  ? -2.626  50.546 20.335  1.00 59.99 ? 189 LEU C CA  1 
ATOM   2284 C  C   . LEU C 1 74  ? -3.390  50.102 21.577  1.00 61.77 ? 189 LEU C C   1 
ATOM   2285 O  O   . LEU C 1 74  ? -3.085  49.064 22.170  1.00 61.69 ? 189 LEU C O   1 
ATOM   2286 C  CB  . LEU C 1 74  ? -1.762  51.761 20.668  1.00 57.95 ? 189 LEU C CB  1 
ATOM   2287 C  CG  . LEU C 1 74  ? -0.643  52.008 19.670  1.00 57.07 ? 189 LEU C CG  1 
ATOM   2288 C  CD1 . LEU C 1 74  ? -0.166  53.429 19.782  1.00 56.70 ? 189 LEU C CD1 1 
ATOM   2289 C  CD2 . LEU C 1 74  ? 0.477   51.017 19.929  1.00 56.72 ? 189 LEU C CD2 1 
ATOM   2290 N  N   . ARG C 1 75  ? -4.393  50.892 21.957  1.00 63.85 ? 190 ARG C N   1 
ATOM   2291 C  CA  . ARG C 1 75  ? -5.212  50.583 23.119  1.00 65.34 ? 190 ARG C CA  1 
ATOM   2292 C  C   . ARG C 1 75  ? -5.742  49.139 23.044  1.00 66.03 ? 190 ARG C C   1 
ATOM   2293 O  O   . ARG C 1 75  ? -5.538  48.345 23.972  1.00 66.35 ? 190 ARG C O   1 
ATOM   2294 C  CB  . ARG C 1 75  ? -6.378  51.568 23.220  1.00 66.44 ? 190 ARG C CB  1 
ATOM   2295 C  CG  . ARG C 1 75  ? -7.080  51.475 24.545  1.00 69.49 ? 190 ARG C CG  1 
ATOM   2296 C  CD  . ARG C 1 75  ? -8.304  52.360 24.679  1.00 71.70 ? 190 ARG C CD  1 
ATOM   2297 N  NE  . ARG C 1 75  ? -8.860  52.161 26.018  1.00 75.17 ? 190 ARG C NE  1 
ATOM   2298 C  CZ  . ARG C 1 75  ? -10.056 52.576 26.431  1.00 76.71 ? 190 ARG C CZ  1 
ATOM   2299 N  NH1 . ARG C 1 75  ? -10.436 52.320 27.681  1.00 76.47 ? 190 ARG C NH1 1 
ATOM   2300 N  NH2 . ARG C 1 75  ? -10.874 53.238 25.606  1.00 77.60 ? 190 ARG C NH2 1 
ATOM   2301 N  N   . GLU C 1 76  ? -6.411  48.795 21.944  1.00 66.37 ? 191 GLU C N   1 
ATOM   2302 C  CA  . GLU C 1 76  ? -6.928  47.442 21.775  1.00 67.52 ? 191 GLU C CA  1 
ATOM   2303 C  C   . GLU C 1 76  ? -5.791  46.437 21.914  1.00 67.19 ? 191 GLU C C   1 
ATOM   2304 O  O   . GLU C 1 76  ? -5.842  45.517 22.741  1.00 67.44 ? 191 GLU C O   1 
ATOM   2305 C  CB  . GLU C 1 76  ? -7.579  47.271 20.393  1.00 69.92 ? 191 GLU C CB  1 
ATOM   2306 C  CG  . GLU C 1 76  ? -8.000  45.818 20.084  1.00 73.93 ? 191 GLU C CG  1 
ATOM   2307 C  CD  . GLU C 1 76  ? -8.587  45.617 18.667  1.00 76.57 ? 191 GLU C CD  1 
ATOM   2308 O  OE1 . GLU C 1 76  ? -7.889  45.930 17.665  1.00 78.09 ? 191 GLU C OE1 1 
ATOM   2309 O  OE2 . GLU C 1 76  ? -9.745  45.134 18.554  1.00 77.57 ? 191 GLU C OE2 1 
ATOM   2310 N  N   . THR C 1 77  ? -4.757  46.632 21.103  1.00 66.92 ? 192 THR C N   1 
ATOM   2311 C  CA  . THR C 1 77  ? -3.601  45.745 21.090  1.00 66.92 ? 192 THR C CA  1 
ATOM   2312 C  C   . THR C 1 77  ? -3.053  45.421 22.472  1.00 67.09 ? 192 THR C C   1 
ATOM   2313 O  O   . THR C 1 77  ? -2.953  44.248 22.851  1.00 66.31 ? 192 THR C O   1 
ATOM   2314 C  CB  . THR C 1 77  ? -2.447  46.335 20.251  1.00 66.62 ? 192 THR C CB  1 
ATOM   2315 O  OG1 . THR C 1 77  ? -2.872  46.508 18.894  1.00 67.72 ? 192 THR C OG1 1 
ATOM   2316 C  CG2 . THR C 1 77  ? -1.251  45.406 20.276  1.00 65.90 ? 192 THR C CG2 1 
ATOM   2317 N  N   . PHE C 1 78  ? -2.703  46.461 23.226  1.00 67.22 ? 193 PHE C N   1 
ATOM   2318 C  CA  . PHE C 1 78  ? -2.130  46.256 24.545  1.00 67.86 ? 193 PHE C CA  1 
ATOM   2319 C  C   . PHE C 1 78  ? -3.120  45.838 25.607  1.00 68.30 ? 193 PHE C C   1 
ATOM   2320 O  O   . PHE C 1 78  ? -2.729  45.295 26.639  1.00 67.84 ? 193 PHE C O   1 
ATOM   2321 C  CB  . PHE C 1 78  ? -1.338  47.495 24.987  1.00 67.82 ? 193 PHE C CB  1 
ATOM   2322 C  CG  . PHE C 1 78  ? -0.004  47.613 24.308  1.00 67.74 ? 193 PHE C CG  1 
ATOM   2323 C  CD1 . PHE C 1 78  ? 0.090   48.100 23.007  1.00 67.48 ? 193 PHE C CD1 1 
ATOM   2324 C  CD2 . PHE C 1 78  ? 1.147   47.147 24.935  1.00 68.20 ? 193 PHE C CD2 1 
ATOM   2325 C  CE1 . PHE C 1 78  ? 1.306   48.114 22.337  1.00 67.21 ? 193 PHE C CE1 1 
ATOM   2326 C  CE2 . PHE C 1 78  ? 2.376   47.154 24.274  1.00 68.06 ? 193 PHE C CE2 1 
ATOM   2327 C  CZ  . PHE C 1 78  ? 2.455   47.639 22.968  1.00 67.69 ? 193 PHE C CZ  1 
ATOM   2328 N  N   . ARG C 1 79  ? -4.403  46.090 25.380  1.00 69.47 ? 194 ARG C N   1 
ATOM   2329 C  CA  . ARG C 1 79  ? -5.381  45.641 26.364  1.00 70.58 ? 194 ARG C CA  1 
ATOM   2330 C  C   . ARG C 1 79  ? -5.383  44.128 26.208  1.00 70.07 ? 194 ARG C C   1 
ATOM   2331 O  O   . ARG C 1 79  ? -5.257  43.396 27.188  1.00 70.36 ? 194 ARG C O   1 
ATOM   2332 C  CB  . ARG C 1 79  ? -6.780  46.216 26.090  1.00 72.33 ? 194 ARG C CB  1 
ATOM   2333 C  CG  . ARG C 1 79  ? -6.929  47.702 26.475  1.00 75.59 ? 194 ARG C CG  1 
ATOM   2334 C  CD  . ARG C 1 79  ? -8.271  48.271 26.014  1.00 77.97 ? 194 ARG C CD  1 
ATOM   2335 N  NE  . ARG C 1 79  ? -9.389  47.630 26.700  1.00 80.17 ? 194 ARG C NE  1 
ATOM   2336 C  CZ  . ARG C 1 79  ? -9.701  47.857 27.975  1.00 81.70 ? 194 ARG C CZ  1 
ATOM   2337 N  NH1 . ARG C 1 79  ? -8.978  48.719 28.695  1.00 81.74 ? 194 ARG C NH1 1 
ATOM   2338 N  NH2 . ARG C 1 79  ? -10.731 47.218 28.530  1.00 82.12 ? 194 ARG C NH2 1 
ATOM   2339 N  N   . ASN C 1 80  ? -5.482  43.662 24.966  1.00 69.13 ? 195 ASN C N   1 
ATOM   2340 C  CA  . ASN C 1 80  ? -5.489  42.228 24.711  1.00 68.78 ? 195 ASN C CA  1 
ATOM   2341 C  C   . ASN C 1 80  ? -4.250  41.566 25.303  1.00 68.54 ? 195 ASN C C   1 
ATOM   2342 O  O   . ASN C 1 80  ? -4.222  40.353 25.496  1.00 68.61 ? 195 ASN C O   1 
ATOM   2343 C  CB  . ASN C 1 80  ? -5.563  41.959 23.208  1.00 69.24 ? 195 ASN C CB  1 
ATOM   2344 C  CG  . ASN C 1 80  ? -6.889  42.408 22.598  1.00 69.48 ? 195 ASN C CG  1 
ATOM   2345 O  OD1 . ASN C 1 80  ? -7.003  42.552 21.380  1.00 70.14 ? 195 ASN C OD1 1 
ATOM   2346 N  ND2 . ASN C 1 80  ? -7.897  42.621 23.443  1.00 69.11 ? 195 ASN C ND2 1 
ATOM   2347 N  N   . LEU C 1 81  ? -3.224  42.363 25.593  1.00 68.44 ? 196 LEU C N   1 
ATOM   2348 C  CA  . LEU C 1 81  ? -1.993  41.825 26.179  1.00 67.52 ? 196 LEU C CA  1 
ATOM   2349 C  C   . LEU C 1 81  ? -2.038  41.924 27.707  1.00 67.70 ? 196 LEU C C   1 
ATOM   2350 O  O   . LEU C 1 81  ? -1.057  41.641 28.408  1.00 67.18 ? 196 LEU C O   1 
ATOM   2351 C  CB  . LEU C 1 81  ? -0.768  42.561 25.619  1.00 66.04 ? 196 LEU C CB  1 
ATOM   2352 C  CG  . LEU C 1 81  ? -0.528  42.295 24.132  1.00 63.90 ? 196 LEU C CG  1 
ATOM   2353 C  CD1 . LEU C 1 81  ? 0.650   43.111 23.635  1.00 63.94 ? 196 LEU C CD1 1 
ATOM   2354 C  CD2 . LEU C 1 81  ? -0.280  40.818 23.932  1.00 62.77 ? 196 LEU C CD2 1 
ATOM   2355 N  N   . LYS C 1 82  ? -3.197  42.335 28.209  1.00 68.00 ? 197 LYS C N   1 
ATOM   2356 C  CA  . LYS C 1 82  ? -3.439  42.446 29.639  1.00 68.46 ? 197 LYS C CA  1 
ATOM   2357 C  C   . LYS C 1 82  ? -2.741  43.603 30.313  1.00 67.48 ? 197 LYS C C   1 
ATOM   2358 O  O   . LYS C 1 82  ? -2.460  43.559 31.512  1.00 67.64 ? 197 LYS C O   1 
ATOM   2359 C  CB  . LYS C 1 82  ? -3.074  41.128 30.335  1.00 70.40 ? 197 LYS C CB  1 
ATOM   2360 C  CG  . LYS C 1 82  ? -3.879  39.934 29.811  1.00 72.69 ? 197 LYS C CG  1 
ATOM   2361 C  CD  . LYS C 1 82  ? -5.372  40.240 29.904  1.00 75.40 ? 197 LYS C CD  1 
ATOM   2362 C  CE  . LYS C 1 82  ? -6.197  39.411 28.917  1.00 76.82 ? 197 LYS C CE  1 
ATOM   2363 N  NZ  . LYS C 1 82  ? -7.577  39.997 28.759  1.00 76.95 ? 197 LYS C NZ  1 
ATOM   2364 N  N   . TYR C 1 83  ? -2.465  44.647 29.547  1.00 66.64 ? 198 TYR C N   1 
ATOM   2365 C  CA  . TYR C 1 83  ? -1.825  45.822 30.119  1.00 65.96 ? 198 TYR C CA  1 
ATOM   2366 C  C   . TYR C 1 83  ? -2.903  46.765 30.632  1.00 65.31 ? 198 TYR C C   1 
ATOM   2367 O  O   . TYR C 1 83  ? -4.045  46.735 30.155  1.00 64.41 ? 198 TYR C O   1 
ATOM   2368 C  CB  . TYR C 1 83  ? -0.972  46.550 29.071  1.00 65.32 ? 198 TYR C CB  1 
ATOM   2369 C  CG  . TYR C 1 83  ? 0.446   46.034 28.968  1.00 64.65 ? 198 TYR C CG  1 
ATOM   2370 C  CD1 . TYR C 1 83  ? 0.781   45.029 28.063  1.00 63.42 ? 198 TYR C CD1 1 
ATOM   2371 C  CD2 . TYR C 1 83  ? 1.451   46.540 29.804  1.00 64.64 ? 198 TYR C CD2 1 
ATOM   2372 C  CE1 . TYR C 1 83  ? 2.079   44.541 27.989  1.00 63.94 ? 198 TYR C CE1 1 
ATOM   2373 C  CE2 . TYR C 1 83  ? 2.756   46.055 29.741  1.00 63.67 ? 198 TYR C CE2 1 
ATOM   2374 C  CZ  . TYR C 1 83  ? 3.063   45.056 28.832  1.00 63.99 ? 198 TYR C CZ  1 
ATOM   2375 O  OH  . TYR C 1 83  ? 4.349   44.568 28.770  1.00 63.19 ? 198 TYR C OH  1 
ATOM   2376 N  N   . GLU C 1 84  ? -2.547  47.590 31.611  1.00 64.26 ? 199 GLU C N   1 
ATOM   2377 C  CA  . GLU C 1 84  ? -3.493  48.553 32.142  1.00 64.03 ? 199 GLU C CA  1 
ATOM   2378 C  C   . GLU C 1 84  ? -3.267  49.795 31.308  1.00 63.69 ? 199 GLU C C   1 
ATOM   2379 O  O   . GLU C 1 84  ? -2.404  50.607 31.630  1.00 64.60 ? 199 GLU C O   1 
ATOM   2380 C  CB  . GLU C 1 84  ? -3.201  48.859 33.614  1.00 65.23 ? 199 GLU C CB  1 
ATOM   2381 C  CG  . GLU C 1 84  ? -4.067  49.998 34.164  1.00 67.18 ? 199 GLU C CG  1 
ATOM   2382 C  CD  . GLU C 1 84  ? -3.632  50.481 35.545  1.00 67.52 ? 199 GLU C CD  1 
ATOM   2383 O  OE1 . GLU C 1 84  ? -3.903  51.669 35.868  1.00 66.70 ? 199 GLU C OE1 1 
ATOM   2384 O  OE2 . GLU C 1 84  ? -3.031  49.676 36.305  1.00 68.02 ? 199 GLU C OE2 1 
ATOM   2385 N  N   . VAL C 1 85  ? -4.036  49.944 30.234  1.00 63.01 ? 200 VAL C N   1 
ATOM   2386 C  CA  . VAL C 1 85  ? -3.880  51.085 29.334  1.00 61.99 ? 200 VAL C CA  1 
ATOM   2387 C  C   . VAL C 1 85  ? -4.456  52.398 29.850  1.00 62.18 ? 200 VAL C C   1 
ATOM   2388 O  O   . VAL C 1 85  ? -5.498  52.423 30.496  1.00 63.02 ? 200 VAL C O   1 
ATOM   2389 C  CB  . VAL C 1 85  ? -4.517  50.786 27.976  1.00 61.25 ? 200 VAL C CB  1 
ATOM   2390 C  CG1 . VAL C 1 85  ? -4.326  51.962 27.043  1.00 61.41 ? 200 VAL C CG1 1 
ATOM   2391 C  CG2 . VAL C 1 85  ? -3.899  49.534 27.389  1.00 60.82 ? 200 VAL C CG2 1 
ATOM   2392 N  N   . ARG C 1 86  ? -3.763  53.490 29.561  1.00 61.89 ? 201 ARG C N   1 
ATOM   2393 C  CA  . ARG C 1 86  ? -4.217  54.806 29.978  1.00 63.12 ? 201 ARG C CA  1 
ATOM   2394 C  C   . ARG C 1 86  ? -3.941  55.811 28.858  1.00 63.85 ? 201 ARG C C   1 
ATOM   2395 O  O   . ARG C 1 86  ? -2.788  56.179 28.613  1.00 64.04 ? 201 ARG C O   1 
ATOM   2396 C  CB  . ARG C 1 86  ? -3.487  55.258 31.249  1.00 62.98 ? 201 ARG C CB  1 
ATOM   2397 C  CG  . ARG C 1 86  ? -3.626  54.334 32.457  1.00 62.67 ? 201 ARG C CG  1 
ATOM   2398 C  CD  . ARG C 1 86  ? -2.999  54.971 33.699  1.00 62.09 ? 201 ARG C CD  1 
ATOM   2399 N  NE  . ARG C 1 86  ? -2.767  53.989 34.756  1.00 62.47 ? 201 ARG C NE  1 
ATOM   2400 C  CZ  . ARG C 1 86  ? -2.165  54.265 35.912  1.00 62.19 ? 201 ARG C CZ  1 
ATOM   2401 N  NH1 . ARG C 1 86  ? -1.736  55.500 36.161  1.00 61.03 ? 201 ARG C NH1 1 
ATOM   2402 N  NH2 . ARG C 1 86  ? -1.987  53.305 36.817  1.00 61.20 ? 201 ARG C NH2 1 
ATOM   2403 N  N   . ASN C 1 87  ? -4.988  56.264 28.175  1.00 64.50 ? 202 ASN C N   1 
ATOM   2404 C  CA  . ASN C 1 87  ? -4.790  57.216 27.095  1.00 65.13 ? 202 ASN C CA  1 
ATOM   2405 C  C   . ASN C 1 87  ? -4.771  58.655 27.575  1.00 65.75 ? 202 ASN C C   1 
ATOM   2406 O  O   . ASN C 1 87  ? -5.420  59.009 28.555  1.00 65.87 ? 202 ASN C O   1 
ATOM   2407 C  CB  . ASN C 1 87  ? -5.870  57.049 26.040  1.00 65.92 ? 202 ASN C CB  1 
ATOM   2408 C  CG  . ASN C 1 87  ? -5.913  55.643 25.483  1.00 68.57 ? 202 ASN C CG  1 
ATOM   2409 O  OD1 . ASN C 1 87  ? -6.278  54.686 26.189  1.00 69.57 ? 202 ASN C OD1 1 
ATOM   2410 N  ND2 . ASN C 1 87  ? -5.532  55.497 24.209  1.00 69.24 ? 202 ASN C ND2 1 
ATOM   2411 N  N   . LYS C 1 88  ? -4.004  59.482 26.878  1.00 66.28 ? 203 LYS C N   1 
ATOM   2412 C  CA  . LYS C 1 88  ? -3.891  60.900 27.198  1.00 66.78 ? 203 LYS C CA  1 
ATOM   2413 C  C   . LYS C 1 88  ? -3.868  61.650 25.869  1.00 66.62 ? 203 LYS C C   1 
ATOM   2414 O  O   . LYS C 1 88  ? -3.309  61.165 24.886  1.00 67.39 ? 203 LYS C O   1 
ATOM   2415 C  CB  . LYS C 1 88  ? -2.604  61.170 27.983  1.00 68.02 ? 203 LYS C CB  1 
ATOM   2416 C  CG  . LYS C 1 88  ? -2.530  60.457 29.330  1.00 69.23 ? 203 LYS C CG  1 
ATOM   2417 C  CD  . LYS C 1 88  ? -3.588  60.969 30.289  1.00 69.90 ? 203 LYS C CD  1 
ATOM   2418 C  CE  . LYS C 1 88  ? -3.474  60.277 31.639  1.00 70.72 ? 203 LYS C CE  1 
ATOM   2419 N  NZ  . LYS C 1 88  ? -4.593  60.646 32.570  1.00 71.30 ? 203 LYS C NZ  1 
ATOM   2420 N  N   . ASN C 1 89  ? -4.471  62.829 25.815  1.00 66.00 ? 204 ASN C N   1 
ATOM   2421 C  CA  . ASN C 1 89  ? -4.485  63.550 24.555  1.00 65.13 ? 204 ASN C CA  1 
ATOM   2422 C  C   . ASN C 1 89  ? -4.123  65.017 24.655  1.00 64.91 ? 204 ASN C C   1 
ATOM   2423 O  O   . ASN C 1 89  ? -4.431  65.690 25.644  1.00 64.29 ? 204 ASN C O   1 
ATOM   2424 C  CB  . ASN C 1 89  ? -5.847  63.391 23.877  1.00 65.01 ? 204 ASN C CB  1 
ATOM   2425 C  CG  . ASN C 1 89  ? -6.188  61.937 23.603  1.00 65.12 ? 204 ASN C CG  1 
ATOM   2426 O  OD1 . ASN C 1 89  ? -6.520  61.183 24.512  1.00 64.73 ? 204 ASN C OD1 1 
ATOM   2427 N  ND2 . ASN C 1 89  ? -6.087  61.533 22.344  1.00 66.42 ? 204 ASN C ND2 1 
ATOM   2428 N  N   . ASP C 1 90  ? -3.446  65.490 23.613  1.00 64.92 ? 205 ASP C N   1 
ATOM   2429 C  CA  . ASP C 1 90  ? -3.009  66.867 23.522  1.00 64.85 ? 205 ASP C CA  1 
ATOM   2430 C  C   . ASP C 1 90  ? -2.453  67.440 24.834  1.00 64.16 ? 205 ASP C C   1 
ATOM   2431 O  O   . ASP C 1 90  ? -2.892  68.490 25.306  1.00 64.64 ? 205 ASP C O   1 
ATOM   2432 C  CB  . ASP C 1 90  ? -4.164  67.717 23.022  1.00 66.08 ? 205 ASP C CB  1 
ATOM   2433 C  CG  . ASP C 1 90  ? -4.721  67.215 21.706  1.00 67.91 ? 205 ASP C CG  1 
ATOM   2434 O  OD1 . ASP C 1 90  ? -3.932  67.048 20.746  1.00 69.06 ? 205 ASP C OD1 1 
ATOM   2435 O  OD2 . ASP C 1 90  ? -5.952  66.991 21.626  1.00 69.39 ? 205 ASP C OD2 1 
ATOM   2436 N  N   . LEU C 1 91  ? -1.488  66.745 25.423  1.00 62.94 ? 206 LEU C N   1 
ATOM   2437 C  CA  . LEU C 1 91  ? -0.872  67.216 26.657  1.00 62.17 ? 206 LEU C CA  1 
ATOM   2438 C  C   . LEU C 1 91  ? 0.211   68.236 26.291  1.00 62.04 ? 206 LEU C C   1 
ATOM   2439 O  O   . LEU C 1 91  ? 0.683   68.267 25.159  1.00 62.35 ? 206 LEU C O   1 
ATOM   2440 C  CB  . LEU C 1 91  ? -0.259  66.042 27.425  1.00 60.83 ? 206 LEU C CB  1 
ATOM   2441 C  CG  . LEU C 1 91  ? -1.228  65.058 28.096  1.00 60.42 ? 206 LEU C CG  1 
ATOM   2442 C  CD1 . LEU C 1 91  ? -2.154  64.439 27.079  1.00 60.39 ? 206 LEU C CD1 1 
ATOM   2443 C  CD2 . LEU C 1 91  ? -0.439  63.965 28.797  1.00 60.48 ? 206 LEU C CD2 1 
ATOM   2444 N  N   . THR C 1 92  ? 0.574   69.094 27.234  1.00 62.33 ? 207 THR C N   1 
ATOM   2445 C  CA  . THR C 1 92  ? 1.622   70.085 26.996  1.00 63.50 ? 207 THR C CA  1 
ATOM   2446 C  C   . THR C 1 92  ? 2.938   69.475 27.486  1.00 64.20 ? 207 THR C C   1 
ATOM   2447 O  O   . THR C 1 92  ? 2.931   68.461 28.198  1.00 65.26 ? 207 THR C O   1 
ATOM   2448 C  CB  . THR C 1 92  ? 1.363   71.376 27.788  1.00 63.42 ? 207 THR C CB  1 
ATOM   2449 O  OG1 . THR C 1 92  ? 1.126   71.055 29.171  1.00 65.01 ? 207 THR C OG1 1 
ATOM   2450 C  CG2 . THR C 1 92  ? 0.168   72.104 27.223  1.00 63.04 ? 207 THR C CG2 1 
ATOM   2451 N  N   . ARG C 1 93  ? 4.068   70.068 27.121  1.00 64.33 ? 208 ARG C N   1 
ATOM   2452 C  CA  . ARG C 1 93  ? 5.340   69.513 27.569  1.00 64.44 ? 208 ARG C CA  1 
ATOM   2453 C  C   . ARG C 1 93  ? 5.308   69.348 29.082  1.00 64.59 ? 208 ARG C C   1 
ATOM   2454 O  O   . ARG C 1 93  ? 5.716   68.311 29.615  1.00 63.83 ? 208 ARG C O   1 
ATOM   2455 C  CB  . ARG C 1 93  ? 6.495   70.417 27.145  1.00 64.26 ? 208 ARG C CB  1 
ATOM   2456 C  CG  . ARG C 1 93  ? 6.188   71.880 27.267  1.00 65.95 ? 208 ARG C CG  1 
ATOM   2457 C  CD  . ARG C 1 93  ? 6.959   72.653 26.226  1.00 67.06 ? 208 ARG C CD  1 
ATOM   2458 N  NE  . ARG C 1 93  ? 8.256   73.097 26.719  1.00 68.98 ? 208 ARG C NE  1 
ATOM   2459 C  CZ  . ARG C 1 93  ? 9.229   73.555 25.939  1.00 69.60 ? 208 ARG C CZ  1 
ATOM   2460 N  NH1 . ARG C 1 93  ? 9.046   73.620 24.621  1.00 68.89 ? 208 ARG C NH1 1 
ATOM   2461 N  NH2 . ARG C 1 93  ? 10.377  73.959 26.479  1.00 70.13 ? 208 ARG C NH2 1 
ATOM   2462 N  N   . GLU C 1 94  ? 4.783   70.360 29.769  1.00 64.74 ? 209 GLU C N   1 
ATOM   2463 C  CA  . GLU C 1 94  ? 4.701   70.323 31.223  1.00 65.39 ? 209 GLU C CA  1 
ATOM   2464 C  C   . GLU C 1 94  ? 3.847   69.146 31.664  1.00 65.66 ? 209 GLU C C   1 
ATOM   2465 O  O   . GLU C 1 94  ? 4.255   68.344 32.508  1.00 65.90 ? 209 GLU C O   1 
ATOM   2466 C  CB  . GLU C 1 94  ? 4.102   71.622 31.765  1.00 65.96 ? 209 GLU C CB  1 
ATOM   2467 C  CG  . GLU C 1 94  ? 4.906   72.878 31.439  1.00 66.93 ? 209 GLU C CG  1 
ATOM   2468 C  CD  . GLU C 1 94  ? 4.762   73.302 29.990  1.00 67.91 ? 209 GLU C CD  1 
ATOM   2469 O  OE1 . GLU C 1 94  ? 5.480   74.243 29.566  1.00 67.20 ? 209 GLU C OE1 1 
ATOM   2470 O  OE2 . GLU C 1 94  ? 3.922   72.693 29.277  1.00 69.25 ? 209 GLU C OE2 1 
ATOM   2471 N  N   . GLU C 1 95  ? 2.658   69.040 31.085  1.00 65.35 ? 210 GLU C N   1 
ATOM   2472 C  CA  . GLU C 1 95  ? 1.760   67.954 31.441  1.00 65.01 ? 210 GLU C CA  1 
ATOM   2473 C  C   . GLU C 1 95  ? 2.424   66.603 31.247  1.00 64.06 ? 210 GLU C C   1 
ATOM   2474 O  O   . GLU C 1 95  ? 2.277   65.709 32.088  1.00 64.53 ? 210 GLU C O   1 
ATOM   2475 C  CB  . GLU C 1 95  ? 0.476   68.049 30.619  1.00 65.92 ? 210 GLU C CB  1 
ATOM   2476 C  CG  . GLU C 1 95  ? -0.334  69.278 30.985  1.00 67.97 ? 210 GLU C CG  1 
ATOM   2477 C  CD  . GLU C 1 95  ? -1.502  69.540 30.058  1.00 69.04 ? 210 GLU C CD  1 
ATOM   2478 O  OE1 . GLU C 1 95  ? -2.260  70.492 30.355  1.00 70.60 ? 210 GLU C OE1 1 
ATOM   2479 O  OE2 . GLU C 1 95  ? -1.664  68.816 29.047  1.00 68.28 ? 210 GLU C OE2 1 
ATOM   2480 N  N   . ILE C 1 96  ? 3.171   66.459 30.153  1.00 62.72 ? 211 ILE C N   1 
ATOM   2481 C  CA  . ILE C 1 96  ? 3.853   65.200 29.873  1.00 61.32 ? 211 ILE C CA  1 
ATOM   2482 C  C   . ILE C 1 96  ? 4.903   64.949 30.948  1.00 60.65 ? 211 ILE C C   1 
ATOM   2483 O  O   . ILE C 1 96  ? 4.901   63.895 31.583  1.00 60.84 ? 211 ILE C O   1 
ATOM   2484 C  CB  . ILE C 1 96  ? 4.539   65.213 28.485  1.00 60.63 ? 211 ILE C CB  1 
ATOM   2485 C  CG1 . ILE C 1 96  ? 3.479   65.307 27.386  1.00 60.34 ? 211 ILE C CG1 1 
ATOM   2486 C  CG2 . ILE C 1 96  ? 5.395   63.957 28.314  1.00 59.00 ? 211 ILE C CG2 1 
ATOM   2487 C  CD1 . ILE C 1 96  ? 4.042   65.421 25.992  1.00 59.63 ? 211 ILE C CD1 1 
ATOM   2488 N  N   . VAL C 1 97  ? 5.787   65.923 31.161  1.00 59.32 ? 212 VAL C N   1 
ATOM   2489 C  CA  . VAL C 1 97  ? 6.832   65.780 32.167  1.00 58.30 ? 212 VAL C CA  1 
ATOM   2490 C  C   . VAL C 1 97  ? 6.179   65.396 33.483  1.00 59.26 ? 212 VAL C C   1 
ATOM   2491 O  O   . VAL C 1 97  ? 6.611   64.456 34.163  1.00 58.10 ? 212 VAL C O   1 
ATOM   2492 C  CB  . VAL C 1 97  ? 7.603   67.090 32.371  1.00 57.08 ? 212 VAL C CB  1 
ATOM   2493 C  CG1 . VAL C 1 97  ? 8.623   66.918 33.467  1.00 56.68 ? 212 VAL C CG1 1 
ATOM   2494 C  CG2 . VAL C 1 97  ? 8.284   67.505 31.087  1.00 56.31 ? 212 VAL C CG2 1 
ATOM   2495 N  N   . GLU C 1 98  ? 5.120   66.131 33.821  1.00 60.82 ? 213 GLU C N   1 
ATOM   2496 C  CA  . GLU C 1 98  ? 4.379   65.903 35.047  1.00 62.33 ? 213 GLU C CA  1 
ATOM   2497 C  C   . GLU C 1 98  ? 3.765   64.508 35.072  1.00 61.97 ? 213 GLU C C   1 
ATOM   2498 O  O   . GLU C 1 98  ? 3.885   63.778 36.066  1.00 61.48 ? 213 GLU C O   1 
ATOM   2499 C  CB  . GLU C 1 98  ? 3.281   66.958 35.204  1.00 65.09 ? 213 GLU C CB  1 
ATOM   2500 C  CG  . GLU C 1 98  ? 2.325   66.657 36.362  1.00 69.17 ? 213 GLU C CG  1 
ATOM   2501 C  CD  . GLU C 1 98  ? 1.227   67.699 36.525  1.00 71.38 ? 213 GLU C CD  1 
ATOM   2502 O  OE1 . GLU C 1 98  ? 0.568   68.041 35.506  1.00 72.22 ? 213 GLU C OE1 1 
ATOM   2503 O  OE2 . GLU C 1 98  ? 1.017   68.163 37.674  1.00 72.62 ? 213 GLU C OE2 1 
ATOM   2504 N  N   . LEU C 1 99  ? 3.105   64.139 33.977  1.00 62.15 ? 214 LEU C N   1 
ATOM   2505 C  CA  . LEU C 1 99  ? 2.474   62.826 33.891  1.00 62.16 ? 214 LEU C CA  1 
ATOM   2506 C  C   . LEU C 1 99  ? 3.493   61.723 34.156  1.00 62.60 ? 214 LEU C C   1 
ATOM   2507 O  O   . LEU C 1 99  ? 3.282   60.856 35.008  1.00 62.82 ? 214 LEU C O   1 
ATOM   2508 C  CB  . LEU C 1 99  ? 1.832   62.626 32.518  1.00 60.95 ? 214 LEU C CB  1 
ATOM   2509 C  CG  . LEU C 1 99  ? 1.355   61.191 32.293  1.00 61.31 ? 214 LEU C CG  1 
ATOM   2510 C  CD1 . LEU C 1 99  ? 0.490   60.767 33.452  1.00 60.50 ? 214 LEU C CD1 1 
ATOM   2511 C  CD2 . LEU C 1 99  ? 0.589   61.083 30.981  1.00 61.56 ? 214 LEU C CD2 1 
ATOM   2512 N  N   . MET C 1 100 ? 4.606   61.766 33.432  1.00 63.05 ? 215 MET C N   1 
ATOM   2513 C  CA  . MET C 1 100 ? 5.647   60.767 33.613  1.00 63.28 ? 215 MET C CA  1 
ATOM   2514 C  C   . MET C 1 100 ? 6.124   60.754 35.069  1.00 62.91 ? 215 MET C C   1 
ATOM   2515 O  O   . MET C 1 100 ? 6.147   59.695 35.713  1.00 62.75 ? 215 MET C O   1 
ATOM   2516 C  CB  . MET C 1 100 ? 6.824   61.048 32.665  1.00 63.71 ? 215 MET C CB  1 
ATOM   2517 C  CG  . MET C 1 100 ? 6.492   60.897 31.175  1.00 63.40 ? 215 MET C CG  1 
ATOM   2518 S  SD  . MET C 1 100 ? 5.917   59.234 30.740  1.00 63.24 ? 215 MET C SD  1 
ATOM   2519 C  CE  . MET C 1 100 ? 4.171   59.499 30.740  1.00 64.42 ? 215 MET C CE  1 
ATOM   2520 N  N   . ARG C 1 101 ? 6.487   61.926 35.589  1.00 62.28 ? 216 ARG C N   1 
ATOM   2521 C  CA  . ARG C 1 101 ? 6.963   62.029 36.969  1.00 61.43 ? 216 ARG C CA  1 
ATOM   2522 C  C   . ARG C 1 101 ? 6.005   61.336 37.941  1.00 60.46 ? 216 ARG C C   1 
ATOM   2523 O  O   . ARG C 1 101 ? 6.422   60.580 38.821  1.00 60.31 ? 216 ARG C O   1 
ATOM   2524 C  CB  . ARG C 1 101 ? 7.119   63.499 37.382  1.00 61.87 ? 216 ARG C CB  1 
ATOM   2525 C  CG  . ARG C 1 101 ? 7.717   63.677 38.780  1.00 63.00 ? 216 ARG C CG  1 
ATOM   2526 C  CD  . ARG C 1 101 ? 7.281   64.981 39.434  1.00 65.26 ? 216 ARG C CD  1 
ATOM   2527 N  NE  . ARG C 1 101 ? 7.542   66.146 38.591  1.00 67.38 ? 216 ARG C NE  1 
ATOM   2528 C  CZ  . ARG C 1 101 ? 8.755   66.530 38.196  1.00 68.86 ? 216 ARG C CZ  1 
ATOM   2529 N  NH1 . ARG C 1 101 ? 9.830   65.839 38.572  1.00 70.07 ? 216 ARG C NH1 1 
ATOM   2530 N  NH2 . ARG C 1 101 ? 8.895   67.601 37.417  1.00 68.74 ? 216 ARG C NH2 1 
ATOM   2531 N  N   . ASP C 1 102 ? 4.718   61.595 37.784  1.00 59.28 ? 217 ASP C N   1 
ATOM   2532 C  CA  . ASP C 1 102 ? 3.754   60.988 38.670  1.00 59.65 ? 217 ASP C CA  1 
ATOM   2533 C  C   . ASP C 1 102 ? 3.774   59.489 38.493  1.00 59.50 ? 217 ASP C C   1 
ATOM   2534 O  O   . ASP C 1 102 ? 3.947   58.755 39.466  1.00 61.06 ? 217 ASP C O   1 
ATOM   2535 C  CB  . ASP C 1 102 ? 2.353   61.523 38.388  1.00 61.04 ? 217 ASP C CB  1 
ATOM   2536 C  CG  . ASP C 1 102 ? 2.189   62.984 38.790  1.00 62.59 ? 217 ASP C CG  1 
ATOM   2537 O  OD1 . ASP C 1 102 ? 1.206   63.614 38.329  1.00 64.52 ? 217 ASP C OD1 1 
ATOM   2538 O  OD2 . ASP C 1 102 ? 3.031   63.501 39.567  1.00 61.00 ? 217 ASP C OD2 1 
ATOM   2539 N  N   . VAL C 1 103 ? 3.615   59.029 37.256  1.00 58.05 ? 218 VAL C N   1 
ATOM   2540 C  CA  . VAL C 1 103 ? 3.597   57.595 36.996  1.00 57.30 ? 218 VAL C CA  1 
ATOM   2541 C  C   . VAL C 1 103 ? 4.877   56.909 37.461  1.00 57.45 ? 218 VAL C C   1 
ATOM   2542 O  O   . VAL C 1 103 ? 4.861   55.738 37.861  1.00 56.41 ? 218 VAL C O   1 
ATOM   2543 C  CB  . VAL C 1 103 ? 3.405   57.308 35.508  1.00 57.17 ? 218 VAL C CB  1 
ATOM   2544 C  CG1 . VAL C 1 103 ? 3.172   55.823 35.289  1.00 56.74 ? 218 VAL C CG1 1 
ATOM   2545 C  CG2 . VAL C 1 103 ? 2.250   58.108 34.982  1.00 57.05 ? 218 VAL C CG2 1 
ATOM   2546 N  N   . SER C 1 104 ? 5.985   57.641 37.411  1.00 57.99 ? 219 SER C N   1 
ATOM   2547 C  CA  . SER C 1 104 ? 7.263   57.085 37.827  1.00 59.50 ? 219 SER C CA  1 
ATOM   2548 C  C   . SER C 1 104 ? 7.289   56.890 39.331  1.00 60.56 ? 219 SER C C   1 
ATOM   2549 O  O   . SER C 1 104 ? 8.143   56.165 39.855  1.00 61.98 ? 219 SER C O   1 
ATOM   2550 C  CB  . SER C 1 104 ? 8.416   58.006 37.420  1.00 58.59 ? 219 SER C CB  1 
ATOM   2551 O  OG  . SER C 1 104 ? 8.400   59.196 38.180  1.00 58.08 ? 219 SER C OG  1 
ATOM   2552 N  N   . LYS C 1 105 ? 6.352   57.528 40.025  1.00 60.87 ? 220 LYS C N   1 
ATOM   2553 C  CA  . LYS C 1 105 ? 6.301   57.421 41.478  1.00 61.60 ? 220 LYS C CA  1 
ATOM   2554 C  C   . LYS C 1 105 ? 5.256   56.452 42.031  1.00 61.06 ? 220 LYS C C   1 
ATOM   2555 O  O   . LYS C 1 105 ? 5.151   56.275 43.247  1.00 60.16 ? 220 LYS C O   1 
ATOM   2556 C  CB  . LYS C 1 105 ? 6.126   58.806 42.090  1.00 63.10 ? 220 LYS C CB  1 
ATOM   2557 C  CG  . LYS C 1 105 ? 7.330   59.719 41.853  1.00 65.32 ? 220 LYS C CG  1 
ATOM   2558 C  CD  . LYS C 1 105 ? 7.109   61.081 42.498  1.00 67.39 ? 220 LYS C CD  1 
ATOM   2559 C  CE  . LYS C 1 105 ? 8.363   61.946 42.432  1.00 68.24 ? 220 LYS C CE  1 
ATOM   2560 N  NZ  . LYS C 1 105 ? 8.109   63.311 42.986  1.00 69.05 ? 220 LYS C NZ  1 
ATOM   2561 N  N   . GLU C 1 106 ? 4.484   55.833 41.141  1.00 61.24 ? 221 GLU C N   1 
ATOM   2562 C  CA  . GLU C 1 106 ? 3.501   54.841 41.560  1.00 60.95 ? 221 GLU C CA  1 
ATOM   2563 C  C   . GLU C 1 106 ? 4.326   53.656 42.064  1.00 61.50 ? 221 GLU C C   1 
ATOM   2564 O  O   . GLU C 1 106 ? 5.559   53.691 42.030  1.00 62.41 ? 221 GLU C O   1 
ATOM   2565 C  CB  . GLU C 1 106 ? 2.628   54.393 40.376  1.00 59.44 ? 221 GLU C CB  1 
ATOM   2566 C  CG  . GLU C 1 106 ? 1.545   55.384 39.970  1.00 57.83 ? 221 GLU C CG  1 
ATOM   2567 C  CD  . GLU C 1 106 ? 0.674   54.885 38.818  1.00 57.65 ? 221 GLU C CD  1 
ATOM   2568 O  OE1 . GLU C 1 106 ? 0.553   53.648 38.644  1.00 56.16 ? 221 GLU C OE1 1 
ATOM   2569 O  OE2 . GLU C 1 106 ? 0.099   55.734 38.097  1.00 55.96 ? 221 GLU C OE2 1 
ATOM   2570 N  N   . ASP C 1 107 ? 3.658   52.609 42.528  1.00 61.70 ? 222 ASP C N   1 
ATOM   2571 C  CA  . ASP C 1 107 ? 4.360   51.436 43.018  1.00 62.05 ? 222 ASP C CA  1 
ATOM   2572 C  C   . ASP C 1 107 ? 4.158   50.250 42.074  1.00 62.20 ? 222 ASP C C   1 
ATOM   2573 O  O   . ASP C 1 107 ? 3.191   49.503 42.196  1.00 62.87 ? 222 ASP C O   1 
ATOM   2574 C  CB  . ASP C 1 107 ? 3.874   51.100 44.423  1.00 62.52 ? 222 ASP C CB  1 
ATOM   2575 C  CG  . ASP C 1 107 ? 4.234   49.691 44.833  1.00 64.75 ? 222 ASP C CG  1 
ATOM   2576 O  OD1 . ASP C 1 107 ? 5.375   49.263 44.542  1.00 65.01 ? 222 ASP C OD1 1 
ATOM   2577 O  OD2 . ASP C 1 107 ? 3.380   49.005 45.446  1.00 65.70 ? 222 ASP C OD2 1 
ATOM   2578 N  N   . HIS C 1 108 ? 5.088   50.085 41.138  1.00 62.18 ? 224 HIS C N   1 
ATOM   2579 C  CA  . HIS C 1 108 ? 5.041   49.017 40.131  1.00 61.65 ? 224 HIS C CA  1 
ATOM   2580 C  C   . HIS C 1 108 ? 5.494   47.661 40.659  1.00 62.07 ? 224 HIS C C   1 
ATOM   2581 O  O   . HIS C 1 108 ? 5.738   46.737 39.877  1.00 61.29 ? 224 HIS C O   1 
ATOM   2582 C  CB  . HIS C 1 108 ? 5.925   49.399 38.941  1.00 60.42 ? 224 HIS C CB  1 
ATOM   2583 C  CG  . HIS C 1 108 ? 5.604   50.739 38.357  1.00 60.21 ? 224 HIS C CG  1 
ATOM   2584 N  ND1 . HIS C 1 108 ? 4.623   50.920 37.405  1.00 60.03 ? 224 HIS C ND1 1 
ATOM   2585 C  CD2 . HIS C 1 108 ? 6.103   51.971 38.624  1.00 60.03 ? 224 HIS C CD2 1 
ATOM   2586 C  CE1 . HIS C 1 108 ? 4.530   52.205 37.112  1.00 61.08 ? 224 HIS C CE1 1 
ATOM   2587 N  NE2 . HIS C 1 108 ? 5.416   52.865 37.839  1.00 60.82 ? 224 HIS C NE2 1 
ATOM   2588 N  N   . SER C 1 109 ? 5.615   47.545 41.977  1.00 62.79 ? 225 SER C N   1 
ATOM   2589 C  CA  . SER C 1 109 ? 6.050   46.295 42.602  1.00 63.61 ? 225 SER C CA  1 
ATOM   2590 C  C   . SER C 1 109 ? 5.361   45.038 42.079  1.00 63.06 ? 225 SER C C   1 
ATOM   2591 O  O   . SER C 1 109 ? 6.017   44.030 41.818  1.00 62.71 ? 225 SER C O   1 
ATOM   2592 C  CB  . SER C 1 109 ? 5.847   46.366 44.118  1.00 64.55 ? 225 SER C CB  1 
ATOM   2593 O  OG  . SER C 1 109 ? 6.756   47.274 44.719  1.00 65.73 ? 225 SER C OG  1 
ATOM   2594 N  N   . LYS C 1 110 ? 4.042   45.085 41.928  1.00 63.68 ? 226 LYS C N   1 
ATOM   2595 C  CA  . LYS C 1 110 ? 3.314   43.907 41.459  1.00 64.66 ? 226 LYS C CA  1 
ATOM   2596 C  C   . LYS C 1 110 ? 3.156   43.863 39.929  1.00 64.28 ? 226 LYS C C   1 
ATOM   2597 O  O   . LYS C 1 110 ? 2.499   42.962 39.384  1.00 63.70 ? 226 LYS C O   1 
ATOM   2598 C  CB  . LYS C 1 110 ? 1.948   43.830 42.174  1.00 64.83 ? 226 LYS C CB  1 
ATOM   2599 C  CG  . LYS C 1 110 ? 2.086   43.767 43.715  1.00 66.10 ? 226 LYS C CG  1 
ATOM   2600 C  CD  . LYS C 1 110 ? 0.749   43.751 44.459  1.00 67.07 ? 226 LYS C CD  1 
ATOM   2601 C  CE  . LYS C 1 110 ? 0.087   42.368 44.436  1.00 68.22 ? 226 LYS C CE  1 
ATOM   2602 N  NZ  . LYS C 1 110 ? 0.833   41.329 45.220  1.00 67.83 ? 226 LYS C NZ  1 
ATOM   2603 N  N   . ARG C 1 111 ? 3.789   44.822 39.247  1.00 63.81 ? 227 ARG C N   1 
ATOM   2604 C  CA  . ARG C 1 111 ? 3.741   44.921 37.784  1.00 62.69 ? 227 ARG C CA  1 
ATOM   2605 C  C   . ARG C 1 111 ? 5.014   44.360 37.120  1.00 61.04 ? 227 ARG C C   1 
ATOM   2606 O  O   . ARG C 1 111 ? 6.132   44.647 37.560  1.00 60.51 ? 227 ARG C O   1 
ATOM   2607 C  CB  . ARG C 1 111 ? 3.554   46.383 37.380  1.00 63.81 ? 227 ARG C CB  1 
ATOM   2608 C  CG  . ARG C 1 111 ? 2.224   46.965 37.804  1.00 65.45 ? 227 ARG C CG  1 
ATOM   2609 C  CD  . ARG C 1 111 ? 2.304   48.479 37.916  1.00 66.58 ? 227 ARG C CD  1 
ATOM   2610 N  NE  . ARG C 1 111 ? 0.985   49.065 38.131  1.00 68.03 ? 227 ARG C NE  1 
ATOM   2611 C  CZ  . ARG C 1 111 ? 0.770   50.329 38.487  1.00 68.64 ? 227 ARG C CZ  1 
ATOM   2612 N  NH1 . ARG C 1 111 ? 1.797   51.149 38.677  1.00 67.91 ? 227 ARG C NH1 1 
ATOM   2613 N  NH2 . ARG C 1 111 ? -0.478  50.772 38.640  1.00 69.27 ? 227 ARG C NH2 1 
ATOM   2614 N  N   . SER C 1 112 ? 4.832   43.576 36.055  1.00 58.80 ? 228 SER C N   1 
ATOM   2615 C  CA  . SER C 1 112 ? 5.943   42.957 35.332  1.00 57.30 ? 228 SER C CA  1 
ATOM   2616 C  C   . SER C 1 112 ? 6.737   43.875 34.413  1.00 56.66 ? 228 SER C C   1 
ATOM   2617 O  O   . SER C 1 112 ? 7.913   43.615 34.151  1.00 55.07 ? 228 SER C O   1 
ATOM   2618 C  CB  . SER C 1 112 ? 5.442   41.788 34.488  1.00 56.98 ? 228 SER C CB  1 
ATOM   2619 O  OG  . SER C 1 112 ? 4.939   40.737 35.286  1.00 58.98 ? 228 SER C OG  1 
ATOM   2620 N  N   . SER C 1 113 ? 6.098   44.927 33.905  1.00 55.38 ? 229 SER C N   1 
ATOM   2621 C  CA  . SER C 1 113 ? 6.783   45.837 32.995  1.00 55.09 ? 229 SER C CA  1 
ATOM   2622 C  C   . SER C 1 113 ? 6.156   47.219 32.911  1.00 55.35 ? 229 SER C C   1 
ATOM   2623 O  O   . SER C 1 113 ? 5.264   47.572 33.678  1.00 56.26 ? 229 SER C O   1 
ATOM   2624 C  CB  . SER C 1 113 ? 6.811   45.239 31.594  1.00 53.84 ? 229 SER C CB  1 
ATOM   2625 O  OG  . SER C 1 113 ? 5.496   45.154 31.086  1.00 51.99 ? 229 SER C OG  1 
ATOM   2626 N  N   . PHE C 1 114 ? 6.643   48.007 31.962  1.00 55.24 ? 230 PHE C N   1 
ATOM   2627 C  CA  . PHE C 1 114 ? 6.129   49.349 31.750  1.00 54.90 ? 230 PHE C CA  1 
ATOM   2628 C  C   . PHE C 1 114 ? 6.246   49.721 30.288  1.00 53.73 ? 230 PHE C C   1 
ATOM   2629 O  O   . PHE C 1 114 ? 7.281   49.492 29.666  1.00 54.27 ? 230 PHE C O   1 
ATOM   2630 C  CB  . PHE C 1 114 ? 6.902   50.368 32.569  1.00 55.36 ? 230 PHE C CB  1 
ATOM   2631 C  CG  . PHE C 1 114 ? 6.474   51.772 32.304  1.00 57.15 ? 230 PHE C CG  1 
ATOM   2632 C  CD1 . PHE C 1 114 ? 5.211   52.211 32.688  1.00 57.76 ? 230 PHE C CD1 1 
ATOM   2633 C  CD2 . PHE C 1 114 ? 7.317   52.655 31.655  1.00 57.32 ? 230 PHE C CD2 1 
ATOM   2634 C  CE1 . PHE C 1 114 ? 4.793   53.511 32.432  1.00 58.22 ? 230 PHE C CE1 1 
ATOM   2635 C  CE2 . PHE C 1 114 ? 6.912   53.954 31.394  1.00 58.73 ? 230 PHE C CE2 1 
ATOM   2636 C  CZ  . PHE C 1 114 ? 5.643   54.384 31.785  1.00 58.95 ? 230 PHE C CZ  1 
ATOM   2637 N  N   . VAL C 1 115 ? 5.188   50.306 29.745  1.00 52.58 ? 231 VAL C N   1 
ATOM   2638 C  CA  . VAL C 1 115 ? 5.179   50.706 28.351  1.00 51.64 ? 231 VAL C CA  1 
ATOM   2639 C  C   . VAL C 1 115 ? 4.643   52.123 28.191  1.00 51.83 ? 231 VAL C C   1 
ATOM   2640 O  O   . VAL C 1 115 ? 3.653   52.490 28.812  1.00 53.04 ? 231 VAL C O   1 
ATOM   2641 C  CB  . VAL C 1 115 ? 4.324   49.740 27.521  1.00 50.85 ? 231 VAL C CB  1 
ATOM   2642 C  CG1 . VAL C 1 115 ? 4.277   50.190 26.083  1.00 50.94 ? 231 VAL C CG1 1 
ATOM   2643 C  CG2 . VAL C 1 115 ? 4.903   48.349 27.605  1.00 49.61 ? 231 VAL C CG2 1 
ATOM   2644 N  N   . CYS C 1 116 ? 5.311   52.919 27.363  1.00 52.25 ? 232 CYS C N   1 
ATOM   2645 C  CA  . CYS C 1 116 ? 4.902   54.295 27.108  1.00 52.16 ? 232 CYS C CA  1 
ATOM   2646 C  C   . CYS C 1 116 ? 4.950   54.511 25.610  1.00 51.59 ? 232 CYS C C   1 
ATOM   2647 O  O   . CYS C 1 116 ? 5.975   54.266 24.985  1.00 52.65 ? 232 CYS C O   1 
ATOM   2648 C  CB  . CYS C 1 116 ? 5.848   55.279 27.795  1.00 52.22 ? 232 CYS C CB  1 
ATOM   2649 S  SG  . CYS C 1 116 ? 5.416   57.010 27.533  1.00 52.95 ? 232 CYS C SG  1 
ATOM   2650 N  N   . VAL C 1 117 ? 3.843   54.965 25.035  1.00 51.29 ? 233 VAL C N   1 
ATOM   2651 C  CA  . VAL C 1 117 ? 3.771   55.193 23.599  1.00 50.03 ? 233 VAL C CA  1 
ATOM   2652 C  C   . VAL C 1 117 ? 3.552   56.660 23.309  1.00 50.15 ? 233 VAL C C   1 
ATOM   2653 O  O   . VAL C 1 117 ? 2.553   57.233 23.717  1.00 51.52 ? 233 VAL C O   1 
ATOM   2654 C  CB  . VAL C 1 117 ? 2.627   54.371 22.965  1.00 49.38 ? 233 VAL C CB  1 
ATOM   2655 C  CG1 . VAL C 1 117 ? 2.509   54.685 21.494  1.00 50.18 ? 233 VAL C CG1 1 
ATOM   2656 C  CG2 . VAL C 1 117 ? 2.897   52.901 23.144  1.00 48.86 ? 233 VAL C CG2 1 
ATOM   2657 N  N   . LEU C 1 118 ? 4.494   57.266 22.599  1.00 50.37 ? 234 LEU C N   1 
ATOM   2658 C  CA  . LEU C 1 118 ? 4.397   58.677 22.259  1.00 49.60 ? 234 LEU C CA  1 
ATOM   2659 C  C   . LEU C 1 118 ? 4.019   58.884 20.790  1.00 48.89 ? 234 LEU C C   1 
ATOM   2660 O  O   . LEU C 1 118 ? 4.646   58.326 19.897  1.00 49.37 ? 234 LEU C O   1 
ATOM   2661 C  CB  . LEU C 1 118 ? 5.730   59.358 22.565  1.00 49.65 ? 234 LEU C CB  1 
ATOM   2662 C  CG  . LEU C 1 118 ? 6.140   59.350 24.041  1.00 50.10 ? 234 LEU C CG  1 
ATOM   2663 C  CD1 . LEU C 1 118 ? 7.588   59.739 24.160  1.00 49.56 ? 234 LEU C CD1 1 
ATOM   2664 C  CD2 . LEU C 1 118 ? 5.266   60.306 24.842  1.00 50.48 ? 234 LEU C CD2 1 
ATOM   2665 N  N   . LEU C 1 119 ? 2.979   59.676 20.548  1.00 48.49 ? 235 LEU C N   1 
ATOM   2666 C  CA  . LEU C 1 119 ? 2.520   59.968 19.190  1.00 48.01 ? 235 LEU C CA  1 
ATOM   2667 C  C   . LEU C 1 119 ? 2.491   61.491 19.086  1.00 47.92 ? 235 LEU C C   1 
ATOM   2668 O  O   . LEU C 1 119 ? 1.616   62.141 19.650  1.00 47.26 ? 235 LEU C O   1 
ATOM   2669 C  CB  . LEU C 1 119 ? 1.113   59.406 18.968  1.00 47.51 ? 235 LEU C CB  1 
ATOM   2670 C  CG  . LEU C 1 119 ? 0.830   57.985 19.463  1.00 48.22 ? 235 LEU C CG  1 
ATOM   2671 C  CD1 . LEU C 1 119 ? -0.654  57.729 19.380  1.00 46.71 ? 235 LEU C CD1 1 
ATOM   2672 C  CD2 . LEU C 1 119 ? 1.609   56.959 18.655  1.00 47.04 ? 235 LEU C CD2 1 
ATOM   2673 N  N   . SER C 1 120 ? 3.446   62.062 18.364  1.00 47.54 ? 236 SER C N   1 
ATOM   2674 C  CA  . SER C 1 120 ? 3.526   63.510 18.255  1.00 47.55 ? 236 SER C CA  1 
ATOM   2675 C  C   . SER C 1 120 ? 4.584   63.912 17.234  1.00 48.11 ? 236 SER C C   1 
ATOM   2676 O  O   . SER C 1 120 ? 5.172   63.062 16.591  1.00 49.30 ? 236 SER C O   1 
ATOM   2677 C  CB  . SER C 1 120 ? 3.873   64.076 19.636  1.00 47.41 ? 236 SER C CB  1 
ATOM   2678 O  OG  . SER C 1 120 ? 4.157   65.459 19.602  1.00 48.93 ? 236 SER C OG  1 
ATOM   2679 N  N   . HIS C 1 121 ? 4.807   65.208 17.065  1.00 49.13 ? 237 HIS C N   1 
ATOM   2680 C  CA  . HIS C 1 121 ? 5.830   65.679 16.140  1.00 49.96 ? 237 HIS C CA  1 
ATOM   2681 C  C   . HIS C 1 121 ? 7.159   65.493 16.838  1.00 50.22 ? 237 HIS C C   1 
ATOM   2682 O  O   . HIS C 1 121 ? 7.203   65.270 18.047  1.00 50.32 ? 237 HIS C O   1 
ATOM   2683 C  CB  . HIS C 1 121 ? 5.664   67.164 15.844  1.00 52.12 ? 237 HIS C CB  1 
ATOM   2684 C  CG  . HIS C 1 121 ? 4.454   67.485 15.035  1.00 54.77 ? 237 HIS C CG  1 
ATOM   2685 N  ND1 . HIS C 1 121 ? 4.311   67.087 13.722  1.00 55.99 ? 237 HIS C ND1 1 
ATOM   2686 C  CD2 . HIS C 1 121 ? 3.324   68.157 15.352  1.00 55.86 ? 237 HIS C CD2 1 
ATOM   2687 C  CE1 . HIS C 1 121 ? 3.142   67.498 13.266  1.00 56.81 ? 237 HIS C CE1 1 
ATOM   2688 N  NE2 . HIS C 1 121 ? 2.523   68.149 14.235  1.00 57.50 ? 237 HIS C NE2 1 
ATOM   2689 N  N   . GLY C 1 122 ? 8.245   65.608 16.085  1.00 49.72 ? 238 GLY C N   1 
ATOM   2690 C  CA  . GLY C 1 122 ? 9.550   65.463 16.689  1.00 48.87 ? 238 GLY C CA  1 
ATOM   2691 C  C   . GLY C 1 122 ? 10.708  65.542 15.728  1.00 48.92 ? 238 GLY C C   1 
ATOM   2692 O  O   . GLY C 1 122 ? 10.534  65.652 14.524  1.00 49.44 ? 238 GLY C O   1 
ATOM   2693 N  N   . GLU C 1 123 ? 11.907  65.505 16.288  1.00 49.86 ? 239 GLU C N   1 
ATOM   2694 C  CA  . GLU C 1 123 ? 13.138  65.527 15.520  1.00 50.19 ? 239 GLU C CA  1 
ATOM   2695 C  C   . GLU C 1 123 ? 14.148  64.830 16.383  1.00 49.69 ? 239 GLU C C   1 
ATOM   2696 O  O   . GLU C 1 123 ? 13.834  64.437 17.489  1.00 49.30 ? 239 GLU C O   1 
ATOM   2697 C  CB  . GLU C 1 123 ? 13.586  66.945 15.225  1.00 51.07 ? 239 GLU C CB  1 
ATOM   2698 C  CG  . GLU C 1 123 ? 13.283  67.921 16.332  1.00 55.83 ? 239 GLU C CG  1 
ATOM   2699 C  CD  . GLU C 1 123 ? 13.786  69.319 16.021  1.00 57.68 ? 239 GLU C CD  1 
ATOM   2700 O  OE1 . GLU C 1 123 ? 15.017  69.544 16.130  1.00 57.86 ? 239 GLU C OE1 1 
ATOM   2701 O  OE2 . GLU C 1 123 ? 12.947  70.181 15.662  1.00 58.16 ? 239 GLU C OE2 1 
ATOM   2702 N  N   . GLU C 1 124 ? 15.357  64.670 15.875  1.00 50.95 ? 240 GLU C N   1 
ATOM   2703 C  CA  . GLU C 1 124 ? 16.413  63.989 16.606  1.00 51.41 ? 240 GLU C CA  1 
ATOM   2704 C  C   . GLU C 1 124 ? 16.330  64.253 18.103  1.00 50.08 ? 240 GLU C C   1 
ATOM   2705 O  O   . GLU C 1 124 ? 16.593  65.363 18.565  1.00 48.80 ? 240 GLU C O   1 
ATOM   2706 C  CB  . GLU C 1 124 ? 17.791  64.428 16.093  1.00 56.41 ? 240 GLU C CB  1 
ATOM   2707 C  CG  . GLU C 1 124 ? 18.052  64.299 14.560  1.00 62.44 ? 240 GLU C CG  1 
ATOM   2708 C  CD  . GLU C 1 124 ? 17.598  65.516 13.693  1.00 64.55 ? 240 GLU C CD  1 
ATOM   2709 O  OE1 . GLU C 1 124 ? 18.175  65.671 12.586  1.00 66.41 ? 240 GLU C OE1 1 
ATOM   2710 O  OE2 . GLU C 1 124 ? 16.681  66.297 14.080  1.00 63.92 ? 240 GLU C OE2 1 
ATOM   2711 N  N   . GLY C 1 125 ? 15.936  63.225 18.845  1.00 49.10 ? 241 GLY C N   1 
ATOM   2712 C  CA  . GLY C 1 125 ? 15.851  63.308 20.290  1.00 49.19 ? 241 GLY C CA  1 
ATOM   2713 C  C   . GLY C 1 125 ? 14.797  64.186 20.926  1.00 50.36 ? 241 GLY C C   1 
ATOM   2714 O  O   . GLY C 1 125 ? 14.843  64.434 22.131  1.00 51.72 ? 241 GLY C O   1 
ATOM   2715 N  N   . ILE C 1 126 ? 13.833  64.641 20.145  1.00 50.31 ? 242 ILE C N   1 
ATOM   2716 C  CA  . ILE C 1 126 ? 12.800  65.510 20.678  1.00 50.59 ? 242 ILE C CA  1 
ATOM   2717 C  C   . ILE C 1 126 ? 11.410  65.017 20.332  1.00 51.04 ? 242 ILE C C   1 
ATOM   2718 O  O   . ILE C 1 126 ? 11.202  64.381 19.306  1.00 51.84 ? 242 ILE C O   1 
ATOM   2719 C  CB  . ILE C 1 126 ? 12.970  66.946 20.120  1.00 50.51 ? 242 ILE C CB  1 
ATOM   2720 C  CG1 . ILE C 1 126 ? 14.248  67.567 20.685  1.00 50.36 ? 242 ILE C CG1 1 
ATOM   2721 C  CG2 . ILE C 1 126 ? 11.756  67.791 20.452  1.00 49.85 ? 242 ILE C CG2 1 
ATOM   2722 C  CD1 . ILE C 1 126 ? 14.549  68.969 20.186  1.00 49.47 ? 242 ILE C CD1 1 
ATOM   2723 N  N   . ILE C 1 127 ? 10.464  65.303 21.208  1.00 51.14 ? 243 ILE C N   1 
ATOM   2724 C  CA  . ILE C 1 127 ? 9.077   64.947 20.978  1.00 52.29 ? 243 ILE C CA  1 
ATOM   2725 C  C   . ILE C 1 127 ? 8.297   66.205 21.349  1.00 53.03 ? 243 ILE C C   1 
ATOM   2726 O  O   . ILE C 1 127 ? 8.715   66.963 22.225  1.00 53.19 ? 243 ILE C O   1 
ATOM   2727 C  CB  . ILE C 1 127 ? 8.618   63.788 21.865  1.00 51.87 ? 243 ILE C CB  1 
ATOM   2728 C  CG1 . ILE C 1 127 ? 7.192   63.414 21.494  1.00 53.65 ? 243 ILE C CG1 1 
ATOM   2729 C  CG2 . ILE C 1 127 ? 8.650   64.192 23.321  1.00 51.80 ? 243 ILE C CG2 1 
ATOM   2730 C  CD1 . ILE C 1 127 ? 6.448   62.679 22.586  1.00 55.27 ? 243 ILE C CD1 1 
ATOM   2731 N  N   . PHE C 1 128 ? 7.166   66.434 20.696  1.00 54.03 ? 244 PHE C N   1 
ATOM   2732 C  CA  . PHE C 1 128 ? 6.395   67.639 20.973  1.00 54.99 ? 244 PHE C CA  1 
ATOM   2733 C  C   . PHE C 1 128 ? 5.187   67.531 21.869  1.00 55.32 ? 244 PHE C C   1 
ATOM   2734 O  O   . PHE C 1 128 ? 4.417   66.578 21.795  1.00 55.36 ? 244 PHE C O   1 
ATOM   2735 C  CB  . PHE C 1 128 ? 5.913   68.278 19.673  1.00 56.15 ? 244 PHE C CB  1 
ATOM   2736 C  CG  . PHE C 1 128 ? 6.884   69.242 19.065  1.00 56.98 ? 244 PHE C CG  1 
ATOM   2737 C  CD1 . PHE C 1 128 ? 7.990   68.785 18.360  1.00 57.77 ? 244 PHE C CD1 1 
ATOM   2738 C  CD2 . PHE C 1 128 ? 6.663   70.612 19.156  1.00 56.83 ? 244 PHE C CD2 1 
ATOM   2739 C  CE1 . PHE C 1 128 ? 8.862   69.682 17.745  1.00 58.16 ? 244 PHE C CE1 1 
ATOM   2740 C  CE2 . PHE C 1 128 ? 7.518   71.513 18.551  1.00 57.41 ? 244 PHE C CE2 1 
ATOM   2741 C  CZ  . PHE C 1 128 ? 8.623   71.052 17.841  1.00 58.40 ? 244 PHE C CZ  1 
ATOM   2742 N  N   . GLY C 1 129 ? 5.036   68.544 22.713  1.00 56.18 ? 245 GLY C N   1 
ATOM   2743 C  CA  . GLY C 1 129 ? 3.876   68.644 23.574  1.00 57.65 ? 245 GLY C CA  1 
ATOM   2744 C  C   . GLY C 1 129 ? 3.084   69.661 22.769  1.00 58.17 ? 245 GLY C C   1 
ATOM   2745 O  O   . GLY C 1 129 ? 3.678   70.418 22.001  1.00 57.95 ? 245 GLY C O   1 
ATOM   2746 N  N   . THR C 1 130 ? 1.769   69.697 22.910  1.00 59.02 ? 246 THR C N   1 
ATOM   2747 C  CA  . THR C 1 130 ? 0.971   70.644 22.135  1.00 60.34 ? 246 THR C CA  1 
ATOM   2748 C  C   . THR C 1 130 ? 1.510   72.076 22.111  1.00 61.06 ? 246 THR C C   1 
ATOM   2749 O  O   . THR C 1 130 ? 1.202   72.839 21.196  1.00 61.68 ? 246 THR C O   1 
ATOM   2750 C  CB  . THR C 1 130 ? -0.467  70.688 22.646  1.00 60.95 ? 246 THR C CB  1 
ATOM   2751 O  OG1 . THR C 1 130 ? -0.478  71.191 23.990  1.00 62.35 ? 246 THR C OG1 1 
ATOM   2752 C  CG2 . THR C 1 130 ? -1.079  69.279 22.628  1.00 61.07 ? 246 THR C CG2 1 
ATOM   2753 N  N   . ASN C 1 131 ? 2.327   72.443 23.093  1.00 61.49 ? 247 ASN C N   1 
ATOM   2754 C  CA  . ASN C 1 131 ? 2.861   73.803 23.160  1.00 61.60 ? 247 ASN C CA  1 
ATOM   2755 C  C   . ASN C 1 131 ? 4.371   73.904 22.957  1.00 61.41 ? 247 ASN C C   1 
ATOM   2756 O  O   . ASN C 1 131 ? 4.951   74.978 23.144  1.00 60.32 ? 247 ASN C O   1 
ATOM   2757 C  CB  . ASN C 1 131 ? 2.544   74.408 24.514  1.00 62.11 ? 247 ASN C CB  1 
ATOM   2758 C  CG  . ASN C 1 131 ? 3.206   73.648 25.636  1.00 64.01 ? 247 ASN C CG  1 
ATOM   2759 O  OD1 . ASN C 1 131 ? 3.380   74.160 26.748  1.00 65.73 ? 247 ASN C OD1 1 
ATOM   2760 N  ND2 . ASN C 1 131 ? 3.579   72.404 25.354  1.00 64.15 ? 247 ASN C ND2 1 
ATOM   2761 N  N   . GLY C 1 132 ? 5.016   72.800 22.599  1.00 61.36 ? 254 GLY C N   1 
ATOM   2762 C  CA  . GLY C 1 132 ? 6.456   72.853 22.394  1.00 60.62 ? 254 GLY C CA  1 
ATOM   2763 C  C   . GLY C 1 132 ? 7.194   71.533 22.533  1.00 60.26 ? 254 GLY C C   1 
ATOM   2764 O  O   . GLY C 1 132 ? 6.618   70.513 22.933  1.00 59.41 ? 254 GLY C O   1 
ATOM   2765 N  N   . PRO C 1 133 ? 8.494   71.529 22.218  1.00 59.44 ? 255 PRO C N   1 
ATOM   2766 C  CA  . PRO C 1 133 ? 9.365   70.358 22.286  1.00 58.85 ? 255 PRO C CA  1 
ATOM   2767 C  C   . PRO C 1 133 ? 9.833   70.022 23.690  1.00 58.06 ? 255 PRO C C   1 
ATOM   2768 O  O   . PRO C 1 133 ? 9.829   70.869 24.581  1.00 57.97 ? 255 PRO C O   1 
ATOM   2769 C  CB  . PRO C 1 133 ? 10.527  70.764 21.401  1.00 59.82 ? 255 PRO C CB  1 
ATOM   2770 C  CG  . PRO C 1 133 ? 10.686  72.201 21.770  1.00 59.76 ? 255 PRO C CG  1 
ATOM   2771 C  CD  . PRO C 1 133 ? 9.241   72.695 21.718  1.00 59.86 ? 255 PRO C CD  1 
ATOM   2772 N  N   . VAL C 1 134 ? 10.237  68.767 23.864  1.00 57.57 ? 256 VAL C N   1 
ATOM   2773 C  CA  . VAL C 1 134 ? 10.754  68.254 25.136  1.00 57.13 ? 256 VAL C CA  1 
ATOM   2774 C  C   . VAL C 1 134 ? 11.799  67.203 24.795  1.00 56.17 ? 256 VAL C C   1 
ATOM   2775 O  O   . VAL C 1 134 ? 11.664  66.492 23.792  1.00 56.30 ? 256 VAL C O   1 
ATOM   2776 C  CB  . VAL C 1 134 ? 9.693   67.521 25.959  1.00 56.71 ? 256 VAL C CB  1 
ATOM   2777 C  CG1 . VAL C 1 134 ? 10.171  67.381 27.376  1.00 57.63 ? 256 VAL C CG1 1 
ATOM   2778 C  CG2 . VAL C 1 134 ? 8.391   68.245 25.904  1.00 57.88 ? 256 VAL C CG2 1 
ATOM   2779 N  N   . ASP C 1 135 ? 12.834  67.089 25.615  1.00 54.51 ? 257 ASP C N   1 
ATOM   2780 C  CA  . ASP C 1 135 ? 13.839  66.077 25.346  1.00 54.72 ? 257 ASP C CA  1 
ATOM   2781 C  C   . ASP C 1 135 ? 13.339  64.698 25.776  1.00 53.31 ? 257 ASP C C   1 
ATOM   2782 O  O   . ASP C 1 135 ? 12.909  64.517 26.913  1.00 53.42 ? 257 ASP C O   1 
ATOM   2783 C  CB  . ASP C 1 135 ? 15.136  66.400 26.075  1.00 56.21 ? 257 ASP C CB  1 
ATOM   2784 C  CG  . ASP C 1 135 ? 15.906  67.514 25.421  1.00 57.77 ? 257 ASP C CG  1 
ATOM   2785 O  OD1 . ASP C 1 135 ? 16.957  67.875 25.981  1.00 61.17 ? 257 ASP C OD1 1 
ATOM   2786 O  OD2 . ASP C 1 135 ? 15.477  68.023 24.359  1.00 57.74 ? 257 ASP C OD2 1 
ATOM   2787 N  N   . LEU C 1 136 ? 13.390  63.733 24.861  1.00 51.77 ? 258 LEU C N   1 
ATOM   2788 C  CA  . LEU C 1 136 ? 12.948  62.392 25.174  1.00 51.65 ? 258 LEU C CA  1 
ATOM   2789 C  C   . LEU C 1 136 ? 13.662  61.954 26.439  1.00 52.01 ? 258 LEU C C   1 
ATOM   2790 O  O   . LEU C 1 136 ? 13.074  61.337 27.324  1.00 51.38 ? 258 LEU C O   1 
ATOM   2791 C  CB  . LEU C 1 136 ? 13.293  61.450 24.030  1.00 51.76 ? 258 LEU C CB  1 
ATOM   2792 C  CG  . LEU C 1 136 ? 12.066  60.765 23.437  1.00 53.63 ? 258 LEU C CG  1 
ATOM   2793 C  CD1 . LEU C 1 136 ? 12.449  59.981 22.189  1.00 55.30 ? 258 LEU C CD1 1 
ATOM   2794 C  CD2 . LEU C 1 136 ? 11.440  59.859 24.480  1.00 53.47 ? 258 LEU C CD2 1 
ATOM   2795 N  N   . LYS C 1 137 ? 14.940  62.302 26.520  1.00 52.52 ? 259 LYS C N   1 
ATOM   2796 C  CA  . LYS C 1 137 ? 15.756  61.953 27.665  1.00 53.53 ? 259 LYS C CA  1 
ATOM   2797 C  C   . LYS C 1 137 ? 15.085  62.408 28.957  1.00 54.33 ? 259 LYS C C   1 
ATOM   2798 O  O   . LYS C 1 137 ? 15.044  61.664 29.933  1.00 54.93 ? 259 LYS C O   1 
ATOM   2799 C  CB  . LYS C 1 137 ? 17.141  62.593 27.536  1.00 54.58 ? 259 LYS C CB  1 
ATOM   2800 C  CG  . LYS C 1 137 ? 18.207  61.998 28.462  1.00 56.22 ? 259 LYS C CG  1 
ATOM   2801 C  CD  . LYS C 1 137 ? 18.488  60.515 28.151  1.00 56.77 ? 259 LYS C CD  1 
ATOM   2802 C  CE  . LYS C 1 137 ? 19.547  59.940 29.088  1.00 57.45 ? 259 LYS C CE  1 
ATOM   2803 N  NZ  . LYS C 1 137 ? 19.798  58.478 28.880  1.00 59.13 ? 259 LYS C NZ  1 
ATOM   2804 N  N   . LYS C 1 138 ? 14.555  63.624 28.978  1.00 53.59 ? 260 LYS C N   1 
ATOM   2805 C  CA  . LYS C 1 138 ? 13.893  64.091 30.186  1.00 54.29 ? 260 LYS C CA  1 
ATOM   2806 C  C   . LYS C 1 138 ? 12.709  63.187 30.562  1.00 53.33 ? 260 LYS C C   1 
ATOM   2807 O  O   . LYS C 1 138 ? 12.507  62.883 31.737  1.00 53.70 ? 260 LYS C O   1 
ATOM   2808 C  CB  . LYS C 1 138 ? 13.428  65.544 30.033  1.00 54.79 ? 260 LYS C CB  1 
ATOM   2809 C  CG  . LYS C 1 138 ? 12.445  65.962 31.110  1.00 57.65 ? 260 LYS C CG  1 
ATOM   2810 C  CD  . LYS C 1 138 ? 12.256  67.463 31.166  1.00 60.73 ? 260 LYS C CD  1 
ATOM   2811 C  CE  . LYS C 1 138 ? 13.449  68.134 31.823  1.00 63.08 ? 260 LYS C CE  1 
ATOM   2812 N  NZ  . LYS C 1 138 ? 13.273  69.614 31.920  1.00 63.06 ? 260 LYS C NZ  1 
ATOM   2813 N  N   . ILE C 1 139 ? 11.929  62.764 29.575  1.00 51.81 ? 261 ILE C N   1 
ATOM   2814 C  CA  . ILE C 1 139 ? 10.796  61.888 29.838  1.00 51.30 ? 261 ILE C CA  1 
ATOM   2815 C  C   . ILE C 1 139 ? 11.320  60.555 30.331  1.00 51.71 ? 261 ILE C C   1 
ATOM   2816 O  O   . ILE C 1 139 ? 10.851  60.003 31.313  1.00 51.28 ? 261 ILE C O   1 
ATOM   2817 C  CB  . ILE C 1 139 ? 9.996   61.601 28.562  1.00 51.58 ? 261 ILE C CB  1 
ATOM   2818 C  CG1 . ILE C 1 139 ? 9.293   62.867 28.092  1.00 51.98 ? 261 ILE C CG1 1 
ATOM   2819 C  CG2 . ILE C 1 139 ? 9.014   60.471 28.806  1.00 49.16 ? 261 ILE C CG2 1 
ATOM   2820 C  CD1 . ILE C 1 139 ? 8.479   62.658 26.828  1.00 52.88 ? 261 ILE C CD1 1 
ATOM   2821 N  N   . THR C 1 140 ? 12.305  60.047 29.611  1.00 52.47 ? 262 THR C N   1 
ATOM   2822 C  CA  . THR C 1 140 ? 12.928  58.767 29.899  1.00 52.48 ? 262 THR C CA  1 
ATOM   2823 C  C   . THR C 1 140 ? 13.588  58.633 31.265  1.00 52.90 ? 262 THR C C   1 
ATOM   2824 O  O   . THR C 1 140 ? 13.414  57.618 31.937  1.00 53.18 ? 262 THR C O   1 
ATOM   2825 C  CB  . THR C 1 140 ? 13.960  58.448 28.804  1.00 52.67 ? 262 THR C CB  1 
ATOM   2826 O  OG1 . THR C 1 140 ? 13.415  57.452 27.939  1.00 54.11 ? 262 THR C OG1 1 
ATOM   2827 C  CG2 . THR C 1 140 ? 15.290  57.975 29.399  1.00 53.88 ? 262 THR C CG2 1 
ATOM   2828 N  N   . ASN C 1 141 ? 14.343  59.649 31.671  1.00 52.85 ? 263 ASN C N   1 
ATOM   2829 C  CA  . ASN C 1 141 ? 15.053  59.611 32.942  1.00 53.00 ? 263 ASN C CA  1 
ATOM   2830 C  C   . ASN C 1 141 ? 14.220  59.286 34.169  1.00 53.16 ? 263 ASN C C   1 
ATOM   2831 O  O   . ASN C 1 141 ? 14.734  58.705 35.134  1.00 53.65 ? 263 ASN C O   1 
ATOM   2832 C  CB  . ASN C 1 141 ? 15.794  60.926 33.193  1.00 53.27 ? 263 ASN C CB  1 
ATOM   2833 C  CG  . ASN C 1 141 ? 17.063  61.055 32.367  1.00 53.67 ? 263 ASN C CG  1 
ATOM   2834 O  OD1 . ASN C 1 141 ? 17.607  60.063 31.869  1.00 55.07 ? 263 ASN C OD1 1 
ATOM   2835 N  ND2 . ASN C 1 141 ? 17.553  62.280 32.233  1.00 52.28 ? 263 ASN C ND2 1 
ATOM   2836 N  N   . PHE C 1 142 ? 12.947  59.657 34.154  1.00 52.78 ? 264 PHE C N   1 
ATOM   2837 C  CA  . PHE C 1 142 ? 12.100  59.384 35.304  1.00 52.42 ? 264 PHE C CA  1 
ATOM   2838 C  C   . PHE C 1 142 ? 12.064  57.914 35.668  1.00 52.41 ? 264 PHE C C   1 
ATOM   2839 O  O   . PHE C 1 142 ? 11.763  57.573 36.813  1.00 53.15 ? 264 PHE C O   1 
ATOM   2840 C  CB  . PHE C 1 142 ? 10.676  59.884 35.066  1.00 51.86 ? 264 PHE C CB  1 
ATOM   2841 C  CG  . PHE C 1 142 ? 10.544  61.374 35.150  1.00 50.72 ? 264 PHE C CG  1 
ATOM   2842 C  CD1 . PHE C 1 142 ? 10.094  62.112 34.058  1.00 50.50 ? 264 PHE C CD1 1 
ATOM   2843 C  CD2 . PHE C 1 142 ? 10.893  62.042 36.311  1.00 49.87 ? 264 PHE C CD2 1 
ATOM   2844 C  CE1 . PHE C 1 142 ? 9.997   63.492 34.125  1.00 50.52 ? 264 PHE C CE1 1 
ATOM   2845 C  CE2 . PHE C 1 142 ? 10.800  63.425 36.391  1.00 50.31 ? 264 PHE C CE2 1 
ATOM   2846 C  CZ  . PHE C 1 142 ? 10.352  64.150 35.299  1.00 51.09 ? 264 PHE C CZ  1 
ATOM   2847 N  N   . PHE C 1 143 ? 12.386  57.047 34.712  1.00 51.06 ? 265 PHE C N   1 
ATOM   2848 C  CA  . PHE C 1 143 ? 12.366  55.622 34.973  1.00 51.16 ? 265 PHE C CA  1 
ATOM   2849 C  C   . PHE C 1 143 ? 13.722  54.959 35.113  1.00 51.71 ? 265 PHE C C   1 
ATOM   2850 O  O   . PHE C 1 143 ? 13.806  53.735 35.130  1.00 50.76 ? 265 PHE C O   1 
ATOM   2851 C  CB  . PHE C 1 143 ? 11.550  54.910 33.905  1.00 51.32 ? 265 PHE C CB  1 
ATOM   2852 C  CG  . PHE C 1 143 ? 10.148  55.402 33.811  1.00 52.08 ? 265 PHE C CG  1 
ATOM   2853 C  CD1 . PHE C 1 143 ? 9.857   56.580 33.154  1.00 53.21 ? 265 PHE C CD1 1 
ATOM   2854 C  CD2 . PHE C 1 143 ? 9.113   54.709 34.422  1.00 54.01 ? 265 PHE C CD2 1 
ATOM   2855 C  CE1 . PHE C 1 143 ? 8.551   57.064 33.106  1.00 54.48 ? 265 PHE C CE1 1 
ATOM   2856 C  CE2 . PHE C 1 143 ? 7.798   55.188 34.380  1.00 53.20 ? 265 PHE C CE2 1 
ATOM   2857 C  CZ  . PHE C 1 143 ? 7.522   56.362 33.723  1.00 53.87 ? 265 PHE C CZ  1 
ATOM   2858 N  N   . ARG C 1 144 ? 14.781  55.758 35.221  1.00 53.40 ? 266 ARG C N   1 
ATOM   2859 C  CA  . ARG C 1 144 ? 16.129  55.212 35.399  1.00 55.26 ? 266 ARG C CA  1 
ATOM   2860 C  C   . ARG C 1 144 ? 16.127  54.231 36.566  1.00 56.47 ? 266 ARG C C   1 
ATOM   2861 O  O   . ARG C 1 144 ? 15.454  54.445 37.580  1.00 57.03 ? 266 ARG C O   1 
ATOM   2862 C  CB  . ARG C 1 144 ? 17.136  56.329 35.682  1.00 56.10 ? 266 ARG C CB  1 
ATOM   2863 C  CG  . ARG C 1 144 ? 18.015  56.673 34.508  1.00 56.81 ? 266 ARG C CG  1 
ATOM   2864 C  CD  . ARG C 1 144 ? 18.204  58.170 34.374  1.00 58.96 ? 266 ARG C CD  1 
ATOM   2865 N  NE  . ARG C 1 144 ? 19.546  58.610 34.747  1.00 61.48 ? 266 ARG C NE  1 
ATOM   2866 C  CZ  . ARG C 1 144 ? 20.022  58.585 35.988  1.00 62.92 ? 266 ARG C CZ  1 
ATOM   2867 N  NH1 . ARG C 1 144 ? 19.260  58.141 36.983  1.00 64.27 ? 266 ARG C NH1 1 
ATOM   2868 N  NH2 . ARG C 1 144 ? 21.257  59.009 36.240  1.00 63.91 ? 266 ARG C NH2 1 
ATOM   2869 N  N   . GLY C 1 145 ? 16.889  53.157 36.420  1.00 57.73 ? 267 GLY C N   1 
ATOM   2870 C  CA  . GLY C 1 145 ? 16.936  52.144 37.458  1.00 59.77 ? 267 GLY C CA  1 
ATOM   2871 C  C   . GLY C 1 145 ? 17.086  52.643 38.890  1.00 60.76 ? 267 GLY C C   1 
ATOM   2872 O  O   . GLY C 1 145 ? 16.776  51.913 39.835  1.00 61.00 ? 267 GLY C O   1 
ATOM   2873 N  N   . ASP C 1 146 ? 17.548  53.878 39.059  1.00 60.72 ? 268 ASP C N   1 
ATOM   2874 C  CA  . ASP C 1 146 ? 17.763  54.424 40.387  1.00 60.40 ? 268 ASP C CA  1 
ATOM   2875 C  C   . ASP C 1 146 ? 16.717  55.456 40.782  1.00 60.92 ? 268 ASP C C   1 
ATOM   2876 O  O   . ASP C 1 146 ? 16.694  55.918 41.926  1.00 61.83 ? 268 ASP C O   1 
ATOM   2877 C  CB  . ASP C 1 146 ? 19.163  55.047 40.459  1.00 60.43 ? 268 ASP C CB  1 
ATOM   2878 C  CG  . ASP C 1 146 ? 19.333  56.207 39.495  1.00 60.58 ? 268 ASP C CG  1 
ATOM   2879 O  OD1 . ASP C 1 146 ? 20.401  56.866 39.497  1.00 59.65 ? 268 ASP C OD1 1 
ATOM   2880 O  OD2 . ASP C 1 146 ? 18.383  56.464 38.727  1.00 62.74 ? 268 ASP C OD2 1 
ATOM   2881 N  N   . ARG C 1 147 ? 15.853  55.821 39.839  1.00 60.88 ? 269 ARG C N   1 
ATOM   2882 C  CA  . ARG C 1 147 ? 14.813  56.812 40.102  1.00 60.44 ? 269 ARG C CA  1 
ATOM   2883 C  C   . ARG C 1 147 ? 13.414  56.189 40.178  1.00 60.14 ? 269 ARG C C   1 
ATOM   2884 O  O   . ARG C 1 147 ? 12.437  56.862 40.487  1.00 60.23 ? 269 ARG C O   1 
ATOM   2885 C  CB  . ARG C 1 147 ? 14.841  57.908 39.027  1.00 61.01 ? 269 ARG C CB  1 
ATOM   2886 C  CG  . ARG C 1 147 ? 15.647  59.146 39.408  1.00 60.79 ? 269 ARG C CG  1 
ATOM   2887 C  CD  . ARG C 1 147 ? 16.932  59.309 38.599  1.00 61.25 ? 269 ARG C CD  1 
ATOM   2888 N  NE  . ARG C 1 147 ? 16.855  60.442 37.674  1.00 63.12 ? 269 ARG C NE  1 
ATOM   2889 C  CZ  . ARG C 1 147 ? 17.907  61.149 37.244  1.00 64.11 ? 269 ARG C CZ  1 
ATOM   2890 N  NH1 . ARG C 1 147 ? 19.138  60.854 37.647  1.00 65.00 ? 269 ARG C NH1 1 
ATOM   2891 N  NH2 . ARG C 1 147 ? 17.734  62.173 36.415  1.00 64.11 ? 269 ARG C NH2 1 
ATOM   2892 N  N   . CYS C 1 148 ? 13.319  54.902 39.882  1.00 59.52 ? 270 CYS C N   1 
ATOM   2893 C  CA  . CYS C 1 148 ? 12.044  54.211 39.945  1.00 59.00 ? 270 CYS C CA  1 
ATOM   2894 C  C   . CYS C 1 148 ? 12.318  52.773 40.342  1.00 59.52 ? 270 CYS C C   1 
ATOM   2895 O  O   . CYS C 1 148 ? 12.065  51.840 39.580  1.00 59.36 ? 270 CYS C O   1 
ATOM   2896 C  CB  . CYS C 1 148 ? 11.344  54.245 38.594  1.00 59.52 ? 270 CYS C CB  1 
ATOM   2897 S  SG  . CYS C 1 148 ? 9.733   53.417 38.616  1.00 58.91 ? 270 CYS C SG  1 
ATOM   2898 N  N   . ARG C 1 149 ? 12.836  52.610 41.555  1.00 60.85 ? 271 ARG C N   1 
ATOM   2899 C  CA  . ARG C 1 149 ? 13.197  51.307 42.098  1.00 61.54 ? 271 ARG C CA  1 
ATOM   2900 C  C   . ARG C 1 149 ? 12.152  50.229 41.860  1.00 61.07 ? 271 ARG C C   1 
ATOM   2901 O  O   . ARG C 1 149 ? 12.477  49.059 41.674  1.00 61.55 ? 271 ARG C O   1 
ATOM   2902 C  CB  . ARG C 1 149 ? 13.470  51.446 43.588  1.00 63.04 ? 271 ARG C CB  1 
ATOM   2903 C  CG  . ARG C 1 149 ? 14.533  52.462 43.906  1.00 65.41 ? 271 ARG C CG  1 
ATOM   2904 C  CD  . ARG C 1 149 ? 14.622  52.691 45.410  1.00 68.89 ? 271 ARG C CD  1 
ATOM   2905 N  NE  . ARG C 1 149 ? 15.767  53.536 45.751  1.00 71.46 ? 271 ARG C NE  1 
ATOM   2906 C  CZ  . ARG C 1 149 ? 17.034  53.180 45.554  1.00 72.28 ? 271 ARG C CZ  1 
ATOM   2907 N  NH1 . ARG C 1 149 ? 17.310  51.992 45.019  1.00 72.67 ? 271 ARG C NH1 1 
ATOM   2908 N  NH2 . ARG C 1 149 ? 18.022  54.008 45.886  1.00 73.26 ? 271 ARG C NH2 1 
ATOM   2909 N  N   . SER C 1 150 ? 10.892  50.627 41.862  1.00 61.08 ? 272 SER C N   1 
ATOM   2910 C  CA  . SER C 1 150 ? 9.806   49.688 41.646  1.00 61.04 ? 272 SER C CA  1 
ATOM   2911 C  C   . SER C 1 150 ? 9.909   48.960 40.291  1.00 60.08 ? 272 SER C C   1 
ATOM   2912 O  O   . SER C 1 150 ? 9.360   47.873 40.120  1.00 59.80 ? 272 SER C O   1 
ATOM   2913 C  CB  . SER C 1 150 ? 8.478   50.447 41.740  1.00 62.17 ? 272 SER C CB  1 
ATOM   2914 O  OG  . SER C 1 150 ? 7.385   49.549 41.735  1.00 64.17 ? 272 SER C OG  1 
ATOM   2915 N  N   . LEU C 1 151 ? 10.615  49.563 39.335  1.00 59.77 ? 273 LEU C N   1 
ATOM   2916 C  CA  . LEU C 1 151 ? 10.768  48.974 38.000  1.00 58.08 ? 273 LEU C CA  1 
ATOM   2917 C  C   . LEU C 1 151 ? 12.160  48.429 37.715  1.00 57.14 ? 273 LEU C C   1 
ATOM   2918 O  O   . LEU C 1 151 ? 12.393  47.828 36.665  1.00 57.49 ? 273 LEU C O   1 
ATOM   2919 C  CB  . LEU C 1 151 ? 10.397  50.002 36.919  1.00 57.45 ? 273 LEU C CB  1 
ATOM   2920 C  CG  . LEU C 1 151 ? 8.896   50.311 36.801  1.00 57.07 ? 273 LEU C CG  1 
ATOM   2921 C  CD1 . LEU C 1 151 ? 8.632   51.507 35.889  1.00 55.74 ? 273 LEU C CD1 1 
ATOM   2922 C  CD2 . LEU C 1 151 ? 8.204   49.072 36.283  1.00 55.90 ? 273 LEU C CD2 1 
ATOM   2923 N  N   . THR C 1 152 ? 13.086  48.624 38.647  1.00 54.97 ? 274 THR C N   1 
ATOM   2924 C  CA  . THR C 1 152 ? 14.438  48.129 38.449  1.00 53.70 ? 274 THR C CA  1 
ATOM   2925 C  C   . THR C 1 152 ? 14.448  46.671 38.026  1.00 53.86 ? 274 THR C C   1 
ATOM   2926 O  O   . THR C 1 152 ? 13.715  45.857 38.577  1.00 55.12 ? 274 THR C O   1 
ATOM   2927 C  CB  . THR C 1 152 ? 15.255  48.250 39.712  1.00 52.45 ? 274 THR C CB  1 
ATOM   2928 O  OG1 . THR C 1 152 ? 15.285  49.620 40.119  1.00 52.10 ? 274 THR C OG1 1 
ATOM   2929 C  CG2 . THR C 1 152 ? 16.667  47.771 39.460  1.00 52.50 ? 274 THR C CG2 1 
ATOM   2930 N  N   . GLY C 1 153 ? 15.277  46.342 37.041  1.00 53.33 ? 275 GLY C N   1 
ATOM   2931 C  CA  . GLY C 1 153 ? 15.361  44.967 36.585  1.00 52.09 ? 275 GLY C CA  1 
ATOM   2932 C  C   . GLY C 1 153 ? 14.183  44.526 35.742  1.00 51.91 ? 275 GLY C C   1 
ATOM   2933 O  O   . GLY C 1 153 ? 14.132  43.389 35.266  1.00 50.95 ? 275 GLY C O   1 
ATOM   2934 N  N   . LYS C 1 154 ? 13.224  45.422 35.562  1.00 52.03 ? 276 LYS C N   1 
ATOM   2935 C  CA  . LYS C 1 154 ? 12.058  45.111 34.753  1.00 52.96 ? 276 LYS C CA  1 
ATOM   2936 C  C   . LYS C 1 154 ? 12.155  45.872 33.433  1.00 51.81 ? 276 LYS C C   1 
ATOM   2937 O  O   . LYS C 1 154 ? 12.667  46.987 33.386  1.00 52.06 ? 276 LYS C O   1 
ATOM   2938 C  CB  . LYS C 1 154 ? 10.784  45.502 35.502  1.00 54.80 ? 276 LYS C CB  1 
ATOM   2939 C  CG  . LYS C 1 154 ? 10.584  44.752 36.802  1.00 55.93 ? 276 LYS C CG  1 
ATOM   2940 C  CD  . LYS C 1 154 ? 9.383   45.301 37.560  1.00 57.76 ? 276 LYS C CD  1 
ATOM   2941 C  CE  . LYS C 1 154 ? 9.061   44.476 38.805  1.00 57.02 ? 276 LYS C CE  1 
ATOM   2942 N  NZ  . LYS C 1 154 ? 7.964   45.110 39.587  1.00 56.94 ? 276 LYS C NZ  1 
ATOM   2943 N  N   . PRO C 1 155 ? 11.663  45.278 32.340  1.00 50.68 ? 277 PRO C N   1 
ATOM   2944 C  CA  . PRO C 1 155 ? 11.729  45.953 31.047  1.00 49.82 ? 277 PRO C CA  1 
ATOM   2945 C  C   . PRO C 1 155 ? 10.846  47.179 30.938  1.00 49.33 ? 277 PRO C C   1 
ATOM   2946 O  O   . PRO C 1 155 ? 9.652   47.128 31.210  1.00 49.93 ? 277 PRO C O   1 
ATOM   2947 C  CB  . PRO C 1 155 ? 11.321  44.860 30.070  1.00 49.63 ? 277 PRO C CB  1 
ATOM   2948 C  CG  . PRO C 1 155 ? 10.337  44.091 30.845  1.00 50.64 ? 277 PRO C CG  1 
ATOM   2949 C  CD  . PRO C 1 155 ? 11.012  43.967 32.203  1.00 50.89 ? 277 PRO C CD  1 
ATOM   2950 N  N   . LYS C 1 156 ? 11.466  48.281 30.535  1.00 48.70 ? 278 LYS C N   1 
ATOM   2951 C  CA  . LYS C 1 156 ? 10.804  49.560 30.340  1.00 47.71 ? 278 LYS C CA  1 
ATOM   2952 C  C   . LYS C 1 156 ? 10.824  49.821 28.824  1.00 48.46 ? 278 LYS C C   1 
ATOM   2953 O  O   . LYS C 1 156 ? 11.887  50.041 28.235  1.00 48.20 ? 278 LYS C O   1 
ATOM   2954 C  CB  . LYS C 1 156 ? 11.582  50.635 31.097  1.00 46.41 ? 278 LYS C CB  1 
ATOM   2955 C  CG  . LYS C 1 156 ? 11.605  50.414 32.592  1.00 45.44 ? 278 LYS C CG  1 
ATOM   2956 C  CD  . LYS C 1 156 ? 12.636  51.286 33.276  1.00 46.96 ? 278 LYS C CD  1 
ATOM   2957 C  CE  . LYS C 1 156 ? 13.977  50.581 33.403  1.00 46.91 ? 278 LYS C CE  1 
ATOM   2958 N  NZ  . LYS C 1 156 ? 13.953  49.456 34.391  1.00 46.93 ? 278 LYS C NZ  1 
ATOM   2959 N  N   . LEU C 1 157 ? 9.653   49.789 28.193  1.00 48.63 ? 279 LEU C N   1 
ATOM   2960 C  CA  . LEU C 1 157 ? 9.571   49.973 26.745  1.00 49.51 ? 279 LEU C CA  1 
ATOM   2961 C  C   . LEU C 1 157 ? 8.980   51.305 26.304  1.00 50.44 ? 279 LEU C C   1 
ATOM   2962 O  O   . LEU C 1 157 ? 7.893   51.667 26.740  1.00 52.18 ? 279 LEU C O   1 
ATOM   2963 C  CB  . LEU C 1 157 ? 8.741   48.842 26.135  1.00 47.86 ? 279 LEU C CB  1 
ATOM   2964 C  CG  . LEU C 1 157 ? 9.114   47.437 26.598  1.00 47.56 ? 279 LEU C CG  1 
ATOM   2965 C  CD1 . LEU C 1 157 ? 8.300   46.415 25.836  1.00 49.20 ? 279 LEU C CD1 1 
ATOM   2966 C  CD2 . LEU C 1 157 ? 10.578  47.195 26.375  1.00 47.01 ? 279 LEU C CD2 1 
ATOM   2967 N  N   . PHE C 1 158 ? 9.691   52.038 25.447  1.00 49.51 ? 280 PHE C N   1 
ATOM   2968 C  CA  . PHE C 1 158 ? 9.175   53.304 24.933  1.00 49.17 ? 280 PHE C CA  1 
ATOM   2969 C  C   . PHE C 1 158 ? 9.008   53.210 23.425  1.00 50.45 ? 280 PHE C C   1 
ATOM   2970 O  O   . PHE C 1 158 ? 9.959   52.928 22.693  1.00 50.79 ? 280 PHE C O   1 
ATOM   2971 C  CB  . PHE C 1 158 ? 10.097  54.461 25.263  1.00 48.82 ? 280 PHE C CB  1 
ATOM   2972 C  CG  . PHE C 1 158 ? 10.198  54.744 26.720  1.00 50.25 ? 280 PHE C CG  1 
ATOM   2973 C  CD1 . PHE C 1 158 ? 10.982  53.945 27.544  1.00 49.53 ? 280 PHE C CD1 1 
ATOM   2974 C  CD2 . PHE C 1 158 ? 9.496   55.807 27.281  1.00 48.57 ? 280 PHE C CD2 1 
ATOM   2975 C  CE1 . PHE C 1 158 ? 11.064  54.202 28.897  1.00 49.24 ? 280 PHE C CE1 1 
ATOM   2976 C  CE2 . PHE C 1 158 ? 9.572   56.072 28.634  1.00 47.82 ? 280 PHE C CE2 1 
ATOM   2977 C  CZ  . PHE C 1 158 ? 10.354  55.271 29.443  1.00 49.09 ? 280 PHE C CZ  1 
ATOM   2978 N  N   . ILE C 1 159 ? 7.787   53.443 22.965  1.00 49.87 ? 281 ILE C N   1 
ATOM   2979 C  CA  . ILE C 1 159 ? 7.474   53.361 21.554  1.00 49.92 ? 281 ILE C CA  1 
ATOM   2980 C  C   . ILE C 1 159 ? 7.236   54.775 21.045  1.00 51.02 ? 281 ILE C C   1 
ATOM   2981 O  O   . ILE C 1 159 ? 6.307   55.457 21.488  1.00 51.60 ? 281 ILE C O   1 
ATOM   2982 C  CB  . ILE C 1 159 ? 6.231   52.467 21.364  1.00 49.85 ? 281 ILE C CB  1 
ATOM   2983 C  CG1 . ILE C 1 159 ? 6.540   51.076 21.933  1.00 51.09 ? 281 ILE C CG1 1 
ATOM   2984 C  CG2 . ILE C 1 159 ? 5.861   52.359 19.897  1.00 49.35 ? 281 ILE C CG2 1 
ATOM   2985 C  CD1 . ILE C 1 159 ? 5.343   50.150 22.079  1.00 51.27 ? 281 ILE C CD1 1 
ATOM   2986 N  N   . ILE C 1 160 ? 8.088   55.223 20.125  1.00 50.22 ? 282 ILE C N   1 
ATOM   2987 C  CA  . ILE C 1 160 ? 7.973   56.575 19.590  1.00 49.11 ? 282 ILE C CA  1 
ATOM   2988 C  C   . ILE C 1 160 ? 7.610   56.683 18.119  1.00 49.40 ? 282 ILE C C   1 
ATOM   2989 O  O   . ILE C 1 160 ? 8.389   56.310 17.243  1.00 49.66 ? 282 ILE C O   1 
ATOM   2990 C  CB  . ILE C 1 160 ? 9.276   57.364 19.778  1.00 48.91 ? 282 ILE C CB  1 
ATOM   2991 C  CG1 . ILE C 1 160 ? 9.622   57.459 21.254  1.00 47.46 ? 282 ILE C CG1 1 
ATOM   2992 C  CG2 . ILE C 1 160 ? 9.145   58.741 19.165  1.00 48.69 ? 282 ILE C CG2 1 
ATOM   2993 C  CD1 . ILE C 1 160 ? 10.694  56.516 21.647  1.00 47.66 ? 282 ILE C CD1 1 
ATOM   2994 N  N   . GLN C 1 161 ? 6.418   57.205 17.858  1.00 48.48 ? 283 GLN C N   1 
ATOM   2995 C  CA  . GLN C 1 161 ? 5.964   57.423 16.496  1.00 47.60 ? 283 GLN C CA  1 
ATOM   2996 C  C   . GLN C 1 161 ? 6.080   58.922 16.277  1.00 47.40 ? 283 GLN C C   1 
ATOM   2997 O  O   . GLN C 1 161 ? 5.154   59.680 16.562  1.00 48.72 ? 283 GLN C O   1 
ATOM   2998 C  CB  . GLN C 1 161 ? 4.512   56.972 16.310  1.00 46.43 ? 283 GLN C CB  1 
ATOM   2999 C  CG  . GLN C 1 161 ? 3.844   57.501 15.036  1.00 45.80 ? 283 GLN C CG  1 
ATOM   3000 C  CD  . GLN C 1 161 ? 4.678   57.307 13.781  1.00 45.33 ? 283 GLN C CD  1 
ATOM   3001 O  OE1 . GLN C 1 161 ? 5.100   56.198 13.457  1.00 45.46 ? 283 GLN C OE1 1 
ATOM   3002 N  NE2 . GLN C 1 161 ? 4.908   58.393 13.062  1.00 45.30 ? 283 GLN C NE2 1 
ATOM   3003 N  N   . ALA C 1 162 ? 7.241   59.337 15.790  1.00 45.59 ? 284 ALA C N   1 
ATOM   3004 C  CA  . ALA C 1 162 ? 7.512   60.738 15.534  1.00 44.17 ? 284 ALA C CA  1 
ATOM   3005 C  C   . ALA C 1 162 ? 8.740   60.880 14.639  1.00 43.67 ? 284 ALA C C   1 
ATOM   3006 O  O   . ALA C 1 162 ? 9.558   59.970 14.538  1.00 43.48 ? 284 ALA C O   1 
ATOM   3007 C  CB  . ALA C 1 162 ? 7.731   61.459 16.842  1.00 41.65 ? 284 ALA C CB  1 
ATOM   3008 N  N   . ALA C 1 163 ? 8.855   62.021 13.978  1.00 43.49 ? 285 ALA C N   1 
ATOM   3009 C  CA  . ALA C 1 163 ? 9.986   62.266 13.107  1.00 44.41 ? 285 ALA C CA  1 
ATOM   3010 C  C   . ALA C 1 163 ? 11.234  62.492 13.947  1.00 43.35 ? 285 ALA C C   1 
ATOM   3011 O  O   . ALA C 1 163 ? 11.154  62.911 15.091  1.00 42.83 ? 285 ALA C O   1 
ATOM   3012 C  CB  . ALA C 1 163 ? 9.717   63.477 12.229  1.00 44.72 ? 285 ALA C CB  1 
ATOM   3013 N  N   . ARG C 1 164 ? 12.386  62.205 13.358  1.00 42.70 ? 286 ARG C N   1 
ATOM   3014 C  CA  . ARG C 1 164 ? 13.670  62.368 14.019  1.00 41.99 ? 286 ARG C CA  1 
ATOM   3015 C  C   . ARG C 1 164 ? 14.537  63.178 13.069  1.00 42.11 ? 286 ARG C C   1 
ATOM   3016 O  O   . ARG C 1 164 ? 15.745  63.024 13.026  1.00 42.35 ? 286 ARG C O   1 
ATOM   3017 C  CB  . ARG C 1 164 ? 14.310  61.001 14.264  1.00 41.05 ? 286 ARG C CB  1 
ATOM   3018 C  CG  . ARG C 1 164 ? 13.409  60.024 14.999  1.00 40.21 ? 286 ARG C CG  1 
ATOM   3019 C  CD  . ARG C 1 164 ? 14.063  58.658 15.170  1.00 39.39 ? 286 ARG C CD  1 
ATOM   3020 N  NE  . ARG C 1 164 ? 15.168  58.694 16.114  1.00 39.50 ? 286 ARG C NE  1 
ATOM   3021 C  CZ  . ARG C 1 164 ? 15.992  57.682 16.332  1.00 39.94 ? 286 ARG C CZ  1 
ATOM   3022 N  NH1 . ARG C 1 164 ? 15.843  56.543 15.678  1.00 38.34 ? 286 ARG C NH1 1 
ATOM   3023 N  NH2 . ARG C 1 164 ? 16.976  57.820 17.200  1.00 41.17 ? 286 ARG C NH2 1 
ATOM   3024 N  N   . GLY C 1 165 ? 13.898  64.038 12.296  1.00 41.42 ? 287 GLY C N   1 
ATOM   3025 C  CA  . GLY C 1 165 ? 14.621  64.849 11.338  1.00 42.57 ? 287 GLY C CA  1 
ATOM   3026 C  C   . GLY C 1 165 ? 13.772  65.014 10.096  1.00 42.18 ? 287 GLY C C   1 
ATOM   3027 O  O   . GLY C 1 165 ? 12.593  64.685 10.120  1.00 42.42 ? 287 GLY C O   1 
ATOM   3028 N  N   . THR C 1 166 ? 14.357  65.509 9.013   1.00 42.04 ? 288 THR C N   1 
ATOM   3029 C  CA  . THR C 1 166 ? 13.599  65.697 7.789   1.00 41.99 ? 288 THR C CA  1 
ATOM   3030 C  C   . THR C 1 166 ? 14.139  64.921 6.591   1.00 43.28 ? 288 THR C C   1 
ATOM   3031 O  O   . THR C 1 166 ? 13.705  65.135 5.469   1.00 44.35 ? 288 THR C O   1 
ATOM   3032 C  CB  . THR C 1 166 ? 13.514  67.178 7.434   1.00 40.96 ? 288 THR C CB  1 
ATOM   3033 O  OG1 . THR C 1 166 ? 14.830  67.716 7.289   1.00 41.28 ? 288 THR C OG1 1 
ATOM   3034 C  CG2 . THR C 1 166 ? 12.797  67.922 8.518   1.00 39.50 ? 288 THR C CG2 1 
ATOM   3035 N  N   . GLU C 1 167 ? 15.081  64.018 6.828   1.00 43.71 ? 289 GLU C N   1 
ATOM   3036 C  CA  . GLU C 1 167 ? 15.640  63.208 5.758   1.00 43.47 ? 289 GLU C CA  1 
ATOM   3037 C  C   . GLU C 1 167 ? 14.571  62.273 5.212   1.00 42.49 ? 289 GLU C C   1 
ATOM   3038 O  O   . GLU C 1 167 ? 13.669  61.868 5.932   1.00 42.47 ? 289 GLU C O   1 
ATOM   3039 C  CB  . GLU C 1 167 ? 16.801  62.372 6.287   1.00 46.74 ? 289 GLU C CB  1 
ATOM   3040 C  CG  . GLU C 1 167 ? 18.165  63.002 6.118   1.00 51.13 ? 289 GLU C CG  1 
ATOM   3041 C  CD  . GLU C 1 167 ? 18.443  63.344 4.665   1.00 54.49 ? 289 GLU C CD  1 
ATOM   3042 O  OE1 . GLU C 1 167 ? 17.993  64.422 4.231   1.00 56.34 ? 289 GLU C OE1 1 
ATOM   3043 O  OE2 . GLU C 1 167 ? 19.086  62.532 3.949   1.00 55.50 ? 289 GLU C OE2 1 
ATOM   3044 N  N   . LEU C 1 168 ? 14.667  61.934 3.936   1.00 40.83 ? 290 LEU C N   1 
ATOM   3045 C  CA  . LEU C 1 168 ? 13.708  61.021 3.345   1.00 40.77 ? 290 LEU C CA  1 
ATOM   3046 C  C   . LEU C 1 168 ? 14.462  59.872 2.696   1.00 40.94 ? 290 LEU C C   1 
ATOM   3047 O  O   . LEU C 1 168 ? 15.482  60.083 2.053   1.00 41.30 ? 290 LEU C O   1 
ATOM   3048 C  CB  . LEU C 1 168 ? 12.849  61.738 2.306   1.00 39.33 ? 290 LEU C CB  1 
ATOM   3049 C  CG  . LEU C 1 168 ? 11.930  62.854 2.809   1.00 40.98 ? 290 LEU C CG  1 
ATOM   3050 C  CD1 . LEU C 1 168 ? 11.190  63.461 1.633   1.00 40.63 ? 290 LEU C CD1 1 
ATOM   3051 C  CD2 . LEU C 1 168 ? 10.945  62.323 3.827   1.00 38.29 ? 290 LEU C CD2 1 
ATOM   3052 N  N   . ASP C 1 169 ? 13.975  58.651 2.874   1.00 41.10 ? 291 ASP C N   1 
ATOM   3053 C  CA  . ASP C 1 169 ? 14.637  57.506 2.274   1.00 41.54 ? 291 ASP C CA  1 
ATOM   3054 C  C   . ASP C 1 169 ? 14.115  57.370 0.854   1.00 42.56 ? 291 ASP C C   1 
ATOM   3055 O  O   . ASP C 1 169 ? 12.928  57.139 0.646   1.00 42.90 ? 291 ASP C O   1 
ATOM   3056 C  CB  . ASP C 1 169 ? 14.333  56.244 3.073   1.00 42.57 ? 291 ASP C CB  1 
ATOM   3057 C  CG  . ASP C 1 169 ? 15.288  55.112 2.759   1.00 44.90 ? 291 ASP C CG  1 
ATOM   3058 O  OD1 . ASP C 1 169 ? 15.991  54.651 3.675   1.00 45.82 ? 291 ASP C OD1 1 
ATOM   3059 O  OD2 . ASP C 1 169 ? 15.337  54.678 1.598   1.00 45.99 ? 291 ASP C OD2 1 
ATOM   3060 N  N   . CYS C 1 170 ? 15.004  57.535 -0.124  1.00 44.25 ? 292 CYS C N   1 
ATOM   3061 C  CA  . CYS C 1 170 ? 14.625  57.449 -1.534  1.00 45.24 ? 292 CYS C CA  1 
ATOM   3062 C  C   . CYS C 1 170 ? 14.422  55.996 -1.922  1.00 45.02 ? 292 CYS C C   1 
ATOM   3063 O  O   . CYS C 1 170 ? 13.794  55.690 -2.930  1.00 45.44 ? 292 CYS C O   1 
ATOM   3064 C  CB  . CYS C 1 170 ? 15.705  58.077 -2.416  1.00 46.26 ? 292 CYS C CB  1 
ATOM   3065 S  SG  . CYS C 1 170 ? 17.261  57.117 -2.500  1.00 54.37 ? 292 CYS C SG  1 
ATOM   3066 N  N   . GLY C 1 171 ? 14.961  55.098 -1.113  1.00 45.20 ? 293 GLY C N   1 
ATOM   3067 C  CA  . GLY C 1 171 ? 14.809  53.686 -1.388  1.00 46.20 ? 293 GLY C CA  1 
ATOM   3068 C  C   . GLY C 1 171 ? 15.711  53.196 -2.496  1.00 47.23 ? 293 GLY C C   1 
ATOM   3069 O  O   . GLY C 1 171 ? 16.391  53.987 -3.153  1.00 47.54 ? 293 GLY C O   1 
ATOM   3070 N  N   . ILE C 1 172 ? 15.733  51.879 -2.681  1.00 48.34 ? 294 ILE C N   1 
ATOM   3071 C  CA  . ILE C 1 172 ? 16.529  51.238 -3.725  1.00 49.67 ? 294 ILE C CA  1 
ATOM   3072 C  C   . ILE C 1 172 ? 15.707  50.098 -4.310  1.00 51.54 ? 294 ILE C C   1 
ATOM   3073 O  O   . ILE C 1 172 ? 14.961  49.426 -3.603  1.00 51.72 ? 294 ILE C O   1 
ATOM   3074 C  CB  . ILE C 1 172 ? 17.870  50.671 -3.182  1.00 48.98 ? 294 ILE C CB  1 
ATOM   3075 C  CG1 . ILE C 1 172 ? 18.686  50.087 -4.333  1.00 48.19 ? 294 ILE C CG1 1 
ATOM   3076 C  CG2 . ILE C 1 172 ? 17.616  49.567 -2.164  1.00 48.96 ? 294 ILE C CG2 1 
ATOM   3077 C  CD1 . ILE C 1 172 ? 18.854  51.037 -5.502  1.00 48.12 ? 294 ILE C CD1 1 
ATOM   3078 N  N   . GLU C 1 173 ? 15.828  49.878 -5.605  1.00 54.47 ? 295 GLU C N   1 
ATOM   3079 C  CA  . GLU C 1 173 ? 15.067  48.816 -6.228  1.00 58.17 ? 295 GLU C CA  1 
ATOM   3080 C  C   . GLU C 1 173 ? 15.509  47.394 -5.893  1.00 60.76 ? 295 GLU C C   1 
ATOM   3081 O  O   . GLU C 1 173 ? 16.695  47.098 -5.695  1.00 60.59 ? 295 GLU C O   1 
ATOM   3082 C  CB  . GLU C 1 173 ? 15.059  49.004 -7.725  1.00 59.41 ? 295 GLU C CB  1 
ATOM   3083 C  CG  . GLU C 1 173 ? 14.147  50.103 -8.171  1.00 62.08 ? 295 GLU C CG  1 
ATOM   3084 C  CD  . GLU C 1 173 ? 13.566  49.798 -9.525  1.00 64.21 ? 295 GLU C CD  1 
ATOM   3085 O  OE1 . GLU C 1 173 ? 13.050  48.655 -9.681  1.00 64.50 ? 295 GLU C OE1 1 
ATOM   3086 O  OE2 . GLU C 1 173 ? 13.621  50.685 -10.419 1.00 65.67 ? 295 GLU C OE2 1 
ATOM   3087 N  N   . THR C 1 174 ? 14.518  46.515 -5.838  1.00 63.83 ? 296 THR C N   1 
ATOM   3088 C  CA  . THR C 1 174 ? 14.729  45.117 -5.518  1.00 67.31 ? 296 THR C CA  1 
ATOM   3089 C  C   . THR C 1 174 ? 14.458  44.208 -6.705  1.00 70.09 ? 296 THR C C   1 
ATOM   3090 O  O   . THR C 1 174 ? 13.371  44.241 -7.309  1.00 70.68 ? 296 THR C O   1 
ATOM   3091 C  CB  . THR C 1 174 ? 13.806  44.686 -4.388  1.00 66.88 ? 296 THR C CB  1 
ATOM   3092 O  OG1 . THR C 1 174 ? 12.448  45.006 -4.730  1.00 67.58 ? 296 THR C OG1 1 
ATOM   3093 C  CG2 . THR C 1 174 ? 14.176  45.401 -3.124  1.00 67.69 ? 296 THR C CG2 1 
ATOM   3094 N  N   . ASP C 1 175 ? 15.455  43.399 -7.042  1.00 73.00 ? 297 ASP C N   1 
ATOM   3095 C  CA  . ASP C 1 175 ? 15.319  42.454 -8.144  1.00 75.13 ? 297 ASP C CA  1 
ATOM   3096 C  C   . ASP C 1 175 ? 13.917  41.852 -8.054  1.00 75.32 ? 297 ASP C C   1 
ATOM   3097 O  O   . ASP C 1 175 ? 13.642  41.152 -7.047  1.00 75.25 ? 297 ASP C O   1 
ATOM   3098 C  CB  . ASP C 1 175 ? 16.392  41.359 -8.029  1.00 76.58 ? 297 ASP C CB  1 
ATOM   3099 C  CG  . ASP C 1 175 ? 16.692  40.979 -6.574  1.00 78.16 ? 297 ASP C CG  1 
ATOM   3100 O  OD1 . ASP C 1 175 ? 17.568  40.101 -6.350  1.00 79.04 ? 297 ASP C OD1 1 
ATOM   3101 O  OD2 . ASP C 1 175 ? 16.052  41.566 -5.657  1.00 78.49 ? 297 ASP C OD2 1 
ATOM   3102 O  OXT . ASP C 1 175 ? 13.110  42.128 -8.974  1.00 75.17 ? 297 ASP C OXT 1 
ATOM   3103 N  N   . SER D 2 1   ? 33.147  59.539 53.702  1.00 65.93 ? 310 SER D N   1 
ATOM   3104 C  CA  . SER D 2 1   ? 34.016  58.613 52.907  1.00 65.26 ? 310 SER D CA  1 
ATOM   3105 C  C   . SER D 2 1   ? 33.329  57.278 52.672  1.00 65.14 ? 310 SER D C   1 
ATOM   3106 O  O   . SER D 2 1   ? 32.181  57.075 53.090  1.00 65.86 ? 310 SER D O   1 
ATOM   3107 C  CB  . SER D 2 1   ? 35.321  58.354 53.645  1.00 64.78 ? 310 SER D CB  1 
ATOM   3108 O  OG  . SER D 2 1   ? 35.064  57.622 54.832  1.00 65.08 ? 310 SER D OG  1 
ATOM   3109 N  N   . GLY D 2 2   ? 34.051  56.366 52.023  1.00 64.79 ? 311 GLY D N   1 
ATOM   3110 C  CA  . GLY D 2 2   ? 33.516  55.045 51.724  1.00 64.45 ? 311 GLY D CA  1 
ATOM   3111 C  C   . GLY D 2 2   ? 34.356  53.894 52.257  1.00 64.44 ? 311 GLY D C   1 
ATOM   3112 O  O   . GLY D 2 2   ? 35.518  54.070 52.633  1.00 65.18 ? 311 GLY D O   1 
ATOM   3113 N  N   . VAL D 2 3   ? 33.770  52.704 52.278  1.00 64.32 ? 312 VAL D N   1 
ATOM   3114 C  CA  . VAL D 2 3   ? 34.455  51.517 52.779  1.00 64.79 ? 312 VAL D CA  1 
ATOM   3115 C  C   . VAL D 2 3   ? 34.850  50.563 51.649  1.00 65.80 ? 312 VAL D C   1 
ATOM   3116 O  O   . VAL D 2 3   ? 34.274  50.624 50.550  1.00 66.22 ? 312 VAL D O   1 
ATOM   3117 C  CB  . VAL D 2 3   ? 33.547  50.791 53.795  1.00 64.16 ? 312 VAL D CB  1 
ATOM   3118 C  CG1 . VAL D 2 3   ? 34.051  49.390 54.078  1.00 63.15 ? 312 VAL D CG1 1 
ATOM   3119 C  CG2 . VAL D 2 3   ? 33.494  51.602 55.070  1.00 64.28 ? 312 VAL D CG2 1 
ATOM   3120 N  N   . ASP D 2 4   ? 35.830  49.692 51.913  1.00 66.24 ? 313 ASP D N   1 
ATOM   3121 C  CA  . ASP D 2 4   ? 36.293  48.728 50.913  1.00 67.34 ? 313 ASP D CA  1 
ATOM   3122 C  C   . ASP D 2 4   ? 35.340  47.559 50.653  1.00 67.34 ? 313 ASP D C   1 
ATOM   3123 O  O   . ASP D 2 4   ? 35.790  46.468 50.298  1.00 68.52 ? 313 ASP D O   1 
ATOM   3124 C  CB  . ASP D 2 4   ? 37.661  48.149 51.301  1.00 69.03 ? 313 ASP D CB  1 
ATOM   3125 C  CG  . ASP D 2 4   ? 38.783  48.582 50.343  1.00 71.06 ? 313 ASP D CG  1 
ATOM   3126 O  OD1 . ASP D 2 4   ? 38.483  48.901 49.164  1.00 70.60 ? 313 ASP D OD1 1 
ATOM   3127 O  OD2 . ASP D 2 4   ? 39.968  48.586 50.771  1.00 72.15 ? 313 ASP D OD2 1 
ATOM   3128 N  N   . ASP D 2 5   ? 34.036  47.765 50.816  1.00 66.61 ? 314 ASP D N   1 
ATOM   3129 C  CA  . ASP D 2 5   ? 33.093  46.679 50.577  1.00 66.24 ? 314 ASP D CA  1 
ATOM   3130 C  C   . ASP D 2 5   ? 32.646  46.599 49.105  1.00 65.42 ? 314 ASP D C   1 
ATOM   3131 O  O   . ASP D 2 5   ? 31.517  46.195 48.798  1.00 65.10 ? 314 ASP D O   1 
ATOM   3132 C  CB  . ASP D 2 5   ? 31.878  46.815 51.501  1.00 67.62 ? 314 ASP D CB  1 
ATOM   3133 C  CG  . ASP D 2 5   ? 31.159  48.152 51.342  1.00 69.48 ? 314 ASP D CG  1 
ATOM   3134 O  OD1 . ASP D 2 5   ? 30.119  48.343 52.022  1.00 70.06 ? 314 ASP D OD1 1 
ATOM   3135 O  OD2 . ASP D 2 5   ? 31.628  49.008 50.545  1.00 69.70 ? 314 ASP D OD2 1 
ATOM   3136 N  N   . ASP D 2 6   ? 33.552  46.968 48.200  1.00 64.12 ? 315 ASP D N   1 
ATOM   3137 C  CA  . ASP D 2 6   ? 33.280  46.934 46.766  1.00 62.72 ? 315 ASP D CA  1 
ATOM   3138 C  C   . ASP D 2 6   ? 32.868  45.552 46.271  1.00 61.38 ? 315 ASP D C   1 
ATOM   3139 O  O   . ASP D 2 6   ? 32.005  45.423 45.408  1.00 60.17 ? 315 ASP D O   1 
ATOM   3140 C  CB  . ASP D 2 6   ? 34.516  47.400 45.992  1.00 63.30 ? 315 ASP D CB  1 
ATOM   3141 C  CG  . ASP D 2 6   ? 34.631  48.912 45.939  1.00 64.51 ? 315 ASP D CG  1 
ATOM   3142 O  OD1 . ASP D 2 6   ? 35.779  49.433 46.014  1.00 64.65 ? 315 ASP D OD1 1 
ATOM   3143 O  OD2 . ASP D 2 6   ? 33.568  49.575 45.809  1.00 64.09 ? 315 ASP D OD2 1 
ATOM   3144 N  N   . MET D 2 7   ? 33.472  44.512 46.827  1.00 60.83 ? 316 MET D N   1 
ATOM   3145 C  CA  . MET D 2 7   ? 33.154  43.165 46.384  1.00 60.27 ? 316 MET D CA  1 
ATOM   3146 C  C   . MET D 2 7   ? 31.858  42.588 46.939  1.00 59.27 ? 316 MET D C   1 
ATOM   3147 O  O   . MET D 2 7   ? 31.392  41.556 46.475  1.00 58.57 ? 316 MET D O   1 
ATOM   3148 C  CB  . MET D 2 7   ? 34.332  42.237 46.683  1.00 61.09 ? 316 MET D CB  1 
ATOM   3149 C  CG  . MET D 2 7   ? 35.553  42.490 45.784  1.00 61.97 ? 316 MET D CG  1 
ATOM   3150 S  SD  . MET D 2 7   ? 35.205  42.214 44.005  1.00 63.30 ? 316 MET D SD  1 
ATOM   3151 C  CE  . MET D 2 7   ? 35.156  43.925 43.415  1.00 64.36 ? 316 MET D CE  1 
ATOM   3152 N  N   . ALA D 2 8   ? 31.252  43.269 47.903  1.00 59.55 ? 317 ALA D N   1 
ATOM   3153 C  CA  . ALA D 2 8   ? 30.011  42.768 48.499  1.00 59.99 ? 317 ALA D CA  1 
ATOM   3154 C  C   . ALA D 2 8   ? 28.740  43.497 48.029  1.00 60.30 ? 317 ALA D C   1 
ATOM   3155 O  O   . ALA D 2 8   ? 27.622  43.160 48.434  1.00 60.40 ? 317 ALA D O   1 
ATOM   3156 C  CB  . ALA D 2 8   ? 30.113  42.845 50.020  1.00 57.96 ? 317 ALA D CB  1 
ATOM   3157 N  N   . CYS D 2 9   ? 28.912  44.484 47.164  1.00 60.44 ? 318 CYS D N   1 
ATOM   3158 C  CA  . CYS D 2 9   ? 27.793  45.282 46.698  1.00 60.81 ? 318 CYS D CA  1 
ATOM   3159 C  C   . CYS D 2 9   ? 27.559  45.032 45.207  1.00 59.31 ? 318 CYS D C   1 
ATOM   3160 O  O   . CYS D 2 9   ? 28.451  45.247 44.388  1.00 59.33 ? 318 CYS D O   1 
ATOM   3161 C  CB  . CYS D 2 9   ? 28.130  46.754 47.009  1.00 62.28 ? 318 CYS D CB  1 
ATOM   3162 S  SG  . CYS D 2 9   ? 27.103  48.062 46.260  1.00 68.74 ? 318 CYS D SG  1 
ATOM   3163 N  N   . HIS D 2 10  ? 26.371  44.569 44.842  1.00 57.53 ? 319 HIS D N   1 
ATOM   3164 C  CA  . HIS D 2 10  ? 26.117  44.309 43.429  1.00 55.95 ? 319 HIS D CA  1 
ATOM   3165 C  C   . HIS D 2 10  ? 25.177  45.310 42.754  1.00 54.11 ? 319 HIS D C   1 
ATOM   3166 O  O   . HIS D 2 10  ? 24.080  45.576 43.257  1.00 54.77 ? 319 HIS D O   1 
ATOM   3167 C  CB  . HIS D 2 10  ? 25.571  42.895 43.235  1.00 56.73 ? 319 HIS D CB  1 
ATOM   3168 C  CG  . HIS D 2 10  ? 25.452  42.505 41.798  1.00 58.09 ? 319 HIS D CG  1 
ATOM   3169 N  ND1 . HIS D 2 10  ? 26.553  42.330 40.984  1.00 57.51 ? 319 HIS D ND1 1 
ATOM   3170 C  CD2 . HIS D 2 10  ? 24.365  42.328 41.008  1.00 58.49 ? 319 HIS D CD2 1 
ATOM   3171 C  CE1 . HIS D 2 10  ? 26.149  42.065 39.755  1.00 58.28 ? 319 HIS D CE1 1 
ATOM   3172 N  NE2 . HIS D 2 10  ? 24.827  42.059 39.741  1.00 58.85 ? 319 HIS D NE2 1 
ATOM   3173 N  N   . LYS D 2 11  ? 25.600  45.824 41.594  1.00 51.38 ? 320 LYS D N   1 
ATOM   3174 C  CA  . LYS D 2 11  ? 24.830  46.820 40.847  1.00 48.05 ? 320 LYS D CA  1 
ATOM   3175 C  C   . LYS D 2 11  ? 24.572  46.520 39.373  1.00 46.81 ? 320 LYS D C   1 
ATOM   3176 O  O   . LYS D 2 11  ? 25.255  45.712 38.753  1.00 46.12 ? 320 LYS D O   1 
ATOM   3177 C  CB  . LYS D 2 11  ? 25.536  48.177 40.928  1.00 46.95 ? 320 LYS D CB  1 
ATOM   3178 C  CG  . LYS D 2 11  ? 25.619  48.762 42.319  1.00 45.93 ? 320 LYS D CG  1 
ATOM   3179 C  CD  . LYS D 2 11  ? 26.133  50.188 42.289  1.00 45.06 ? 320 LYS D CD  1 
ATOM   3180 C  CE  . LYS D 2 11  ? 27.573  50.263 41.867  1.00 46.10 ? 320 LYS D CE  1 
ATOM   3181 N  NZ  . LYS D 2 11  ? 28.058  51.667 41.961  1.00 47.14 ? 320 LYS D NZ  1 
ATOM   3182 N  N   . ILE D 2 12  ? 23.566  47.192 38.822  1.00 46.06 ? 321 ILE D N   1 
ATOM   3183 C  CA  . ILE D 2 12  ? 23.228  47.083 37.404  1.00 43.81 ? 321 ILE D CA  1 
ATOM   3184 C  C   . ILE D 2 12  ? 23.139  48.519 36.907  1.00 43.47 ? 321 ILE D C   1 
ATOM   3185 O  O   . ILE D 2 12  ? 22.816  49.430 37.669  1.00 43.59 ? 321 ILE D O   1 
ATOM   3186 C  CB  . ILE D 2 12  ? 21.873  46.386 37.151  1.00 41.97 ? 321 ILE D CB  1 
ATOM   3187 C  CG1 . ILE D 2 12  ? 20.733  47.224 37.713  1.00 39.78 ? 321 ILE D CG1 1 
ATOM   3188 C  CG2 . ILE D 2 12  ? 21.881  45.016 37.769  1.00 40.71 ? 321 ILE D CG2 1 
ATOM   3189 C  CD1 . ILE D 2 12  ? 19.375  46.710 37.354  1.00 37.69 ? 321 ILE D CD1 1 
ATOM   3190 N  N   . PRO D 2 13  ? 23.452  48.745 35.631  1.00 43.26 ? 322 PRO D N   1 
ATOM   3191 C  CA  . PRO D 2 13  ? 23.394  50.092 35.067  1.00 42.95 ? 322 PRO D CA  1 
ATOM   3192 C  C   . PRO D 2 13  ? 22.018  50.715 35.233  1.00 44.10 ? 322 PRO D C   1 
ATOM   3193 O  O   . PRO D 2 13  ? 20.999  50.048 35.029  1.00 43.44 ? 322 PRO D O   1 
ATOM   3194 C  CB  . PRO D 2 13  ? 23.752  49.860 33.611  1.00 42.48 ? 322 PRO D CB  1 
ATOM   3195 C  CG  . PRO D 2 13  ? 24.713  48.739 33.699  1.00 43.42 ? 322 PRO D CG  1 
ATOM   3196 C  CD  . PRO D 2 13  ? 24.037  47.804 34.666  1.00 43.00 ? 322 PRO D CD  1 
ATOM   3197 N  N   . VAL D 2 14  ? 21.992  51.995 35.607  1.00 44.72 ? 323 VAL D N   1 
ATOM   3198 C  CA  . VAL D 2 14  ? 20.730  52.704 35.792  1.00 45.84 ? 323 VAL D CA  1 
ATOM   3199 C  C   . VAL D 2 14  ? 20.053  52.903 34.447  1.00 45.83 ? 323 VAL D C   1 
ATOM   3200 O  O   . VAL D 2 14  ? 18.863  53.203 34.369  1.00 46.91 ? 323 VAL D O   1 
ATOM   3201 C  CB  . VAL D 2 14  ? 20.933  54.093 36.419  1.00 47.08 ? 323 VAL D CB  1 
ATOM   3202 C  CG1 . VAL D 2 14  ? 21.607  53.964 37.761  1.00 47.75 ? 323 VAL D CG1 1 
ATOM   3203 C  CG2 . VAL D 2 14  ? 21.735  54.976 35.477  1.00 46.27 ? 323 VAL D CG2 1 
ATOM   3204 N  N   . GLU D 2 15  ? 20.831  52.718 33.392  1.00 45.92 ? 324 GLU D N   1 
ATOM   3205 C  CA  . GLU D 2 15  ? 20.348  52.899 32.038  1.00 45.13 ? 324 GLU D CA  1 
ATOM   3206 C  C   . GLU D 2 15  ? 19.965  51.570 31.386  1.00 43.60 ? 324 GLU D C   1 
ATOM   3207 O  O   . GLU D 2 15  ? 19.457  51.528 30.271  1.00 43.91 ? 324 GLU D O   1 
ATOM   3208 C  CB  . GLU D 2 15  ? 21.437  53.602 31.229  1.00 45.51 ? 324 GLU D CB  1 
ATOM   3209 C  CG  . GLU D 2 15  ? 20.912  54.543 30.187  1.00 47.90 ? 324 GLU D CG  1 
ATOM   3210 C  CD  . GLU D 2 15  ? 20.437  55.854 30.765  1.00 48.39 ? 324 GLU D CD  1 
ATOM   3211 O  OE1 . GLU D 2 15  ? 21.287  56.715 31.063  1.00 49.16 ? 324 GLU D OE1 1 
ATOM   3212 O  OE2 . GLU D 2 15  ? 19.208  56.020 30.919  1.00 50.24 ? 324 GLU D OE2 1 
ATOM   3213 N  N   . ALA D 2 16  ? 20.199  50.484 32.100  1.00 43.79 ? 325 ALA D N   1 
ATOM   3214 C  CA  . ALA D 2 16  ? 19.901  49.160 31.587  1.00 44.13 ? 325 ALA D CA  1 
ATOM   3215 C  C   . ALA D 2 16  ? 18.416  48.858 31.623  1.00 44.14 ? 325 ALA D C   1 
ATOM   3216 O  O   . ALA D 2 16  ? 17.657  49.537 32.295  1.00 43.86 ? 325 ALA D O   1 
ATOM   3217 C  CB  . ALA D 2 16  ? 20.665  48.114 32.388  1.00 43.31 ? 325 ALA D CB  1 
ATOM   3218 N  N   . ASP D 2 17  ? 18.015  47.829 30.882  1.00 45.00 ? 326 ASP D N   1 
ATOM   3219 C  CA  . ASP D 2 17  ? 16.625  47.392 30.818  1.00 46.27 ? 326 ASP D CA  1 
ATOM   3220 C  C   . ASP D 2 17  ? 15.669  48.358 30.142  1.00 47.68 ? 326 ASP D C   1 
ATOM   3221 O  O   . ASP D 2 17  ? 14.492  48.387 30.471  1.00 49.41 ? 326 ASP D O   1 
ATOM   3222 C  CB  . ASP D 2 17  ? 16.117  47.078 32.216  1.00 45.79 ? 326 ASP D CB  1 
ATOM   3223 C  CG  . ASP D 2 17  ? 16.848  45.914 32.838  1.00 48.02 ? 326 ASP D CG  1 
ATOM   3224 O  OD1 . ASP D 2 17  ? 17.139  45.973 34.058  1.00 48.62 ? 326 ASP D OD1 1 
ATOM   3225 O  OD2 . ASP D 2 17  ? 17.126  44.940 32.105  1.00 46.05 ? 326 ASP D OD2 1 
ATOM   3226 N  N   . PHE D 2 18  ? 16.173  49.156 29.209  1.00 47.06 ? 327 PHE D N   1 
ATOM   3227 C  CA  . PHE D 2 18  ? 15.334  50.089 28.480  1.00 45.70 ? 327 PHE D CA  1 
ATOM   3228 C  C   . PHE D 2 18  ? 15.272  49.635 27.036  1.00 45.90 ? 327 PHE D C   1 
ATOM   3229 O  O   . PHE D 2 18  ? 16.240  49.094 26.509  1.00 46.20 ? 327 PHE D O   1 
ATOM   3230 C  CB  . PHE D 2 18  ? 15.916  51.498 28.496  1.00 45.60 ? 327 PHE D CB  1 
ATOM   3231 C  CG  . PHE D 2 18  ? 15.501  52.319 29.663  1.00 45.16 ? 327 PHE D CG  1 
ATOM   3232 C  CD1 . PHE D 2 18  ? 16.225  52.293 30.842  1.00 45.46 ? 327 PHE D CD1 1 
ATOM   3233 C  CD2 . PHE D 2 18  ? 14.397  53.143 29.576  1.00 44.86 ? 327 PHE D CD2 1 
ATOM   3234 C  CE1 . PHE D 2 18  ? 15.858  53.082 31.915  1.00 44.51 ? 327 PHE D CE1 1 
ATOM   3235 C  CE2 . PHE D 2 18  ? 14.020  53.934 30.642  1.00 45.20 ? 327 PHE D CE2 1 
ATOM   3236 C  CZ  . PHE D 2 18  ? 14.751  53.905 31.814  1.00 45.82 ? 327 PHE D CZ  1 
ATOM   3237 N  N   . LEU D 2 19  ? 14.130  49.847 26.398  1.00 45.11 ? 328 LEU D N   1 
ATOM   3238 C  CA  . LEU D 2 19  ? 13.992  49.503 25.000  1.00 44.81 ? 328 LEU D CA  1 
ATOM   3239 C  C   . LEU D 2 19  ? 13.246  50.612 24.312  1.00 44.27 ? 328 LEU D C   1 
ATOM   3240 O  O   . LEU D 2 19  ? 12.124  50.936 24.698  1.00 44.44 ? 328 LEU D O   1 
ATOM   3241 C  CB  . LEU D 2 19  ? 13.227  48.206 24.803  1.00 45.92 ? 328 LEU D CB  1 
ATOM   3242 C  CG  . LEU D 2 19  ? 12.980  47.892 23.322  1.00 47.70 ? 328 LEU D CG  1 
ATOM   3243 C  CD1 . LEU D 2 19  ? 14.288  47.771 22.596  1.00 47.23 ? 328 LEU D CD1 1 
ATOM   3244 C  CD2 . LEU D 2 19  ? 12.227  46.602 23.202  1.00 49.95 ? 328 LEU D CD2 1 
ATOM   3245 N  N   . TYR D 2 20  ? 13.881  51.195 23.300  1.00 42.85 ? 329 TYR D N   1 
ATOM   3246 C  CA  . TYR D 2 20  ? 13.272  52.266 22.534  1.00 42.14 ? 329 TYR D CA  1 
ATOM   3247 C  C   . TYR D 2 20  ? 12.962  51.776 21.128  1.00 41.24 ? 329 TYR D C   1 
ATOM   3248 O  O   . TYR D 2 20  ? 13.865  51.530 20.335  1.00 39.59 ? 329 TYR D O   1 
ATOM   3249 C  CB  . TYR D 2 20  ? 14.206  53.472 22.455  1.00 43.11 ? 329 TYR D CB  1 
ATOM   3250 C  CG  . TYR D 2 20  ? 14.764  53.920 23.786  1.00 43.78 ? 329 TYR D CG  1 
ATOM   3251 C  CD1 . TYR D 2 20  ? 15.844  53.265 24.362  1.00 43.49 ? 329 TYR D CD1 1 
ATOM   3252 C  CD2 . TYR D 2 20  ? 14.206  54.996 24.472  1.00 43.00 ? 329 TYR D CD2 1 
ATOM   3253 C  CE1 . TYR D 2 20  ? 16.361  53.664 25.587  1.00 43.20 ? 329 TYR D CE1 1 
ATOM   3254 C  CE2 . TYR D 2 20  ? 14.714  55.405 25.700  1.00 43.32 ? 329 TYR D CE2 1 
ATOM   3255 C  CZ  . TYR D 2 20  ? 15.794  54.733 26.255  1.00 44.56 ? 329 TYR D CZ  1 
ATOM   3256 O  OH  . TYR D 2 20  ? 16.303  55.119 27.481  1.00 44.98 ? 329 TYR D OH  1 
ATOM   3257 N  N   . ALA D 2 21  ? 11.678  51.625 20.829  1.00 40.82 ? 330 ALA D N   1 
ATOM   3258 C  CA  . ALA D 2 21  ? 11.254  51.188 19.511  1.00 39.31 ? 330 ALA D CA  1 
ATOM   3259 C  C   . ALA D 2 21  ? 10.870  52.416 18.719  1.00 40.05 ? 330 ALA D C   1 
ATOM   3260 O  O   . ALA D 2 21  ? 9.743   52.889 18.824  1.00 39.25 ? 330 ALA D O   1 
ATOM   3261 C  CB  . ALA D 2 21  ? 10.076  50.268 19.623  1.00 37.09 ? 330 ALA D CB  1 
ATOM   3262 N  N   . TYR D 2 22  ? 11.822  52.941 17.949  1.00 41.46 ? 331 TYR D N   1 
ATOM   3263 C  CA  . TYR D 2 22  ? 11.604  54.124 17.112  1.00 41.62 ? 331 TYR D CA  1 
ATOM   3264 C  C   . TYR D 2 22  ? 10.958  53.760 15.767  1.00 42.72 ? 331 TYR D C   1 
ATOM   3265 O  O   . TYR D 2 22  ? 11.221  52.696 15.199  1.00 43.04 ? 331 TYR D O   1 
ATOM   3266 C  CB  . TYR D 2 22  ? 12.927  54.840 16.832  1.00 41.43 ? 331 TYR D CB  1 
ATOM   3267 C  CG  . TYR D 2 22  ? 13.565  55.557 18.007  1.00 41.20 ? 331 TYR D CG  1 
ATOM   3268 C  CD1 . TYR D 2 22  ? 14.573  54.959 18.757  1.00 41.19 ? 331 TYR D CD1 1 
ATOM   3269 C  CD2 . TYR D 2 22  ? 13.193  56.859 18.336  1.00 40.42 ? 331 TYR D CD2 1 
ATOM   3270 C  CE1 . TYR D 2 22  ? 15.196  55.644 19.799  1.00 40.77 ? 331 TYR D CE1 1 
ATOM   3271 C  CE2 . TYR D 2 22  ? 13.806  57.542 19.373  1.00 39.41 ? 331 TYR D CE2 1 
ATOM   3272 C  CZ  . TYR D 2 22  ? 14.806  56.932 20.094  1.00 40.06 ? 331 TYR D CZ  1 
ATOM   3273 O  OH  . TYR D 2 22  ? 15.440  57.618 21.092  1.00 40.23 ? 331 TYR D OH  1 
ATOM   3274 N  N   . SER D 2 23  ? 10.130  54.659 15.246  1.00 43.70 ? 332 SER D N   1 
ATOM   3275 C  CA  . SER D 2 23  ? 9.447   54.422 13.971  1.00 44.27 ? 332 SER D CA  1 
ATOM   3276 C  C   . SER D 2 23  ? 10.330  54.662 12.740  1.00 44.27 ? 332 SER D C   1 
ATOM   3277 O  O   . SER D 2 23  ? 10.083  54.109 11.669  1.00 44.34 ? 332 SER D O   1 
ATOM   3278 C  CB  . SER D 2 23  ? 8.206   55.311 13.866  1.00 44.47 ? 332 SER D CB  1 
ATOM   3279 O  OG  . SER D 2 23  ? 8.575   56.679 13.811  1.00 46.79 ? 332 SER D OG  1 
ATOM   3280 N  N   . THR D 2 24  ? 11.359  55.485 12.887  1.00 43.38 ? 333 THR D N   1 
ATOM   3281 C  CA  . THR D 2 24  ? 12.224  55.788 11.763  1.00 42.40 ? 333 THR D CA  1 
ATOM   3282 C  C   . THR D 2 24  ? 13.668  55.903 12.205  1.00 42.72 ? 333 THR D C   1 
ATOM   3283 O  O   . THR D 2 24  ? 13.943  56.163 13.368  1.00 42.45 ? 333 THR D O   1 
ATOM   3284 C  CB  . THR D 2 24  ? 11.808  57.115 11.100  1.00 42.24 ? 333 THR D CB  1 
ATOM   3285 O  OG1 . THR D 2 24  ? 12.549  57.306 9.893   1.00 42.66 ? 333 THR D OG1 1 
ATOM   3286 C  CG2 . THR D 2 24  ? 12.084  58.279 12.037  1.00 41.72 ? 333 THR D CG2 1 
ATOM   3287 N  N   . ALA D 2 25  ? 14.585  55.712 11.262  1.00 42.75 ? 334 ALA D N   1 
ATOM   3288 C  CA  . ALA D 2 25  ? 16.010  55.802 11.537  1.00 43.40 ? 334 ALA D CA  1 
ATOM   3289 C  C   . ALA D 2 25  ? 16.351  57.219 11.996  1.00 44.37 ? 334 ALA D C   1 
ATOM   3290 O  O   . ALA D 2 25  ? 15.630  58.168 11.683  1.00 45.17 ? 334 ALA D O   1 
ATOM   3291 C  CB  . ALA D 2 25  ? 16.796  55.449 10.288  1.00 41.34 ? 334 ALA D CB  1 
ATOM   3292 N  N   . PRO D 2 26  ? 17.453  57.381 12.752  1.00 44.71 ? 335 PRO D N   1 
ATOM   3293 C  CA  . PRO D 2 26  ? 17.852  58.703 13.232  1.00 44.95 ? 335 PRO D CA  1 
ATOM   3294 C  C   . PRO D 2 26  ? 17.950  59.685 12.068  1.00 45.86 ? 335 PRO D C   1 
ATOM   3295 O  O   . PRO D 2 26  ? 18.307  59.299 10.958  1.00 46.10 ? 335 PRO D O   1 
ATOM   3296 C  CB  . PRO D 2 26  ? 19.211  58.443 13.856  1.00 42.82 ? 335 PRO D CB  1 
ATOM   3297 C  CG  . PRO D 2 26  ? 19.119  57.060 14.296  1.00 42.90 ? 335 PRO D CG  1 
ATOM   3298 C  CD  . PRO D 2 26  ? 18.436  56.371 13.163  1.00 43.55 ? 335 PRO D CD  1 
ATOM   3299 N  N   . GLY D 2 27  ? 17.619  60.946 12.329  1.00 46.51 ? 336 GLY D N   1 
ATOM   3300 C  CA  . GLY D 2 27  ? 17.697  61.961 11.300  1.00 45.95 ? 336 GLY D CA  1 
ATOM   3301 C  C   . GLY D 2 27  ? 16.610  61.903 10.256  1.00 46.89 ? 336 GLY D C   1 
ATOM   3302 O  O   . GLY D 2 27  ? 16.435  62.849 9.508   1.00 47.76 ? 336 GLY D O   1 
ATOM   3303 N  N   . TYR D 2 28  ? 15.859  60.813 10.198  1.00 47.14 ? 337 TYR D N   1 
ATOM   3304 C  CA  . TYR D 2 28  ? 14.818  60.703 9.180   1.00 46.99 ? 337 TYR D CA  1 
ATOM   3305 C  C   . TYR D 2 28  ? 13.420  61.121 9.585   1.00 46.51 ? 337 TYR D C   1 
ATOM   3306 O  O   . TYR D 2 28  ? 13.095  61.207 10.759  1.00 47.29 ? 337 TYR D O   1 
ATOM   3307 C  CB  . TYR D 2 28  ? 14.757  59.277 8.627   1.00 44.94 ? 337 TYR D CB  1 
ATOM   3308 C  CG  . TYR D 2 28  ? 15.854  58.973 7.645   1.00 43.97 ? 337 TYR D CG  1 
ATOM   3309 C  CD1 . TYR D 2 28  ? 17.137  58.637 8.074   1.00 42.82 ? 337 TYR D CD1 1 
ATOM   3310 C  CD2 . TYR D 2 28  ? 15.620  59.059 6.281   1.00 43.56 ? 337 TYR D CD2 1 
ATOM   3311 C  CE1 . TYR D 2 28  ? 18.161  58.396 7.160   1.00 42.06 ? 337 TYR D CE1 1 
ATOM   3312 C  CE2 . TYR D 2 28  ? 16.630  58.829 5.362   1.00 42.77 ? 337 TYR D CE2 1 
ATOM   3313 C  CZ  . TYR D 2 28  ? 17.897  58.503 5.802   1.00 43.32 ? 337 TYR D CZ  1 
ATOM   3314 O  OH  . TYR D 2 28  ? 18.895  58.331 4.872   1.00 43.10 ? 337 TYR D OH  1 
ATOM   3315 N  N   . TYR D 2 29  ? 12.596  61.368 8.578   1.00 45.98 ? 338 TYR D N   1 
ATOM   3316 C  CA  . TYR D 2 29  ? 11.211  61.763 8.762   1.00 45.07 ? 338 TYR D CA  1 
ATOM   3317 C  C   . TYR D 2 29  ? 10.416  60.491 9.060   1.00 44.34 ? 338 TYR D C   1 
ATOM   3318 O  O   . TYR D 2 29  ? 10.912  59.393 8.850   1.00 44.37 ? 338 TYR D O   1 
ATOM   3319 C  CB  . TYR D 2 29  ? 10.728  62.418 7.466   1.00 45.35 ? 338 TYR D CB  1 
ATOM   3320 C  CG  . TYR D 2 29  ? 9.360   63.040 7.526   1.00 46.39 ? 338 TYR D CG  1 
ATOM   3321 C  CD1 . TYR D 2 29  ? 9.127   64.191 8.275   1.00 46.46 ? 338 TYR D CD1 1 
ATOM   3322 C  CD2 . TYR D 2 29  ? 8.302   62.492 6.815   1.00 46.20 ? 338 TYR D CD2 1 
ATOM   3323 C  CE1 . TYR D 2 29  ? 7.877   64.781 8.308   1.00 47.57 ? 338 TYR D CE1 1 
ATOM   3324 C  CE2 . TYR D 2 29  ? 7.047   63.072 6.844   1.00 48.05 ? 338 TYR D CE2 1 
ATOM   3325 C  CZ  . TYR D 2 29  ? 6.842   64.216 7.588   1.00 48.18 ? 338 TYR D CZ  1 
ATOM   3326 O  OH  . TYR D 2 29  ? 5.605   64.798 7.597   1.00 49.34 ? 338 TYR D OH  1 
ATOM   3327 N  N   . SER D 2 30  ? 9.195   60.633 9.556   1.00 44.32 ? 339 SER D N   1 
ATOM   3328 C  CA  . SER D 2 30  ? 8.362   59.473 9.849   1.00 45.71 ? 339 SER D CA  1 
ATOM   3329 C  C   . SER D 2 30  ? 7.008   59.708 9.213   1.00 45.54 ? 339 SER D C   1 
ATOM   3330 O  O   . SER D 2 30  ? 6.370   60.714 9.489   1.00 46.57 ? 339 SER D O   1 
ATOM   3331 C  CB  . SER D 2 30  ? 8.207   59.291 11.356  1.00 46.92 ? 339 SER D CB  1 
ATOM   3332 O  OG  . SER D 2 30  ? 7.554   58.068 11.647  1.00 49.80 ? 339 SER D OG  1 
ATOM   3333 N  N   . TRP D 2 31  ? 6.570   58.772 8.382   1.00 45.01 ? 340 TRP D N   1 
ATOM   3334 C  CA  . TRP D 2 31  ? 5.314   58.912 7.656   1.00 46.72 ? 340 TRP D CA  1 
ATOM   3335 C  C   . TRP D 2 31  ? 3.993   58.574 8.342   1.00 48.35 ? 340 TRP D C   1 
ATOM   3336 O  O   . TRP D 2 31  ? 3.920   57.690 9.174   1.00 49.45 ? 340 TRP D O   1 
ATOM   3337 C  CB  . TRP D 2 31  ? 5.391   58.118 6.351   1.00 45.06 ? 340 TRP D CB  1 
ATOM   3338 C  CG  . TRP D 2 31  ? 6.383   58.643 5.360   1.00 43.64 ? 340 TRP D CG  1 
ATOM   3339 C  CD1 . TRP D 2 31  ? 7.711   58.346 5.291   1.00 43.80 ? 340 TRP D CD1 1 
ATOM   3340 C  CD2 . TRP D 2 31  ? 6.123   59.559 4.295   1.00 42.36 ? 340 TRP D CD2 1 
ATOM   3341 N  NE1 . TRP D 2 31  ? 8.296   59.019 4.245   1.00 42.21 ? 340 TRP D NE1 1 
ATOM   3342 C  CE2 . TRP D 2 31  ? 7.340   59.772 3.620   1.00 41.94 ? 340 TRP D CE2 1 
ATOM   3343 C  CE3 . TRP D 2 31  ? 4.981   60.219 3.846   1.00 41.71 ? 340 TRP D CE3 1 
ATOM   3344 C  CZ2 . TRP D 2 31  ? 7.444   60.614 2.523   1.00 42.59 ? 340 TRP D CZ2 1 
ATOM   3345 C  CZ3 . TRP D 2 31  ? 5.085   61.054 2.755   1.00 43.20 ? 340 TRP D CZ3 1 
ATOM   3346 C  CH2 . TRP D 2 31  ? 6.308   61.247 2.105   1.00 42.93 ? 340 TRP D CH2 1 
ATOM   3347 N  N   . ARG D 2 32  ? 2.942   59.290 7.956   1.00 50.31 ? 341 ARG D N   1 
ATOM   3348 C  CA  . ARG D 2 32  ? 1.593   59.069 8.475   1.00 51.74 ? 341 ARG D CA  1 
ATOM   3349 C  C   . ARG D 2 32  ? 0.646   58.964 7.282   1.00 53.05 ? 341 ARG D C   1 
ATOM   3350 O  O   . ARG D 2 32  ? 0.853   59.626 6.270   1.00 53.20 ? 341 ARG D O   1 
ATOM   3351 C  CB  . ARG D 2 32  ? 1.156   60.240 9.352   1.00 52.12 ? 341 ARG D CB  1 
ATOM   3352 C  CG  . ARG D 2 32  ? 1.894   60.323 10.662  1.00 53.20 ? 341 ARG D CG  1 
ATOM   3353 C  CD  . ARG D 2 32  ? 1.356   61.417 11.577  1.00 52.81 ? 341 ARG D CD  1 
ATOM   3354 N  NE  . ARG D 2 32  ? 1.708   62.749 11.120  1.00 52.61 ? 341 ARG D NE  1 
ATOM   3355 C  CZ  . ARG D 2 32  ? 0.894   63.543 10.438  1.00 54.20 ? 341 ARG D CZ  1 
ATOM   3356 N  NH1 . ARG D 2 32  ? -0.332  63.127 10.136  1.00 53.51 ? 341 ARG D NH1 1 
ATOM   3357 N  NH2 . ARG D 2 32  ? 1.306   64.757 10.066  1.00 54.03 ? 341 ARG D NH2 1 
ATOM   3358 N  N   . ASN D 2 33  ? -0.384  58.132 7.375   1.00 53.66 ? 342 ASN D N   1 
ATOM   3359 C  CA  . ASN D 2 33  ? -1.318  58.032 6.258   1.00 55.04 ? 342 ASN D CA  1 
ATOM   3360 C  C   . ASN D 2 33  ? -2.297  59.185 6.355   1.00 55.60 ? 342 ASN D C   1 
ATOM   3361 O  O   . ASN D 2 33  ? -2.726  59.528 7.445   1.00 57.18 ? 342 ASN D O   1 
ATOM   3362 C  CB  . ASN D 2 33  ? -2.095  56.715 6.291   1.00 54.09 ? 342 ASN D CB  1 
ATOM   3363 C  CG  . ASN D 2 33  ? -1.238  55.525 5.935   1.00 53.69 ? 342 ASN D CG  1 
ATOM   3364 O  OD1 . ASN D 2 33  ? -0.607  55.480 4.870   1.00 52.80 ? 342 ASN D OD1 1 
ATOM   3365 N  ND2 . ASN D 2 33  ? -1.217  54.539 6.823   1.00 53.98 ? 342 ASN D ND2 1 
ATOM   3366 N  N   . SER D 2 34  ? -2.636  59.779 5.216   1.00 56.49 ? 343 SER D N   1 
ATOM   3367 C  CA  . SER D 2 34  ? -3.580  60.887 5.159   1.00 56.77 ? 343 SER D CA  1 
ATOM   3368 C  C   . SER D 2 34  ? -4.534  60.863 6.349   1.00 57.65 ? 343 SER D C   1 
ATOM   3369 O  O   . SER D 2 34  ? -4.708  61.876 7.033   1.00 57.54 ? 343 SER D O   1 
ATOM   3370 C  CB  . SER D 2 34  ? -4.369  60.812 3.851   1.00 57.17 ? 343 SER D CB  1 
ATOM   3371 O  OG  . SER D 2 34  ? -5.322  61.859 3.740   1.00 56.74 ? 343 SER D OG  1 
ATOM   3372 N  N   . LYS D 2 35  ? -5.155  59.714 6.602   1.00 58.43 ? 344 LYS D N   1 
ATOM   3373 C  CA  . LYS D 2 35  ? -6.059  59.618 7.744   1.00 59.65 ? 344 LYS D CA  1 
ATOM   3374 C  C   . LYS D 2 35  ? -6.178  58.213 8.350   1.00 60.17 ? 344 LYS D C   1 
ATOM   3375 O  O   . LYS D 2 35  ? -6.957  58.000 9.280   1.00 61.14 ? 344 LYS D O   1 
ATOM   3376 C  CB  . LYS D 2 35  ? -7.450  60.141 7.366   0.00 59.57 ? 344 LYS D CB  1 
ATOM   3377 C  CG  . LYS D 2 35  ? -8.353  60.400 8.566   0.00 59.59 ? 344 LYS D CG  1 
ATOM   3378 C  CD  . LYS D 2 35  ? -9.666  61.049 8.161   0.00 59.64 ? 344 LYS D CD  1 
ATOM   3379 C  CE  . LYS D 2 35  ? -10.518 61.363 9.382   0.00 59.78 ? 344 LYS D CE  1 
ATOM   3380 N  NZ  . LYS D 2 35  ? -11.799 62.030 9.019   0.00 59.77 ? 344 LYS D NZ  1 
ATOM   3381 N  N   . ASP D 2 36  ? -5.388  57.264 7.855   1.00 60.40 ? 345 ASP D N   1 
ATOM   3382 C  CA  . ASP D 2 36  ? -5.446  55.887 8.351   1.00 59.91 ? 345 ASP D CA  1 
ATOM   3383 C  C   . ASP D 2 36  ? -4.315  55.514 9.334   1.00 59.24 ? 345 ASP D C   1 
ATOM   3384 O  O   . ASP D 2 36  ? -3.808  54.395 9.313   1.00 59.74 ? 345 ASP D O   1 
ATOM   3385 C  CB  . ASP D 2 36  ? -5.437  54.926 7.151   1.00 60.43 ? 345 ASP D CB  1 
ATOM   3386 C  CG  . ASP D 2 36  ? -5.600  53.454 7.552   1.00 61.49 ? 345 ASP D CG  1 
ATOM   3387 O  OD1 . ASP D 2 36  ? -5.181  52.571 6.761   1.00 60.54 ? 345 ASP D OD1 1 
ATOM   3388 O  OD2 . ASP D 2 36  ? -6.150  53.177 8.648   1.00 61.51 ? 345 ASP D OD2 1 
ATOM   3389 N  N   . GLY D 2 37  ? -3.921  56.437 10.201  1.00 57.96 ? 346 GLY D N   1 
ATOM   3390 C  CA  . GLY D 2 37  ? -2.864  56.124 11.151  1.00 57.50 ? 346 GLY D CA  1 
ATOM   3391 C  C   . GLY D 2 37  ? -1.457  56.225 10.578  1.00 56.97 ? 346 GLY D C   1 
ATOM   3392 O  O   . GLY D 2 37  ? -1.251  56.813 9.504   1.00 58.41 ? 346 GLY D O   1 
ATOM   3393 N  N   . SER D 2 38  ? -0.480  55.651 11.276  1.00 54.20 ? 347 SER D N   1 
ATOM   3394 C  CA  . SER D 2 38  ? 0.888   55.717 10.791  1.00 52.37 ? 347 SER D CA  1 
ATOM   3395 C  C   . SER D 2 38  ? 1.405   54.353 10.376  1.00 51.00 ? 347 SER D C   1 
ATOM   3396 O  O   . SER D 2 38  ? 0.964   53.337 10.892  1.00 49.83 ? 347 SER D O   1 
ATOM   3397 C  CB  . SER D 2 38  ? 1.786   56.303 11.868  1.00 52.15 ? 347 SER D CB  1 
ATOM   3398 O  OG  . SER D 2 38  ? 1.732   55.499 13.025  1.00 54.20 ? 347 SER D OG  1 
ATOM   3399 N  N   . TRP D 2 39  ? 2.337   54.346 9.429   1.00 50.43 ? 348 TRP D N   1 
ATOM   3400 C  CA  . TRP D 2 39  ? 2.945   53.118 8.927   1.00 49.94 ? 348 TRP D CA  1 
ATOM   3401 C  C   . TRP D 2 39  ? 3.436   52.203 10.056  1.00 50.01 ? 348 TRP D C   1 
ATOM   3402 O  O   . TRP D 2 39  ? 3.103   51.019 10.102  1.00 50.46 ? 348 TRP D O   1 
ATOM   3403 C  CB  . TRP D 2 39  ? 4.148   53.454 8.041   1.00 49.65 ? 348 TRP D CB  1 
ATOM   3404 C  CG  . TRP D 2 39  ? 3.853   54.146 6.750   1.00 48.49 ? 348 TRP D CG  1 
ATOM   3405 C  CD1 . TRP D 2 39  ? 2.655   54.628 6.329   1.00 48.10 ? 348 TRP D CD1 1 
ATOM   3406 C  CD2 . TRP D 2 39  ? 4.786   54.395 5.689   1.00 47.11 ? 348 TRP D CD2 1 
ATOM   3407 N  NE1 . TRP D 2 39  ? 2.778   55.157 5.067   1.00 47.66 ? 348 TRP D NE1 1 
ATOM   3408 C  CE2 . TRP D 2 39  ? 4.077   55.025 4.651   1.00 45.86 ? 348 TRP D CE2 1 
ATOM   3409 C  CE3 . TRP D 2 39  ? 6.151   54.141 5.516   1.00 46.14 ? 348 TRP D CE3 1 
ATOM   3410 C  CZ2 . TRP D 2 39  ? 4.683   55.405 3.454   1.00 45.33 ? 348 TRP D CZ2 1 
ATOM   3411 C  CZ3 . TRP D 2 39  ? 6.753   54.519 4.326   1.00 46.75 ? 348 TRP D CZ3 1 
ATOM   3412 C  CH2 . TRP D 2 39  ? 6.018   55.144 3.310   1.00 45.71 ? 348 TRP D CH2 1 
ATOM   3413 N  N   . PHE D 2 40  ? 4.246   52.771 10.946  1.00 49.40 ? 349 PHE D N   1 
ATOM   3414 C  CA  . PHE D 2 40  ? 4.841   52.063 12.075  1.00 48.74 ? 349 PHE D CA  1 
ATOM   3415 C  C   . PHE D 2 40  ? 3.835   51.485 13.055  1.00 48.63 ? 349 PHE D C   1 
ATOM   3416 O  O   . PHE D 2 40  ? 3.783   50.281 13.276  1.00 47.45 ? 349 PHE D O   1 
ATOM   3417 C  CB  . PHE D 2 40  ? 5.776   53.011 12.822  1.00 48.78 ? 349 PHE D CB  1 
ATOM   3418 C  CG  . PHE D 2 40  ? 6.516   52.374 13.958  1.00 47.16 ? 349 PHE D CG  1 
ATOM   3419 C  CD1 . PHE D 2 40  ? 7.424   51.350 13.729  1.00 46.59 ? 349 PHE D CD1 1 
ATOM   3420 C  CD2 . PHE D 2 40  ? 6.334   52.828 15.256  1.00 46.91 ? 349 PHE D CD2 1 
ATOM   3421 C  CE1 . PHE D 2 40  ? 8.150   50.787 14.777  1.00 46.27 ? 349 PHE D CE1 1 
ATOM   3422 C  CE2 . PHE D 2 40  ? 7.059   52.271 16.322  1.00 46.56 ? 349 PHE D CE2 1 
ATOM   3423 C  CZ  . PHE D 2 40  ? 7.968   51.251 16.079  1.00 46.29 ? 349 PHE D CZ  1 
ATOM   3424 N  N   . ILE D 2 41  ? 3.046   52.350 13.666  1.00 49.44 ? 350 ILE D N   1 
ATOM   3425 C  CA  . ILE D 2 41  ? 2.065   51.881 14.620  1.00 50.50 ? 350 ILE D CA  1 
ATOM   3426 C  C   . ILE D 2 41  ? 1.189   50.809 13.991  1.00 50.85 ? 350 ILE D C   1 
ATOM   3427 O  O   . ILE D 2 41  ? 0.912   49.779 14.607  1.00 51.12 ? 350 ILE D O   1 
ATOM   3428 C  CB  . ILE D 2 41  ? 1.201   53.036 15.115  1.00 50.66 ? 350 ILE D CB  1 
ATOM   3429 C  CG1 . ILE D 2 41  ? 2.079   54.035 15.882  1.00 51.21 ? 350 ILE D CG1 1 
ATOM   3430 C  CG2 . ILE D 2 41  ? 0.077   52.508 15.993  1.00 52.39 ? 350 ILE D CG2 1 
ATOM   3431 C  CD1 . ILE D 2 41  ? 2.852   53.420 17.036  1.00 49.35 ? 350 ILE D CD1 1 
ATOM   3432 N  N   . GLN D 2 42  ? 0.771   51.050 12.752  1.00 51.56 ? 351 GLN D N   1 
ATOM   3433 C  CA  . GLN D 2 42  ? -0.068  50.106 12.025  1.00 51.14 ? 351 GLN D CA  1 
ATOM   3434 C  C   . GLN D 2 42  ? 0.581   48.734 11.996  1.00 50.72 ? 351 GLN D C   1 
ATOM   3435 O  O   . GLN D 2 42  ? -0.061  47.735 12.300  1.00 50.64 ? 351 GLN D O   1 
ATOM   3436 C  CB  . GLN D 2 42  ? -0.301  50.609 10.600  1.00 52.17 ? 351 GLN D CB  1 
ATOM   3437 C  CG  . GLN D 2 42  ? -1.156  49.708 9.708   1.00 53.00 ? 351 GLN D CG  1 
ATOM   3438 C  CD  . GLN D 2 42  ? -1.627  50.434 8.448   1.00 54.65 ? 351 GLN D CD  1 
ATOM   3439 O  OE1 . GLN D 2 42  ? -2.347  51.439 8.531   1.00 54.60 ? 351 GLN D OE1 1 
ATOM   3440 N  NE2 . GLN D 2 42  ? -1.219  49.936 7.278   1.00 55.21 ? 351 GLN D NE2 1 
ATOM   3441 N  N   . SER D 2 43  ? 1.857   48.693 11.642  1.00 50.40 ? 352 SER D N   1 
ATOM   3442 C  CA  . SER D 2 43  ? 2.579   47.435 11.577  1.00 50.92 ? 352 SER D CA  1 
ATOM   3443 C  C   . SER D 2 43  ? 2.849   46.854 12.962  1.00 51.56 ? 352 SER D C   1 
ATOM   3444 O  O   . SER D 2 43  ? 2.787   45.631 13.159  1.00 51.84 ? 352 SER D O   1 
ATOM   3445 C  CB  . SER D 2 43  ? 3.898   47.637 10.847  1.00 51.24 ? 352 SER D CB  1 
ATOM   3446 O  OG  . SER D 2 43  ? 3.664   48.133 9.548   1.00 52.40 ? 352 SER D OG  1 
ATOM   3447 N  N   . LEU D 2 44  ? 3.146   47.730 13.918  1.00 51.48 ? 353 LEU D N   1 
ATOM   3448 C  CA  . LEU D 2 44  ? 3.433   47.301 15.281  1.00 51.63 ? 353 LEU D CA  1 
ATOM   3449 C  C   . LEU D 2 44  ? 2.274   46.456 15.798  1.00 52.75 ? 353 LEU D C   1 
ATOM   3450 O  O   . LEU D 2 44  ? 2.443   45.282 16.140  1.00 53.82 ? 353 LEU D O   1 
ATOM   3451 C  CB  . LEU D 2 44  ? 3.646   48.522 16.178  1.00 50.41 ? 353 LEU D CB  1 
ATOM   3452 C  CG  . LEU D 2 44  ? 3.964   48.272 17.649  1.00 49.23 ? 353 LEU D CG  1 
ATOM   3453 C  CD1 . LEU D 2 44  ? 5.163   47.369 17.765  1.00 48.35 ? 353 LEU D CD1 1 
ATOM   3454 C  CD2 . LEU D 2 44  ? 4.218   49.595 18.342  1.00 48.79 ? 353 LEU D CD2 1 
ATOM   3455 N  N   . CYS D 2 45  ? 1.089   47.052 15.833  1.00 52.67 ? 354 CYS D N   1 
ATOM   3456 C  CA  . CYS D 2 45  ? -0.091  46.345 16.308  1.00 52.66 ? 354 CYS D CA  1 
ATOM   3457 C  C   . CYS D 2 45  ? -0.274  45.046 15.521  1.00 52.90 ? 354 CYS D C   1 
ATOM   3458 O  O   . CYS D 2 45  ? -0.424  43.972 16.112  1.00 53.51 ? 354 CYS D O   1 
ATOM   3459 C  CB  . CYS D 2 45  ? -1.335  47.235 16.177  1.00 51.43 ? 354 CYS D CB  1 
ATOM   3460 S  SG  . CYS D 2 45  ? -1.323  48.736 17.218  1.00 52.37 ? 354 CYS D SG  1 
ATOM   3461 N  N   . ALA D 2 46  ? -0.238  45.137 14.197  1.00 52.37 ? 355 ALA D N   1 
ATOM   3462 C  CA  . ALA D 2 46  ? -0.409  43.958 13.367  1.00 53.46 ? 355 ALA D CA  1 
ATOM   3463 C  C   . ALA D 2 46  ? 0.495   42.843 13.848  1.00 54.97 ? 355 ALA D C   1 
ATOM   3464 O  O   . ALA D 2 46  ? 0.018   41.754 14.185  1.00 56.31 ? 355 ALA D O   1 
ATOM   3465 C  CB  . ALA D 2 46  ? -0.105  44.276 11.925  1.00 52.68 ? 355 ALA D CB  1 
ATOM   3466 N  N   . MET D 2 47  ? 1.799   43.102 13.900  1.00 55.25 ? 356 MET D N   1 
ATOM   3467 C  CA  . MET D 2 47  ? 2.720   42.066 14.342  1.00 55.80 ? 356 MET D CA  1 
ATOM   3468 C  C   . MET D 2 47  ? 2.495   41.648 15.799  1.00 55.80 ? 356 MET D C   1 
ATOM   3469 O  O   . MET D 2 47  ? 2.640   40.468 16.137  1.00 55.30 ? 356 MET D O   1 
ATOM   3470 C  CB  . MET D 2 47  ? 4.168   42.510 14.129  1.00 56.64 ? 356 MET D CB  1 
ATOM   3471 C  CG  . MET D 2 47  ? 4.496   42.799 12.680  1.00 57.96 ? 356 MET D CG  1 
ATOM   3472 S  SD  . MET D 2 47  ? 3.751   41.599 11.542  1.00 59.71 ? 356 MET D SD  1 
ATOM   3473 C  CE  . MET D 2 47  ? 5.146   40.630 11.079  1.00 59.57 ? 356 MET D CE  1 
ATOM   3474 N  N   . LEU D 2 48  ? 2.139   42.597 16.663  1.00 55.13 ? 357 LEU D N   1 
ATOM   3475 C  CA  . LEU D 2 48  ? 1.898   42.243 18.054  1.00 56.13 ? 357 LEU D CA  1 
ATOM   3476 C  C   . LEU D 2 48  ? 0.702   41.300 18.119  1.00 57.82 ? 357 LEU D C   1 
ATOM   3477 O  O   . LEU D 2 48  ? 0.714   40.313 18.863  1.00 57.32 ? 357 LEU D O   1 
ATOM   3478 C  CB  . LEU D 2 48  ? 1.640   43.490 18.910  1.00 53.70 ? 357 LEU D CB  1 
ATOM   3479 C  CG  . LEU D 2 48  ? 2.888   44.214 19.424  1.00 52.01 ? 357 LEU D CG  1 
ATOM   3480 C  CD1 . LEU D 2 48  ? 2.498   45.421 20.248  1.00 50.36 ? 357 LEU D CD1 1 
ATOM   3481 C  CD2 . LEU D 2 48  ? 3.713   43.255 20.251  1.00 49.45 ? 357 LEU D CD2 1 
ATOM   3482 N  N   . LYS D 2 49  ? -0.317  41.591 17.313  1.00 59.58 ? 358 LYS D N   1 
ATOM   3483 C  CA  . LYS D 2 49  ? -1.524  40.769 17.286  1.00 61.05 ? 358 LYS D CA  1 
ATOM   3484 C  C   . LYS D 2 49  ? -1.228  39.337 16.852  1.00 61.64 ? 358 LYS D C   1 
ATOM   3485 O  O   . LYS D 2 49  ? -1.680  38.395 17.486  1.00 62.43 ? 358 LYS D O   1 
ATOM   3486 C  CB  . LYS D 2 49  ? -2.560  41.379 16.346  1.00 61.87 ? 358 LYS D CB  1 
ATOM   3487 C  CG  . LYS D 2 49  ? -3.931  40.729 16.444  1.00 64.24 ? 358 LYS D CG  1 
ATOM   3488 C  CD  . LYS D 2 49  ? -4.511  40.369 15.071  1.00 65.68 ? 358 LYS D CD  1 
ATOM   3489 C  CE  . LYS D 2 49  ? -4.669  41.601 14.157  1.00 66.74 ? 358 LYS D CE  1 
ATOM   3490 N  NZ  . LYS D 2 49  ? -5.366  41.295 12.862  1.00 66.28 ? 358 LYS D NZ  1 
ATOM   3491 N  N   . GLN D 2 50  ? -0.472  39.171 15.772  1.00 62.80 ? 359 GLN D N   1 
ATOM   3492 C  CA  . GLN D 2 50  ? -0.134  37.834 15.281  1.00 64.08 ? 359 GLN D CA  1 
ATOM   3493 C  C   . GLN D 2 50  ? 0.891   37.072 16.113  1.00 64.03 ? 359 GLN D C   1 
ATOM   3494 O  O   . GLN D 2 50  ? 0.723   35.881 16.353  1.00 65.65 ? 359 GLN D O   1 
ATOM   3495 C  CB  . GLN D 2 50  ? 0.437   37.884 13.859  1.00 65.09 ? 359 GLN D CB  1 
ATOM   3496 C  CG  . GLN D 2 50  ? -0.406  38.580 12.821  1.00 68.43 ? 359 GLN D CG  1 
ATOM   3497 C  CD  . GLN D 2 50  ? 0.186   38.445 11.421  1.00 69.93 ? 359 GLN D CD  1 
ATOM   3498 O  OE1 . GLN D 2 50  ? -0.280  39.094 10.468  1.00 70.45 ? 359 GLN D OE1 1 
ATOM   3499 N  NE2 . GLN D 2 50  ? 1.214   37.585 11.283  1.00 70.28 ? 359 GLN D NE2 1 
ATOM   3500 N  N   . TYR D 2 51  ? 1.953   37.739 16.549  1.00 63.00 ? 360 TYR D N   1 
ATOM   3501 C  CA  . TYR D 2 51  ? 2.989   37.016 17.259  1.00 63.19 ? 360 TYR D CA  1 
ATOM   3502 C  C   . TYR D 2 51  ? 3.198   37.190 18.763  1.00 64.35 ? 360 TYR D C   1 
ATOM   3503 O  O   . TYR D 2 51  ? 3.986   36.438 19.364  1.00 65.14 ? 360 TYR D O   1 
ATOM   3504 C  CB  . TYR D 2 51  ? 4.318   37.247 16.548  1.00 60.93 ? 360 TYR D CB  1 
ATOM   3505 C  CG  . TYR D 2 51  ? 4.267   37.047 15.053  1.00 59.25 ? 360 TYR D CG  1 
ATOM   3506 C  CD1 . TYR D 2 51  ? 4.036   38.118 14.195  1.00 59.14 ? 360 TYR D CD1 1 
ATOM   3507 C  CD2 . TYR D 2 51  ? 4.508   35.800 14.492  1.00 58.57 ? 360 TYR D CD2 1 
ATOM   3508 C  CE1 . TYR D 2 51  ? 4.058   37.950 12.820  1.00 58.28 ? 360 TYR D CE1 1 
ATOM   3509 C  CE2 . TYR D 2 51  ? 4.530   35.619 13.114  1.00 57.41 ? 360 TYR D CE2 1 
ATOM   3510 C  CZ  . TYR D 2 51  ? 4.306   36.693 12.287  1.00 57.94 ? 360 TYR D CZ  1 
ATOM   3511 O  OH  . TYR D 2 51  ? 4.323   36.504 10.923  1.00 59.43 ? 360 TYR D OH  1 
ATOM   3512 N  N   . ALA D 2 52  ? 2.512   38.147 19.381  1.00 64.62 ? 361 ALA D N   1 
ATOM   3513 C  CA  . ALA D 2 52  ? 2.689   38.366 20.813  1.00 65.48 ? 361 ALA D CA  1 
ATOM   3514 C  C   . ALA D 2 52  ? 2.780   37.053 21.599  1.00 67.19 ? 361 ALA D C   1 
ATOM   3515 O  O   . ALA D 2 52  ? 3.574   36.927 22.536  1.00 68.89 ? 361 ALA D O   1 
ATOM   3516 C  CB  . ALA D 2 52  ? 1.555   39.210 21.351  1.00 64.05 ? 361 ALA D CB  1 
ATOM   3517 N  N   . ASP D 2 53  ? 1.989   36.067 21.196  1.00 68.18 ? 362 ASP D N   1 
ATOM   3518 C  CA  . ASP D 2 53  ? 1.946   34.786 21.889  1.00 68.81 ? 362 ASP D CA  1 
ATOM   3519 C  C   . ASP D 2 53  ? 2.891   33.716 21.374  1.00 68.24 ? 362 ASP D C   1 
ATOM   3520 O  O   . ASP D 2 53  ? 2.767   32.553 21.765  1.00 68.97 ? 362 ASP D O   1 
ATOM   3521 C  CB  . ASP D 2 53  ? 0.535   34.232 21.814  1.00 71.12 ? 362 ASP D CB  1 
ATOM   3522 C  CG  . ASP D 2 53  ? 0.065   34.078 20.376  1.00 73.56 ? 362 ASP D CG  1 
ATOM   3523 O  OD1 . ASP D 2 53  ? 0.751   33.348 19.608  1.00 73.94 ? 362 ASP D OD1 1 
ATOM   3524 O  OD2 . ASP D 2 53  ? -0.974  34.697 20.015  1.00 75.00 ? 362 ASP D OD2 1 
ATOM   3525 N  N   . LYS D 2 54  ? 3.826   34.066 20.503  1.00 66.98 ? 363 LYS D N   1 
ATOM   3526 C  CA  . LYS D 2 54  ? 4.725   33.029 20.006  1.00 65.62 ? 363 LYS D CA  1 
ATOM   3527 C  C   . LYS D 2 54  ? 6.099   33.496 19.532  1.00 64.82 ? 363 LYS D C   1 
ATOM   3528 O  O   . LYS D 2 54  ? 6.816   32.744 18.865  1.00 65.55 ? 363 LYS D O   1 
ATOM   3529 C  CB  . LYS D 2 54  ? 4.032   32.237 18.890  1.00 66.03 ? 363 LYS D CB  1 
ATOM   3530 C  CG  . LYS D 2 54  ? 3.449   33.092 17.768  1.00 65.79 ? 363 LYS D CG  1 
ATOM   3531 C  CD  . LYS D 2 54  ? 2.736   32.236 16.726  0.00 65.64 ? 363 LYS D CD  1 
ATOM   3532 C  CE  . LYS D 2 54  ? 3.690   31.255 16.053  0.00 65.55 ? 363 LYS D CE  1 
ATOM   3533 N  NZ  . LYS D 2 54  ? 2.982   30.302 15.151  0.00 65.26 ? 363 LYS D NZ  1 
ATOM   3534 N  N   . LEU D 2 55  ? 6.466   34.730 19.868  1.00 63.17 ? 364 LEU D N   1 
ATOM   3535 C  CA  . LEU D 2 55  ? 7.769   35.262 19.487  1.00 60.46 ? 364 LEU D CA  1 
ATOM   3536 C  C   . LEU D 2 55  ? 8.330   36.199 20.533  1.00 58.50 ? 364 LEU D C   1 
ATOM   3537 O  O   . LEU D 2 55  ? 7.588   36.828 21.288  1.00 57.27 ? 364 LEU D O   1 
ATOM   3538 C  CB  . LEU D 2 55  ? 7.687   36.007 18.163  1.00 61.19 ? 364 LEU D CB  1 
ATOM   3539 C  CG  . LEU D 2 55  ? 7.593   35.158 16.898  1.00 62.47 ? 364 LEU D CG  1 
ATOM   3540 C  CD1 . LEU D 2 55  ? 7.694   36.065 15.670  1.00 63.06 ? 364 LEU D CD1 1 
ATOM   3541 C  CD2 . LEU D 2 55  ? 8.721   34.155 16.883  1.00 62.82 ? 364 LEU D CD2 1 
ATOM   3542 N  N   . GLU D 2 56  ? 9.653   36.281 20.567  1.00 56.80 ? 365 GLU D N   1 
ATOM   3543 C  CA  . GLU D 2 56  ? 10.354  37.153 21.493  1.00 55.12 ? 365 GLU D CA  1 
ATOM   3544 C  C   . GLU D 2 56  ? 10.155  38.571 20.933  1.00 53.90 ? 365 GLU D C   1 
ATOM   3545 O  O   . GLU D 2 56  ? 10.014  38.750 19.724  1.00 53.26 ? 365 GLU D O   1 
ATOM   3546 C  CB  . GLU D 2 56  ? 11.834  36.745 21.532  1.00 55.00 ? 365 GLU D CB  1 
ATOM   3547 C  CG  . GLU D 2 56  ? 12.617  37.259 22.724  1.00 55.87 ? 365 GLU D CG  1 
ATOM   3548 C  CD  . GLU D 2 56  ? 13.099  38.672 22.517  1.00 56.06 ? 365 GLU D CD  1 
ATOM   3549 O  OE1 . GLU D 2 56  ? 12.772  39.558 23.339  1.00 54.65 ? 365 GLU D OE1 1 
ATOM   3550 O  OE2 . GLU D 2 56  ? 13.812  38.887 21.517  1.00 57.31 ? 365 GLU D OE2 1 
ATOM   3551 N  N   . PHE D 2 57  ? 10.132  39.571 21.803  1.00 52.64 ? 366 PHE D N   1 
ATOM   3552 C  CA  . PHE D 2 57  ? 9.895   40.941 21.368  1.00 52.08 ? 366 PHE D CA  1 
ATOM   3553 C  C   . PHE D 2 57  ? 10.816  41.447 20.234  1.00 52.30 ? 366 PHE D C   1 
ATOM   3554 O  O   . PHE D 2 57  ? 10.344  42.037 19.257  1.00 51.12 ? 366 PHE D O   1 
ATOM   3555 C  CB  . PHE D 2 57  ? 9.942   41.875 22.590  1.00 50.14 ? 366 PHE D CB  1 
ATOM   3556 C  CG  . PHE D 2 57  ? 9.276   43.206 22.363  1.00 49.26 ? 366 PHE D CG  1 
ATOM   3557 C  CD1 . PHE D 2 57  ? 8.074   43.285 21.672  1.00 48.34 ? 366 PHE D CD1 1 
ATOM   3558 C  CD2 . PHE D 2 57  ? 9.851   44.381 22.839  1.00 49.03 ? 366 PHE D CD2 1 
ATOM   3559 C  CE1 . PHE D 2 57  ? 7.454   44.511 21.453  1.00 49.05 ? 366 PHE D CE1 1 
ATOM   3560 C  CE2 . PHE D 2 57  ? 9.236   45.612 22.625  1.00 49.48 ? 366 PHE D CE2 1 
ATOM   3561 C  CZ  . PHE D 2 57  ? 8.036   45.679 21.930  1.00 48.73 ? 366 PHE D CZ  1 
ATOM   3562 N  N   . MET D 2 58  ? 12.119  41.218 20.357  1.00 52.34 ? 367 MET D N   1 
ATOM   3563 C  CA  . MET D 2 58  ? 13.063  41.643 19.329  1.00 52.54 ? 367 MET D CA  1 
ATOM   3564 C  C   . MET D 2 58  ? 12.654  41.119 17.968  1.00 52.48 ? 367 MET D C   1 
ATOM   3565 O  O   . MET D 2 58  ? 12.675  41.843 16.977  1.00 53.08 ? 367 MET D O   1 
ATOM   3566 C  CB  . MET D 2 58  ? 14.464  41.125 19.635  1.00 53.89 ? 367 MET D CB  1 
ATOM   3567 C  CG  . MET D 2 58  ? 15.104  41.753 20.833  1.00 55.16 ? 367 MET D CG  1 
ATOM   3568 S  SD  . MET D 2 58  ? 15.268  43.509 20.573  1.00 58.01 ? 367 MET D SD  1 
ATOM   3569 C  CE  . MET D 2 58  ? 13.785  44.112 21.466  1.00 57.24 ? 367 MET D CE  1 
ATOM   3570 N  N   . HIS D 2 59  ? 12.295  39.845 17.920  1.00 52.38 ? 368 HIS D N   1 
ATOM   3571 C  CA  . HIS D 2 59  ? 11.886  39.236 16.672  1.00 52.09 ? 368 HIS D CA  1 
ATOM   3572 C  C   . HIS D 2 59  ? 10.576  39.834 16.189  1.00 51.31 ? 368 HIS D C   1 
ATOM   3573 O  O   . HIS D 2 59  ? 10.373  40.015 14.997  1.00 51.84 ? 368 HIS D O   1 
ATOM   3574 C  CB  . HIS D 2 59  ? 11.790  37.723 16.845  1.00 53.01 ? 368 HIS D CB  1 
ATOM   3575 C  CG  . HIS D 2 59  ? 13.115  37.079 17.108  1.00 56.11 ? 368 HIS D CG  1 
ATOM   3576 N  ND1 . HIS D 2 59  ? 13.249  35.750 17.448  1.00 57.94 ? 368 HIS D ND1 1 
ATOM   3577 C  CD2 . HIS D 2 59  ? 14.372  37.588 17.077  1.00 57.26 ? 368 HIS D CD2 1 
ATOM   3578 C  CE1 . HIS D 2 59  ? 14.531  35.468 17.616  1.00 58.51 ? 368 HIS D CE1 1 
ATOM   3579 N  NE2 . HIS D 2 59  ? 15.234  36.567 17.397  1.00 57.90 ? 368 HIS D NE2 1 
ATOM   3580 N  N   . ILE D 2 60  ? 9.684   40.164 17.109  1.00 49.75 ? 369 ILE D N   1 
ATOM   3581 C  CA  . ILE D 2 60  ? 8.438   40.760 16.690  1.00 48.43 ? 369 ILE D CA  1 
ATOM   3582 C  C   . ILE D 2 60  ? 8.748   42.108 16.046  1.00 47.82 ? 369 ILE D C   1 
ATOM   3583 O  O   . ILE D 2 60  ? 8.292   42.393 14.940  1.00 46.26 ? 369 ILE D O   1 
ATOM   3584 C  CB  . ILE D 2 60  ? 7.507   40.964 17.874  1.00 48.71 ? 369 ILE D CB  1 
ATOM   3585 C  CG1 . ILE D 2 60  ? 7.256   39.613 18.532  1.00 50.08 ? 369 ILE D CG1 1 
ATOM   3586 C  CG2 . ILE D 2 60  ? 6.197   41.596 17.409  1.00 48.18 ? 369 ILE D CG2 1 
ATOM   3587 C  CD1 . ILE D 2 60  ? 6.408   39.689 19.767  1.00 52.12 ? 369 ILE D CD1 1 
ATOM   3588 N  N   . LEU D 2 61  ? 9.536   42.929 16.736  1.00 47.09 ? 370 LEU D N   1 
ATOM   3589 C  CA  . LEU D 2 61  ? 9.891   44.242 16.219  1.00 45.31 ? 370 LEU D CA  1 
ATOM   3590 C  C   . LEU D 2 61  ? 10.738  44.131 14.961  1.00 45.47 ? 370 LEU D C   1 
ATOM   3591 O  O   . LEU D 2 61  ? 10.834  45.082 14.199  1.00 44.77 ? 370 LEU D O   1 
ATOM   3592 C  CB  . LEU D 2 61  ? 10.614  45.072 17.286  1.00 44.60 ? 370 LEU D CB  1 
ATOM   3593 C  CG  . LEU D 2 61  ? 9.773   45.549 18.482  1.00 44.68 ? 370 LEU D CG  1 
ATOM   3594 C  CD1 . LEU D 2 61  ? 10.655  46.257 19.483  1.00 44.56 ? 370 LEU D CD1 1 
ATOM   3595 C  CD2 . LEU D 2 61  ? 8.683   46.483 18.021  1.00 42.53 ? 370 LEU D CD2 1 
ATOM   3596 N  N   . THR D 2 62  ? 11.355  42.976 14.740  1.00 44.44 ? 371 THR D N   1 
ATOM   3597 C  CA  . THR D 2 62  ? 12.145  42.789 13.533  1.00 44.51 ? 371 THR D CA  1 
ATOM   3598 C  C   . THR D 2 62  ? 11.157  42.469 12.422  1.00 44.93 ? 371 THR D C   1 
ATOM   3599 O  O   . THR D 2 62  ? 11.429  42.661 11.243  1.00 45.29 ? 371 THR D O   1 
ATOM   3600 C  CB  . THR D 2 62  ? 13.151  41.633 13.676  1.00 43.93 ? 371 THR D CB  1 
ATOM   3601 O  OG1 . THR D 2 62  ? 14.045  41.909 14.760  1.00 45.65 ? 371 THR D OG1 1 
ATOM   3602 C  CG2 . THR D 2 62  ? 13.963  41.473 12.398  1.00 41.01 ? 371 THR D CG2 1 
ATOM   3603 N  N   . ARG D 2 63  ? 9.996   41.973 12.815  1.00 46.32 ? 372 ARG D N   1 
ATOM   3604 C  CA  . ARG D 2 63  ? 8.948   41.663 11.863  1.00 47.75 ? 372 ARG D CA  1 
ATOM   3605 C  C   . ARG D 2 63  ? 8.401   42.990 11.384  1.00 47.43 ? 372 ARG D C   1 
ATOM   3606 O  O   . ARG D 2 63  ? 8.132   43.173 10.197  1.00 48.32 ? 372 ARG D O   1 
ATOM   3607 C  CB  . ARG D 2 63  ? 7.823   40.891 12.540  1.00 49.70 ? 372 ARG D CB  1 
ATOM   3608 C  CG  . ARG D 2 63  ? 8.120   39.432 12.800  1.00 53.79 ? 372 ARG D CG  1 
ATOM   3609 C  CD  . ARG D 2 63  ? 8.070   38.619 11.534  1.00 56.37 ? 372 ARG D CD  1 
ATOM   3610 N  NE  . ARG D 2 63  ? 7.947   37.193 11.830  1.00 61.47 ? 372 ARG D NE  1 
ATOM   3611 C  CZ  . ARG D 2 63  ? 7.664   36.266 10.920  1.00 63.60 ? 372 ARG D CZ  1 
ATOM   3612 N  NH1 . ARG D 2 63  ? 7.470   36.618 9.648   1.00 65.08 ? 372 ARG D NH1 1 
ATOM   3613 N  NH2 . ARG D 2 63  ? 7.584   34.988 11.279  1.00 63.51 ? 372 ARG D NH2 1 
ATOM   3614 N  N   . VAL D 2 64  ? 8.232   43.911 12.328  1.00 45.98 ? 373 VAL D N   1 
ATOM   3615 C  CA  . VAL D 2 64  ? 7.711   45.235 12.040  1.00 45.13 ? 373 VAL D CA  1 
ATOM   3616 C  C   . VAL D 2 64  ? 8.648   45.956 11.086  1.00 45.45 ? 373 VAL D C   1 
ATOM   3617 O  O   . VAL D 2 64  ? 8.209   46.636 10.170  1.00 46.32 ? 373 VAL D O   1 
ATOM   3618 C  CB  . VAL D 2 64  ? 7.574   46.053 13.323  1.00 44.81 ? 373 VAL D CB  1 
ATOM   3619 C  CG1 . VAL D 2 64  ? 6.860   47.343 13.047  1.00 44.28 ? 373 VAL D CG1 1 
ATOM   3620 C  CG2 . VAL D 2 64  ? 6.826   45.260 14.350  1.00 46.35 ? 373 VAL D CG2 1 
ATOM   3621 N  N   . ASN D 2 65  ? 9.947   45.801 11.303  1.00 45.35 ? 374 ASN D N   1 
ATOM   3622 C  CA  . ASN D 2 65  ? 10.928  46.438 10.448  1.00 44.75 ? 374 ASN D CA  1 
ATOM   3623 C  C   . ASN D 2 65  ? 10.708  45.985 9.019   1.00 45.98 ? 374 ASN D C   1 
ATOM   3624 O  O   . ASN D 2 65  ? 10.645  46.804 8.104   1.00 46.72 ? 374 ASN D O   1 
ATOM   3625 C  CB  . ASN D 2 65  ? 12.343  46.077 10.894  1.00 43.32 ? 374 ASN D CB  1 
ATOM   3626 C  CG  . ASN D 2 65  ? 12.827  46.932 12.048  1.00 42.92 ? 374 ASN D CG  1 
ATOM   3627 O  OD1 . ASN D 2 65  ? 12.075  47.736 12.603  1.00 41.15 ? 374 ASN D OD1 1 
ATOM   3628 N  ND2 . ASN D 2 65  ? 14.095  46.762 12.418  1.00 41.31 ? 374 ASN D ND2 1 
ATOM   3629 N  N   . ARG D 2 66  ? 10.590  44.681 8.822   1.00 46.30 ? 375 ARG D N   1 
ATOM   3630 C  CA  . ARG D 2 66  ? 10.379  44.165 7.487   1.00 47.11 ? 375 ARG D CA  1 
ATOM   3631 C  C   . ARG D 2 66  ? 9.049   44.628 6.925   1.00 47.71 ? 375 ARG D C   1 
ATOM   3632 O  O   . ARG D 2 66  ? 8.968   45.014 5.760   1.00 48.76 ? 375 ARG D O   1 
ATOM   3633 C  CB  . ARG D 2 66  ? 10.438  42.637 7.473   1.00 47.74 ? 375 ARG D CB  1 
ATOM   3634 C  CG  . ARG D 2 66  ? 10.327  42.036 6.067   1.00 48.28 ? 375 ARG D CG  1 
ATOM   3635 C  CD  . ARG D 2 66  ? 11.061  40.718 5.962   1.00 47.48 ? 375 ARG D CD  1 
ATOM   3636 N  NE  . ARG D 2 66  ? 10.532  39.723 6.883   0.00 47.84 ? 375 ARG D NE  1 
ATOM   3637 C  CZ  . ARG D 2 66  ? 9.560   38.875 6.572   0.00 47.86 ? 375 ARG D CZ  1 
ATOM   3638 N  NH1 . ARG D 2 66  ? 9.023   38.905 5.360   0.00 47.94 ? 375 ARG D NH1 1 
ATOM   3639 N  NH2 . ARG D 2 66  ? 9.123   38.003 7.470   0.00 47.94 ? 375 ARG D NH2 1 
ATOM   3640 N  N   . LYS D 2 67  ? 8.005   44.609 7.745   1.00 47.85 ? 376 LYS D N   1 
ATOM   3641 C  CA  . LYS D 2 67  ? 6.694   45.018 7.265   1.00 48.63 ? 376 LYS D CA  1 
ATOM   3642 C  C   . LYS D 2 67  ? 6.739   46.444 6.769   1.00 48.85 ? 376 LYS D C   1 
ATOM   3643 O  O   . LYS D 2 67  ? 6.312   46.725 5.660   1.00 50.86 ? 376 LYS D O   1 
ATOM   3644 C  CB  . LYS D 2 67  ? 5.643   44.904 8.364   1.00 50.26 ? 376 LYS D CB  1 
ATOM   3645 C  CG  . LYS D 2 67  ? 4.213   44.851 7.839   1.00 50.77 ? 376 LYS D CG  1 
ATOM   3646 C  CD  . LYS D 2 67  ? 3.188   44.995 8.968   1.00 52.11 ? 376 LYS D CD  1 
ATOM   3647 C  CE  . LYS D 2 67  ? 1.816   44.510 8.532   1.00 52.68 ? 376 LYS D CE  1 
ATOM   3648 N  NZ  . LYS D 2 67  ? 1.435   45.042 7.199   1.00 52.42 ? 376 LYS D NZ  1 
ATOM   3649 N  N   . VAL D 2 68  ? 7.263   47.347 7.583   1.00 47.81 ? 377 VAL D N   1 
ATOM   3650 C  CA  . VAL D 2 68  ? 7.339   48.746 7.193   1.00 46.98 ? 377 VAL D CA  1 
ATOM   3651 C  C   . VAL D 2 68  ? 8.257   48.939 5.988   1.00 47.12 ? 377 VAL D C   1 
ATOM   3652 O  O   . VAL D 2 68  ? 7.930   49.666 5.062   1.00 47.11 ? 377 VAL D O   1 
ATOM   3653 C  CB  . VAL D 2 68  ? 7.836   49.624 8.370   1.00 46.72 ? 377 VAL D CB  1 
ATOM   3654 C  CG1 . VAL D 2 68  ? 8.047   51.055 7.910   1.00 47.19 ? 377 VAL D CG1 1 
ATOM   3655 C  CG2 . VAL D 2 68  ? 6.832   49.588 9.509   1.00 44.57 ? 377 VAL D CG2 1 
ATOM   3656 N  N   . ALA D 2 69  ? 9.398   48.266 5.997   1.00 47.10 ? 378 ALA D N   1 
ATOM   3657 C  CA  . ALA D 2 69  ? 10.368  48.382 4.914   1.00 47.30 ? 378 ALA D CA  1 
ATOM   3658 C  C   . ALA D 2 69  ? 9.885   47.803 3.597   1.00 47.65 ? 378 ALA D C   1 
ATOM   3659 O  O   . ALA D 2 69  ? 10.207  48.310 2.525   1.00 47.75 ? 378 ALA D O   1 
ATOM   3660 C  CB  . ALA D 2 69  ? 11.676  47.693 5.319   1.00 46.72 ? 378 ALA D CB  1 
ATOM   3661 N  N   . THR D 2 70  ? 9.109   46.736 3.695   1.00 48.24 ? 379 THR D N   1 
ATOM   3662 C  CA  . THR D 2 70  ? 8.601   46.017 2.545   1.00 49.21 ? 379 THR D CA  1 
ATOM   3663 C  C   . THR D 2 70  ? 7.266   46.451 1.957   1.00 50.25 ? 379 THR D C   1 
ATOM   3664 O  O   . THR D 2 70  ? 7.155   46.689 0.761   1.00 51.18 ? 379 THR D O   1 
ATOM   3665 C  CB  . THR D 2 70  ? 8.507   44.535 2.894   1.00 48.27 ? 379 THR D CB  1 
ATOM   3666 O  OG1 . THR D 2 70  ? 9.790   43.940 2.717   1.00 49.03 ? 379 THR D OG1 1 
ATOM   3667 C  CG2 . THR D 2 70  ? 7.493   43.827 2.028   1.00 51.04 ? 379 THR D CG2 1 
ATOM   3668 N  N   . GLU D 2 71  A 6.250   46.544 2.797   1.00 50.98 ? 379 GLU D N   1 
ATOM   3669 C  CA  . GLU D 2 71  A 4.923   46.884 2.331   1.00 50.73 ? 379 GLU D CA  1 
ATOM   3670 C  C   . GLU D 2 71  A 4.568   48.359 2.190   1.00 51.06 ? 379 GLU D C   1 
ATOM   3671 O  O   . GLU D 2 71  A 3.490   48.676 1.698   1.00 52.19 ? 379 GLU D O   1 
ATOM   3672 C  CB  . GLU D 2 71  A 3.912   46.192 3.237   1.00 51.39 ? 379 GLU D CB  1 
ATOM   3673 C  CG  . GLU D 2 71  A 4.082   44.678 3.243   1.00 53.55 ? 379 GLU D CG  1 
ATOM   3674 C  CD  . GLU D 2 71  A 3.351   44.000 4.385   1.00 53.96 ? 379 GLU D CD  1 
ATOM   3675 O  OE1 . GLU D 2 71  A 2.309   44.542 4.831   1.00 54.82 ? 379 GLU D OE1 1 
ATOM   3676 O  OE2 . GLU D 2 71  A 3.816   42.921 4.821   1.00 53.23 ? 379 GLU D OE2 1 
ATOM   3677 N  N   . PHE D 2 72  ? 5.452   49.266 2.596   1.00 50.05 ? 380 PHE D N   1 
ATOM   3678 C  CA  . PHE D 2 72  ? 5.132   50.684 2.492   1.00 48.96 ? 380 PHE D CA  1 
ATOM   3679 C  C   . PHE D 2 72  ? 6.034   51.525 1.596   1.00 50.46 ? 380 PHE D C   1 
ATOM   3680 O  O   . PHE D 2 72  ? 7.245   51.314 1.527   1.00 50.68 ? 380 PHE D O   1 
ATOM   3681 C  CB  . PHE D 2 72  ? 5.111   51.327 3.874   1.00 47.35 ? 380 PHE D CB  1 
ATOM   3682 C  CG  . PHE D 2 72  ? 4.043   50.801 4.778   1.00 46.73 ? 380 PHE D CG  1 
ATOM   3683 C  CD1 . PHE D 2 72  ? 4.191   49.572 5.410   1.00 46.67 ? 380 PHE D CD1 1 
ATOM   3684 C  CD2 . PHE D 2 72  ? 2.899   51.546 5.023   1.00 44.41 ? 380 PHE D CD2 1 
ATOM   3685 C  CE1 . PHE D 2 72  ? 3.217   49.095 6.272   1.00 46.49 ? 380 PHE D CE1 1 
ATOM   3686 C  CE2 . PHE D 2 72  ? 1.919   51.079 5.884   1.00 45.71 ? 380 PHE D CE2 1 
ATOM   3687 C  CZ  . PHE D 2 72  ? 2.075   49.853 6.511   1.00 46.00 ? 380 PHE D CZ  1 
ATOM   3688 N  N   . GLU D 2 73  ? 5.411   52.496 0.927   1.00 51.61 ? 381 GLU D N   1 
ATOM   3689 C  CA  . GLU D 2 73  ? 6.066   53.459 0.032   1.00 51.01 ? 381 GLU D CA  1 
ATOM   3690 C  C   . GLU D 2 73  ? 5.092   54.624 -0.072  1.00 50.50 ? 381 GLU D C   1 
ATOM   3691 O  O   . GLU D 2 73  ? 3.910   54.422 -0.330  1.00 52.21 ? 381 GLU D O   1 
ATOM   3692 C  CB  . GLU D 2 73  ? 6.311   52.854 -1.348  1.00 49.87 ? 381 GLU D CB  1 
ATOM   3693 C  CG  . GLU D 2 73  ? 6.722   53.869 -2.393  1.00 51.63 ? 381 GLU D CG  1 
ATOM   3694 C  CD  . GLU D 2 73  ? 7.264   53.213 -3.649  1.00 54.03 ? 381 GLU D CD  1 
ATOM   3695 O  OE1 . GLU D 2 73  ? 7.200   53.838 -4.731  1.00 54.86 ? 381 GLU D OE1 1 
ATOM   3696 O  OE2 . GLU D 2 73  ? 7.766   52.066 -3.553  1.00 56.84 ? 381 GLU D OE2 1 
ATOM   3697 N  N   . SER D 2 74  A 5.569   55.841 0.133   1.00 49.98 ? 381 SER D N   1 
ATOM   3698 C  CA  . SER D 2 74  A 4.675   56.990 0.099   1.00 50.03 ? 381 SER D CA  1 
ATOM   3699 C  C   . SER D 2 74  A 4.129   57.352 -1.268  1.00 50.89 ? 381 SER D C   1 
ATOM   3700 O  O   . SER D 2 74  A 4.652   56.942 -2.305  1.00 51.07 ? 381 SER D O   1 
ATOM   3701 C  CB  . SER D 2 74  A 5.374   58.217 0.668   1.00 48.95 ? 381 SER D CB  1 
ATOM   3702 O  OG  . SER D 2 74  A 6.347   58.695 -0.235  1.00 47.35 ? 381 SER D OG  1 
ATOM   3703 N  N   . PHE D 2 75  B 3.062   58.137 -1.251  1.00 51.89 ? 381 PHE D N   1 
ATOM   3704 C  CA  . PHE D 2 75  B 2.438   58.625 -2.469  1.00 52.36 ? 381 PHE D CA  1 
ATOM   3705 C  C   . PHE D 2 75  B 2.099   60.098 -2.276  1.00 51.74 ? 381 PHE D C   1 
ATOM   3706 O  O   . PHE D 2 75  B 1.300   60.456 -1.412  1.00 50.86 ? 381 PHE D O   1 
ATOM   3707 C  CB  . PHE D 2 75  B 1.159   57.864 -2.783  1.00 52.94 ? 381 PHE D CB  1 
ATOM   3708 C  CG  . PHE D 2 75  B 0.579   58.209 -4.122  1.00 54.94 ? 381 PHE D CG  1 
ATOM   3709 C  CD1 . PHE D 2 75  B 0.755   57.356 -5.207  1.00 55.62 ? 381 PHE D CD1 1 
ATOM   3710 C  CD2 . PHE D 2 75  B -0.104  59.409 -4.317  1.00 55.01 ? 381 PHE D CD2 1 
ATOM   3711 C  CE1 . PHE D 2 75  B 0.263   57.692 -6.467  1.00 55.48 ? 381 PHE D CE1 1 
ATOM   3712 C  CE2 . PHE D 2 75  B -0.598  59.754 -5.575  1.00 54.71 ? 381 PHE D CE2 1 
ATOM   3713 C  CZ  . PHE D 2 75  B -0.414  58.893 -6.649  1.00 55.02 ? 381 PHE D CZ  1 
ATOM   3714 N  N   . SER D 2 76  C 2.720   60.951 -3.077  1.00 52.53 ? 381 SER D N   1 
ATOM   3715 C  CA  . SER D 2 76  C 2.462   62.377 -3.000  1.00 53.18 ? 381 SER D CA  1 
ATOM   3716 C  C   . SER D 2 76  C 2.416   62.923 -4.404  1.00 53.82 ? 381 SER D C   1 
ATOM   3717 O  O   . SER D 2 76  C 3.059   62.378 -5.300  1.00 52.77 ? 381 SER D O   1 
ATOM   3718 C  CB  . SER D 2 76  C 3.566   63.086 -2.228  1.00 51.67 ? 381 SER D CB  1 
ATOM   3719 O  OG  . SER D 2 76  C 3.326   64.471 -2.213  1.00 51.99 ? 381 SER D OG  1 
ATOM   3720 N  N   . PHE D 2 77  D 1.646   63.989 -4.601  1.00 56.00 ? 381 PHE D N   1 
ATOM   3721 C  CA  . PHE D 2 77  D 1.564   64.600 -5.921  1.00 57.14 ? 381 PHE D CA  1 
ATOM   3722 C  C   . PHE D 2 77  D 2.791   65.475 -6.117  1.00 56.63 ? 381 PHE D C   1 
ATOM   3723 O  O   . PHE D 2 77  D 3.085   65.903 -7.230  1.00 58.37 ? 381 PHE D O   1 
ATOM   3724 C  CB  . PHE D 2 77  D 0.286   65.425 -6.063  1.00 59.34 ? 381 PHE D CB  1 
ATOM   3725 C  CG  . PHE D 2 77  D -0.959  64.589 -6.184  1.00 61.55 ? 381 PHE D CG  1 
ATOM   3726 C  CD1 . PHE D 2 77  D -2.015  64.761 -5.281  1.00 62.21 ? 381 PHE D CD1 1 
ATOM   3727 C  CD2 . PHE D 2 77  D -1.075  63.621 -7.196  1.00 61.19 ? 381 PHE D CD2 1 
ATOM   3728 C  CE1 . PHE D 2 77  D -3.175  63.978 -5.379  1.00 62.65 ? 381 PHE D CE1 1 
ATOM   3729 C  CE2 . PHE D 2 77  D -2.226  62.834 -7.307  1.00 61.17 ? 381 PHE D CE2 1 
ATOM   3730 C  CZ  . PHE D 2 77  D -3.277  63.012 -6.395  1.00 62.70 ? 381 PHE D CZ  1 
ATOM   3731 N  N   . ASP D 2 78  E 3.507   65.736 -5.027  1.00 55.54 ? 381 ASP D N   1 
ATOM   3732 C  CA  . ASP D 2 78  E 4.728   66.530 -5.082  1.00 53.82 ? 381 ASP D CA  1 
ATOM   3733 C  C   . ASP D 2 78  E 5.882   65.530 -5.180  1.00 53.09 ? 381 ASP D C   1 
ATOM   3734 O  O   . ASP D 2 78  E 6.119   64.744 -4.261  1.00 51.47 ? 381 ASP D O   1 
ATOM   3735 C  CB  . ASP D 2 78  E 4.849   67.389 -3.820  1.00 54.26 ? 381 ASP D CB  1 
ATOM   3736 C  CG  . ASP D 2 78  E 6.095   68.269 -3.811  1.00 55.69 ? 381 ASP D CG  1 
ATOM   3737 O  OD1 . ASP D 2 78  E 6.135   69.229 -3.003  1.00 57.78 ? 381 ASP D OD1 1 
ATOM   3738 O  OD2 . ASP D 2 78  E 7.037   68.009 -4.591  1.00 54.40 ? 381 ASP D OD2 1 
ATOM   3739 N  N   . ALA D 2 79  F 6.585   65.547 -6.308  1.00 51.91 ? 381 ALA D N   1 
ATOM   3740 C  CA  . ALA D 2 79  F 7.703   64.632 -6.530  1.00 51.69 ? 381 ALA D CA  1 
ATOM   3741 C  C   . ALA D 2 79  F 8.683   64.583 -5.363  1.00 51.99 ? 381 ALA D C   1 
ATOM   3742 O  O   . ALA D 2 79  F 9.293   63.546 -5.090  1.00 52.60 ? 381 ALA D O   1 
ATOM   3743 C  CB  . ALA D 2 79  F 8.442   65.017 -7.794  1.00 49.18 ? 381 ALA D CB  1 
ATOM   3744 N  N   . THR D 2 80  G 8.833   65.708 -4.677  1.00 51.73 ? 381 THR D N   1 
ATOM   3745 C  CA  . THR D 2 80  G 9.755   65.794 -3.559  1.00 51.78 ? 381 THR D CA  1 
ATOM   3746 C  C   . THR D 2 80  G 9.487   64.779 -2.458  1.00 51.08 ? 381 THR D C   1 
ATOM   3747 O  O   . THR D 2 80  G 10.415  64.325 -1.793  1.00 51.64 ? 381 THR D O   1 
ATOM   3748 C  CB  . THR D 2 80  G 9.715   67.188 -2.926  1.00 52.76 ? 381 THR D CB  1 
ATOM   3749 O  OG1 . THR D 2 80  G 9.954   68.176 -3.933  1.00 53.43 ? 381 THR D OG1 1 
ATOM   3750 C  CG2 . THR D 2 80  G 10.777  67.304 -1.843  1.00 52.14 ? 381 THR D CG2 1 
ATOM   3751 N  N   . PHE D 2 81  H 8.225   64.420 -2.272  1.00 49.07 ? 381 PHE D N   1 
ATOM   3752 C  CA  . PHE D 2 81  H 7.856   63.495 -1.213  1.00 48.17 ? 381 PHE D CA  1 
ATOM   3753 C  C   . PHE D 2 81  H 7.268   62.168 -1.690  1.00 48.65 ? 381 PHE D C   1 
ATOM   3754 O  O   . PHE D 2 81  H 6.849   61.342 -0.875  1.00 48.27 ? 381 PHE D O   1 
ATOM   3755 C  CB  . PHE D 2 81  H 6.844   64.174 -0.316  1.00 46.92 ? 381 PHE D CB  1 
ATOM   3756 C  CG  . PHE D 2 81  H 7.210   65.569 0.046   1.00 47.52 ? 381 PHE D CG  1 
ATOM   3757 C  CD1 . PHE D 2 81  H 6.294   66.599 -0.092  1.00 47.46 ? 381 PHE D CD1 1 
ATOM   3758 C  CD2 . PHE D 2 81  H 8.463   65.859 0.548   1.00 48.34 ? 381 PHE D CD2 1 
ATOM   3759 C  CE1 . PHE D 2 81  H 6.625   67.899 0.267   1.00 46.12 ? 381 PHE D CE1 1 
ATOM   3760 C  CE2 . PHE D 2 81  H 8.801   67.162 0.910   1.00 48.09 ? 381 PHE D CE2 1 
ATOM   3761 C  CZ  . PHE D 2 81  H 7.880   68.179 0.768   1.00 46.18 ? 381 PHE D CZ  1 
ATOM   3762 N  N   . HIS D 2 82  I 7.247   61.962 -3.003  1.00 47.84 ? 381 HIS D N   1 
ATOM   3763 C  CA  . HIS D 2 82  I 6.667   60.763 -3.581  1.00 46.47 ? 381 HIS D CA  1 
ATOM   3764 C  C   . HIS D 2 82  I 7.581   59.551 -3.625  1.00 47.03 ? 381 HIS D C   1 
ATOM   3765 O  O   . HIS D 2 82  I 8.784   59.677 -3.834  1.00 47.16 ? 381 HIS D O   1 
ATOM   3766 C  CB  . HIS D 2 82  I 6.186   61.067 -4.999  1.00 45.38 ? 381 HIS D CB  1 
ATOM   3767 C  CG  . HIS D 2 82  I 5.586   59.889 -5.697  1.00 42.91 ? 381 HIS D CG  1 
ATOM   3768 N  ND1 . HIS D 2 82  I 4.342   59.392 -5.378  1.00 42.94 ? 381 HIS D ND1 1 
ATOM   3769 C  CD2 . HIS D 2 82  I 6.073   59.092 -6.676  1.00 42.61 ? 381 HIS D CD2 1 
ATOM   3770 C  CE1 . HIS D 2 82  I 4.088   58.337 -6.132  1.00 42.61 ? 381 HIS D CE1 1 
ATOM   3771 N  NE2 . HIS D 2 82  I 5.123   58.134 -6.927  1.00 42.60 ? 381 HIS D NE2 1 
ATOM   3772 N  N   . ALA D 2 83  ? 6.984   58.374 -3.435  1.00 46.56 ? 382 ALA D N   1 
ATOM   3773 C  CA  . ALA D 2 83  ? 7.691   57.102 -3.484  1.00 45.77 ? 382 ALA D CA  1 
ATOM   3774 C  C   . ALA D 2 83  ? 8.796   56.958 -2.446  1.00 45.36 ? 382 ALA D C   1 
ATOM   3775 O  O   . ALA D 2 83  ? 9.809   56.315 -2.702  1.00 45.17 ? 382 ALA D O   1 
ATOM   3776 C  CB  . ALA D 2 83  ? 8.260   56.895 -4.884  1.00 43.40 ? 382 ALA D CB  1 
ATOM   3777 N  N   . LYS D 2 84  ? 8.604   57.541 -1.272  1.00 45.64 ? 383 LYS D N   1 
ATOM   3778 C  CA  . LYS D 2 84  ? 9.619   57.449 -0.235  1.00 45.74 ? 383 LYS D CA  1 
ATOM   3779 C  C   . LYS D 2 84  ? 9.416   56.214 0.633   1.00 46.27 ? 383 LYS D C   1 
ATOM   3780 O  O   . LYS D 2 84  ? 8.301   55.728 0.789   1.00 46.96 ? 383 LYS D O   1 
ATOM   3781 C  CB  . LYS D 2 84  ? 9.600   58.705 0.618   1.00 45.08 ? 383 LYS D CB  1 
ATOM   3782 C  CG  . LYS D 2 84  ? 9.776   59.961 -0.194  1.00 45.64 ? 383 LYS D CG  1 
ATOM   3783 C  CD  . LYS D 2 84  ? 11.021  59.875 -1.045  1.00 45.13 ? 383 LYS D CD  1 
ATOM   3784 C  CE  . LYS D 2 84  ? 11.142  61.088 -1.942  1.00 45.50 ? 383 LYS D CE  1 
ATOM   3785 N  NZ  . LYS D 2 84  ? 12.362  60.995 -2.780  1.00 47.02 ? 383 LYS D NZ  1 
ATOM   3786 N  N   . LYS D 2 85  ? 10.508  55.709 1.190   1.00 46.28 ? 384 LYS D N   1 
ATOM   3787 C  CA  . LYS D 2 85  ? 10.460  54.527 2.032   1.00 46.21 ? 384 LYS D CA  1 
ATOM   3788 C  C   . LYS D 2 85  ? 10.789  54.863 3.479   1.00 45.81 ? 384 LYS D C   1 
ATOM   3789 O  O   . LYS D 2 85  ? 11.035  56.018 3.812   1.00 45.13 ? 384 LYS D O   1 
ATOM   3790 C  CB  . LYS D 2 85  ? 11.426  53.473 1.493   1.00 46.89 ? 384 LYS D CB  1 
ATOM   3791 C  CG  . LYS D 2 85  ? 11.110  53.056 0.066   1.00 48.31 ? 384 LYS D CG  1 
ATOM   3792 C  CD  . LYS D 2 85  ? 9.880   52.170 -0.022  1.00 48.03 ? 384 LYS D CD  1 
ATOM   3793 C  CE  . LYS D 2 85  ? 10.204  50.764 0.443   1.00 49.29 ? 384 LYS D CE  1 
ATOM   3794 N  NZ  . LYS D 2 85  ? 9.088   49.816 0.206   1.00 48.38 ? 384 LYS D NZ  1 
ATOM   3795 N  N   . GLN D 2 86  ? 10.788  53.845 4.332   1.00 45.57 ? 385 GLN D N   1 
ATOM   3796 C  CA  . GLN D 2 86  ? 11.060  54.031 5.752   1.00 44.13 ? 385 GLN D CA  1 
ATOM   3797 C  C   . GLN D 2 86  ? 11.498  52.739 6.447   1.00 43.75 ? 385 GLN D C   1 
ATOM   3798 O  O   . GLN D 2 86  ? 11.007  51.653 6.143   1.00 44.10 ? 385 GLN D O   1 
ATOM   3799 C  CB  . GLN D 2 86  ? 9.806   54.571 6.438   1.00 43.07 ? 385 GLN D CB  1 
ATOM   3800 C  CG  . GLN D 2 86  ? 9.980   54.859 7.904   1.00 43.12 ? 385 GLN D CG  1 
ATOM   3801 C  CD  . GLN D 2 86  ? 8.739   55.443 8.517   1.00 44.29 ? 385 GLN D CD  1 
ATOM   3802 O  OE1 . GLN D 2 86  ? 8.208   56.435 8.029   1.00 45.96 ? 385 GLN D OE1 1 
ATOM   3803 N  NE2 . GLN D 2 86  ? 8.267   54.838 9.596   1.00 43.91 ? 385 GLN D NE2 1 
ATOM   3804 N  N   . ILE D 2 87  ? 12.433  52.858 7.382   1.00 43.16 ? 386 ILE D N   1 
ATOM   3805 C  CA  . ILE D 2 87  ? 12.894  51.697 8.129   1.00 42.59 ? 386 ILE D CA  1 
ATOM   3806 C  C   . ILE D 2 87  ? 12.791  52.033 9.607   1.00 42.61 ? 386 ILE D C   1 
ATOM   3807 O  O   . ILE D 2 87  ? 13.332  53.032 10.054  1.00 42.97 ? 386 ILE D O   1 
ATOM   3808 C  CB  . ILE D 2 87  ? 14.358  51.323 7.777   1.00 42.47 ? 386 ILE D CB  1 
ATOM   3809 C  CG1 . ILE D 2 87  ? 14.765  50.059 8.529   1.00 43.14 ? 386 ILE D CG1 1 
ATOM   3810 C  CG2 . ILE D 2 87  ? 15.301  52.441 8.133   1.00 41.18 ? 386 ILE D CG2 1 
ATOM   3811 C  CD1 . ILE D 2 87  ? 14.065  48.811 8.048   1.00 45.26 ? 386 ILE D CD1 1 
ATOM   3812 N  N   . PRO D 2 88  ? 12.065  51.222 10.386  1.00 42.80 ? 387 PRO D N   1 
ATOM   3813 C  CA  . PRO D 2 88  ? 11.983  51.572 11.807  1.00 41.82 ? 387 PRO D CA  1 
ATOM   3814 C  C   . PRO D 2 88  ? 13.335  51.375 12.453  1.00 41.48 ? 387 PRO D C   1 
ATOM   3815 O  O   . PRO D 2 88  ? 14.264  50.885 11.815  1.00 41.36 ? 387 PRO D O   1 
ATOM   3816 C  CB  . PRO D 2 88  ? 10.931  50.617 12.337  1.00 41.19 ? 387 PRO D CB  1 
ATOM   3817 C  CG  . PRO D 2 88  ? 10.064  50.372 11.129  1.00 41.60 ? 387 PRO D CG  1 
ATOM   3818 C  CD  . PRO D 2 88  ? 11.086  50.179 10.045  1.00 42.14 ? 387 PRO D CD  1 
ATOM   3819 N  N   . CYS D 2 89  ? 13.455  51.769 13.715  1.00 41.66 ? 388 CYS D N   1 
ATOM   3820 C  CA  . CYS D 2 89  ? 14.731  51.631 14.413  1.00 40.88 ? 388 CYS D CA  1 
ATOM   3821 C  C   . CYS D 2 89  ? 14.609  51.077 15.828  1.00 39.30 ? 388 CYS D C   1 
ATOM   3822 O  O   . CYS D 2 89  ? 14.072  51.723 16.714  1.00 38.63 ? 388 CYS D O   1 
ATOM   3823 C  CB  . CYS D 2 89  ? 15.442  52.975 14.449  1.00 42.02 ? 388 CYS D CB  1 
ATOM   3824 S  SG  . CYS D 2 89  ? 17.061  52.889 15.173  1.00 42.21 ? 388 CYS D SG  1 
ATOM   3825 N  N   . ILE D 2 90  ? 15.120  49.868 16.021  1.00 37.89 ? 389 ILE D N   1 
ATOM   3826 C  CA  . ILE D 2 90  ? 15.083  49.206 17.318  1.00 37.30 ? 389 ILE D CA  1 
ATOM   3827 C  C   . ILE D 2 90  ? 16.329  49.545 18.123  1.00 37.35 ? 389 ILE D C   1 
ATOM   3828 O  O   . ILE D 2 90  ? 17.447  49.309 17.671  1.00 36.70 ? 389 ILE D O   1 
ATOM   3829 C  CB  . ILE D 2 90  ? 15.015  47.684 17.146  1.00 36.23 ? 389 ILE D CB  1 
ATOM   3830 C  CG1 . ILE D 2 90  ? 13.841  47.324 16.248  1.00 37.54 ? 389 ILE D CG1 1 
ATOM   3831 C  CG2 . ILE D 2 90  ? 14.851  47.020 18.480  1.00 35.01 ? 389 ILE D CG2 1 
ATOM   3832 C  CD1 . ILE D 2 90  ? 13.740  45.871 15.934  1.00 36.62 ? 389 ILE D CD1 1 
ATOM   3833 N  N   . VAL D 2 91  ? 16.130  50.118 19.305  1.00 36.57 ? 390 VAL D N   1 
ATOM   3834 C  CA  . VAL D 2 91  ? 17.243  50.472 20.183  1.00 38.56 ? 390 VAL D CA  1 
ATOM   3835 C  C   . VAL D 2 91  ? 17.076  49.737 21.508  1.00 39.39 ? 390 VAL D C   1 
ATOM   3836 O  O   . VAL D 2 91  ? 16.435  50.235 22.427  1.00 41.11 ? 390 VAL D O   1 
ATOM   3837 C  CB  . VAL D 2 91  ? 17.287  51.982 20.464  1.00 38.30 ? 390 VAL D CB  1 
ATOM   3838 C  CG1 . VAL D 2 91  ? 18.420  52.286 21.395  1.00 37.31 ? 390 VAL D CG1 1 
ATOM   3839 C  CG2 . VAL D 2 91  ? 17.462  52.747 19.175  1.00 38.49 ? 390 VAL D CG2 1 
ATOM   3840 N  N   . SER D 2 92  ? 17.652  48.548 21.604  1.00 40.02 ? 392 SER D N   1 
ATOM   3841 C  CA  . SER D 2 92  ? 17.521  47.753 22.814  1.00 40.66 ? 392 SER D CA  1 
ATOM   3842 C  C   . SER D 2 92  ? 18.697  47.802 23.761  1.00 41.65 ? 392 SER D C   1 
ATOM   3843 O  O   . SER D 2 92  ? 19.843  47.700 23.356  1.00 41.68 ? 392 SER D O   1 
ATOM   3844 C  CB  . SER D 2 92  ? 17.263  46.294 22.458  1.00 39.82 ? 392 SER D CB  1 
ATOM   3845 O  OG  . SER D 2 92  ? 17.317  45.482 23.611  1.00 38.30 ? 392 SER D OG  1 
ATOM   3846 N  N   . MET D 2 93  ? 18.393  47.944 25.040  1.00 42.77 ? 393 MET D N   1 
ATOM   3847 C  CA  . MET D 2 93  ? 19.407  47.961 26.067  1.00 44.10 ? 393 MET D CA  1 
ATOM   3848 C  C   . MET D 2 93  ? 18.921  46.984 27.110  1.00 44.96 ? 393 MET D C   1 
ATOM   3849 O  O   . MET D 2 93  ? 19.262  47.065 28.286  1.00 45.64 ? 393 MET D O   1 
ATOM   3850 C  CB  . MET D 2 93  ? 19.549  49.371 26.600  1.00 44.64 ? 393 MET D CB  1 
ATOM   3851 C  CG  . MET D 2 93  ? 19.934  50.279 25.463  1.00 47.82 ? 393 MET D CG  1 
ATOM   3852 S  SD  . MET D 2 93  ? 20.281  51.947 25.889  1.00 54.70 ? 393 MET D SD  1 
ATOM   3853 C  CE  . MET D 2 93  ? 19.453  52.812 24.593  1.00 51.32 ? 393 MET D CE  1 
ATOM   3854 N  N   . LEU D 2 94  ? 18.110  46.045 26.637  1.00 44.57 ? 394 LEU D N   1 
ATOM   3855 C  CA  . LEU D 2 94  ? 17.530  45.012 27.465  1.00 44.80 ? 394 LEU D CA  1 
ATOM   3856 C  C   . LEU D 2 94  ? 18.601  43.996 27.825  1.00 46.20 ? 394 LEU D C   1 
ATOM   3857 O  O   . LEU D 2 94  ? 19.579  43.834 27.092  1.00 47.30 ? 394 LEU D O   1 
ATOM   3858 C  CB  . LEU D 2 94  ? 16.396  44.319 26.709  1.00 43.43 ? 394 LEU D CB  1 
ATOM   3859 C  CG  . LEU D 2 94  ? 15.227  45.172 26.223  1.00 41.53 ? 394 LEU D CG  1 
ATOM   3860 C  CD1 . LEU D 2 94  ? 14.132  44.270 25.709  1.00 38.92 ? 394 LEU D CD1 1 
ATOM   3861 C  CD2 . LEU D 2 94  ? 14.713  46.034 27.353  1.00 41.11 ? 394 LEU D CD2 1 
ATOM   3862 N  N   . THR D 2 95  ? 18.413  43.307 28.949  1.00 46.05 ? 395 THR D N   1 
ATOM   3863 C  CA  . THR D 2 95  ? 19.373  42.308 29.388  1.00 46.61 ? 395 THR D CA  1 
ATOM   3864 C  C   . THR D 2 95  ? 18.838  40.893 29.249  1.00 47.00 ? 395 THR D C   1 
ATOM   3865 O  O   . THR D 2 95  ? 19.600  39.931 29.296  1.00 48.08 ? 395 THR D O   1 
ATOM   3866 C  CB  . THR D 2 95  ? 19.792  42.556 30.840  1.00 46.45 ? 395 THR D CB  1 
ATOM   3867 O  OG1 . THR D 2 95  ? 18.658  43.002 31.586  1.00 47.54 ? 395 THR D OG1 1 
ATOM   3868 C  CG2 . THR D 2 95  ? 20.882  43.607 30.912  1.00 46.47 ? 395 THR D CG2 1 
ATOM   3869 N  N   . LYS D 2 96  ? 17.531  40.764 29.066  1.00 48.01 ? 396 LYS D N   1 
ATOM   3870 C  CA  . LYS D 2 96  ? 16.900  39.454 28.910  1.00 49.08 ? 396 LYS D CA  1 
ATOM   3871 C  C   . LYS D 2 96  ? 15.907  39.463 27.747  1.00 49.91 ? 396 LYS D C   1 
ATOM   3872 O  O   . LYS D 2 96  ? 15.612  40.510 27.177  1.00 49.58 ? 396 LYS D O   1 
ATOM   3873 C  CB  . LYS D 2 96  ? 16.159  39.076 30.191  1.00 50.18 ? 396 LYS D CB  1 
ATOM   3874 C  CG  . LYS D 2 96  ? 17.042  38.875 31.415  1.00 51.19 ? 396 LYS D CG  1 
ATOM   3875 C  CD  . LYS D 2 96  ? 16.190  38.714 32.672  1.00 52.81 ? 396 LYS D CD  1 
ATOM   3876 C  CE  . LYS D 2 96  ? 17.063  38.616 33.919  1.00 54.63 ? 396 LYS D CE  1 
ATOM   3877 N  NZ  . LYS D 2 96  ? 16.373  39.162 35.129  1.00 54.62 ? 396 LYS D NZ  1 
ATOM   3878 N  N   . GLU D 2 97  ? 15.389  38.294 27.388  1.00 49.65 ? 397 GLU D N   1 
ATOM   3879 C  CA  . GLU D 2 97  ? 14.411  38.226 26.311  1.00 49.64 ? 397 GLU D CA  1 
ATOM   3880 C  C   . GLU D 2 97  ? 13.036  38.525 26.891  1.00 50.40 ? 397 GLU D C   1 
ATOM   3881 O  O   . GLU D 2 97  ? 12.764  38.230 28.054  1.00 50.63 ? 397 GLU D O   1 
ATOM   3882 C  CB  . GLU D 2 97  ? 14.438  36.853 25.668  1.00 49.23 ? 397 GLU D CB  1 
ATOM   3883 C  CG  . GLU D 2 97  ? 15.743  36.590 24.963  1.00 51.15 ? 397 GLU D CG  1 
ATOM   3884 C  CD  . GLU D 2 97  ? 15.914  35.139 24.572  1.00 53.45 ? 397 GLU D CD  1 
ATOM   3885 O  OE1 . GLU D 2 97  ? 17.040  34.770 24.161  1.00 54.46 ? 397 GLU D OE1 1 
ATOM   3886 O  OE2 . GLU D 2 97  ? 14.929  34.369 24.678  1.00 52.23 ? 397 GLU D OE2 1 
ATOM   3887 N  N   . LEU D 2 98  ? 12.173  39.124 26.084  1.00 51.42 ? 398 LEU D N   1 
ATOM   3888 C  CA  . LEU D 2 98  ? 10.840  39.482 26.542  1.00 52.03 ? 398 LEU D CA  1 
ATOM   3889 C  C   . LEU D 2 98  ? 9.731   38.771 25.782  1.00 53.10 ? 398 LEU D C   1 
ATOM   3890 O  O   . LEU D 2 98  ? 9.531   39.008 24.596  1.00 53.23 ? 398 LEU D O   1 
ATOM   3891 C  CB  . LEU D 2 98  ? 10.669  40.997 26.441  1.00 52.18 ? 398 LEU D CB  1 
ATOM   3892 C  CG  . LEU D 2 98  ? 9.290   41.649 26.503  1.00 53.97 ? 398 LEU D CG  1 
ATOM   3893 C  CD1 . LEU D 2 98  ? 8.417   40.936 27.498  1.00 54.58 ? 398 LEU D CD1 1 
ATOM   3894 C  CD2 . LEU D 2 98  ? 9.442   43.123 26.871  1.00 53.44 ? 398 LEU D CD2 1 
ATOM   3895 N  N   . TYR D 2 99  ? 9.028   37.875 26.468  1.00 53.97 ? 399 TYR D N   1 
ATOM   3896 C  CA  . TYR D 2 99  ? 7.916   37.163 25.856  1.00 54.74 ? 399 TYR D CA  1 
ATOM   3897 C  C   . TYR D 2 99  ? 6.663   37.670 26.524  1.00 56.67 ? 399 TYR D C   1 
ATOM   3898 O  O   . TYR D 2 99  ? 6.614   37.774 27.741  1.00 57.29 ? 399 TYR D O   1 
ATOM   3899 C  CB  . TYR D 2 99  ? 8.030   35.655 26.071  1.00 51.62 ? 399 TYR D CB  1 
ATOM   3900 C  CG  . TYR D 2 99  ? 9.259   35.048 25.454  1.00 48.84 ? 399 TYR D CG  1 
ATOM   3901 C  CD1 . TYR D 2 99  ? 10.464  35.003 26.151  1.00 48.14 ? 399 TYR D CD1 1 
ATOM   3902 C  CD2 . TYR D 2 99  ? 9.232   34.567 24.153  1.00 47.91 ? 399 TYR D CD2 1 
ATOM   3903 C  CE1 . TYR D 2 99  ? 11.616  34.493 25.562  1.00 46.66 ? 399 TYR D CE1 1 
ATOM   3904 C  CE2 . TYR D 2 99  ? 10.382  34.059 23.554  1.00 47.22 ? 399 TYR D CE2 1 
ATOM   3905 C  CZ  . TYR D 2 99  ? 11.568  34.029 24.265  1.00 46.81 ? 399 TYR D CZ  1 
ATOM   3906 O  OH  . TYR D 2 99  ? 12.711  33.564 23.660  1.00 47.79 ? 399 TYR D OH  1 
ATOM   3907 N  N   . PHE D 2 100 ? 5.649   38.007 25.743  1.00 59.97 ? 400 PHE D N   1 
ATOM   3908 C  CA  . PHE D 2 100 ? 4.428   38.500 26.357  1.00 63.96 ? 400 PHE D CA  1 
ATOM   3909 C  C   . PHE D 2 100 ? 3.543   37.360 26.850  1.00 66.21 ? 400 PHE D C   1 
ATOM   3910 O  O   . PHE D 2 100 ? 2.679   37.560 27.705  1.00 66.66 ? 400 PHE D O   1 
ATOM   3911 C  CB  . PHE D 2 100 ? 3.659   39.394 25.388  1.00 63.73 ? 400 PHE D CB  1 
ATOM   3912 C  CG  . PHE D 2 100 ? 4.276   40.750 25.209  1.00 63.98 ? 400 PHE D CG  1 
ATOM   3913 C  CD1 . PHE D 2 100 ? 4.977   41.067 24.049  1.00 62.88 ? 400 PHE D CD1 1 
ATOM   3914 C  CD2 . PHE D 2 100 ? 4.178   41.704 26.217  1.00 63.38 ? 400 PHE D CD2 1 
ATOM   3915 C  CE1 . PHE D 2 100 ? 5.571   42.310 23.895  1.00 62.07 ? 400 PHE D CE1 1 
ATOM   3916 C  CE2 . PHE D 2 100 ? 4.772   42.952 26.070  1.00 63.43 ? 400 PHE D CE2 1 
ATOM   3917 C  CZ  . PHE D 2 100 ? 5.471   43.253 24.904  1.00 62.69 ? 400 PHE D CZ  1 
ATOM   3918 N  N   . TYR D 2 101 ? 3.767   36.164 26.315  1.00 68.64 ? 401 TYR D N   1 
ATOM   3919 C  CA  . TYR D 2 101 ? 2.996   35.009 26.729  1.00 71.38 ? 401 TYR D CA  1 
ATOM   3920 C  C   . TYR D 2 101 ? 3.679   34.366 27.941  1.00 72.30 ? 401 TYR D C   1 
ATOM   3921 O  O   . TYR D 2 101 ? 4.472   35.083 28.604  1.00 72.23 ? 401 TYR D O   1 
ATOM   3922 C  CB  . TYR D 2 101 ? 2.877   34.020 25.573  1.00 73.24 ? 401 TYR D CB  1 
ATOM   3923 C  CG  . TYR D 2 101 ? 4.184   33.413 25.087  1.00 76.77 ? 401 TYR D CG  1 
ATOM   3924 C  CD1 . TYR D 2 101 ? 4.772   32.328 25.760  1.00 78.02 ? 401 TYR D CD1 1 
ATOM   3925 C  CD2 . TYR D 2 101 ? 4.785   33.852 23.893  1.00 77.84 ? 401 TYR D CD2 1 
ATOM   3926 C  CE1 . TYR D 2 101 ? 5.919   31.681 25.246  1.00 79.34 ? 401 TYR D CE1 1 
ATOM   3927 C  CE2 . TYR D 2 101 ? 5.938   33.212 23.367  1.00 78.71 ? 401 TYR D CE2 1 
ATOM   3928 C  CZ  . TYR D 2 101 ? 6.493   32.125 24.049  1.00 79.19 ? 401 TYR D CZ  1 
ATOM   3929 O  OH  . TYR D 2 101 ? 7.599   31.465 23.538  1.00 78.06 ? 401 TYR D OH  1 
ATOM   3930 N  N   . PHE E 3 8   ? 45.951  72.536 35.454  1.00 71.12 ? 127 PHE E N   1 
ATOM   3931 C  CA  . PHE E 3 8   ? 44.593  72.609 34.813  1.00 71.99 ? 127 PHE E CA  1 
ATOM   3932 C  C   . PHE E 3 8   ? 43.732  73.686 35.471  1.00 72.31 ? 127 PHE E C   1 
ATOM   3933 O  O   . PHE E 3 8   ? 43.439  74.717 34.854  1.00 72.97 ? 127 PHE E O   1 
ATOM   3934 C  CB  . PHE E 3 8   ? 43.850  71.264 34.922  1.00 70.55 ? 127 PHE E CB  1 
ATOM   3935 C  CG  . PHE E 3 8   ? 42.672  71.135 33.974  1.00 69.00 ? 127 PHE E CG  1 
ATOM   3936 C  CD1 . PHE E 3 8   ? 42.844  70.586 32.693  1.00 68.06 ? 127 PHE E CD1 1 
ATOM   3937 C  CD2 . PHE E 3 8   ? 41.397  71.564 34.356  1.00 68.02 ? 127 PHE E CD2 1 
ATOM   3938 C  CE1 . PHE E 3 8   ? 41.759  70.464 31.801  1.00 67.61 ? 127 PHE E CE1 1 
ATOM   3939 C  CE2 . PHE E 3 8   ? 40.296  71.450 33.475  1.00 68.14 ? 127 PHE E CE2 1 
ATOM   3940 C  CZ  . PHE E 3 8   ? 40.478  70.896 32.191  1.00 67.75 ? 127 PHE E CZ  1 
ATOM   3941 N  N   . ALA E 3 9   ? 43.320  73.430 36.716  1.00 72.51 ? 128 ALA E N   1 
ATOM   3942 C  CA  . ALA E 3 9   ? 42.485  74.367 37.478  1.00 72.09 ? 128 ALA E CA  1 
ATOM   3943 C  C   . ALA E 3 9   ? 42.981  75.797 37.355  1.00 71.79 ? 128 ALA E C   1 
ATOM   3944 O  O   . ALA E 3 9   ? 42.200  76.735 37.508  1.00 72.12 ? 128 ALA E O   1 
ATOM   3945 C  CB  . ALA E 3 9   ? 42.437  73.966 38.949  1.00 72.37 ? 128 ALA E CB  1 
ATOM   3946 N  N   . LEU E 3 10  ? 44.279  75.958 37.088  1.00 71.67 ? 129 LEU E N   1 
ATOM   3947 C  CA  . LEU E 3 10  ? 44.870  77.287 36.918  1.00 70.96 ? 129 LEU E CA  1 
ATOM   3948 C  C   . LEU E 3 10  ? 44.711  77.736 35.464  1.00 70.01 ? 129 LEU E C   1 
ATOM   3949 O  O   . LEU E 3 10  ? 44.281  78.859 35.193  1.00 69.59 ? 129 LEU E O   1 
ATOM   3950 C  CB  . LEU E 3 10  ? 46.366  77.276 37.293  1.00 71.22 ? 129 LEU E CB  1 
ATOM   3951 C  CG  . LEU E 3 10  ? 46.775  76.779 38.694  1.00 71.53 ? 129 LEU E CG  1 
ATOM   3952 C  CD1 . LEU E 3 10  ? 48.274  77.033 38.911  1.00 70.85 ? 129 LEU E CD1 1 
ATOM   3953 C  CD2 . LEU E 3 10  ? 45.955  77.495 39.771  1.00 70.61 ? 129 LEU E CD2 1 
ATOM   3954 N  N   . ASP E 3 11  ? 45.049  76.846 34.534  1.00 69.79 ? 130 ASP E N   1 
ATOM   3955 C  CA  . ASP E 3 11  ? 44.954  77.141 33.099  1.00 69.96 ? 130 ASP E CA  1 
ATOM   3956 C  C   . ASP E 3 11  ? 43.505  77.311 32.615  1.00 69.07 ? 130 ASP E C   1 
ATOM   3957 O  O   . ASP E 3 11  ? 43.142  78.345 32.049  1.00 69.15 ? 130 ASP E O   1 
ATOM   3958 C  CB  . ASP E 3 11  ? 45.626  76.032 32.278  1.00 70.92 ? 130 ASP E CB  1 
ATOM   3959 C  CG  . ASP E 3 11  ? 46.929  75.541 32.901  1.00 72.56 ? 130 ASP E CG  1 
ATOM   3960 O  OD1 . ASP E 3 11  ? 46.848  74.854 33.960  1.00 73.51 ? 130 ASP E OD1 1 
ATOM   3961 O  OD2 . ASP E 3 11  ? 48.016  75.842 32.330  1.00 71.11 ? 130 ASP E OD2 1 
ATOM   3962 N  N   . ARG E 3 12  ? 42.687  76.288 32.824  1.00 68.17 ? 131 ARG E N   1 
ATOM   3963 C  CA  . ARG E 3 12  ? 41.289  76.327 32.413  1.00 67.83 ? 131 ARG E CA  1 
ATOM   3964 C  C   . ARG E 3 12  ? 40.397  76.169 33.645  1.00 67.71 ? 131 ARG E C   1 
ATOM   3965 O  O   . ARG E 3 12  ? 39.760  75.126 33.865  1.00 66.95 ? 131 ARG E O   1 
ATOM   3966 C  CB  . ARG E 3 12  ? 41.016  75.226 31.382  1.00 67.03 ? 131 ARG E CB  1 
ATOM   3967 C  CG  . ARG E 3 12  ? 41.794  73.963 31.627  1.00 65.78 ? 131 ARG E CG  1 
ATOM   3968 C  CD  . ARG E 3 12  ? 42.412  73.460 30.345  1.00 64.11 ? 131 ARG E CD  1 
ATOM   3969 N  NE  . ARG E 3 12  ? 41.429  72.864 29.444  1.00 63.46 ? 131 ARG E NE  1 
ATOM   3970 C  CZ  . ARG E 3 12  ? 41.636  71.725 28.789  1.00 62.48 ? 131 ARG E CZ  1 
ATOM   3971 N  NH1 . ARG E 3 12  ? 40.709  71.233 27.979  1.00 61.63 ? 131 ARG E NH1 1 
ATOM   3972 N  NH2 . ARG E 3 12  ? 42.778  71.068 28.960  1.00 62.91 ? 131 ARG E NH2 1 
ATOM   3973 N  N   . PRO E 3 13  ? 40.344  77.227 34.466  1.00 67.66 ? 132 PRO E N   1 
ATOM   3974 C  CA  . PRO E 3 13  ? 39.564  77.301 35.704  1.00 68.11 ? 132 PRO E CA  1 
ATOM   3975 C  C   . PRO E 3 13  ? 38.094  76.927 35.528  1.00 68.60 ? 132 PRO E C   1 
ATOM   3976 O  O   . PRO E 3 13  ? 37.537  76.161 36.322  1.00 69.39 ? 132 PRO E O   1 
ATOM   3977 C  CB  . PRO E 3 13  ? 39.741  78.753 36.130  1.00 67.95 ? 132 PRO E CB  1 
ATOM   3978 C  CG  . PRO E 3 13  ? 41.083  79.116 35.551  1.00 67.88 ? 132 PRO E CG  1 
ATOM   3979 C  CD  . PRO E 3 13  ? 40.998  78.516 34.185  1.00 66.95 ? 132 PRO E CD  1 
ATOM   3980 N  N   . SER E 3 14  ? 37.474  77.452 34.477  1.00 68.49 ? 133 SER E N   1 
ATOM   3981 C  CA  . SER E 3 14  ? 36.057  77.186 34.223  1.00 68.67 ? 133 SER E CA  1 
ATOM   3982 C  C   . SER E 3 14  ? 35.693  75.812 33.634  1.00 68.68 ? 133 SER E C   1 
ATOM   3983 O  O   . SER E 3 14  ? 34.518  75.418 33.651  1.00 68.37 ? 133 SER E O   1 
ATOM   3984 C  CB  . SER E 3 14  ? 35.475  78.287 33.331  1.00 67.77 ? 133 SER E CB  1 
ATOM   3985 O  OG  . SER E 3 14  ? 35.328  79.504 34.038  1.00 66.91 ? 133 SER E OG  1 
ATOM   3986 N  N   . GLU E 3 15  ? 36.674  75.081 33.116  1.00 68.86 ? 134 GLU E N   1 
ATOM   3987 C  CA  . GLU E 3 15  ? 36.373  73.770 32.534  1.00 69.60 ? 134 GLU E CA  1 
ATOM   3988 C  C   . GLU E 3 15  ? 36.456  72.705 33.623  1.00 69.03 ? 134 GLU E C   1 
ATOM   3989 O  O   . GLU E 3 15  ? 36.846  73.025 34.757  1.00 69.91 ? 134 GLU E O   1 
ATOM   3990 C  CB  . GLU E 3 15  ? 37.357  73.445 31.401  1.00 70.63 ? 134 GLU E CB  1 
ATOM   3991 C  CG  . GLU E 3 15  ? 37.525  74.581 30.398  1.00 71.50 ? 134 GLU E CG  1 
ATOM   3992 C  CD  . GLU E 3 15  ? 38.208  74.148 29.108  1.00 71.88 ? 134 GLU E CD  1 
ATOM   3993 O  OE1 . GLU E 3 15  ? 38.660  75.039 28.360  1.00 73.27 ? 134 GLU E OE1 1 
ATOM   3994 O  OE2 . GLU E 3 15  ? 38.280  72.930 28.827  1.00 71.37 ? 134 GLU E OE2 1 
ATOM   3995 N  N   . THR E 3 16  ? 36.092  71.460 33.280  1.00 67.04 ? 135 THR E N   1 
ATOM   3996 C  CA  . THR E 3 16  ? 36.121  70.341 34.230  1.00 64.82 ? 135 THR E CA  1 
ATOM   3997 C  C   . THR E 3 16  ? 37.118  69.250 33.874  1.00 63.82 ? 135 THR E C   1 
ATOM   3998 O  O   . THR E 3 16  ? 36.953  68.507 32.897  1.00 63.75 ? 135 THR E O   1 
ATOM   3999 C  CB  . THR E 3 16  ? 34.771  69.649 34.353  1.00 64.53 ? 135 THR E CB  1 
ATOM   4000 O  OG1 . THR E 3 16  ? 33.752  70.630 34.559  1.00 65.46 ? 135 THR E OG1 1 
ATOM   4001 C  CG2 . THR E 3 16  ? 34.788  68.682 35.524  1.00 63.16 ? 135 THR E CG2 1 
ATOM   4002 N  N   . HIS E 3 17  ? 38.135  69.150 34.713  1.00 61.80 ? 136 HIS E N   1 
ATOM   4003 C  CA  . HIS E 3 17  ? 39.203  68.182 34.577  1.00 59.93 ? 136 HIS E CA  1 
ATOM   4004 C  C   . HIS E 3 17  ? 38.654  66.776 34.295  1.00 58.90 ? 136 HIS E C   1 
ATOM   4005 O  O   . HIS E 3 17  ? 39.102  66.093 33.376  1.00 59.05 ? 136 HIS E O   1 
ATOM   4006 C  CB  . HIS E 3 17  ? 40.015  68.207 35.875  1.00 59.78 ? 136 HIS E CB  1 
ATOM   4007 C  CG  . HIS E 3 17  ? 41.284  67.426 35.821  1.00 59.72 ? 136 HIS E CG  1 
ATOM   4008 N  ND1 . HIS E 3 17  ? 42.374  67.832 35.086  1.00 59.66 ? 136 HIS E ND1 1 
ATOM   4009 C  CD2 . HIS E 3 17  ? 41.640  66.265 36.420  1.00 60.01 ? 136 HIS E CD2 1 
ATOM   4010 C  CE1 . HIS E 3 17  ? 43.351  66.956 35.236  1.00 60.56 ? 136 HIS E CE1 1 
ATOM   4011 N  NE2 . HIS E 3 17  ? 42.932  65.996 36.041  1.00 60.61 ? 136 HIS E NE2 1 
ATOM   4012 N  N   . ALA E 3 18  ? 37.678  66.349 35.082  1.00 57.77 ? 137 ALA E N   1 
ATOM   4013 C  CA  . ALA E 3 18  ? 37.092  65.019 34.910  1.00 56.60 ? 137 ALA E CA  1 
ATOM   4014 C  C   . ALA E 3 18  ? 36.650  64.788 33.475  1.00 55.11 ? 137 ALA E C   1 
ATOM   4015 O  O   . ALA E 3 18  ? 36.992  63.772 32.867  1.00 54.81 ? 137 ALA E O   1 
ATOM   4016 C  CB  . ALA E 3 18  ? 35.903  64.844 35.851  1.00 56.60 ? 137 ALA E CB  1 
ATOM   4017 N  N   . ASP E 3 19  ? 35.881  65.737 32.945  1.00 53.48 ? 138 ASP E N   1 
ATOM   4018 C  CA  . ASP E 3 19  ? 35.385  65.643 31.580  1.00 51.91 ? 138 ASP E CA  1 
ATOM   4019 C  C   . ASP E 3 19  ? 36.553  65.601 30.628  1.00 49.31 ? 138 ASP E C   1 
ATOM   4020 O  O   . ASP E 3 19  ? 36.490  64.944 29.597  1.00 47.90 ? 138 ASP E O   1 
ATOM   4021 C  CB  . ASP E 3 19  ? 34.492  66.837 31.242  1.00 54.89 ? 138 ASP E CB  1 
ATOM   4022 C  CG  . ASP E 3 19  ? 33.042  66.643 31.680  1.00 56.68 ? 138 ASP E CG  1 
ATOM   4023 O  OD1 . ASP E 3 19  ? 32.282  67.635 31.591  1.00 57.48 ? 138 ASP E OD1 1 
ATOM   4024 O  OD2 . ASP E 3 19  ? 32.658  65.518 32.096  1.00 56.30 ? 138 ASP E OD2 1 
ATOM   4025 N  N   . TYR E 3 20  ? 37.619  66.316 30.976  1.00 47.74 ? 139 TYR E N   1 
ATOM   4026 C  CA  . TYR E 3 20  ? 38.824  66.336 30.149  1.00 45.88 ? 139 TYR E CA  1 
ATOM   4027 C  C   . TYR E 3 20  ? 39.381  64.921 30.048  1.00 45.55 ? 139 TYR E C   1 
ATOM   4028 O  O   . TYR E 3 20  ? 39.486  64.363 28.963  1.00 44.82 ? 139 TYR E O   1 
ATOM   4029 C  CB  . TYR E 3 20  ? 39.903  67.240 30.760  1.00 44.89 ? 139 TYR E CB  1 
ATOM   4030 C  CG  . TYR E 3 20  ? 41.254  67.083 30.091  1.00 43.92 ? 139 TYR E CG  1 
ATOM   4031 C  CD1 . TYR E 3 20  ? 41.451  67.495 28.774  1.00 45.02 ? 139 TYR E CD1 1 
ATOM   4032 C  CD2 . TYR E 3 20  ? 42.319  66.472 30.752  1.00 44.01 ? 139 TYR E CD2 1 
ATOM   4033 C  CE1 . TYR E 3 20  ? 42.667  67.300 28.132  1.00 44.22 ? 139 TYR E CE1 1 
ATOM   4034 C  CE2 . TYR E 3 20  ? 43.543  66.269 30.118  1.00 43.36 ? 139 TYR E CE2 1 
ATOM   4035 C  CZ  . TYR E 3 20  ? 43.706  66.684 28.808  1.00 45.08 ? 139 TYR E CZ  1 
ATOM   4036 O  OH  . TYR E 3 20  ? 44.892  66.459 28.151  1.00 46.39 ? 139 TYR E OH  1 
ATOM   4037 N  N   . LEU E 3 21  ? 39.731  64.357 31.200  1.00 44.38 ? 140 LEU E N   1 
ATOM   4038 C  CA  . LEU E 3 21  ? 40.285  63.018 31.280  1.00 44.46 ? 140 LEU E CA  1 
ATOM   4039 C  C   . LEU E 3 21  ? 39.477  61.965 30.531  1.00 44.93 ? 140 LEU E C   1 
ATOM   4040 O  O   . LEU E 3 21  ? 40.044  61.030 29.973  1.00 44.64 ? 140 LEU E O   1 
ATOM   4041 C  CB  . LEU E 3 21  ? 40.434  62.618 32.743  1.00 44.43 ? 140 LEU E CB  1 
ATOM   4042 C  CG  . LEU E 3 21  ? 41.579  63.314 33.473  1.00 44.68 ? 140 LEU E CG  1 
ATOM   4043 C  CD1 . LEU E 3 21  ? 41.591  62.895 34.928  1.00 42.63 ? 140 LEU E CD1 1 
ATOM   4044 C  CD2 . LEU E 3 21  ? 42.891  62.956 32.793  1.00 44.55 ? 140 LEU E CD2 1 
ATOM   4045 N  N   . LEU E 3 22  ? 38.158  62.112 30.522  1.00 44.99 ? 141 LEU E N   1 
ATOM   4046 C  CA  . LEU E 3 22  ? 37.296  61.171 29.827  1.00 45.01 ? 141 LEU E CA  1 
ATOM   4047 C  C   . LEU E 3 22  ? 37.329  61.377 28.315  1.00 45.78 ? 141 LEU E C   1 
ATOM   4048 O  O   . LEU E 3 22  ? 37.584  60.437 27.567  1.00 45.76 ? 141 LEU E O   1 
ATOM   4049 C  CB  . LEU E 3 22  ? 35.865  61.291 30.356  1.00 44.64 ? 141 LEU E CB  1 
ATOM   4050 C  CG  . LEU E 3 22  ? 35.635  60.656 31.733  1.00 44.11 ? 141 LEU E CG  1 
ATOM   4051 C  CD1 . LEU E 3 22  ? 34.354  61.183 32.322  1.00 45.82 ? 141 LEU E CD1 1 
ATOM   4052 C  CD2 . LEU E 3 22  ? 35.588  59.143 31.618  1.00 40.88 ? 141 LEU E CD2 1 
ATOM   4053 N  N   . ARG E 3 23  ? 37.077  62.604 27.865  1.00 47.23 ? 142 ARG E N   1 
ATOM   4054 C  CA  . ARG E 3 23  ? 37.094  62.922 26.436  1.00 48.60 ? 142 ARG E CA  1 
ATOM   4055 C  C   . ARG E 3 23  ? 38.401  62.479 25.788  1.00 49.84 ? 142 ARG E C   1 
ATOM   4056 O  O   . ARG E 3 23  ? 38.423  62.032 24.647  1.00 50.35 ? 142 ARG E O   1 
ATOM   4057 C  CB  . ARG E 3 23  ? 36.942  64.426 26.221  1.00 49.70 ? 142 ARG E CB  1 
ATOM   4058 C  CG  . ARG E 3 23  ? 36.966  64.831 24.763  1.00 50.43 ? 142 ARG E CG  1 
ATOM   4059 C  CD  . ARG E 3 23  ? 37.099  66.329 24.591  1.00 52.91 ? 142 ARG E CD  1 
ATOM   4060 N  NE  . ARG E 3 23  ? 38.484  66.767 24.462  1.00 54.96 ? 142 ARG E NE  1 
ATOM   4061 C  CZ  . ARG E 3 23  ? 39.068  67.632 25.291  1.00 58.85 ? 142 ARG E CZ  1 
ATOM   4062 N  NH1 . ARG E 3 23  ? 38.383  68.148 26.319  1.00 60.40 ? 142 ARG E NH1 1 
ATOM   4063 N  NH2 . ARG E 3 23  ? 40.330  68.004 25.089  1.00 59.58 ? 142 ARG E NH2 1 
ATOM   4064 N  N   . THR E 3 24  ? 39.494  62.621 26.529  1.00 51.12 ? 143 THR E N   1 
ATOM   4065 C  CA  . THR E 3 24  ? 40.809  62.254 26.044  1.00 51.91 ? 143 THR E CA  1 
ATOM   4066 C  C   . THR E 3 24  ? 41.084  60.771 26.250  1.00 52.25 ? 143 THR E C   1 
ATOM   4067 O  O   . THR E 3 24  ? 42.171  60.285 25.943  1.00 53.64 ? 143 THR E O   1 
ATOM   4068 C  CB  . THR E 3 24  ? 41.890  63.063 26.757  1.00 53.12 ? 143 THR E CB  1 
ATOM   4069 O  OG1 . THR E 3 24  ? 43.167  62.536 26.413  1.00 57.82 ? 143 THR E OG1 1 
ATOM   4070 C  CG2 . THR E 3 24  ? 41.738  62.973 28.255  1.00 53.86 ? 143 THR E CG2 1 
ATOM   4071 N  N   . GLY E 3 25  ? 40.098  60.055 26.779  1.00 51.19 ? 144 GLY E N   1 
ATOM   4072 C  CA  . GLY E 3 25  ? 40.250  58.627 27.000  1.00 51.17 ? 144 GLY E CA  1 
ATOM   4073 C  C   . GLY E 3 25  ? 41.352  58.162 27.940  1.00 51.29 ? 144 GLY E C   1 
ATOM   4074 O  O   . GLY E 3 25  ? 41.955  57.113 27.721  1.00 51.90 ? 144 GLY E O   1 
ATOM   4075 N  N   . GLN E 3 26  ? 41.617  58.923 28.993  1.00 50.62 ? 145 GLN E N   1 
ATOM   4076 C  CA  . GLN E 3 26  ? 42.650  58.546 29.946  1.00 49.34 ? 145 GLN E CA  1 
ATOM   4077 C  C   . GLN E 3 26  ? 42.064  57.732 31.088  1.00 48.04 ? 145 GLN E C   1 
ATOM   4078 O  O   . GLN E 3 26  ? 42.788  57.077 31.824  1.00 48.17 ? 145 GLN E O   1 
ATOM   4079 C  CB  . GLN E 3 26  ? 43.334  59.792 30.494  1.00 50.43 ? 145 GLN E CB  1 
ATOM   4080 C  CG  . GLN E 3 26  ? 44.028  60.588 29.417  1.00 52.65 ? 145 GLN E CG  1 
ATOM   4081 C  CD  . GLN E 3 26  ? 44.698  61.845 29.938  1.00 53.88 ? 145 GLN E CD  1 
ATOM   4082 O  OE1 . GLN E 3 26  ? 45.389  61.818 30.959  1.00 53.87 ? 145 GLN E OE1 1 
ATOM   4083 N  NE2 . GLN E 3 26  ? 44.508  62.954 29.224  1.00 53.45 ? 145 GLN E NE2 1 
ATOM   4084 N  N   . VAL E 3 27  ? 40.748  57.774 31.236  1.00 46.69 ? 146 VAL E N   1 
ATOM   4085 C  CA  . VAL E 3 27  ? 40.098  57.024 32.297  1.00 46.42 ? 146 VAL E CA  1 
ATOM   4086 C  C   . VAL E 3 27  ? 40.071  55.558 31.910  1.00 44.92 ? 146 VAL E C   1 
ATOM   4087 O  O   . VAL E 3 27  ? 39.671  55.201 30.815  1.00 43.66 ? 146 VAL E O   1 
ATOM   4088 C  CB  . VAL E 3 27  ? 38.663  57.532 32.546  1.00 47.67 ? 146 VAL E CB  1 
ATOM   4089 C  CG1 . VAL E 3 27  ? 37.979  56.666 33.586  1.00 46.64 ? 146 VAL E CG1 1 
ATOM   4090 C  CG2 . VAL E 3 27  ? 38.706  58.991 33.006  1.00 47.30 ? 146 VAL E CG2 1 
ATOM   4091 N  N   . VAL E 3 28  ? 40.492  54.711 32.832  1.00 44.40 ? 147 VAL E N   1 
ATOM   4092 C  CA  . VAL E 3 28  ? 40.563  53.290 32.573  1.00 44.30 ? 147 VAL E CA  1 
ATOM   4093 C  C   . VAL E 3 28  ? 40.264  52.481 33.825  1.00 44.68 ? 147 VAL E C   1 
ATOM   4094 O  O   . VAL E 3 28  ? 40.579  52.913 34.930  1.00 45.13 ? 147 VAL E O   1 
ATOM   4095 C  CB  . VAL E 3 28  ? 41.968  52.954 32.046  1.00 43.42 ? 147 VAL E CB  1 
ATOM   4096 C  CG1 . VAL E 3 28  ? 42.521  51.710 32.706  1.00 43.92 ? 147 VAL E CG1 1 
ATOM   4097 C  CG2 . VAL E 3 28  ? 41.914  52.791 30.559  1.00 43.08 ? 147 VAL E CG2 1 
ATOM   4098 N  N   . ASP E 3 29  ? 39.651  51.314 33.641  1.00 44.32 ? 148 ASP E N   1 
ATOM   4099 C  CA  . ASP E 3 29  ? 39.315  50.414 34.742  1.00 44.54 ? 148 ASP E CA  1 
ATOM   4100 C  C   . ASP E 3 29  ? 40.543  49.596 35.100  1.00 44.26 ? 148 ASP E C   1 
ATOM   4101 O  O   . ASP E 3 29  ? 41.008  48.797 34.298  1.00 45.77 ? 148 ASP E O   1 
ATOM   4102 C  CB  . ASP E 3 29  ? 38.180  49.476 34.329  1.00 45.03 ? 148 ASP E CB  1 
ATOM   4103 C  CG  . ASP E 3 29  ? 37.987  48.327 35.303  1.00 45.37 ? 148 ASP E CG  1 
ATOM   4104 O  OD1 . ASP E 3 29  ? 38.501  48.418 36.439  1.00 48.20 ? 148 ASP E OD1 1 
ATOM   4105 O  OD2 . ASP E 3 29  ? 37.311  47.343 34.936  1.00 42.05 ? 148 ASP E OD2 1 
ATOM   4106 N  N   . ILE E 3 30  ? 41.063  49.772 36.306  1.00 43.86 ? 149 ILE E N   1 
ATOM   4107 C  CA  . ILE E 3 30  ? 42.261  49.045 36.695  1.00 43.71 ? 149 ILE E CA  1 
ATOM   4108 C  C   . ILE E 3 30  ? 42.020  47.748 37.463  1.00 45.18 ? 149 ILE E C   1 
ATOM   4109 O  O   . ILE E 3 30  ? 42.952  47.171 38.022  1.00 45.02 ? 149 ILE E O   1 
ATOM   4110 C  CB  . ILE E 3 30  ? 43.211  49.952 37.497  1.00 41.74 ? 149 ILE E CB  1 
ATOM   4111 C  CG1 . ILE E 3 30  ? 42.542  50.429 38.777  1.00 40.29 ? 149 ILE E CG1 1 
ATOM   4112 C  CG2 . ILE E 3 30  ? 43.588  51.141 36.662  1.00 39.77 ? 149 ILE E CG2 1 
ATOM   4113 C  CD1 . ILE E 3 30  ? 43.444  51.241 39.644  1.00 39.64 ? 149 ILE E CD1 1 
ATOM   4114 N  N   . SER E 3 31  ? 40.773  47.284 37.477  1.00 45.90 ? 150 SER E N   1 
ATOM   4115 C  CA  . SER E 3 31  ? 40.451  46.042 38.163  1.00 47.64 ? 150 SER E CA  1 
ATOM   4116 C  C   . SER E 3 31  ? 41.486  44.983 37.817  1.00 48.77 ? 150 SER E C   1 
ATOM   4117 O  O   . SER E 3 31  ? 41.877  44.180 38.663  1.00 49.30 ? 150 SER E O   1 
ATOM   4118 C  CB  . SER E 3 31  ? 39.064  45.524 37.753  1.00 46.74 ? 150 SER E CB  1 
ATOM   4119 O  OG  . SER E 3 31  ? 38.016  46.123 38.505  1.00 47.25 ? 150 SER E OG  1 
ATOM   4120 N  N   . ASP E 3 32  ? 41.944  44.991 36.574  1.00 49.39 ? 151 ASP E N   1 
ATOM   4121 C  CA  . ASP E 3 32  ? 42.900  43.994 36.151  1.00 50.94 ? 151 ASP E CA  1 
ATOM   4122 C  C   . ASP E 3 32  ? 44.245  44.062 36.852  1.00 51.68 ? 151 ASP E C   1 
ATOM   4123 O  O   . ASP E 3 32  ? 45.111  43.256 36.568  1.00 52.71 ? 151 ASP E O   1 
ATOM   4124 C  CB  . ASP E 3 32  ? 43.083  44.037 34.627  1.00 53.60 ? 151 ASP E CB  1 
ATOM   4125 C  CG  . ASP E 3 32  ? 43.688  45.334 34.138  1.00 57.16 ? 151 ASP E CG  1 
ATOM   4126 O  OD1 . ASP E 3 32  ? 43.832  45.486 32.902  1.00 57.23 ? 151 ASP E OD1 1 
ATOM   4127 O  OD2 . ASP E 3 32  ? 44.020  46.195 34.986  1.00 59.84 ? 151 ASP E OD2 1 
ATOM   4128 N  N   . THR E 3 33  ? 44.434  45.013 37.762  1.00 51.71 ? 152 THR E N   1 
ATOM   4129 C  CA  . THR E 3 33  ? 45.699  45.109 38.491  1.00 51.80 ? 152 THR E CA  1 
ATOM   4130 C  C   . THR E 3 33  ? 45.430  45.052 39.988  1.00 53.17 ? 152 THR E C   1 
ATOM   4131 O  O   . THR E 3 33  ? 46.352  45.183 40.801  1.00 54.24 ? 152 THR E O   1 
ATOM   4132 C  CB  . THR E 3 33  ? 46.469  46.422 38.202  1.00 51.67 ? 152 THR E CB  1 
ATOM   4133 O  OG1 . THR E 3 33  ? 45.752  47.540 38.743  1.00 53.12 ? 152 THR E OG1 1 
ATOM   4134 C  CG2 . THR E 3 33  ? 46.661  46.617 36.713  1.00 52.74 ? 152 THR E CG2 1 
ATOM   4135 N  N   . ILE E 3 34  ? 44.163  44.872 40.354  1.00 52.38 ? 153 ILE E N   1 
ATOM   4136 C  CA  . ILE E 3 34  ? 43.795  44.794 41.754  1.00 51.08 ? 153 ILE E CA  1 
ATOM   4137 C  C   . ILE E 3 34  ? 43.383  43.373 42.099  1.00 50.76 ? 153 ILE E C   1 
ATOM   4138 O  O   . ILE E 3 34  ? 43.621  42.901 43.206  1.00 51.65 ? 153 ILE E O   1 
ATOM   4139 C  CB  . ILE E 3 34  ? 42.652  45.775 42.081  1.00 51.54 ? 153 ILE E CB  1 
ATOM   4140 C  CG1 . ILE E 3 34  ? 43.227  47.128 42.515  1.00 52.21 ? 153 ILE E CG1 1 
ATOM   4141 C  CG2 . ILE E 3 34  ? 41.813  45.239 43.221  1.00 52.48 ? 153 ILE E CG2 1 
ATOM   4142 C  CD1 . ILE E 3 34  ? 44.262  47.706 41.582  1.00 52.36 ? 153 ILE E CD1 1 
ATOM   4143 N  N   . TYR E 3 35  ? 42.781  42.684 41.138  1.00 49.82 ? 154 TYR E N   1 
ATOM   4144 C  CA  . TYR E 3 35  ? 42.335  41.313 41.353  1.00 48.39 ? 154 TYR E CA  1 
ATOM   4145 C  C   . TYR E 3 35  ? 43.083  40.362 40.430  1.00 48.56 ? 154 TYR E C   1 
ATOM   4146 O  O   . TYR E 3 35  ? 43.473  40.736 39.330  1.00 49.64 ? 154 TYR E O   1 
ATOM   4147 C  CB  . TYR E 3 35  ? 40.830  41.196 41.091  1.00 47.43 ? 154 TYR E CB  1 
ATOM   4148 C  CG  . TYR E 3 35  ? 39.988  42.227 41.821  1.00 47.23 ? 154 TYR E CG  1 
ATOM   4149 C  CD1 . TYR E 3 35  ? 39.713  43.468 41.246  1.00 46.70 ? 154 TYR E CD1 1 
ATOM   4150 C  CD2 . TYR E 3 35  ? 39.469  41.964 43.088  1.00 45.88 ? 154 TYR E CD2 1 
ATOM   4151 C  CE1 . TYR E 3 35  ? 38.943  44.410 41.911  1.00 45.31 ? 154 TYR E CE1 1 
ATOM   4152 C  CE2 . TYR E 3 35  ? 38.702  42.905 43.757  1.00 46.17 ? 154 TYR E CE2 1 
ATOM   4153 C  CZ  . TYR E 3 35  ? 38.442  44.123 43.162  1.00 44.07 ? 154 TYR E CZ  1 
ATOM   4154 O  OH  . TYR E 3 35  ? 37.668  45.047 43.809  1.00 42.21 ? 154 TYR E OH  1 
ATOM   4155 N  N   . PRO E 3 36  ? 43.317  39.122 40.877  1.00 48.68 ? 155 PRO E N   1 
ATOM   4156 C  CA  . PRO E 3 36  ? 42.923  38.590 42.182  1.00 48.12 ? 155 PRO E CA  1 
ATOM   4157 C  C   . PRO E 3 36  ? 43.686  39.282 43.281  1.00 47.59 ? 155 PRO E C   1 
ATOM   4158 O  O   . PRO E 3 36  ? 44.820  39.680 43.082  1.00 47.71 ? 155 PRO E O   1 
ATOM   4159 C  CB  . PRO E 3 36  ? 43.289  37.113 42.075  1.00 47.62 ? 155 PRO E CB  1 
ATOM   4160 C  CG  . PRO E 3 36  ? 44.447  37.127 41.146  1.00 47.24 ? 155 PRO E CG  1 
ATOM   4161 C  CD  . PRO E 3 36  ? 43.986  38.083 40.079  1.00 48.14 ? 155 PRO E CD  1 
ATOM   4162 N  N   . ARG E 3 37  ? 43.062  39.424 44.439  1.00 48.49 ? 156 ARG E N   1 
ATOM   4163 C  CA  . ARG E 3 37  ? 43.710  40.075 45.573  1.00 48.97 ? 156 ARG E CA  1 
ATOM   4164 C  C   . ARG E 3 37  ? 44.942  39.303 46.029  1.00 48.48 ? 156 ARG E C   1 
ATOM   4165 O  O   . ARG E 3 37  ? 45.906  39.900 46.490  1.00 49.04 ? 156 ARG E O   1 
ATOM   4166 C  CB  . ARG E 3 37  ? 42.731  40.211 46.741  1.00 50.32 ? 156 ARG E CB  1 
ATOM   4167 C  CG  . ARG E 3 37  ? 41.615  41.235 46.532  1.00 54.76 ? 156 ARG E CG  1 
ATOM   4168 C  CD  . ARG E 3 37  ? 41.996  42.637 47.016  1.00 56.46 ? 156 ARG E CD  1 
ATOM   4169 N  NE  . ARG E 3 37  ? 43.175  43.144 46.322  1.00 60.03 ? 156 ARG E NE  1 
ATOM   4170 C  CZ  . ARG E 3 37  ? 44.279  43.587 46.925  1.00 62.13 ? 156 ARG E CZ  1 
ATOM   4171 N  NH1 . ARG E 3 37  ? 44.371  43.590 48.263  1.00 62.90 ? 156 ARG E NH1 1 
ATOM   4172 N  NH2 . ARG E 3 37  ? 45.295  44.021 46.184  1.00 61.39 ? 156 ARG E NH2 1 
ATOM   4173 N  N   . ASN E 3 38  ? 44.912  37.980 45.904  1.00 48.15 ? 157 ASN E N   1 
ATOM   4174 C  CA  . ASN E 3 38  ? 46.047  37.161 46.318  1.00 47.32 ? 157 ASN E CA  1 
ATOM   4175 C  C   . ASN E 3 38  ? 46.474  36.132 45.286  1.00 47.08 ? 157 ASN E C   1 
ATOM   4176 O  O   . ASN E 3 38  ? 45.988  35.008 45.264  1.00 47.17 ? 157 ASN E O   1 
ATOM   4177 C  CB  . ASN E 3 38  ? 45.753  36.445 47.632  1.00 47.57 ? 157 ASN E CB  1 
ATOM   4178 C  CG  . ASN E 3 38  ? 46.873  35.511 48.038  1.00 48.41 ? 157 ASN E CG  1 
ATOM   4179 O  OD1 . ASN E 3 38  ? 47.946  35.511 47.425  1.00 50.66 ? 157 ASN E OD1 1 
ATOM   4180 N  ND2 . ASN E 3 38  ? 46.637  34.714 49.073  1.00 47.54 ? 157 ASN E ND2 1 
ATOM   4181 N  N   . PRO E 3 39  ? 47.413  36.511 44.422  1.00 46.85 ? 158 PRO E N   1 
ATOM   4182 C  CA  . PRO E 3 39  ? 47.945  35.656 43.364  1.00 46.80 ? 158 PRO E CA  1 
ATOM   4183 C  C   . PRO E 3 39  ? 48.439  34.331 43.920  1.00 47.30 ? 158 PRO E C   1 
ATOM   4184 O  O   . PRO E 3 39  ? 48.278  33.287 43.295  1.00 47.55 ? 158 PRO E O   1 
ATOM   4185 C  CB  . PRO E 3 39  ? 49.082  36.493 42.799  1.00 47.85 ? 158 PRO E CB  1 
ATOM   4186 C  CG  . PRO E 3 39  ? 48.595  37.905 43.011  1.00 47.31 ? 158 PRO E CG  1 
ATOM   4187 C  CD  . PRO E 3 39  ? 48.042  37.842 44.398  1.00 46.54 ? 158 PRO E CD  1 
ATOM   4188 N  N   . ALA E 3 40  ? 49.039  34.389 45.104  1.00 47.81 ? 159 ALA E N   1 
ATOM   4189 C  CA  . ALA E 3 40  ? 49.587  33.212 45.774  1.00 48.39 ? 159 ALA E CA  1 
ATOM   4190 C  C   . ALA E 3 40  ? 48.581  32.083 45.955  1.00 49.46 ? 159 ALA E C   1 
ATOM   4191 O  O   . ALA E 3 40  ? 48.953  30.912 45.935  1.00 50.23 ? 159 ALA E O   1 
ATOM   4192 C  CB  . ALA E 3 40  ? 50.159  33.611 47.127  1.00 47.26 ? 159 ALA E CB  1 
ATOM   4193 N  N   . MET E 3 41  ? 47.310  32.429 46.144  1.00 49.63 ? 160 MET E N   1 
ATOM   4194 C  CA  . MET E 3 41  ? 46.279  31.418 46.334  1.00 48.81 ? 160 MET E CA  1 
ATOM   4195 C  C   . MET E 3 41  ? 45.448  31.257 45.076  1.00 48.63 ? 160 MET E C   1 
ATOM   4196 O  O   . MET E 3 41  ? 44.301  30.825 45.110  1.00 48.28 ? 160 MET E O   1 
ATOM   4197 C  CB  . MET E 3 41  ? 45.395  31.790 47.522  1.00 47.56 ? 160 MET E CB  1 
ATOM   4198 C  CG  . MET E 3 41  ? 46.066  31.595 48.876  1.00 47.34 ? 160 MET E CG  1 
ATOM   4199 S  SD  . MET E 3 41  ? 46.206  29.861 49.359  1.00 46.84 ? 160 MET E SD  1 
ATOM   4200 C  CE  . MET E 3 41  ? 47.678  29.365 48.507  1.00 49.94 ? 160 MET E CE  1 
ATOM   4201 N  N   . TYR E 3 42  ? 46.059  31.591 43.951  1.00 49.15 ? 161 TYR E N   1 
ATOM   4202 C  CA  . TYR E 3 42  ? 45.398  31.500 42.656  1.00 49.53 ? 161 TYR E CA  1 
ATOM   4203 C  C   . TYR E 3 42  ? 44.920  30.078 42.367  1.00 49.51 ? 161 TYR E C   1 
ATOM   4204 O  O   . TYR E 3 42  ? 43.754  29.861 42.052  1.00 50.12 ? 161 TYR E O   1 
ATOM   4205 C  CB  . TYR E 3 42  ? 46.367  31.950 41.552  1.00 49.10 ? 161 TYR E CB  1 
ATOM   4206 C  CG  . TYR E 3 42  ? 45.740  32.075 40.190  1.00 47.42 ? 161 TYR E CG  1 
ATOM   4207 C  CD1 . TYR E 3 42  ? 44.852  33.104 39.912  1.00 48.40 ? 161 TYR E CD1 1 
ATOM   4208 C  CD2 . TYR E 3 42  ? 46.027  31.162 39.183  1.00 46.78 ? 161 TYR E CD2 1 
ATOM   4209 C  CE1 . TYR E 3 42  ? 44.263  33.227 38.665  1.00 48.87 ? 161 TYR E CE1 1 
ATOM   4210 C  CE2 . TYR E 3 42  ? 45.445  31.270 37.931  1.00 47.10 ? 161 TYR E CE2 1 
ATOM   4211 C  CZ  . TYR E 3 42  ? 44.565  32.306 37.676  1.00 48.98 ? 161 TYR E CZ  1 
ATOM   4212 O  OH  . TYR E 3 42  ? 43.990  32.435 36.431  1.00 51.51 ? 161 TYR E OH  1 
ATOM   4213 N  N   . SER E 3 43  ? 45.838  29.122 42.478  1.00 49.25 ? 162 SER E N   1 
ATOM   4214 C  CA  . SER E 3 43  ? 45.562  27.708 42.223  1.00 49.51 ? 162 SER E CA  1 
ATOM   4215 C  C   . SER E 3 43  ? 44.792  26.950 43.307  1.00 49.52 ? 162 SER E C   1 
ATOM   4216 O  O   . SER E 3 43  ? 44.960  27.187 44.498  1.00 48.10 ? 162 SER E O   1 
ATOM   4217 C  CB  . SER E 3 43  ? 46.880  26.987 41.969  1.00 50.04 ? 162 SER E CB  1 
ATOM   4218 O  OG  . SER E 3 43  ? 47.831  27.340 42.955  1.00 50.48 ? 162 SER E OG  1 
ATOM   4219 N  N   . GLU E 3 44  ? 43.960  26.010 42.878  1.00 50.50 ? 163 GLU E N   1 
ATOM   4220 C  CA  . GLU E 3 44  ? 43.176  25.212 43.811  1.00 52.44 ? 163 GLU E CA  1 
ATOM   4221 C  C   . GLU E 3 44  ? 44.085  24.351 44.704  1.00 52.30 ? 163 GLU E C   1 
ATOM   4222 O  O   . GLU E 3 44  ? 43.847  24.208 45.909  1.00 51.09 ? 163 GLU E O   1 
ATOM   4223 C  CB  . GLU E 3 44  ? 42.188  24.330 43.043  1.00 52.97 ? 163 GLU E CB  1 
ATOM   4224 C  CG  . GLU E 3 44  ? 41.228  23.572 43.934  1.00 55.16 ? 163 GLU E CG  1 
ATOM   4225 C  CD  . GLU E 3 44  ? 40.140  22.890 43.145  1.00 57.88 ? 163 GLU E CD  1 
ATOM   4226 O  OE1 . GLU E 3 44  ? 40.474  22.042 42.288  1.00 61.31 ? 163 GLU E OE1 1 
ATOM   4227 O  OE2 . GLU E 3 44  ? 38.949  23.199 43.373  1.00 59.25 ? 163 GLU E OE2 1 
ATOM   4228 N  N   . GLU E 3 45  ? 45.126  23.781 44.106  1.00 53.14 ? 164 GLU E N   1 
ATOM   4229 C  CA  . GLU E 3 45  ? 46.059  22.962 44.859  1.00 54.64 ? 164 GLU E CA  1 
ATOM   4230 C  C   . GLU E 3 45  ? 46.679  23.815 45.964  1.00 53.46 ? 164 GLU E C   1 
ATOM   4231 O  O   . GLU E 3 45  ? 46.714  23.408 47.127  1.00 53.18 ? 164 GLU E O   1 
ATOM   4232 C  CB  . GLU E 3 45  ? 47.155  22.405 43.942  1.00 58.09 ? 164 GLU E CB  1 
ATOM   4233 C  CG  . GLU E 3 45  ? 48.274  21.664 44.691  1.00 63.21 ? 164 GLU E CG  1 
ATOM   4234 C  CD  . GLU E 3 45  ? 49.124  20.776 43.781  1.00 66.57 ? 164 GLU E CD  1 
ATOM   4235 O  OE1 . GLU E 3 45  ? 49.740  21.318 42.824  1.00 67.64 ? 164 GLU E OE1 1 
ATOM   4236 O  OE2 . GLU E 3 45  ? 49.168  19.536 44.030  1.00 67.66 ? 164 GLU E OE2 1 
ATOM   4237 N  N   . ALA E 3 46  ? 47.163  25.002 45.607  1.00 51.89 ? 165 ALA E N   1 
ATOM   4238 C  CA  . ALA E 3 46  ? 47.763  25.896 46.596  1.00 50.44 ? 165 ALA E CA  1 
ATOM   4239 C  C   . ALA E 3 46  ? 46.735  26.134 47.684  1.00 49.60 ? 165 ALA E C   1 
ATOM   4240 O  O   . ALA E 3 46  ? 47.062  26.230 48.871  1.00 49.75 ? 165 ALA E O   1 
ATOM   4241 C  CB  . ALA E 3 46  ? 48.143  27.217 45.955  1.00 49.97 ? 165 ALA E CB  1 
ATOM   4242 N  N   . ARG E 3 47  ? 45.479  26.229 47.261  1.00 48.72 ? 166 ARG E N   1 
ATOM   4243 C  CA  . ARG E 3 47  ? 44.391  26.456 48.185  1.00 46.85 ? 166 ARG E CA  1 
ATOM   4244 C  C   . ARG E 3 47  ? 44.213  25.253 49.088  1.00 45.87 ? 166 ARG E C   1 
ATOM   4245 O  O   . ARG E 3 47  ? 44.179  25.391 50.302  1.00 43.93 ? 166 ARG E O   1 
ATOM   4246 C  CB  . ARG E 3 47  ? 43.100  26.748 47.420  1.00 46.81 ? 166 ARG E CB  1 
ATOM   4247 C  CG  . ARG E 3 47  ? 42.916  28.211 47.084  1.00 45.59 ? 166 ARG E CG  1 
ATOM   4248 C  CD  . ARG E 3 47  ? 41.543  28.502 46.520  1.00 45.87 ? 166 ARG E CD  1 
ATOM   4249 N  NE  . ARG E 3 47  ? 41.609  28.916 45.126  1.00 47.29 ? 166 ARG E NE  1 
ATOM   4250 C  CZ  . ARG E 3 47  ? 41.276  28.143 44.102  1.00 47.71 ? 166 ARG E CZ  1 
ATOM   4251 N  NH1 . ARG E 3 47  ? 40.849  26.911 44.308  1.00 48.61 ? 166 ARG E NH1 1 
ATOM   4252 N  NH2 . ARG E 3 47  ? 41.364  28.603 42.868  1.00 49.68 ? 166 ARG E NH2 1 
ATOM   4253 N  N   . LEU E 3 48  ? 44.099  24.073 48.491  1.00 46.63 ? 167 LEU E N   1 
ATOM   4254 C  CA  . LEU E 3 48  ? 43.939  22.857 49.268  1.00 48.03 ? 167 LEU E CA  1 
ATOM   4255 C  C   . LEU E 3 48  ? 45.010  22.761 50.325  1.00 48.94 ? 167 LEU E C   1 
ATOM   4256 O  O   . LEU E 3 48  ? 44.740  22.439 51.479  1.00 48.38 ? 167 LEU E O   1 
ATOM   4257 C  CB  . LEU E 3 48  ? 44.033  21.632 48.374  1.00 47.80 ? 167 LEU E CB  1 
ATOM   4258 C  CG  . LEU E 3 48  ? 42.707  21.171 47.797  1.00 50.79 ? 167 LEU E CG  1 
ATOM   4259 C  CD1 . LEU E 3 48  ? 42.842  19.762 47.190  1.00 50.00 ? 167 LEU E CD1 1 
ATOM   4260 C  CD2 . LEU E 3 48  ? 41.679  21.175 48.933  1.00 52.01 ? 167 LEU E CD2 1 
ATOM   4261 N  N   . LYS E 3 49  ? 46.232  23.064 49.914  1.00 50.59 ? 168 LYS E N   1 
ATOM   4262 C  CA  . LYS E 3 49  ? 47.384  22.991 50.792  1.00 52.62 ? 168 LYS E CA  1 
ATOM   4263 C  C   . LYS E 3 49  ? 47.315  23.938 51.990  1.00 52.70 ? 168 LYS E C   1 
ATOM   4264 O  O   . LYS E 3 49  ? 48.206  23.931 52.837  1.00 53.89 ? 168 LYS E O   1 
ATOM   4265 C  CB  . LYS E 3 49  ? 48.651  23.246 49.967  1.00 54.65 ? 168 LYS E CB  1 
ATOM   4266 C  CG  . LYS E 3 49  ? 49.959  23.180 50.742  1.00 57.84 ? 168 LYS E CG  1 
ATOM   4267 C  CD  . LYS E 3 49  ? 51.154  23.493 49.833  1.00 60.11 ? 168 LYS E CD  1 
ATOM   4268 C  CE  . LYS E 3 49  ? 52.441  23.679 50.649  1.00 60.85 ? 168 LYS E CE  1 
ATOM   4269 N  NZ  . LYS E 3 49  ? 53.626  23.934 49.776  1.00 61.48 ? 168 LYS E NZ  1 
ATOM   4270 N  N   . SER E 3 50  ? 46.254  24.730 52.088  1.00 52.45 ? 169 SER E N   1 
ATOM   4271 C  CA  . SER E 3 50  ? 46.140  25.675 53.198  1.00 52.83 ? 169 SER E CA  1 
ATOM   4272 C  C   . SER E 3 50  ? 45.336  25.164 54.370  1.00 52.68 ? 169 SER E C   1 
ATOM   4273 O  O   . SER E 3 50  ? 45.398  25.732 55.459  1.00 52.61 ? 169 SER E O   1 
ATOM   4274 C  CB  . SER E 3 50  ? 45.515  26.991 52.732  1.00 52.24 ? 169 SER E CB  1 
ATOM   4275 O  OG  . SER E 3 50  ? 44.174  26.800 52.323  1.00 53.22 ? 169 SER E OG  1 
ATOM   4276 N  N   . PHE E 3 51  ? 44.571  24.105 54.152  1.00 52.14 ? 170 PHE E N   1 
ATOM   4277 C  CA  . PHE E 3 51  ? 43.753  23.562 55.216  1.00 52.74 ? 170 PHE E CA  1 
ATOM   4278 C  C   . PHE E 3 51  ? 44.490  22.599 56.132  1.00 54.33 ? 170 PHE E C   1 
ATOM   4279 O  O   . PHE E 3 51  ? 43.877  21.723 56.740  1.00 55.02 ? 170 PHE E O   1 
ATOM   4280 C  CB  . PHE E 3 51  ? 42.524  22.887 54.626  1.00 50.40 ? 170 PHE E CB  1 
ATOM   4281 C  CG  . PHE E 3 51  ? 41.596  23.837 53.974  1.00 48.98 ? 170 PHE E CG  1 
ATOM   4282 C  CD1 . PHE E 3 51  ? 41.853  24.308 52.697  1.00 49.09 ? 170 PHE E CD1 1 
ATOM   4283 C  CD2 . PHE E 3 51  ? 40.484  24.315 54.659  1.00 48.85 ? 170 PHE E CD2 1 
ATOM   4284 C  CE1 . PHE E 3 51  ? 41.019  25.247 52.102  1.00 48.50 ? 170 PHE E CE1 1 
ATOM   4285 C  CE2 . PHE E 3 51  ? 39.639  25.255 54.078  1.00 48.03 ? 170 PHE E CE2 1 
ATOM   4286 C  CZ  . PHE E 3 51  ? 39.910  25.723 52.791  1.00 48.85 ? 170 PHE E CZ  1 
ATOM   4287 N  N   . GLN E 3 52  ? 45.799  22.784 56.246  1.00 56.28 ? 171 GLN E N   1 
ATOM   4288 C  CA  . GLN E 3 52  ? 46.635  21.929 57.081  1.00 58.41 ? 171 GLN E CA  1 
ATOM   4289 C  C   . GLN E 3 52  ? 46.032  21.673 58.461  1.00 58.05 ? 171 GLN E C   1 
ATOM   4290 O  O   . GLN E 3 52  ? 46.255  20.614 59.039  1.00 58.66 ? 171 GLN E O   1 
ATOM   4291 C  CB  . GLN E 3 52  ? 48.036  22.549 57.228  1.00 61.63 ? 171 GLN E CB  1 
ATOM   4292 C  CG  . GLN E 3 52  ? 49.026  21.760 58.102  1.00 67.12 ? 171 GLN E CG  1 
ATOM   4293 C  CD  . GLN E 3 52  ? 49.429  20.410 57.492  1.00 70.84 ? 171 GLN E CD  1 
ATOM   4294 O  OE1 . GLN E 3 52  ? 50.000  20.357 56.393  1.00 72.54 ? 171 GLN E OE1 1 
ATOM   4295 N  NE2 . GLN E 3 52  ? 49.139  19.309 58.212  1.00 72.43 ? 171 GLN E NE2 1 
ATOM   4296 N  N   . ASN E 3 53  ? 45.251  22.612 58.985  1.00 57.33 ? 172 ASN E N   1 
ATOM   4297 C  CA  . ASN E 3 53  ? 44.680  22.422 60.319  1.00 57.03 ? 172 ASN E CA  1 
ATOM   4298 C  C   . ASN E 3 53  ? 43.198  22.768 60.469  1.00 55.41 ? 172 ASN E C   1 
ATOM   4299 O  O   . ASN E 3 53  ? 42.775  23.267 61.513  1.00 54.61 ? 172 ASN E O   1 
ATOM   4300 C  CB  . ASN E 3 53  ? 45.484  23.244 61.305  1.00 59.84 ? 172 ASN E CB  1 
ATOM   4301 C  CG  . ASN E 3 53  ? 46.944  23.343 60.904  1.00 64.35 ? 172 ASN E CG  1 
ATOM   4302 O  OD1 . ASN E 3 53  ? 47.692  22.353 60.987  1.00 65.97 ? 172 ASN E OD1 1 
ATOM   4303 N  ND2 . ASN E 3 53  ? 47.362  24.537 60.440  1.00 64.96 ? 172 ASN E ND2 1 
ATOM   4304 N  N   . TRP E 3 54  ? 42.417  22.500 59.424  1.00 53.60 ? 173 TRP E N   1 
ATOM   4305 C  CA  . TRP E 3 54  ? 40.979  22.771 59.424  1.00 51.06 ? 173 TRP E CA  1 
ATOM   4306 C  C   . TRP E 3 54  ? 40.387  22.103 60.679  1.00 51.55 ? 173 TRP E C   1 
ATOM   4307 O  O   . TRP E 3 54  ? 40.615  20.917 60.924  1.00 51.54 ? 173 TRP E O   1 
ATOM   4308 C  CB  . TRP E 3 54  ? 40.378  22.196 58.133  1.00 47.21 ? 173 TRP E CB  1 
ATOM   4309 C  CG  . TRP E 3 54  ? 38.981  22.608 57.797  1.00 43.31 ? 173 TRP E CG  1 
ATOM   4310 C  CD1 . TRP E 3 54  ? 37.969  21.785 57.416  1.00 43.54 ? 173 TRP E CD1 1 
ATOM   4311 C  CD2 . TRP E 3 54  ? 38.451  23.935 57.752  1.00 42.12 ? 173 TRP E CD2 1 
ATOM   4312 N  NE1 . TRP E 3 54  ? 36.844  22.508 57.138  1.00 42.16 ? 173 TRP E NE1 1 
ATOM   4313 C  CE2 . TRP E 3 54  ? 37.112  23.834 57.336  1.00 42.09 ? 173 TRP E CE2 1 
ATOM   4314 C  CE3 . TRP E 3 54  ? 38.974  25.202 58.024  1.00 41.93 ? 173 TRP E CE3 1 
ATOM   4315 C  CZ2 . TRP E 3 54  ? 36.290  24.950 57.186  1.00 41.99 ? 173 TRP E CZ2 1 
ATOM   4316 C  CZ3 . TRP E 3 54  ? 38.156  26.303 57.875  1.00 40.47 ? 173 TRP E CZ3 1 
ATOM   4317 C  CH2 . TRP E 3 54  ? 36.830  26.170 57.460  1.00 40.32 ? 173 TRP E CH2 1 
ATOM   4318 N  N   . PRO E 3 55  ? 39.634  22.864 61.497  1.00 52.82 ? 174 PRO E N   1 
ATOM   4319 C  CA  . PRO E 3 55  ? 39.008  22.367 62.732  1.00 52.72 ? 174 PRO E CA  1 
ATOM   4320 C  C   . PRO E 3 55  ? 38.153  21.133 62.518  1.00 53.78 ? 174 PRO E C   1 
ATOM   4321 O  O   . PRO E 3 55  ? 37.533  20.981 61.468  1.00 53.03 ? 174 PRO E O   1 
ATOM   4322 C  CB  . PRO E 3 55  ? 38.155  23.547 63.193  1.00 52.60 ? 174 PRO E CB  1 
ATOM   4323 C  CG  . PRO E 3 55  ? 38.860  24.731 62.630  1.00 52.97 ? 174 PRO E CG  1 
ATOM   4324 C  CD  . PRO E 3 55  ? 39.258  24.269 61.254  1.00 52.73 ? 174 PRO E CD  1 
ATOM   4325 N  N   . ASP E 3 56  ? 38.096  20.263 63.523  1.00 56.25 ? 175 ASP E N   1 
ATOM   4326 C  CA  . ASP E 3 56  ? 37.289  19.051 63.417  1.00 58.20 ? 175 ASP E CA  1 
ATOM   4327 C  C   . ASP E 3 56  ? 35.807  19.407 63.231  1.00 57.39 ? 175 ASP E C   1 
ATOM   4328 O  O   . ASP E 3 56  ? 35.158  18.902 62.310  1.00 57.50 ? 175 ASP E O   1 
ATOM   4329 C  CB  . ASP E 3 56  ? 37.487  18.162 64.644  1.00 62.03 ? 175 ASP E CB  1 
ATOM   4330 C  CG  . ASP E 3 56  ? 37.405  16.678 64.292  1.00 66.00 ? 175 ASP E CG  1 
ATOM   4331 O  OD1 . ASP E 3 56  ? 38.069  16.288 63.292  1.00 66.53 ? 175 ASP E OD1 1 
ATOM   4332 O  OD2 . ASP E 3 56  ? 36.685  15.912 64.994  1.00 67.87 ? 175 ASP E OD2 1 
ATOM   4333 N  N   . TYR E 3 57  ? 35.272  20.265 64.100  1.00 56.28 ? 176 TYR E N   1 
ATOM   4334 C  CA  . TYR E 3 57  ? 33.891  20.728 63.954  1.00 55.76 ? 176 TYR E CA  1 
ATOM   4335 C  C   . TYR E 3 57  ? 33.977  21.473 62.624  1.00 55.61 ? 176 TYR E C   1 
ATOM   4336 O  O   . TYR E 3 57  ? 34.952  22.184 62.387  1.00 55.88 ? 176 TYR E O   1 
ATOM   4337 C  CB  . TYR E 3 57  ? 33.529  21.701 65.084  1.00 55.27 ? 176 TYR E CB  1 
ATOM   4338 C  CG  . TYR E 3 57  ? 34.246  23.040 65.041  1.00 55.22 ? 176 TYR E CG  1 
ATOM   4339 C  CD1 . TYR E 3 57  ? 33.832  24.049 64.174  1.00 55.89 ? 176 TYR E CD1 1 
ATOM   4340 C  CD2 . TYR E 3 57  ? 35.343  23.296 65.863  1.00 55.57 ? 176 TYR E CD2 1 
ATOM   4341 C  CE1 . TYR E 3 57  ? 34.495  25.284 64.120  1.00 55.85 ? 176 TYR E CE1 1 
ATOM   4342 C  CE2 . TYR E 3 57  ? 36.014  24.534 65.826  1.00 55.24 ? 176 TYR E CE2 1 
ATOM   4343 C  CZ  . TYR E 3 57  ? 35.583  25.522 64.948  1.00 55.95 ? 176 TYR E CZ  1 
ATOM   4344 O  OH  . TYR E 3 57  ? 36.236  26.742 64.885  1.00 54.77 ? 176 TYR E OH  1 
ATOM   4345 N  N   . ALA E 3 58  ? 33.005  21.337 61.737  1.00 55.54 ? 177 ALA E N   1 
ATOM   4346 C  CA  . ALA E 3 58  ? 33.191  22.036 60.482  1.00 55.63 ? 177 ALA E CA  1 
ATOM   4347 C  C   . ALA E 3 58  ? 31.973  22.145 59.600  1.00 56.14 ? 177 ALA E C   1 
ATOM   4348 O  O   . ALA E 3 58  ? 31.466  23.248 59.371  1.00 58.67 ? 177 ALA E O   1 
ATOM   4349 C  CB  . ALA E 3 58  ? 34.311  21.384 59.716  1.00 55.73 ? 177 ALA E CB  1 
ATOM   4350 N  N   . HIS E 3 59  ? 31.512  21.010 59.096  1.00 54.55 ? 178 HIS E N   1 
ATOM   4351 C  CA  . HIS E 3 59  ? 30.351  20.959 58.207  1.00 53.26 ? 178 HIS E CA  1 
ATOM   4352 C  C   . HIS E 3 59  ? 30.794  21.132 56.772  1.00 51.79 ? 178 HIS E C   1 
ATOM   4353 O  O   . HIS E 3 59  ? 29.967  21.120 55.873  1.00 54.18 ? 178 HIS E O   1 
ATOM   4354 C  CB  . HIS E 3 59  ? 29.311  22.044 58.532  1.00 53.34 ? 178 HIS E CB  1 
ATOM   4355 C  CG  . HIS E 3 59  ? 28.920  22.099 59.975  1.00 54.58 ? 178 HIS E CG  1 
ATOM   4356 N  ND1 . HIS E 3 59  ? 28.486  20.991 60.673  1.00 55.06 ? 178 HIS E ND1 1 
ATOM   4357 C  CD2 . HIS E 3 59  ? 28.938  23.122 60.862  1.00 54.34 ? 178 HIS E CD2 1 
ATOM   4358 C  CE1 . HIS E 3 59  ? 28.258  21.329 61.930  1.00 54.52 ? 178 HIS E CE1 1 
ATOM   4359 N  NE2 . HIS E 3 59  ? 28.525  22.616 62.071  1.00 54.84 ? 178 HIS E NE2 1 
ATOM   4360 N  N   . LEU E 3 60  ? 32.091  21.311 56.559  1.00 48.94 ? 179 LEU E N   1 
ATOM   4361 C  CA  . LEU E 3 60  ? 32.558  21.754 55.229  1.00 46.94 ? 179 LEU E CA  1 
ATOM   4362 C  C   . LEU E 3 60  ? 33.987  21.265 55.174  1.00 45.61 ? 179 LEU E C   1 
ATOM   4363 O  O   . LEU E 3 60  ? 34.755  21.483 56.102  1.00 46.38 ? 179 LEU E O   1 
ATOM   4364 C  CB  . LEU E 3 60  ? 32.519  23.223 54.818  1.00 48.86 ? 179 LEU E CB  1 
ATOM   4365 C  CG  . LEU E 3 60  ? 31.230  23.801 54.240  1.00 50.82 ? 179 LEU E CG  1 
ATOM   4366 C  CD1 . LEU E 3 60  ? 31.589  24.765 53.112  1.00 50.34 ? 179 LEU E CD1 1 
ATOM   4367 C  CD2 . LEU E 3 60  ? 30.357  22.682 53.685  1.00 50.68 ? 179 LEU E CD2 1 
ATOM   4368 N  N   . THR E 3 61  ? 34.349  20.613 54.078  1.00 43.65 ? 180 THR E N   1 
ATOM   4369 C  CA  . THR E 3 61  ? 35.697  20.081 53.907  1.00 41.67 ? 180 THR E CA  1 
ATOM   4370 C  C   . THR E 3 61  ? 36.507  20.984 53.009  1.00 42.12 ? 180 THR E C   1 
ATOM   4371 O  O   . THR E 3 61  ? 35.959  21.692 52.167  1.00 42.59 ? 180 THR E O   1 
ATOM   4372 C  CB  . THR E 3 61  ? 35.665  18.745 53.233  1.00 39.99 ? 180 THR E CB  1 
ATOM   4373 O  OG1 . THR E 3 61  ? 35.208  18.928 51.894  1.00 38.70 ? 180 THR E OG1 1 
ATOM   4374 C  CG2 . THR E 3 61  ? 34.724  17.804 53.956  1.00 39.94 ? 180 THR E CG2 1 
ATOM   4375 N  N   . PRO E 3 62  ? 37.834  20.955 53.153  1.00 42.05 ? 181 PRO E N   1 
ATOM   4376 C  CA  . PRO E 3 62  ? 38.713  21.791 52.336  1.00 42.09 ? 181 PRO E CA  1 
ATOM   4377 C  C   . PRO E 3 62  ? 38.392  21.802 50.845  1.00 42.93 ? 181 PRO E C   1 
ATOM   4378 O  O   . PRO E 3 62  ? 38.233  22.865 50.252  1.00 43.61 ? 181 PRO E O   1 
ATOM   4379 C  CB  . PRO E 3 62  ? 40.087  21.224 52.639  1.00 40.87 ? 181 PRO E CB  1 
ATOM   4380 C  CG  . PRO E 3 62  ? 39.958  20.906 54.080  1.00 41.50 ? 181 PRO E CG  1 
ATOM   4381 C  CD  . PRO E 3 62  ? 38.614  20.209 54.150  1.00 41.66 ? 181 PRO E CD  1 
ATOM   4382 N  N   . ARG E 3 63  ? 38.276  20.630 50.237  1.00 42.38 ? 182 ARG E N   1 
ATOM   4383 C  CA  . ARG E 3 63  ? 37.991  20.576 48.816  1.00 42.96 ? 182 ARG E CA  1 
ATOM   4384 C  C   . ARG E 3 63  ? 36.791  21.404 48.376  1.00 42.18 ? 182 ARG E C   1 
ATOM   4385 O  O   . ARG E 3 63  ? 36.869  22.099 47.371  1.00 41.90 ? 182 ARG E O   1 
ATOM   4386 C  CB  . ARG E 3 63  ? 37.830  19.125 48.361  1.00 44.44 ? 182 ARG E CB  1 
ATOM   4387 C  CG  . ARG E 3 63  ? 39.131  18.506 47.831  1.00 46.90 ? 182 ARG E CG  1 
ATOM   4388 C  CD  . ARG E 3 63  ? 38.985  16.997 47.553  1.00 47.75 ? 182 ARG E CD  1 
ATOM   4389 N  NE  . ARG E 3 63  ? 40.187  16.392 46.981  1.00 46.87 ? 182 ARG E NE  1 
ATOM   4390 C  CZ  . ARG E 3 63  ? 40.837  16.866 45.920  1.00 46.96 ? 182 ARG E CZ  1 
ATOM   4391 N  NH1 . ARG E 3 63  ? 40.417  17.971 45.312  1.00 44.34 ? 182 ARG E NH1 1 
ATOM   4392 N  NH2 . ARG E 3 63  ? 41.883  16.205 45.438  1.00 47.38 ? 182 ARG E NH2 1 
ATOM   4393 N  N   . GLU E 3 64  ? 35.685  21.346 49.109  1.00 41.00 ? 183 GLU E N   1 
ATOM   4394 C  CA  . GLU E 3 64  ? 34.526  22.135 48.715  1.00 40.09 ? 183 GLU E CA  1 
ATOM   4395 C  C   . GLU E 3 64  ? 34.830  23.619 48.842  1.00 40.12 ? 183 GLU E C   1 
ATOM   4396 O  O   . GLU E 3 64  ? 34.401  24.420 48.007  1.00 41.32 ? 183 GLU E O   1 
ATOM   4397 C  CB  . GLU E 3 64  ? 33.300  21.821 49.561  1.00 38.50 ? 183 GLU E CB  1 
ATOM   4398 C  CG  . GLU E 3 64  ? 32.035  22.229 48.851  1.00 39.69 ? 183 GLU E CG  1 
ATOM   4399 C  CD  . GLU E 3 64  ? 30.818  22.322 49.739  1.00 40.55 ? 183 GLU E CD  1 
ATOM   4400 O  OE1 . GLU E 3 64  ? 30.618  21.436 50.586  1.00 41.55 ? 183 GLU E OE1 1 
ATOM   4401 O  OE2 . GLU E 3 64  ? 30.040  23.282 49.568  1.00 41.63 ? 183 GLU E OE2 1 
ATOM   4402 N  N   . LEU E 3 65  ? 35.572  23.981 49.886  1.00 38.09 ? 184 LEU E N   1 
ATOM   4403 C  CA  . LEU E 3 65  ? 35.942  25.369 50.120  1.00 37.41 ? 184 LEU E CA  1 
ATOM   4404 C  C   . LEU E 3 65  ? 36.982  25.841 49.097  1.00 37.96 ? 184 LEU E C   1 
ATOM   4405 O  O   . LEU E 3 65  ? 36.895  26.943 48.564  1.00 37.63 ? 184 LEU E O   1 
ATOM   4406 C  CB  . LEU E 3 65  ? 36.479  25.533 51.547  1.00 37.05 ? 184 LEU E CB  1 
ATOM   4407 C  CG  . LEU E 3 65  ? 35.510  25.283 52.707  1.00 36.06 ? 184 LEU E CG  1 
ATOM   4408 C  CD1 . LEU E 3 65  ? 36.286  25.089 53.984  1.00 34.53 ? 184 LEU E CD1 1 
ATOM   4409 C  CD2 . LEU E 3 65  ? 34.541  26.433 52.828  1.00 33.62 ? 184 LEU E CD2 1 
ATOM   4410 N  N   . ALA E 3 66  ? 37.970  25.001 48.826  1.00 38.10 ? 185 ALA E N   1 
ATOM   4411 C  CA  . ALA E 3 66  ? 38.999  25.342 47.859  1.00 37.59 ? 185 ALA E CA  1 
ATOM   4412 C  C   . ALA E 3 66  ? 38.379  25.467 46.473  1.00 37.63 ? 185 ALA E C   1 
ATOM   4413 O  O   . ALA E 3 66  ? 38.749  26.339 45.705  1.00 38.05 ? 185 ALA E O   1 
ATOM   4414 C  CB  . ALA E 3 66  ? 40.088  24.282 47.855  1.00 38.37 ? 185 ALA E CB  1 
ATOM   4415 N  N   . SER E 3 67  ? 37.425  24.600 46.162  1.00 37.42 ? 186 SER E N   1 
ATOM   4416 C  CA  . SER E 3 67  ? 36.774  24.630 44.862  1.00 37.51 ? 186 SER E CA  1 
ATOM   4417 C  C   . SER E 3 67  ? 35.916  25.878 44.661  1.00 37.81 ? 186 SER E C   1 
ATOM   4418 O  O   . SER E 3 67  ? 35.556  26.218 43.537  1.00 38.19 ? 186 SER E O   1 
ATOM   4419 C  CB  . SER E 3 67  ? 35.918  23.375 44.660  1.00 38.73 ? 186 SER E CB  1 
ATOM   4420 O  OG  . SER E 3 67  ? 35.169  23.451 43.454  1.00 38.59 ? 186 SER E OG  1 
ATOM   4421 N  N   . ALA E 3 68  ? 35.566  26.551 45.750  1.00 37.53 ? 187 ALA E N   1 
ATOM   4422 C  CA  . ALA E 3 68  ? 34.784  27.779 45.653  1.00 35.57 ? 187 ALA E CA  1 
ATOM   4423 C  C   . ALA E 3 68  ? 35.763  28.949 45.737  1.00 35.99 ? 187 ALA E C   1 
ATOM   4424 O  O   . ALA E 3 68  ? 35.374  30.077 45.981  1.00 34.59 ? 187 ALA E O   1 
ATOM   4425 C  CB  . ALA E 3 68  ? 33.774  27.852 46.773  1.00 32.97 ? 187 ALA E CB  1 
ATOM   4426 N  N   . GLY E 3 69  ? 37.044  28.646 45.543  1.00 38.16 ? 188 GLY E N   1 
ATOM   4427 C  CA  . GLY E 3 69  ? 38.092  29.649 45.580  1.00 39.06 ? 188 GLY E CA  1 
ATOM   4428 C  C   . GLY E 3 69  ? 38.476  30.158 46.953  1.00 39.88 ? 188 GLY E C   1 
ATOM   4429 O  O   . GLY E 3 69  ? 39.215  31.125 47.073  1.00 40.45 ? 188 GLY E O   1 
ATOM   4430 N  N   . LEU E 3 70  ? 37.987  29.505 47.994  1.00 40.86 ? 189 LEU E N   1 
ATOM   4431 C  CA  . LEU E 3 70  ? 38.279  29.935 49.349  1.00 41.04 ? 189 LEU E CA  1 
ATOM   4432 C  C   . LEU E 3 70  ? 39.438  29.158 49.957  1.00 41.37 ? 189 LEU E C   1 
ATOM   4433 O  O   . LEU E 3 70  ? 39.526  27.938 49.798  1.00 40.67 ? 189 LEU E O   1 
ATOM   4434 C  CB  . LEU E 3 70  ? 37.034  29.764 50.212  1.00 40.81 ? 189 LEU E CB  1 
ATOM   4435 C  CG  . LEU E 3 70  ? 35.761  30.383 49.634  1.00 41.50 ? 189 LEU E CG  1 
ATOM   4436 C  CD1 . LEU E 3 70  ? 34.569  29.944 50.471  1.00 41.60 ? 189 LEU E CD1 1 
ATOM   4437 C  CD2 . LEU E 3 70  ? 35.890  31.909 49.581  1.00 40.60 ? 189 LEU E CD2 1 
ATOM   4438 N  N   . TYR E 3 71  ? 40.329  29.868 50.647  1.00 40.98 ? 190 TYR E N   1 
ATOM   4439 C  CA  . TYR E 3 71  ? 41.468  29.231 51.294  1.00 40.71 ? 190 TYR E CA  1 
ATOM   4440 C  C   . TYR E 3 71  ? 41.461  29.580 52.774  1.00 40.49 ? 190 TYR E C   1 
ATOM   4441 O  O   . TYR E 3 71  ? 41.099  30.682 53.155  1.00 40.80 ? 190 TYR E O   1 
ATOM   4442 C  CB  . TYR E 3 71  ? 42.775  29.666 50.633  1.00 40.06 ? 190 TYR E CB  1 
ATOM   4443 C  CG  . TYR E 3 71  ? 43.131  31.121 50.810  1.00 41.59 ? 190 TYR E CG  1 
ATOM   4444 C  CD1 . TYR E 3 71  ? 43.857  31.547 51.919  1.00 41.67 ? 190 TYR E CD1 1 
ATOM   4445 C  CD2 . TYR E 3 71  ? 42.747  32.075 49.865  1.00 40.68 ? 190 TYR E CD2 1 
ATOM   4446 C  CE1 . TYR E 3 71  ? 44.200  32.885 52.088  1.00 43.37 ? 190 TYR E CE1 1 
ATOM   4447 C  CE2 . TYR E 3 71  ? 43.080  33.417 50.022  1.00 42.78 ? 190 TYR E CE2 1 
ATOM   4448 C  CZ  . TYR E 3 71  ? 43.810  33.821 51.133  1.00 44.99 ? 190 TYR E CZ  1 
ATOM   4449 O  OH  . TYR E 3 71  ? 44.169  35.153 51.277  1.00 46.57 ? 190 TYR E OH  1 
ATOM   4450 N  N   . TYR E 3 72  ? 41.848  28.621 53.605  1.00 41.80 ? 191 TYR E N   1 
ATOM   4451 C  CA  . TYR E 3 72  ? 41.873  28.801 55.055  1.00 43.91 ? 191 TYR E CA  1 
ATOM   4452 C  C   . TYR E 3 72  ? 42.838  29.878 55.545  1.00 44.18 ? 191 TYR E C   1 
ATOM   4453 O  O   . TYR E 3 72  ? 43.931  30.044 55.014  1.00 44.74 ? 191 TYR E O   1 
ATOM   4454 C  CB  . TYR E 3 72  ? 42.193  27.468 55.737  1.00 45.87 ? 191 TYR E CB  1 
ATOM   4455 C  CG  . TYR E 3 72  ? 42.049  27.494 57.245  1.00 46.75 ? 191 TYR E CG  1 
ATOM   4456 C  CD1 . TYR E 3 72  ? 40.893  27.982 57.852  1.00 48.03 ? 191 TYR E CD1 1 
ATOM   4457 C  CD2 . TYR E 3 72  ? 43.066  27.013 58.066  1.00 48.13 ? 191 TYR E CD2 1 
ATOM   4458 C  CE1 . TYR E 3 72  ? 40.758  27.988 59.242  1.00 49.73 ? 191 TYR E CE1 1 
ATOM   4459 C  CE2 . TYR E 3 72  ? 42.943  27.011 59.456  1.00 48.63 ? 191 TYR E CE2 1 
ATOM   4460 C  CZ  . TYR E 3 72  ? 41.792  27.500 60.036  1.00 49.96 ? 191 TYR E CZ  1 
ATOM   4461 O  OH  . TYR E 3 72  ? 41.695  27.515 61.404  1.00 50.71 ? 191 TYR E OH  1 
ATOM   4462 N  N   . THR E 3 73  ? 42.419  30.598 56.577  1.00 44.80 ? 192 THR E N   1 
ATOM   4463 C  CA  . THR E 3 73  ? 43.207  31.681 57.150  1.00 46.89 ? 192 THR E CA  1 
ATOM   4464 C  C   . THR E 3 73  ? 43.962  31.268 58.402  1.00 47.41 ? 192 THR E C   1 
ATOM   4465 O  O   . THR E 3 73  ? 44.754  32.042 58.936  1.00 46.81 ? 192 THR E O   1 
ATOM   4466 C  CB  . THR E 3 73  ? 42.310  32.863 57.532  1.00 48.60 ? 192 THR E CB  1 
ATOM   4467 O  OG1 . THR E 3 73  ? 41.384  33.114 56.477  1.00 53.24 ? 192 THR E OG1 1 
ATOM   4468 C  CG2 . THR E 3 73  ? 43.138  34.119 57.728  1.00 53.09 ? 192 THR E CG2 1 
ATOM   4469 N  N   . GLY E 3 74  ? 43.699  30.059 58.885  1.00 47.39 ? 193 GLY E N   1 
ATOM   4470 C  CA  . GLY E 3 74  ? 44.381  29.589 60.072  1.00 46.95 ? 193 GLY E CA  1 
ATOM   4471 C  C   . GLY E 3 74  ? 43.671  29.906 61.372  1.00 46.92 ? 193 GLY E C   1 
ATOM   4472 O  O   . GLY E 3 74  ? 44.109  29.480 62.426  1.00 46.70 ? 193 GLY E O   1 
ATOM   4473 N  N   . ILE E 3 75  ? 42.575  30.649 61.305  1.00 47.37 ? 194 ILE E N   1 
ATOM   4474 C  CA  . ILE E 3 75  ? 41.827  31.010 62.507  1.00 47.77 ? 194 ILE E CA  1 
ATOM   4475 C  C   . ILE E 3 75  ? 40.420  30.446 62.460  1.00 47.22 ? 194 ILE E C   1 
ATOM   4476 O  O   . ILE E 3 75  ? 39.724  30.575 61.450  1.00 47.86 ? 194 ILE E O   1 
ATOM   4477 C  CB  . ILE E 3 75  ? 41.702  32.532 62.666  1.00 49.67 ? 194 ILE E CB  1 
ATOM   4478 C  CG1 . ILE E 3 75  ? 43.074  33.192 62.524  1.00 53.63 ? 194 ILE E CG1 1 
ATOM   4479 C  CG2 . ILE E 3 75  ? 41.133  32.857 64.022  1.00 47.84 ? 194 ILE E CG2 1 
ATOM   4480 C  CD1 . ILE E 3 75  ? 43.025  34.730 62.555  1.00 57.03 ? 194 ILE E CD1 1 
ATOM   4481 N  N   . GLY E 3 76  ? 39.994  29.840 63.562  1.00 45.75 ? 195 GLY E N   1 
ATOM   4482 C  CA  . GLY E 3 76  ? 38.670  29.246 63.610  1.00 45.05 ? 195 GLY E CA  1 
ATOM   4483 C  C   . GLY E 3 76  ? 38.361  28.525 62.310  1.00 43.85 ? 195 GLY E C   1 
ATOM   4484 O  O   . GLY E 3 76  ? 39.182  27.771 61.795  1.00 42.67 ? 195 GLY E O   1 
ATOM   4485 N  N   . ASP E 3 77  ? 37.168  28.751 61.781  1.00 43.11 ? 196 ASP E N   1 
ATOM   4486 C  CA  . ASP E 3 77  ? 36.786  28.153 60.516  1.00 42.21 ? 196 ASP E CA  1 
ATOM   4487 C  C   . ASP E 3 77  ? 36.702  29.286 59.486  1.00 42.26 ? 196 ASP E C   1 
ATOM   4488 O  O   . ASP E 3 77  ? 35.898  29.245 58.559  1.00 41.94 ? 196 ASP E O   1 
ATOM   4489 C  CB  . ASP E 3 77  ? 35.447  27.420 60.663  1.00 41.37 ? 196 ASP E CB  1 
ATOM   4490 C  CG  . ASP E 3 77  ? 34.289  28.348 60.975  1.00 42.50 ? 196 ASP E CG  1 
ATOM   4491 O  OD1 . ASP E 3 77  ? 34.523  29.452 61.494  1.00 43.90 ? 196 ASP E OD1 1 
ATOM   4492 O  OD2 . ASP E 3 77  ? 33.134  27.963 60.713  1.00 43.10 ? 196 ASP E OD2 1 
ATOM   4493 N  N   . GLN E 3 78  ? 37.552  30.297 59.661  1.00 42.88 ? 197 GLN E N   1 
ATOM   4494 C  CA  . GLN E 3 78  ? 37.565  31.449 58.767  1.00 43.23 ? 197 GLN E CA  1 
ATOM   4495 C  C   . GLN E 3 78  ? 38.464  31.279 57.562  1.00 42.53 ? 197 GLN E C   1 
ATOM   4496 O  O   . GLN E 3 78  ? 39.681  31.136 57.680  1.00 42.07 ? 197 GLN E O   1 
ATOM   4497 C  CB  . GLN E 3 78  ? 37.958  32.729 59.512  1.00 43.60 ? 197 GLN E CB  1 
ATOM   4498 C  CG  . GLN E 3 78  ? 38.255  33.887 58.568  1.00 46.65 ? 197 GLN E CG  1 
ATOM   4499 C  CD  . GLN E 3 78  ? 38.342  35.235 59.262  1.00 48.70 ? 197 GLN E CD  1 
ATOM   4500 O  OE1 . GLN E 3 78  ? 39.034  36.139 58.788  1.00 49.48 ? 197 GLN E OE1 1 
ATOM   4501 N  NE2 . GLN E 3 78  ? 37.646  35.376 60.394  1.00 48.11 ? 197 GLN E NE2 1 
ATOM   4502 N  N   . VAL E 3 79  ? 37.825  31.321 56.401  1.00 41.96 ? 198 VAL E N   1 
ATOM   4503 C  CA  . VAL E 3 79  ? 38.476  31.193 55.111  1.00 40.62 ? 198 VAL E CA  1 
ATOM   4504 C  C   . VAL E 3 79  ? 38.398  32.527 54.364  1.00 40.97 ? 198 VAL E C   1 
ATOM   4505 O  O   . VAL E 3 79  ? 37.630  33.416 54.738  1.00 40.52 ? 198 VAL E O   1 
ATOM   4506 C  CB  . VAL E 3 79  ? 37.779  30.109 54.262  1.00 40.66 ? 198 VAL E CB  1 
ATOM   4507 C  CG1 . VAL E 3 79  ? 37.981  28.753 54.885  1.00 39.93 ? 198 VAL E CG1 1 
ATOM   4508 C  CG2 . VAL E 3 79  ? 36.285  30.410 54.160  1.00 39.93 ? 198 VAL E CG2 1 
ATOM   4509 N  N   . GLN E 3 80  ? 39.183  32.644 53.296  1.00 42.43 ? 199 GLN E N   1 
ATOM   4510 C  CA  . GLN E 3 80  ? 39.231  33.853 52.482  1.00 42.25 ? 199 GLN E CA  1 
ATOM   4511 C  C   . GLN E 3 80  ? 39.275  33.493 50.985  1.00 43.52 ? 199 GLN E C   1 
ATOM   4512 O  O   . GLN E 3 80  ? 39.769  32.421 50.619  1.00 43.70 ? 199 GLN E O   1 
ATOM   4513 C  CB  . GLN E 3 80  ? 40.464  34.665 52.897  1.00 39.65 ? 199 GLN E CB  1 
ATOM   4514 C  CG  . GLN E 3 80  ? 40.621  36.007 52.225  1.00 39.87 ? 199 GLN E CG  1 
ATOM   4515 C  CD  . GLN E 3 80  ? 41.536  36.946 52.995  1.00 39.01 ? 199 GLN E CD  1 
ATOM   4516 O  OE1 . GLN E 3 80  ? 42.526  36.528 53.582  1.00 39.02 ? 199 GLN E OE1 1 
ATOM   4517 N  NE2 . GLN E 3 80  ? 41.211  38.222 52.977  1.00 38.16 ? 199 GLN E NE2 1 
ATOM   4518 N  N   . CYS E 3 81  ? 38.744  34.378 50.131  1.00 43.65 ? 200 CYS E N   1 
ATOM   4519 C  CA  . CYS E 3 81  ? 38.730  34.178 48.674  1.00 42.60 ? 200 CYS E CA  1 
ATOM   4520 C  C   . CYS E 3 81  ? 39.977  34.777 48.013  1.00 41.93 ? 200 CYS E C   1 
ATOM   4521 O  O   . CYS E 3 81  ? 40.317  35.927 48.258  1.00 43.48 ? 200 CYS E O   1 
ATOM   4522 C  CB  . CYS E 3 81  ? 37.481  34.821 48.070  1.00 43.96 ? 200 CYS E CB  1 
ATOM   4523 S  SG  . CYS E 3 81  ? 37.495  34.897 46.272  1.00 46.70 ? 200 CYS E SG  1 
ATOM   4524 N  N   . PHE E 3 82  ? 40.649  34.007 47.168  1.00 40.58 ? 201 PHE E N   1 
ATOM   4525 C  CA  . PHE E 3 82  ? 41.859  34.484 46.502  1.00 41.13 ? 201 PHE E CA  1 
ATOM   4526 C  C   . PHE E 3 82  ? 41.558  35.636 45.547  1.00 42.20 ? 201 PHE E C   1 
ATOM   4527 O  O   . PHE E 3 82  ? 42.393  36.512 45.312  1.00 41.65 ? 201 PHE E O   1 
ATOM   4528 C  CB  . PHE E 3 82  ? 42.514  33.343 45.724  1.00 38.11 ? 201 PHE E CB  1 
ATOM   4529 C  CG  . PHE E 3 82  ? 41.834  33.024 44.427  1.00 38.25 ? 201 PHE E CG  1 
ATOM   4530 C  CD1 . PHE E 3 82  ? 42.327  33.523 43.227  1.00 38.32 ? 201 PHE E CD1 1 
ATOM   4531 C  CD2 . PHE E 3 82  ? 40.691  32.232 44.401  1.00 39.94 ? 201 PHE E CD2 1 
ATOM   4532 C  CE1 . PHE E 3 82  ? 41.694  33.240 42.019  1.00 38.01 ? 201 PHE E CE1 1 
ATOM   4533 C  CE2 . PHE E 3 82  ? 40.046  31.941 43.193  1.00 39.24 ? 201 PHE E CE2 1 
ATOM   4534 C  CZ  . PHE E 3 82  ? 40.550  32.448 42.003  1.00 38.94 ? 201 PHE E CZ  1 
ATOM   4535 N  N   . ALA E 3 83  ? 40.350  35.616 44.998  1.00 42.78 ? 202 ALA E N   1 
ATOM   4536 C  CA  . ALA E 3 83  ? 39.912  36.624 44.054  1.00 43.07 ? 202 ALA E CA  1 
ATOM   4537 C  C   . ALA E 3 83  ? 39.548  37.956 44.697  1.00 43.04 ? 202 ALA E C   1 
ATOM   4538 O  O   . ALA E 3 83  ? 40.291  38.927 44.580  1.00 41.48 ? 202 ALA E O   1 
ATOM   4539 C  CB  . ALA E 3 83  ? 38.726  36.095 43.259  1.00 43.77 ? 202 ALA E CB  1 
ATOM   4540 N  N   . CYS E 3 84  ? 38.404  37.986 45.379  1.00 43.45 ? 203 CYS E N   1 
ATOM   4541 C  CA  . CYS E 3 84  ? 37.894  39.205 46.009  1.00 42.97 ? 203 CYS E CA  1 
ATOM   4542 C  C   . CYS E 3 84  ? 38.498  39.565 47.357  1.00 42.55 ? 203 CYS E C   1 
ATOM   4543 O  O   . CYS E 3 84  ? 38.456  40.721 47.766  1.00 41.43 ? 203 CYS E O   1 
ATOM   4544 C  CB  . CYS E 3 84  ? 36.370  39.116 46.162  1.00 42.42 ? 203 CYS E CB  1 
ATOM   4545 S  SG  . CYS E 3 84  ? 35.837  37.819 47.284  1.00 44.38 ? 203 CYS E SG  1 
ATOM   4546 N  N   . GLY E 3 85  ? 39.042  38.578 48.054  1.00 42.04 ? 204 GLY E N   1 
ATOM   4547 C  CA  . GLY E 3 85  ? 39.624  38.848 49.352  1.00 40.67 ? 204 GLY E CA  1 
ATOM   4548 C  C   . GLY E 3 85  ? 38.603  38.793 50.468  1.00 40.42 ? 204 GLY E C   1 
ATOM   4549 O  O   . GLY E 3 85  ? 38.930  39.063 51.618  1.00 40.36 ? 204 GLY E O   1 
ATOM   4550 N  N   . GLY E 3 86  ? 37.365  38.448 50.125  1.00 41.69 ? 205 GLY E N   1 
ATOM   4551 C  CA  . GLY E 3 86  ? 36.308  38.355 51.114  1.00 43.19 ? 205 GLY E CA  1 
ATOM   4552 C  C   . GLY E 3 86  ? 36.579  37.284 52.159  1.00 45.01 ? 205 GLY E C   1 
ATOM   4553 O  O   . GLY E 3 86  ? 37.270  36.302 51.888  1.00 45.45 ? 205 GLY E O   1 
ATOM   4554 N  N   . LYS E 3 87  ? 36.038  37.469 53.359  1.00 44.96 ? 206 LYS E N   1 
ATOM   4555 C  CA  . LYS E 3 87  ? 36.239  36.507 54.425  1.00 45.50 ? 206 LYS E CA  1 
ATOM   4556 C  C   . LYS E 3 87  ? 34.926  35.896 54.870  1.00 46.12 ? 206 LYS E C   1 
ATOM   4557 O  O   . LYS E 3 87  ? 33.939  36.602 55.060  1.00 46.98 ? 206 LYS E O   1 
ATOM   4558 C  CB  . LYS E 3 87  ? 36.906  37.171 55.617  1.00 46.96 ? 206 LYS E CB  1 
ATOM   4559 C  CG  . LYS E 3 87  ? 38.384  37.493 55.438  1.00 49.60 ? 206 LYS E CG  1 
ATOM   4560 C  CD  . LYS E 3 87  ? 38.829  38.459 56.537  1.00 52.30 ? 206 LYS E CD  1 
ATOM   4561 C  CE  . LYS E 3 87  ? 40.325  38.650 56.585  1.00 52.97 ? 206 LYS E CE  1 
ATOM   4562 N  NZ  . LYS E 3 87  ? 40.990  37.413 57.061  1.00 55.11 ? 206 LYS E NZ  1 
ATOM   4563 N  N   . LEU E 3 88  ? 34.918  34.576 55.022  1.00 45.30 ? 207 LEU E N   1 
ATOM   4564 C  CA  . LEU E 3 88  ? 33.733  33.869 55.471  1.00 44.95 ? 207 LEU E CA  1 
ATOM   4565 C  C   . LEU E 3 88  ? 34.115  33.036 56.687  1.00 45.61 ? 207 LEU E C   1 
ATOM   4566 O  O   . LEU E 3 88  ? 35.221  32.502 56.752  1.00 45.73 ? 207 LEU E O   1 
ATOM   4567 C  CB  . LEU E 3 88  ? 33.196  32.990 54.354  1.00 44.00 ? 207 LEU E CB  1 
ATOM   4568 C  CG  . LEU E 3 88  ? 32.779  33.786 53.122  1.00 42.65 ? 207 LEU E CG  1 
ATOM   4569 C  CD1 . LEU E 3 88  ? 32.241  32.859 52.054  1.00 42.51 ? 207 LEU E CD1 1 
ATOM   4570 C  CD2 . LEU E 3 88  ? 31.716  34.782 53.521  1.00 43.77 ? 207 LEU E CD2 1 
ATOM   4571 N  N   . LYS E 3 89  ? 33.208  32.938 57.654  1.00 45.25 ? 208 LYS E N   1 
ATOM   4572 C  CA  . LYS E 3 89  ? 33.475  32.193 58.877  1.00 45.91 ? 208 LYS E CA  1 
ATOM   4573 C  C   . LYS E 3 89  ? 32.173  31.769 59.538  1.00 46.81 ? 208 LYS E C   1 
ATOM   4574 O  O   . LYS E 3 89  ? 31.090  32.087 59.052  1.00 46.34 ? 208 LYS E O   1 
ATOM   4575 C  CB  . LYS E 3 89  ? 34.281  33.062 59.851  1.00 45.59 ? 208 LYS E CB  1 
ATOM   4576 C  CG  . LYS E 3 89  ? 33.571  34.347 60.240  1.00 44.51 ? 208 LYS E CG  1 
ATOM   4577 C  CD  . LYS E 3 89  ? 34.372  35.214 61.206  1.00 45.34 ? 208 LYS E CD  1 
ATOM   4578 C  CE  . LYS E 3 89  ? 33.540  36.416 61.657  1.00 43.73 ? 208 LYS E CE  1 
ATOM   4579 N  NZ  . LYS E 3 89  ? 34.158  37.183 62.763  1.00 45.78 ? 208 LYS E NZ  1 
ATOM   4580 N  N   . ASN E 3 90  ? 32.291  31.055 60.653  1.00 47.31 ? 209 ASN E N   1 
ATOM   4581 C  CA  . ASN E 3 90  ? 31.131  30.591 61.394  1.00 46.73 ? 209 ASN E CA  1 
ATOM   4582 C  C   . ASN E 3 90  ? 30.130  29.858 60.492  1.00 47.45 ? 209 ASN E C   1 
ATOM   4583 O  O   . ASN E 3 90  ? 28.930  30.144 60.501  1.00 48.31 ? 209 ASN E O   1 
ATOM   4584 C  CB  . ASN E 3 90  ? 30.469  31.772 62.106  1.00 47.03 ? 209 ASN E CB  1 
ATOM   4585 C  CG  . ASN E 3 90  ? 31.379  32.404 63.143  1.00 50.64 ? 209 ASN E CG  1 
ATOM   4586 O  OD1 . ASN E 3 90  ? 32.076  31.701 63.862  1.00 53.23 ? 209 ASN E OD1 1 
ATOM   4587 N  ND2 . ASN E 3 90  ? 31.370  33.733 63.234  1.00 52.40 ? 209 ASN E ND2 1 
ATOM   4588 N  N   . TRP E 3 91  ? 30.638  28.898 59.723  1.00 46.42 ? 210 TRP E N   1 
ATOM   4589 C  CA  . TRP E 3 91  ? 29.818  28.106 58.815  1.00 46.84 ? 210 TRP E CA  1 
ATOM   4590 C  C   . TRP E 3 91  ? 28.800  27.222 59.536  1.00 49.04 ? 210 TRP E C   1 
ATOM   4591 O  O   . TRP E 3 91  ? 29.164  26.419 60.387  1.00 51.12 ? 210 TRP E O   1 
ATOM   4592 C  CB  . TRP E 3 91  ? 30.707  27.215 57.956  1.00 42.89 ? 210 TRP E CB  1 
ATOM   4593 C  CG  . TRP E 3 91  ? 31.710  27.972 57.199  1.00 40.86 ? 210 TRP E CG  1 
ATOM   4594 C  CD1 . TRP E 3 91  ? 32.864  28.508 57.680  1.00 39.74 ? 210 TRP E CD1 1 
ATOM   4595 C  CD2 . TRP E 3 91  ? 31.621  28.371 55.827  1.00 39.35 ? 210 TRP E CD2 1 
ATOM   4596 N  NE1 . TRP E 3 91  ? 33.501  29.225 56.694  1.00 38.92 ? 210 TRP E NE1 1 
ATOM   4597 C  CE2 . TRP E 3 91  ? 32.756  29.157 55.548  1.00 37.58 ? 210 TRP E CE2 1 
ATOM   4598 C  CE3 . TRP E 3 91  ? 30.690  28.142 54.808  1.00 38.35 ? 210 TRP E CE3 1 
ATOM   4599 C  CZ2 . TRP E 3 91  ? 32.983  29.715 54.300  1.00 37.06 ? 210 TRP E CZ2 1 
ATOM   4600 C  CZ3 . TRP E 3 91  ? 30.919  28.695 53.565  1.00 36.94 ? 210 TRP E CZ3 1 
ATOM   4601 C  CH2 . TRP E 3 91  ? 32.055  29.473 53.323  1.00 37.29 ? 210 TRP E CH2 1 
ATOM   4602 N  N   . GLU E 3 92  ? 27.527  27.351 59.176  1.00 50.10 ? 211 GLU E N   1 
ATOM   4603 C  CA  . GLU E 3 92  ? 26.472  26.554 59.787  1.00 49.70 ? 211 GLU E CA  1 
ATOM   4604 C  C   . GLU E 3 92  ? 26.121  25.369 58.904  1.00 48.94 ? 211 GLU E C   1 
ATOM   4605 O  O   . GLU E 3 92  ? 26.302  25.414 57.689  1.00 48.99 ? 211 GLU E O   1 
ATOM   4606 C  CB  . GLU E 3 92  ? 25.229  27.410 60.001  1.00 51.45 ? 211 GLU E CB  1 
ATOM   4607 C  CG  . GLU E 3 92  ? 25.383  28.472 61.075  1.00 56.42 ? 211 GLU E CG  1 
ATOM   4608 C  CD  . GLU E 3 92  ? 24.290  29.527 60.994  1.00 59.22 ? 211 GLU E CD  1 
ATOM   4609 O  OE1 . GLU E 3 92  ? 23.095  29.143 60.984  1.00 61.33 ? 211 GLU E OE1 1 
ATOM   4610 O  OE2 . GLU E 3 92  ? 24.630  30.737 60.935  1.00 60.47 ? 211 GLU E OE2 1 
ATOM   4611 N  N   . PRO E 3 93  ? 25.602  24.289 59.502  1.00 48.10 ? 212 PRO E N   1 
ATOM   4612 C  CA  . PRO E 3 93  ? 25.227  23.094 58.744  1.00 46.73 ? 212 PRO E CA  1 
ATOM   4613 C  C   . PRO E 3 93  ? 24.350  23.483 57.570  1.00 46.04 ? 212 PRO E C   1 
ATOM   4614 O  O   . PRO E 3 93  ? 23.475  24.335 57.701  1.00 46.84 ? 212 PRO E O   1 
ATOM   4615 C  CB  . PRO E 3 93  ? 24.459  22.270 59.764  1.00 46.81 ? 212 PRO E CB  1 
ATOM   4616 C  CG  . PRO E 3 93  ? 25.103  22.644 61.040  1.00 47.64 ? 212 PRO E CG  1 
ATOM   4617 C  CD  . PRO E 3 93  ? 25.231  24.138 60.915  1.00 48.29 ? 212 PRO E CD  1 
ATOM   4618 N  N   . GLY E 3 94  ? 24.581  22.864 56.424  1.00 45.08 ? 213 GLY E N   1 
ATOM   4619 C  CA  . GLY E 3 94  ? 23.776  23.182 55.263  1.00 43.66 ? 213 GLY E CA  1 
ATOM   4620 C  C   . GLY E 3 94  ? 24.405  24.265 54.411  1.00 43.83 ? 213 GLY E C   1 
ATOM   4621 O  O   . GLY E 3 94  ? 23.991  24.494 53.278  1.00 43.94 ? 213 GLY E O   1 
ATOM   4622 N  N   . ASP E 3 95  ? 25.411  24.938 54.953  1.00 44.00 ? 214 ASP E N   1 
ATOM   4623 C  CA  . ASP E 3 95  ? 26.082  25.986 54.207  1.00 44.34 ? 214 ASP E CA  1 
ATOM   4624 C  C   . ASP E 3 95  ? 26.989  25.431 53.113  1.00 45.39 ? 214 ASP E C   1 
ATOM   4625 O  O   . ASP E 3 95  ? 28.029  24.833 53.391  1.00 46.59 ? 214 ASP E O   1 
ATOM   4626 C  CB  . ASP E 3 95  ? 26.899  26.869 55.149  1.00 44.91 ? 214 ASP E CB  1 
ATOM   4627 C  CG  . ASP E 3 95  ? 26.041  27.859 55.905  1.00 46.57 ? 214 ASP E CG  1 
ATOM   4628 O  OD1 . ASP E 3 95  ? 24.834  27.962 55.605  1.00 47.30 ? 214 ASP E OD1 1 
ATOM   4629 O  OD2 . ASP E 3 95  ? 26.571  28.547 56.795  1.00 45.59 ? 214 ASP E OD2 1 
ATOM   4630 N  N   . ARG E 3 96  ? 26.580  25.610 51.865  1.00 44.93 ? 215 ARG E N   1 
ATOM   4631 C  CA  . ARG E 3 96  ? 27.389  25.156 50.744  1.00 45.81 ? 215 ARG E CA  1 
ATOM   4632 C  C   . ARG E 3 96  ? 28.382  26.292 50.451  1.00 46.18 ? 215 ARG E C   1 
ATOM   4633 O  O   . ARG E 3 96  ? 27.996  27.449 50.302  1.00 45.25 ? 215 ARG E O   1 
ATOM   4634 C  CB  . ARG E 3 96  ? 26.520  24.867 49.505  1.00 45.23 ? 215 ARG E CB  1 
ATOM   4635 C  CG  . ARG E 3 96  ? 25.472  23.756 49.640  1.00 45.67 ? 215 ARG E CG  1 
ATOM   4636 C  CD  . ARG E 3 96  ? 26.054  22.336 49.780  1.00 45.94 ? 215 ARG E CD  1 
ATOM   4637 N  NE  . ARG E 3 96  ? 26.288  21.960 51.177  1.00 46.75 ? 215 ARG E NE  1 
ATOM   4638 C  CZ  . ARG E 3 96  ? 27.459  22.074 51.794  1.00 46.04 ? 215 ARG E CZ  1 
ATOM   4639 N  NH1 . ARG E 3 96  ? 28.506  22.539 51.133  1.00 46.52 ? 215 ARG E NH1 1 
ATOM   4640 N  NH2 . ARG E 3 96  ? 27.578  21.759 53.076  1.00 45.42 ? 215 ARG E NH2 1 
ATOM   4641 N  N   . ALA E 3 97  ? 29.663  25.951 50.390  1.00 47.02 ? 216 ALA E N   1 
ATOM   4642 C  CA  . ALA E 3 97  ? 30.719  26.921 50.140  1.00 47.36 ? 216 ALA E CA  1 
ATOM   4643 C  C   . ALA E 3 97  ? 30.360  27.946 49.076  1.00 48.49 ? 216 ALA E C   1 
ATOM   4644 O  O   . ALA E 3 97  ? 30.210  29.130 49.347  1.00 48.48 ? 216 ALA E O   1 
ATOM   4645 C  CB  . ALA E 3 97  ? 31.993  26.197 49.734  1.00 45.96 ? 216 ALA E CB  1 
ATOM   4646 N  N   . TRP E 3 98  ? 30.227  27.469 47.852  1.00 51.23 ? 217 TRP E N   1 
ATOM   4647 C  CA  . TRP E 3 98  ? 29.920  28.320 46.714  1.00 53.11 ? 217 TRP E CA  1 
ATOM   4648 C  C   . TRP E 3 98  ? 28.703  29.234 46.864  1.00 51.62 ? 217 TRP E C   1 
ATOM   4649 O  O   . TRP E 3 98  ? 28.760  30.410 46.519  1.00 50.43 ? 217 TRP E O   1 
ATOM   4650 C  CB  . TRP E 3 98  ? 29.758  27.450 45.476  1.00 57.44 ? 217 TRP E CB  1 
ATOM   4651 C  CG  . TRP E 3 98  ? 29.175  28.188 44.376  1.00 64.92 ? 217 TRP E CG  1 
ATOM   4652 C  CD1 . TRP E 3 98  ? 29.826  29.019 43.485  1.00 66.88 ? 217 TRP E CD1 1 
ATOM   4653 C  CD2 . TRP E 3 98  ? 27.780  28.283 44.081  1.00 68.04 ? 217 TRP E CD2 1 
ATOM   4654 N  NE1 . TRP E 3 98  ? 28.901  29.628 42.651  1.00 70.84 ? 217 TRP E NE1 1 
ATOM   4655 C  CE2 . TRP E 3 98  ? 27.639  29.199 42.998  1.00 70.42 ? 217 TRP E CE2 1 
ATOM   4656 C  CE3 . TRP E 3 98  ? 26.629  27.693 44.631  1.00 67.75 ? 217 TRP E CE3 1 
ATOM   4657 C  CZ2 . TRP E 3 98  ? 26.382  29.538 42.459  1.00 70.46 ? 217 TRP E CZ2 1 
ATOM   4658 C  CZ3 . TRP E 3 98  ? 25.380  28.030 44.096  1.00 68.86 ? 217 TRP E CZ3 1 
ATOM   4659 C  CH2 . TRP E 3 98  ? 25.271  28.948 43.018  1.00 70.01 ? 217 TRP E CH2 1 
ATOM   4660 N  N   . SER E 3 99  ? 27.601  28.686 47.362  1.00 50.65 ? 218 SER E N   1 
ATOM   4661 C  CA  . SER E 3 99  ? 26.385  29.463 47.549  1.00 49.18 ? 218 SER E CA  1 
ATOM   4662 C  C   . SER E 3 99  ? 26.622  30.622 48.519  1.00 48.68 ? 218 SER E C   1 
ATOM   4663 O  O   . SER E 3 99  ? 26.187  31.744 48.276  1.00 48.37 ? 218 SER E O   1 
ATOM   4664 C  CB  . SER E 3 99  ? 25.273  28.560 48.072  1.00 50.11 ? 218 SER E CB  1 
ATOM   4665 O  OG  . SER E 3 99  ? 24.029  29.226 48.034  1.00 53.53 ? 218 SER E OG  1 
ATOM   4666 N  N   . GLU E 3 100 ? 27.309  30.350 49.622  1.00 47.53 ? 219 GLU E N   1 
ATOM   4667 C  CA  . GLU E 3 100 ? 27.604  31.389 50.596  1.00 46.37 ? 219 GLU E CA  1 
ATOM   4668 C  C   . GLU E 3 100 ? 28.548  32.423 50.011  1.00 45.81 ? 219 GLU E C   1 
ATOM   4669 O  O   . GLU E 3 100 ? 28.419  33.615 50.268  1.00 45.64 ? 219 GLU E O   1 
ATOM   4670 C  CB  . GLU E 3 100 ? 28.243  30.789 51.849  1.00 46.30 ? 219 GLU E CB  1 
ATOM   4671 C  CG  . GLU E 3 100 ? 27.260  30.125 52.778  1.00 46.51 ? 219 GLU E CG  1 
ATOM   4672 C  CD  . GLU E 3 100 ? 26.203  31.080 53.244  1.00 44.98 ? 219 GLU E CD  1 
ATOM   4673 O  OE1 . GLU E 3 100 ? 26.517  31.979 54.045  1.00 47.24 ? 219 GLU E OE1 1 
ATOM   4674 O  OE2 . GLU E 3 100 ? 25.059  30.940 52.796  1.00 44.99 ? 219 GLU E OE2 1 
ATOM   4675 N  N   . HIS E 3 101 ? 29.503  31.956 49.224  1.00 44.31 ? 220 HIS E N   1 
ATOM   4676 C  CA  . HIS E 3 101 ? 30.481  32.837 48.622  1.00 44.61 ? 220 HIS E CA  1 
ATOM   4677 C  C   . HIS E 3 101 ? 29.848  33.948 47.792  1.00 46.63 ? 220 HIS E C   1 
ATOM   4678 O  O   . HIS E 3 101 ? 30.236  35.109 47.900  1.00 46.03 ? 220 HIS E O   1 
ATOM   4679 C  CB  . HIS E 3 101 ? 31.443  32.031 47.748  1.00 43.23 ? 220 HIS E CB  1 
ATOM   4680 C  CG  . HIS E 3 101 ? 32.635  32.810 47.299  1.00 40.61 ? 220 HIS E CG  1 
ATOM   4681 N  ND1 . HIS E 3 101 ? 33.630  32.264 46.524  1.00 40.03 ? 220 HIS E ND1 1 
ATOM   4682 C  CD2 . HIS E 3 101 ? 33.001  34.091 47.539  1.00 40.35 ? 220 HIS E CD2 1 
ATOM   4683 C  CE1 . HIS E 3 101 ? 34.561  33.176 46.304  1.00 39.99 ? 220 HIS E CE1 1 
ATOM   4684 N  NE2 . HIS E 3 101 ? 34.202  34.293 46.909  1.00 39.96 ? 220 HIS E NE2 1 
ATOM   4685 N  N   . ARG E 3 102 ? 28.875  33.600 46.957  1.00 48.60 ? 221 ARG E N   1 
ATOM   4686 C  CA  . ARG E 3 102 ? 28.240  34.611 46.124  1.00 51.16 ? 221 ARG E CA  1 
ATOM   4687 C  C   . ARG E 3 102 ? 27.167  35.420 46.854  1.00 51.53 ? 221 ARG E C   1 
ATOM   4688 O  O   . ARG E 3 102 ? 26.855  36.538 46.457  1.00 50.32 ? 221 ARG E O   1 
ATOM   4689 C  CB  . ARG E 3 102 ? 27.638  33.979 44.867  1.00 53.06 ? 221 ARG E CB  1 
ATOM   4690 C  CG  . ARG E 3 102 ? 26.271  33.376 45.042  1.00 55.01 ? 221 ARG E CG  1 
ATOM   4691 C  CD  . ARG E 3 102 ? 25.636  33.099 43.693  1.00 57.89 ? 221 ARG E CD  1 
ATOM   4692 N  NE  . ARG E 3 102 ? 24.329  32.457 43.846  1.00 61.45 ? 221 ARG E NE  1 
ATOM   4693 C  CZ  . ARG E 3 102 ? 23.415  32.358 42.883  1.00 61.84 ? 221 ARG E CZ  1 
ATOM   4694 N  NH1 . ARG E 3 102 ? 23.652  32.860 41.670  1.00 62.61 ? 221 ARG E NH1 1 
ATOM   4695 N  NH2 . ARG E 3 102 ? 22.253  31.768 43.143  1.00 62.18 ? 221 ARG E NH2 1 
ATOM   4696 N  N   . ARG E 3 103 ? 26.600  34.849 47.911  1.00 51.20 ? 222 ARG E N   1 
ATOM   4697 C  CA  . ARG E 3 103 ? 25.582  35.543 48.678  1.00 51.68 ? 222 ARG E CA  1 
ATOM   4698 C  C   . ARG E 3 103 ? 26.208  36.775 49.329  1.00 50.87 ? 222 ARG E C   1 
ATOM   4699 O  O   . ARG E 3 103 ? 25.631  37.859 49.315  1.00 51.65 ? 222 ARG E O   1 
ATOM   4700 C  CB  . ARG E 3 103 ? 25.018  34.622 49.757  1.00 53.53 ? 222 ARG E CB  1 
ATOM   4701 C  CG  . ARG E 3 103 ? 23.706  35.079 50.370  1.00 57.13 ? 222 ARG E CG  1 
ATOM   4702 C  CD  . ARG E 3 103 ? 23.402  34.268 51.624  1.00 60.93 ? 222 ARG E CD  1 
ATOM   4703 N  NE  . ARG E 3 103 ? 23.785  34.990 52.838  1.00 64.11 ? 222 ARG E NE  1 
ATOM   4704 C  CZ  . ARG E 3 103 ? 23.913  34.424 54.037  1.00 66.57 ? 222 ARG E CZ  1 
ATOM   4705 N  NH1 . ARG E 3 103 ? 23.694  33.117 54.186  1.00 68.15 ? 222 ARG E NH1 1 
ATOM   4706 N  NH2 . ARG E 3 103 ? 24.251  35.162 55.092  1.00 67.33 ? 222 ARG E NH2 1 
ATOM   4707 N  N   . HIS E 3 104 ? 27.397  36.605 49.896  1.00 49.74 ? 223 HIS E N   1 
ATOM   4708 C  CA  . HIS E 3 104 ? 28.098  37.704 50.558  1.00 47.43 ? 223 HIS E CA  1 
ATOM   4709 C  C   . HIS E 3 104 ? 28.998  38.513 49.639  1.00 46.57 ? 223 HIS E C   1 
ATOM   4710 O  O   . HIS E 3 104 ? 29.393  39.621 49.986  1.00 46.37 ? 223 HIS E O   1 
ATOM   4711 C  CB  . HIS E 3 104 ? 28.954  37.187 51.714  1.00 47.04 ? 223 HIS E CB  1 
ATOM   4712 C  CG  . HIS E 3 104 ? 28.166  36.676 52.873  1.00 47.44 ? 223 HIS E CG  1 
ATOM   4713 N  ND1 . HIS E 3 104 ? 28.156  37.299 54.099  1.00 48.63 ? 223 HIS E ND1 1 
ATOM   4714 C  CD2 . HIS E 3 104 ? 27.354  35.603 52.988  1.00 46.60 ? 223 HIS E CD2 1 
ATOM   4715 C  CE1 . HIS E 3 104 ? 27.368  36.634 54.923  1.00 48.25 ? 223 HIS E CE1 1 
ATOM   4716 N  NE2 . HIS E 3 104 ? 26.870  35.600 54.271  1.00 47.96 ? 223 HIS E NE2 1 
ATOM   4717 N  N   . PHE E 3 105 ? 29.343  37.963 48.481  1.00 45.21 ? 224 PHE E N   1 
ATOM   4718 C  CA  . PHE E 3 105 ? 30.208  38.681 47.557  1.00 43.14 ? 224 PHE E CA  1 
ATOM   4719 C  C   . PHE E 3 105 ? 29.767  38.467 46.128  1.00 43.59 ? 224 PHE E C   1 
ATOM   4720 O  O   . PHE E 3 105 ? 30.528  37.972 45.307  1.00 43.46 ? 224 PHE E O   1 
ATOM   4721 C  CB  . PHE E 3 105 ? 31.645  38.223 47.743  1.00 40.28 ? 224 PHE E CB  1 
ATOM   4722 C  CG  . PHE E 3 105 ? 32.144  38.390 49.137  1.00 37.37 ? 224 PHE E CG  1 
ATOM   4723 C  CD1 . PHE E 3 105 ? 32.307  37.288 49.971  1.00 38.10 ? 224 PHE E CD1 1 
ATOM   4724 C  CD2 . PHE E 3 105 ? 32.430  39.652 49.633  1.00 36.06 ? 224 PHE E CD2 1 
ATOM   4725 C  CE1 . PHE E 3 105 ? 32.749  37.443 51.279  1.00 37.80 ? 224 PHE E CE1 1 
ATOM   4726 C  CE2 . PHE E 3 105 ? 32.871  39.821 50.943  1.00 37.29 ? 224 PHE E CE2 1 
ATOM   4727 C  CZ  . PHE E 3 105 ? 33.031  38.715 51.768  1.00 36.91 ? 224 PHE E CZ  1 
ATOM   4728 N  N   . PRO E 3 106 ? 28.525  38.873 45.812  1.00 44.55 ? 225 PRO E N   1 
ATOM   4729 C  CA  . PRO E 3 106 ? 27.930  38.737 44.483  1.00 44.43 ? 225 PRO E CA  1 
ATOM   4730 C  C   . PRO E 3 106 ? 28.666  39.512 43.419  1.00 44.92 ? 225 PRO E C   1 
ATOM   4731 O  O   . PRO E 3 106 ? 28.427  39.309 42.235  1.00 46.79 ? 225 PRO E O   1 
ATOM   4732 C  CB  . PRO E 3 106 ? 26.515  39.248 44.694  1.00 43.61 ? 225 PRO E CB  1 
ATOM   4733 C  CG  . PRO E 3 106 ? 26.717  40.322 45.688  1.00 42.46 ? 225 PRO E CG  1 
ATOM   4734 C  CD  . PRO E 3 106 ? 27.661  39.701 46.675  1.00 43.07 ? 225 PRO E CD  1 
ATOM   4735 N  N   . ASN E 3 107 ? 29.579  40.378 43.844  1.00 44.74 ? 226 ASN E N   1 
ATOM   4736 C  CA  . ASN E 3 107 ? 30.338  41.199 42.912  1.00 46.43 ? 226 ASN E CA  1 
ATOM   4737 C  C   . ASN E 3 107 ? 31.760  40.688 42.670  1.00 46.67 ? 226 ASN E C   1 
ATOM   4738 O  O   . ASN E 3 107 ? 32.562  41.337 41.997  1.00 47.84 ? 226 ASN E O   1 
ATOM   4739 C  CB  . ASN E 3 107 ? 30.381  42.641 43.420  1.00 46.47 ? 226 ASN E CB  1 
ATOM   4740 C  CG  . ASN E 3 107 ? 30.129  43.655 42.321  1.00 46.50 ? 226 ASN E CG  1 
ATOM   4741 O  OD1 . ASN E 3 107 ? 29.186  43.522 41.546  1.00 47.15 ? 226 ASN E OD1 1 
ATOM   4742 N  ND2 . ASN E 3 107 ? 30.965  44.681 42.259  1.00 47.20 ? 226 ASN E ND2 1 
ATOM   4743 N  N   . CYS E 3 108 ? 32.063  39.517 43.215  1.00 46.62 ? 227 CYS E N   1 
ATOM   4744 C  CA  . CYS E 3 108 ? 33.377  38.892 43.070  1.00 45.63 ? 227 CYS E CA  1 
ATOM   4745 C  C   . CYS E 3 108 ? 33.617  38.337 41.667  1.00 44.15 ? 227 CYS E C   1 
ATOM   4746 O  O   . CYS E 3 108 ? 32.735  37.741 41.071  1.00 44.12 ? 227 CYS E O   1 
ATOM   4747 C  CB  . CYS E 3 108 ? 33.515  37.771 44.100  1.00 46.78 ? 227 CYS E CB  1 
ATOM   4748 S  SG  . CYS E 3 108 ? 34.815  36.578 43.778  1.00 50.82 ? 227 CYS E SG  1 
ATOM   4749 N  N   . PHE E 3 109 ? 34.821  38.534 41.148  1.00 42.87 ? 228 PHE E N   1 
ATOM   4750 C  CA  . PHE E 3 109 ? 35.168  38.054 39.815  1.00 42.32 ? 228 PHE E CA  1 
ATOM   4751 C  C   . PHE E 3 109 ? 35.029  36.548 39.694  1.00 42.24 ? 228 PHE E C   1 
ATOM   4752 O  O   . PHE E 3 109 ? 34.449  36.041 38.730  1.00 42.27 ? 228 PHE E O   1 
ATOM   4753 C  CB  . PHE E 3 109 ? 36.606  38.447 39.459  1.00 41.85 ? 228 PHE E CB  1 
ATOM   4754 C  CG  . PHE E 3 109 ? 36.781  39.904 39.122  1.00 40.61 ? 228 PHE E CG  1 
ATOM   4755 C  CD1 . PHE E 3 109 ? 36.100  40.887 39.830  1.00 39.75 ? 228 PHE E CD1 1 
ATOM   4756 C  CD2 . PHE E 3 109 ? 37.677  40.292 38.135  1.00 39.38 ? 228 PHE E CD2 1 
ATOM   4757 C  CE1 . PHE E 3 109 ? 36.313  42.225 39.566  1.00 38.48 ? 228 PHE E CE1 1 
ATOM   4758 C  CE2 . PHE E 3 109 ? 37.898  41.625 37.864  1.00 38.96 ? 228 PHE E CE2 1 
ATOM   4759 C  CZ  . PHE E 3 109 ? 37.215  42.596 38.583  1.00 39.87 ? 228 PHE E CZ  1 
ATOM   4760 N  N   . PHE E 3 110 ? 35.579  35.824 40.662  1.00 42.18 ? 229 PHE E N   1 
ATOM   4761 C  CA  . PHE E 3 110 ? 35.496  34.373 40.625  1.00 41.50 ? 229 PHE E CA  1 
ATOM   4762 C  C   . PHE E 3 110 ? 34.026  33.963 40.625  1.00 41.76 ? 229 PHE E C   1 
ATOM   4763 O  O   . PHE E 3 110 ? 33.623  33.046 39.916  1.00 42.43 ? 229 PHE E O   1 
ATOM   4764 C  CB  . PHE E 3 110 ? 36.209  33.759 41.827  1.00 39.52 ? 229 PHE E CB  1 
ATOM   4765 C  CG  . PHE E 3 110 ? 36.387  32.271 41.720  1.00 40.12 ? 229 PHE E CG  1 
ATOM   4766 C  CD1 . PHE E 3 110 ? 37.293  31.727 40.808  1.00 40.57 ? 229 PHE E CD1 1 
ATOM   4767 C  CD2 . PHE E 3 110 ? 35.636  31.406 42.512  1.00 38.25 ? 229 PHE E CD2 1 
ATOM   4768 C  CE1 . PHE E 3 110 ? 37.446  30.346 40.690  1.00 40.07 ? 229 PHE E CE1 1 
ATOM   4769 C  CE2 . PHE E 3 110 ? 35.781  30.028 42.400  1.00 38.22 ? 229 PHE E CE2 1 
ATOM   4770 C  CZ  . PHE E 3 110 ? 36.687  29.497 41.488  1.00 38.85 ? 229 PHE E CZ  1 
ATOM   4771 N  N   . VAL E 3 111 ? 33.230  34.657 41.427  1.00 42.24 ? 230 VAL E N   1 
ATOM   4772 C  CA  . VAL E 3 111 ? 31.804  34.386 41.520  1.00 44.40 ? 230 VAL E CA  1 
ATOM   4773 C  C   . VAL E 3 111 ? 31.082  34.713 40.224  1.00 45.35 ? 230 VAL E C   1 
ATOM   4774 O  O   . VAL E 3 111 ? 30.187  33.989 39.803  1.00 45.81 ? 230 VAL E O   1 
ATOM   4775 C  CB  . VAL E 3 111 ? 31.141  35.233 42.620  1.00 45.72 ? 230 VAL E CB  1 
ATOM   4776 C  CG1 . VAL E 3 111 ? 29.631  35.051 42.566  1.00 45.71 ? 230 VAL E CG1 1 
ATOM   4777 C  CG2 . VAL E 3 111 ? 31.685  34.856 43.989  1.00 46.48 ? 230 VAL E CG2 1 
ATOM   4778 N  N   . LEU E 3 112 ? 31.469  35.826 39.614  1.00 46.31 ? 231 LEU E N   1 
ATOM   4779 C  CA  . LEU E 3 112 ? 30.874  36.300 38.378  1.00 46.59 ? 231 LEU E CA  1 
ATOM   4780 C  C   . LEU E 3 112 ? 31.351  35.598 37.109  1.00 47.37 ? 231 LEU E C   1 
ATOM   4781 O  O   . LEU E 3 112 ? 30.593  35.464 36.161  1.00 48.78 ? 231 LEU E O   1 
ATOM   4782 C  CB  . LEU E 3 112 ? 31.126  37.799 38.238  1.00 45.24 ? 231 LEU E CB  1 
ATOM   4783 C  CG  . LEU E 3 112 ? 30.402  38.719 39.210  1.00 44.63 ? 231 LEU E CG  1 
ATOM   4784 C  CD1 . LEU E 3 112 ? 30.957  40.122 39.085  1.00 43.35 ? 231 LEU E CD1 1 
ATOM   4785 C  CD2 . LEU E 3 112 ? 28.915  38.693 38.911  1.00 43.64 ? 231 LEU E CD2 1 
ATOM   4786 N  N   . GLY E 3 113 ? 32.598  35.150 37.082  1.00 47.69 ? 232 GLY E N   1 
ATOM   4787 C  CA  . GLY E 3 113 ? 33.103  34.519 35.881  1.00 48.76 ? 232 GLY E CA  1 
ATOM   4788 C  C   . GLY E 3 113 ? 33.949  35.505 35.087  1.00 49.78 ? 232 GLY E C   1 
ATOM   4789 O  O   . GLY E 3 113 ? 34.282  35.254 33.933  1.00 50.23 ? 232 GLY E O   1 
ATOM   4790 N  N   . ARG E 3 114 ? 34.283  36.639 35.698  1.00 49.54 ? 233 ARG E N   1 
ATOM   4791 C  CA  . ARG E 3 114 ? 35.120  37.633 35.044  1.00 51.25 ? 233 ARG E CA  1 
ATOM   4792 C  C   . ARG E 3 114 ? 36.524  37.037 35.069  1.00 53.56 ? 233 ARG E C   1 
ATOM   4793 O  O   . ARG E 3 114 ? 36.925  36.397 36.043  1.00 51.81 ? 233 ARG E O   1 
ATOM   4794 C  CB  . ARG E 3 114 ? 35.056  38.961 35.810  1.00 50.48 ? 233 ARG E CB  1 
ATOM   4795 C  CG  . ARG E 3 114 ? 35.866  40.159 35.259  1.00 49.22 ? 233 ARG E CG  1 
ATOM   4796 C  CD  . ARG E 3 114 ? 35.025  41.418 35.462  1.00 49.36 ? 233 ARG E CD  1 
ATOM   4797 N  NE  . ARG E 3 114 ? 35.715  42.681 35.710  1.00 49.86 ? 233 ARG E NE  1 
ATOM   4798 C  CZ  . ARG E 3 114 ? 36.601  43.250 34.904  1.00 51.80 ? 233 ARG E CZ  1 
ATOM   4799 N  NH1 . ARG E 3 114 ? 36.958  42.671 33.762  1.00 53.18 ? 233 ARG E NH1 1 
ATOM   4800 N  NH2 . ARG E 3 114 ? 37.100  44.436 35.223  1.00 53.24 ? 233 ARG E NH2 1 
ATOM   4801 N  N   . ASN E 3 115 ? 37.262  37.225 33.984  1.00 57.37 ? 234 ASN E N   1 
ATOM   4802 C  CA  . ASN E 3 115 ? 38.607  36.674 33.877  1.00 61.13 ? 234 ASN E CA  1 
ATOM   4803 C  C   . ASN E 3 115 ? 39.525  37.136 35.000  1.00 62.17 ? 234 ASN E C   1 
ATOM   4804 O  O   . ASN E 3 115 ? 39.551  38.327 35.324  1.00 62.16 ? 234 ASN E O   1 
ATOM   4805 C  CB  . ASN E 3 115 ? 39.220  37.066 32.523  1.00 63.45 ? 234 ASN E CB  1 
ATOM   4806 C  CG  . ASN E 3 115 ? 38.365  36.601 31.336  1.00 67.29 ? 234 ASN E CG  1 
ATOM   4807 O  OD1 . ASN E 3 115 ? 38.631  36.958 30.171  1.00 69.48 ? 234 ASN E OD1 1 
ATOM   4808 N  ND2 . ASN E 3 115 ? 37.334  35.796 31.626  1.00 67.77 ? 234 ASN E ND2 1 
ATOM   4809 N  N   . LEU E 3 116 ? 40.264  36.201 35.601  1.00 63.26 ? 235 LEU E N   1 
ATOM   4810 C  CA  . LEU E 3 116 ? 41.214  36.580 36.638  1.00 65.48 ? 235 LEU E CA  1 
ATOM   4811 C  C   . LEU E 3 116 ? 42.556  36.971 36.001  1.00 67.33 ? 235 LEU E C   1 
ATOM   4812 O  O   . LEU E 3 116 ? 42.790  38.172 35.816  1.00 68.53 ? 235 LEU E O   1 
ATOM   4813 C  CB  . LEU E 3 116 ? 41.379  35.484 37.693  1.00 65.14 ? 235 LEU E CB  1 
ATOM   4814 C  CG  . LEU E 3 116 ? 40.590  35.781 38.995  1.00 64.44 ? 235 LEU E CG  1 
ATOM   4815 C  CD1 . LEU E 3 116 ? 40.457  37.298 39.207  1.00 62.23 ? 235 LEU E CD1 1 
ATOM   4816 C  CD2 . LEU E 3 116 ? 39.200  35.165 38.939  1.00 64.49 ? 235 LEU E CD2 1 
ATOM   4817 N  N   . ASN E 3 117 ? 43.445  36.029 35.677  1.00 69.07 ? 236 ASN E N   1 
ATOM   4818 C  CA  . ASN E 3 117 ? 44.689  36.453 34.998  1.00 72.32 ? 236 ASN E CA  1 
ATOM   4819 C  C   . ASN E 3 117 ? 45.560  35.375 34.312  1.00 75.69 ? 236 ASN E C   1 
ATOM   4820 O  O   . ASN E 3 117 ? 46.111  34.459 34.965  1.00 76.89 ? 236 ASN E O   1 
ATOM   4821 C  CB  . ASN E 3 117 ? 45.575  37.301 35.929  1.00 70.40 ? 236 ASN E CB  1 
ATOM   4822 C  CG  . ASN E 3 117 ? 46.420  36.466 36.857  1.00 70.54 ? 236 ASN E CG  1 
ATOM   4823 O  OD1 . ASN E 3 117 ? 47.508  36.875 37.283  1.00 69.60 ? 236 ASN E OD1 1 
ATOM   4824 N  ND2 . ASN E 3 117 ? 45.923  35.285 37.190  1.00 71.53 ? 236 ASN E ND2 1 
ATOM   4825 N  N   . ILE E 3 118 ? 45.671  35.488 32.982  1.00 78.15 ? 237 ILE E N   1 
ATOM   4826 C  CA  . ILE E 3 118 ? 46.480  34.566 32.161  1.00 80.12 ? 237 ILE E CA  1 
ATOM   4827 C  C   . ILE E 3 118 ? 46.491  34.953 30.670  1.00 81.12 ? 237 ILE E C   1 
ATOM   4828 O  O   . ILE E 3 118 ? 47.597  35.269 30.147  1.00 81.21 ? 237 ILE E O   1 
ATOM   4829 C  CB  . ILE E 3 118 ? 45.991  33.081 32.281  1.00 80.25 ? 237 ILE E CB  1 
ATOM   4830 C  CG1 . ILE E 3 118 ? 46.293  32.322 30.967  1.00 79.48 ? 237 ILE E CG1 1 
ATOM   4831 C  CG2 . ILE E 3 118 ? 44.494  33.040 32.673  1.00 80.09 ? 237 ILE E CG2 1 
ATOM   4832 C  CD1 . ILE E 3 118 ? 45.777  30.883 30.937  1.00 78.72 ? 237 ILE E CD1 1 
ATOM   4833 N  N   . THR F 3 16  ? 13.977  75.637 2.775   1.00 67.09 ? 135 THR F N   1 
ATOM   4834 C  CA  . THR F 3 16  ? 13.136  75.505 1.548   1.00 67.71 ? 135 THR F CA  1 
ATOM   4835 C  C   . THR F 3 16  ? 11.680  75.266 1.909   1.00 67.37 ? 135 THR F C   1 
ATOM   4836 O  O   . THR F 3 16  ? 11.388  74.717 2.976   1.00 67.21 ? 135 THR F O   1 
ATOM   4837 C  CB  . THR F 3 16  ? 13.603  74.318 0.696   1.00 68.76 ? 135 THR F CB  1 
ATOM   4838 O  OG1 . THR F 3 16  ? 14.976  74.518 0.329   1.00 69.52 ? 135 THR F OG1 1 
ATOM   4839 C  CG2 . THR F 3 16  ? 12.732  74.176 -0.565  1.00 68.22 ? 135 THR F CG2 1 
ATOM   4840 N  N   . HIS F 3 17  ? 10.767  75.676 1.031   1.00 66.90 ? 136 HIS F N   1 
ATOM   4841 C  CA  . HIS F 3 17  ? 9.349   75.449 1.292   1.00 67.49 ? 136 HIS F CA  1 
ATOM   4842 C  C   . HIS F 3 17  ? 9.215   73.970 1.649   1.00 68.90 ? 136 HIS F C   1 
ATOM   4843 O  O   . HIS F 3 17  ? 8.547   73.615 2.635   1.00 68.91 ? 136 HIS F O   1 
ATOM   4844 C  CB  . HIS F 3 17  ? 8.498   75.747 0.050   1.00 66.00 ? 136 HIS F CB  1 
ATOM   4845 C  CG  . HIS F 3 17  ? 7.022   75.600 0.275   1.00 65.82 ? 136 HIS F CG  1 
ATOM   4846 N  ND1 . HIS F 3 17  ? 6.372   76.159 1.359   1.00 66.33 ? 136 HIS F ND1 1 
ATOM   4847 C  CD2 . HIS F 3 17  ? 6.061   74.997 -0.465  1.00 66.00 ? 136 HIS F CD2 1 
ATOM   4848 C  CE1 . HIS F 3 17  ? 5.076   75.909 1.275   1.00 65.65 ? 136 HIS F CE1 1 
ATOM   4849 N  NE2 . HIS F 3 17  ? 4.860   75.206 0.176   1.00 65.75 ? 136 HIS F NE2 1 
ATOM   4850 N  N   . ALA F 3 18  ? 9.879   73.122 0.850   1.00 68.89 ? 137 ALA F N   1 
ATOM   4851 C  CA  . ALA F 3 18  ? 9.850   71.680 1.059   1.00 68.93 ? 137 ALA F CA  1 
ATOM   4852 C  C   . ALA F 3 18  ? 10.281  71.352 2.487   1.00 69.24 ? 137 ALA F C   1 
ATOM   4853 O  O   . ALA F 3 18  ? 9.562   70.658 3.222   1.00 68.86 ? 137 ALA F O   1 
ATOM   4854 C  CB  . ALA F 3 18  ? 10.764  70.986 0.063   1.00 68.34 ? 137 ALA F CB  1 
ATOM   4855 N  N   . ASP F 3 19  ? 11.455  71.849 2.874   1.00 69.11 ? 138 ASP F N   1 
ATOM   4856 C  CA  . ASP F 3 19  ? 11.965  71.613 4.218   1.00 68.73 ? 138 ASP F CA  1 
ATOM   4857 C  C   . ASP F 3 19  ? 10.985  72.146 5.245   1.00 67.12 ? 138 ASP F C   1 
ATOM   4858 O  O   . ASP F 3 19  ? 10.843  71.571 6.324   1.00 67.16 ? 138 ASP F O   1 
ATOM   4859 C  CB  . ASP F 3 19  ? 13.321  72.296 4.408   1.00 70.93 ? 138 ASP F CB  1 
ATOM   4860 C  CG  . ASP F 3 19  ? 14.478  71.442 3.916   1.00 72.41 ? 138 ASP F CG  1 
ATOM   4861 O  OD1 . ASP F 3 19  ? 15.607  71.970 3.865   1.00 73.95 ? 138 ASP F OD1 1 
ATOM   4862 O  OD2 . ASP F 3 19  ? 14.265  70.248 3.593   1.00 72.44 ? 138 ASP F OD2 1 
ATOM   4863 N  N   . TYR F 3 20  ? 10.321  73.250 4.905   1.00 65.32 ? 139 TYR F N   1 
ATOM   4864 C  CA  . TYR F 3 20  ? 9.335   73.857 5.798   1.00 63.48 ? 139 TYR F CA  1 
ATOM   4865 C  C   . TYR F 3 20  ? 8.212   72.858 6.048   1.00 61.08 ? 139 TYR F C   1 
ATOM   4866 O  O   . TYR F 3 20  ? 7.952   72.462 7.189   1.00 60.60 ? 139 TYR F O   1 
ATOM   4867 C  CB  . TYR F 3 20  ? 8.743   75.132 5.178   1.00 64.44 ? 139 TYR F CB  1 
ATOM   4868 C  CG  . TYR F 3 20  ? 7.533   75.639 5.929   1.00 64.24 ? 139 TYR F CG  1 
ATOM   4869 C  CD1 . TYR F 3 20  ? 7.663   76.168 7.213   1.00 65.34 ? 139 TYR F CD1 1 
ATOM   4870 C  CD2 . TYR F 3 20  ? 6.245   75.518 5.387   1.00 64.38 ? 139 TYR F CD2 1 
ATOM   4871 C  CE1 . TYR F 3 20  ? 6.531   76.564 7.956   1.00 66.14 ? 139 TYR F CE1 1 
ATOM   4872 C  CE2 . TYR F 3 20  ? 5.106   75.906 6.116   1.00 64.45 ? 139 TYR F CE2 1 
ATOM   4873 C  CZ  . TYR F 3 20  ? 5.259   76.423 7.400   1.00 65.28 ? 139 TYR F CZ  1 
ATOM   4874 O  OH  . TYR F 3 20  ? 4.160   76.762 8.150   1.00 65.11 ? 139 TYR F OH  1 
ATOM   4875 N  N   . LEU F 3 21  ? 7.559   72.459 4.962   1.00 58.37 ? 140 LEU F N   1 
ATOM   4876 C  CA  . LEU F 3 21  ? 6.456   71.511 5.018   1.00 56.59 ? 140 LEU F CA  1 
ATOM   4877 C  C   . LEU F 3 21  ? 6.769   70.247 5.807   1.00 54.42 ? 140 LEU F C   1 
ATOM   4878 O  O   . LEU F 3 21  ? 5.890   69.699 6.467   1.00 53.42 ? 140 LEU F O   1 
ATOM   4879 C  CB  . LEU F 3 21  ? 6.012   71.136 3.599   1.00 56.13 ? 140 LEU F CB  1 
ATOM   4880 C  CG  . LEU F 3 21  ? 5.226   72.230 2.888   1.00 55.51 ? 140 LEU F CG  1 
ATOM   4881 C  CD1 . LEU F 3 21  ? 4.910   71.811 1.477   1.00 54.00 ? 140 LEU F CD1 1 
ATOM   4882 C  CD2 . LEU F 3 21  ? 3.958   72.503 3.673   1.00 55.48 ? 140 LEU F CD2 1 
ATOM   4883 N  N   . LEU F 3 22  ? 8.014   69.788 5.732   1.00 52.79 ? 141 LEU F N   1 
ATOM   4884 C  CA  . LEU F 3 22  ? 8.424   68.585 6.444   1.00 52.12 ? 141 LEU F CA  1 
ATOM   4885 C  C   . LEU F 3 22  ? 8.612   68.852 7.931   1.00 53.04 ? 141 LEU F C   1 
ATOM   4886 O  O   . LEU F 3 22  ? 8.040   68.159 8.764   1.00 52.14 ? 141 LEU F O   1 
ATOM   4887 C  CB  . LEU F 3 22  ? 9.712   68.020 5.829   1.00 50.26 ? 141 LEU F CB  1 
ATOM   4888 C  CG  . LEU F 3 22  ? 9.533   67.278 4.495   1.00 48.91 ? 141 LEU F CG  1 
ATOM   4889 C  CD1 . LEU F 3 22  ? 10.856  67.157 3.791   1.00 45.31 ? 141 LEU F CD1 1 
ATOM   4890 C  CD2 . LEU F 3 22  ? 8.903   65.909 4.734   1.00 47.18 ? 141 LEU F CD2 1 
ATOM   4891 N  N   . ARG F 3 23  ? 9.405   69.865 8.259   1.00 54.82 ? 142 ARG F N   1 
ATOM   4892 C  CA  . ARG F 3 23  ? 9.657   70.220 9.650   1.00 57.50 ? 142 ARG F CA  1 
ATOM   4893 C  C   . ARG F 3 23  ? 8.359   70.452 10.414  1.00 57.98 ? 142 ARG F C   1 
ATOM   4894 O  O   . ARG F 3 23  ? 8.245   70.155 11.607  1.00 57.27 ? 142 ARG F O   1 
ATOM   4895 C  CB  . ARG F 3 23  ? 10.483  71.496 9.731   1.00 59.70 ? 142 ARG F CB  1 
ATOM   4896 C  CG  . ARG F 3 23  ? 10.785  71.913 11.162  1.00 63.08 ? 142 ARG F CG  1 
ATOM   4897 C  CD  . ARG F 3 23  ? 11.365  73.320 11.233  1.00 65.84 ? 142 ARG F CD  1 
ATOM   4898 N  NE  . ARG F 3 23  ? 10.335  74.347 11.404  1.00 68.96 ? 142 ARG F NE  1 
ATOM   4899 C  CZ  . ARG F 3 23  ? 10.126  75.350 10.555  1.00 70.14 ? 142 ARG F CZ  1 
ATOM   4900 N  NH1 . ARG F 3 23  ? 10.876  75.469 9.456   1.00 70.75 ? 142 ARG F NH1 1 
ATOM   4901 N  NH2 . ARG F 3 23  ? 9.168   76.236 10.806  1.00 70.33 ? 142 ARG F NH2 1 
ATOM   4902 N  N   . THR F 3 24  ? 7.387   71.011 9.714   1.00 58.86 ? 143 THR F N   1 
ATOM   4903 C  CA  . THR F 3 24  ? 6.097   71.302 10.306  1.00 59.99 ? 143 THR F CA  1 
ATOM   4904 C  C   . THR F 3 24  ? 5.166   70.099 10.240  1.00 59.72 ? 143 THR F C   1 
ATOM   4905 O  O   . THR F 3 24  ? 4.008   70.175 10.653  1.00 59.69 ? 143 THR F O   1 
ATOM   4906 C  CB  . THR F 3 24  ? 5.431   72.483 9.599   1.00 61.21 ? 143 THR F CB  1 
ATOM   4907 O  OG1 . THR F 3 24  ? 4.085   72.611 10.068  1.00 64.89 ? 143 THR F OG1 1 
ATOM   4908 C  CG2 . THR F 3 24  ? 5.409   72.261 8.103   1.00 60.77 ? 143 THR F CG2 1 
ATOM   4909 N  N   . GLY F 3 25  ? 5.677   68.996 9.706   1.00 59.27 ? 144 GLY F N   1 
ATOM   4910 C  CA  . GLY F 3 25  ? 4.888   67.778 9.616   1.00 59.85 ? 144 GLY F CA  1 
ATOM   4911 C  C   . GLY F 3 25  ? 3.619   67.816 8.785   1.00 59.42 ? 144 GLY F C   1 
ATOM   4912 O  O   . GLY F 3 25  ? 2.635   67.165 9.126   1.00 59.90 ? 144 GLY F O   1 
ATOM   4913 N  N   . GLN F 3 26  ? 3.639   68.562 7.691   1.00 59.57 ? 145 GLN F N   1 
ATOM   4914 C  CA  . GLN F 3 26  ? 2.474   68.657 6.825   1.00 59.82 ? 145 GLN F CA  1 
ATOM   4915 C  C   . GLN F 3 26  ? 2.531   67.603 5.730   1.00 58.71 ? 145 GLN F C   1 
ATOM   4916 O  O   . GLN F 3 26  ? 1.516   67.295 5.106   1.00 59.66 ? 145 GLN F O   1 
ATOM   4917 C  CB  . GLN F 3 26  ? 2.400   70.052 6.206   1.00 61.33 ? 145 GLN F CB  1 
ATOM   4918 C  CG  . GLN F 3 26  ? 2.233   71.125 7.259   1.00 65.33 ? 145 GLN F CG  1 
ATOM   4919 C  CD  . GLN F 3 26  ? 2.122   72.531 6.690   1.00 66.80 ? 145 GLN F CD  1 
ATOM   4920 O  OE1 . GLN F 3 26  ? 1.415   72.760 5.704   1.00 67.60 ? 145 GLN F OE1 1 
ATOM   4921 N  NE2 . GLN F 3 26  ? 2.807   73.486 7.326   1.00 67.51 ? 145 GLN F NE2 1 
ATOM   4922 N  N   . VAL F 3 27  ? 3.717   67.053 5.497   1.00 56.05 ? 146 VAL F N   1 
ATOM   4923 C  CA  . VAL F 3 27  ? 3.873   66.040 4.473   1.00 54.32 ? 146 VAL F CA  1 
ATOM   4924 C  C   . VAL F 3 27  ? 3.264   64.740 4.966   1.00 53.82 ? 146 VAL F C   1 
ATOM   4925 O  O   . VAL F 3 27  ? 3.546   64.286 6.064   1.00 53.58 ? 146 VAL F O   1 
ATOM   4926 C  CB  . VAL F 3 27  ? 5.353   65.827 4.114   1.00 53.99 ? 146 VAL F CB  1 
ATOM   4927 C  CG1 . VAL F 3 27  ? 5.484   64.690 3.113   1.00 52.60 ? 146 VAL F CG1 1 
ATOM   4928 C  CG2 . VAL F 3 27  ? 5.930   67.110 3.534   1.00 51.96 ? 146 VAL F CG2 1 
ATOM   4929 N  N   . VAL F 3 28  ? 2.432   64.136 4.130   1.00 53.49 ? 147 VAL F N   1 
ATOM   4930 C  CA  . VAL F 3 28  ? 1.742   62.916 4.497   1.00 51.96 ? 147 VAL F CA  1 
ATOM   4931 C  C   . VAL F 3 28  ? 1.543   62.001 3.295   1.00 51.54 ? 147 VAL F C   1 
ATOM   4932 O  O   . VAL F 3 28  ? 1.375   62.470 2.175   1.00 52.47 ? 147 VAL F O   1 
ATOM   4933 C  CB  . VAL F 3 28  ? 0.375   63.294 5.134   1.00 51.03 ? 147 VAL F CB  1 
ATOM   4934 C  CG1 . VAL F 3 28  ? -0.745  62.428 4.591   1.00 51.23 ? 147 VAL F CG1 1 
ATOM   4935 C  CG2 . VAL F 3 28  ? 0.471   63.173 6.631   1.00 50.94 ? 147 VAL F CG2 1 
ATOM   4936 N  N   . ASP F 3 29  ? 1.574   60.693 3.538   1.00 50.70 ? 148 ASP F N   1 
ATOM   4937 C  CA  . ASP F 3 29  ? 1.375   59.694 2.492   1.00 50.35 ? 148 ASP F CA  1 
ATOM   4938 C  C   . ASP F 3 29  ? -0.111  59.526 2.273   1.00 50.36 ? 148 ASP F C   1 
ATOM   4939 O  O   . ASP F 3 29  ? -0.819  59.095 3.176   1.00 51.73 ? 148 ASP F O   1 
ATOM   4940 C  CB  . ASP F 3 29  ? 1.975   58.354 2.915   1.00 49.59 ? 148 ASP F CB  1 
ATOM   4941 C  CG  . ASP F 3 29  ? 1.560   57.210 2.002   1.00 49.52 ? 148 ASP F CG  1 
ATOM   4942 O  OD1 . ASP F 3 29  ? 1.061   57.469 0.895   1.00 48.12 ? 148 ASP F OD1 1 
ATOM   4943 O  OD2 . ASP F 3 29  ? 1.746   56.044 2.385   1.00 49.40 ? 148 ASP F OD2 1 
ATOM   4944 N  N   . ILE F 3 30  ? -0.594  59.847 1.079   1.00 50.77 ? 149 ILE F N   1 
ATOM   4945 C  CA  . ILE F 3 30  ? -2.024  59.724 0.824   1.00 50.63 ? 149 ILE F CA  1 
ATOM   4946 C  C   . ILE F 3 30  ? -2.462  58.431 0.148   1.00 51.05 ? 149 ILE F C   1 
ATOM   4947 O  O   . ILE F 3 30  ? -3.604  58.313 -0.288  1.00 49.77 ? 149 ILE F O   1 
ATOM   4948 C  CB  . ILE F 3 30  ? -2.536  60.915 0.014   1.00 49.82 ? 149 ILE F CB  1 
ATOM   4949 C  CG1 . ILE F 3 30  ? -1.828  60.990 -1.333  1.00 49.76 ? 149 ILE F CG1 1 
ATOM   4950 C  CG2 . ILE F 3 30  ? -2.272  62.187 0.780   1.00 50.04 ? 149 ILE F CG2 1 
ATOM   4951 C  CD1 . ILE F 3 30  ? -2.330  62.099 -2.204  1.00 46.74 ? 149 ILE F CD1 1 
ATOM   4952 N  N   . SER F 3 31  ? -1.561  57.454 0.083   1.00 52.20 ? 150 SER F N   1 
ATOM   4953 C  CA  . SER F 3 31  ? -1.892  56.175 -0.530  1.00 53.03 ? 150 SER F CA  1 
ATOM   4954 C  C   . SER F 3 31  ? -3.249  55.722 -0.043  1.00 54.52 ? 150 SER F C   1 
ATOM   4955 O  O   . SER F 3 31  ? -4.023  55.144 -0.801  1.00 55.28 ? 150 SER F O   1 
ATOM   4956 C  CB  . SER F 3 31  ? -0.860  55.099 -0.172  1.00 52.73 ? 150 SER F CB  1 
ATOM   4957 O  OG  . SER F 3 31  ? 0.286   55.134 -1.015  1.00 54.31 ? 150 SER F OG  1 
ATOM   4958 N  N   . ASP F 3 32  ? -3.547  56.001 1.225   1.00 56.21 ? 151 ASP F N   1 
ATOM   4959 C  CA  . ASP F 3 32  ? -4.817  55.565 1.805   1.00 56.75 ? 151 ASP F CA  1 
ATOM   4960 C  C   . ASP F 3 32  ? -6.047  56.207 1.183   1.00 57.27 ? 151 ASP F C   1 
ATOM   4961 O  O   . ASP F 3 32  ? -7.160  55.907 1.598   1.00 58.87 ? 151 ASP F O   1 
ATOM   4962 C  CB  . ASP F 3 32  ? -4.830  55.766 3.334   1.00 56.42 ? 151 ASP F CB  1 
ATOM   4963 C  CG  . ASP F 3 32  ? -4.760  57.237 3.746   1.00 56.34 ? 151 ASP F CG  1 
ATOM   4964 O  OD1 . ASP F 3 32  ? -4.722  57.527 4.966   1.00 54.85 ? 151 ASP F OD1 1 
ATOM   4965 O  OD2 . ASP F 3 32  ? -4.746  58.106 2.854   1.00 55.75 ? 151 ASP F OD2 1 
ATOM   4966 N  N   . THR F 3 33  ? -5.855  57.087 0.200   1.00 56.66 ? 152 THR F N   1 
ATOM   4967 C  CA  . THR F 3 33  ? -6.990  57.715 -0.477  1.00 55.68 ? 152 THR F CA  1 
ATOM   4968 C  C   . THR F 3 33  ? -6.892  57.476 -1.974  1.00 55.51 ? 152 THR F C   1 
ATOM   4969 O  O   . THR F 3 33  ? -7.699  57.977 -2.747  1.00 56.02 ? 152 THR F O   1 
ATOM   4970 C  CB  . THR F 3 33  ? -7.068  59.242 -0.247  1.00 55.07 ? 152 THR F CB  1 
ATOM   4971 O  OG1 . THR F 3 33  ? -5.987  59.900 -0.925  1.00 52.88 ? 152 THR F OG1 1 
ATOM   4972 C  CG2 . THR F 3 33  ? -7.034  59.549 1.237   1.00 56.11 ? 152 THR F CG2 1 
ATOM   4973 N  N   . ILE F 3 34  ? -5.891  56.718 -2.388  1.00 55.27 ? 153 ILE F N   1 
ATOM   4974 C  CA  . ILE F 3 34  ? -5.731  56.419 -3.795  1.00 55.89 ? 153 ILE F CA  1 
ATOM   4975 C  C   . ILE F 3 34  ? -6.026  54.943 -4.051  1.00 56.57 ? 153 ILE F C   1 
ATOM   4976 O  O   . ILE F 3 34  ? -6.521  54.578 -5.113  1.00 57.63 ? 153 ILE F O   1 
ATOM   4977 C  CB  . ILE F 3 34  ? -4.297  56.763 -4.282  1.00 56.05 ? 153 ILE F CB  1 
ATOM   4978 C  CG1 . ILE F 3 34  ? -4.237  58.207 -4.787  1.00 55.85 ? 153 ILE F CG1 1 
ATOM   4979 C  CG2 . ILE F 3 34  ? -3.900  55.854 -5.437  1.00 56.31 ? 153 ILE F CG2 1 
ATOM   4980 C  CD1 . ILE F 3 34  ? -4.820  59.231 -3.839  1.00 57.59 ? 153 ILE F CD1 1 
ATOM   4981 N  N   . TYR F 3 35  ? -5.726  54.098 -3.072  1.00 56.95 ? 154 TYR F N   1 
ATOM   4982 C  CA  . TYR F 3 35  ? -5.957  52.673 -3.207  1.00 57.23 ? 154 TYR F CA  1 
ATOM   4983 C  C   . TYR F 3 35  ? -6.960  52.206 -2.159  1.00 58.77 ? 154 TYR F C   1 
ATOM   4984 O  O   . TYR F 3 35  ? -7.030  52.773 -1.067  1.00 59.08 ? 154 TYR F O   1 
ATOM   4985 C  CB  . TYR F 3 35  ? -4.647  51.909 -3.032  1.00 55.88 ? 154 TYR F CB  1 
ATOM   4986 C  CG  . TYR F 3 35  ? -3.504  52.410 -3.885  1.00 55.28 ? 154 TYR F CG  1 
ATOM   4987 C  CD1 . TYR F 3 35  ? -2.655  53.411 -3.426  1.00 55.02 ? 154 TYR F CD1 1 
ATOM   4988 C  CD2 . TYR F 3 35  ? -3.264  51.876 -5.150  1.00 55.60 ? 154 TYR F CD2 1 
ATOM   4989 C  CE1 . TYR F 3 35  ? -1.596  53.868 -4.199  1.00 54.15 ? 154 TYR F CE1 1 
ATOM   4990 C  CE2 . TYR F 3 35  ? -2.209  52.325 -5.932  1.00 54.62 ? 154 TYR F CE2 1 
ATOM   4991 C  CZ  . TYR F 3 35  ? -1.380  53.320 -5.453  1.00 54.79 ? 154 TYR F CZ  1 
ATOM   4992 O  OH  . TYR F 3 35  ? -0.336  53.774 -6.227  1.00 55.00 ? 154 TYR F OH  1 
ATOM   4993 N  N   . PRO F 3 36  ? -7.771  51.181 -2.483  1.00 60.28 ? 155 PRO F N   1 
ATOM   4994 C  CA  . PRO F 3 36  ? -7.776  50.471 -3.769  1.00 61.55 ? 155 PRO F CA  1 
ATOM   4995 C  C   . PRO F 3 36  ? -8.246  51.395 -4.887  1.00 62.37 ? 155 PRO F C   1 
ATOM   4996 O  O   . PRO F 3 36  ? -9.054  52.293 -4.657  1.00 62.04 ? 155 PRO F O   1 
ATOM   4997 C  CB  . PRO F 3 36  ? -8.749  49.315 -3.518  1.00 61.59 ? 155 PRO F CB  1 
ATOM   4998 C  CG  . PRO F 3 36  ? -9.703  49.897 -2.526  1.00 60.93 ? 155 PRO F CG  1 
ATOM   4999 C  CD  . PRO F 3 36  ? -8.755  50.584 -1.564  1.00 60.68 ? 155 PRO F CD  1 
ATOM   5000 N  N   . ARG F 3 37  ? -7.739  51.173 -6.093  1.00 63.50 ? 156 ARG F N   1 
ATOM   5001 C  CA  . ARG F 3 37  ? -8.107  52.010 -7.229  1.00 64.56 ? 156 ARG F CA  1 
ATOM   5002 C  C   . ARG F 3 37  ? -9.590  51.851 -7.543  1.00 65.07 ? 156 ARG F C   1 
ATOM   5003 O  O   . ARG F 3 37  ? -10.247 52.799 -7.975  1.00 64.12 ? 156 ARG F O   1 
ATOM   5004 C  CB  . ARG F 3 37  ? -7.260  51.638 -8.458  1.00 64.94 ? 156 ARG F CB  1 
ATOM   5005 C  CG  . ARG F 3 37  ? -5.777  52.040 -8.390  1.00 65.52 ? 156 ARG F CG  1 
ATOM   5006 C  CD  . ARG F 3 37  ? -5.566  53.420 -8.976  1.00 68.30 ? 156 ARG F CD  1 
ATOM   5007 N  NE  . ARG F 3 37  ? -6.339  54.432 -8.256  1.00 72.14 ? 156 ARG F NE  1 
ATOM   5008 C  CZ  . ARG F 3 37  ? -7.163  55.318 -8.830  1.00 73.37 ? 156 ARG F CZ  1 
ATOM   5009 N  NH1 . ARG F 3 37  ? -7.337  55.321 -10.158 1.00 73.07 ? 156 ARG F NH1 1 
ATOM   5010 N  NH2 . ARG F 3 37  ? -7.806  56.216 -8.074  1.00 72.68 ? 156 ARG F NH2 1 
ATOM   5011 N  N   . ASN F 3 38  ? -10.119 50.651 -7.324  1.00 66.21 ? 157 ASN F N   1 
ATOM   5012 C  CA  . ASN F 3 38  ? -11.532 50.417 -7.597  1.00 68.44 ? 157 ASN F CA  1 
ATOM   5013 C  C   . ASN F 3 38  ? -12.285 49.740 -6.466  1.00 68.56 ? 157 ASN F C   1 
ATOM   5014 O  O   . ASN F 3 38  ? -12.360 48.506 -6.391  1.00 68.26 ? 157 ASN F O   1 
ATOM   5015 C  CB  . ASN F 3 38  ? -11.720 49.589 -8.868  1.00 70.01 ? 157 ASN F CB  1 
ATOM   5016 C  CG  . ASN F 3 38  ? -13.190 49.240 -9.122  1.00 70.97 ? 157 ASN F CG  1 
ATOM   5017 O  OD1 . ASN F 3 38  ? -14.091 49.750 -8.441  1.00 69.98 ? 157 ASN F OD1 1 
ATOM   5018 N  ND2 . ASN F 3 38  ? -13.434 48.371 -10.109 1.00 71.51 ? 157 ASN F ND2 1 
ATOM   5019 N  N   . PRO F 3 39  ? -12.878 50.549 -5.582  1.00 68.91 ? 158 PRO F N   1 
ATOM   5020 C  CA  . PRO F 3 39  ? -13.650 50.076 -4.427  1.00 69.63 ? 158 PRO F CA  1 
ATOM   5021 C  C   . PRO F 3 39  ? -14.738 49.079 -4.848  1.00 70.64 ? 158 PRO F C   1 
ATOM   5022 O  O   . PRO F 3 39  ? -14.999 48.086 -4.152  1.00 69.70 ? 158 PRO F O   1 
ATOM   5023 C  CB  . PRO F 3 39  ? -14.241 51.368 -3.863  1.00 69.75 ? 158 PRO F CB  1 
ATOM   5024 C  CG  . PRO F 3 39  ? -13.194 52.404 -4.220  1.00 68.46 ? 158 PRO F CG  1 
ATOM   5025 C  CD  . PRO F 3 39  ? -12.855 52.023 -5.638  1.00 68.74 ? 158 PRO F CD  1 
ATOM   5026 N  N   . ALA F 3 40  ? -15.356 49.361 -5.999  1.00 71.77 ? 159 ALA F N   1 
ATOM   5027 C  CA  . ALA F 3 40  ? -16.425 48.531 -6.552  1.00 72.09 ? 159 ALA F CA  1 
ATOM   5028 C  C   . ALA F 3 40  ? -16.035 47.070 -6.701  1.00 72.93 ? 159 ALA F C   1 
ATOM   5029 O  O   . ALA F 3 40  ? -16.881 46.191 -6.544  1.00 73.55 ? 159 ALA F O   1 
ATOM   5030 C  CB  . ALA F 3 40  ? -16.877 49.085 -7.899  1.00 70.51 ? 159 ALA F CB  1 
ATOM   5031 N  N   . MET F 3 41  ? -14.767 46.799 -7.003  1.00 74.35 ? 160 MET F N   1 
ATOM   5032 C  CA  . MET F 3 41  ? -14.327 45.416 -7.168  1.00 76.01 ? 160 MET F CA  1 
ATOM   5033 C  C   . MET F 3 41  ? -13.565 44.946 -5.950  1.00 76.99 ? 160 MET F C   1 
ATOM   5034 O  O   . MET F 3 41  ? -12.755 44.014 -6.016  1.00 76.88 ? 160 MET F O   1 
ATOM   5035 C  CB  . MET F 3 41  ? -13.463 45.283 -8.417  1.00 76.61 ? 160 MET F CB  1 
ATOM   5036 C  CG  . MET F 3 41  ? -14.252 45.354 -9.720  1.00 77.50 ? 160 MET F CG  1 
ATOM   5037 S  SD  . MET F 3 41  ? -15.158 43.800 -10.064 1.00 78.90 ? 160 MET F SD  1 
ATOM   5038 C  CE  . MET F 3 41  ? -16.732 44.076 -9.072  1.00 78.56 ? 160 MET F CE  1 
ATOM   5039 N  N   . TYR F 3 42  ? -13.845 45.592 -4.826  1.00 78.61 ? 161 TYR F N   1 
ATOM   5040 C  CA  . TYR F 3 42  ? -13.190 45.257 -3.567  1.00 80.76 ? 161 TYR F CA  1 
ATOM   5041 C  C   . TYR F 3 42  ? -13.366 43.779 -3.197  1.00 81.12 ? 161 TYR F C   1 
ATOM   5042 O  O   . TYR F 3 42  ? -12.390 43.064 -2.944  1.00 80.73 ? 161 TYR F O   1 
ATOM   5043 C  CB  . TYR F 3 42  ? -13.760 46.137 -2.453  1.00 82.87 ? 161 TYR F CB  1 
ATOM   5044 C  CG  . TYR F 3 42  ? -13.018 46.023 -1.146  1.00 85.55 ? 161 TYR F CG  1 
ATOM   5045 C  CD1 . TYR F 3 42  ? -11.728 46.552 -1.005  1.00 86.32 ? 161 TYR F CD1 1 
ATOM   5046 C  CD2 . TYR F 3 42  ? -13.595 45.380 -0.050  1.00 86.55 ? 161 TYR F CD2 1 
ATOM   5047 C  CE1 . TYR F 3 42  ? -11.029 46.445 0.199   1.00 87.45 ? 161 TYR F CE1 1 
ATOM   5048 C  CE2 . TYR F 3 42  ? -12.904 45.265 1.165   1.00 87.72 ? 161 TYR F CE2 1 
ATOM   5049 C  CZ  . TYR F 3 42  ? -11.621 45.799 1.280   1.00 87.93 ? 161 TYR F CZ  1 
ATOM   5050 O  OH  . TYR F 3 42  ? -10.922 45.676 2.468   1.00 88.52 ? 161 TYR F OH  1 
ATOM   5051 N  N   . SER F 3 43  ? -14.623 43.336 -3.178  1.00 81.98 ? 162 SER F N   1 
ATOM   5052 C  CA  . SER F 3 43  ? -14.988 41.961 -2.818  1.00 82.27 ? 162 SER F CA  1 
ATOM   5053 C  C   . SER F 3 43  ? -14.725 40.898 -3.889  1.00 82.74 ? 162 SER F C   1 
ATOM   5054 O  O   . SER F 3 43  ? -14.849 41.151 -5.094  1.00 83.43 ? 162 SER F O   1 
ATOM   5055 C  CB  . SER F 3 43  ? -16.470 41.922 -2.435  1.00 81.63 ? 162 SER F CB  1 
ATOM   5056 O  OG  . SER F 3 43  ? -17.251 42.606 -3.406  1.00 80.44 ? 162 SER F OG  1 
ATOM   5057 N  N   . GLU F 3 44  ? -14.389 39.695 -3.437  1.00 83.03 ? 163 GLU F N   1 
ATOM   5058 C  CA  . GLU F 3 44  ? -14.119 38.590 -4.350  1.00 83.34 ? 163 GLU F CA  1 
ATOM   5059 C  C   . GLU F 3 44  ? -15.387 38.188 -5.116  1.00 83.81 ? 163 GLU F C   1 
ATOM   5060 O  O   . GLU F 3 44  ? -15.341 37.894 -6.322  1.00 83.70 ? 163 GLU F O   1 
ATOM   5061 C  CB  . GLU F 3 44  ? -13.577 37.390 -3.571  1.00 82.32 ? 163 GLU F CB  1 
ATOM   5062 C  CG  . GLU F 3 44  ? -13.138 36.245 -4.454  1.00 82.06 ? 163 GLU F CG  1 
ATOM   5063 C  CD  . GLU F 3 44  ? -12.394 35.176 -3.676  1.00 82.58 ? 163 GLU F CD  1 
ATOM   5064 O  OE1 . GLU F 3 44  ? -12.990 34.598 -2.731  1.00 82.91 ? 163 GLU F OE1 1 
ATOM   5065 O  OE2 . GLU F 3 44  ? -11.209 34.914 -4.012  1.00 83.30 ? 163 GLU F OE2 1 
ATOM   5066 N  N   . GLU F 3 45  ? -16.517 38.171 -4.410  1.00 83.98 ? 164 GLU F N   1 
ATOM   5067 C  CA  . GLU F 3 45  ? -17.776 37.803 -5.042  1.00 83.73 ? 164 GLU F CA  1 
ATOM   5068 C  C   . GLU F 3 45  ? -18.036 38.792 -6.158  1.00 82.92 ? 164 GLU F C   1 
ATOM   5069 O  O   . GLU F 3 45  ? -18.313 38.405 -7.302  1.00 82.60 ? 164 GLU F O   1 
ATOM   5070 C  CB  . GLU F 3 45  ? -18.921 37.839 -4.022  1.00 85.06 ? 164 GLU F CB  1 
ATOM   5071 C  CG  . GLU F 3 45  ? -20.318 37.668 -4.642  1.00 86.59 ? 164 GLU F CG  1 
ATOM   5072 C  CD  . GLU F 3 45  ? -21.385 37.295 -3.606  1.00 86.97 ? 164 GLU F CD  1 
ATOM   5073 O  OE1 . GLU F 3 45  ? -21.599 38.074 -2.637  1.00 87.63 ? 164 GLU F OE1 1 
ATOM   5074 O  OE2 . GLU F 3 45  ? -22.005 36.217 -3.765  1.00 86.24 ? 164 GLU F OE2 1 
ATOM   5075 N  N   . ALA F 3 46  ? -17.936 40.074 -5.822  1.00 82.40 ? 165 ALA F N   1 
ATOM   5076 C  CA  . ALA F 3 46  ? -18.164 41.101 -6.823  1.00 82.65 ? 165 ALA F CA  1 
ATOM   5077 C  C   . ALA F 3 46  ? -17.220 40.780 -7.972  1.00 82.73 ? 165 ALA F C   1 
ATOM   5078 O  O   . ALA F 3 46  ? -17.541 40.975 -9.159  1.00 82.88 ? 165 ALA F O   1 
ATOM   5079 C  CB  . ALA F 3 46  ? -17.852 42.478 -6.253  1.00 82.73 ? 165 ALA F CB  1 
ATOM   5080 N  N   . ARG F 3 47  ? -16.049 40.267 -7.608  1.00 82.03 ? 166 ARG F N   1 
ATOM   5081 C  CA  . ARG F 3 47  ? -15.059 39.938 -8.609  1.00 81.10 ? 166 ARG F CA  1 
ATOM   5082 C  C   . ARG F 3 47  ? -15.614 38.800 -9.436  1.00 80.82 ? 166 ARG F C   1 
ATOM   5083 O  O   . ARG F 3 47  ? -15.950 38.986 -10.612 1.00 81.18 ? 166 ARG F O   1 
ATOM   5084 C  CB  . ARG F 3 47  ? -13.747 39.538 -7.941  1.00 80.65 ? 166 ARG F CB  1 
ATOM   5085 C  CG  . ARG F 3 47  ? -12.528 39.693 -8.843  1.00 79.93 ? 166 ARG F CG  1 
ATOM   5086 C  CD  . ARG F 3 47  ? -11.266 39.918 -7.992  1.00 78.84 ? 166 ARG F CD  1 
ATOM   5087 N  NE  . ARG F 3 47  ? -11.476 41.024 -7.066  1.00 75.84 ? 166 ARG F NE  1 
ATOM   5088 C  CZ  . ARG F 3 47  ? -11.229 40.951 -5.767  1.00 74.91 ? 166 ARG F CZ  1 
ATOM   5089 N  NH1 . ARG F 3 47  ? -10.749 39.821 -5.250  1.00 72.81 ? 166 ARG F NH1 1 
ATOM   5090 N  NH2 . ARG F 3 47  ? -11.499 41.994 -4.982  1.00 74.46 ? 166 ARG F NH2 1 
ATOM   5091 N  N   . LEU F 3 48  ? -15.736 37.631 -8.813  1.00 80.46 ? 167 LEU F N   1 
ATOM   5092 C  CA  . LEU F 3 48  ? -16.252 36.457 -9.504  1.00 79.60 ? 167 LEU F CA  1 
ATOM   5093 C  C   . LEU F 3 48  ? -17.416 36.787 -10.439 1.00 79.02 ? 167 LEU F C   1 
ATOM   5094 O  O   . LEU F 3 48  ? -17.744 35.985 -11.317 1.00 79.05 ? 167 LEU F O   1 
ATOM   5095 C  CB  . LEU F 3 48  ? -16.687 35.388 -8.501  1.00 79.26 ? 167 LEU F CB  1 
ATOM   5096 C  CG  . LEU F 3 48  ? -15.753 34.189 -8.329  1.00 79.05 ? 167 LEU F CG  1 
ATOM   5097 C  CD1 . LEU F 3 48  ? -16.489 33.105 -7.525  1.00 78.62 ? 167 LEU F CD1 1 
ATOM   5098 C  CD2 . LEU F 3 48  ? -15.334 33.645 -9.697  1.00 78.26 ? 167 LEU F CD2 1 
ATOM   5099 N  N   . LYS F 3 49  ? -18.043 37.951 -10.256 1.00 77.83 ? 168 LYS F N   1 
ATOM   5100 C  CA  . LYS F 3 49  ? -19.139 38.345 -11.137 1.00 77.02 ? 168 LYS F CA  1 
ATOM   5101 C  C   . LYS F 3 49  ? -18.637 38.457 -12.580 1.00 76.09 ? 168 LYS F C   1 
ATOM   5102 O  O   . LYS F 3 49  ? -18.310 37.440 -13.198 1.00 76.46 ? 168 LYS F O   1 
ATOM   5103 C  CB  . LYS F 3 49  ? -19.746 39.682 -10.707 1.00 77.34 ? 168 LYS F CB  1 
ATOM   5104 C  CG  . LYS F 3 49  ? -20.971 40.069 -11.523 1.00 77.80 ? 168 LYS F CG  1 
ATOM   5105 C  CD  . LYS F 3 49  ? -20.697 41.241 -12.467 1.00 78.61 ? 168 LYS F CD  1 
ATOM   5106 C  CE  . LYS F 3 49  ? -21.842 41.425 -13.478 1.00 79.85 ? 168 LYS F CE  1 
ATOM   5107 N  NZ  . LYS F 3 49  ? -23.212 41.518 -12.854 1.00 79.63 ? 168 LYS F NZ  1 
ATOM   5108 N  N   . SER F 3 50  ? -18.559 39.688 -13.097 1.00 74.72 ? 169 SER F N   1 
ATOM   5109 C  CA  . SER F 3 50  ? -18.123 39.974 -14.477 1.00 73.06 ? 169 SER F CA  1 
ATOM   5110 C  C   . SER F 3 50  ? -17.092 39.006 -15.089 1.00 71.16 ? 169 SER F C   1 
ATOM   5111 O  O   . SER F 3 50  ? -15.885 39.115 -14.838 1.00 71.58 ? 169 SER F O   1 
ATOM   5112 C  CB  . SER F 3 50  ? -17.569 41.397 -14.561 1.00 73.05 ? 169 SER F CB  1 
ATOM   5113 O  OG  . SER F 3 50  ? -16.410 41.519 -13.750 1.00 73.32 ? 169 SER F OG  1 
ATOM   5114 N  N   . LEU F 3 60  ? -8.218  30.746 -18.300 1.00 70.85 ? 179 LEU F N   1 
ATOM   5115 C  CA  . LEU F 3 60  ? -8.403  31.506 -16.959 1.00 73.38 ? 179 LEU F CA  1 
ATOM   5116 C  C   . LEU F 3 60  ? -9.415  31.238 -15.856 1.00 75.02 ? 179 LEU F C   1 
ATOM   5117 O  O   . LEU F 3 60  ? -10.348 32.042 -15.680 1.00 74.86 ? 179 LEU F O   1 
ATOM   5118 C  CB  . LEU F 3 60  ? -8.798  32.976 -17.087 1.00 73.16 ? 179 LEU F CB  1 
ATOM   5119 C  CG  . LEU F 3 60  ? -9.595  33.336 -18.350 1.00 73.65 ? 179 LEU F CG  1 
ATOM   5120 C  CD1 . LEU F 3 60  ? -10.998 33.818 -18.029 1.00 72.09 ? 179 LEU F CD1 1 
ATOM   5121 C  CD2 . LEU F 3 60  ? -8.844  34.405 -19.129 1.00 73.21 ? 179 LEU F CD2 1 
ATOM   5122 N  N   . THR F 3 61  ? -9.291  30.127 -15.119 1.00 76.67 ? 180 THR F N   1 
ATOM   5123 C  CA  . THR F 3 61  ? -10.044 29.760 -13.873 1.00 77.66 ? 180 THR F CA  1 
ATOM   5124 C  C   . THR F 3 61  ? -10.768 30.910 -13.185 1.00 78.77 ? 180 THR F C   1 
ATOM   5125 O  O   . THR F 3 61  ? -10.071 31.537 -12.389 1.00 79.60 ? 180 THR F O   1 
ATOM   5126 C  CB  . THR F 3 61  ? -9.016  29.462 -12.783 1.00 77.76 ? 180 THR F CB  1 
ATOM   5127 O  OG1 . THR F 3 61  ? -8.232  30.638 -12.518 1.00 78.31 ? 180 THR F OG1 1 
ATOM   5128 C  CG2 . THR F 3 61  ? -8.123  28.315 -13.228 1.00 78.27 ? 180 THR F CG2 1 
ATOM   5129 N  N   . PRO F 3 62  ? -11.983 31.344 -13.327 1.00 78.78 ? 181 PRO F N   1 
ATOM   5130 C  CA  . PRO F 3 62  ? -12.382 32.469 -12.688 1.00 78.97 ? 181 PRO F CA  1 
ATOM   5131 C  C   . PRO F 3 62  ? -12.005 32.478 -11.183 1.00 79.30 ? 181 PRO F C   1 
ATOM   5132 O  O   . PRO F 3 62  ? -11.300 33.367 -10.705 1.00 79.07 ? 181 PRO F O   1 
ATOM   5133 C  CB  . PRO F 3 62  ? -13.845 32.725 -13.062 1.00 78.99 ? 181 PRO F CB  1 
ATOM   5134 C  CG  . PRO F 3 62  ? -13.898 32.279 -14.505 1.00 78.86 ? 181 PRO F CG  1 
ATOM   5135 C  CD  . PRO F 3 62  ? -12.758 31.320 -14.744 1.00 78.15 ? 181 PRO F CD  1 
ATOM   5136 N  N   . ARG F 3 63  ? -12.489 31.445 -10.459 1.00 79.99 ? 182 ARG F N   1 
ATOM   5137 C  CA  . ARG F 3 63  ? -12.269 31.299 -9.027  1.00 80.97 ? 182 ARG F CA  1 
ATOM   5138 C  C   . ARG F 3 63  ? -10.810 31.568 -8.628  1.00 82.25 ? 182 ARG F C   1 
ATOM   5139 O  O   . ARG F 3 63  ? -10.534 31.966 -7.492  1.00 82.58 ? 182 ARG F O   1 
ATOM   5140 C  CB  . ARG F 3 63  ? -12.679 29.881 -8.560  0.00 78.60 ? 182 ARG F CB  1 
ATOM   5141 C  CG  . ARG F 3 63  ? -14.060 29.452 -9.023  0.00 75.92 ? 182 ARG F CG  1 
ATOM   5142 C  CD  . ARG F 3 63  ? -14.376 28.023 -8.585  0.00 73.43 ? 182 ARG F CD  1 
ATOM   5143 N  NE  . ARG F 3 63  ? -15.761 27.665 -8.885  0.00 71.15 ? 182 ARG F NE  1 
ATOM   5144 C  CZ  . ARG F 3 63  ? -16.822 28.266 -8.356  0.00 70.00 ? 182 ARG F CZ  1 
ATOM   5145 N  NH1 . ARG F 3 63  ? -16.666 29.260 -7.492  0.00 69.22 ? 182 ARG F NH1 1 
ATOM   5146 N  NH2 . ARG F 3 63  ? -18.043 27.872 -8.692  0.00 69.22 ? 182 ARG F NH2 1 
ATOM   5147 N  N   . GLU F 3 64  ? -9.881  31.357 -9.561  1.00 82.87 ? 183 GLU F N   1 
ATOM   5148 C  CA  . GLU F 3 64  ? -8.471  31.616 -9.282  1.00 83.60 ? 183 GLU F CA  1 
ATOM   5149 C  C   . GLU F 3 64  ? -8.110  33.098 -9.442  1.00 83.92 ? 183 GLU F C   1 
ATOM   5150 O  O   . GLU F 3 64  ? -7.592  33.737 -8.505  1.00 84.30 ? 183 GLU F O   1 
ATOM   5151 C  CB  . GLU F 3 64  ? -7.580  30.784 -10.199 1.00 83.35 ? 183 GLU F CB  1 
ATOM   5152 C  CG  . GLU F 3 64  ? -6.113  30.955 -9.875  1.00 84.23 ? 183 GLU F CG  1 
ATOM   5153 C  CD  . GLU F 3 64  ? -5.289  29.823 -10.429 1.00 85.46 ? 183 GLU F CD  1 
ATOM   5154 O  OE1 . GLU F 3 64  ? -5.206  29.733 -11.682 1.00 85.90 ? 183 GLU F OE1 1 
ATOM   5155 O  OE2 . GLU F 3 64  ? -4.743  29.023 -9.613  1.00 86.21 ? 183 GLU F OE2 1 
ATOM   5156 N  N   . LEU F 3 65  ? -8.367  33.637 -10.632 1.00 82.93 ? 184 LEU F N   1 
ATOM   5157 C  CA  . LEU F 3 65  ? -8.076  35.040 -10.888 1.00 81.34 ? 184 LEU F CA  1 
ATOM   5158 C  C   . LEU F 3 65  ? -8.712  35.930 -9.807  1.00 80.55 ? 184 LEU F C   1 
ATOM   5159 O  O   . LEU F 3 65  ? -8.014  36.698 -9.129  1.00 81.06 ? 184 LEU F O   1 
ATOM   5160 C  CB  . LEU F 3 65  ? -8.579  35.436 -12.280 1.00 81.05 ? 184 LEU F CB  1 
ATOM   5161 C  CG  . LEU F 3 65  ? -7.854  34.788 -13.474 1.00 80.73 ? 184 LEU F CG  1 
ATOM   5162 C  CD1 . LEU F 3 65  ? -8.323  35.463 -14.770 1.00 80.61 ? 184 LEU F CD1 1 
ATOM   5163 C  CD2 . LEU F 3 65  ? -6.335  34.954 -13.333 1.00 80.24 ? 184 LEU F CD2 1 
ATOM   5164 N  N   . ALA F 3 66  ? -10.025 35.818 -9.631  1.00 78.90 ? 185 ALA F N   1 
ATOM   5165 C  CA  . ALA F 3 66  ? -10.710 36.620 -8.631  1.00 77.77 ? 185 ALA F CA  1 
ATOM   5166 C  C   . ALA F 3 66  ? -9.986  36.517 -7.292  1.00 77.11 ? 185 ALA F C   1 
ATOM   5167 O  O   . ALA F 3 66  ? -9.864  37.508 -6.563  1.00 77.29 ? 185 ALA F O   1 
ATOM   5168 C  CB  . ALA F 3 66  ? -12.152 36.157 -8.486  1.00 77.77 ? 185 ALA F CB  1 
ATOM   5169 N  N   . SER F 3 67  ? -9.501  35.321 -6.977  1.00 76.41 ? 186 SER F N   1 
ATOM   5170 C  CA  . SER F 3 67  ? -8.789  35.105 -5.724  1.00 76.77 ? 186 SER F CA  1 
ATOM   5171 C  C   . SER F 3 67  ? -7.450  35.834 -5.676  1.00 76.83 ? 186 SER F C   1 
ATOM   5172 O  O   . SER F 3 67  ? -6.862  35.995 -4.599  1.00 77.62 ? 186 SER F O   1 
ATOM   5173 C  CB  . SER F 3 67  ? -8.553  33.614 -5.485  1.00 77.21 ? 186 SER F CB  1 
ATOM   5174 O  OG  . SER F 3 67  ? -7.747  33.419 -4.330  1.00 77.59 ? 186 SER F OG  1 
ATOM   5175 N  N   . ALA F 3 68  ? -6.948  36.246 -6.838  1.00 76.62 ? 187 ALA F N   1 
ATOM   5176 C  CA  . ALA F 3 68  ? -5.691  36.997 -6.890  1.00 76.12 ? 187 ALA F CA  1 
ATOM   5177 C  C   . ALA F 3 68  ? -6.056  38.486 -7.002  1.00 75.29 ? 187 ALA F C   1 
ATOM   5178 O  O   . ALA F 3 68  ? -5.226  39.319 -7.368  1.00 75.62 ? 187 ALA F O   1 
ATOM   5179 C  CB  . ALA F 3 68  ? -4.848  36.556 -8.099  1.00 76.34 ? 187 ALA F CB  1 
ATOM   5180 N  N   . GLY F 3 69  ? -7.318  38.791 -6.698  1.00 74.26 ? 188 GLY F N   1 
ATOM   5181 C  CA  . GLY F 3 69  ? -7.816  40.154 -6.747  1.00 73.34 ? 188 GLY F CA  1 
ATOM   5182 C  C   . GLY F 3 69  ? -8.026  40.726 -8.140  1.00 72.44 ? 188 GLY F C   1 
ATOM   5183 O  O   . GLY F 3 69  ? -8.270  41.926 -8.309  1.00 72.15 ? 188 GLY F O   1 
ATOM   5184 N  N   . LEU F 3 70  ? -7.936  39.880 -9.156  1.00 71.83 ? 189 LEU F N   1 
ATOM   5185 C  CA  . LEU F 3 70  ? -8.108  40.369 -10.518 1.00 71.31 ? 189 LEU F CA  1 
ATOM   5186 C  C   . LEU F 3 70  ? -9.533  40.171 -10.991 1.00 71.54 ? 189 LEU F C   1 
ATOM   5187 O  O   . LEU F 3 70  ? -10.133 39.110 -10.749 1.00 72.23 ? 189 LEU F O   1 
ATOM   5188 C  CB  . LEU F 3 70  ? -7.159  39.628 -11.452 1.00 70.32 ? 189 LEU F CB  1 
ATOM   5189 C  CG  . LEU F 3 70  ? -5.695  39.621 -11.013 1.00 69.93 ? 189 LEU F CG  1 
ATOM   5190 C  CD1 . LEU F 3 70  ? -4.916  38.669 -11.898 1.00 70.12 ? 189 LEU F CD1 1 
ATOM   5191 C  CD2 . LEU F 3 70  ? -5.120  41.029 -11.094 1.00 69.31 ? 189 LEU F CD2 1 
ATOM   5192 N  N   . TYR F 3 71  ? -10.076 41.187 -11.655 1.00 71.20 ? 190 TYR F N   1 
ATOM   5193 C  CA  . TYR F 3 71  ? -11.425 41.101 -12.187 1.00 72.19 ? 190 TYR F CA  1 
ATOM   5194 C  C   . TYR F 3 71  ? -11.411 41.350 -13.700 1.00 73.82 ? 190 TYR F C   1 
ATOM   5195 O  O   . TYR F 3 71  ? -10.665 42.209 -14.190 1.00 73.82 ? 190 TYR F O   1 
ATOM   5196 C  CB  . TYR F 3 71  ? -12.337 42.099 -11.480 1.00 70.31 ? 190 TYR F CB  1 
ATOM   5197 C  CG  . TYR F 3 71  ? -12.022 43.537 -11.773 1.00 69.38 ? 190 TYR F CG  1 
ATOM   5198 C  CD1 . TYR F 3 71  ? -12.573 44.182 -12.878 1.00 69.27 ? 190 TYR F CD1 1 
ATOM   5199 C  CD2 . TYR F 3 71  ? -11.186 44.264 -10.936 1.00 69.11 ? 190 TYR F CD2 1 
ATOM   5200 C  CE1 . TYR F 3 71  ? -12.302 45.533 -13.138 1.00 69.03 ? 190 TYR F CE1 1 
ATOM   5201 C  CE2 . TYR F 3 71  ? -10.905 45.613 -11.185 1.00 69.05 ? 190 TYR F CE2 1 
ATOM   5202 C  CZ  . TYR F 3 71  ? -11.469 46.246 -12.287 1.00 68.44 ? 190 TYR F CZ  1 
ATOM   5203 O  OH  . TYR F 3 71  ? -11.227 47.590 -12.524 1.00 67.05 ? 190 TYR F OH  1 
ATOM   5204 N  N   . TYR F 3 72  ? -12.239 40.593 -14.429 1.00 75.63 ? 191 TYR F N   1 
ATOM   5205 C  CA  . TYR F 3 72  ? -12.324 40.692 -15.888 1.00 76.74 ? 191 TYR F CA  1 
ATOM   5206 C  C   . TYR F 3 72  ? -12.763 42.074 -16.395 1.00 76.22 ? 191 TYR F C   1 
ATOM   5207 O  O   . TYR F 3 72  ? -13.623 42.730 -15.796 1.00 74.79 ? 191 TYR F O   1 
ATOM   5208 C  CB  . TYR F 3 72  ? -13.257 39.594 -16.434 1.00 78.48 ? 191 TYR F CB  1 
ATOM   5209 C  CG  . TYR F 3 72  ? -13.251 39.478 -17.950 1.00 80.36 ? 191 TYR F CG  1 
ATOM   5210 C  CD1 . TYR F 3 72  ? -12.049 39.336 -18.661 1.00 80.81 ? 191 TYR F CD1 1 
ATOM   5211 C  CD2 . TYR F 3 72  ? -14.442 39.522 -18.674 1.00 81.21 ? 191 TYR F CD2 1 
ATOM   5212 C  CE1 . TYR F 3 72  ? -12.040 39.250 -20.056 1.00 81.66 ? 191 TYR F CE1 1 
ATOM   5213 C  CE2 . TYR F 3 72  ? -14.448 39.431 -20.069 1.00 82.14 ? 191 TYR F CE2 1 
ATOM   5214 C  CZ  . TYR F 3 72  ? -13.249 39.302 -20.757 1.00 82.40 ? 191 TYR F CZ  1 
ATOM   5215 O  OH  . TYR F 3 72  ? -13.263 39.261 -22.142 1.00 83.10 ? 191 TYR F OH  1 
ATOM   5216 N  N   . THR F 3 73  ? -12.155 42.493 -17.504 1.00 76.25 ? 192 THR F N   1 
ATOM   5217 C  CA  . THR F 3 73  ? -12.424 43.792 -18.114 1.00 77.13 ? 192 THR F CA  1 
ATOM   5218 C  C   . THR F 3 73  ? -13.394 43.702 -19.288 1.00 77.21 ? 192 THR F C   1 
ATOM   5219 O  O   . THR F 3 73  ? -13.810 44.724 -19.846 1.00 76.23 ? 192 THR F O   1 
ATOM   5220 C  CB  . THR F 3 73  ? -11.127 44.417 -18.636 1.00 77.86 ? 192 THR F CB  1 
ATOM   5221 O  OG1 . THR F 3 73  ? -10.074 44.176 -17.688 1.00 79.30 ? 192 THR F OG1 1 
ATOM   5222 C  CG2 . THR F 3 73  ? -11.316 45.933 -18.852 1.00 76.74 ? 192 THR F CG2 1 
ATOM   5223 N  N   . GLY F 3 74  ? -13.736 42.477 -19.674 1.00 77.70 ? 193 GLY F N   1 
ATOM   5224 C  CA  . GLY F 3 74  ? -14.656 42.308 -20.777 1.00 78.27 ? 193 GLY F CA  1 
ATOM   5225 C  C   . GLY F 3 74  ? -13.988 42.214 -22.133 1.00 78.88 ? 193 GLY F C   1 
ATOM   5226 O  O   . GLY F 3 74  ? -14.677 41.974 -23.140 1.00 79.72 ? 193 GLY F O   1 
ATOM   5227 N  N   . ILE F 3 75  ? -12.666 42.405 -22.178 1.00 78.67 ? 194 ILE F N   1 
ATOM   5228 C  CA  . ILE F 3 75  ? -11.933 42.337 -23.450 1.00 78.12 ? 194 ILE F CA  1 
ATOM   5229 C  C   . ILE F 3 75  ? -10.934 41.187 -23.450 1.00 77.97 ? 194 ILE F C   1 
ATOM   5230 O  O   . ILE F 3 75  ? -10.174 41.005 -22.491 1.00 78.61 ? 194 ILE F O   1 
ATOM   5231 C  CB  . ILE F 3 75  ? -11.161 43.629 -23.738 1.00 77.08 ? 194 ILE F CB  1 
ATOM   5232 C  CG1 . ILE F 3 75  ? -12.083 44.845 -23.583 1.00 77.23 ? 194 ILE F CG1 1 
ATOM   5233 C  CG2 . ILE F 3 75  ? -10.623 43.584 -25.147 1.00 77.79 ? 194 ILE F CG2 1 
ATOM   5234 C  CD1 . ILE F 3 75  ? -11.367 46.189 -23.785 1.00 76.73 ? 194 ILE F CD1 1 
ATOM   5235 N  N   . GLY F 3 76  ? -10.937 40.413 -24.530 1.00 77.28 ? 195 GLY F N   1 
ATOM   5236 C  CA  . GLY F 3 76  ? -10.027 39.288 -24.626 1.00 76.39 ? 195 GLY F CA  1 
ATOM   5237 C  C   . GLY F 3 76  ? -9.940  38.601 -23.288 1.00 75.58 ? 195 GLY F C   1 
ATOM   5238 O  O   . GLY F 3 76  ? -10.958 38.362 -22.643 1.00 75.21 ? 195 GLY F O   1 
ATOM   5239 N  N   . ASP F 3 77  ? -8.727  38.282 -22.863 1.00 75.91 ? 196 ASP F N   1 
ATOM   5240 C  CA  . ASP F 3 77  ? -8.549  37.627 -21.577 1.00 76.50 ? 196 ASP F CA  1 
ATOM   5241 C  C   . ASP F 3 77  ? -7.867  38.630 -20.657 1.00 76.32 ? 196 ASP F C   1 
ATOM   5242 O  O   . ASP F 3 77  ? -7.056  38.259 -19.794 1.00 76.21 ? 196 ASP F O   1 
ATOM   5243 C  CB  . ASP F 3 77  ? -7.701  36.357 -21.738 1.00 76.38 ? 196 ASP F CB  1 
ATOM   5244 C  CG  . ASP F 3 77  ? -6.273  36.650 -22.185 1.00 76.75 ? 196 ASP F CG  1 
ATOM   5245 O  OD1 . ASP F 3 77  ? -6.036  37.728 -22.802 1.00 74.66 ? 196 ASP F OD1 1 
ATOM   5246 O  OD2 . ASP F 3 77  ? -5.394  35.784 -21.919 1.00 77.04 ? 196 ASP F OD2 1 
ATOM   5247 N  N   . GLN F 3 78  ? -8.197  39.909 -20.860 1.00 75.72 ? 197 GLN F N   1 
ATOM   5248 C  CA  . GLN F 3 78  ? -7.621  40.988 -20.058 1.00 75.42 ? 197 GLN F CA  1 
ATOM   5249 C  C   . GLN F 3 78  ? -8.394  41.312 -18.785 1.00 74.98 ? 197 GLN F C   1 
ATOM   5250 O  O   . GLN F 3 78  ? -9.551  41.771 -18.821 1.00 74.61 ? 197 GLN F O   1 
ATOM   5251 C  CB  . GLN F 3 78  ? -7.475  42.273 -20.873 1.00 75.27 ? 197 GLN F CB  1 
ATOM   5252 C  CG  . GLN F 3 78  ? -7.178  43.480 -19.994 1.00 75.29 ? 197 GLN F CG  1 
ATOM   5253 C  CD  . GLN F 3 78  ? -6.699  44.685 -20.777 1.00 75.88 ? 197 GLN F CD  1 
ATOM   5254 O  OE1 . GLN F 3 78  ? -7.289  45.777 -20.689 1.00 76.56 ? 197 GLN F OE1 1 
ATOM   5255 N  NE2 . GLN F 3 78  ? -5.625  44.502 -21.552 1.00 75.13 ? 197 GLN F NE2 1 
ATOM   5256 N  N   . VAL F 3 79  ? -7.703  41.096 -17.668 1.00 74.41 ? 198 VAL F N   1 
ATOM   5257 C  CA  . VAL F 3 79  ? -8.228  41.326 -16.330 1.00 73.15 ? 198 VAL F CA  1 
ATOM   5258 C  C   . VAL F 3 79  ? -7.502  42.506 -15.696 1.00 72.18 ? 198 VAL F C   1 
ATOM   5259 O  O   . VAL F 3 79  ? -6.468  42.948 -16.193 1.00 71.89 ? 198 VAL F O   1 
ATOM   5260 C  CB  . VAL F 3 79  ? -8.007  40.080 -15.455 1.00 73.16 ? 198 VAL F CB  1 
ATOM   5261 C  CG1 . VAL F 3 79  ? -8.858  38.922 -15.980 1.00 73.43 ? 198 VAL F CG1 1 
ATOM   5262 C  CG2 . VAL F 3 79  ? -6.515  39.695 -15.467 1.00 72.24 ? 198 VAL F CG2 1 
ATOM   5263 N  N   . GLN F 3 80  ? -8.044  43.001 -14.590 1.00 71.38 ? 199 GLN F N   1 
ATOM   5264 C  CA  . GLN F 3 80  ? -7.465  44.135 -13.876 1.00 70.09 ? 199 GLN F CA  1 
ATOM   5265 C  C   . GLN F 3 80  ? -7.555  43.903 -12.350 1.00 70.06 ? 199 GLN F C   1 
ATOM   5266 O  O   . GLN F 3 80  ? -8.449  43.185 -11.866 1.00 70.40 ? 199 GLN F O   1 
ATOM   5267 C  CB  . GLN F 3 80  ? -8.210  45.404 -14.296 1.00 68.81 ? 199 GLN F CB  1 
ATOM   5268 C  CG  . GLN F 3 80  ? -7.711  46.693 -13.694 1.00 67.88 ? 199 GLN F CG  1 
ATOM   5269 C  CD  . GLN F 3 80  ? -8.205  47.910 -14.473 1.00 67.82 ? 199 GLN F CD  1 
ATOM   5270 O  OE1 . GLN F 3 80  ? -9.333  47.927 -14.971 1.00 68.55 ? 199 GLN F OE1 1 
ATOM   5271 N  NE2 . GLN F 3 80  ? -7.365  48.934 -14.573 1.00 67.14 ? 199 GLN F NE2 1 
ATOM   5272 N  N   . CYS F 3 81  ? -6.613  44.490 -11.601 1.00 69.84 ? 200 CYS F N   1 
ATOM   5273 C  CA  . CYS F 3 81  ? -6.559  44.361 -10.126 1.00 67.85 ? 200 CYS F CA  1 
ATOM   5274 C  C   . CYS F 3 81  ? -7.335  45.481 -9.446  1.00 65.14 ? 200 CYS F C   1 
ATOM   5275 O  O   . CYS F 3 81  ? -7.134  46.649 -9.761  1.00 64.95 ? 200 CYS F O   1 
ATOM   5276 C  CB  . CYS F 3 81  ? -5.108  44.396 -9.632  1.00 68.26 ? 200 CYS F CB  1 
ATOM   5277 S  SG  . CYS F 3 81  ? -4.970  44.613 -7.821  1.00 70.35 ? 200 CYS F SG  1 
ATOM   5278 N  N   . PHE F 3 82  ? -8.201  45.131 -8.504  1.00 62.63 ? 201 PHE F N   1 
ATOM   5279 C  CA  . PHE F 3 82  ? -9.019  46.134 -7.819  1.00 61.50 ? 201 PHE F CA  1 
ATOM   5280 C  C   . PHE F 3 82  ? -8.168  47.074 -6.974  1.00 59.99 ? 201 PHE F C   1 
ATOM   5281 O  O   . PHE F 3 82  ? -8.507  48.248 -6.766  1.00 58.54 ? 201 PHE F O   1 
ATOM   5282 C  CB  . PHE F 3 82  ? -10.057 45.439 -6.927  1.00 61.09 ? 201 PHE F CB  1 
ATOM   5283 C  CG  . PHE F 3 82  ? -9.487  44.898 -5.644  1.00 60.47 ? 201 PHE F CG  1 
ATOM   5284 C  CD1 . PHE F 3 82  ? -9.570  45.640 -4.467  1.00 60.18 ? 201 PHE F CD1 1 
ATOM   5285 C  CD2 . PHE F 3 82  ? -8.840  43.663 -5.618  1.00 60.49 ? 201 PHE F CD2 1 
ATOM   5286 C  CE1 . PHE F 3 82  ? -9.015  45.159 -3.275  1.00 60.55 ? 201 PHE F CE1 1 
ATOM   5287 C  CE2 . PHE F 3 82  ? -8.277  43.164 -4.433  1.00 60.07 ? 201 PHE F CE2 1 
ATOM   5288 C  CZ  . PHE F 3 82  ? -8.364  43.912 -3.260  1.00 60.44 ? 201 PHE F CZ  1 
ATOM   5289 N  N   . ALA F 3 83  ? -7.057  46.533 -6.496  1.00 59.64 ? 202 ALA F N   1 
ATOM   5290 C  CA  . ALA F 3 83  ? -6.127  47.267 -5.653  1.00 59.65 ? 202 ALA F CA  1 
ATOM   5291 C  C   . ALA F 3 83  ? -5.255  48.257 -6.427  1.00 60.65 ? 202 ALA F C   1 
ATOM   5292 O  O   . ALA F 3 83  ? -5.479  49.467 -6.357  1.00 60.00 ? 202 ALA F O   1 
ATOM   5293 C  CB  . ALA F 3 83  ? -5.242  46.276 -4.893  1.00 58.81 ? 202 ALA F CB  1 
ATOM   5294 N  N   . CYS F 3 84  ? -4.272  47.728 -7.164  1.00 61.51 ? 203 CYS F N   1 
ATOM   5295 C  CA  . CYS F 3 84  ? -3.331  48.549 -7.919  1.00 62.64 ? 203 CYS F CA  1 
ATOM   5296 C  C   . CYS F 3 84  ? -3.811  49.088 -9.256  1.00 64.11 ? 203 CYS F C   1 
ATOM   5297 O  O   . CYS F 3 84  ? -3.283  50.094 -9.745  1.00 64.68 ? 203 CYS F O   1 
ATOM   5298 C  CB  . CYS F 3 84  ? -2.048  47.779 -8.152  1.00 62.28 ? 203 CYS F CB  1 
ATOM   5299 S  SG  . CYS F 3 84  ? -2.268  46.373 -9.206  1.00 62.61 ? 203 CYS F SG  1 
ATOM   5300 N  N   . GLY F 3 85  ? -4.793  48.425 -9.856  1.00 64.93 ? 204 GLY F N   1 
ATOM   5301 C  CA  . GLY F 3 85  ? -5.303  48.903 -11.130 1.00 65.65 ? 204 GLY F CA  1 
ATOM   5302 C  C   . GLY F 3 85  ? -4.510  48.362 -12.294 1.00 65.88 ? 204 GLY F C   1 
ATOM   5303 O  O   . GLY F 3 85  ? -4.746  48.734 -13.437 1.00 66.38 ? 204 GLY F O   1 
ATOM   5304 N  N   . GLY F 3 86  ? -3.556  47.485 -11.998 1.00 66.94 ? 205 GLY F N   1 
ATOM   5305 C  CA  . GLY F 3 86  ? -2.746  46.881 -13.046 1.00 67.52 ? 205 GLY F CA  1 
ATOM   5306 C  C   . GLY F 3 86  ? -3.567  46.001 -13.980 1.00 68.49 ? 205 GLY F C   1 
ATOM   5307 O  O   . GLY F 3 86  ? -4.619  45.458 -13.610 1.00 68.69 ? 205 GLY F O   1 
ATOM   5308 N  N   . LYS F 3 87  ? -3.096  45.863 -15.211 1.00 69.27 ? 206 LYS F N   1 
ATOM   5309 C  CA  . LYS F 3 87  ? -3.796  45.054 -16.196 1.00 69.98 ? 206 LYS F CA  1 
ATOM   5310 C  C   . LYS F 3 87  ? -2.934  43.900 -16.662 1.00 70.47 ? 206 LYS F C   1 
ATOM   5311 O  O   . LYS F 3 87  ? -1.749  44.061 -16.950 1.00 70.20 ? 206 LYS F O   1 
ATOM   5312 C  CB  . LYS F 3 87  ? -4.188  45.912 -17.401 1.00 70.53 ? 206 LYS F CB  1 
ATOM   5313 C  CG  . LYS F 3 87  ? -5.319  46.902 -17.150 1.00 71.47 ? 206 LYS F CG  1 
ATOM   5314 C  CD  . LYS F 3 87  ? -5.376  47.917 -18.291 1.00 72.99 ? 206 LYS F CD  1 
ATOM   5315 C  CE  . LYS F 3 87  ? -6.654  48.757 -18.263 1.00 73.87 ? 206 LYS F CE  1 
ATOM   5316 N  NZ  . LYS F 3 87  ? -7.864  47.939 -18.622 1.00 75.27 ? 206 LYS F NZ  1 
ATOM   5317 N  N   . LEU F 3 88  ? -3.537  42.726 -16.726 1.00 71.95 ? 207 LEU F N   1 
ATOM   5318 C  CA  . LEU F 3 88  ? -2.832  41.547 -17.186 1.00 74.21 ? 207 LEU F CA  1 
ATOM   5319 C  C   . LEU F 3 88  ? -3.664  40.950 -18.310 1.00 75.26 ? 207 LEU F C   1 
ATOM   5320 O  O   . LEU F 3 88  ? -4.907  41.019 -18.280 1.00 75.82 ? 207 LEU F O   1 
ATOM   5321 C  CB  . LEU F 3 88  ? -2.670  40.548 -16.045 1.00 75.09 ? 207 LEU F CB  1 
ATOM   5322 C  CG  . LEU F 3 88  ? -1.833  41.117 -14.903 1.00 76.08 ? 207 LEU F CG  1 
ATOM   5323 C  CD1 . LEU F 3 88  ? -1.666  40.064 -13.805 1.00 77.06 ? 207 LEU F CD1 1 
ATOM   5324 C  CD2 . LEU F 3 88  ? -0.468  41.536 -15.454 1.00 76.56 ? 207 LEU F CD2 1 
ATOM   5325 N  N   . LYS F 3 89  ? -2.986  40.378 -19.305 1.00 75.74 ? 208 LYS F N   1 
ATOM   5326 C  CA  . LYS F 3 89  ? -3.669  39.784 -20.455 1.00 75.76 ? 208 LYS F CA  1 
ATOM   5327 C  C   . LYS F 3 89  ? -2.766  38.777 -21.169 1.00 76.58 ? 208 LYS F C   1 
ATOM   5328 O  O   . LYS F 3 89  ? -1.609  38.572 -20.776 1.00 77.07 ? 208 LYS F O   1 
ATOM   5329 C  CB  . LYS F 3 89  ? -4.080  40.889 -21.436 1.00 73.66 ? 208 LYS F CB  1 
ATOM   5330 C  CG  . LYS F 3 89  ? -2.897  41.672 -21.994 1.00 70.70 ? 208 LYS F CG  1 
ATOM   5331 C  CD  . LYS F 3 89  ? -3.328  42.762 -22.969 1.00 68.08 ? 208 LYS F CD  1 
ATOM   5332 C  CE  . LYS F 3 89  ? -2.104  43.457 -23.547 1.00 68.04 ? 208 LYS F CE  1 
ATOM   5333 N  NZ  . LYS F 3 89  ? -2.405  44.388 -24.684 1.00 66.40 ? 208 LYS F NZ  1 
ATOM   5334 N  N   . ASN F 3 90  ? -3.297  38.154 -22.216 1.00 76.79 ? 209 ASN F N   1 
ATOM   5335 C  CA  . ASN F 3 90  ? -2.533  37.186 -22.974 1.00 77.91 ? 209 ASN F CA  1 
ATOM   5336 C  C   . ASN F 3 90  ? -1.890  36.108 -22.082 1.00 79.62 ? 209 ASN F C   1 
ATOM   5337 O  O   . ASN F 3 90  ? -0.696  35.790 -22.214 1.00 79.82 ? 209 ASN F O   1 
ATOM   5338 C  CB  . ASN F 3 90  ? -1.478  37.926 -23.800 1.00 76.93 ? 209 ASN F CB  1 
ATOM   5339 C  CG  . ASN F 3 90  ? -2.113  38.877 -24.831 1.00 77.55 ? 209 ASN F CG  1 
ATOM   5340 O  OD1 . ASN F 3 90  ? -3.122  38.532 -25.465 1.00 77.74 ? 209 ASN F OD1 1 
ATOM   5341 N  ND2 . ASN F 3 90  ? -1.525  40.066 -25.011 1.00 75.11 ? 209 ASN F ND2 1 
ATOM   5342 N  N   . TRP F 3 91  ? -2.696  35.534 -21.189 1.00 81.12 ? 210 TRP F N   1 
ATOM   5343 C  CA  . TRP F 3 91  ? -2.223  34.491 -20.276 1.00 83.29 ? 210 TRP F CA  1 
ATOM   5344 C  C   . TRP F 3 91  ? -1.764  33.221 -20.991 1.00 85.14 ? 210 TRP F C   1 
ATOM   5345 O  O   . TRP F 3 91  ? -2.509  32.647 -21.790 1.00 85.94 ? 210 TRP F O   1 
ATOM   5346 C  CB  . TRP F 3 91  ? -3.330  34.123 -19.302 1.00 82.75 ? 210 TRP F CB  1 
ATOM   5347 C  CG  . TRP F 3 91  ? -3.819  35.295 -18.568 1.00 82.60 ? 210 TRP F CG  1 
ATOM   5348 C  CD1 . TRP F 3 91  ? -4.654  36.279 -19.038 1.00 82.19 ? 210 TRP F CD1 1 
ATOM   5349 C  CD2 . TRP F 3 91  ? -3.447  35.673 -17.240 1.00 82.46 ? 210 TRP F CD2 1 
ATOM   5350 N  NE1 . TRP F 3 91  ? -4.819  37.253 -18.072 1.00 83.28 ? 210 TRP F NE1 1 
ATOM   5351 C  CE2 . TRP F 3 91  ? -4.088  36.905 -16.960 1.00 82.74 ? 210 TRP F CE2 1 
ATOM   5352 C  CE3 . TRP F 3 91  ? -2.631  35.093 -16.262 1.00 81.63 ? 210 TRP F CE3 1 
ATOM   5353 C  CZ2 . TRP F 3 91  ? -3.936  37.564 -15.741 1.00 82.50 ? 210 TRP F CZ2 1 
ATOM   5354 C  CZ3 . TRP F 3 91  ? -2.481  35.749 -15.053 1.00 82.40 ? 210 TRP F CZ3 1 
ATOM   5355 C  CH2 . TRP F 3 91  ? -3.132  36.974 -14.803 1.00 82.74 ? 210 TRP F CH2 1 
ATOM   5356 N  N   . GLU F 3 92  ? -0.547  32.778 -20.698 1.00 86.77 ? 211 GLU F N   1 
ATOM   5357 C  CA  . GLU F 3 92  ? -0.025  31.565 -21.318 1.00 88.85 ? 211 GLU F CA  1 
ATOM   5358 C  C   . GLU F 3 92  ? -0.171  30.368 -20.373 1.00 90.04 ? 211 GLU F C   1 
ATOM   5359 O  O   . GLU F 3 92  ? -0.202  30.525 -19.146 1.00 91.16 ? 211 GLU F O   1 
ATOM   5360 C  CB  . GLU F 3 92  ? 1.450   31.750 -21.666 1.00 88.83 ? 211 GLU F CB  1 
ATOM   5361 C  CG  . GLU F 3 92  ? 1.694   32.726 -22.787 1.00 89.89 ? 211 GLU F CG  1 
ATOM   5362 C  CD  . GLU F 3 92  ? 3.161   33.137 -22.863 1.00 91.06 ? 211 GLU F CD  1 
ATOM   5363 O  OE1 . GLU F 3 92  ? 4.040   32.229 -22.915 1.00 91.68 ? 211 GLU F OE1 1 
ATOM   5364 O  OE2 . GLU F 3 92  ? 3.441   34.365 -22.864 1.00 92.16 ? 211 GLU F OE2 1 
ATOM   5365 N  N   . PRO F 3 93  ? -0.238  29.147 -20.932 1.00 91.15 ? 212 PRO F N   1 
ATOM   5366 C  CA  . PRO F 3 93  ? -0.379  27.947 -20.090 1.00 91.11 ? 212 PRO F CA  1 
ATOM   5367 C  C   . PRO F 3 93  ? 0.676   27.945 -18.986 1.00 90.71 ? 212 PRO F C   1 
ATOM   5368 O  O   . PRO F 3 93  ? 1.829   28.314 -19.222 1.00 90.78 ? 212 PRO F O   1 
ATOM   5369 C  CB  . PRO F 3 93  ? -0.165  26.795 -21.080 1.00 91.36 ? 212 PRO F CB  1 
ATOM   5370 C  CG  . PRO F 3 93  ? -0.653  27.372 -22.390 1.00 91.41 ? 212 PRO F CG  1 
ATOM   5371 C  CD  . PRO F 3 93  ? -0.077  28.787 -22.354 1.00 91.16 ? 212 PRO F CD  1 
ATOM   5372 N  N   . GLY F 3 94  ? 0.283   27.538 -17.786 1.00 90.52 ? 213 GLY F N   1 
ATOM   5373 C  CA  . GLY F 3 94  ? 1.236   27.497 -16.694 1.00 90.35 ? 213 GLY F CA  1 
ATOM   5374 C  C   . GLY F 3 94  ? 1.233   28.792 -15.907 1.00 90.56 ? 213 GLY F C   1 
ATOM   5375 O  O   . GLY F 3 94  ? 1.818   28.866 -14.812 1.00 90.86 ? 213 GLY F O   1 
ATOM   5376 N  N   . ASP F 3 95  ? 0.585   29.820 -16.453 1.00 90.03 ? 214 ASP F N   1 
ATOM   5377 C  CA  . ASP F 3 95  ? 0.523   31.095 -15.750 1.00 89.83 ? 214 ASP F CA  1 
ATOM   5378 C  C   . ASP F 3 95  ? -0.448  31.044 -14.563 1.00 90.02 ? 214 ASP F C   1 
ATOM   5379 O  O   . ASP F 3 95  ? -1.671  30.963 -14.748 1.00 89.56 ? 214 ASP F O   1 
ATOM   5380 C  CB  . ASP F 3 95  ? 0.111   32.227 -16.704 1.00 89.00 ? 214 ASP F CB  1 
ATOM   5381 C  CG  . ASP F 3 95  ? 1.266   32.695 -17.585 1.00 88.41 ? 214 ASP F CG  1 
ATOM   5382 O  OD1 . ASP F 3 95  ? 2.415   32.255 -17.335 1.00 87.93 ? 214 ASP F OD1 1 
ATOM   5383 O  OD2 . ASP F 3 95  ? 1.028   33.505 -18.513 1.00 87.58 ? 214 ASP F OD2 1 
ATOM   5384 N  N   . ARG F 3 96  ? 0.106   31.059 -13.348 1.00 90.39 ? 215 ARG F N   1 
ATOM   5385 C  CA  . ARG F 3 96  ? -0.710  31.067 -12.135 1.00 90.48 ? 215 ARG F CA  1 
ATOM   5386 C  C   . ARG F 3 96  ? -1.042  32.544 -11.878 1.00 90.18 ? 215 ARG F C   1 
ATOM   5387 O  O   . ARG F 3 96  ? -0.138  33.407 -11.829 1.00 90.40 ? 215 ARG F O   1 
ATOM   5388 C  CB  . ARG F 3 96  ? 0.063   30.493 -10.943 1.00 91.24 ? 215 ARG F CB  1 
ATOM   5389 C  CG  . ARG F 3 96  ? 0.513   29.023 -11.069 1.00 92.27 ? 215 ARG F CG  1 
ATOM   5390 C  CD  . ARG F 3 96  ? -0.659  27.997 -11.040 1.00 93.93 ? 215 ARG F CD  1 
ATOM   5391 N  NE  . ARG F 3 96  ? -1.189  27.730 -12.388 1.00 95.24 ? 215 ARG F NE  1 
ATOM   5392 C  CZ  . ARG F 3 96  ? -2.226  28.366 -12.942 1.00 95.20 ? 215 ARG F CZ  1 
ATOM   5393 N  NH1 . ARG F 3 96  ? -2.870  29.313 -12.256 1.00 94.27 ? 215 ARG F NH1 1 
ATOM   5394 N  NH2 . ARG F 3 96  ? -2.595  28.074 -14.195 1.00 95.45 ? 215 ARG F NH2 1 
ATOM   5395 N  N   . ALA F 3 97  ? -2.334  32.829 -11.731 1.00 88.93 ? 216 ALA F N   1 
ATOM   5396 C  CA  . ALA F 3 97  ? -2.811  34.189 -11.508 1.00 88.00 ? 216 ALA F CA  1 
ATOM   5397 C  C   . ALA F 3 97  ? -1.932  34.996 -10.549 1.00 87.23 ? 216 ALA F C   1 
ATOM   5398 O  O   . ALA F 3 97  ? -1.278  35.978 -10.933 1.00 86.47 ? 216 ALA F O   1 
ATOM   5399 C  CB  . ALA F 3 97  ? -4.244  34.143 -10.974 1.00 88.31 ? 216 ALA F CB  1 
ATOM   5400 N  N   . TRP F 3 98  ? -1.928  34.564 -9.296  1.00 86.25 ? 217 TRP F N   1 
ATOM   5401 C  CA  . TRP F 3 98  ? -1.188  35.245 -8.255  1.00 85.52 ? 217 TRP F CA  1 
ATOM   5402 C  C   . TRP F 3 98  ? 0.292   35.482 -8.555  1.00 83.54 ? 217 TRP F C   1 
ATOM   5403 O  O   . TRP F 3 98  ? 0.808   36.573 -8.305  1.00 83.90 ? 217 TRP F O   1 
ATOM   5404 C  CB  . TRP F 3 98  ? -1.339  34.481 -6.949  1.00 87.78 ? 217 TRP F CB  1 
ATOM   5405 C  CG  . TRP F 3 98  ? -0.375  34.932 -5.943  1.00 90.86 ? 217 TRP F CG  1 
ATOM   5406 C  CD1 . TRP F 3 98  ? -0.512  35.990 -5.073  1.00 91.00 ? 217 TRP F CD1 1 
ATOM   5407 C  CD2 . TRP F 3 98  ? 0.937   34.391 -5.731  1.00 92.85 ? 217 TRP F CD2 1 
ATOM   5408 N  NE1 . TRP F 3 98  ? 0.648   36.136 -4.326  1.00 92.86 ? 217 TRP F NE1 1 
ATOM   5409 C  CE2 . TRP F 3 98  ? 1.552   35.171 -4.710  1.00 93.75 ? 217 TRP F CE2 1 
ATOM   5410 C  CE3 . TRP F 3 98  ? 1.655   33.322 -6.305  1.00 93.65 ? 217 TRP F CE3 1 
ATOM   5411 C  CZ2 . TRP F 3 98  ? 2.867   34.911 -4.248  1.00 94.42 ? 217 TRP F CZ2 1 
ATOM   5412 C  CZ3 . TRP F 3 98  ? 2.961   33.057 -5.847  1.00 94.20 ? 217 TRP F CZ3 1 
ATOM   5413 C  CH2 . TRP F 3 98  ? 3.551   33.854 -4.826  1.00 94.90 ? 217 TRP F CH2 1 
ATOM   5414 N  N   . SER F 3 99  ? 0.975   34.471 -9.079  1.00 81.11 ? 218 SER F N   1 
ATOM   5415 C  CA  . SER F 3 99  ? 2.396   34.607 -9.389  1.00 78.93 ? 218 SER F CA  1 
ATOM   5416 C  C   . SER F 3 99  ? 2.629   35.709 -10.425 1.00 77.41 ? 218 SER F C   1 
ATOM   5417 O  O   . SER F 3 99  ? 3.551   36.518 -10.291 1.00 77.11 ? 218 SER F O   1 
ATOM   5418 C  CB  . SER F 3 99  ? 2.953   33.284 -9.910  1.00 78.64 ? 218 SER F CB  1 
ATOM   5419 O  OG  . SER F 3 99  ? 4.370   33.331 -9.964  1.00 78.00 ? 218 SER F OG  1 
ATOM   5420 N  N   . GLU F 3 100 ? 1.797   35.734 -11.461 1.00 75.17 ? 219 GLU F N   1 
ATOM   5421 C  CA  . GLU F 3 100 ? 1.910   36.757 -12.500 1.00 73.19 ? 219 GLU F CA  1 
ATOM   5422 C  C   . GLU F 3 100 ? 1.587   38.135 -11.929 1.00 71.99 ? 219 GLU F C   1 
ATOM   5423 O  O   . GLU F 3 100 ? 2.233   39.138 -12.262 1.00 71.85 ? 219 GLU F O   1 
ATOM   5424 C  CB  . GLU F 3 100 ? 0.942   36.464 -13.657 1.00 72.45 ? 219 GLU F CB  1 
ATOM   5425 C  CG  . GLU F 3 100 ? 1.424   35.389 -14.593 1.00 71.44 ? 219 GLU F CG  1 
ATOM   5426 C  CD  . GLU F 3 100 ? 2.766   35.733 -15.196 1.00 71.42 ? 219 GLU F CD  1 
ATOM   5427 O  OE1 . GLU F 3 100 ? 2.814   36.635 -16.059 1.00 71.92 ? 219 GLU F OE1 1 
ATOM   5428 O  OE2 . GLU F 3 100 ? 3.776   35.112 -14.794 1.00 72.05 ? 219 GLU F OE2 1 
ATOM   5429 N  N   . HIS F 3 101 ? 0.579   38.176 -11.065 1.00 70.16 ? 220 HIS F N   1 
ATOM   5430 C  CA  . HIS F 3 101 ? 0.162   39.430 -10.465 1.00 68.50 ? 220 HIS F CA  1 
ATOM   5431 C  C   . HIS F 3 101 ? 1.298   40.164 -9.753  1.00 68.44 ? 220 HIS F C   1 
ATOM   5432 O  O   . HIS F 3 101 ? 1.459   41.374 -9.923  1.00 68.54 ? 220 HIS F O   1 
ATOM   5433 C  CB  . HIS F 3 101 ? -0.978  39.188 -9.487  1.00 65.54 ? 220 HIS F CB  1 
ATOM   5434 C  CG  . HIS F 3 101 ? -1.647  40.442 -9.036  1.00 63.51 ? 220 HIS F CG  1 
ATOM   5435 N  ND1 . HIS F 3 101 ? -2.708  40.445 -8.159  1.00 62.91 ? 220 HIS F ND1 1 
ATOM   5436 C  CD2 . HIS F 3 101 ? -1.419  41.737 -9.358  1.00 62.84 ? 220 HIS F CD2 1 
ATOM   5437 C  CE1 . HIS F 3 101 ? -3.109  41.687 -7.960  1.00 62.52 ? 220 HIS F CE1 1 
ATOM   5438 N  NE2 . HIS F 3 101 ? -2.343  42.490 -8.677  1.00 62.31 ? 220 HIS F NE2 1 
ATOM   5439 N  N   . ARG F 3 102 ? 2.090   39.442 -8.968  1.00 68.00 ? 221 ARG F N   1 
ATOM   5440 C  CA  . ARG F 3 102 ? 3.172   40.095 -8.256  1.00 69.45 ? 221 ARG F CA  1 
ATOM   5441 C  C   . ARG F 3 102 ? 4.424   40.299 -9.104  1.00 68.52 ? 221 ARG F C   1 
ATOM   5442 O  O   . ARG F 3 102 ? 5.235   41.187 -8.826  1.00 68.42 ? 221 ARG F O   1 
ATOM   5443 C  CB  . ARG F 3 102 ? 3.530   39.325 -6.982  1.00 72.28 ? 221 ARG F CB  1 
ATOM   5444 C  CG  . ARG F 3 102 ? 4.465   38.167 -7.186  1.00 76.05 ? 221 ARG F CG  1 
ATOM   5445 C  CD  . ARG F 3 102 ? 5.011   37.686 -5.849  1.00 79.86 ? 221 ARG F CD  1 
ATOM   5446 N  NE  . ARG F 3 102 ? 5.878   36.523 -6.031  1.00 83.82 ? 221 ARG F NE  1 
ATOM   5447 C  CZ  . ARG F 3 102 ? 6.748   36.079 -5.127  1.00 85.42 ? 221 ARG F CZ  1 
ATOM   5448 N  NH1 . ARG F 3 102 ? 6.880   36.701 -3.946  1.00 86.04 ? 221 ARG F NH1 1 
ATOM   5449 N  NH2 . ARG F 3 102 ? 7.505   35.020 -5.418  1.00 86.19 ? 221 ARG F NH2 1 
ATOM   5450 N  N   . ARG F 3 103 ? 4.588   39.482 -10.132 1.00 67.34 ? 222 ARG F N   1 
ATOM   5451 C  CA  . ARG F 3 103 ? 5.747   39.619 -11.004 1.00 66.51 ? 222 ARG F CA  1 
ATOM   5452 C  C   . ARG F 3 103 ? 5.685   40.976 -11.715 1.00 65.95 ? 222 ARG F C   1 
ATOM   5453 O  O   . ARG F 3 103 ? 6.699   41.680 -11.831 1.00 65.64 ? 222 ARG F O   1 
ATOM   5454 C  CB  . ARG F 3 103 ? 5.747   38.506 -12.047 1.00 67.65 ? 222 ARG F CB  1 
ATOM   5455 C  CG  . ARG F 3 103 ? 7.068   38.313 -12.777 1.00 69.02 ? 222 ARG F CG  1 
ATOM   5456 C  CD  . ARG F 3 103 ? 6.874   37.395 -13.984 1.00 70.09 ? 222 ARG F CD  1 
ATOM   5457 N  NE  . ARG F 3 103 ? 6.696   38.152 -15.223 1.00 70.51 ? 222 ARG F NE  1 
ATOM   5458 C  CZ  . ARG F 3 103 ? 6.219   37.636 -16.353 1.00 70.69 ? 222 ARG F CZ  1 
ATOM   5459 N  NH1 . ARG F 3 103 ? 5.862   36.358 -16.400 1.00 70.67 ? 222 ARG F NH1 1 
ATOM   5460 N  NH2 . ARG F 3 103 ? 6.110   38.391 -17.444 1.00 70.82 ? 222 ARG F NH2 1 
ATOM   5461 N  N   . HIS F 3 104 ? 4.489   41.336 -12.184 1.00 64.42 ? 223 HIS F N   1 
ATOM   5462 C  CA  . HIS F 3 104 ? 4.287   42.601 -12.890 1.00 63.34 ? 223 HIS F CA  1 
ATOM   5463 C  C   . HIS F 3 104 ? 3.926   43.764 -11.981 1.00 61.31 ? 223 HIS F C   1 
ATOM   5464 O  O   . HIS F 3 104 ? 4.024   44.925 -12.387 1.00 61.90 ? 223 HIS F O   1 
ATOM   5465 C  CB  . HIS F 3 104 ? 3.194   42.469 -13.962 1.00 64.32 ? 223 HIS F CB  1 
ATOM   5466 C  CG  . HIS F 3 104 ? 3.585   41.613 -15.127 1.00 66.20 ? 223 HIS F CG  1 
ATOM   5467 N  ND1 . HIS F 3 104 ? 4.287   42.104 -16.209 1.00 66.76 ? 223 HIS F ND1 1 
ATOM   5468 C  CD2 . HIS F 3 104 ? 3.392   40.293 -15.373 1.00 65.94 ? 223 HIS F CD2 1 
ATOM   5469 C  CE1 . HIS F 3 104 ? 4.514   41.122 -17.067 1.00 66.51 ? 223 HIS F CE1 1 
ATOM   5470 N  NE2 . HIS F 3 104 ? 3.982   40.014 -16.582 1.00 66.01 ? 223 HIS F NE2 1 
ATOM   5471 N  N   . PHE F 3 105 ? 3.496   43.467 -10.762 1.00 58.29 ? 224 PHE F N   1 
ATOM   5472 C  CA  . PHE F 3 105 ? 3.123   44.532 -9.850  1.00 56.49 ? 224 PHE F CA  1 
ATOM   5473 C  C   . PHE F 3 105 ? 3.537   44.196 -8.435  1.00 55.28 ? 224 PHE F C   1 
ATOM   5474 O  O   . PHE F 3 105 ? 2.715   44.125 -7.530  1.00 54.00 ? 224 PHE F O   1 
ATOM   5475 C  CB  . PHE F 3 105 ? 1.618   44.781 -9.926  1.00 56.26 ? 224 PHE F CB  1 
ATOM   5476 C  CG  . PHE F 3 105 ? 1.138   45.104 -11.308 1.00 56.49 ? 224 PHE F CG  1 
ATOM   5477 C  CD1 . PHE F 3 105 ? 0.422   44.167 -12.046 1.00 56.26 ? 224 PHE F CD1 1 
ATOM   5478 C  CD2 . PHE F 3 105 ? 1.427   46.335 -11.888 1.00 56.76 ? 224 PHE F CD2 1 
ATOM   5479 C  CE1 . PHE F 3 105 ? -0.004  44.445 -13.343 1.00 55.88 ? 224 PHE F CE1 1 
ATOM   5480 C  CE2 . PHE F 3 105 ? 1.008   46.624 -13.187 1.00 57.16 ? 224 PHE F CE2 1 
ATOM   5481 C  CZ  . PHE F 3 105 ? 0.290   45.673 -13.916 1.00 56.48 ? 224 PHE F CZ  1 
ATOM   5482 N  N   . PRO F 3 106 ? 4.844   44.010 -8.227  1.00 55.36 ? 225 PRO F N   1 
ATOM   5483 C  CA  . PRO F 3 106 ? 5.425   43.675 -6.931  1.00 54.99 ? 225 PRO F CA  1 
ATOM   5484 C  C   . PRO F 3 106 ? 5.227   44.759 -5.892  1.00 55.81 ? 225 PRO F C   1 
ATOM   5485 O  O   . PRO F 3 106 ? 5.485   44.536 -4.719  1.00 56.10 ? 225 PRO F O   1 
ATOM   5486 C  CB  . PRO F 3 106 ? 6.893   43.470 -7.266  1.00 55.04 ? 225 PRO F CB  1 
ATOM   5487 C  CG  . PRO F 3 106 ? 7.123   44.498 -8.325  1.00 55.49 ? 225 PRO F CG  1 
ATOM   5488 C  CD  . PRO F 3 106 ? 5.903   44.327 -9.206  1.00 55.48 ? 225 PRO F CD  1 
ATOM   5489 N  N   . ASN F 3 107 ? 4.767   45.932 -6.322  1.00 57.22 ? 226 ASN F N   1 
ATOM   5490 C  CA  . ASN F 3 107 ? 4.560   47.046 -5.407  1.00 57.40 ? 226 ASN F CA  1 
ATOM   5491 C  C   . ASN F 3 107 ? 3.100   47.252 -5.044  1.00 58.26 ? 226 ASN F C   1 
ATOM   5492 O  O   . ASN F 3 107 ? 2.757   48.226 -4.373  1.00 58.68 ? 226 ASN F O   1 
ATOM   5493 C  CB  . ASN F 3 107 ? 5.123   48.324 -6.018  1.00 57.92 ? 226 ASN F CB  1 
ATOM   5494 C  CG  . ASN F 3 107 ? 5.863   49.178 -4.999  1.00 57.46 ? 226 ASN F CG  1 
ATOM   5495 O  OD1 . ASN F 3 107 ? 6.720   48.680 -4.263  1.00 57.25 ? 226 ASN F OD1 1 
ATOM   5496 N  ND2 . ASN F 3 107 ? 5.548   50.465 -4.960  1.00 56.86 ? 226 ASN F ND2 1 
ATOM   5497 N  N   . CYS F 3 108 ? 2.252   46.325 -5.485  1.00 59.53 ? 227 CYS F N   1 
ATOM   5498 C  CA  . CYS F 3 108 ? 0.803   46.360 -5.221  1.00 60.02 ? 227 CYS F CA  1 
ATOM   5499 C  C   . CYS F 3 108 ? 0.448   46.037 -3.759  1.00 58.88 ? 227 CYS F C   1 
ATOM   5500 O  O   . CYS F 3 108 ? 0.986   45.105 -3.168  1.00 58.01 ? 227 CYS F O   1 
ATOM   5501 C  CB  . CYS F 3 108 ? 0.086   45.368 -6.147  1.00 60.76 ? 227 CYS F CB  1 
ATOM   5502 S  SG  . CYS F 3 108 ? -1.608  44.942 -5.636  1.00 64.36 ? 227 CYS F SG  1 
ATOM   5503 N  N   . PHE F 3 109 ? -0.468  46.804 -3.187  1.00 58.35 ? 228 PHE F N   1 
ATOM   5504 C  CA  . PHE F 3 109 ? -0.873  46.586 -1.806  1.00 57.94 ? 228 PHE F CA  1 
ATOM   5505 C  C   . PHE F 3 109 ? -1.408  45.182 -1.595  1.00 58.70 ? 228 PHE F C   1 
ATOM   5506 O  O   . PHE F 3 109 ? -1.015  44.494 -0.656  1.00 59.20 ? 228 PHE F O   1 
ATOM   5507 C  CB  . PHE F 3 109 ? -1.953  47.591 -1.398  1.00 56.96 ? 228 PHE F CB  1 
ATOM   5508 C  CG  . PHE F 3 109 ? -1.448  48.984 -1.187  1.00 56.52 ? 228 PHE F CG  1 
ATOM   5509 C  CD1 . PHE F 3 109 ? -0.459  49.519 -2.011  1.00 56.43 ? 228 PHE F CD1 1 
ATOM   5510 C  CD2 . PHE F 3 109 ? -2.002  49.785 -0.192  1.00 56.61 ? 228 PHE F CD2 1 
ATOM   5511 C  CE1 . PHE F 3 109 ? -0.031  50.829 -1.847  1.00 56.14 ? 228 PHE F CE1 1 
ATOM   5512 C  CE2 . PHE F 3 109 ? -1.585  51.101 -0.016  1.00 55.42 ? 228 PHE F CE2 1 
ATOM   5513 C  CZ  . PHE F 3 109 ? -0.599  51.625 -0.844  1.00 56.16 ? 228 PHE F CZ  1 
ATOM   5514 N  N   . PHE F 3 110 ? -2.324  44.758 -2.457  1.00 59.70 ? 229 PHE F N   1 
ATOM   5515 C  CA  . PHE F 3 110 ? -2.904  43.431 -2.310  1.00 60.75 ? 229 PHE F CA  1 
ATOM   5516 C  C   . PHE F 3 110 ? -1.780  42.415 -2.362  1.00 60.10 ? 229 PHE F C   1 
ATOM   5517 O  O   . PHE F 3 110 ? -1.762  41.464 -1.589  1.00 60.70 ? 229 PHE F O   1 
ATOM   5518 C  CB  . PHE F 3 110 ? -3.925  43.150 -3.425  1.00 63.05 ? 229 PHE F CB  1 
ATOM   5519 C  CG  . PHE F 3 110 ? -4.748  41.900 -3.198  1.00 64.85 ? 229 PHE F CG  1 
ATOM   5520 C  CD1 . PHE F 3 110 ? -5.715  41.859 -2.194  1.00 64.82 ? 229 PHE F CD1 1 
ATOM   5521 C  CD2 . PHE F 3 110 ? -4.532  40.753 -3.969  1.00 65.69 ? 229 PHE F CD2 1 
ATOM   5522 C  CE1 . PHE F 3 110 ? -6.457  40.694 -1.954  1.00 64.74 ? 229 PHE F CE1 1 
ATOM   5523 C  CE2 . PHE F 3 110 ? -5.271  39.580 -3.736  1.00 65.56 ? 229 PHE F CE2 1 
ATOM   5524 C  CZ  . PHE F 3 110 ? -6.233  39.553 -2.725  1.00 64.67 ? 229 PHE F CZ  1 
ATOM   5525 N  N   . VAL F 3 111 ? -0.838  42.632 -3.270  1.00 59.15 ? 230 VAL F N   1 
ATOM   5526 C  CA  . VAL F 3 111 ? 0.296   41.734 -3.422  1.00 58.95 ? 230 VAL F CA  1 
ATOM   5527 C  C   . VAL F 3 111 ? 1.183   41.755 -2.186  1.00 59.16 ? 230 VAL F C   1 
ATOM   5528 O  O   . VAL F 3 111 ? 1.665   40.712 -1.732  1.00 58.88 ? 230 VAL F O   1 
ATOM   5529 C  CB  . VAL F 3 111 ? 1.170   42.147 -4.618  1.00 59.07 ? 230 VAL F CB  1 
ATOM   5530 C  CG1 . VAL F 3 111 ? 2.448   41.309 -4.643  1.00 58.23 ? 230 VAL F CG1 1 
ATOM   5531 C  CG2 . VAL F 3 111 ? 0.377   42.000 -5.918  1.00 60.30 ? 230 VAL F CG2 1 
ATOM   5532 N  N   . LEU F 3 112 ? 1.397   42.955 -1.656  1.00 58.53 ? 231 LEU F N   1 
ATOM   5533 C  CA  . LEU F 3 112 ? 2.255   43.155 -0.498  1.00 57.88 ? 231 LEU F CA  1 
ATOM   5534 C  C   . LEU F 3 112 ? 1.644   42.804 0.851   1.00 58.84 ? 231 LEU F C   1 
ATOM   5535 O  O   . LEU F 3 112 ? 2.350   42.381 1.768   1.00 58.95 ? 231 LEU F O   1 
ATOM   5536 C  CB  . LEU F 3 112 ? 2.721   44.605 -0.456  1.00 57.09 ? 231 LEU F CB  1 
ATOM   5537 C  CG  . LEU F 3 112 ? 3.687   45.052 -1.548  1.00 57.12 ? 231 LEU F CG  1 
ATOM   5538 C  CD1 . LEU F 3 112 ? 3.837   46.559 -1.495  1.00 55.66 ? 231 LEU F CD1 1 
ATOM   5539 C  CD2 . LEU F 3 112 ? 5.028   44.368 -1.357  1.00 57.08 ? 231 LEU F CD2 1 
ATOM   5540 N  N   . GLY F 3 113 ? 0.338   42.985 0.987   1.00 59.35 ? 232 GLY F N   1 
ATOM   5541 C  CA  . GLY F 3 113 ? -0.289  42.695 2.261   1.00 59.04 ? 232 GLY F CA  1 
ATOM   5542 C  C   . GLY F 3 113 ? -0.549  43.980 3.017   1.00 59.97 ? 232 GLY F C   1 
ATOM   5543 O  O   . GLY F 3 113 ? -0.897  43.962 4.194   1.00 60.18 ? 232 GLY F O   1 
ATOM   5544 N  N   . ARG F 3 114 ? -0.368  45.108 2.341   1.00 60.16 ? 233 ARG F N   1 
ATOM   5545 C  CA  . ARG F 3 114 ? -0.613  46.397 2.963   1.00 60.73 ? 233 ARG F CA  1 
ATOM   5546 C  C   . ARG F 3 114 ? -2.122  46.528 3.075   1.00 63.09 ? 233 ARG F C   1 
ATOM   5547 O  O   . ARG F 3 114 ? -2.879  46.075 2.192   1.00 63.45 ? 233 ARG F O   1 
ATOM   5548 C  CB  . ARG F 3 114 ? -0.040  47.523 2.099   1.00 59.71 ? 233 ARG F CB  1 
ATOM   5549 C  CG  . ARG F 3 114 ? -0.206  48.973 2.597   1.00 57.16 ? 233 ARG F CG  1 
ATOM   5550 C  CD  . ARG F 3 114 ? 1.074   49.727 2.221   1.00 56.98 ? 233 ARG F CD  1 
ATOM   5551 N  NE  . ARG F 3 114 ? 0.996   51.164 1.919   1.00 55.78 ? 233 ARG F NE  1 
ATOM   5552 C  CZ  . ARG F 3 114 ? 0.527   52.107 2.734   1.00 54.46 ? 233 ARG F CZ  1 
ATOM   5553 N  NH1 . ARG F 3 114 ? 0.051   51.800 3.928   1.00 57.13 ? 233 ARG F NH1 1 
ATOM   5554 N  NH2 . ARG F 3 114 ? 0.593   53.376 2.380   1.00 51.12 ? 233 ARG F NH2 1 
ATOM   5555 N  N   . ASN F 3 115 ? -2.541  47.125 4.187   1.00 64.84 ? 234 ASN F N   1 
ATOM   5556 C  CA  . ASN F 3 115 ? -3.945  47.368 4.488   1.00 65.85 ? 234 ASN F CA  1 
ATOM   5557 C  C   . ASN F 3 115 ? -4.650  47.989 3.264   1.00 65.47 ? 234 ASN F C   1 
ATOM   5558 O  O   . ASN F 3 115 ? -4.024  48.697 2.481   1.00 65.21 ? 234 ASN F O   1 
ATOM   5559 C  CB  . ASN F 3 115 ? -4.007  48.318 5.679   1.00 67.35 ? 234 ASN F CB  1 
ATOM   5560 C  CG  . ASN F 3 115 ? -5.361  48.346 6.329   1.00 69.36 ? 234 ASN F CG  1 
ATOM   5561 O  OD1 . ASN F 3 115 ? -5.725  49.335 6.993   1.00 71.33 ? 234 ASN F OD1 1 
ATOM   5562 N  ND2 . ASN F 3 115 ? -6.125  47.260 6.163   1.00 69.38 ? 234 ASN F ND2 1 
ATOM   5563 N  N   . LEU F 3 116 ? -5.938  47.707 3.093   1.00 65.70 ? 235 LEU F N   1 
ATOM   5564 C  CA  . LEU F 3 116 ? -6.718  48.248 1.974   1.00 66.08 ? 235 LEU F CA  1 
ATOM   5565 C  C   . LEU F 3 116 ? -8.065  48.726 2.503   1.00 67.17 ? 235 LEU F C   1 
ATOM   5566 O  O   . LEU F 3 116 ? -8.756  47.987 3.210   1.00 66.54 ? 235 LEU F O   1 
ATOM   5567 C  CB  . LEU F 3 116 ? -6.970  47.182 0.900   1.00 65.82 ? 235 LEU F CB  1 
ATOM   5568 C  CG  . LEU F 3 116 ? -6.261  47.188 -0.466  1.00 65.55 ? 235 LEU F CG  1 
ATOM   5569 C  CD1 . LEU F 3 116 ? -5.807  48.614 -0.846  1.00 65.61 ? 235 LEU F CD1 1 
ATOM   5570 C  CD2 . LEU F 3 116 ? -5.084  46.231 -0.424  1.00 65.40 ? 235 LEU F CD2 1 
ATOM   5571 N  N   . ASN F 3 117 ? -8.439  49.954 2.141   1.00 69.23 ? 236 ASN F N   1 
ATOM   5572 C  CA  . ASN F 3 117 ? -9.693  50.572 2.587   1.00 69.85 ? 236 ASN F CA  1 
ATOM   5573 C  C   . ASN F 3 117 ? -9.769  50.656 4.116   1.00 69.63 ? 236 ASN F C   1 
ATOM   5574 O  O   . ASN F 3 117 ? -8.755  50.378 4.816   1.00 68.97 ? 236 ASN F O   1 
ATOM   5575 C  CB  . ASN F 3 117 ? -10.921 49.800 2.061   1.00 70.83 ? 236 ASN F CB  1 
ATOM   5576 C  CG  . ASN F 3 117 ? -12.171 50.698 1.920   1.00 72.53 ? 236 ASN F CG  1 
ATOM   5577 O  OD1 . ASN F 3 117 ? -12.337 51.400 0.907   1.00 73.11 ? 236 ASN F OD1 1 
ATOM   5578 N  ND2 . ASN F 3 117 ? -13.041 50.691 2.943   1.00 72.09 ? 236 ASN F ND2 1 
HETATM 5579 ZN ZN  . ZN  G 4 .   ? 35.407  35.919 46.020  1.00 46.12 ? 1   ZN  E ZN  1 
HETATM 5580 ZN ZN  . ZN  H 4 .   ? -2.554  44.351 -7.894  1.00 59.35 ? 2   ZN  F ZN  1 
HETATM 5581 O  O   . HOH I 5 .   ? 21.069  55.158 19.776  1.00 38.38 ? 3   HOH A O   1 
HETATM 5582 O  O   . HOH I 5 .   ? 37.872  53.419 23.645  1.00 46.35 ? 5   HOH A O   1 
HETATM 5583 O  O   . HOH I 5 .   ? 27.605  60.220 12.787  1.00 39.25 ? 25  HOH A O   1 
HETATM 5584 O  O   . HOH J 5 .   ? 21.030  52.503 8.891   1.00 32.30 ? 1   HOH B O   1 
HETATM 5585 O  O   . HOH J 5 .   ? 23.174  54.628 14.423  1.00 32.74 ? 2   HOH B O   1 
HETATM 5586 O  O   . HOH J 5 .   ? 28.013  45.860 40.130  1.00 44.33 ? 11  HOH B O   1 
HETATM 5587 O  O   . HOH J 5 .   ? 25.207  44.198 22.554  1.00 39.59 ? 23  HOH B O   1 
HETATM 5588 O  O   . HOH K 5 .   ? 16.389  63.520 24.224  1.00 42.37 ? 12  HOH C O   1 
HETATM 5589 O  O   . HOH K 5 .   ? 4.816   62.356 13.343  1.00 39.54 ? 18  HOH C O   1 
HETATM 5590 O  O   . HOH K 5 .   ? 15.644  55.481 6.133   1.00 36.59 ? 24  HOH C O   1 
HETATM 5591 O  O   . HOH L 5 .   ? 17.738  56.316 22.745  1.00 42.84 ? 7   HOH D O   1 
HETATM 5592 O  O   . HOH L 5 .   ? 1.322   64.497 -0.633  1.00 39.54 ? 17  HOH D O   1 
HETATM 5593 O  O   . HOH M 5 .   ? 42.655  55.215 34.853  1.00 35.75 ? 10  HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   117 ?   ?   ?   A . n 
A 1 2   GLU 2   118 ?   ?   ?   A . n 
A 1 3   ASN 3   119 ?   ?   ?   A . n 
A 1 4   THR 4   120 ?   ?   ?   A . n 
A 1 5   GLU 5   121 ?   ?   ?   A . n 
A 1 6   ASN 6   122 ?   ?   ?   A . n 
A 1 7   SER 7   123 ?   ?   ?   A . n 
A 1 8   VAL 8   124 ?   ?   ?   A . n 
A 1 9   ASP 9   125 ?   ?   ?   A . n 
A 1 10  SER 10  126 ?   ?   ?   A . n 
A 1 11  LYS 11  127 ?   ?   ?   A . n 
A 1 12  SER 12  128 ?   ?   ?   A . n 
A 1 13  ILE 13  129 ?   ?   ?   A . n 
A 1 14  LYS 14  130 ?   ?   ?   A . n 
A 1 15  ASN 15  131 ?   ?   ?   A . n 
A 1 16  LEU 16  132 ?   ?   ?   A . n 
A 1 17  GLU 17  133 ?   ?   ?   A . n 
A 1 18  PRO 18  134 ?   ?   ?   A . n 
A 1 19  LYS 19  135 ?   ?   ?   A . n 
A 1 20  ILE 20  136 ?   ?   ?   A . n 
A 1 21  ILE 21  137 ?   ?   ?   A . n 
A 1 22  HIS 22  138 ?   ?   ?   A . n 
A 1 23  GLY 23  139 ?   ?   ?   A . n 
A 1 24  SER 24  140 ?   ?   ?   A . n 
A 1 25  GLU 25  141 ?   ?   ?   A . n 
A 1 26  SER 26  142 ?   ?   ?   A . n 
A 1 27  MET 27  143 ?   ?   ?   A . n 
A 1 28  ASP 28  144 ?   ?   ?   A . n 
A 1 29  SER 29  145 ?   ?   ?   A . n 
A 1 30  GLY 30  146 ?   ?   ?   A . n 
A 1 31  ILE 31  147 ?   ?   ?   A . n 
A 1 32  SER 32  148 148 SER SER A . n 
A 1 33  LEU 33  149 149 LEU LEU A . n 
A 1 34  ASP 34  150 150 ASP ASP A . n 
A 1 35  ASN 35  151 151 ASN ASN A . n 
A 1 36  SER 36  152 152 SER SER A . n 
A 1 37  TYR 37  153 153 TYR TYR A . n 
A 1 38  LYS 38  154 154 LYS LYS A . n 
A 1 39  MET 39  155 155 MET MET A . n 
A 1 40  ASP 40  156 156 ASP ASP A . n 
A 1 41  TYR 41  156 156 TYR TYR A A n 
A 1 42  PRO 42  161 161 PRO PRO A . n 
A 1 43  GLU 43  162 162 GLU GLU A . n 
A 1 44  MET 44  162 162 MET MET A A n 
A 1 45  GLY 45  163 163 GLY GLY A . n 
A 1 46  LEU 46  164 164 LEU LEU A . n 
A 1 47  CYS 47  165 165 CYS CYS A . n 
A 1 48  ILE 48  166 166 ILE ILE A . n 
A 1 49  ILE 49  167 167 ILE ILE A . n 
A 1 50  ILE 50  168 168 ILE ILE A . n 
A 1 51  ASN 51  169 169 ASN ASN A . n 
A 1 52  ASN 52  170 170 ASN ASN A . n 
A 1 53  LYS 53  171 171 LYS LYS A . n 
A 1 54  ASN 54  172 172 ASN ASN A . n 
A 1 55  PHE 55  173 173 PHE PHE A . n 
A 1 56  HIS 56  174 174 HIS HIS A . n 
A 1 57  LYS 57  175 175 LYS LYS A . n 
A 1 58  SER 58  175 175 SER SER A A n 
A 1 59  THR 59  175 175 THR THR A B n 
A 1 60  GLY 60  175 175 GLY GLY A C n 
A 1 61  MET 61  176 176 MET MET A . n 
A 1 62  THR 62  177 177 THR THR A . n 
A 1 63  SER 63  178 178 SER SER A . n 
A 1 64  ARG 64  179 179 ARG ARG A . n 
A 1 65  SER 65  180 180 SER SER A . n 
A 1 66  GLY 66  181 181 GLY GLY A . n 
A 1 67  THR 67  182 182 THR THR A . n 
A 1 68  ASP 68  183 183 ASP ASP A . n 
A 1 69  VAL 69  184 184 VAL VAL A . n 
A 1 70  ASP 70  185 185 ASP ASP A . n 
A 1 71  ALA 71  186 186 ALA ALA A . n 
A 1 72  ALA 72  187 187 ALA ALA A . n 
A 1 73  ASN 73  188 188 ASN ASN A . n 
A 1 74  LEU 74  189 189 LEU LEU A . n 
A 1 75  ARG 75  190 190 ARG ARG A . n 
A 1 76  GLU 76  191 191 GLU GLU A . n 
A 1 77  THR 77  192 192 THR THR A . n 
A 1 78  PHE 78  193 193 PHE PHE A . n 
A 1 79  ARG 79  194 194 ARG ARG A . n 
A 1 80  ASN 80  195 195 ASN ASN A . n 
A 1 81  LEU 81  196 196 LEU LEU A . n 
A 1 82  LYS 82  197 197 LYS LYS A . n 
A 1 83  TYR 83  198 198 TYR TYR A . n 
A 1 84  GLU 84  199 199 GLU GLU A . n 
A 1 85  VAL 85  200 200 VAL VAL A . n 
A 1 86  ARG 86  201 201 ARG ARG A . n 
A 1 87  ASN 87  202 202 ASN ASN A . n 
A 1 88  LYS 88  203 203 LYS LYS A . n 
A 1 89  ASN 89  204 204 ASN ASN A . n 
A 1 90  ASP 90  205 205 ASP ASP A . n 
A 1 91  LEU 91  206 206 LEU LEU A . n 
A 1 92  THR 92  207 207 THR THR A . n 
A 1 93  ARG 93  208 208 ARG ARG A . n 
A 1 94  GLU 94  209 209 GLU GLU A . n 
A 1 95  GLU 95  210 210 GLU GLU A . n 
A 1 96  ILE 96  211 211 ILE ILE A . n 
A 1 97  VAL 97  212 212 VAL VAL A . n 
A 1 98  GLU 98  213 213 GLU GLU A . n 
A 1 99  LEU 99  214 214 LEU LEU A . n 
A 1 100 MET 100 215 215 MET MET A . n 
A 1 101 ARG 101 216 216 ARG ARG A . n 
A 1 102 ASP 102 217 217 ASP ASP A . n 
A 1 103 VAL 103 218 218 VAL VAL A . n 
A 1 104 SER 104 219 219 SER SER A . n 
A 1 105 LYS 105 220 220 LYS LYS A . n 
A 1 106 GLU 106 221 221 GLU GLU A . n 
A 1 107 ASP 107 222 222 ASP ASP A . n 
A 1 108 HIS 108 224 224 HIS HIS A . n 
A 1 109 SER 109 225 225 SER SER A . n 
A 1 110 LYS 110 226 226 LYS LYS A . n 
A 1 111 ARG 111 227 227 ARG ARG A . n 
A 1 112 SER 112 228 228 SER SER A . n 
A 1 113 SER 113 229 229 SER SER A . n 
A 1 114 PHE 114 230 230 PHE PHE A . n 
A 1 115 VAL 115 231 231 VAL VAL A . n 
A 1 116 CYS 116 232 232 CYS CYS A . n 
A 1 117 VAL 117 233 233 VAL VAL A . n 
A 1 118 LEU 118 234 234 LEU LEU A . n 
A 1 119 LEU 119 235 235 LEU LEU A . n 
A 1 120 SER 120 236 236 SER SER A . n 
A 1 121 HIS 121 237 237 HIS HIS A . n 
A 1 122 GLY 122 238 238 GLY GLY A . n 
A 1 123 GLU 123 239 239 GLU GLU A . n 
A 1 124 GLU 124 240 240 GLU GLU A . n 
A 1 125 GLY 125 241 241 GLY GLY A . n 
A 1 126 ILE 126 242 242 ILE ILE A . n 
A 1 127 ILE 127 243 243 ILE ILE A . n 
A 1 128 PHE 128 244 244 PHE PHE A . n 
A 1 129 GLY 129 245 245 GLY GLY A . n 
A 1 130 THR 130 246 246 THR THR A . n 
A 1 131 ASN 131 247 247 ASN ASN A . n 
A 1 132 GLY 132 254 254 GLY GLY A . n 
A 1 133 PRO 133 255 255 PRO PRO A . n 
A 1 134 VAL 134 256 256 VAL VAL A . n 
A 1 135 ASP 135 257 257 ASP ASP A . n 
A 1 136 LEU 136 258 258 LEU LEU A . n 
A 1 137 LYS 137 259 259 LYS LYS A . n 
A 1 138 LYS 138 260 260 LYS LYS A . n 
A 1 139 ILE 139 261 261 ILE ILE A . n 
A 1 140 THR 140 262 262 THR THR A . n 
A 1 141 ASN 141 263 263 ASN ASN A . n 
A 1 142 PHE 142 264 264 PHE PHE A . n 
A 1 143 PHE 143 265 265 PHE PHE A . n 
A 1 144 ARG 144 266 266 ARG ARG A . n 
A 1 145 GLY 145 267 267 GLY GLY A . n 
A 1 146 ASP 146 268 268 ASP ASP A . n 
A 1 147 ARG 147 269 269 ARG ARG A . n 
A 1 148 CYS 148 270 270 CYS CYS A . n 
A 1 149 ARG 149 271 271 ARG ARG A . n 
A 1 150 SER 150 272 272 SER SER A . n 
A 1 151 LEU 151 273 273 LEU LEU A . n 
A 1 152 THR 152 274 274 THR THR A . n 
A 1 153 GLY 153 275 275 GLY GLY A . n 
A 1 154 LYS 154 276 276 LYS LYS A . n 
A 1 155 PRO 155 277 277 PRO PRO A . n 
A 1 156 LYS 156 278 278 LYS LYS A . n 
A 1 157 LEU 157 279 279 LEU LEU A . n 
A 1 158 PHE 158 280 280 PHE PHE A . n 
A 1 159 ILE 159 281 281 ILE ILE A . n 
A 1 160 ILE 160 282 282 ILE ILE A . n 
A 1 161 GLN 161 283 283 GLN GLN A . n 
A 1 162 ALA 162 284 284 ALA ALA A . n 
A 1 163 ALA 163 285 285 ALA ALA A . n 
A 1 164 ARG 164 286 286 ARG ARG A . n 
A 1 165 GLY 165 287 287 GLY GLY A . n 
A 1 166 THR 166 288 288 THR THR A . n 
A 1 167 GLU 167 289 289 GLU GLU A . n 
A 1 168 LEU 168 290 290 LEU LEU A . n 
A 1 169 ASP 169 291 291 ASP ASP A . n 
A 1 170 CYS 170 292 292 CYS CYS A . n 
A 1 171 GLY 171 293 293 GLY GLY A . n 
A 1 172 ILE 172 294 294 ILE ILE A . n 
A 1 173 GLU 173 295 295 GLU GLU A . n 
A 1 174 THR 174 296 296 THR THR A . n 
A 1 175 ASP 175 297 ?   ?   ?   A . n 
B 2 1   SER 1   310 310 SER SER B . n 
B 2 2   GLY 2   311 311 GLY GLY B . n 
B 2 3   VAL 3   312 312 VAL VAL B . n 
B 2 4   ASP 4   313 313 ASP ASP B . n 
B 2 5   ASP 5   314 314 ASP ASP B . n 
B 2 6   ASP 6   315 315 ASP ASP B . n 
B 2 7   MET 7   316 316 MET MET B . n 
B 2 8   ALA 8   317 317 ALA ALA B . n 
B 2 9   CYS 9   318 318 CYS CYS B . n 
B 2 10  HIS 10  319 319 HIS HIS B . n 
B 2 11  LYS 11  320 320 LYS LYS B . n 
B 2 12  ILE 12  321 321 ILE ILE B . n 
B 2 13  PRO 13  322 322 PRO PRO B . n 
B 2 14  VAL 14  323 323 VAL VAL B . n 
B 2 15  GLU 15  324 324 GLU GLU B . n 
B 2 16  ALA 16  325 325 ALA ALA B . n 
B 2 17  ASP 17  326 326 ASP ASP B . n 
B 2 18  PHE 18  327 327 PHE PHE B . n 
B 2 19  LEU 19  328 328 LEU LEU B . n 
B 2 20  TYR 20  329 329 TYR TYR B . n 
B 2 21  ALA 21  330 330 ALA ALA B . n 
B 2 22  TYR 22  331 331 TYR TYR B . n 
B 2 23  SER 23  332 332 SER SER B . n 
B 2 24  THR 24  333 333 THR THR B . n 
B 2 25  ALA 25  334 334 ALA ALA B . n 
B 2 26  PRO 26  335 335 PRO PRO B . n 
B 2 27  GLY 27  336 336 GLY GLY B . n 
B 2 28  TYR 28  337 337 TYR TYR B . n 
B 2 29  TYR 29  338 338 TYR TYR B . n 
B 2 30  SER 30  339 339 SER SER B . n 
B 2 31  TRP 31  340 340 TRP TRP B . n 
B 2 32  ARG 32  341 341 ARG ARG B . n 
B 2 33  ASN 33  342 342 ASN ASN B . n 
B 2 34  SER 34  343 343 SER SER B . n 
B 2 35  LYS 35  344 344 LYS LYS B . n 
B 2 36  ASP 36  345 345 ASP ASP B . n 
B 2 37  GLY 37  346 346 GLY GLY B . n 
B 2 38  SER 38  347 347 SER SER B . n 
B 2 39  TRP 39  348 348 TRP TRP B . n 
B 2 40  PHE 40  349 349 PHE PHE B . n 
B 2 41  ILE 41  350 350 ILE ILE B . n 
B 2 42  GLN 42  351 351 GLN GLN B . n 
B 2 43  SER 43  352 352 SER SER B . n 
B 2 44  LEU 44  353 353 LEU LEU B . n 
B 2 45  CYS 45  354 354 CYS CYS B . n 
B 2 46  ALA 46  355 355 ALA ALA B . n 
B 2 47  MET 47  356 356 MET MET B . n 
B 2 48  LEU 48  357 357 LEU LEU B . n 
B 2 49  LYS 49  358 358 LYS LYS B . n 
B 2 50  GLN 50  359 359 GLN GLN B . n 
B 2 51  TYR 51  360 360 TYR TYR B . n 
B 2 52  ALA 52  361 361 ALA ALA B . n 
B 2 53  ASP 53  362 362 ASP ASP B . n 
B 2 54  LYS 54  363 363 LYS LYS B . n 
B 2 55  LEU 55  364 364 LEU LEU B . n 
B 2 56  GLU 56  365 365 GLU GLU B . n 
B 2 57  PHE 57  366 366 PHE PHE B . n 
B 2 58  MET 58  367 367 MET MET B . n 
B 2 59  HIS 59  368 368 HIS HIS B . n 
B 2 60  ILE 60  369 369 ILE ILE B . n 
B 2 61  LEU 61  370 370 LEU LEU B . n 
B 2 62  THR 62  371 371 THR THR B . n 
B 2 63  ARG 63  372 372 ARG ARG B . n 
B 2 64  VAL 64  373 373 VAL VAL B . n 
B 2 65  ASN 65  374 374 ASN ASN B . n 
B 2 66  ARG 66  375 375 ARG ARG B . n 
B 2 67  LYS 67  376 376 LYS LYS B . n 
B 2 68  VAL 68  377 377 VAL VAL B . n 
B 2 69  ALA 69  378 378 ALA ALA B . n 
B 2 70  THR 70  379 379 THR THR B . n 
B 2 71  GLU 71  379 379 GLU GLU B A n 
B 2 72  PHE 72  380 380 PHE PHE B . n 
B 2 73  GLU 73  381 381 GLU GLU B . n 
B 2 74  SER 74  381 381 SER SER B A n 
B 2 75  PHE 75  381 381 PHE PHE B B n 
B 2 76  SER 76  381 381 SER SER B C n 
B 2 77  PHE 77  381 381 PHE PHE B D n 
B 2 78  ASP 78  381 381 ASP ASP B E n 
B 2 79  ALA 79  381 381 ALA ALA B F n 
B 2 80  THR 80  381 381 THR THR B G n 
B 2 81  PHE 81  381 381 PHE PHE B H n 
B 2 82  HIS 82  381 381 HIS HIS B I n 
B 2 83  ALA 83  382 382 ALA ALA B . n 
B 2 84  LYS 84  383 383 LYS LYS B . n 
B 2 85  LYS 85  384 384 LYS LYS B . n 
B 2 86  GLN 86  385 385 GLN GLN B . n 
B 2 87  ILE 87  386 386 ILE ILE B . n 
B 2 88  PRO 88  387 387 PRO PRO B . n 
B 2 89  CYS 89  388 388 CYS CYS B . n 
B 2 90  ILE 90  389 389 ILE ILE B . n 
B 2 91  VAL 91  390 390 VAL VAL B . n 
B 2 92  SER 92  392 392 SER SER B . n 
B 2 93  MET 93  393 393 MET MET B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  THR 95  395 395 THR THR B . n 
B 2 96  LYS 96  396 396 LYS LYS B . n 
B 2 97  GLU 97  397 397 GLU GLU B . n 
B 2 98  LEU 98  398 398 LEU LEU B . n 
B 2 99  TYR 99  399 399 TYR TYR B . n 
B 2 100 PHE 100 400 400 PHE PHE B . n 
B 2 101 TYR 101 401 401 TYR TYR B . n 
B 2 102 HIS 102 402 ?   ?   ?   B . n 
B 2 103 LEU 103 403 ?   ?   ?   B . n 
B 2 104 GLU 104 404 ?   ?   ?   B . n 
B 2 105 HIS 105 405 ?   ?   ?   B . n 
B 2 106 HIS 106 406 ?   ?   ?   B . n 
B 2 107 HIS 107 407 ?   ?   ?   B . n 
B 2 108 HIS 108 408 ?   ?   ?   B . n 
B 2 109 HIS 109 409 ?   ?   ?   B . n 
B 2 110 HIS 110 410 ?   ?   ?   B . n 
C 1 1   MET 1   117 ?   ?   ?   C . n 
C 1 2   GLU 2   118 ?   ?   ?   C . n 
C 1 3   ASN 3   119 ?   ?   ?   C . n 
C 1 4   THR 4   120 ?   ?   ?   C . n 
C 1 5   GLU 5   121 ?   ?   ?   C . n 
C 1 6   ASN 6   122 ?   ?   ?   C . n 
C 1 7   SER 7   123 ?   ?   ?   C . n 
C 1 8   VAL 8   124 ?   ?   ?   C . n 
C 1 9   ASP 9   125 ?   ?   ?   C . n 
C 1 10  SER 10  126 ?   ?   ?   C . n 
C 1 11  LYS 11  127 ?   ?   ?   C . n 
C 1 12  SER 12  128 ?   ?   ?   C . n 
C 1 13  ILE 13  129 ?   ?   ?   C . n 
C 1 14  LYS 14  130 ?   ?   ?   C . n 
C 1 15  ASN 15  131 ?   ?   ?   C . n 
C 1 16  LEU 16  132 ?   ?   ?   C . n 
C 1 17  GLU 17  133 ?   ?   ?   C . n 
C 1 18  PRO 18  134 ?   ?   ?   C . n 
C 1 19  LYS 19  135 ?   ?   ?   C . n 
C 1 20  ILE 20  136 ?   ?   ?   C . n 
C 1 21  ILE 21  137 ?   ?   ?   C . n 
C 1 22  HIS 22  138 ?   ?   ?   C . n 
C 1 23  GLY 23  139 ?   ?   ?   C . n 
C 1 24  SER 24  140 ?   ?   ?   C . n 
C 1 25  GLU 25  141 ?   ?   ?   C . n 
C 1 26  SER 26  142 ?   ?   ?   C . n 
C 1 27  MET 27  143 ?   ?   ?   C . n 
C 1 28  ASP 28  144 ?   ?   ?   C . n 
C 1 29  SER 29  145 ?   ?   ?   C . n 
C 1 30  GLY 30  146 ?   ?   ?   C . n 
C 1 31  ILE 31  147 ?   ?   ?   C . n 
C 1 32  SER 32  148 148 SER SER C . n 
C 1 33  LEU 33  149 149 LEU LEU C . n 
C 1 34  ASP 34  150 150 ASP ASP C . n 
C 1 35  ASN 35  151 151 ASN ASN C . n 
C 1 36  SER 36  152 152 SER SER C . n 
C 1 37  TYR 37  153 153 TYR TYR C . n 
C 1 38  LYS 38  154 154 LYS LYS C . n 
C 1 39  MET 39  155 155 MET MET C . n 
C 1 40  ASP 40  156 156 ASP ASP C . n 
C 1 41  TYR 41  156 156 TYR TYR C A n 
C 1 42  PRO 42  161 161 PRO PRO C . n 
C 1 43  GLU 43  162 162 GLU GLU C . n 
C 1 44  MET 44  162 162 MET MET C A n 
C 1 45  GLY 45  163 163 GLY GLY C . n 
C 1 46  LEU 46  164 164 LEU LEU C . n 
C 1 47  CYS 47  165 165 CYS CYS C . n 
C 1 48  ILE 48  166 166 ILE ILE C . n 
C 1 49  ILE 49  167 167 ILE ILE C . n 
C 1 50  ILE 50  168 168 ILE ILE C . n 
C 1 51  ASN 51  169 169 ASN ASN C . n 
C 1 52  ASN 52  170 170 ASN ASN C . n 
C 1 53  LYS 53  171 171 LYS LYS C . n 
C 1 54  ASN 54  172 172 ASN ASN C . n 
C 1 55  PHE 55  173 173 PHE PHE C . n 
C 1 56  HIS 56  174 174 HIS HIS C . n 
C 1 57  LYS 57  175 175 LYS LYS C . n 
C 1 58  SER 58  175 175 SER SER C A n 
C 1 59  THR 59  175 175 THR THR C B n 
C 1 60  GLY 60  175 175 GLY GLY C C n 
C 1 61  MET 61  176 176 MET MET C . n 
C 1 62  THR 62  177 177 THR THR C . n 
C 1 63  SER 63  178 178 SER SER C . n 
C 1 64  ARG 64  179 179 ARG ARG C . n 
C 1 65  SER 65  180 180 SER SER C . n 
C 1 66  GLY 66  181 181 GLY GLY C . n 
C 1 67  THR 67  182 182 THR THR C . n 
C 1 68  ASP 68  183 183 ASP ASP C . n 
C 1 69  VAL 69  184 184 VAL VAL C . n 
C 1 70  ASP 70  185 185 ASP ASP C . n 
C 1 71  ALA 71  186 186 ALA ALA C . n 
C 1 72  ALA 72  187 187 ALA ALA C . n 
C 1 73  ASN 73  188 188 ASN ASN C . n 
C 1 74  LEU 74  189 189 LEU LEU C . n 
C 1 75  ARG 75  190 190 ARG ARG C . n 
C 1 76  GLU 76  191 191 GLU GLU C . n 
C 1 77  THR 77  192 192 THR THR C . n 
C 1 78  PHE 78  193 193 PHE PHE C . n 
C 1 79  ARG 79  194 194 ARG ARG C . n 
C 1 80  ASN 80  195 195 ASN ASN C . n 
C 1 81  LEU 81  196 196 LEU LEU C . n 
C 1 82  LYS 82  197 197 LYS LYS C . n 
C 1 83  TYR 83  198 198 TYR TYR C . n 
C 1 84  GLU 84  199 199 GLU GLU C . n 
C 1 85  VAL 85  200 200 VAL VAL C . n 
C 1 86  ARG 86  201 201 ARG ARG C . n 
C 1 87  ASN 87  202 202 ASN ASN C . n 
C 1 88  LYS 88  203 203 LYS LYS C . n 
C 1 89  ASN 89  204 204 ASN ASN C . n 
C 1 90  ASP 90  205 205 ASP ASP C . n 
C 1 91  LEU 91  206 206 LEU LEU C . n 
C 1 92  THR 92  207 207 THR THR C . n 
C 1 93  ARG 93  208 208 ARG ARG C . n 
C 1 94  GLU 94  209 209 GLU GLU C . n 
C 1 95  GLU 95  210 210 GLU GLU C . n 
C 1 96  ILE 96  211 211 ILE ILE C . n 
C 1 97  VAL 97  212 212 VAL VAL C . n 
C 1 98  GLU 98  213 213 GLU GLU C . n 
C 1 99  LEU 99  214 214 LEU LEU C . n 
C 1 100 MET 100 215 215 MET MET C . n 
C 1 101 ARG 101 216 216 ARG ARG C . n 
C 1 102 ASP 102 217 217 ASP ASP C . n 
C 1 103 VAL 103 218 218 VAL VAL C . n 
C 1 104 SER 104 219 219 SER SER C . n 
C 1 105 LYS 105 220 220 LYS LYS C . n 
C 1 106 GLU 106 221 221 GLU GLU C . n 
C 1 107 ASP 107 222 222 ASP ASP C . n 
C 1 108 HIS 108 224 224 HIS HIS C . n 
C 1 109 SER 109 225 225 SER SER C . n 
C 1 110 LYS 110 226 226 LYS LYS C . n 
C 1 111 ARG 111 227 227 ARG ARG C . n 
C 1 112 SER 112 228 228 SER SER C . n 
C 1 113 SER 113 229 229 SER SER C . n 
C 1 114 PHE 114 230 230 PHE PHE C . n 
C 1 115 VAL 115 231 231 VAL VAL C . n 
C 1 116 CYS 116 232 232 CYS CYS C . n 
C 1 117 VAL 117 233 233 VAL VAL C . n 
C 1 118 LEU 118 234 234 LEU LEU C . n 
C 1 119 LEU 119 235 235 LEU LEU C . n 
C 1 120 SER 120 236 236 SER SER C . n 
C 1 121 HIS 121 237 237 HIS HIS C . n 
C 1 122 GLY 122 238 238 GLY GLY C . n 
C 1 123 GLU 123 239 239 GLU GLU C . n 
C 1 124 GLU 124 240 240 GLU GLU C . n 
C 1 125 GLY 125 241 241 GLY GLY C . n 
C 1 126 ILE 126 242 242 ILE ILE C . n 
C 1 127 ILE 127 243 243 ILE ILE C . n 
C 1 128 PHE 128 244 244 PHE PHE C . n 
C 1 129 GLY 129 245 245 GLY GLY C . n 
C 1 130 THR 130 246 246 THR THR C . n 
C 1 131 ASN 131 247 247 ASN ASN C . n 
C 1 132 GLY 132 254 254 GLY GLY C . n 
C 1 133 PRO 133 255 255 PRO PRO C . n 
C 1 134 VAL 134 256 256 VAL VAL C . n 
C 1 135 ASP 135 257 257 ASP ASP C . n 
C 1 136 LEU 136 258 258 LEU LEU C . n 
C 1 137 LYS 137 259 259 LYS LYS C . n 
C 1 138 LYS 138 260 260 LYS LYS C . n 
C 1 139 ILE 139 261 261 ILE ILE C . n 
C 1 140 THR 140 262 262 THR THR C . n 
C 1 141 ASN 141 263 263 ASN ASN C . n 
C 1 142 PHE 142 264 264 PHE PHE C . n 
C 1 143 PHE 143 265 265 PHE PHE C . n 
C 1 144 ARG 144 266 266 ARG ARG C . n 
C 1 145 GLY 145 267 267 GLY GLY C . n 
C 1 146 ASP 146 268 268 ASP ASP C . n 
C 1 147 ARG 147 269 269 ARG ARG C . n 
C 1 148 CYS 148 270 270 CYS CYS C . n 
C 1 149 ARG 149 271 271 ARG ARG C . n 
C 1 150 SER 150 272 272 SER SER C . n 
C 1 151 LEU 151 273 273 LEU LEU C . n 
C 1 152 THR 152 274 274 THR THR C . n 
C 1 153 GLY 153 275 275 GLY GLY C . n 
C 1 154 LYS 154 276 276 LYS LYS C . n 
C 1 155 PRO 155 277 277 PRO PRO C . n 
C 1 156 LYS 156 278 278 LYS LYS C . n 
C 1 157 LEU 157 279 279 LEU LEU C . n 
C 1 158 PHE 158 280 280 PHE PHE C . n 
C 1 159 ILE 159 281 281 ILE ILE C . n 
C 1 160 ILE 160 282 282 ILE ILE C . n 
C 1 161 GLN 161 283 283 GLN GLN C . n 
C 1 162 ALA 162 284 284 ALA ALA C . n 
C 1 163 ALA 163 285 285 ALA ALA C . n 
C 1 164 ARG 164 286 286 ARG ARG C . n 
C 1 165 GLY 165 287 287 GLY GLY C . n 
C 1 166 THR 166 288 288 THR THR C . n 
C 1 167 GLU 167 289 289 GLU GLU C . n 
C 1 168 LEU 168 290 290 LEU LEU C . n 
C 1 169 ASP 169 291 291 ASP ASP C . n 
C 1 170 CYS 170 292 292 CYS CYS C . n 
C 1 171 GLY 171 293 293 GLY GLY C . n 
C 1 172 ILE 172 294 294 ILE ILE C . n 
C 1 173 GLU 173 295 295 GLU GLU C . n 
C 1 174 THR 174 296 296 THR THR C . n 
C 1 175 ASP 175 297 297 ASP ASP C . n 
D 2 1   SER 1   310 310 SER SER D . n 
D 2 2   GLY 2   311 311 GLY GLY D . n 
D 2 3   VAL 3   312 312 VAL VAL D . n 
D 2 4   ASP 4   313 313 ASP ASP D . n 
D 2 5   ASP 5   314 314 ASP ASP D . n 
D 2 6   ASP 6   315 315 ASP ASP D . n 
D 2 7   MET 7   316 316 MET MET D . n 
D 2 8   ALA 8   317 317 ALA ALA D . n 
D 2 9   CYS 9   318 318 CYS CYS D . n 
D 2 10  HIS 10  319 319 HIS HIS D . n 
D 2 11  LYS 11  320 320 LYS LYS D . n 
D 2 12  ILE 12  321 321 ILE ILE D . n 
D 2 13  PRO 13  322 322 PRO PRO D . n 
D 2 14  VAL 14  323 323 VAL VAL D . n 
D 2 15  GLU 15  324 324 GLU GLU D . n 
D 2 16  ALA 16  325 325 ALA ALA D . n 
D 2 17  ASP 17  326 326 ASP ASP D . n 
D 2 18  PHE 18  327 327 PHE PHE D . n 
D 2 19  LEU 19  328 328 LEU LEU D . n 
D 2 20  TYR 20  329 329 TYR TYR D . n 
D 2 21  ALA 21  330 330 ALA ALA D . n 
D 2 22  TYR 22  331 331 TYR TYR D . n 
D 2 23  SER 23  332 332 SER SER D . n 
D 2 24  THR 24  333 333 THR THR D . n 
D 2 25  ALA 25  334 334 ALA ALA D . n 
D 2 26  PRO 26  335 335 PRO PRO D . n 
D 2 27  GLY 27  336 336 GLY GLY D . n 
D 2 28  TYR 28  337 337 TYR TYR D . n 
D 2 29  TYR 29  338 338 TYR TYR D . n 
D 2 30  SER 30  339 339 SER SER D . n 
D 2 31  TRP 31  340 340 TRP TRP D . n 
D 2 32  ARG 32  341 341 ARG ARG D . n 
D 2 33  ASN 33  342 342 ASN ASN D . n 
D 2 34  SER 34  343 343 SER SER D . n 
D 2 35  LYS 35  344 344 LYS LYS D . n 
D 2 36  ASP 36  345 345 ASP ASP D . n 
D 2 37  GLY 37  346 346 GLY GLY D . n 
D 2 38  SER 38  347 347 SER SER D . n 
D 2 39  TRP 39  348 348 TRP TRP D . n 
D 2 40  PHE 40  349 349 PHE PHE D . n 
D 2 41  ILE 41  350 350 ILE ILE D . n 
D 2 42  GLN 42  351 351 GLN GLN D . n 
D 2 43  SER 43  352 352 SER SER D . n 
D 2 44  LEU 44  353 353 LEU LEU D . n 
D 2 45  CYS 45  354 354 CYS CYS D . n 
D 2 46  ALA 46  355 355 ALA ALA D . n 
D 2 47  MET 47  356 356 MET MET D . n 
D 2 48  LEU 48  357 357 LEU LEU D . n 
D 2 49  LYS 49  358 358 LYS LYS D . n 
D 2 50  GLN 50  359 359 GLN GLN D . n 
D 2 51  TYR 51  360 360 TYR TYR D . n 
D 2 52  ALA 52  361 361 ALA ALA D . n 
D 2 53  ASP 53  362 362 ASP ASP D . n 
D 2 54  LYS 54  363 363 LYS LYS D . n 
D 2 55  LEU 55  364 364 LEU LEU D . n 
D 2 56  GLU 56  365 365 GLU GLU D . n 
D 2 57  PHE 57  366 366 PHE PHE D . n 
D 2 58  MET 58  367 367 MET MET D . n 
D 2 59  HIS 59  368 368 HIS HIS D . n 
D 2 60  ILE 60  369 369 ILE ILE D . n 
D 2 61  LEU 61  370 370 LEU LEU D . n 
D 2 62  THR 62  371 371 THR THR D . n 
D 2 63  ARG 63  372 372 ARG ARG D . n 
D 2 64  VAL 64  373 373 VAL VAL D . n 
D 2 65  ASN 65  374 374 ASN ASN D . n 
D 2 66  ARG 66  375 375 ARG ARG D . n 
D 2 67  LYS 67  376 376 LYS LYS D . n 
D 2 68  VAL 68  377 377 VAL VAL D . n 
D 2 69  ALA 69  378 378 ALA ALA D . n 
D 2 70  THR 70  379 379 THR THR D . n 
D 2 71  GLU 71  379 379 GLU GLU D A n 
D 2 72  PHE 72  380 380 PHE PHE D . n 
D 2 73  GLU 73  381 381 GLU GLU D . n 
D 2 74  SER 74  381 381 SER SER D A n 
D 2 75  PHE 75  381 381 PHE PHE D B n 
D 2 76  SER 76  381 381 SER SER D C n 
D 2 77  PHE 77  381 381 PHE PHE D D n 
D 2 78  ASP 78  381 381 ASP ASP D E n 
D 2 79  ALA 79  381 381 ALA ALA D F n 
D 2 80  THR 80  381 381 THR THR D G n 
D 2 81  PHE 81  381 381 PHE PHE D H n 
D 2 82  HIS 82  381 381 HIS HIS D I n 
D 2 83  ALA 83  382 382 ALA ALA D . n 
D 2 84  LYS 84  383 383 LYS LYS D . n 
D 2 85  LYS 85  384 384 LYS LYS D . n 
D 2 86  GLN 86  385 385 GLN GLN D . n 
D 2 87  ILE 87  386 386 ILE ILE D . n 
D 2 88  PRO 88  387 387 PRO PRO D . n 
D 2 89  CYS 89  388 388 CYS CYS D . n 
D 2 90  ILE 90  389 389 ILE ILE D . n 
D 2 91  VAL 91  390 390 VAL VAL D . n 
D 2 92  SER 92  392 392 SER SER D . n 
D 2 93  MET 93  393 393 MET MET D . n 
D 2 94  LEU 94  394 394 LEU LEU D . n 
D 2 95  THR 95  395 395 THR THR D . n 
D 2 96  LYS 96  396 396 LYS LYS D . n 
D 2 97  GLU 97  397 397 GLU GLU D . n 
D 2 98  LEU 98  398 398 LEU LEU D . n 
D 2 99  TYR 99  399 399 TYR TYR D . n 
D 2 100 PHE 100 400 400 PHE PHE D . n 
D 2 101 TYR 101 401 401 TYR TYR D . n 
D 2 102 HIS 102 402 ?   ?   ?   D . n 
D 2 103 LEU 103 403 ?   ?   ?   D . n 
D 2 104 GLU 104 404 ?   ?   ?   D . n 
D 2 105 HIS 105 405 ?   ?   ?   D . n 
D 2 106 HIS 106 406 ?   ?   ?   D . n 
D 2 107 HIS 107 407 ?   ?   ?   D . n 
D 2 108 HIS 108 408 ?   ?   ?   D . n 
D 2 109 HIS 109 409 ?   ?   ?   D . n 
D 2 110 HIS 110 410 ?   ?   ?   D . n 
E 3 1   GLY 1   120 ?   ?   ?   E . n 
E 3 2   SER 2   121 ?   ?   ?   E . n 
E 3 3   HIS 3   122 ?   ?   ?   E . n 
E 3 4   MET 4   123 ?   ?   ?   E . n 
E 3 5   ARG 5   124 ?   ?   ?   E . n 
E 3 6   ASP 6   125 ?   ?   ?   E . n 
E 3 7   HIS 7   126 ?   ?   ?   E . n 
E 3 8   PHE 8   127 127 PHE PHE E . n 
E 3 9   ALA 9   128 128 ALA ALA E . n 
E 3 10  LEU 10  129 129 LEU LEU E . n 
E 3 11  ASP 11  130 130 ASP ASP E . n 
E 3 12  ARG 12  131 131 ARG ARG E . n 
E 3 13  PRO 13  132 132 PRO PRO E . n 
E 3 14  SER 14  133 133 SER SER E . n 
E 3 15  GLU 15  134 134 GLU GLU E . n 
E 3 16  THR 16  135 135 THR THR E . n 
E 3 17  HIS 17  136 136 HIS HIS E . n 
E 3 18  ALA 18  137 137 ALA ALA E . n 
E 3 19  ASP 19  138 138 ASP ASP E . n 
E 3 20  TYR 20  139 139 TYR TYR E . n 
E 3 21  LEU 21  140 140 LEU LEU E . n 
E 3 22  LEU 22  141 141 LEU LEU E . n 
E 3 23  ARG 23  142 142 ARG ARG E . n 
E 3 24  THR 24  143 143 THR THR E . n 
E 3 25  GLY 25  144 144 GLY GLY E . n 
E 3 26  GLN 26  145 145 GLN GLN E . n 
E 3 27  VAL 27  146 146 VAL VAL E . n 
E 3 28  VAL 28  147 147 VAL VAL E . n 
E 3 29  ASP 29  148 148 ASP ASP E . n 
E 3 30  ILE 30  149 149 ILE ILE E . n 
E 3 31  SER 31  150 150 SER SER E . n 
E 3 32  ASP 32  151 151 ASP ASP E . n 
E 3 33  THR 33  152 152 THR THR E . n 
E 3 34  ILE 34  153 153 ILE ILE E . n 
E 3 35  TYR 35  154 154 TYR TYR E . n 
E 3 36  PRO 36  155 155 PRO PRO E . n 
E 3 37  ARG 37  156 156 ARG ARG E . n 
E 3 38  ASN 38  157 157 ASN ASN E . n 
E 3 39  PRO 39  158 158 PRO PRO E . n 
E 3 40  ALA 40  159 159 ALA ALA E . n 
E 3 41  MET 41  160 160 MET MET E . n 
E 3 42  TYR 42  161 161 TYR TYR E . n 
E 3 43  SER 43  162 162 SER SER E . n 
E 3 44  GLU 44  163 163 GLU GLU E . n 
E 3 45  GLU 45  164 164 GLU GLU E . n 
E 3 46  ALA 46  165 165 ALA ALA E . n 
E 3 47  ARG 47  166 166 ARG ARG E . n 
E 3 48  LEU 48  167 167 LEU LEU E . n 
E 3 49  LYS 49  168 168 LYS LYS E . n 
E 3 50  SER 50  169 169 SER SER E . n 
E 3 51  PHE 51  170 170 PHE PHE E . n 
E 3 52  GLN 52  171 171 GLN GLN E . n 
E 3 53  ASN 53  172 172 ASN ASN E . n 
E 3 54  TRP 54  173 173 TRP TRP E . n 
E 3 55  PRO 55  174 174 PRO PRO E . n 
E 3 56  ASP 56  175 175 ASP ASP E . n 
E 3 57  TYR 57  176 176 TYR TYR E . n 
E 3 58  ALA 58  177 177 ALA ALA E . n 
E 3 59  HIS 59  178 178 HIS HIS E . n 
E 3 60  LEU 60  179 179 LEU LEU E . n 
E 3 61  THR 61  180 180 THR THR E . n 
E 3 62  PRO 62  181 181 PRO PRO E . n 
E 3 63  ARG 63  182 182 ARG ARG E . n 
E 3 64  GLU 64  183 183 GLU GLU E . n 
E 3 65  LEU 65  184 184 LEU LEU E . n 
E 3 66  ALA 66  185 185 ALA ALA E . n 
E 3 67  SER 67  186 186 SER SER E . n 
E 3 68  ALA 68  187 187 ALA ALA E . n 
E 3 69  GLY 69  188 188 GLY GLY E . n 
E 3 70  LEU 70  189 189 LEU LEU E . n 
E 3 71  TYR 71  190 190 TYR TYR E . n 
E 3 72  TYR 72  191 191 TYR TYR E . n 
E 3 73  THR 73  192 192 THR THR E . n 
E 3 74  GLY 74  193 193 GLY GLY E . n 
E 3 75  ILE 75  194 194 ILE ILE E . n 
E 3 76  GLY 76  195 195 GLY GLY E . n 
E 3 77  ASP 77  196 196 ASP ASP E . n 
E 3 78  GLN 78  197 197 GLN GLN E . n 
E 3 79  VAL 79  198 198 VAL VAL E . n 
E 3 80  GLN 80  199 199 GLN GLN E . n 
E 3 81  CYS 81  200 200 CYS CYS E . n 
E 3 82  PHE 82  201 201 PHE PHE E . n 
E 3 83  ALA 83  202 202 ALA ALA E . n 
E 3 84  CYS 84  203 203 CYS CYS E . n 
E 3 85  GLY 85  204 204 GLY GLY E . n 
E 3 86  GLY 86  205 205 GLY GLY E . n 
E 3 87  LYS 87  206 206 LYS LYS E . n 
E 3 88  LEU 88  207 207 LEU LEU E . n 
E 3 89  LYS 89  208 208 LYS LYS E . n 
E 3 90  ASN 90  209 209 ASN ASN E . n 
E 3 91  TRP 91  210 210 TRP TRP E . n 
E 3 92  GLU 92  211 211 GLU GLU E . n 
E 3 93  PRO 93  212 212 PRO PRO E . n 
E 3 94  GLY 94  213 213 GLY GLY E . n 
E 3 95  ASP 95  214 214 ASP ASP E . n 
E 3 96  ARG 96  215 215 ARG ARG E . n 
E 3 97  ALA 97  216 216 ALA ALA E . n 
E 3 98  TRP 98  217 217 TRP TRP E . n 
E 3 99  SER 99  218 218 SER SER E . n 
E 3 100 GLU 100 219 219 GLU GLU E . n 
E 3 101 HIS 101 220 220 HIS HIS E . n 
E 3 102 ARG 102 221 221 ARG ARG E . n 
E 3 103 ARG 103 222 222 ARG ARG E . n 
E 3 104 HIS 104 223 223 HIS HIS E . n 
E 3 105 PHE 105 224 224 PHE PHE E . n 
E 3 106 PRO 106 225 225 PRO PRO E . n 
E 3 107 ASN 107 226 226 ASN ASN E . n 
E 3 108 CYS 108 227 227 CYS CYS E . n 
E 3 109 PHE 109 228 228 PHE PHE E . n 
E 3 110 PHE 110 229 229 PHE PHE E . n 
E 3 111 VAL 111 230 230 VAL VAL E . n 
E 3 112 LEU 112 231 231 LEU LEU E . n 
E 3 113 GLY 113 232 232 GLY GLY E . n 
E 3 114 ARG 114 233 233 ARG ARG E . n 
E 3 115 ASN 115 234 234 ASN ASN E . n 
E 3 116 LEU 116 235 235 LEU LEU E . n 
E 3 117 ASN 117 236 236 ASN ASN E . n 
E 3 118 ILE 118 237 237 ILE ILE E . n 
E 3 119 ARG 119 238 ?   ?   ?   E . n 
E 3 120 SER 120 239 ?   ?   ?   E . n 
E 3 121 GLU 121 240 ?   ?   ?   E . n 
F 3 1   GLY 1   120 ?   ?   ?   F . n 
F 3 2   SER 2   121 ?   ?   ?   F . n 
F 3 3   HIS 3   122 ?   ?   ?   F . n 
F 3 4   MET 4   123 ?   ?   ?   F . n 
F 3 5   ARG 5   124 ?   ?   ?   F . n 
F 3 6   ASP 6   125 ?   ?   ?   F . n 
F 3 7   HIS 7   126 ?   ?   ?   F . n 
F 3 8   PHE 8   127 ?   ?   ?   F . n 
F 3 9   ALA 9   128 ?   ?   ?   F . n 
F 3 10  LEU 10  129 ?   ?   ?   F . n 
F 3 11  ASP 11  130 ?   ?   ?   F . n 
F 3 12  ARG 12  131 ?   ?   ?   F . n 
F 3 13  PRO 13  132 ?   ?   ?   F . n 
F 3 14  SER 14  133 ?   ?   ?   F . n 
F 3 15  GLU 15  134 ?   ?   ?   F . n 
F 3 16  THR 16  135 135 THR THR F . n 
F 3 17  HIS 17  136 136 HIS HIS F . n 
F 3 18  ALA 18  137 137 ALA ALA F . n 
F 3 19  ASP 19  138 138 ASP ASP F . n 
F 3 20  TYR 20  139 139 TYR TYR F . n 
F 3 21  LEU 21  140 140 LEU LEU F . n 
F 3 22  LEU 22  141 141 LEU LEU F . n 
F 3 23  ARG 23  142 142 ARG ARG F . n 
F 3 24  THR 24  143 143 THR THR F . n 
F 3 25  GLY 25  144 144 GLY GLY F . n 
F 3 26  GLN 26  145 145 GLN GLN F . n 
F 3 27  VAL 27  146 146 VAL VAL F . n 
F 3 28  VAL 28  147 147 VAL VAL F . n 
F 3 29  ASP 29  148 148 ASP ASP F . n 
F 3 30  ILE 30  149 149 ILE ILE F . n 
F 3 31  SER 31  150 150 SER SER F . n 
F 3 32  ASP 32  151 151 ASP ASP F . n 
F 3 33  THR 33  152 152 THR THR F . n 
F 3 34  ILE 34  153 153 ILE ILE F . n 
F 3 35  TYR 35  154 154 TYR TYR F . n 
F 3 36  PRO 36  155 155 PRO PRO F . n 
F 3 37  ARG 37  156 156 ARG ARG F . n 
F 3 38  ASN 38  157 157 ASN ASN F . n 
F 3 39  PRO 39  158 158 PRO PRO F . n 
F 3 40  ALA 40  159 159 ALA ALA F . n 
F 3 41  MET 41  160 160 MET MET F . n 
F 3 42  TYR 42  161 161 TYR TYR F . n 
F 3 43  SER 43  162 162 SER SER F . n 
F 3 44  GLU 44  163 163 GLU GLU F . n 
F 3 45  GLU 45  164 164 GLU GLU F . n 
F 3 46  ALA 46  165 165 ALA ALA F . n 
F 3 47  ARG 47  166 166 ARG ARG F . n 
F 3 48  LEU 48  167 167 LEU LEU F . n 
F 3 49  LYS 49  168 168 LYS LYS F . n 
F 3 50  SER 50  169 169 SER SER F . n 
F 3 51  PHE 51  170 ?   ?   ?   F . n 
F 3 52  GLN 52  171 ?   ?   ?   F . n 
F 3 53  ASN 53  172 ?   ?   ?   F . n 
F 3 54  TRP 54  173 ?   ?   ?   F . n 
F 3 55  PRO 55  174 ?   ?   ?   F . n 
F 3 56  ASP 56  175 ?   ?   ?   F . n 
F 3 57  TYR 57  176 ?   ?   ?   F . n 
F 3 58  ALA 58  177 ?   ?   ?   F . n 
F 3 59  HIS 59  178 ?   ?   ?   F . n 
F 3 60  LEU 60  179 179 LEU LEU F . n 
F 3 61  THR 61  180 180 THR THR F . n 
F 3 62  PRO 62  181 181 PRO PRO F . n 
F 3 63  ARG 63  182 182 ARG ARG F . n 
F 3 64  GLU 64  183 183 GLU GLU F . n 
F 3 65  LEU 65  184 184 LEU LEU F . n 
F 3 66  ALA 66  185 185 ALA ALA F . n 
F 3 67  SER 67  186 186 SER SER F . n 
F 3 68  ALA 68  187 187 ALA ALA F . n 
F 3 69  GLY 69  188 188 GLY GLY F . n 
F 3 70  LEU 70  189 189 LEU LEU F . n 
F 3 71  TYR 71  190 190 TYR TYR F . n 
F 3 72  TYR 72  191 191 TYR TYR F . n 
F 3 73  THR 73  192 192 THR THR F . n 
F 3 74  GLY 74  193 193 GLY GLY F . n 
F 3 75  ILE 75  194 194 ILE ILE F . n 
F 3 76  GLY 76  195 195 GLY GLY F . n 
F 3 77  ASP 77  196 196 ASP ASP F . n 
F 3 78  GLN 78  197 197 GLN GLN F . n 
F 3 79  VAL 79  198 198 VAL VAL F . n 
F 3 80  GLN 80  199 199 GLN GLN F . n 
F 3 81  CYS 81  200 200 CYS CYS F . n 
F 3 82  PHE 82  201 201 PHE PHE F . n 
F 3 83  ALA 83  202 202 ALA ALA F . n 
F 3 84  CYS 84  203 203 CYS CYS F . n 
F 3 85  GLY 85  204 204 GLY GLY F . n 
F 3 86  GLY 86  205 205 GLY GLY F . n 
F 3 87  LYS 87  206 206 LYS LYS F . n 
F 3 88  LEU 88  207 207 LEU LEU F . n 
F 3 89  LYS 89  208 208 LYS LYS F . n 
F 3 90  ASN 90  209 209 ASN ASN F . n 
F 3 91  TRP 91  210 210 TRP TRP F . n 
F 3 92  GLU 92  211 211 GLU GLU F . n 
F 3 93  PRO 93  212 212 PRO PRO F . n 
F 3 94  GLY 94  213 213 GLY GLY F . n 
F 3 95  ASP 95  214 214 ASP ASP F . n 
F 3 96  ARG 96  215 215 ARG ARG F . n 
F 3 97  ALA 97  216 216 ALA ALA F . n 
F 3 98  TRP 98  217 217 TRP TRP F . n 
F 3 99  SER 99  218 218 SER SER F . n 
F 3 100 GLU 100 219 219 GLU GLU F . n 
F 3 101 HIS 101 220 220 HIS HIS F . n 
F 3 102 ARG 102 221 221 ARG ARG F . n 
F 3 103 ARG 103 222 222 ARG ARG F . n 
F 3 104 HIS 104 223 223 HIS HIS F . n 
F 3 105 PHE 105 224 224 PHE PHE F . n 
F 3 106 PRO 106 225 225 PRO PRO F . n 
F 3 107 ASN 107 226 226 ASN ASN F . n 
F 3 108 CYS 108 227 227 CYS CYS F . n 
F 3 109 PHE 109 228 228 PHE PHE F . n 
F 3 110 PHE 110 229 229 PHE PHE F . n 
F 3 111 VAL 111 230 230 VAL VAL F . n 
F 3 112 LEU 112 231 231 LEU LEU F . n 
F 3 113 GLY 113 232 232 GLY GLY F . n 
F 3 114 ARG 114 233 233 ARG ARG F . n 
F 3 115 ASN 115 234 234 ASN ASN F . n 
F 3 116 LEU 116 235 235 LEU LEU F . n 
F 3 117 ASN 117 236 236 ASN ASN F . n 
F 3 118 ILE 118 237 ?   ?   ?   F . n 
F 3 119 ARG 119 238 ?   ?   ?   F . n 
F 3 120 SER 120 239 ?   ?   ?   F . n 
F 3 121 GLU 121 240 ?   ?   ?   F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ZN  1 1  1  ZN  ZN  E . 
H 4 ZN  1 2  2  ZN  ZN  F . 
I 5 HOH 1 3  3  HOH HOH A . 
I 5 HOH 2 5  5  HOH HOH A . 
I 5 HOH 3 25 25 HOH HOH A . 
J 5 HOH 1 1  1  HOH HOH B . 
J 5 HOH 2 2  2  HOH HOH B . 
J 5 HOH 3 11 11 HOH HOH B . 
J 5 HOH 4 23 23 HOH HOH B . 
K 5 HOH 1 12 12 HOH HOH C . 
K 5 HOH 2 18 18 HOH HOH C . 
K 5 HOH 3 24 24 HOH HOH C . 
L 5 HOH 1 7  7  HOH HOH D . 
L 5 HOH 2 17 17 HOH HOH D . 
M 5 HOH 1 10 10 HOH HOH E . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18820 ? 
1 MORE         -114  ? 
1 'SSA (A^2)'  28860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? E CYS 81  ? E CYS 200 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 SG  ? E CYS 84  ? E CYS 203 ? 1_555 97.7  ? 
2  SG  ? E CYS 81  ? E CYS 200 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 NE2 ? E HIS 101 ? E HIS 220 ? 1_555 97.0  ? 
3  SG  ? E CYS 84  ? E CYS 203 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 NE2 ? E HIS 101 ? E HIS 220 ? 1_555 118.9 ? 
4  SG  ? E CYS 81  ? E CYS 200 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 SG  ? E CYS 108 ? E CYS 227 ? 1_555 116.0 ? 
5  SG  ? E CYS 84  ? E CYS 203 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 SG  ? E CYS 108 ? E CYS 227 ? 1_555 109.1 ? 
6  NE2 ? E HIS 101 ? E HIS 220 ? 1_555 ZN ? G ZN . ? E ZN 1 ? 1_555 SG  ? E CYS 108 ? E CYS 227 ? 1_555 116.2 ? 
7  SG  ? F CYS 81  ? F CYS 200 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 SG  ? F CYS 84  ? F CYS 203 ? 1_555 92.5  ? 
8  SG  ? F CYS 81  ? F CYS 200 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 NE2 ? F HIS 101 ? F HIS 220 ? 1_555 102.3 ? 
9  SG  ? F CYS 84  ? F CYS 203 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 NE2 ? F HIS 101 ? F HIS 220 ? 1_555 122.9 ? 
10 SG  ? F CYS 81  ? F CYS 200 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 SG  ? F CYS 108 ? F CYS 227 ? 1_555 108.7 ? 
11 SG  ? F CYS 84  ? F CYS 203 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 SG  ? F CYS 108 ? F CYS 227 ? 1_555 104.2 ? 
12 NE2 ? F HIS 101 ? F HIS 220 ? 1_555 ZN ? H ZN . ? F ZN 2 ? 1_555 SG  ? F CYS 108 ? F CYS 227 ? 1_555 121.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-21 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
13 4 'Structure model' '_pdbx_struct_conn_angle.value'               
14 4 'Structure model' '_struct_conn.pdbx_dist_value'                
15 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
16 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
17 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
18 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
19 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
20 4 'Structure model' '_struct_ref_seq_dif.details'                 
21 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
22 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
23 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE     phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N  F PRO 181 ? ? CA F PRO 181 ? ? 1.354 1.468 -0.114 0.017 N 
2 1 CD F PRO 181 ? ? N  F PRO 181 ? ? 1.615 1.474 0.141  0.014 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB F LEU 179 ? ? CA F LEU 179 ? ? C F LEU 179 ? ? 93.34  110.20 -16.86 1.90 N 
2 1 N  F LEU 179 ? ? CA F LEU 179 ? ? C F LEU 179 ? ? 128.28 111.00 17.28  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 149 ? ? 170.94  138.98  
2  1 TYR A 156 A ? -19.17  141.50  
3  1 PRO A 161 ? ? -34.79  -74.00  
4  1 ARG A 179 ? ? -117.10 61.19   
5  1 SER A 236 ? ? -171.11 -177.43 
6  1 GLU A 240 ? ? -35.17  109.49  
7  1 MET B 316 ? ? -50.69  -7.73   
8  1 SER B 343 ? ? -24.62  -49.54  
9  1 LYS B 344 ? ? -152.37 4.97    
10 1 LYS B 363 ? ? -154.86 13.74   
11 1 TYR C 156 A ? -20.22  141.81  
12 1 PRO C 161 ? ? -34.39  -74.75  
13 1 ARG C 179 ? ? -115.94 62.78   
14 1 SER C 236 ? ? -172.57 -177.42 
15 1 GLU C 240 ? ? -34.86  108.61  
16 1 ASP D 313 ? ? -73.87  29.70   
17 1 ASP D 314 ? ? -87.74  32.31   
18 1 SER D 343 ? ? -24.93  -50.65  
19 1 LYS D 344 ? ? -151.72 4.95    
20 1 LYS D 363 ? ? -154.11 13.88   
21 1 ARG E 131 ? ? -119.30 72.40   
22 1 ALA E 177 ? ? -166.71 -66.47  
23 1 HIS E 178 ? ? 88.44   -0.85   
24 1 ALA E 202 ? ? -76.00  -73.20  
25 1 LEU E 235 ? ? -86.37  -83.40  
26 1 ASN E 236 ? ? -165.29 115.77  
27 1 LEU F 167 ? ? -39.78  -17.66  
28 1 LYS F 168 ? ? -61.09  -109.76 
29 1 THR F 180 ? ? -16.38  91.60   
30 1 ALA F 202 ? ? -76.26  -74.14  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 175 ? CB  ? A LYS 57  CB  
2  1 Y 0 A LYS 175 ? CG  ? A LYS 57  CG  
3  1 Y 0 A LYS 175 ? CD  ? A LYS 57  CD  
4  1 Y 0 A LYS 175 ? CE  ? A LYS 57  CE  
5  1 Y 0 A LYS 175 ? NZ  ? A LYS 57  NZ  
6  1 Y 0 A ARG 271 ? CG  ? A ARG 149 CG  
7  1 Y 0 A ARG 271 ? CD  ? A ARG 149 CD  
8  1 Y 0 A ARG 271 ? NE  ? A ARG 149 NE  
9  1 Y 0 A ARG 271 ? CZ  ? A ARG 149 CZ  
10 1 Y 0 A ARG 271 ? NH1 ? A ARG 149 NH1 
11 1 Y 0 A ARG 271 ? NH2 ? A ARG 149 NH2 
12 1 Y 0 B LYS 344 ? CB  ? B LYS 35  CB  
13 1 Y 0 B LYS 344 ? CG  ? B LYS 35  CG  
14 1 Y 0 B LYS 344 ? CD  ? B LYS 35  CD  
15 1 Y 0 B LYS 344 ? CE  ? B LYS 35  CE  
16 1 Y 0 B LYS 344 ? NZ  ? B LYS 35  NZ  
17 1 Y 0 C ASP 150 ? CB  ? C ASP 34  CB  
18 1 Y 0 C ASP 150 ? CG  ? C ASP 34  CG  
19 1 Y 0 C ASP 150 ? OD1 ? C ASP 34  OD1 
20 1 Y 0 C ASP 150 ? OD2 ? C ASP 34  OD2 
21 1 Y 0 C LYS 171 ? CE  ? C LYS 53  CE  
22 1 Y 0 C LYS 171 ? NZ  ? C LYS 53  NZ  
23 1 Y 0 D LYS 344 ? CB  ? D LYS 35  CB  
24 1 Y 0 D LYS 344 ? CG  ? D LYS 35  CG  
25 1 Y 0 D LYS 344 ? CD  ? D LYS 35  CD  
26 1 Y 0 D LYS 344 ? CE  ? D LYS 35  CE  
27 1 Y 0 D LYS 344 ? NZ  ? D LYS 35  NZ  
28 1 Y 0 D LYS 363 ? CD  ? D LYS 54  CD  
29 1 Y 0 D LYS 363 ? CE  ? D LYS 54  CE  
30 1 Y 0 D LYS 363 ? NZ  ? D LYS 54  NZ  
31 1 Y 0 D ARG 375 ? NE  ? D ARG 66  NE  
32 1 Y 0 D ARG 375 ? CZ  ? D ARG 66  CZ  
33 1 Y 0 D ARG 375 ? NH1 ? D ARG 66  NH1 
34 1 Y 0 D ARG 375 ? NH2 ? D ARG 66  NH2 
35 1 Y 0 F ARG 182 ? CB  ? F ARG 63  CB  
36 1 Y 0 F ARG 182 ? CG  ? F ARG 63  CG  
37 1 Y 0 F ARG 182 ? CD  ? F ARG 63  CD  
38 1 Y 0 F ARG 182 ? NE  ? F ARG 63  NE  
39 1 Y 0 F ARG 182 ? CZ  ? F ARG 63  CZ  
40 1 Y 0 F ARG 182 ? NH1 ? F ARG 63  NH1 
41 1 Y 0 F ARG 182 ? NH2 ? F ARG 63  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 117 ? A MET 1   
2   1 Y 1 A GLU 118 ? A GLU 2   
3   1 Y 1 A ASN 119 ? A ASN 3   
4   1 Y 1 A THR 120 ? A THR 4   
5   1 Y 1 A GLU 121 ? A GLU 5   
6   1 Y 1 A ASN 122 ? A ASN 6   
7   1 Y 1 A SER 123 ? A SER 7   
8   1 Y 1 A VAL 124 ? A VAL 8   
9   1 Y 1 A ASP 125 ? A ASP 9   
10  1 Y 1 A SER 126 ? A SER 10  
11  1 Y 1 A LYS 127 ? A LYS 11  
12  1 Y 1 A SER 128 ? A SER 12  
13  1 Y 1 A ILE 129 ? A ILE 13  
14  1 Y 1 A LYS 130 ? A LYS 14  
15  1 Y 1 A ASN 131 ? A ASN 15  
16  1 Y 1 A LEU 132 ? A LEU 16  
17  1 Y 1 A GLU 133 ? A GLU 17  
18  1 Y 1 A PRO 134 ? A PRO 18  
19  1 Y 1 A LYS 135 ? A LYS 19  
20  1 Y 1 A ILE 136 ? A ILE 20  
21  1 Y 1 A ILE 137 ? A ILE 21  
22  1 Y 1 A HIS 138 ? A HIS 22  
23  1 Y 1 A GLY 139 ? A GLY 23  
24  1 Y 1 A SER 140 ? A SER 24  
25  1 Y 1 A GLU 141 ? A GLU 25  
26  1 Y 1 A SER 142 ? A SER 26  
27  1 Y 1 A MET 143 ? A MET 27  
28  1 Y 1 A ASP 144 ? A ASP 28  
29  1 Y 1 A SER 145 ? A SER 29  
30  1 Y 1 A GLY 146 ? A GLY 30  
31  1 Y 1 A ILE 147 ? A ILE 31  
32  1 Y 1 A ASP 297 ? A ASP 175 
33  1 Y 1 B HIS 402 ? B HIS 102 
34  1 Y 1 B LEU 403 ? B LEU 103 
35  1 Y 1 B GLU 404 ? B GLU 104 
36  1 Y 1 B HIS 405 ? B HIS 105 
37  1 Y 1 B HIS 406 ? B HIS 106 
38  1 Y 1 B HIS 407 ? B HIS 107 
39  1 Y 1 B HIS 408 ? B HIS 108 
40  1 Y 1 B HIS 409 ? B HIS 109 
41  1 Y 1 B HIS 410 ? B HIS 110 
42  1 Y 1 C MET 117 ? C MET 1   
43  1 Y 1 C GLU 118 ? C GLU 2   
44  1 Y 1 C ASN 119 ? C ASN 3   
45  1 Y 1 C THR 120 ? C THR 4   
46  1 Y 1 C GLU 121 ? C GLU 5   
47  1 Y 1 C ASN 122 ? C ASN 6   
48  1 Y 1 C SER 123 ? C SER 7   
49  1 Y 1 C VAL 124 ? C VAL 8   
50  1 Y 1 C ASP 125 ? C ASP 9   
51  1 Y 1 C SER 126 ? C SER 10  
52  1 Y 1 C LYS 127 ? C LYS 11  
53  1 Y 1 C SER 128 ? C SER 12  
54  1 Y 1 C ILE 129 ? C ILE 13  
55  1 Y 1 C LYS 130 ? C LYS 14  
56  1 Y 1 C ASN 131 ? C ASN 15  
57  1 Y 1 C LEU 132 ? C LEU 16  
58  1 Y 1 C GLU 133 ? C GLU 17  
59  1 Y 1 C PRO 134 ? C PRO 18  
60  1 Y 1 C LYS 135 ? C LYS 19  
61  1 Y 1 C ILE 136 ? C ILE 20  
62  1 Y 1 C ILE 137 ? C ILE 21  
63  1 Y 1 C HIS 138 ? C HIS 22  
64  1 Y 1 C GLY 139 ? C GLY 23  
65  1 Y 1 C SER 140 ? C SER 24  
66  1 Y 1 C GLU 141 ? C GLU 25  
67  1 Y 1 C SER 142 ? C SER 26  
68  1 Y 1 C MET 143 ? C MET 27  
69  1 Y 1 C ASP 144 ? C ASP 28  
70  1 Y 1 C SER 145 ? C SER 29  
71  1 Y 1 C GLY 146 ? C GLY 30  
72  1 Y 1 C ILE 147 ? C ILE 31  
73  1 Y 1 D HIS 402 ? D HIS 102 
74  1 Y 1 D LEU 403 ? D LEU 103 
75  1 Y 1 D GLU 404 ? D GLU 104 
76  1 Y 1 D HIS 405 ? D HIS 105 
77  1 Y 1 D HIS 406 ? D HIS 106 
78  1 Y 1 D HIS 407 ? D HIS 107 
79  1 Y 1 D HIS 408 ? D HIS 108 
80  1 Y 1 D HIS 409 ? D HIS 109 
81  1 Y 1 D HIS 410 ? D HIS 110 
82  1 Y 1 E GLY 120 ? E GLY 1   
83  1 Y 1 E SER 121 ? E SER 2   
84  1 Y 1 E HIS 122 ? E HIS 3   
85  1 Y 1 E MET 123 ? E MET 4   
86  1 Y 1 E ARG 124 ? E ARG 5   
87  1 Y 1 E ASP 125 ? E ASP 6   
88  1 Y 1 E HIS 126 ? E HIS 7   
89  1 Y 1 E ARG 238 ? E ARG 119 
90  1 Y 1 E SER 239 ? E SER 120 
91  1 Y 1 E GLU 240 ? E GLU 121 
92  1 Y 1 F GLY 120 ? F GLY 1   
93  1 Y 1 F SER 121 ? F SER 2   
94  1 Y 1 F HIS 122 ? F HIS 3   
95  1 Y 1 F MET 123 ? F MET 4   
96  1 Y 1 F ARG 124 ? F ARG 5   
97  1 Y 1 F ASP 125 ? F ASP 6   
98  1 Y 1 F HIS 126 ? F HIS 7   
99  1 Y 1 F PHE 127 ? F PHE 8   
100 1 Y 1 F ALA 128 ? F ALA 9   
101 1 Y 1 F LEU 129 ? F LEU 10  
102 1 Y 1 F ASP 130 ? F ASP 11  
103 1 Y 1 F ARG 131 ? F ARG 12  
104 1 Y 1 F PRO 132 ? F PRO 13  
105 1 Y 1 F SER 133 ? F SER 14  
106 1 Y 1 F GLU 134 ? F GLU 15  
107 1 Y 1 F PHE 170 ? F PHE 51  
108 1 Y 1 F GLN 171 ? F GLN 52  
109 1 Y 1 F ASN 172 ? F ASN 53  
110 1 Y 1 F TRP 173 ? F TRP 54  
111 1 Y 1 F PRO 174 ? F PRO 55  
112 1 Y 1 F ASP 175 ? F ASP 56  
113 1 Y 1 F TYR 176 ? F TYR 57  
114 1 Y 1 F ALA 177 ? F ALA 58  
115 1 Y 1 F HIS 178 ? F HIS 59  
116 1 Y 1 F ILE 237 ? F ILE 118 
117 1 Y 1 F ARG 238 ? F ARG 119 
118 1 Y 1 F SER 239 ? F SER 120 
119 1 Y 1 F GLU 240 ? F GLU 121 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#