data_1I3R
# 
_entry.id   1I3R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I3R         
RCSB  RCSB012866   
WWPDB D_1000012866 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1IEA '1IEA is Histocompatibility Antigen' unspecified 
PDB 1IEB '1IEB IS Histocompatibility Antigen' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I3R 
_pdbx_database_status.recvd_initial_deposition_date   2001-02-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kappler, J.W.' 1 
'Wilson, N.'    2 
# 
_citation.id                        primary 
_citation.title                     'Mutations changing the kinetics of class II MHC peptide exchange.' 
_citation.journal_abbrev            Immunity 
_citation.journal_volume            14 
_citation.page_first                513 
_citation.page_last                 522 
_citation.year                      2001 
_citation.journal_id_ASTM           IUNIEH 
_citation.country                   US 
_citation.journal_id_ISSN           1074-7613 
_citation.journal_id_CSD            2048 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11371354 
_citation.pdbx_database_id_DOI      '10.1016/S1074-7613(01)00140-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wilson, N.'  1 ? 
primary 'Fremont, D.' 2 ? 
primary 'Marrack, P.' 3 ? 
primary 'Kappler, J.' 4 ? 
# 
_cell.entry_id           1I3R 
_cell.length_a           117.059 
_cell.length_b           58.020 
_cell.length_c           143.222 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.24 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I3R 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K ALPHA CHAIN'                                              
22359.082 4   ? 'E11Q, D66N' ? ? 
2 polymer     man 'FUSION PROTEIN CONSISTING OF MHC E-BETA-K PRECURSOR, GLYCINE RICH LINKER, AND HEMOGLOBIN BETA-2 CHAIN' 
25892.832 4   ? ?            ? ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose'               424.401 
4   ? ?            ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                                221.208 
8   ? ?            ? ? 
5 water       nat water                                                                                                   18.015 
319 ? ?            ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IKEEHTIIQAQFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVNKANLDVMKERSNNT
PDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDF
YDCEVDHWGLEEPLRKHWEFEEKTLLPETKEN
;
;IKEEHTIIQAQFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVNKANLDVMKERSNNT
PDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDF
YDCEVDHWGLEEPLRKHWEFEEKTLLPETKEN
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;RDSRGKKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAV
TELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVR
WFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNK
;
;RDSRGKKVITAFNEGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAV
TELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVR
WFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNK
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LYS n 
1 3   GLU n 
1 4   GLU n 
1 5   HIS n 
1 6   THR n 
1 7   ILE n 
1 8   ILE n 
1 9   GLN n 
1 10  ALA n 
1 11  GLN n 
1 12  PHE n 
1 13  TYR n 
1 14  LEU n 
1 15  LEU n 
1 16  PRO n 
1 17  ASP n 
1 18  LYS n 
1 19  ARG n 
1 20  GLY n 
1 21  GLU n 
1 22  PHE n 
1 23  MET n 
1 24  PHE n 
1 25  ASP n 
1 26  PHE n 
1 27  ASP n 
1 28  GLY n 
1 29  ASP n 
1 30  GLU n 
1 31  ILE n 
1 32  PHE n 
1 33  HIS n 
1 34  VAL n 
1 35  ASP n 
1 36  ILE n 
1 37  GLU n 
1 38  LYS n 
1 39  SER n 
1 40  GLU n 
1 41  THR n 
1 42  ILE n 
1 43  TRP n 
1 44  ARG n 
1 45  LEU n 
1 46  GLU n 
1 47  GLU n 
1 48  PHE n 
1 49  ALA n 
1 50  LYS n 
1 51  PHE n 
1 52  ALA n 
1 53  SER n 
1 54  PHE n 
1 55  GLU n 
1 56  ALA n 
1 57  GLN n 
1 58  GLY n 
1 59  ALA n 
1 60  LEU n 
1 61  ALA n 
1 62  ASN n 
1 63  ILE n 
1 64  ALA n 
1 65  VAL n 
1 66  ASN n 
1 67  LYS n 
1 68  ALA n 
1 69  ASN n 
1 70  LEU n 
1 71  ASP n 
1 72  VAL n 
1 73  MET n 
1 74  LYS n 
1 75  GLU n 
1 76  ARG n 
1 77  SER n 
1 78  ASN n 
1 79  ASN n 
1 80  THR n 
1 81  PRO n 
1 82  ASP n 
1 83  ALA n 
1 84  ASN n 
1 85  VAL n 
1 86  ALA n 
1 87  PRO n 
1 88  GLU n 
1 89  VAL n 
1 90  THR n 
1 91  VAL n 
1 92  LEU n 
1 93  SER n 
1 94  ARG n 
1 95  SER n 
1 96  PRO n 
1 97  VAL n 
1 98  ASN n 
1 99  LEU n 
1 100 GLY n 
1 101 GLU n 
1 102 PRO n 
1 103 ASN n 
1 104 ILE n 
1 105 LEU n 
1 106 ILE n 
1 107 CYS n 
1 108 PHE n 
1 109 ILE n 
1 110 ASP n 
1 111 LYS n 
1 112 PHE n 
1 113 SER n 
1 114 PRO n 
1 115 PRO n 
1 116 VAL n 
1 117 VAL n 
1 118 ASN n 
1 119 VAL n 
1 120 THR n 
1 121 TRP n 
1 122 LEU n 
1 123 ARG n 
1 124 ASN n 
1 125 GLY n 
1 126 ARG n 
1 127 PRO n 
1 128 VAL n 
1 129 THR n 
1 130 GLU n 
1 131 GLY n 
1 132 VAL n 
1 133 SER n 
1 134 GLU n 
1 135 THR n 
1 136 VAL n 
1 137 PHE n 
1 138 LEU n 
1 139 PRO n 
1 140 ARG n 
1 141 ASP n 
1 142 ASP n 
1 143 HIS n 
1 144 LEU n 
1 145 PHE n 
1 146 ARG n 
1 147 LYS n 
1 148 PHE n 
1 149 HIS n 
1 150 TYR n 
1 151 LEU n 
1 152 THR n 
1 153 PHE n 
1 154 LEU n 
1 155 PRO n 
1 156 SER n 
1 157 THR n 
1 158 ASP n 
1 159 ASP n 
1 160 PHE n 
1 161 TYR n 
1 162 ASP n 
1 163 CYS n 
1 164 GLU n 
1 165 VAL n 
1 166 ASP n 
1 167 HIS n 
1 168 TRP n 
1 169 GLY n 
1 170 LEU n 
1 171 GLU n 
1 172 GLU n 
1 173 PRO n 
1 174 LEU n 
1 175 ARG n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 GLU n 
1 180 PHE n 
1 181 GLU n 
1 182 GLU n 
1 183 LYS n 
1 184 THR n 
1 185 LEU n 
1 186 LEU n 
1 187 PRO n 
1 188 GLU n 
1 189 THR n 
1 190 LYS n 
1 191 GLU n 
1 192 ASN n 
2 1   ARG n 
2 2   ASP n 
2 3   SER n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   LYS n 
2 8   VAL n 
2 9   ILE n 
2 10  THR n 
2 11  ALA n 
2 12  PHE n 
2 13  ASN n 
2 14  GLU n 
2 15  GLY n 
2 16  LEU n 
2 17  LYS n 
2 18  GLY n 
2 19  GLY n 
2 20  GLY n 
2 21  GLY n 
2 22  SER n 
2 23  LEU n 
2 24  VAL n 
2 25  GLY n 
2 26  GLY n 
2 27  GLY n 
2 28  SER n 
2 29  GLY n 
2 30  GLY n 
2 31  GLY n 
2 32  GLY n 
2 33  SER n 
2 34  ARG n 
2 35  PRO n 
2 36  TRP n 
2 37  PHE n 
2 38  LEU n 
2 39  GLU n 
2 40  TYR n 
2 41  CYS n 
2 42  LYS n 
2 43  SER n 
2 44  GLU n 
2 45  CYS n 
2 46  HIS n 
2 47  PHE n 
2 48  TYR n 
2 49  ASN n 
2 50  GLY n 
2 51  THR n 
2 52  GLN n 
2 53  ARG n 
2 54  VAL n 
2 55  ARG n 
2 56  LEU n 
2 57  LEU n 
2 58  VAL n 
2 59  ARG n 
2 60  TYR n 
2 61  PHE n 
2 62  TYR n 
2 63  ASN n 
2 64  LEU n 
2 65  GLU n 
2 66  GLU n 
2 67  ASN n 
2 68  LEU n 
2 69  ARG n 
2 70  PHE n 
2 71  ASP n 
2 72  SER n 
2 73  ASP n 
2 74  VAL n 
2 75  GLY n 
2 76  GLU n 
2 77  PHE n 
2 78  ARG n 
2 79  ALA n 
2 80  VAL n 
2 81  THR n 
2 82  GLU n 
2 83  LEU n 
2 84  GLY n 
2 85  ARG n 
2 86  PRO n 
2 87  ASP n 
2 88  ALA n 
2 89  GLU n 
2 90  ASN n 
2 91  TRP n 
2 92  ASN n 
2 93  SER n 
2 94  GLN n 
2 95  PRO n 
2 96  GLU n 
2 97  PHE n 
2 98  LEU n 
2 99  GLU n 
2 100 GLN n 
2 101 LYS n 
2 102 ARG n 
2 103 ALA n 
2 104 GLU n 
2 105 VAL n 
2 106 ASP n 
2 107 THR n 
2 108 VAL n 
2 109 CYS n 
2 110 ARG n 
2 111 HIS n 
2 112 ASN n 
2 113 TYR n 
2 114 GLU n 
2 115 ILE n 
2 116 PHE n 
2 117 ASP n 
2 118 ASN n 
2 119 PHE n 
2 120 LEU n 
2 121 VAL n 
2 122 PRO n 
2 123 ARG n 
2 124 ARG n 
2 125 VAL n 
2 126 GLU n 
2 127 PRO n 
2 128 THR n 
2 129 VAL n 
2 130 THR n 
2 131 VAL n 
2 132 TYR n 
2 133 PRO n 
2 134 THR n 
2 135 LYS n 
2 136 THR n 
2 137 GLN n 
2 138 PRO n 
2 139 LEU n 
2 140 GLU n 
2 141 HIS n 
2 142 HIS n 
2 143 ASN n 
2 144 LEU n 
2 145 LEU n 
2 146 VAL n 
2 147 CYS n 
2 148 SER n 
2 149 VAL n 
2 150 SER n 
2 151 ASP n 
2 152 PHE n 
2 153 TYR n 
2 154 PRO n 
2 155 GLY n 
2 156 ASN n 
2 157 ILE n 
2 158 GLU n 
2 159 VAL n 
2 160 ARG n 
2 161 TRP n 
2 162 PHE n 
2 163 ARG n 
2 164 ASN n 
2 165 GLY n 
2 166 LYS n 
2 167 GLU n 
2 168 GLU n 
2 169 LYS n 
2 170 THR n 
2 171 GLY n 
2 172 ILE n 
2 173 VAL n 
2 174 SER n 
2 175 THR n 
2 176 GLY n 
2 177 LEU n 
2 178 VAL n 
2 179 ARG n 
2 180 ASN n 
2 181 GLY n 
2 182 ASP n 
2 183 TRP n 
2 184 THR n 
2 185 PHE n 
2 186 GLN n 
2 187 THR n 
2 188 LEU n 
2 189 VAL n 
2 190 MET n 
2 191 LEU n 
2 192 GLU n 
2 193 THR n 
2 194 VAL n 
2 195 PRO n 
2 196 GLN n 
2 197 SER n 
2 198 GLY n 
2 199 GLU n 
2 200 VAL n 
2 201 TYR n 
2 202 THR n 
2 203 CYS n 
2 204 GLN n 
2 205 VAL n 
2 206 GLU n 
2 207 HIS n 
2 208 PRO n 
2 209 SER n 
2 210 LEU n 
2 211 THR n 
2 212 ASP n 
2 213 PRO n 
2 214 VAL n 
2 215 THR n 
2 216 VAL n 
2 217 GLU n 
2 218 TRP n 
2 219 LYS n 
2 220 ALA n 
2 221 GLN n 
2 222 SER n 
2 223 THR n 
2 224 SER n 
2 225 ALA n 
2 226 GLN n 
2 227 ASN n 
2 228 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ?  ?   'house mouse' Mus IEK ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 
7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
2 1 sample ? 5  17  'house mouse' Mus IEK ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 
7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
2 2 sample ? 33 228 'house mouse' Mus IEK ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 
7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HA22_MOUSE 1 
;IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNT
PDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDF
YDCEVDHWGLEEPLRKHWEFEEKTLLLPETKEN
;
26 P04224 ? 
2 UNP HBB2_MOUSE 2 GKKVITAFNEGLK 64 P02089 ? 
3 GB  AAA39593   2 
;SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHN
YEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLE
TVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQN
;
29 199396 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1I3R A 1  ? 192 ? P04224 26 ? 217 ? 1  192 
2  1 1I3R C 1  ? 192 ? P04224 26 ? 217 ? 1  192 
3  1 1I3R E 1  ? 192 ? P04224 26 ? 217 ? 1  192 
4  1 1I3R G 1  ? 192 ? P04224 26 ? 217 ? 1  192 
5  2 1I3R B 5  ? 17  ? P02089 64 ? 76  ? 1  13  
6  2 1I3R D 5  ? 17  ? P02089 64 ? 76  ? 1  13  
7  2 1I3R F 5  ? 17  ? P02089 64 ? 76  ? 1  13  
8  2 1I3R H 5  ? 17  ? P02089 64 ? 76  ? 1  13  
9  3 1I3R B 33 ? 228 ? 199396 29 ? 224 ? 29 224 
10 3 1I3R D 33 ? 228 ? 199396 29 ? 224 ? 29 224 
11 3 1I3R F 33 ? 228 ? 199396 29 ? 224 ? 29 224 
12 3 1I3R H 33 ? 228 ? 199396 29 ? 224 ? 29 224 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1I3R GLN A 11 ? UNP P04224 GLU 36 engineered         11 1  
1 1I3R ASN A 66 ? UNP P04224 ASP 91 engineered         66 2  
2 1I3R GLN C 11 ? UNP P04224 GLU 36 engineered         11 3  
2 1I3R ASN C 66 ? UNP P04224 ASP 91 engineered         66 4  
3 1I3R GLN E 11 ? UNP P04224 GLU 36 engineered         11 5  
3 1I3R ASN E 66 ? UNP P04224 ASP 91 engineered         66 6  
4 1I3R GLN G 11 ? UNP P04224 GLU 36 engineered         11 7  
4 1I3R ASN G 66 ? UNP P04224 ASP 91 engineered         66 8  
5 1I3R ARG B 1  ? UNP P02089 ?   ?  'cloning artifact' -3 9  
5 1I3R ASP B 2  ? UNP P02089 ?   ?  'cloning artifact' -2 10 
5 1I3R SER B 3  ? UNP P02089 ?   ?  'cloning artifact' -1 11 
5 1I3R ARG B 4  ? UNP P02089 ?   ?  'cloning artifact' 0  12 
6 1I3R ARG D 1  ? UNP P02089 ?   ?  'cloning artifact' -3 13 
6 1I3R ASP D 2  ? UNP P02089 ?   ?  'cloning artifact' -2 14 
6 1I3R SER D 3  ? UNP P02089 ?   ?  'cloning artifact' -1 15 
6 1I3R ARG D 4  ? UNP P02089 ?   ?  'cloning artifact' 0  16 
7 1I3R ARG F 1  ? UNP P02089 ?   ?  'cloning artifact' -3 17 
7 1I3R ASP F 2  ? UNP P02089 ?   ?  'cloning artifact' -2 18 
7 1I3R SER F 3  ? UNP P02089 ?   ?  'cloning artifact' -1 19 
7 1I3R ARG F 4  ? UNP P02089 ?   ?  'cloning artifact' 0  20 
8 1I3R ARG H 1  ? UNP P02089 ?   ?  'cloning artifact' -3 21 
8 1I3R ASP H 2  ? UNP P02089 ?   ?  'cloning artifact' -2 22 
8 1I3R SER H 3  ? UNP P02089 ?   ?  'cloning artifact' -1 23 
8 1I3R ARG H 4  ? UNP P02089 ?   ?  'cloning artifact' 0  24 
5 1I3R GLY B 18 ? UNP P02089 ?   ?  linker             14 25 
5 1I3R GLY B 19 ? UNP P02089 ?   ?  linker             15 26 
5 1I3R GLY B 20 ? UNP P02089 ?   ?  linker             16 27 
5 1I3R GLY B 21 ? UNP P02089 ?   ?  linker             17 28 
5 1I3R SER B 22 ? UNP P02089 ?   ?  linker             18 29 
5 1I3R LEU B 23 ? UNP P02089 ?   ?  linker             19 30 
5 1I3R VAL B 24 ? UNP P02089 ?   ?  linker             20 31 
5 1I3R GLY B 25 ? UNP P02089 ?   ?  linker             21 32 
5 1I3R GLY B 26 ? UNP P02089 ?   ?  linker             22 33 
5 1I3R GLY B 27 ? UNP P02089 ?   ?  linker             23 34 
5 1I3R SER B 28 ? UNP P02089 ?   ?  linker             24 35 
5 1I3R GLY B 29 ? UNP P02089 ?   ?  linker             25 36 
5 1I3R GLY B 30 ? UNP P02089 ?   ?  linker             26 37 
5 1I3R GLY B 31 ? UNP P02089 ?   ?  linker             27 38 
5 1I3R GLY B 32 ? UNP P02089 ?   ?  linker             28 39 
6 1I3R GLY D 18 ? UNP P02089 ?   ?  linker             14 40 
6 1I3R GLY D 19 ? UNP P02089 ?   ?  linker             15 41 
6 1I3R GLY D 20 ? UNP P02089 ?   ?  linker             16 42 
6 1I3R GLY D 21 ? UNP P02089 ?   ?  linker             17 43 
6 1I3R SER D 22 ? UNP P02089 ?   ?  linker             18 44 
6 1I3R LEU D 23 ? UNP P02089 ?   ?  linker             19 45 
6 1I3R VAL D 24 ? UNP P02089 ?   ?  linker             20 46 
6 1I3R GLY D 25 ? UNP P02089 ?   ?  linker             21 47 
6 1I3R GLY D 26 ? UNP P02089 ?   ?  linker             22 48 
6 1I3R GLY D 27 ? UNP P02089 ?   ?  linker             23 49 
6 1I3R SER D 28 ? UNP P02089 ?   ?  linker             24 50 
6 1I3R GLY D 29 ? UNP P02089 ?   ?  linker             25 51 
6 1I3R GLY D 30 ? UNP P02089 ?   ?  linker             26 52 
6 1I3R GLY D 31 ? UNP P02089 ?   ?  linker             27 53 
6 1I3R GLY D 32 ? UNP P02089 ?   ?  linker             28 54 
7 1I3R GLY F 18 ? UNP P02089 ?   ?  linker             14 55 
7 1I3R GLY F 19 ? UNP P02089 ?   ?  linker             15 56 
7 1I3R GLY F 20 ? UNP P02089 ?   ?  linker             16 57 
7 1I3R GLY F 21 ? UNP P02089 ?   ?  linker             17 58 
7 1I3R SER F 22 ? UNP P02089 ?   ?  linker             18 59 
7 1I3R LEU F 23 ? UNP P02089 ?   ?  linker             19 60 
7 1I3R VAL F 24 ? UNP P02089 ?   ?  linker             20 61 
7 1I3R GLY F 25 ? UNP P02089 ?   ?  linker             21 62 
7 1I3R GLY F 26 ? UNP P02089 ?   ?  linker             22 63 
7 1I3R GLY F 27 ? UNP P02089 ?   ?  linker             23 64 
7 1I3R SER F 28 ? UNP P02089 ?   ?  linker             24 65 
7 1I3R GLY F 29 ? UNP P02089 ?   ?  linker             25 66 
7 1I3R GLY F 30 ? UNP P02089 ?   ?  linker             26 67 
7 1I3R GLY F 31 ? UNP P02089 ?   ?  linker             27 68 
7 1I3R GLY F 32 ? UNP P02089 ?   ?  linker             28 69 
8 1I3R GLY H 18 ? UNP P02089 ?   ?  linker             14 70 
8 1I3R GLY H 19 ? UNP P02089 ?   ?  linker             15 71 
8 1I3R GLY H 20 ? UNP P02089 ?   ?  linker             16 72 
8 1I3R GLY H 21 ? UNP P02089 ?   ?  linker             17 73 
8 1I3R SER H 22 ? UNP P02089 ?   ?  linker             18 74 
8 1I3R LEU H 23 ? UNP P02089 ?   ?  linker             19 75 
8 1I3R VAL H 24 ? UNP P02089 ?   ?  linker             20 76 
8 1I3R GLY H 25 ? UNP P02089 ?   ?  linker             21 77 
8 1I3R GLY H 26 ? UNP P02089 ?   ?  linker             22 78 
8 1I3R GLY H 27 ? UNP P02089 ?   ?  linker             23 79 
8 1I3R SER H 28 ? UNP P02089 ?   ?  linker             24 80 
8 1I3R GLY H 29 ? UNP P02089 ?   ?  linker             25 81 
8 1I3R GLY H 30 ? UNP P02089 ?   ?  linker             26 82 
8 1I3R GLY H 31 ? UNP P02089 ?   ?  linker             27 83 
8 1I3R GLY H 32 ? UNP P02089 ?   ?  linker             28 84 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I3R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   51.09 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '12.8% PEG4000, 80mM MgCl2, 80mM HEPES pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1I3R 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   74154 
_reflns.number_all                   76526 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   90.8 
_reflns_shell.Rmerge_I_obs           0.445 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1I3R 
_refine.ls_number_reflns_obs                     74154 
_refine.ls_number_reflns_all                     76526 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             25.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.27 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3615 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLF 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           100000 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I3R 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12782 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         224 
_refine_hist.number_atoms_solvent             319 
_refine_hist.number_atoms_total               13325 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        25.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.27  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    .0066 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1I3R 
_struct.title                     'CRYSTAL STRUCTURE OF A MUTANT IEK CLASS II MHC MOLECULE' 
_struct.pdbx_descriptor           
;Complex of H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K ALPHA CHAIN/Fusion Protein Consisting of MHC E-Beta-k precursor, Glycine Rich Chain and Hemoglobin Beta-2 Chain
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I3R 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'MHC ClassII, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 45  ? PHE A 51  ? LEU A 45  PHE A 51  5 ? 7  
HELX_P HELX_P2  2  GLU A 55  ? SER A 77  ? GLU A 55  SER A 77  1 ? 23 
HELX_P HELX_P3  3  ASN B 49  ? GLN B 52  ? ASN B 45  GLN B 48  5 ? 4  
HELX_P HELX_P4  4  THR B 81  ? LEU B 83  ? THR B 77  LEU B 79  5 ? 3  
HELX_P HELX_P5  5  GLY B 84  ? SER B 93  ? GLY B 80  SER B 89  1 ? 10 
HELX_P HELX_P6  6  GLN B 94  ? VAL B 108 ? GLN B 90  VAL B 104 1 ? 15 
HELX_P HELX_P7  7  VAL B 108 ? ASP B 117 ? VAL B 104 ASP B 113 1 ? 10 
HELX_P HELX_P8  8  LEU C 45  ? ALA C 52  ? LEU C 45  ALA C 52  5 ? 8  
HELX_P HELX_P9  9  GLU C 55  ? SER C 77  ? GLU C 55  SER C 77  1 ? 23 
HELX_P HELX_P10 10 THR D 81  ? LEU D 83  ? THR D 77  LEU D 79  5 ? 3  
HELX_P HELX_P11 11 GLY D 84  ? SER D 93  ? GLY D 80  SER D 89  1 ? 10 
HELX_P HELX_P12 12 GLN D 94  ? VAL D 108 ? GLN D 90  VAL D 104 1 ? 15 
HELX_P HELX_P13 13 VAL D 108 ? ASP D 117 ? VAL D 104 ASP D 113 1 ? 10 
HELX_P HELX_P14 14 LEU E 45  ? PHE E 51  ? LEU E 45  PHE E 51  5 ? 7  
HELX_P HELX_P15 15 GLU E 55  ? SER E 77  ? GLU E 55  SER E 77  1 ? 23 
HELX_P HELX_P16 16 THR F 81  ? LEU F 83  ? THR F 77  LEU F 79  5 ? 3  
HELX_P HELX_P17 17 GLY F 84  ? SER F 93  ? GLY F 80  SER F 89  1 ? 10 
HELX_P HELX_P18 18 GLN F 94  ? VAL F 108 ? GLN F 90  VAL F 104 1 ? 15 
HELX_P HELX_P19 19 VAL F 108 ? ASP F 117 ? VAL F 104 ASP F 113 1 ? 10 
HELX_P HELX_P20 20 LEU G 45  ? LYS G 50  ? LEU G 45  LYS G 50  5 ? 6  
HELX_P HELX_P21 21 GLU G 55  ? SER G 77  ? GLU G 55  SER G 77  1 ? 23 
HELX_P HELX_P22 22 THR H 81  ? LEU H 83  ? THR H 77  LEU H 79  5 ? 3  
HELX_P HELX_P23 23 GLY H 84  ? ASN H 92  ? GLY H 80  ASN H 88  1 ? 9  
HELX_P HELX_P24 24 GLN H 94  ? VAL H 108 ? GLN H 90  VAL H 104 1 ? 15 
HELX_P HELX_P25 25 VAL H 108 ? ASP H 117 ? VAL H 104 ASP H 113 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 107 SG  ? ? ? 1_555 A CYS 163 SG ? ? A CYS 107 A CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf2  disulf ?    ? B CYS 45  SG  ? ? ? 1_555 B CYS 109 SG ? ? B CYS 41  B CYS 105 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf3  disulf ?    ? B CYS 147 SG  ? ? ? 1_555 B CYS 203 SG ? ? B CYS 143 B CYS 199 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4  disulf ?    ? C CYS 107 SG  ? ? ? 1_555 C CYS 163 SG ? ? C CYS 107 C CYS 163 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf5  disulf ?    ? D CYS 45  SG  ? ? ? 1_555 D CYS 109 SG ? ? D CYS 41  D CYS 105 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf6  disulf ?    ? D CYS 147 SG  ? ? ? 1_555 D CYS 203 SG ? ? D CYS 143 D CYS 199 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf7  disulf ?    ? E CYS 107 SG  ? ? ? 1_555 E CYS 163 SG ? ? E CYS 107 E CYS 163 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf8  disulf ?    ? F CYS 45  SG  ? ? ? 1_555 F CYS 109 SG ? ? F CYS 41  F CYS 105 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf9  disulf ?    ? F CYS 147 SG  ? ? ? 1_555 F CYS 203 SG ? ? F CYS 143 F CYS 199 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf10 disulf ?    ? G CYS 107 SG  ? ? ? 1_555 G CYS 163 SG ? ? G CYS 107 G CYS 163 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf11 disulf ?    ? H CYS 45  SG  ? ? ? 1_555 H CYS 109 SG ? ? H CYS 41  H CYS 105 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf12 disulf ?    ? H CYS 147 SG  ? ? ? 1_555 H CYS 203 SG ? ? H CYS 143 H CYS 199 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
covale1  covale one  ? A ASN 78  ND2 ? ? ? 1_555 M NAG .   C1 ? ? A ASN 78  A NAG 301 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale2  covale one  ? A ASN 118 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 118 I NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale3  covale one  ? B ASN 49  ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 45  B NAG 304 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale4  covale one  ? C ASN 78  ND2 ? ? ? 1_555 O NAG .   C1 ? ? C ASN 78  C NAG 305 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale5  covale one  ? C ASN 118 ND2 ? ? ? 1_555 J NAG .   C1 ? ? C ASN 118 J NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale6  covale one  ? D ASN 49  ND2 ? ? ? 1_555 P NAG .   C1 ? ? D ASN 45  D NAG 308 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale7  covale one  ? E ASN 78  ND2 ? ? ? 1_555 Q NAG .   C1 ? ? E ASN 78  E NAG 309 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale8  covale one  ? E ASN 118 ND2 ? ? ? 1_555 K NAG .   C1 ? ? E ASN 118 K NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale9  covale one  ? F ASN 49  ND2 ? ? ? 1_555 R NAG .   C1 ? ? F ASN 45  F NAG 312 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale10 covale one  ? G ASN 78  ND2 ? ? ? 1_555 S NAG .   C1 ? ? G ASN 78  G NAG 313 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale11 covale one  ? G ASN 118 ND2 ? ? ? 1_555 L NAG .   C1 ? ? G ASN 118 L NAG 1   1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale12 covale one  ? H ASN 49  ND2 ? ? ? 1_555 T NAG .   C1 ? ? H ASN 45  H NAG 316 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale13 covale both ? I NAG .   O4  ? ? ? 1_555 I NAG .   C1 ? ? I NAG 1   I NAG 2   1_555 ? ? ? ? ? ? ? 1.381 ? ?               
covale14 covale both ? J NAG .   O4  ? ? ? 1_555 J NAG .   C1 ? ? J NAG 1   J NAG 2   1_555 ? ? ? ? ? ? ? 1.389 ? ?               
covale15 covale both ? K NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? K NAG 1   K NAG 2   1_555 ? ? ? ? ? ? ? 1.379 ? ?               
covale16 covale both ? L NAG .   O4  ? ? ? 1_555 L NAG .   C1 ? ? L NAG 1   L NAG 2   1_555 ? ? ? ? ? ? ? 1.384 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 15  A . ? LEU 15  A PRO 16  A ? PRO 16  A 1 0.24  
2  SER 113 A . ? SER 113 A PRO 114 A ? PRO 114 A 1 0.22  
3  TYR 153 B . ? TYR 149 B PRO 154 B ? PRO 150 B 1 -0.05 
4  LEU 15  C . ? LEU 15  C PRO 16  C ? PRO 16  C 1 0.14  
5  SER 113 C . ? SER 113 C PRO 114 C ? PRO 114 C 1 0.31  
6  TYR 153 D . ? TYR 149 D PRO 154 D ? PRO 150 D 1 -0.07 
7  LEU 15  E . ? LEU 15  E PRO 16  E ? PRO 16  E 1 0.49  
8  SER 113 E . ? SER 113 E PRO 114 E ? PRO 114 E 1 0.37  
9  TYR 153 F . ? TYR 149 F PRO 154 F ? PRO 150 F 1 -0.42 
10 LEU 15  G . ? LEU 15  G PRO 16  G ? PRO 16  G 1 0.71  
11 SER 113 G . ? SER 113 G PRO 114 G ? PRO 114 G 1 0.28  
12 TYR 153 H . ? TYR 149 H PRO 154 H ? PRO 150 H 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 8 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 8 ? 
I  ? 4 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 4 ? 
O  ? 8 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 4 ? 
V  ? 8 ? 
W  ? 2 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
A  7 8 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
H  5 6 ? anti-parallel 
H  6 7 ? anti-parallel 
H  7 8 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
O  5 6 ? anti-parallel 
O  6 7 ? anti-parallel 
O  7 8 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
V  5 6 ? anti-parallel 
V  6 7 ? anti-parallel 
V  7 8 ? anti-parallel 
W  1 2 ? parallel      
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLU A 40  ? TRP A 43  ? GLU A 40  TRP A 43  
A  2 ASP A 29  ? ASP A 35  ? ASP A 29  ASP A 35  
A  3 ARG A 19  ? PHE A 26  ? ARG A 19  PHE A 26  
A  4 HIS A 5   ? LEU A 15  ? HIS A 5   LEU A 15  
A  5 PHE B 37  ? TYR B 48  ? PHE B 33  TYR B 44  
A  6 ARG B 53  ? TYR B 62  ? ARG B 49  TYR B 58  
A  7 GLU B 65  ? ASP B 71  ? GLU B 61  ASP B 67  
A  8 PHE B 77  ? ALA B 79  ? PHE B 73  ALA B 75  
B  1 GLU A 88  ? SER A 93  ? GLU A 88  SER A 93  
B  2 ASN A 103 ? PHE A 112 ? ASN A 103 PHE A 112 
B  3 PHE A 145 ? PHE A 153 ? PHE A 145 PHE A 153 
B  4 VAL A 132 ? GLU A 134 ? VAL A 132 GLU A 134 
C  1 GLU A 88  ? SER A 93  ? GLU A 88  SER A 93  
C  2 ASN A 103 ? PHE A 112 ? ASN A 103 PHE A 112 
C  3 PHE A 145 ? PHE A 153 ? PHE A 145 PHE A 153 
C  4 LEU A 138 ? PRO A 139 ? LEU A 138 PRO A 139 
D  1 ARG A 126 ? PRO A 127 ? ARG A 126 PRO A 127 
D  2 ASN A 118 ? ARG A 123 ? ASN A 118 ARG A 123 
D  3 PHE A 160 ? ASP A 166 ? PHE A 160 ASP A 166 
D  4 LEU A 174 ? GLU A 179 ? LEU A 174 GLU A 179 
E  1 THR B 128 ? PRO B 133 ? THR B 124 PRO B 129 
E  2 LEU B 144 ? PHE B 152 ? LEU B 140 PHE B 148 
E  3 PHE B 185 ? GLU B 192 ? PHE B 181 GLU B 188 
E  4 ILE B 172 ? SER B 174 ? ILE B 168 SER B 170 
F  1 THR B 128 ? PRO B 133 ? THR B 124 PRO B 129 
F  2 LEU B 144 ? PHE B 152 ? LEU B 140 PHE B 148 
F  3 PHE B 185 ? GLU B 192 ? PHE B 181 GLU B 188 
F  4 VAL B 178 ? ARG B 179 ? VAL B 174 ARG B 175 
G  1 LYS B 166 ? GLU B 168 ? LYS B 162 GLU B 164 
G  2 GLU B 158 ? ARG B 163 ? GLU B 154 ARG B 159 
G  3 VAL B 200 ? GLU B 206 ? VAL B 196 GLU B 202 
G  4 VAL B 214 ? LYS B 219 ? VAL B 210 LYS B 215 
H  1 THR C 41  ? TRP C 43  ? THR C 41  TRP C 43  
H  2 ASP C 29  ? VAL C 34  ? ASP C 29  VAL C 34  
H  3 ARG C 19  ? PHE C 26  ? ARG C 19  PHE C 26  
H  4 GLU C 4   ? LEU C 15  ? GLU C 4   LEU C 15  
H  5 PHE D 37  ? TYR D 48  ? PHE D 33  TYR D 44  
H  6 ARG D 53  ? TYR D 62  ? ARG D 49  TYR D 58  
H  7 GLU D 65  ? ASP D 71  ? GLU D 61  ASP D 67  
H  8 PHE D 77  ? ALA D 79  ? PHE D 73  ALA D 75  
I  1 GLU C 88  ? SER C 93  ? GLU C 88  SER C 93  
I  2 ASN C 103 ? PHE C 112 ? ASN C 103 PHE C 112 
I  3 PHE C 145 ? PHE C 153 ? PHE C 145 PHE C 153 
I  4 VAL C 132 ? GLU C 134 ? VAL C 132 GLU C 134 
J  1 GLU C 88  ? SER C 93  ? GLU C 88  SER C 93  
J  2 ASN C 103 ? PHE C 112 ? ASN C 103 PHE C 112 
J  3 PHE C 145 ? PHE C 153 ? PHE C 145 PHE C 153 
J  4 LEU C 138 ? PRO C 139 ? LEU C 138 PRO C 139 
K  1 ARG C 126 ? PRO C 127 ? ARG C 126 PRO C 127 
K  2 ASN C 118 ? ARG C 123 ? ASN C 118 ARG C 123 
K  3 PHE C 160 ? ASP C 166 ? PHE C 160 ASP C 166 
K  4 LEU C 174 ? GLU C 179 ? LEU C 174 GLU C 179 
L  1 THR D 128 ? THR D 134 ? THR D 124 THR D 130 
L  2 LEU D 144 ? PHE D 152 ? LEU D 140 PHE D 148 
L  3 PHE D 185 ? GLU D 192 ? PHE D 181 GLU D 188 
L  4 ILE D 172 ? SER D 174 ? ILE D 168 SER D 170 
M  1 THR D 128 ? THR D 134 ? THR D 124 THR D 130 
M  2 LEU D 144 ? PHE D 152 ? LEU D 140 PHE D 148 
M  3 PHE D 185 ? GLU D 192 ? PHE D 181 GLU D 188 
M  4 VAL D 178 ? ARG D 179 ? VAL D 174 ARG D 175 
N  1 LYS D 166 ? GLU D 168 ? LYS D 162 GLU D 164 
N  2 GLU D 158 ? ARG D 163 ? GLU D 154 ARG D 159 
N  3 VAL D 200 ? GLU D 206 ? VAL D 196 GLU D 202 
N  4 VAL D 214 ? LYS D 219 ? VAL D 210 LYS D 215 
O  1 GLU E 40  ? TRP E 43  ? GLU E 40  TRP E 43  
O  2 ASP E 29  ? ASP E 35  ? ASP E 29  ASP E 35  
O  3 ARG E 19  ? PHE E 26  ? ARG E 19  PHE E 26  
O  4 HIS E 5   ? LEU E 15  ? HIS E 5   LEU E 15  
O  5 PHE F 37  ? TYR F 48  ? PHE F 33  TYR F 44  
O  6 ARG F 53  ? TYR F 62  ? ARG F 49  TYR F 58  
O  7 GLU F 65  ? ASP F 71  ? GLU F 61  ASP F 67  
O  8 PHE F 77  ? ALA F 79  ? PHE F 73  ALA F 75  
P  1 GLU E 88  ? SER E 93  ? GLU E 88  SER E 93  
P  2 ASN E 103 ? PHE E 112 ? ASN E 103 PHE E 112 
P  3 PHE E 145 ? PHE E 153 ? PHE E 145 PHE E 153 
P  4 VAL E 132 ? GLU E 134 ? VAL E 132 GLU E 134 
Q  1 GLU E 88  ? SER E 93  ? GLU E 88  SER E 93  
Q  2 ASN E 103 ? PHE E 112 ? ASN E 103 PHE E 112 
Q  3 PHE E 145 ? PHE E 153 ? PHE E 145 PHE E 153 
Q  4 LEU E 138 ? PRO E 139 ? LEU E 138 PRO E 139 
R  1 ARG E 126 ? VAL E 128 ? ARG E 126 VAL E 128 
R  2 ASN E 118 ? ARG E 123 ? ASN E 118 ARG E 123 
R  3 TYR E 161 ? ASP E 166 ? TYR E 161 ASP E 166 
R  4 LEU E 174 ? TRP E 178 ? LEU E 174 TRP E 178 
S  1 THR F 128 ? THR F 134 ? THR F 124 THR F 130 
S  2 LEU F 144 ? PHE F 152 ? LEU F 140 PHE F 148 
S  3 PHE F 185 ? GLU F 192 ? PHE F 181 GLU F 188 
S  4 ILE F 172 ? SER F 174 ? ILE F 168 SER F 170 
T  1 THR F 128 ? THR F 134 ? THR F 124 THR F 130 
T  2 LEU F 144 ? PHE F 152 ? LEU F 140 PHE F 148 
T  3 PHE F 185 ? GLU F 192 ? PHE F 181 GLU F 188 
T  4 VAL F 178 ? ARG F 179 ? VAL F 174 ARG F 175 
U  1 LYS F 166 ? GLU F 167 ? LYS F 162 GLU F 163 
U  2 GLU F 158 ? ARG F 163 ? GLU F 154 ARG F 159 
U  3 VAL F 200 ? GLU F 206 ? VAL F 196 GLU F 202 
U  4 VAL F 214 ? LYS F 219 ? VAL F 210 LYS F 215 
V  1 THR G 41  ? TRP G 43  ? THR G 41  TRP G 43  
V  2 ASP G 29  ? ASP G 35  ? ASP G 29  ASP G 35  
V  3 ARG G 19  ? PHE G 26  ? ARG G 19  PHE G 26  
V  4 HIS G 5   ? LEU G 15  ? HIS G 5   LEU G 15  
V  5 PHE H 37  ? TYR H 48  ? PHE H 33  TYR H 44  
V  6 ARG H 53  ? TYR H 62  ? ARG H 49  TYR H 58  
V  7 GLU H 65  ? ASP H 71  ? GLU H 61  ASP H 67  
V  8 PHE H 77  ? ALA H 79  ? PHE H 73  ALA H 75  
W  1 ALA G 52  ? SER G 53  ? ALA G 52  SER G 53  
W  2 LYS H 7   ? VAL H 8   ? LYS H 3   VAL H 4   
X  1 GLU G 88  ? SER G 93  ? GLU G 88  SER G 93  
X  2 ASN G 103 ? PHE G 112 ? ASN G 103 PHE G 112 
X  3 PHE G 145 ? PHE G 153 ? PHE G 145 PHE G 153 
X  4 VAL G 132 ? GLU G 134 ? VAL G 132 GLU G 134 
Y  1 GLU G 88  ? SER G 93  ? GLU G 88  SER G 93  
Y  2 ASN G 103 ? PHE G 112 ? ASN G 103 PHE G 112 
Y  3 PHE G 145 ? PHE G 153 ? PHE G 145 PHE G 153 
Y  4 LEU G 138 ? PRO G 139 ? LEU G 138 PRO G 139 
Z  1 ARG G 126 ? VAL G 128 ? ARG G 126 VAL G 128 
Z  2 ASN G 118 ? ARG G 123 ? ASN G 118 ARG G 123 
Z  3 TYR G 161 ? ASP G 166 ? TYR G 161 ASP G 166 
Z  4 LEU G 174 ? TRP G 178 ? LEU G 174 TRP G 178 
AA 1 THR H 128 ? THR H 134 ? THR H 124 THR H 130 
AA 2 ASN H 143 ? PHE H 152 ? ASN H 139 PHE H 148 
AA 3 PHE H 185 ? THR H 193 ? PHE H 181 THR H 189 
AA 4 ILE H 172 ? SER H 174 ? ILE H 168 SER H 170 
AB 1 THR H 128 ? THR H 134 ? THR H 124 THR H 130 
AB 2 ASN H 143 ? PHE H 152 ? ASN H 139 PHE H 148 
AB 3 PHE H 185 ? THR H 193 ? PHE H 181 THR H 189 
AB 4 VAL H 178 ? ARG H 179 ? VAL H 174 ARG H 175 
AC 1 LYS H 166 ? GLU H 168 ? LYS H 162 GLU H 164 
AC 2 GLU H 158 ? ARG H 163 ? GLU H 154 ARG H 159 
AC 3 VAL H 200 ? GLU H 206 ? VAL H 196 GLU H 202 
AC 4 VAL H 214 ? LYS H 219 ? VAL H 210 LYS H 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ILE A 42  ? N ILE A 42  O HIS A 33  ? O HIS A 33  
A  2 3 N VAL A 34  ? N VAL A 34  O PHE A 22  ? O PHE A 22  
A  3 4 O ASP A 25  ? O ASP A 25  N ILE A 8   ? N ILE A 8   
A  4 5 N LEU A 15  ? N LEU A 15  O PHE B 37  ? O PHE B 33  
A  5 6 N TYR B 48  ? N TYR B 44  O ARG B 53  ? O ARG B 49  
A  6 7 N TYR B 62  ? N TYR B 58  O GLU B 65  ? O GLU B 61  
A  7 8 O ARG B 69  ? O ARG B 65  N ARG B 78  ? N ARG B 74  
B  1 2 O LEU A 92  ? O LEU A 92  N ILE A 106 ? N ILE A 106 
B  2 3 O PHE A 112 ? O PHE A 112 N PHE A 145 ? N PHE A 145 
B  3 4 N TYR A 150 ? N TYR A 150 O SER A 133 ? O SER A 133 
C  1 2 O LEU A 92  ? O LEU A 92  N ILE A 106 ? N ILE A 106 
C  2 3 O PHE A 112 ? O PHE A 112 N PHE A 145 ? N PHE A 145 
C  3 4 O ARG A 146 ? O ARG A 146 N LEU A 138 ? N LEU A 138 
D  1 2 O ARG A 126 ? O ARG A 126 N ARG A 123 ? N ARG A 123 
D  2 3 O LEU A 122 ? O LEU A 122 N ASP A 162 ? N ASP A 162 
D  3 4 N VAL A 165 ? N VAL A 165 O LEU A 174 ? O LEU A 174 
E  1 2 O TYR B 132 ? O TYR B 128 N VAL B 146 ? N VAL B 142 
E  2 3 O PHE B 152 ? O PHE B 148 N PHE B 185 ? N PHE B 181 
E  3 4 N MET B 190 ? N MET B 186 O VAL B 173 ? O VAL B 169 
F  1 2 O TYR B 132 ? O TYR B 128 N VAL B 146 ? N VAL B 142 
F  2 3 O PHE B 152 ? O PHE B 148 N PHE B 185 ? N PHE B 181 
F  3 4 O GLN B 186 ? O GLN B 182 N VAL B 178 ? N VAL B 174 
G  1 2 N GLU B 168 ? N GLU B 164 O TRP B 161 ? O TRP B 157 
G  2 3 N PHE B 162 ? N PHE B 158 O THR B 202 ? O THR B 198 
G  3 4 N VAL B 205 ? N VAL B 201 O VAL B 214 ? O VAL B 210 
H  1 2 N ILE C 42  ? N ILE C 42  O HIS C 33  ? O HIS C 33  
H  2 3 N VAL C 34  ? N VAL C 34  O PHE C 22  ? O PHE C 22  
H  3 4 O ASP C 25  ? O ASP C 25  N ILE C 8   ? N ILE C 8   
H  4 5 N LEU C 15  ? N LEU C 15  O PHE D 37  ? O PHE D 33  
H  5 6 N TYR D 48  ? N TYR D 44  O ARG D 53  ? O ARG D 49  
H  6 7 O TYR D 62  ? O TYR D 58  N GLU D 65  ? N GLU D 61  
H  7 8 O ARG D 69  ? O ARG D 65  N ARG D 78  ? N ARG D 74  
I  1 2 O LEU C 92  ? O LEU C 92  N ILE C 106 ? N ILE C 106 
I  2 3 O PHE C 112 ? O PHE C 112 N PHE C 145 ? N PHE C 145 
I  3 4 N TYR C 150 ? N TYR C 150 O SER C 133 ? O SER C 133 
J  1 2 O LEU C 92  ? O LEU C 92  N ILE C 106 ? N ILE C 106 
J  2 3 O PHE C 112 ? O PHE C 112 N PHE C 145 ? N PHE C 145 
J  3 4 O ARG C 146 ? O ARG C 146 N LEU C 138 ? N LEU C 138 
K  1 2 O ARG C 126 ? O ARG C 126 N ARG C 123 ? N ARG C 123 
K  2 3 O LEU C 122 ? O LEU C 122 N ASP C 162 ? N ASP C 162 
K  3 4 N VAL C 165 ? N VAL C 165 O LEU C 174 ? O LEU C 174 
L  1 2 N THR D 134 ? N THR D 130 O LEU D 144 ? O LEU D 140 
L  2 3 O PHE D 152 ? O PHE D 148 N PHE D 185 ? N PHE D 181 
L  3 4 N MET D 190 ? N MET D 186 O VAL D 173 ? O VAL D 169 
M  1 2 N THR D 134 ? N THR D 130 O LEU D 144 ? O LEU D 140 
M  2 3 O PHE D 152 ? O PHE D 148 N PHE D 185 ? N PHE D 181 
M  3 4 O GLN D 186 ? O GLN D 182 N VAL D 178 ? N VAL D 174 
N  1 2 N GLU D 168 ? N GLU D 164 O TRP D 161 ? O TRP D 157 
N  2 3 O PHE D 162 ? O PHE D 158 N THR D 202 ? N THR D 198 
N  3 4 N VAL D 205 ? N VAL D 201 O VAL D 214 ? O VAL D 210 
O  1 2 N ILE E 42  ? N ILE E 42  O HIS E 33  ? O HIS E 33  
O  2 3 N VAL E 34  ? N VAL E 34  O PHE E 22  ? O PHE E 22  
O  3 4 O ASP E 25  ? O ASP E 25  N ILE E 8   ? N ILE E 8   
O  4 5 O LEU E 15  ? O LEU E 15  N PHE F 37  ? N PHE F 33  
O  5 6 N TYR F 48  ? N TYR F 44  O ARG F 53  ? O ARG F 49  
O  6 7 N TYR F 62  ? N TYR F 58  O GLU F 65  ? O GLU F 61  
O  7 8 O ARG F 69  ? O ARG F 65  N ARG F 78  ? N ARG F 74  
P  1 2 O LEU E 92  ? O LEU E 92  N ILE E 106 ? N ILE E 106 
P  2 3 O PHE E 112 ? O PHE E 112 N PHE E 145 ? N PHE E 145 
P  3 4 N TYR E 150 ? N TYR E 150 O SER E 133 ? O SER E 133 
Q  1 2 O LEU E 92  ? O LEU E 92  N ILE E 106 ? N ILE E 106 
Q  2 3 O PHE E 112 ? O PHE E 112 N PHE E 145 ? N PHE E 145 
Q  3 4 O ARG E 146 ? O ARG E 146 N LEU E 138 ? N LEU E 138 
R  1 2 N VAL E 128 ? N VAL E 128 O TRP E 121 ? O TRP E 121 
R  2 3 N LEU E 122 ? N LEU E 122 O ASP E 162 ? O ASP E 162 
R  3 4 N VAL E 165 ? N VAL E 165 O LEU E 174 ? O LEU E 174 
S  1 2 N THR F 134 ? N THR F 130 O LEU F 144 ? O LEU F 140 
S  2 3 O PHE F 152 ? O PHE F 148 N PHE F 185 ? N PHE F 181 
S  3 4 O MET F 190 ? O MET F 186 N VAL F 173 ? N VAL F 169 
T  1 2 N THR F 134 ? N THR F 130 O LEU F 144 ? O LEU F 140 
T  2 3 O PHE F 152 ? O PHE F 148 N PHE F 185 ? N PHE F 181 
T  3 4 O GLN F 186 ? O GLN F 182 N VAL F 178 ? N VAL F 174 
U  1 2 O LYS F 166 ? O LYS F 162 N ARG F 163 ? N ARG F 159 
U  2 3 O PHE F 162 ? O PHE F 158 N THR F 202 ? N THR F 198 
U  3 4 O VAL F 205 ? O VAL F 201 N VAL F 214 ? N VAL F 210 
V  1 2 N ILE G 42  ? N ILE G 42  O HIS G 33  ? O HIS G 33  
V  2 3 N VAL G 34  ? N VAL G 34  O PHE G 22  ? O PHE G 22  
V  3 4 O ASP G 25  ? O ASP G 25  N ILE G 8   ? N ILE G 8   
V  4 5 O LEU G 15  ? O LEU G 15  N PHE H 37  ? N PHE H 33  
V  5 6 O TYR H 48  ? O TYR H 44  N ARG H 53  ? N ARG H 49  
V  6 7 N TYR H 62  ? N TYR H 58  O GLU H 65  ? O GLU H 61  
V  7 8 O ARG H 69  ? O ARG H 65  N ARG H 78  ? N ARG H 74  
W  1 2 N SER G 53  ? N SER G 53  O LYS H 7   ? O LYS H 3   
X  1 2 O LEU G 92  ? O LEU G 92  N ILE G 106 ? N ILE G 106 
X  2 3 O PHE G 112 ? O PHE G 112 N PHE G 145 ? N PHE G 145 
X  3 4 N TYR G 150 ? N TYR G 150 O SER G 133 ? O SER G 133 
Y  1 2 O LEU G 92  ? O LEU G 92  N ILE G 106 ? N ILE G 106 
Y  2 3 O PHE G 112 ? O PHE G 112 N PHE G 145 ? N PHE G 145 
Y  3 4 O ARG G 146 ? O ARG G 146 N LEU G 138 ? N LEU G 138 
Z  1 2 N VAL G 128 ? N VAL G 128 O TRP G 121 ? O TRP G 121 
Z  2 3 N LEU G 122 ? N LEU G 122 O ASP G 162 ? O ASP G 162 
Z  3 4 O VAL G 165 ? O VAL G 165 N LEU G 174 ? N LEU G 174 
AA 1 2 N THR H 134 ? N THR H 130 O LEU H 144 ? O LEU H 140 
AA 2 3 O PHE H 152 ? O PHE H 148 N PHE H 185 ? N PHE H 181 
AA 3 4 N MET H 190 ? N MET H 186 O VAL H 173 ? O VAL H 169 
AB 1 2 N THR H 134 ? N THR H 130 O LEU H 144 ? O LEU H 140 
AB 2 3 O PHE H 152 ? O PHE H 148 N PHE H 185 ? N PHE H 181 
AB 3 4 O GLN H 186 ? O GLN H 182 N VAL H 178 ? N VAL H 174 
AC 1 2 N GLU H 168 ? N GLU H 164 O TRP H 161 ? O TRP H 157 
AC 2 3 O PHE H 162 ? O PHE H 158 N THR H 202 ? N THR H 198 
AC 3 4 N VAL H 205 ? N VAL H 201 O VAL H 214 ? O VAL H 210 
# 
_database_PDB_matrix.entry_id          1I3R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I3R 
_atom_sites.fract_transf_matrix[1][1]   0.008543 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000484 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017235 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006993 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A  1 1   ? -12.263 16.938  -7.948  1.00 90.02  ? 1   ILE A N   1 
ATOM   2     C CA  . ILE A  1 1   ? -13.478 16.273  -7.390  1.00 89.50  ? 1   ILE A CA  1 
ATOM   3     C C   . ILE A  1 1   ? -14.616 17.289  -7.280  1.00 88.36  ? 1   ILE A C   1 
ATOM   4     O O   . ILE A  1 1   ? -15.519 17.138  -6.454  1.00 88.84  ? 1   ILE A O   1 
ATOM   5     C CB  . ILE A  1 1   ? -13.185 15.670  -5.987  1.00 90.04  ? 1   ILE A CB  1 
ATOM   6     C CG1 . ILE A  1 1   ? -11.888 14.856  -6.037  1.00 89.78  ? 1   ILE A CG1 1 
ATOM   7     C CG2 . ILE A  1 1   ? -14.336 14.763  -5.548  1.00 89.97  ? 1   ILE A CG2 1 
ATOM   8     C CD1 . ILE A  1 1   ? -11.433 14.342  -4.691  1.00 90.01  ? 1   ILE A CD1 1 
ATOM   9     N N   . LYS A  1 2   ? -14.561 18.324  -8.116  1.00 86.29  ? 2   LYS A N   1 
ATOM   10    C CA  . LYS A  1 2   ? -15.589 19.357  -8.109  1.00 83.87  ? 2   LYS A CA  1 
ATOM   11    C C   . LYS A  1 2   ? -16.932 18.642  -8.002  1.00 80.90  ? 2   LYS A C   1 
ATOM   12    O O   . LYS A  1 2   ? -17.137 17.611  -8.645  1.00 81.45  ? 2   LYS A O   1 
ATOM   13    C CB  . LYS A  1 2   ? -15.544 20.179  -9.405  1.00 85.59  ? 2   LYS A CB  1 
ATOM   14    C CG  . LYS A  1 2   ? -14.156 20.683  -9.813  1.00 87.14  ? 2   LYS A CG  1 
ATOM   15    C CD  . LYS A  1 2   ? -13.338 19.582  -10.486 1.00 87.80  ? 2   LYS A CD  1 
ATOM   16    C CE  . LYS A  1 2   ? -11.997 20.094  -11.004 1.00 87.60  ? 2   LYS A CE  1 
ATOM   17    N NZ  . LYS A  1 2   ? -11.025 20.387  -9.913  1.00 87.53  ? 2   LYS A NZ  1 
ATOM   18    N N   . GLU A  1 3   ? -17.832 19.158  -7.173  1.00 76.34  ? 3   GLU A N   1 
ATOM   19    C CA  . GLU A  1 3   ? -19.140 18.532  -7.025  1.00 71.67  ? 3   GLU A CA  1 
ATOM   20    C C   . GLU A  1 3   ? -19.858 18.532  -8.380  1.00 67.57  ? 3   GLU A C   1 
ATOM   21    O O   . GLU A  1 3   ? -20.635 19.443  -8.671  1.00 67.90  ? 3   GLU A O   1 
ATOM   22    C CB  . GLU A  1 3   ? -19.988 19.290  -5.992  1.00 72.79  ? 3   GLU A CB  1 
ATOM   23    C CG  . GLU A  1 3   ? -19.469 19.263  -4.553  1.00 75.39  ? 3   GLU A CG  1 
ATOM   24    C CD  . GLU A  1 3   ? -19.329 17.854  -3.971  1.00 76.92  ? 3   GLU A CD  1 
ATOM   25    O OE1 . GLU A  1 3   ? -20.273 17.042  -4.102  1.00 75.37  ? 3   GLU A OE1 1 
ATOM   26    O OE2 . GLU A  1 3   ? -18.270 17.563  -3.364  1.00 76.90  ? 3   GLU A OE2 1 
ATOM   27    N N   . GLU A  1 4   ? -19.588 17.526  -9.211  1.00 61.71  ? 4   GLU A N   1 
ATOM   28    C CA  . GLU A  1 4   ? -20.228 17.427  -10.526 1.00 56.68  ? 4   GLU A CA  1 
ATOM   29    C C   . GLU A  1 4   ? -21.296 16.346  -10.476 1.00 52.24  ? 4   GLU A C   1 
ATOM   30    O O   . GLU A  1 4   ? -21.005 15.195  -10.150 1.00 52.20  ? 4   GLU A O   1 
ATOM   31    C CB  . GLU A  1 4   ? -19.220 17.067  -11.619 1.00 56.28  ? 4   GLU A CB  1 
ATOM   32    C CG  . GLU A  1 4   ? -17.906 17.812  -11.545 1.00 60.76  ? 4   GLU A CG  1 
ATOM   33    C CD  . GLU A  1 4   ? -17.276 18.020  -12.909 1.00 63.31  ? 4   GLU A CD  1 
ATOM   34    O OE1 . GLU A  1 4   ? -17.452 17.155  -13.801 1.00 63.96  ? 4   GLU A OE1 1 
ATOM   35    O OE2 . GLU A  1 4   ? -16.594 19.053  -13.086 1.00 65.59  ? 4   GLU A OE2 1 
ATOM   36    N N   . HIS A  1 5   ? -22.530 16.708  -10.804 1.00 46.76  ? 5   HIS A N   1 
ATOM   37    C CA  . HIS A  1 5   ? -23.614 15.742  -10.766 1.00 44.39  ? 5   HIS A CA  1 
ATOM   38    C C   . HIS A  1 5   ? -24.616 15.923  -11.882 1.00 42.31  ? 5   HIS A C   1 
ATOM   39    O O   . HIS A  1 5   ? -24.682 16.970  -12.512 1.00 42.74  ? 5   HIS A O   1 
ATOM   40    C CB  . HIS A  1 5   ? -24.353 15.839  -9.429  1.00 42.98  ? 5   HIS A CB  1 
ATOM   41    C CG  . HIS A  1 5   ? -23.484 15.573  -8.243  1.00 43.03  ? 5   HIS A CG  1 
ATOM   42    N ND1 . HIS A  1 5   ? -22.934 14.334  -7.989  1.00 43.57  ? 5   HIS A ND1 1 
ATOM   43    C CD2 . HIS A  1 5   ? -23.030 16.396  -7.269  1.00 41.37  ? 5   HIS A CD2 1 
ATOM   44    C CE1 . HIS A  1 5   ? -22.173 14.407  -6.911  1.00 43.12  ? 5   HIS A CE1 1 
ATOM   45    N NE2 . HIS A  1 5   ? -22.214 15.647  -6.456  1.00 44.44  ? 5   HIS A NE2 1 
ATOM   46    N N   . THR A  1 6   ? -25.405 14.885  -12.112 1.00 40.93  ? 6   THR A N   1 
ATOM   47    C CA  . THR A  1 6   ? -26.442 14.936  -13.121 1.00 40.90  ? 6   THR A CA  1 
ATOM   48    C C   . THR A  1 6   ? -27.737 14.429  -12.514 1.00 40.69  ? 6   THR A C   1 
ATOM   49    O O   . THR A  1 6   ? -27.744 13.472  -11.741 1.00 43.15  ? 6   THR A O   1 
ATOM   50    C CB  . THR A  1 6   ? -26.085 14.076  -14.335 1.00 39.76  ? 6   THR A CB  1 
ATOM   51    O OG1 . THR A  1 6   ? -24.846 14.535  -14.881 1.00 44.19  ? 6   THR A OG1 1 
ATOM   52    C CG2 . THR A  1 6   ? -27.145 14.199  -15.404 1.00 41.52  ? 6   THR A CG2 1 
ATOM   53    N N   . ILE A  1 7   ? -28.830 15.095  -12.847 1.00 39.30  ? 7   ILE A N   1 
ATOM   54    C CA  . ILE A  1 7   ? -30.145 14.713  -12.363 1.00 38.71  ? 7   ILE A CA  1 
ATOM   55    C C   . ILE A  1 7   ? -30.983 14.639  -13.618 1.00 36.63  ? 7   ILE A C   1 
ATOM   56    O O   . ILE A  1 7   ? -30.998 15.586  -14.403 1.00 37.38  ? 7   ILE A O   1 
ATOM   57    C CB  . ILE A  1 7   ? -30.739 15.787  -11.438 1.00 40.27  ? 7   ILE A CB  1 
ATOM   58    C CG1 . ILE A  1 7   ? -29.968 15.838  -10.123 1.00 41.89  ? 7   ILE A CG1 1 
ATOM   59    C CG2 . ILE A  1 7   ? -32.215 15.490  -11.183 1.00 42.20  ? 7   ILE A CG2 1 
ATOM   60    C CD1 . ILE A  1 7   ? -30.470 16.943  -9.189  1.00 45.26  ? 7   ILE A CD1 1 
ATOM   61    N N   . ILE A  1 8   ? -31.674 13.530  -13.830 1.00 33.96  ? 8   ILE A N   1 
ATOM   62    C CA  . ILE A  1 8   ? -32.477 13.413  -15.042 1.00 32.84  ? 8   ILE A CA  1 
ATOM   63    C C   . ILE A  1 8   ? -33.900 12.960  -14.780 1.00 31.90  ? 8   ILE A C   1 
ATOM   64    O O   . ILE A  1 8   ? -34.134 12.081  -13.951 1.00 30.94  ? 8   ILE A O   1 
ATOM   65    C CB  . ILE A  1 8   ? -31.850 12.408  -16.045 1.00 31.70  ? 8   ILE A CB  1 
ATOM   66    C CG1 . ILE A  1 8   ? -30.430 12.846  -16.416 1.00 33.05  ? 8   ILE A CG1 1 
ATOM   67    C CG2 . ILE A  1 8   ? -32.714 12.323  -17.320 1.00 30.45  ? 8   ILE A CG2 1 
ATOM   68    C CD1 . ILE A  1 8   ? -29.665 11.811  -17.250 1.00 31.40  ? 8   ILE A CD1 1 
ATOM   69    N N   . GLN A  1 9   ? -34.846 13.586  -15.476 1.00 31.14  ? 9   GLN A N   1 
ATOM   70    C CA  . GLN A  1 9   ? -36.250 13.196  -15.396 1.00 29.80  ? 9   GLN A CA  1 
ATOM   71    C C   . GLN A  1 9   ? -36.474 12.499  -16.735 1.00 27.85  ? 9   GLN A C   1 
ATOM   72    O O   . GLN A  1 9   ? -36.345 13.119  -17.792 1.00 28.36  ? 9   GLN A O   1 
ATOM   73    C CB  . GLN A  1 9   ? -37.170 14.416  -15.294 1.00 30.44  ? 9   GLN A CB  1 
ATOM   74    C CG  . GLN A  1 9   ? -38.658 14.041  -15.342 1.00 35.37  ? 9   GLN A CG  1 
ATOM   75    C CD  . GLN A  1 9   ? -39.600 15.230  -15.209 1.00 36.86  ? 9   GLN A CD  1 
ATOM   76    O OE1 . GLN A  1 9   ? -39.601 15.937  -14.202 1.00 37.49  ? 9   GLN A OE1 1 
ATOM   77    N NE2 . GLN A  1 9   ? -40.417 15.444  -16.230 1.00 38.50  ? 9   GLN A NE2 1 
ATOM   78    N N   . ALA A  1 10  ? -36.783 11.212  -16.703 1.00 26.63  ? 10  ALA A N   1 
ATOM   79    C CA  . ALA A  1 10  ? -36.995 10.456  -17.940 1.00 27.38  ? 10  ALA A CA  1 
ATOM   80    C C   . ALA A  1 10  ? -38.410 9.883   -17.989 1.00 29.15  ? 10  ALA A C   1 
ATOM   81    O O   . ALA A  1 10  ? -38.881 9.249   -17.035 1.00 30.48  ? 10  ALA A O   1 
ATOM   82    C CB  . ALA A  1 10  ? -35.965 9.351   -18.053 1.00 23.78  ? 10  ALA A CB  1 
ATOM   83    N N   . GLN A  1 11  ? -39.094 10.112  -19.100 1.00 29.04  ? 11  GLN A N   1 
ATOM   84    C CA  . GLN A  1 11  ? -40.467 9.652   -19.233 1.00 30.74  ? 11  GLN A CA  1 
ATOM   85    C C   . GLN A  1 11  ? -40.813 9.277   -20.667 1.00 30.49  ? 11  GLN A C   1 
ATOM   86    O O   . GLN A  1 11  ? -40.237 9.802   -21.622 1.00 30.54  ? 11  GLN A O   1 
ATOM   87    C CB  . GLN A  1 11  ? -41.417 10.755  -18.775 1.00 32.23  ? 11  GLN A CB  1 
ATOM   88    C CG  . GLN A  1 11  ? -41.401 11.978  -19.689 1.00 37.08  ? 11  GLN A CG  1 
ATOM   89    C CD  . GLN A  1 11  ? -42.038 13.191  -19.047 1.00 41.16  ? 11  GLN A CD  1 
ATOM   90    O OE1 . GLN A  1 11  ? -41.491 13.767  -18.106 1.00 44.61  ? 11  GLN A OE1 1 
ATOM   91    N NE2 . GLN A  1 11  ? -43.205 13.577  -19.542 1.00 43.01  ? 11  GLN A NE2 1 
ATOM   92    N N   . PHE A  1 12  ? -41.790 8.393   -20.816 1.00 29.11  ? 12  PHE A N   1 
ATOM   93    C CA  . PHE A  1 12  ? -42.200 7.972   -22.138 1.00 29.75  ? 12  PHE A CA  1 
ATOM   94    C C   . PHE A  1 12  ? -43.542 7.268   -22.104 1.00 31.44  ? 12  PHE A C   1 
ATOM   95    O O   . PHE A  1 12  ? -44.072 6.924   -21.038 1.00 31.16  ? 12  PHE A O   1 
ATOM   96    C CB  . PHE A  1 12  ? -41.155 7.022   -22.720 1.00 31.21  ? 12  PHE A CB  1 
ATOM   97    C CG  . PHE A  1 12  ? -41.127 5.681   -22.048 1.00 31.10  ? 12  PHE A CG  1 
ATOM   98    C CD1 . PHE A  1 12  ? -42.132 4.750   -22.285 1.00 30.40  ? 12  PHE A CD1 1 
ATOM   99    C CD2 . PHE A  1 12  ? -40.114 5.359   -21.157 1.00 31.84  ? 12  PHE A CD2 1 
ATOM   100   C CE1 . PHE A  1 12  ? -42.134 3.522   -21.645 1.00 34.40  ? 12  PHE A CE1 1 
ATOM   101   C CE2 . PHE A  1 12  ? -40.100 4.124   -20.503 1.00 33.77  ? 12  PHE A CE2 1 
ATOM   102   C CZ  . PHE A  1 12  ? -41.108 3.202   -20.743 1.00 34.00  ? 12  PHE A CZ  1 
ATOM   103   N N   . TYR A  1 13  ? -44.084 7.065   -23.295 1.00 32.29  ? 13  TYR A N   1 
ATOM   104   C CA  . TYR A  1 13  ? -45.329 6.351   -23.475 1.00 32.87  ? 13  TYR A CA  1 
ATOM   105   C C   . TYR A  1 13  ? -45.067 5.535   -24.729 1.00 32.68  ? 13  TYR A C   1 
ATOM   106   O O   . TYR A  1 13  ? -44.595 6.067   -25.726 1.00 34.03  ? 13  TYR A O   1 
ATOM   107   C CB  . TYR A  1 13  ? -46.486 7.304   -23.693 1.00 34.36  ? 13  TYR A CB  1 
ATOM   108   C CG  . TYR A  1 13  ? -47.798 6.577   -23.754 1.00 37.30  ? 13  TYR A CG  1 
ATOM   109   C CD1 . TYR A  1 13  ? -48.503 6.259   -22.586 1.00 39.75  ? 13  TYR A CD1 1 
ATOM   110   C CD2 . TYR A  1 13  ? -48.330 6.177   -24.977 1.00 38.65  ? 13  TYR A CD2 1 
ATOM   111   C CE1 . TYR A  1 13  ? -49.719 5.558   -22.643 1.00 40.65  ? 13  TYR A CE1 1 
ATOM   112   C CE2 . TYR A  1 13  ? -49.538 5.479   -25.046 1.00 40.80  ? 13  TYR A CE2 1 
ATOM   113   C CZ  . TYR A  1 13  ? -50.228 5.175   -23.882 1.00 41.89  ? 13  TYR A CZ  1 
ATOM   114   O OH  . TYR A  1 13  ? -51.432 4.508   -23.970 1.00 44.70  ? 13  TYR A OH  1 
ATOM   115   N N   . LEU A  1 14  ? -45.355 4.244   -24.669 1.00 33.40  ? 14  LEU A N   1 
ATOM   116   C CA  . LEU A  1 14  ? -45.098 3.342   -25.780 1.00 34.02  ? 14  LEU A CA  1 
ATOM   117   C C   . LEU A  1 14  ? -46.323 2.596   -26.302 1.00 37.14  ? 14  LEU A C   1 
ATOM   118   O O   . LEU A  1 14  ? -47.120 2.066   -25.523 1.00 36.96  ? 14  LEU A O   1 
ATOM   119   C CB  . LEU A  1 14  ? -44.060 2.313   -25.342 1.00 32.62  ? 14  LEU A CB  1 
ATOM   120   C CG  . LEU A  1 14  ? -43.984 1.008   -26.125 1.00 30.48  ? 14  LEU A CG  1 
ATOM   121   C CD1 . LEU A  1 14  ? -43.037 1.159   -27.310 1.00 28.01  ? 14  LEU A CD1 1 
ATOM   122   C CD2 . LEU A  1 14  ? -43.507 -0.090  -25.183 1.00 28.96  ? 14  LEU A CD2 1 
ATOM   123   N N   . LEU A  1 15  ? -46.445 2.548   -27.627 1.00 39.20  ? 15  LEU A N   1 
ATOM   124   C CA  . LEU A  1 15  ? -47.524 1.847   -28.300 1.00 39.45  ? 15  LEU A CA  1 
ATOM   125   C C   . LEU A  1 15  ? -46.883 0.736   -29.102 1.00 40.98  ? 15  LEU A C   1 
ATOM   126   O O   . LEU A  1 15  ? -45.711 0.824   -29.467 1.00 41.86  ? 15  LEU A O   1 
ATOM   127   C CB  . LEU A  1 15  ? -48.282 2.777   -29.244 1.00 38.67  ? 15  LEU A CB  1 
ATOM   128   C CG  . LEU A  1 15  ? -49.311 3.718   -28.617 1.00 39.13  ? 15  LEU A CG  1 
ATOM   129   C CD1 . LEU A  1 15  ? -49.918 4.614   -29.693 1.00 38.17  ? 15  LEU A CD1 1 
ATOM   130   C CD2 . LEU A  1 15  ? -50.397 2.910   -27.929 1.00 38.00  ? 15  LEU A CD2 1 
ATOM   131   N N   . PRO A  1 16  ? -47.646 -0.324  -29.406 1.00 42.87  ? 16  PRO A N   1 
ATOM   132   C CA  . PRO A  1 16  ? -49.056 -0.491  -29.027 1.00 43.86  ? 16  PRO A CA  1 
ATOM   133   C C   . PRO A  1 16  ? -49.288 -1.011  -27.598 1.00 44.86  ? 16  PRO A C   1 
ATOM   134   O O   . PRO A  1 16  ? -50.433 -1.200  -27.181 1.00 46.26  ? 16  PRO A O   1 
ATOM   135   C CB  . PRO A  1 16  ? -49.566 -1.474  -30.076 1.00 43.51  ? 16  PRO A CB  1 
ATOM   136   C CG  . PRO A  1 16  ? -48.369 -2.395  -30.237 1.00 43.08  ? 16  PRO A CG  1 
ATOM   137   C CD  . PRO A  1 16  ? -47.211 -1.405  -30.317 1.00 41.69  ? 16  PRO A CD  1 
ATOM   138   N N   . ASP A  1 17  ? -48.212 -1.239  -26.851 1.00 44.40  ? 17  ASP A N   1 
ATOM   139   C CA  . ASP A  1 17  ? -48.330 -1.759  -25.490 1.00 44.38  ? 17  ASP A CA  1 
ATOM   140   C C   . ASP A  1 17  ? -49.094 -0.868  -24.508 1.00 44.19  ? 17  ASP A C   1 
ATOM   141   O O   . ASP A  1 17  ? -49.604 -1.351  -23.498 1.00 44.73  ? 17  ASP A O   1 
ATOM   142   C CB  . ASP A  1 17  ? -46.937 -2.049  -24.923 1.00 45.67  ? 17  ASP A CB  1 
ATOM   143   C CG  . ASP A  1 17  ? -46.078 -2.852  -25.877 1.00 48.76  ? 17  ASP A CG  1 
ATOM   144   O OD1 . ASP A  1 17  ? -45.877 -2.387  -27.017 1.00 52.86  ? 17  ASP A OD1 1 
ATOM   145   O OD2 . ASP A  1 17  ? -45.598 -3.944  -25.501 1.00 49.12  ? 17  ASP A OD2 1 
ATOM   146   N N   . LYS A  1 18  ? -49.189 0.423   -24.802 1.00 44.88  ? 18  LYS A N   1 
ATOM   147   C CA  . LYS A  1 18  ? -49.860 1.354   -23.899 1.00 46.79  ? 18  LYS A CA  1 
ATOM   148   C C   . LYS A  1 18  ? -49.171 1.367   -22.528 1.00 46.80  ? 18  LYS A C   1 
ATOM   149   O O   . LYS A  1 18  ? -49.834 1.375   -21.492 1.00 48.19  ? 18  LYS A O   1 
ATOM   150   C CB  . LYS A  1 18  ? -51.337 0.985   -23.716 1.00 49.30  ? 18  LYS A CB  1 
ATOM   151   C CG  . LYS A  1 18  ? -52.292 1.619   -24.723 1.00 53.41  ? 18  LYS A CG  1 
ATOM   152   C CD  . LYS A  1 18  ? -53.735 1.276   -24.374 1.00 56.42  ? 18  LYS A CD  1 
ATOM   153   C CE  . LYS A  1 18  ? -54.738 1.893   -25.345 1.00 59.21  ? 18  LYS A CE  1 
ATOM   154   N NZ  . LYS A  1 18  ? -56.151 1.476   -25.033 1.00 60.12  ? 18  LYS A NZ  1 
ATOM   155   N N   . ARG A  1 19  ? -47.842 1.354   -22.526 1.00 45.46  ? 19  ARG A N   1 
ATOM   156   C CA  . ARG A  1 19  ? -47.089 1.381   -21.285 1.00 45.09  ? 19  ARG A CA  1 
ATOM   157   C C   . ARG A  1 19  ? -46.519 2.779   -21.111 1.00 43.42  ? 19  ARG A C   1 
ATOM   158   O O   . ARG A  1 19  ? -46.133 3.422   -22.084 1.00 44.27  ? 19  ARG A O   1 
ATOM   159   C CB  . ARG A  1 19  ? -45.954 0.354   -21.327 1.00 49.91  ? 19  ARG A CB  1 
ATOM   160   C CG  . ARG A  1 19  ? -46.417 -1.101  -21.422 1.00 56.16  ? 19  ARG A CG  1 
ATOM   161   C CD  . ARG A  1 19  ? -46.478 -1.788  -20.055 1.00 62.04  ? 19  ARG A CD  1 
ATOM   162   N NE  . ARG A  1 19  ? -47.449 -1.178  -19.143 1.00 68.08  ? 19  ARG A NE  1 
ATOM   163   C CZ  . ARG A  1 19  ? -48.773 -1.285  -19.258 1.00 70.80  ? 19  ARG A CZ  1 
ATOM   164   N NH1 . ARG A  1 19  ? -49.311 -1.985  -20.253 1.00 71.13  ? 19  ARG A NH1 1 
ATOM   165   N NH2 . ARG A  1 19  ? -49.564 -0.684  -18.374 1.00 71.68  ? 19  ARG A NH2 1 
ATOM   166   N N   . GLY A  1 20  ? -46.479 3.254   -19.873 1.00 40.92  ? 20  GLY A N   1 
ATOM   167   C CA  . GLY A  1 20  ? -45.947 4.577   -19.615 1.00 39.13  ? 20  GLY A CA  1 
ATOM   168   C C   . GLY A  1 20  ? -45.084 4.595   -18.369 1.00 38.68  ? 20  GLY A C   1 
ATOM   169   O O   . GLY A  1 20  ? -45.391 3.908   -17.398 1.00 38.82  ? 20  GLY A O   1 
ATOM   170   N N   . GLU A  1 21  ? -43.997 5.365   -18.391 1.00 37.48  ? 21  GLU A N   1 
ATOM   171   C CA  . GLU A  1 21  ? -43.124 5.455   -17.228 1.00 37.46  ? 21  GLU A CA  1 
ATOM   172   C C   . GLU A  1 21  ? -42.566 6.846   -16.981 1.00 35.90  ? 21  GLU A C   1 
ATOM   173   O O   . GLU A  1 21  ? -42.415 7.634   -17.908 1.00 35.93  ? 21  GLU A O   1 
ATOM   174   C CB  . GLU A  1 21  ? -41.977 4.447   -17.334 1.00 39.20  ? 21  GLU A CB  1 
ATOM   175   C CG  . GLU A  1 21  ? -42.455 3.024   -17.154 1.00 41.17  ? 21  GLU A CG  1 
ATOM   176   C CD  . GLU A  1 21  ? -41.333 2.028   -16.946 1.00 42.81  ? 21  GLU A CD  1 
ATOM   177   O OE1 . GLU A  1 21  ? -41.659 0.841   -16.701 1.00 45.95  ? 21  GLU A OE1 1 
ATOM   178   O OE2 . GLU A  1 21  ? -40.142 2.417   -17.026 1.00 41.38  ? 21  GLU A OE2 1 
ATOM   179   N N   . PHE A  1 22  ? -42.276 7.131   -15.713 1.00 33.74  ? 22  PHE A N   1 
ATOM   180   C CA  . PHE A  1 22  ? -41.720 8.413   -15.287 1.00 32.84  ? 22  PHE A CA  1 
ATOM   181   C C   . PHE A  1 22  ? -40.727 8.140   -14.150 1.00 33.09  ? 22  PHE A C   1 
ATOM   182   O O   . PHE A  1 22  ? -41.070 7.502   -13.158 1.00 34.10  ? 22  PHE A O   1 
ATOM   183   C CB  . PHE A  1 22  ? -42.838 9.321   -14.793 1.00 28.12  ? 22  PHE A CB  1 
ATOM   184   C CG  . PHE A  1 22  ? -42.375 10.679  -14.349 1.00 28.65  ? 22  PHE A CG  1 
ATOM   185   C CD1 . PHE A  1 22  ? -42.516 11.788  -15.186 1.00 28.43  ? 22  PHE A CD1 1 
ATOM   186   C CD2 . PHE A  1 22  ? -41.854 10.874  -13.068 1.00 27.59  ? 22  PHE A CD2 1 
ATOM   187   C CE1 . PHE A  1 22  ? -42.155 13.062  -14.753 1.00 27.13  ? 22  PHE A CE1 1 
ATOM   188   C CE2 . PHE A  1 22  ? -41.490 12.153  -12.628 1.00 27.25  ? 22  PHE A CE2 1 
ATOM   189   C CZ  . PHE A  1 22  ? -41.644 13.243  -13.471 1.00 27.01  ? 22  PHE A CZ  1 
ATOM   190   N N   . MET A  1 23  ? -39.498 8.622   -14.290 1.00 33.17  ? 23  MET A N   1 
ATOM   191   C CA  . MET A  1 23  ? -38.502 8.394   -13.255 1.00 32.16  ? 23  MET A CA  1 
ATOM   192   C C   . MET A  1 23  ? -37.479 9.513   -13.138 1.00 34.08  ? 23  MET A C   1 
ATOM   193   O O   . MET A  1 23  ? -37.349 10.374  -14.020 1.00 32.57  ? 23  MET A O   1 
ATOM   194   C CB  . MET A  1 23  ? -37.780 7.064   -13.511 1.00 31.97  ? 23  MET A CB  1 
ATOM   195   C CG  . MET A  1 23  ? -36.931 6.997   -14.792 1.00 34.60  ? 23  MET A CG  1 
ATOM   196   S SD  . MET A  1 23  ? -35.213 7.628   -14.583 1.00 38.15  ? 23  MET A SD  1 
ATOM   197   C CE  . MET A  1 23  ? -34.450 6.279   -13.666 1.00 33.61  ? 23  MET A CE  1 
ATOM   198   N N   . PHE A  1 24  ? -36.774 9.502   -12.014 1.00 35.12  ? 24  PHE A N   1 
ATOM   199   C CA  . PHE A  1 24  ? -35.722 10.463  -11.749 1.00 35.54  ? 24  PHE A CA  1 
ATOM   200   C C   . PHE A  1 24  ? -34.436 9.680   -11.597 1.00 36.04  ? 24  PHE A C   1 
ATOM   201   O O   . PHE A  1 24  ? -34.415 8.594   -11.011 1.00 37.72  ? 24  PHE A O   1 
ATOM   202   C CB  . PHE A  1 24  ? -36.000 11.259  -10.481 1.00 34.35  ? 24  PHE A CB  1 
ATOM   203   C CG  . PHE A  1 24  ? -36.535 12.628  -10.743 1.00 35.02  ? 24  PHE A CG  1 
ATOM   204   C CD1 . PHE A  1 24  ? -37.803 12.801  -11.284 1.00 35.69  ? 24  PHE A CD1 1 
ATOM   205   C CD2 . PHE A  1 24  ? -35.781 13.751  -10.432 1.00 34.89  ? 24  PHE A CD2 1 
ATOM   206   C CE1 . PHE A  1 24  ? -38.319 14.076  -11.510 1.00 36.40  ? 24  PHE A CE1 1 
ATOM   207   C CE2 . PHE A  1 24  ? -36.287 15.032  -10.653 1.00 37.70  ? 24  PHE A CE2 1 
ATOM   208   C CZ  . PHE A  1 24  ? -37.560 15.196  -11.194 1.00 35.49  ? 24  PHE A CZ  1 
ATOM   209   N N   . ASP A  1 25  ? -33.366 10.239  -12.134 1.00 35.61  ? 25  ASP A N   1 
ATOM   210   C CA  . ASP A  1 25  ? -32.069 9.595   -12.097 1.00 36.85  ? 25  ASP A CA  1 
ATOM   211   C C   . ASP A  1 25  ? -31.032 10.558  -11.540 1.00 36.09  ? 25  ASP A C   1 
ATOM   212   O O   . ASP A  1 25  ? -31.021 11.745  -11.871 1.00 37.19  ? 25  ASP A O   1 
ATOM   213   C CB  . ASP A  1 25  ? -31.692 9.167   -13.520 1.00 39.18  ? 25  ASP A CB  1 
ATOM   214   C CG  . ASP A  1 25  ? -30.271 8.649   -13.630 1.00 44.53  ? 25  ASP A CG  1 
ATOM   215   O OD1 . ASP A  1 25  ? -29.328 9.422   -13.346 1.00 45.63  ? 25  ASP A OD1 1 
ATOM   216   O OD2 . ASP A  1 25  ? -30.099 7.467   -14.020 1.00 47.00  ? 25  ASP A OD2 1 
ATOM   217   N N   . PHE A  1 26  ? -30.175 10.047  -10.672 1.00 34.86  ? 26  PHE A N   1 
ATOM   218   C CA  . PHE A  1 26  ? -29.119 10.858  -10.094 1.00 34.99  ? 26  PHE A CA  1 
ATOM   219   C C   . PHE A  1 26  ? -27.823 10.121  -10.397 1.00 34.41  ? 26  PHE A C   1 
ATOM   220   O O   . PHE A  1 26  ? -27.627 8.987   -9.958  1.00 35.15  ? 26  PHE A O   1 
ATOM   221   C CB  . PHE A  1 26  ? -29.316 11.001  -8.581  1.00 36.39  ? 26  PHE A CB  1 
ATOM   222   C CG  . PHE A  1 26  ? -28.270 11.854  -7.901  1.00 36.00  ? 26  PHE A CG  1 
ATOM   223   C CD1 . PHE A  1 26  ? -28.395 13.238  -7.863  1.00 34.17  ? 26  PHE A CD1 1 
ATOM   224   C CD2 . PHE A  1 26  ? -27.163 11.266  -7.290  1.00 37.18  ? 26  PHE A CD2 1 
ATOM   225   C CE1 . PHE A  1 26  ? -27.444 14.026  -7.231  1.00 32.59  ? 26  PHE A CE1 1 
ATOM   226   C CE2 . PHE A  1 26  ? -26.196 12.053  -6.650  1.00 37.73  ? 26  PHE A CE2 1 
ATOM   227   C CZ  . PHE A  1 26  ? -26.342 13.441  -6.625  1.00 35.70  ? 26  PHE A CZ  1 
ATOM   228   N N   . ASP A  1 27  ? -26.960 10.758  -11.180 1.00 33.96  ? 27  ASP A N   1 
ATOM   229   C CA  . ASP A  1 27  ? -25.673 10.180  -11.550 1.00 35.56  ? 27  ASP A CA  1 
ATOM   230   C C   . ASP A  1 27  ? -25.756 8.750   -12.086 1.00 35.20  ? 27  ASP A C   1 
ATOM   231   O O   . ASP A  1 27  ? -24.847 7.947   -11.864 1.00 35.20  ? 27  ASP A O   1 
ATOM   232   C CB  . ASP A  1 27  ? -24.712 10.213  -10.355 1.00 37.54  ? 27  ASP A CB  1 
ATOM   233   C CG  . ASP A  1 27  ? -24.375 11.631  -9.906  1.00 42.35  ? 27  ASP A CG  1 
ATOM   234   O OD1 . ASP A  1 27  ? -24.681 12.589  -10.648 1.00 42.95  ? 27  ASP A OD1 1 
ATOM   235   O OD2 . ASP A  1 27  ? -23.787 11.790  -8.811  1.00 46.31  ? 27  ASP A OD2 1 
ATOM   236   N N   . GLY A  1 28  ? -26.850 8.420   -12.769 1.00 33.82  ? 28  GLY A N   1 
ATOM   237   C CA  . GLY A  1 28  ? -26.964 7.085   -13.330 1.00 32.92  ? 28  GLY A CA  1 
ATOM   238   C C   . GLY A  1 28  ? -27.815 6.110   -12.551 1.00 33.94  ? 28  GLY A C   1 
ATOM   239   O O   . GLY A  1 28  ? -28.109 5.021   -13.036 1.00 33.30  ? 28  GLY A O   1 
ATOM   240   N N   . ASP A  1 29  ? -28.206 6.482   -11.337 1.00 35.14  ? 29  ASP A N   1 
ATOM   241   C CA  . ASP A  1 29  ? -29.046 5.607   -10.533 1.00 35.49  ? 29  ASP A CA  1 
ATOM   242   C C   . ASP A  1 29  ? -30.427 6.211   -10.364 1.00 35.75  ? 29  ASP A C   1 
ATOM   243   O O   . ASP A  1 29  ? -30.590 7.434   -10.325 1.00 37.94  ? 29  ASP A O   1 
ATOM   244   C CB  . ASP A  1 29  ? -28.420 5.361   -9.158  1.00 37.06  ? 29  ASP A CB  1 
ATOM   245   C CG  . ASP A  1 29  ? -27.099 4.637   -9.247  1.00 40.40  ? 29  ASP A CG  1 
ATOM   246   O OD1 . ASP A  1 29  ? -27.055 3.560   -9.881  1.00 39.85  ? 29  ASP A OD1 1 
ATOM   247   O OD2 . ASP A  1 29  ? -26.104 5.146   -8.685  1.00 43.66  ? 29  ASP A OD2 1 
ATOM   248   N N   . GLU A  1 30  ? -31.425 5.346   -10.267 1.00 34.87  ? 30  GLU A N   1 
ATOM   249   C CA  . GLU A  1 30  ? -32.796 5.789   -10.090 1.00 35.20  ? 30  GLU A CA  1 
ATOM   250   C C   . GLU A  1 30  ? -33.076 6.222   -8.649  1.00 35.17  ? 30  GLU A C   1 
ATOM   251   O O   . GLU A  1 30  ? -32.710 5.538   -7.694  1.00 35.40  ? 30  GLU A O   1 
ATOM   252   C CB  . GLU A  1 30  ? -33.769 4.676   -10.491 1.00 35.38  ? 30  GLU A CB  1 
ATOM   253   C CG  . GLU A  1 30  ? -35.000 4.589   -9.597  1.00 39.10  ? 30  GLU A CG  1 
ATOM   254   C CD  . GLU A  1 30  ? -36.012 3.555   -10.058 1.00 40.49  ? 30  GLU A CD  1 
ATOM   255   O OE1 . GLU A  1 30  ? -35.607 2.433   -10.443 1.00 43.05  ? 30  GLU A OE1 1 
ATOM   256   O OE2 . GLU A  1 30  ? -37.220 3.861   -10.019 1.00 41.96  ? 30  GLU A OE2 1 
ATOM   257   N N   . ILE A  1 31  ? -33.722 7.372   -8.511  1.00 34.33  ? 31  ILE A N   1 
ATOM   258   C CA  . ILE A  1 31  ? -34.101 7.887   -7.213  1.00 34.55  ? 31  ILE A CA  1 
ATOM   259   C C   . ILE A  1 31  ? -35.466 7.286   -6.889  1.00 35.27  ? 31  ILE A C   1 
ATOM   260   O O   . ILE A  1 31  ? -35.704 6.791   -5.787  1.00 35.85  ? 31  ILE A O   1 
ATOM   261   C CB  . ILE A  1 31  ? -34.256 9.406   -7.242  1.00 33.61  ? 31  ILE A CB  1 
ATOM   262   C CG1 . ILE A  1 31  ? -32.928 10.054  -7.629  1.00 33.55  ? 31  ILE A CG1 1 
ATOM   263   C CG2 . ILE A  1 31  ? -34.737 9.895   -5.897  1.00 32.34  ? 31  ILE A CG2 1 
ATOM   264   C CD1 . ILE A  1 31  ? -32.984 11.572  -7.659  1.00 32.87  ? 31  ILE A CD1 1 
ATOM   265   N N   . PHE A  1 32  ? -36.363 7.361   -7.866  1.00 34.69  ? 32  PHE A N   1 
ATOM   266   C CA  . PHE A  1 32  ? -37.713 6.842   -7.736  1.00 33.95  ? 32  PHE A CA  1 
ATOM   267   C C   . PHE A  1 32  ? -38.357 6.818   -9.116  1.00 35.33  ? 32  PHE A C   1 
ATOM   268   O O   . PHE A  1 32  ? -37.780 7.285   -10.092 1.00 35.69  ? 32  PHE A O   1 
ATOM   269   C CB  . PHE A  1 32  ? -38.549 7.748   -6.838  1.00 34.18  ? 32  PHE A CB  1 
ATOM   270   C CG  . PHE A  1 32  ? -38.915 9.067   -7.476  1.00 32.17  ? 32  PHE A CG  1 
ATOM   271   C CD1 . PHE A  1 32  ? -38.139 10.196  -7.270  1.00 32.83  ? 32  PHE A CD1 1 
ATOM   272   C CD2 . PHE A  1 32  ? -40.028 9.168   -8.301  1.00 32.29  ? 32  PHE A CD2 1 
ATOM   273   C CE1 . PHE A  1 32  ? -38.462 11.398  -7.874  1.00 31.49  ? 32  PHE A CE1 1 
ATOM   274   C CE2 . PHE A  1 32  ? -40.360 10.371  -8.912  1.00 30.50  ? 32  PHE A CE2 1 
ATOM   275   C CZ  . PHE A  1 32  ? -39.578 11.483  -8.699  1.00 33.62  ? 32  PHE A CZ  1 
ATOM   276   N N   . HIS A  1 33  ? -39.563 6.274   -9.188  1.00 34.96  ? 33  HIS A N   1 
ATOM   277   C CA  . HIS A  1 33  ? -40.296 6.235   -10.433 1.00 35.08  ? 33  HIS A CA  1 
ATOM   278   C C   . HIS A  1 33  ? -41.746 6.173   -10.042 1.00 37.68  ? 33  HIS A C   1 
ATOM   279   O O   . HIS A  1 33  ? -42.074 5.875   -8.893  1.00 38.03  ? 33  HIS A O   1 
ATOM   280   C CB  . HIS A  1 33  ? -39.936 5.005   -11.268 1.00 33.57  ? 33  HIS A CB  1 
ATOM   281   C CG  . HIS A  1 33  ? -40.418 3.714   -10.689 1.00 33.09  ? 33  HIS A CG  1 
ATOM   282   N ND1 . HIS A  1 33  ? -39.629 2.913   -9.892  1.00 33.57  ? 33  HIS A ND1 1 
ATOM   283   C CD2 . HIS A  1 33  ? -41.604 3.072   -10.809 1.00 33.37  ? 33  HIS A CD2 1 
ATOM   284   C CE1 . HIS A  1 33  ? -40.304 1.829   -9.553  1.00 32.38  ? 33  HIS A CE1 1 
ATOM   285   N NE2 . HIS A  1 33  ? -41.506 1.900   -10.097 1.00 33.32  ? 33  HIS A NE2 1 
ATOM   286   N N   . VAL A  1 34  ? -42.620 6.461   -10.989 1.00 39.49  ? 34  VAL A N   1 
ATOM   287   C CA  . VAL A  1 34  ? -44.031 6.411   -10.701 1.00 41.72  ? 34  VAL A CA  1 
ATOM   288   C C   . VAL A  1 34  ? -44.687 5.331   -11.541 1.00 46.43  ? 34  VAL A C   1 
ATOM   289   O O   . VAL A  1 34  ? -44.468 5.245   -12.753 1.00 44.63  ? 34  VAL A O   1 
ATOM   290   C CB  . VAL A  1 34  ? -44.688 7.762   -10.969 1.00 38.37  ? 34  VAL A CB  1 
ATOM   291   C CG1 . VAL A  1 34  ? -46.162 7.677   -10.720 1.00 35.77  ? 34  VAL A CG1 1 
ATOM   292   C CG2 . VAL A  1 34  ? -44.068 8.813   -10.076 1.00 35.85  ? 34  VAL A CG2 1 
ATOM   293   N N   . ASP A  1 35  ? -45.465 4.491   -10.864 1.00 53.32  ? 35  ASP A N   1 
ATOM   294   C CA  . ASP A  1 35  ? -46.202 3.403   -11.495 1.00 58.66  ? 35  ASP A CA  1 
ATOM   295   C C   . ASP A  1 35  ? -47.410 4.075   -12.132 1.00 59.61  ? 35  ASP A C   1 
ATOM   296   O O   . ASP A  1 35  ? -48.296 4.567   -11.430 1.00 61.43  ? 35  ASP A O   1 
ATOM   297   C CB  . ASP A  1 35  ? -46.664 2.395   -10.432 1.00 63.40  ? 35  ASP A CB  1 
ATOM   298   C CG  . ASP A  1 35  ? -47.224 1.113   -11.041 1.00 67.41  ? 35  ASP A CG  1 
ATOM   299   O OD1 . ASP A  1 35  ? -46.426 0.268   -11.503 1.00 69.61  ? 35  ASP A OD1 1 
ATOM   300   O OD2 . ASP A  1 35  ? -48.462 0.952   -11.064 1.00 68.82  ? 35  ASP A OD2 1 
ATOM   301   N N   . ILE A  1 36  ? -47.443 4.105   -13.455 1.00 59.86  ? 36  ILE A N   1 
ATOM   302   C CA  . ILE A  1 36  ? -48.530 4.753   -14.164 1.00 63.02  ? 36  ILE A CA  1 
ATOM   303   C C   . ILE A  1 36  ? -49.911 4.132   -13.969 1.00 64.50  ? 36  ILE A C   1 
ATOM   304   O O   . ILE A  1 36  ? -50.927 4.784   -14.201 1.00 64.67  ? 36  ILE A O   1 
ATOM   305   C CB  . ILE A  1 36  ? -48.194 4.834   -15.652 1.00 62.66  ? 36  ILE A CB  1 
ATOM   306   C CG1 . ILE A  1 36  ? -46.921 5.664   -15.818 1.00 64.82  ? 36  ILE A CG1 1 
ATOM   307   C CG2 . ILE A  1 36  ? -49.337 5.444   -16.433 1.00 63.68  ? 36  ILE A CG2 1 
ATOM   308   C CD1 . ILE A  1 36  ? -46.956 6.996   -15.079 1.00 62.73  ? 36  ILE A CD1 1 
ATOM   309   N N   . GLU A  1 37  ? -49.954 2.882   -13.531 1.00 65.80  ? 37  GLU A N   1 
ATOM   310   C CA  . GLU A  1 37  ? -51.225 2.215   -13.308 1.00 67.22  ? 37  GLU A CA  1 
ATOM   311   C C   . GLU A  1 37  ? -51.652 2.339   -11.848 1.00 67.46  ? 37  GLU A C   1 
ATOM   312   O O   . GLU A  1 37  ? -52.844 2.315   -11.551 1.00 68.05  ? 37  GLU A O   1 
ATOM   313   C CB  . GLU A  1 37  ? -51.105 0.741   -13.676 1.00 69.04  ? 37  GLU A CB  1 
ATOM   314   C CG  . GLU A  1 37  ? -50.497 0.501   -15.034 1.00 70.57  ? 37  GLU A CG  1 
ATOM   315   C CD  . GLU A  1 37  ? -49.759 -0.820  -15.096 1.00 71.97  ? 37  GLU A CD  1 
ATOM   316   O OE1 . GLU A  1 37  ? -50.412 -1.875  -14.940 1.00 72.83  ? 37  GLU A OE1 1 
ATOM   317   O OE2 . GLU A  1 37  ? -48.523 -0.801  -15.292 1.00 72.06  ? 37  GLU A OE2 1 
ATOM   318   N N   . LYS A  1 38  ? -50.675 2.472   -10.949 1.00 66.87  ? 38  LYS A N   1 
ATOM   319   C CA  . LYS A  1 38  ? -50.935 2.584   -9.513  1.00 66.43  ? 38  LYS A CA  1 
ATOM   320   C C   . LYS A  1 38  ? -50.955 4.005   -8.956  1.00 66.04  ? 38  LYS A C   1 
ATOM   321   O O   . LYS A  1 38  ? -51.451 4.226   -7.848  1.00 66.93  ? 38  LYS A O   1 
ATOM   322   C CB  . LYS A  1 38  ? -49.901 1.786   -8.707  1.00 67.48  ? 38  LYS A CB  1 
ATOM   323   C CG  . LYS A  1 38  ? -50.079 0.274   -8.707  1.00 69.14  ? 38  LYS A CG  1 
ATOM   324   C CD  . LYS A  1 38  ? -49.023 -0.383  -7.826  1.00 70.65  ? 38  LYS A CD  1 
ATOM   325   C CE  . LYS A  1 38  ? -49.180 -1.894  -7.791  1.00 71.78  ? 38  LYS A CE  1 
ATOM   326   N NZ  . LYS A  1 38  ? -49.031 -2.507  -9.143  1.00 73.67  ? 38  LYS A NZ  1 
ATOM   327   N N   . SER A  1 39  ? -50.417 4.965   -9.702  1.00 63.81  ? 39  SER A N   1 
ATOM   328   C CA  . SER A  1 39  ? -50.372 6.345   -9.226  1.00 61.17  ? 39  SER A CA  1 
ATOM   329   C C   . SER A  1 39  ? -49.666 6.399   -7.872  1.00 59.72  ? 39  SER A C   1 
ATOM   330   O O   . SER A  1 39  ? -50.163 6.997   -6.918  1.00 59.88  ? 39  SER A O   1 
ATOM   331   C CB  . SER A  1 39  ? -51.782 6.919   -9.076  1.00 61.92  ? 39  SER A CB  1 
ATOM   332   O OG  . SER A  1 39  ? -51.733 8.212   -8.482  1.00 63.82  ? 39  SER A OG  1 
ATOM   333   N N   . GLU A  1 40  ? -48.504 5.767   -7.793  1.00 57.34  ? 40  GLU A N   1 
ATOM   334   C CA  . GLU A  1 40  ? -47.742 5.746   -6.556  1.00 54.82  ? 40  GLU A CA  1 
ATOM   335   C C   . GLU A  1 40  ? -46.258 6.019   -6.797  1.00 51.78  ? 40  GLU A C   1 
ATOM   336   O O   . GLU A  1 40  ? -45.678 5.555   -7.783  1.00 51.53  ? 40  GLU A O   1 
ATOM   337   C CB  . GLU A  1 40  ? -47.900 4.386   -5.881  1.00 57.16  ? 40  GLU A CB  1 
ATOM   338   C CG  . GLU A  1 40  ? -47.126 4.242   -4.587  1.00 61.14  ? 40  GLU A CG  1 
ATOM   339   C CD  . GLU A  1 40  ? -47.153 2.822   -4.057  1.00 64.02  ? 40  GLU A CD  1 
ATOM   340   O OE1 . GLU A  1 40  ? -46.633 2.595   -2.935  1.00 64.01  ? 40  GLU A OE1 1 
ATOM   341   O OE2 . GLU A  1 40  ? -47.691 1.938   -4.769  1.00 63.70  ? 40  GLU A OE2 1 
ATOM   342   N N   . THR A  1 41  ? -45.649 6.779   -5.896  1.00 48.39  ? 41  THR A N   1 
ATOM   343   C CA  . THR A  1 41  ? -44.231 7.079   -5.999  1.00 44.59  ? 41  THR A CA  1 
ATOM   344   C C   . THR A  1 41  ? -43.501 5.936   -5.305  1.00 43.01  ? 41  THR A C   1 
ATOM   345   O O   . THR A  1 41  ? -43.731 5.685   -4.123  1.00 43.65  ? 41  THR A O   1 
ATOM   346   C CB  . THR A  1 41  ? -43.884 8.386   -5.278  1.00 44.23  ? 41  THR A CB  1 
ATOM   347   O OG1 . THR A  1 41  ? -44.699 9.447   -5.783  1.00 44.00  ? 41  THR A OG1 1 
ATOM   348   C CG2 . THR A  1 41  ? -42.436 8.739   -5.501  1.00 45.04  ? 41  THR A CG2 1 
ATOM   349   N N   . ILE A  1 42  ? -42.646 5.232   -6.043  1.00 40.46  ? 42  ILE A N   1 
ATOM   350   C CA  . ILE A  1 42  ? -41.875 4.114   -5.496  1.00 38.66  ? 42  ILE A CA  1 
ATOM   351   C C   . ILE A  1 42  ? -40.421 4.565   -5.416  1.00 39.79  ? 42  ILE A C   1 
ATOM   352   O O   . ILE A  1 42  ? -39.840 4.946   -6.429  1.00 40.71  ? 42  ILE A O   1 
ATOM   353   C CB  . ILE A  1 42  ? -41.937 2.874   -6.427  1.00 39.86  ? 42  ILE A CB  1 
ATOM   354   C CG1 . ILE A  1 42  ? -43.396 2.529   -6.766  1.00 38.13  ? 42  ILE A CG1 1 
ATOM   355   C CG2 . ILE A  1 42  ? -41.208 1.710   -5.797  1.00 33.49  ? 42  ILE A CG2 1 
ATOM   356   C CD1 . ILE A  1 42  ? -44.278 2.344   -5.582  1.00 37.55  ? 42  ILE A CD1 1 
ATOM   357   N N   . TRP A  1 43  ? -39.827 4.531   -4.224  1.00 39.31  ? 43  TRP A N   1 
ATOM   358   C CA  . TRP A  1 43  ? -38.438 4.958   -4.077  1.00 37.98  ? 43  TRP A CA  1 
ATOM   359   C C   . TRP A  1 43  ? -37.475 3.802   -4.263  1.00 36.68  ? 43  TRP A C   1 
ATOM   360   O O   . TRP A  1 43  ? -37.697 2.713   -3.753  1.00 36.53  ? 43  TRP A O   1 
ATOM   361   C CB  . TRP A  1 43  ? -38.218 5.601   -2.711  1.00 37.10  ? 43  TRP A CB  1 
ATOM   362   C CG  . TRP A  1 43  ? -39.115 6.758   -2.477  1.00 38.54  ? 43  TRP A CG  1 
ATOM   363   C CD1 . TRP A  1 43  ? -40.397 6.723   -2.003  1.00 39.96  ? 43  TRP A CD1 1 
ATOM   364   C CD2 . TRP A  1 43  ? -38.833 8.133   -2.769  1.00 39.01  ? 43  TRP A CD2 1 
ATOM   365   N NE1 . TRP A  1 43  ? -40.930 7.995   -1.984  1.00 39.75  ? 43  TRP A NE1 1 
ATOM   366   C CE2 . TRP A  1 43  ? -39.989 8.875   -2.450  1.00 39.02  ? 43  TRP A CE2 1 
ATOM   367   C CE3 . TRP A  1 43  ? -37.712 8.808   -3.273  1.00 38.96  ? 43  TRP A CE3 1 
ATOM   368   C CZ2 . TRP A  1 43  ? -40.057 10.255  -2.618  1.00 40.01  ? 43  TRP A CZ2 1 
ATOM   369   C CZ3 . TRP A  1 43  ? -37.780 10.176  -3.439  1.00 38.22  ? 43  TRP A CZ3 1 
ATOM   370   C CH2 . TRP A  1 43  ? -38.944 10.888  -3.114  1.00 41.16  ? 43  TRP A CH2 1 
ATOM   371   N N   . ARG A  1 44  ? -36.396 4.043   -4.990  1.00 34.50  ? 44  ARG A N   1 
ATOM   372   C CA  . ARG A  1 44  ? -35.429 2.992   -5.233  1.00 35.75  ? 44  ARG A CA  1 
ATOM   373   C C   . ARG A  1 44  ? -34.924 2.412   -3.917  1.00 37.04  ? 44  ARG A C   1 
ATOM   374   O O   . ARG A  1 44  ? -34.628 1.221   -3.824  1.00 36.36  ? 44  ARG A O   1 
ATOM   375   C CB  . ARG A  1 44  ? -34.266 3.521   -6.070  1.00 33.77  ? 44  ARG A CB  1 
ATOM   376   C CG  . ARG A  1 44  ? -33.324 2.417   -6.518  1.00 34.77  ? 44  ARG A CG  1 
ATOM   377   C CD  . ARG A  1 44  ? -34.049 1.377   -7.375  1.00 31.62  ? 44  ARG A CD  1 
ATOM   378   N NE  . ARG A  1 44  ? -33.148 0.290   -7.739  1.00 29.66  ? 44  ARG A NE  1 
ATOM   379   C CZ  . ARG A  1 44  ? -32.822 -0.725  -6.942  1.00 29.95  ? 44  ARG A CZ  1 
ATOM   380   N NH1 . ARG A  1 44  ? -33.327 -0.810  -5.716  1.00 25.38  ? 44  ARG A NH1 1 
ATOM   381   N NH2 . ARG A  1 44  ? -31.978 -1.660  -7.376  1.00 29.35  ? 44  ARG A NH2 1 
ATOM   382   N N   . LEU A  1 45  ? -34.818 3.263   -2.903  1.00 40.01  ? 45  LEU A N   1 
ATOM   383   C CA  . LEU A  1 45  ? -34.383 2.836   -1.572  1.00 42.30  ? 45  LEU A CA  1 
ATOM   384   C C   . LEU A  1 45  ? -35.379 3.412   -0.589  1.00 42.91  ? 45  LEU A C   1 
ATOM   385   O O   . LEU A  1 45  ? -35.677 4.598   -0.625  1.00 42.96  ? 45  LEU A O   1 
ATOM   386   C CB  . LEU A  1 45  ? -32.978 3.351   -1.250  1.00 41.72  ? 45  LEU A CB  1 
ATOM   387   C CG  . LEU A  1 45  ? -31.861 2.784   -2.119  1.00 42.11  ? 45  LEU A CG  1 
ATOM   388   C CD1 . LEU A  1 45  ? -30.538 3.366   -1.694  1.00 43.14  ? 45  LEU A CD1 1 
ATOM   389   C CD2 . LEU A  1 45  ? -31.847 1.267   -1.993  1.00 40.28  ? 45  LEU A CD2 1 
ATOM   390   N N   . GLU A  1 46  ? -35.897 2.556   0.278   1.00 46.61  ? 46  GLU A N   1 
ATOM   391   C CA  . GLU A  1 46  ? -36.887 2.942   1.275   1.00 49.89  ? 46  GLU A CA  1 
ATOM   392   C C   . GLU A  1 46  ? -36.503 4.218   2.029   1.00 48.78  ? 46  GLU A C   1 
ATOM   393   O O   . GLU A  1 46  ? -37.325 5.118   2.220   1.00 47.80  ? 46  GLU A O   1 
ATOM   394   C CB  . GLU A  1 46  ? -37.066 1.784   2.259   1.00 54.08  ? 46  GLU A CB  1 
ATOM   395   C CG  . GLU A  1 46  ? -38.350 1.812   3.077   1.00 61.25  ? 46  GLU A CG  1 
ATOM   396   C CD  . GLU A  1 46  ? -38.431 0.646   4.063   1.00 65.71  ? 46  GLU A CD  1 
ATOM   397   O OE1 . GLU A  1 46  ? -38.205 -0.510  3.628   1.00 67.42  ? 46  GLU A OE1 1 
ATOM   398   O OE2 . GLU A  1 46  ? -38.721 0.886   5.262   1.00 65.91  ? 46  GLU A OE2 1 
ATOM   399   N N   . GLU A  1 47  ? -35.245 4.299   2.441   1.00 48.22  ? 47  GLU A N   1 
ATOM   400   C CA  . GLU A  1 47  ? -34.765 5.447   3.194   1.00 49.26  ? 47  GLU A CA  1 
ATOM   401   C C   . GLU A  1 47  ? -34.912 6.784   2.480   1.00 47.79  ? 47  GLU A C   1 
ATOM   402   O O   . GLU A  1 47  ? -35.113 7.810   3.121   1.00 48.33  ? 47  GLU A O   1 
ATOM   403   C CB  . GLU A  1 47  ? -33.306 5.229   3.584   1.00 51.54  ? 47  GLU A CB  1 
ATOM   404   C CG  . GLU A  1 47  ? -32.373 5.191   2.410   1.00 54.26  ? 47  GLU A CG  1 
ATOM   405   C CD  . GLU A  1 47  ? -31.200 4.272   2.650   1.00 57.27  ? 47  GLU A CD  1 
ATOM   406   O OE1 . GLU A  1 47  ? -31.440 3.048   2.792   1.00 58.74  ? 47  GLU A OE1 1 
ATOM   407   O OE2 . GLU A  1 47  ? -30.051 4.769   2.697   1.00 55.62  ? 47  GLU A OE2 1 
ATOM   408   N N   . PHE A  1 48  ? -34.802 6.786   1.159   1.00 45.66  ? 48  PHE A N   1 
ATOM   409   C CA  . PHE A  1 48  ? -34.936 8.034   0.423   1.00 44.37  ? 48  PHE A CA  1 
ATOM   410   C C   . PHE A  1 48  ? -36.195 8.784   0.831   1.00 44.13  ? 48  PHE A C   1 
ATOM   411   O O   . PHE A  1 48  ? -36.202 10.013  0.896   1.00 43.33  ? 48  PHE A O   1 
ATOM   412   C CB  . PHE A  1 48  ? -35.002 7.775   -1.088  1.00 42.88  ? 48  PHE A CB  1 
ATOM   413   C CG  . PHE A  1 48  ? -33.703 7.337   -1.698  1.00 40.96  ? 48  PHE A CG  1 
ATOM   414   C CD1 . PHE A  1 48  ? -32.500 7.496   -1.017  1.00 40.45  ? 48  PHE A CD1 1 
ATOM   415   C CD2 . PHE A  1 48  ? -33.677 6.821   -2.990  1.00 40.72  ? 48  PHE A CD2 1 
ATOM   416   C CE1 . PHE A  1 48  ? -31.299 7.154   -1.614  1.00 37.75  ? 48  PHE A CE1 1 
ATOM   417   C CE2 . PHE A  1 48  ? -32.480 6.478   -3.594  1.00 38.25  ? 48  PHE A CE2 1 
ATOM   418   C CZ  . PHE A  1 48  ? -31.287 6.645   -2.908  1.00 37.74  ? 48  PHE A CZ  1 
ATOM   419   N N   . ALA A  1 49  ? -37.256 8.032   1.108   1.00 44.69  ? 49  ALA A N   1 
ATOM   420   C CA  . ALA A  1 49  ? -38.552 8.608   1.461   1.00 46.84  ? 49  ALA A CA  1 
ATOM   421   C C   . ALA A  1 49  ? -38.593 9.582   2.633   1.00 46.77  ? 49  ALA A C   1 
ATOM   422   O O   . ALA A  1 49  ? -39.424 10.492  2.644   1.00 47.69  ? 49  ALA A O   1 
ATOM   423   C CB  . ALA A  1 49  ? -39.580 7.490   1.680   1.00 46.26  ? 49  ALA A CB  1 
ATOM   424   N N   . LYS A  1 50  ? -37.720 9.417   3.619   1.00 46.73  ? 50  LYS A N   1 
ATOM   425   C CA  . LYS A  1 50  ? -37.756 10.333  4.756   1.00 48.56  ? 50  LYS A CA  1 
ATOM   426   C C   . LYS A  1 50  ? -37.071 11.665  4.465   1.00 48.25  ? 50  LYS A C   1 
ATOM   427   O O   . LYS A  1 50  ? -37.157 12.601  5.261   1.00 48.84  ? 50  LYS A O   1 
ATOM   428   C CB  . LYS A  1 50  ? -37.148 9.672   5.996   1.00 47.62  ? 50  LYS A CB  1 
ATOM   429   C CG  . LYS A  1 50  ? -35.832 8.997   5.741   1.00 50.74  ? 50  LYS A CG  1 
ATOM   430   C CD  . LYS A  1 50  ? -35.445 8.110   6.907   1.00 52.52  ? 50  LYS A CD  1 
ATOM   431   C CE  . LYS A  1 50  ? -34.245 7.251   6.566   1.00 54.37  ? 50  LYS A CE  1 
ATOM   432   N NZ  . LYS A  1 50  ? -33.765 6.486   7.755   1.00 59.00  ? 50  LYS A NZ  1 
ATOM   433   N N   . PHE A  1 51  ? -36.427 11.761  3.307   1.00 46.63  ? 51  PHE A N   1 
ATOM   434   C CA  . PHE A  1 51  ? -35.736 12.983  2.929   1.00 47.28  ? 51  PHE A CA  1 
ATOM   435   C C   . PHE A  1 51  ? -36.444 13.796  1.852   1.00 47.43  ? 51  PHE A C   1 
ATOM   436   O O   . PHE A  1 51  ? -36.105 14.955  1.627   1.00 47.67  ? 51  PHE A O   1 
ATOM   437   C CB  . PHE A  1 51  ? -34.324 12.648  2.473   1.00 45.76  ? 51  PHE A CB  1 
ATOM   438   C CG  . PHE A  1 51  ? -33.468 12.081  3.555   1.00 48.00  ? 51  PHE A CG  1 
ATOM   439   C CD1 . PHE A  1 51  ? -32.772 12.920  4.421   1.00 49.90  ? 51  PHE A CD1 1 
ATOM   440   C CD2 . PHE A  1 51  ? -33.373 10.706  3.733   1.00 49.01  ? 51  PHE A CD2 1 
ATOM   441   C CE1 . PHE A  1 51  ? -31.994 12.396  5.448   1.00 49.23  ? 51  PHE A CE1 1 
ATOM   442   C CE2 . PHE A  1 51  ? -32.600 10.171  4.757   1.00 49.03  ? 51  PHE A CE2 1 
ATOM   443   C CZ  . PHE A  1 51  ? -31.911 11.016  5.616   1.00 50.13  ? 51  PHE A CZ  1 
ATOM   444   N N   . ALA A  1 52  ? -37.426 13.197  1.188   1.00 48.06  ? 52  ALA A N   1 
ATOM   445   C CA  . ALA A  1 52  ? -38.153 13.902  0.134   1.00 48.13  ? 52  ALA A CA  1 
ATOM   446   C C   . ALA A  1 52  ? -39.544 13.325  -0.176  1.00 48.12  ? 52  ALA A C   1 
ATOM   447   O O   . ALA A  1 52  ? -39.909 12.244  0.286   1.00 49.00  ? 52  ALA A O   1 
ATOM   448   C CB  . ALA A  1 52  ? -37.310 13.924  -1.134  1.00 45.66  ? 52  ALA A CB  1 
ATOM   449   N N   . SER A  1 53  ? -40.318 14.061  -0.964  1.00 46.99  ? 53  SER A N   1 
ATOM   450   C CA  . SER A  1 53  ? -41.650 13.622  -1.350  1.00 46.20  ? 53  SER A CA  1 
ATOM   451   C C   . SER A  1 53  ? -41.919 14.054  -2.789  1.00 45.08  ? 53  SER A C   1 
ATOM   452   O O   . SER A  1 53  ? -41.337 15.028  -3.268  1.00 45.05  ? 53  SER A O   1 
ATOM   453   C CB  . SER A  1 53  ? -42.707 14.238  -0.422  1.00 45.17  ? 53  SER A CB  1 
ATOM   454   O OG  . SER A  1 53  ? -42.730 15.651  -0.536  1.00 43.50  ? 53  SER A OG  1 
ATOM   455   N N   . PHE A  1 54  ? -42.796 13.323  -3.474  1.00 43.28  ? 54  PHE A N   1 
ATOM   456   C CA  . PHE A  1 54  ? -43.150 13.652  -4.850  1.00 41.28  ? 54  PHE A CA  1 
ATOM   457   C C   . PHE A  1 54  ? -44.583 13.242  -5.138  1.00 41.19  ? 54  PHE A C   1 
ATOM   458   O O   . PHE A  1 54  ? -44.937 12.066  -5.004  1.00 39.76  ? 54  PHE A O   1 
ATOM   459   C CB  . PHE A  1 54  ? -42.235 12.941  -5.849  1.00 38.47  ? 54  PHE A CB  1 
ATOM   460   C CG  . PHE A  1 54  ? -42.566 13.257  -7.280  1.00 40.08  ? 54  PHE A CG  1 
ATOM   461   C CD1 . PHE A  1 54  ? -42.147 14.458  -7.856  1.00 38.57  ? 54  PHE A CD1 1 
ATOM   462   C CD2 . PHE A  1 54  ? -43.369 12.394  -8.028  1.00 36.30  ? 54  PHE A CD2 1 
ATOM   463   C CE1 . PHE A  1 54  ? -42.530 14.801  -9.155  1.00 39.23  ? 54  PHE A CE1 1 
ATOM   464   C CE2 . PHE A  1 54  ? -43.758 12.722  -9.322  1.00 37.11  ? 54  PHE A CE2 1 
ATOM   465   C CZ  . PHE A  1 54  ? -43.341 13.928  -9.893  1.00 37.86  ? 54  PHE A CZ  1 
ATOM   466   N N   . GLU A  1 55  ? -45.407 14.208  -5.534  1.00 42.43  ? 55  GLU A N   1 
ATOM   467   C CA  . GLU A  1 55  ? -46.802 13.922  -5.849  1.00 43.23  ? 55  GLU A CA  1 
ATOM   468   C C   . GLU A  1 55  ? -46.901 13.124  -7.146  1.00 41.62  ? 55  GLU A C   1 
ATOM   469   O O   . GLU A  1 55  ? -46.575 13.626  -8.228  1.00 39.10  ? 55  GLU A O   1 
ATOM   470   C CB  . GLU A  1 55  ? -47.592 15.224  -5.981  1.00 48.51  ? 55  GLU A CB  1 
ATOM   471   C CG  . GLU A  1 55  ? -47.741 15.984  -4.670  1.00 57.29  ? 55  GLU A CG  1 
ATOM   472   C CD  . GLU A  1 55  ? -47.190 17.411  -4.728  1.00 62.47  ? 55  GLU A CD  1 
ATOM   473   O OE1 . GLU A  1 55  ? -47.265 18.111  -3.690  1.00 65.07  ? 55  GLU A OE1 1 
ATOM   474   O OE2 . GLU A  1 55  ? -46.683 17.831  -5.799  1.00 63.60  ? 55  GLU A OE2 1 
ATOM   475   N N   . ALA A  1 56  ? -47.348 11.877  -7.019  1.00 39.12  ? 56  ALA A N   1 
ATOM   476   C CA  . ALA A  1 56  ? -47.507 10.980  -8.151  1.00 39.10  ? 56  ALA A CA  1 
ATOM   477   C C   . ALA A  1 56  ? -48.329 11.591  -9.291  1.00 40.11  ? 56  ALA A C   1 
ATOM   478   O O   . ALA A  1 56  ? -48.040 11.367  -10.470 1.00 39.69  ? 56  ALA A O   1 
ATOM   479   C CB  . ALA A  1 56  ? -48.137 9.671   -7.687  1.00 37.61  ? 56  ALA A CB  1 
ATOM   480   N N   . GLN A  1 57  ? -49.345 12.370  -8.943  1.00 41.75  ? 57  GLN A N   1 
ATOM   481   C CA  . GLN A  1 57  ? -50.204 13.008  -9.944  1.00 44.01  ? 57  GLN A CA  1 
ATOM   482   C C   . GLN A  1 57  ? -49.434 13.873  -10.942 1.00 43.58  ? 57  GLN A C   1 
ATOM   483   O O   . GLN A  1 57  ? -49.861 14.037  -12.084 1.00 43.62  ? 57  GLN A O   1 
ATOM   484   C CB  . GLN A  1 57  ? -51.285 13.838  -9.242  1.00 45.48  ? 57  GLN A CB  1 
ATOM   485   C CG  . GLN A  1 57  ? -52.202 12.989  -8.382  1.00 49.61  ? 57  GLN A CG  1 
ATOM   486   C CD  . GLN A  1 57  ? -53.032 12.038  -9.218  1.00 54.44  ? 57  GLN A CD  1 
ATOM   487   O OE1 . GLN A  1 57  ? -53.419 10.957  -8.766  1.00 57.66  ? 57  GLN A OE1 1 
ATOM   488   N NE2 . GLN A  1 57  ? -53.321 12.442  -10.446 1.00 57.58  ? 57  GLN A NE2 1 
ATOM   489   N N   . GLY A  1 58  ? -48.302 14.426  -10.519 1.00 42.71  ? 58  GLY A N   1 
ATOM   490   C CA  . GLY A  1 58  ? -47.512 15.245  -11.422 1.00 42.06  ? 58  GLY A CA  1 
ATOM   491   C C   . GLY A  1 58  ? -46.922 14.409  -12.544 1.00 42.90  ? 58  GLY A C   1 
ATOM   492   O O   . GLY A  1 58  ? -46.747 14.879  -13.670 1.00 42.35  ? 58  GLY A O   1 
ATOM   493   N N   . ALA A  1 59  ? -46.610 13.158  -12.232 1.00 42.20  ? 59  ALA A N   1 
ATOM   494   C CA  . ALA A  1 59  ? -46.053 12.249  -13.219 1.00 41.89  ? 59  ALA A CA  1 
ATOM   495   C C   . ALA A  1 59  ? -47.152 11.719  -14.137 1.00 41.74  ? 59  ALA A C   1 
ATOM   496   O O   . ALA A  1 59  ? -46.947 11.564  -15.342 1.00 41.78  ? 59  ALA A O   1 
ATOM   497   C CB  . ALA A  1 59  ? -45.354 11.091  -12.527 1.00 42.39  ? 59  ALA A CB  1 
ATOM   498   N N   . LEU A  1 60  ? -48.321 11.437  -13.576 1.00 41.45  ? 60  LEU A N   1 
ATOM   499   C CA  . LEU A  1 60  ? -49.407 10.916  -14.392 1.00 40.77  ? 60  LEU A CA  1 
ATOM   500   C C   . LEU A  1 60  ? -49.844 11.973  -15.383 1.00 40.84  ? 60  LEU A C   1 
ATOM   501   O O   . LEU A  1 60  ? -50.195 11.652  -16.512 1.00 42.86  ? 60  LEU A O   1 
ATOM   502   C CB  . LEU A  1 60  ? -50.584 10.494  -13.520 1.00 41.33  ? 60  LEU A CB  1 
ATOM   503   C CG  . LEU A  1 60  ? -50.300 9.425   -12.464 1.00 43.49  ? 60  LEU A CG  1 
ATOM   504   C CD1 . LEU A  1 60  ? -51.614 9.027   -11.844 1.00 44.12  ? 60  LEU A CD1 1 
ATOM   505   C CD2 . LEU A  1 60  ? -49.638 8.204   -13.079 1.00 45.05  ? 60  LEU A CD2 1 
ATOM   506   N N   . ALA A  1 61  ? -49.815 13.234  -14.962 1.00 39.22  ? 61  ALA A N   1 
ATOM   507   C CA  . ALA A  1 61  ? -50.197 14.333  -15.839 1.00 39.52  ? 61  ALA A CA  1 
ATOM   508   C C   . ALA A  1 61  ? -49.169 14.442  -16.961 1.00 39.50  ? 61  ALA A C   1 
ATOM   509   O O   . ALA A  1 61  ? -49.502 14.725  -18.107 1.00 40.70  ? 61  ALA A O   1 
ATOM   510   C CB  . ALA A  1 61  ? -50.262 15.647  -15.055 1.00 38.08  ? 61  ALA A CB  1 
ATOM   511   N N   . ASN A  1 62  ? -47.908 14.211  -16.625 1.00 40.88  ? 62  ASN A N   1 
ATOM   512   C CA  . ASN A  1 62  ? -46.849 14.283  -17.625 1.00 41.34  ? 62  ASN A CA  1 
ATOM   513   C C   . ASN A  1 62  ? -46.961 13.152  -18.645 1.00 40.27  ? 62  ASN A C   1 
ATOM   514   O O   . ASN A  1 62  ? -46.810 13.379  -19.845 1.00 39.63  ? 62  ASN A O   1 
ATOM   515   C CB  . ASN A  1 62  ? -45.488 14.266  -16.938 1.00 44.48  ? 62  ASN A CB  1 
ATOM   516   C CG  . ASN A  1 62  ? -44.984 15.667  -16.626 1.00 47.21  ? 62  ASN A CG  1 
ATOM   517   O OD1 . ASN A  1 62  ? -45.622 16.432  -15.899 1.00 47.50  ? 62  ASN A OD1 1 
ATOM   518   N ND2 . ASN A  1 62  ? -43.832 16.010  -17.189 1.00 49.53  ? 62  ASN A ND2 1 
ATOM   519   N N   . ILE A  1 63  ? -47.227 11.939  -18.167 1.00 39.65  ? 63  ILE A N   1 
ATOM   520   C CA  . ILE A  1 63  ? -47.412 10.792  -19.049 1.00 38.75  ? 63  ILE A CA  1 
ATOM   521   C C   . ILE A  1 63  ? -48.581 11.080  -19.998 1.00 38.65  ? 63  ILE A C   1 
ATOM   522   O O   . ILE A  1 63  ? -48.513 10.762  -21.185 1.00 38.05  ? 63  ILE A O   1 
ATOM   523   C CB  . ILE A  1 63  ? -47.737 9.506   -18.243 1.00 39.74  ? 63  ILE A CB  1 
ATOM   524   C CG1 . ILE A  1 63  ? -46.539 9.136   -17.371 1.00 40.86  ? 63  ILE A CG1 1 
ATOM   525   C CG2 . ILE A  1 63  ? -48.091 8.361   -19.171 1.00 36.51  ? 63  ILE A CG2 1 
ATOM   526   C CD1 . ILE A  1 63  ? -45.247 9.085   -18.119 1.00 43.06  ? 63  ILE A CD1 1 
ATOM   527   N N   . ALA A  1 64  ? -49.642 11.692  -19.477 1.00 35.88  ? 64  ALA A N   1 
ATOM   528   C CA  . ALA A  1 64  ? -50.802 12.000  -20.299 1.00 36.94  ? 64  ALA A CA  1 
ATOM   529   C C   . ALA A  1 64  ? -50.392 12.877  -21.477 1.00 38.82  ? 64  ALA A C   1 
ATOM   530   O O   . ALA A  1 64  ? -50.879 12.696  -22.602 1.00 38.36  ? 64  ALA A O   1 
ATOM   531   C CB  . ALA A  1 64  ? -51.872 12.692  -19.470 1.00 36.70  ? 64  ALA A CB  1 
ATOM   532   N N   . VAL A  1 65  ? -49.491 13.825  -21.223 1.00 39.41  ? 65  VAL A N   1 
ATOM   533   C CA  . VAL A  1 65  ? -49.004 14.698  -22.282 1.00 38.76  ? 65  VAL A CA  1 
ATOM   534   C C   . VAL A  1 65  ? -48.188 13.881  -23.287 1.00 39.49  ? 65  VAL A C   1 
ATOM   535   O O   . VAL A  1 65  ? -48.334 14.051  -24.496 1.00 41.01  ? 65  VAL A O   1 
ATOM   536   C CB  . VAL A  1 65  ? -48.119 15.832  -21.729 1.00 39.89  ? 65  VAL A CB  1 
ATOM   537   C CG1 . VAL A  1 65  ? -47.524 16.637  -22.882 1.00 36.66  ? 65  VAL A CG1 1 
ATOM   538   C CG2 . VAL A  1 65  ? -48.936 16.739  -20.810 1.00 36.11  ? 65  VAL A CG2 1 
ATOM   539   N N   . ASN A  1 66  ? -47.341 12.981  -22.801 1.00 38.67  ? 66  ASN A N   1 
ATOM   540   C CA  . ASN A  1 66  ? -46.543 12.172  -23.718 1.00 40.51  ? 66  ASN A CA  1 
ATOM   541   C C   . ASN A  1 66  ? -47.454 11.308  -24.575 1.00 39.99  ? 66  ASN A C   1 
ATOM   542   O O   . ASN A  1 66  ? -47.151 11.008  -25.732 1.00 39.56  ? 66  ASN A O   1 
ATOM   543   C CB  . ASN A  1 66  ? -45.577 11.267  -22.951 1.00 42.73  ? 66  ASN A CB  1 
ATOM   544   C CG  . ASN A  1 66  ? -44.525 12.048  -22.180 1.00 45.76  ? 66  ASN A CG  1 
ATOM   545   O OD1 . ASN A  1 66  ? -44.196 11.701  -21.049 1.00 49.42  ? 66  ASN A OD1 1 
ATOM   546   N ND2 . ASN A  1 66  ? -43.989 13.096  -22.789 1.00 44.85  ? 66  ASN A ND2 1 
ATOM   547   N N   . LYS A  1 67  ? -48.580 10.925  -23.987 1.00 39.88  ? 67  LYS A N   1 
ATOM   548   C CA  . LYS A  1 67  ? -49.555 10.082  -24.655 1.00 39.59  ? 67  LYS A CA  1 
ATOM   549   C C   . LYS A  1 67  ? -50.190 10.826  -25.821 1.00 37.60  ? 67  LYS A C   1 
ATOM   550   O O   . LYS A  1 67  ? -50.323 10.275  -26.914 1.00 36.27  ? 67  LYS A O   1 
ATOM   551   C CB  . LYS A  1 67  ? -50.616 9.629   -23.653 1.00 41.55  ? 67  LYS A CB  1 
ATOM   552   C CG  . LYS A  1 67  ? -51.423 8.424   -24.096 1.00 45.47  ? 67  LYS A CG  1 
ATOM   553   C CD  . LYS A  1 67  ? -52.398 8.022   -23.004 1.00 48.74  ? 67  LYS A CD  1 
ATOM   554   C CE  . LYS A  1 67  ? -53.529 7.178   -23.558 1.00 51.45  ? 67  LYS A CE  1 
ATOM   555   N NZ  . LYS A  1 67  ? -54.303 7.963   -24.567 1.00 54.54  ? 67  LYS A NZ  1 
ATOM   556   N N   . ALA A  1 68  ? -50.562 12.083  -25.603 1.00 35.98  ? 68  ALA A N   1 
ATOM   557   C CA  . ALA A  1 68  ? -51.162 12.866  -26.676 1.00 36.37  ? 68  ALA A CA  1 
ATOM   558   C C   . ALA A  1 68  ? -50.092 13.224  -27.713 1.00 36.88  ? 68  ALA A C   1 
ATOM   559   O O   . ALA A  1 68  ? -50.330 13.147  -28.932 1.00 36.66  ? 68  ALA A O   1 
ATOM   560   C CB  . ALA A  1 68  ? -51.811 14.136  -26.118 1.00 36.76  ? 68  ALA A CB  1 
ATOM   561   N N   . ASN A  1 69  ? -48.907 13.603  -27.238 1.00 34.66  ? 69  ASN A N   1 
ATOM   562   C CA  . ASN A  1 69  ? -47.835 13.941  -28.159 1.00 33.48  ? 69  ASN A CA  1 
ATOM   563   C C   . ASN A  1 69  ? -47.466 12.748  -29.048 1.00 32.93  ? 69  ASN A C   1 
ATOM   564   O O   . ASN A  1 69  ? -47.088 12.928  -30.207 1.00 35.24  ? 69  ASN A O   1 
ATOM   565   C CB  . ASN A  1 69  ? -46.597 14.431  -27.401 1.00 34.31  ? 69  ASN A CB  1 
ATOM   566   C CG  . ASN A  1 69  ? -46.785 15.811  -26.795 1.00 33.56  ? 69  ASN A CG  1 
ATOM   567   O OD1 . ASN A  1 69  ? -47.663 16.573  -27.197 1.00 33.92  ? 69  ASN A OD1 1 
ATOM   568   N ND2 . ASN A  1 69  ? -45.940 16.147  -25.833 1.00 34.79  ? 69  ASN A ND2 1 
ATOM   569   N N   . LEU A  1 70  ? -47.580 11.529  -28.529 1.00 31.91  ? 70  LEU A N   1 
ATOM   570   C CA  . LEU A  1 70  ? -47.246 10.351  -29.334 1.00 32.99  ? 70  LEU A CA  1 
ATOM   571   C C   . LEU A  1 70  ? -48.110 10.221  -30.592 1.00 36.02  ? 70  LEU A C   1 
ATOM   572   O O   . LEU A  1 70  ? -47.587 9.973   -31.676 1.00 36.09  ? 70  LEU A O   1 
ATOM   573   C CB  . LEU A  1 70  ? -47.373 9.059   -28.519 1.00 32.03  ? 70  LEU A CB  1 
ATOM   574   C CG  . LEU A  1 70  ? -47.175 7.780   -29.354 1.00 30.93  ? 70  LEU A CG  1 
ATOM   575   C CD1 . LEU A  1 70  ? -45.788 7.749   -30.000 1.00 27.97  ? 70  LEU A CD1 1 
ATOM   576   C CD2 . LEU A  1 70  ? -47.345 6.570   -28.467 1.00 32.25  ? 70  LEU A CD2 1 
ATOM   577   N N   . ASP A  1 71  ? -49.429 10.373  -30.459 1.00 38.15  ? 71  ASP A N   1 
ATOM   578   C CA  . ASP A  1 71  ? -50.299 10.266  -31.630 1.00 39.11  ? 71  ASP A CA  1 
ATOM   579   C C   . ASP A  1 71  ? -49.904 11.320  -32.651 1.00 38.55  ? 71  ASP A C   1 
ATOM   580   O O   . ASP A  1 71  ? -49.808 11.041  -33.844 1.00 37.89  ? 71  ASP A O   1 
ATOM   581   C CB  . ASP A  1 71  ? -51.779 10.425  -31.244 1.00 41.79  ? 71  ASP A CB  1 
ATOM   582   C CG  . ASP A  1 71  ? -52.305 9.241   -30.416 1.00 45.49  ? 71  ASP A CG  1 
ATOM   583   O OD1 . ASP A  1 71  ? -52.059 8.070   -30.799 1.00 46.19  ? 71  ASP A OD1 1 
ATOM   584   O OD2 . ASP A  1 71  ? -52.972 9.481   -29.385 1.00 48.79  ? 71  ASP A OD2 1 
ATOM   585   N N   . VAL A  1 72  ? -49.662 12.536  -32.177 1.00 40.03  ? 72  VAL A N   1 
ATOM   586   C CA  . VAL A  1 72  ? -49.258 13.610  -33.066 1.00 39.18  ? 72  VAL A CA  1 
ATOM   587   C C   . VAL A  1 72  ? -47.974 13.226  -33.787 1.00 39.46  ? 72  VAL A C   1 
ATOM   588   O O   . VAL A  1 72  ? -47.841 13.491  -34.975 1.00 40.56  ? 72  VAL A O   1 
ATOM   589   C CB  . VAL A  1 72  ? -49.029 14.908  -32.304 1.00 40.06  ? 72  VAL A CB  1 
ATOM   590   C CG1 . VAL A  1 72  ? -48.348 15.916  -33.211 1.00 40.26  ? 72  VAL A CG1 1 
ATOM   591   C CG2 . VAL A  1 72  ? -50.354 15.459  -31.826 1.00 37.54  ? 72  VAL A CG2 1 
ATOM   592   N N   . MET A  1 73  ? -47.029 12.612  -33.075 1.00 38.25  ? 73  MET A N   1 
ATOM   593   C CA  . MET A  1 73  ? -45.787 12.184  -33.710 1.00 39.05  ? 73  MET A CA  1 
ATOM   594   C C   . MET A  1 73  ? -46.032 11.038  -34.694 1.00 39.22  ? 73  MET A C   1 
ATOM   595   O O   . MET A  1 73  ? -45.326 10.922  -35.695 1.00 40.99  ? 73  MET A O   1 
ATOM   596   C CB  . MET A  1 73  ? -44.739 11.742  -32.674 1.00 38.67  ? 73  MET A CB  1 
ATOM   597   C CG  . MET A  1 73  ? -44.242 12.832  -31.732 1.00 39.74  ? 73  MET A CG  1 
ATOM   598   S SD  . MET A  1 73  ? -43.708 14.376  -32.547 1.00 41.22  ? 73  MET A SD  1 
ATOM   599   C CE  . MET A  1 73  ? -42.357 13.767  -33.559 1.00 39.58  ? 73  MET A CE  1 
ATOM   600   N N   . LYS A  1 74  ? -47.013 10.182  -34.417 1.00 41.63  ? 74  LYS A N   1 
ATOM   601   C CA  . LYS A  1 74  ? -47.312 9.069   -35.331 1.00 44.42  ? 74  LYS A CA  1 
ATOM   602   C C   . LYS A  1 74  ? -47.813 9.626   -36.660 1.00 44.34  ? 74  LYS A C   1 
ATOM   603   O O   . LYS A  1 74  ? -47.386 9.190   -37.727 1.00 45.13  ? 74  LYS A O   1 
ATOM   604   C CB  . LYS A  1 74  ? -48.374 8.134   -34.752 1.00 45.02  ? 74  LYS A CB  1 
ATOM   605   C CG  . LYS A  1 74  ? -47.957 7.386   -33.508 1.00 46.90  ? 74  LYS A CG  1 
ATOM   606   C CD  . LYS A  1 74  ? -48.964 6.286   -33.175 1.00 50.78  ? 74  LYS A CD  1 
ATOM   607   C CE  . LYS A  1 74  ? -49.008 5.226   -34.279 1.00 50.85  ? 74  LYS A CE  1 
ATOM   608   N NZ  . LYS A  1 74  ? -49.951 4.133   -33.953 1.00 52.59  ? 74  LYS A NZ  1 
ATOM   609   N N   . GLU A  1 75  ? -48.728 10.584  -36.580 1.00 45.19  ? 75  GLU A N   1 
ATOM   610   C CA  . GLU A  1 75  ? -49.271 11.233  -37.762 1.00 46.34  ? 75  GLU A CA  1 
ATOM   611   C C   . GLU A  1 75  ? -48.129 11.928  -38.491 1.00 45.43  ? 75  GLU A C   1 
ATOM   612   O O   . GLU A  1 75  ? -47.906 11.704  -39.679 1.00 41.64  ? 75  GLU A O   1 
ATOM   613   C CB  . GLU A  1 75  ? -50.306 12.292  -37.368 1.00 49.22  ? 75  GLU A CB  1 
ATOM   614   C CG  . GLU A  1 75  ? -51.663 11.754  -36.965 1.00 58.36  ? 75  GLU A CG  1 
ATOM   615   C CD  . GLU A  1 75  ? -52.529 11.382  -38.161 1.00 62.62  ? 75  GLU A CD  1 
ATOM   616   O OE1 . GLU A  1 75  ? -52.820 12.277  -38.989 1.00 65.43  ? 75  GLU A OE1 1 
ATOM   617   O OE2 . GLU A  1 75  ? -52.920 10.198  -38.270 1.00 64.00  ? 75  GLU A OE2 1 
ATOM   618   N N   . ARG A  1 76  ? -47.410 12.772  -37.753 1.00 45.15  ? 76  ARG A N   1 
ATOM   619   C CA  . ARG A  1 76  ? -46.299 13.548  -38.304 1.00 45.60  ? 76  ARG A CA  1 
ATOM   620   C C   . ARG A  1 76  ? -45.295 12.716  -39.099 1.00 45.02  ? 76  ARG A C   1 
ATOM   621   O O   . ARG A  1 76  ? -44.656 13.232  -40.015 1.00 44.94  ? 76  ARG A O   1 
ATOM   622   C CB  . ARG A  1 76  ? -45.579 14.313  -37.181 1.00 44.51  ? 76  ARG A CB  1 
ATOM   623   C CG  . ARG A  1 76  ? -44.538 15.308  -37.678 1.00 43.70  ? 76  ARG A CG  1 
ATOM   624   C CD  . ARG A  1 76  ? -43.783 15.968  -36.529 1.00 42.45  ? 76  ARG A CD  1 
ATOM   625   N NE  . ARG A  1 76  ? -44.635 16.790  -35.671 1.00 41.10  ? 76  ARG A NE  1 
ATOM   626   C CZ  . ARG A  1 76  ? -44.196 17.427  -34.587 1.00 41.99  ? 76  ARG A CZ  1 
ATOM   627   N NH1 . ARG A  1 76  ? -42.921 17.340  -34.227 1.00 39.95  ? 76  ARG A NH1 1 
ATOM   628   N NH2 . ARG A  1 76  ? -45.031 18.148  -33.853 1.00 41.82  ? 76  ARG A NH2 1 
ATOM   629   N N   . SER A  1 77  ? -45.165 11.436  -38.763 1.00 45.82  ? 77  SER A N   1 
ATOM   630   C CA  . SER A  1 77  ? -44.235 10.560  -39.477 1.00 48.43  ? 77  SER A CA  1 
ATOM   631   C C   . SER A  1 77  ? -44.953 9.510   -40.329 1.00 49.05  ? 77  SER A C   1 
ATOM   632   O O   . SER A  1 77  ? -44.339 8.547   -40.781 1.00 48.86  ? 77  SER A O   1 
ATOM   633   C CB  . SER A  1 77  ? -43.318 9.847   -38.484 1.00 49.18  ? 77  SER A CB  1 
ATOM   634   O OG  . SER A  1 77  ? -44.087 9.038   -37.609 1.00 51.75  ? 77  SER A OG  1 
ATOM   635   N N   . ASN A  1 78  ? -46.251 9.700   -40.536 1.00 52.14  ? 78  ASN A N   1 
ATOM   636   C CA  . ASN A  1 78  ? -47.064 8.773   -41.318 1.00 55.81  ? 78  ASN A CA  1 
ATOM   637   C C   . ASN A  1 78  ? -46.936 7.331   -40.815 1.00 56.66  ? 78  ASN A C   1 
ATOM   638   O O   . ASN A  1 78  ? -46.839 6.388   -41.608 1.00 55.84  ? 78  ASN A O   1 
ATOM   639   C CB  . ASN A  1 78  ? -46.690 8.848   -42.808 1.00 60.30  ? 78  ASN A CB  1 
ATOM   640   C CG  . ASN A  1 78  ? -47.685 8.111   -43.699 1.00 65.48  ? 78  ASN A CG  1 
ATOM   641   O OD1 . ASN A  1 78  ? -48.901 8.224   -43.504 1.00 65.34  ? 78  ASN A OD1 1 
ATOM   642   N ND2 . ASN A  1 78  ? -47.178 7.373   -44.685 1.00 69.80  ? 78  ASN A ND2 1 
ATOM   643   N N   . ASN A  1 79  ? -46.934 7.176   -39.491 1.00 57.23  ? 79  ASN A N   1 
ATOM   644   C CA  . ASN A  1 79  ? -46.834 5.869   -38.836 1.00 56.76  ? 79  ASN A CA  1 
ATOM   645   C C   . ASN A  1 79  ? -45.671 5.004   -39.327 1.00 56.62  ? 79  ASN A C   1 
ATOM   646   O O   . ASN A  1 79  ? -45.786 3.781   -39.407 1.00 56.09  ? 79  ASN A O   1 
ATOM   647   C CB  . ASN A  1 79  ? -48.140 5.100   -39.017 1.00 57.59  ? 79  ASN A CB  1 
ATOM   648   C CG  . ASN A  1 79  ? -49.352 5.952   -38.739 1.00 59.55  ? 79  ASN A CG  1 
ATOM   649   O OD1 . ASN A  1 79  ? -49.601 6.354   -37.598 1.00 59.91  ? 79  ASN A OD1 1 
ATOM   650   N ND2 . ASN A  1 79  ? -50.112 6.252   -39.790 1.00 59.00  ? 79  ASN A ND2 1 
ATOM   651   N N   . THR A  1 80  ? -44.550 5.627   -39.665 1.00 56.97  ? 80  THR A N   1 
ATOM   652   C CA  . THR A  1 80  ? -43.407 4.851   -40.112 1.00 57.27  ? 80  THR A CA  1 
ATOM   653   C C   . THR A  1 80  ? -42.746 4.305   -38.852 1.00 57.85  ? 80  THR A C   1 
ATOM   654   O O   . THR A  1 80  ? -42.619 5.011   -37.848 1.00 56.26  ? 80  THR A O   1 
ATOM   655   C CB  . THR A  1 80  ? -42.400 5.715   -40.888 1.00 57.71  ? 80  THR A CB  1 
ATOM   656   O OG1 . THR A  1 80  ? -43.101 6.504   -41.855 1.00 58.63  ? 80  THR A OG1 1 
ATOM   657   C CG2 . THR A  1 80  ? -41.399 4.829   -41.614 1.00 57.78  ? 80  THR A CG2 1 
ATOM   658   N N   . PRO A  1 81  ? -42.347 3.029   -38.877 1.00 58.21  ? 81  PRO A N   1 
ATOM   659   C CA  . PRO A  1 81  ? -41.706 2.445   -37.698 1.00 58.39  ? 81  PRO A CA  1 
ATOM   660   C C   . PRO A  1 81  ? -40.200 2.231   -37.882 1.00 57.71  ? 81  PRO A C   1 
ATOM   661   O O   . PRO A  1 81  ? -39.708 2.151   -39.012 1.00 57.71  ? 81  PRO A O   1 
ATOM   662   C CB  . PRO A  1 81  ? -42.446 1.127   -37.551 1.00 59.05  ? 81  PRO A CB  1 
ATOM   663   C CG  . PRO A  1 81  ? -42.538 0.682   -38.999 1.00 58.83  ? 81  PRO A CG  1 
ATOM   664   C CD  . PRO A  1 81  ? -42.884 1.972   -39.757 1.00 58.65  ? 81  PRO A CD  1 
ATOM   665   N N   . ASP A  1 82  ? -39.472 2.146   -36.771 1.00 55.68  ? 82  ASP A N   1 
ATOM   666   C CA  . ASP A  1 82  ? -38.040 1.896   -36.829 1.00 54.01  ? 82  ASP A CA  1 
ATOM   667   C C   . ASP A  1 82  ? -37.807 0.481   -36.326 1.00 51.70  ? 82  ASP A C   1 
ATOM   668   O O   . ASP A  1 82  ? -38.667 -0.096  -35.669 1.00 51.48  ? 82  ASP A O   1 
ATOM   669   C CB  . ASP A  1 82  ? -37.259 2.882   -35.959 1.00 55.44  ? 82  ASP A CB  1 
ATOM   670   C CG  . ASP A  1 82  ? -37.309 4.298   -36.486 1.00 56.73  ? 82  ASP A CG  1 
ATOM   671   O OD1 . ASP A  1 82  ? -37.192 4.486   -37.715 1.00 59.04  ? 82  ASP A OD1 1 
ATOM   672   O OD2 . ASP A  1 82  ? -37.450 5.231   -35.669 1.00 59.21  ? 82  ASP A OD2 1 
ATOM   673   N N   . ALA A  1 83  ? -36.646 -0.079  -36.629 1.00 49.40  ? 83  ALA A N   1 
ATOM   674   C CA  . ALA A  1 83  ? -36.348 -1.431  -36.189 1.00 48.15  ? 83  ALA A CA  1 
ATOM   675   C C   . ALA A  1 83  ? -36.264 -1.540  -34.669 1.00 47.88  ? 83  ALA A C   1 
ATOM   676   O O   . ALA A  1 83  ? -36.140 -0.545  -33.954 1.00 48.77  ? 83  ALA A O   1 
ATOM   677   C CB  . ALA A  1 83  ? -35.045 -1.901  -36.810 1.00 47.23  ? 83  ALA A CB  1 
ATOM   678   N N   . ASN A  1 84  ? -36.339 -2.770  -34.189 1.00 47.46  ? 84  ASN A N   1 
ATOM   679   C CA  . ASN A  1 84  ? -36.246 -3.070  -32.775 1.00 46.19  ? 84  ASN A CA  1 
ATOM   680   C C   . ASN A  1 84  ? -34.762 -3.316  -32.521 1.00 47.36  ? 84  ASN A C   1 
ATOM   681   O O   . ASN A  1 84  ? -34.130 -4.060  -33.271 1.00 50.37  ? 84  ASN A O   1 
ATOM   682   C CB  . ASN A  1 84  ? -37.048 -4.339  -32.474 1.00 45.19  ? 84  ASN A CB  1 
ATOM   683   C CG  . ASN A  1 84  ? -38.545 -4.122  -32.577 1.00 46.31  ? 84  ASN A CG  1 
ATOM   684   O OD1 . ASN A  1 84  ? -39.229 -3.928  -31.565 1.00 47.39  ? 84  ASN A OD1 1 
ATOM   685   N ND2 . ASN A  1 84  ? -39.066 -4.142  -33.801 1.00 44.88  ? 84  ASN A ND2 1 
ATOM   686   N N   . VAL A  1 85  ? -34.196 -2.680  -31.498 1.00 45.98  ? 85  VAL A N   1 
ATOM   687   C CA  . VAL A  1 85  ? -32.779 -2.880  -31.179 1.00 44.06  ? 85  VAL A CA  1 
ATOM   688   C C   . VAL A  1 85  ? -32.665 -3.849  -30.004 1.00 43.97  ? 85  VAL A C   1 
ATOM   689   O O   . VAL A  1 85  ? -33.100 -3.557  -28.887 1.00 44.18  ? 85  VAL A O   1 
ATOM   690   C CB  . VAL A  1 85  ? -32.076 -1.546  -30.817 1.00 44.34  ? 85  VAL A CB  1 
ATOM   691   C CG1 . VAL A  1 85  ? -30.613 -1.794  -30.489 1.00 41.63  ? 85  VAL A CG1 1 
ATOM   692   C CG2 . VAL A  1 85  ? -32.187 -0.573  -31.976 1.00 44.45  ? 85  VAL A CG2 1 
ATOM   693   N N   . ALA A  1 86  ? -32.097 -5.014  -30.277 1.00 44.10  ? 86  ALA A N   1 
ATOM   694   C CA  . ALA A  1 86  ? -31.927 -6.059  -29.277 1.00 43.68  ? 86  ALA A CA  1 
ATOM   695   C C   . ALA A  1 86  ? -30.974 -5.648  -28.171 1.00 44.58  ? 86  ALA A C   1 
ATOM   696   O O   . ALA A  1 86  ? -30.067 -4.843  -28.382 1.00 43.99  ? 86  ALA A O   1 
ATOM   697   C CB  . ALA A  1 86  ? -31.420 -7.328  -29.941 1.00 43.36  ? 86  ALA A CB  1 
ATOM   698   N N   . PRO A  1 87  ? -31.153 -6.226  -26.973 1.00 45.09  ? 87  PRO A N   1 
ATOM   699   C CA  . PRO A  1 87  ? -30.314 -5.928  -25.812 1.00 44.27  ? 87  PRO A CA  1 
ATOM   700   C C   . PRO A  1 87  ? -29.041 -6.745  -25.683 1.00 44.59  ? 87  PRO A C   1 
ATOM   701   O O   . PRO A  1 87  ? -28.895 -7.802  -26.283 1.00 46.45  ? 87  PRO A O   1 
ATOM   702   C CB  . PRO A  1 87  ? -31.255 -6.199  -24.647 1.00 44.57  ? 87  PRO A CB  1 
ATOM   703   C CG  . PRO A  1 87  ? -32.003 -7.393  -25.127 1.00 44.05  ? 87  PRO A CG  1 
ATOM   704   C CD  . PRO A  1 87  ? -32.325 -7.027  -26.574 1.00 44.25  ? 87  PRO A CD  1 
ATOM   705   N N   . GLU A  1 88  ? -28.123 -6.232  -24.877 1.00 47.07  ? 88  GLU A N   1 
ATOM   706   C CA  . GLU A  1 88  ? -26.861 -6.899  -24.561 1.00 47.02  ? 88  GLU A CA  1 
ATOM   707   C C   . GLU A  1 88  ? -27.114 -7.430  -23.135 1.00 45.78  ? 88  GLU A C   1 
ATOM   708   O O   . GLU A  1 88  ? -27.633 -6.704  -22.284 1.00 44.42  ? 88  GLU A O   1 
ATOM   709   C CB  . GLU A  1 88  ? -25.717 -5.870  -24.586 1.00 50.28  ? 88  GLU A CB  1 
ATOM   710   C CG  . GLU A  1 88  ? -24.404 -6.333  -23.967 1.00 56.39  ? 88  GLU A CG  1 
ATOM   711   C CD  . GLU A  1 88  ? -23.282 -5.294  -24.077 1.00 59.56  ? 88  GLU A CD  1 
ATOM   712   O OE1 . GLU A  1 88  ? -22.259 -5.450  -23.370 1.00 61.11  ? 88  GLU A OE1 1 
ATOM   713   O OE2 . GLU A  1 88  ? -23.414 -4.333  -24.870 1.00 60.28  ? 88  GLU A OE2 1 
ATOM   714   N N   . VAL A  1 89  ? -26.793 -8.693  -22.875 1.00 45.38  ? 89  VAL A N   1 
ATOM   715   C CA  . VAL A  1 89  ? -27.035 -9.250  -21.543 1.00 44.73  ? 89  VAL A CA  1 
ATOM   716   C C   . VAL A  1 89  ? -25.800 -9.763  -20.829 1.00 45.28  ? 89  VAL A C   1 
ATOM   717   O O   . VAL A  1 89  ? -24.951 -10.423 -21.421 1.00 44.21  ? 89  VAL A O   1 
ATOM   718   C CB  . VAL A  1 89  ? -28.059 -10.385 -21.578 1.00 45.20  ? 89  VAL A CB  1 
ATOM   719   C CG1 . VAL A  1 89  ? -28.232 -10.960 -20.176 1.00 46.73  ? 89  VAL A CG1 1 
ATOM   720   C CG2 . VAL A  1 89  ? -29.393 -9.860  -22.092 1.00 45.22  ? 89  VAL A CG2 1 
ATOM   721   N N   . THR A  1 90  ? -25.722 -9.451  -19.538 1.00 45.99  ? 90  THR A N   1 
ATOM   722   C CA  . THR A  1 90  ? -24.601 -9.848  -18.706 1.00 47.43  ? 90  THR A CA  1 
ATOM   723   C C   . THR A  1 90  ? -25.129 -10.289 -17.357 1.00 48.64  ? 90  THR A C   1 
ATOM   724   O O   . THR A  1 90  ? -25.934 -9.592  -16.743 1.00 49.58  ? 90  THR A O   1 
ATOM   725   C CB  . THR A  1 90  ? -23.639 -8.671  -18.458 1.00 49.41  ? 90  THR A CB  1 
ATOM   726   O OG1 . THR A  1 90  ? -23.232 -8.097  -19.708 1.00 52.82  ? 90  THR A OG1 1 
ATOM   727   C CG2 . THR A  1 90  ? -22.419 -9.147  -17.698 1.00 49.44  ? 90  THR A CG2 1 
ATOM   728   N N   . VAL A  1 91  ? -24.679 -11.448 -16.893 1.00 48.90  ? 91  VAL A N   1 
ATOM   729   C CA  . VAL A  1 91  ? -25.101 -11.951 -15.594 1.00 47.07  ? 91  VAL A CA  1 
ATOM   730   C C   . VAL A  1 91  ? -23.895 -11.929 -14.676 1.00 47.63  ? 91  VAL A C   1 
ATOM   731   O O   . VAL A  1 91  ? -22.811 -12.361 -15.059 1.00 46.97  ? 91  VAL A O   1 
ATOM   732   C CB  . VAL A  1 91  ? -25.634 -13.386 -15.686 1.00 46.71  ? 91  VAL A CB  1 
ATOM   733   C CG1 . VAL A  1 91  ? -25.837 -13.953 -14.287 1.00 46.75  ? 91  VAL A CG1 1 
ATOM   734   C CG2 . VAL A  1 91  ? -26.947 -13.396 -16.444 1.00 42.93  ? 91  VAL A CG2 1 
ATOM   735   N N   . LEU A  1 92  ? -24.078 -11.406 -13.469 1.00 47.37  ? 92  LEU A N   1 
ATOM   736   C CA  . LEU A  1 92  ? -22.984 -11.340 -12.507 1.00 46.63  ? 92  LEU A CA  1 
ATOM   737   C C   . LEU A  1 92  ? -23.528 -11.270 -11.090 1.00 46.94  ? 92  LEU A C   1 
ATOM   738   O O   . LEU A  1 92  ? -24.726 -11.056 -10.884 1.00 47.41  ? 92  LEU A O   1 
ATOM   739   C CB  . LEU A  1 92  ? -22.101 -10.114 -12.766 1.00 47.22  ? 92  LEU A CB  1 
ATOM   740   C CG  . LEU A  1 92  ? -22.664 -8.737  -12.395 1.00 47.40  ? 92  LEU A CG  1 
ATOM   741   C CD1 . LEU A  1 92  ? -21.512 -7.740  -12.292 1.00 47.84  ? 92  LEU A CD1 1 
ATOM   742   C CD2 . LEU A  1 92  ? -23.693 -8.285  -13.426 1.00 46.69  ? 92  LEU A CD2 1 
ATOM   743   N N   . SER A  1 93  ? -22.641 -11.455 -10.117 1.00 46.45  ? 93  SER A N   1 
ATOM   744   C CA  . SER A  1 93  ? -23.028 -11.409 -8.715  1.00 45.32  ? 93  SER A CA  1 
ATOM   745   C C   . SER A  1 93  ? -22.835 -9.992  -8.209  1.00 44.89  ? 93  SER A C   1 
ATOM   746   O O   . SER A  1 93  ? -21.940 -9.288  -8.658  1.00 44.52  ? 93  SER A O   1 
ATOM   747   C CB  . SER A  1 93  ? -22.176 -12.377 -7.892  1.00 44.77  ? 93  SER A CB  1 
ATOM   748   O OG  . SER A  1 93  ? -20.803 -12.041 -7.962  1.00 45.44  ? 93  SER A OG  1 
ATOM   749   N N   . ARG A  1 94  ? -23.691 -9.573  -7.286  1.00 46.81  ? 94  ARG A N   1 
ATOM   750   C CA  . ARG A  1 94  ? -23.606 -8.234  -6.724  1.00 47.79  ? 94  ARG A CA  1 
ATOM   751   C C   . ARG A  1 94  ? -22.292 -8.075  -5.972  1.00 49.33  ? 94  ARG A C   1 
ATOM   752   O O   . ARG A  1 94  ? -21.668 -7.016  -6.031  1.00 49.58  ? 94  ARG A O   1 
ATOM   753   C CB  . ARG A  1 94  ? -24.791 -7.974  -5.791  1.00 47.63  ? 94  ARG A CB  1 
ATOM   754   C CG  . ARG A  1 94  ? -24.720 -6.668  -5.002  1.00 48.87  ? 94  ARG A CG  1 
ATOM   755   C CD  . ARG A  1 94  ? -26.023 -6.436  -4.264  1.00 49.82  ? 94  ARG A CD  1 
ATOM   756   N NE  . ARG A  1 94  ? -26.059 -5.190  -3.504  1.00 52.68  ? 94  ARG A NE  1 
ATOM   757   C CZ  . ARG A  1 94  ? -25.683 -5.069  -2.233  1.00 54.75  ? 94  ARG A CZ  1 
ATOM   758   N NH1 . ARG A  1 94  ? -25.230 -6.124  -1.565  1.00 54.05  ? 94  ARG A NH1 1 
ATOM   759   N NH2 . ARG A  1 94  ? -25.791 -3.896  -1.618  1.00 54.96  ? 94  ARG A NH2 1 
ATOM   760   N N   . SER A  1 95  ? -21.865 -9.126  -5.275  1.00 49.18  ? 95  SER A N   1 
ATOM   761   C CA  . SER A  1 95  ? -20.611 -9.065  -4.529  1.00 50.64  ? 95  SER A CA  1 
ATOM   762   C C   . SER A  1 95  ? -19.883 -10.399 -4.575  1.00 50.83  ? 95  SER A C   1 
ATOM   763   O O   . SER A  1 95  ? -20.445 -11.405 -5.001  1.00 50.90  ? 95  SER A O   1 
ATOM   764   C CB  . SER A  1 95  ? -20.873 -8.697  -3.068  1.00 51.69  ? 95  SER A CB  1 
ATOM   765   O OG  . SER A  1 95  ? -21.356 -9.816  -2.350  1.00 54.02  ? 95  SER A OG  1 
ATOM   766   N N   . PRO A  1 96  ? -18.611 -10.421 -4.144  1.00 51.29  ? 96  PRO A N   1 
ATOM   767   C CA  . PRO A  1 96  ? -17.842 -11.670 -4.149  1.00 50.10  ? 96  PRO A CA  1 
ATOM   768   C C   . PRO A  1 96  ? -18.653 -12.800 -3.521  1.00 49.90  ? 96  PRO A C   1 
ATOM   769   O O   . PRO A  1 96  ? -19.265 -12.627 -2.465  1.00 49.02  ? 96  PRO A O   1 
ATOM   770   C CB  . PRO A  1 96  ? -16.610 -11.307 -3.331  1.00 50.02  ? 96  PRO A CB  1 
ATOM   771   C CG  . PRO A  1 96  ? -16.374 -9.887  -3.747  1.00 51.05  ? 96  PRO A CG  1 
ATOM   772   C CD  . PRO A  1 96  ? -17.769 -9.289  -3.712  1.00 51.13  ? 96  PRO A CD  1 
ATOM   773   N N   . VAL A  1 97  ? -18.659 -13.953 -4.177  1.00 49.18  ? 97  VAL A N   1 
ATOM   774   C CA  . VAL A  1 97  ? -19.409 -15.096 -3.682  1.00 50.00  ? 97  VAL A CA  1 
ATOM   775   C C   . VAL A  1 97  ? -18.663 -16.027 -2.713  1.00 50.27  ? 97  VAL A C   1 
ATOM   776   O O   . VAL A  1 97  ? -17.481 -16.328 -2.889  1.00 49.87  ? 97  VAL A O   1 
ATOM   777   C CB  . VAL A  1 97  ? -19.949 -15.928 -4.858  1.00 49.01  ? 97  VAL A CB  1 
ATOM   778   C CG1 . VAL A  1 97  ? -20.596 -17.206 -4.349  1.00 49.91  ? 97  VAL A CG1 1 
ATOM   779   C CG2 . VAL A  1 97  ? -20.961 -15.111 -5.627  1.00 49.76  ? 97  VAL A CG2 1 
ATOM   780   N N   . ASN A  1 98  ? -19.380 -16.466 -1.681  1.00 49.96  ? 98  ASN A N   1 
ATOM   781   C CA  . ASN A  1 98  ? -18.847 -17.381 -0.679  1.00 50.86  ? 98  ASN A CA  1 
ATOM   782   C C   . ASN A  1 98  ? -19.918 -18.428 -0.403  1.00 51.86  ? 98  ASN A C   1 
ATOM   783   O O   . ASN A  1 98  ? -21.078 -18.086 -0.175  1.00 52.10  ? 98  ASN A O   1 
ATOM   784   C CB  . ASN A  1 98  ? -18.514 -16.637 0.614   1.00 50.37  ? 98  ASN A CB  1 
ATOM   785   C CG  . ASN A  1 98  ? -17.348 -15.674 0.452   1.00 50.57  ? 98  ASN A CG  1 
ATOM   786   O OD1 . ASN A  1 98  ? -16.238 -16.079 0.119   1.00 50.70  ? 98  ASN A OD1 1 
ATOM   787   N ND2 . ASN A  1 98  ? -17.599 -14.392 0.691   1.00 49.98  ? 98  ASN A ND2 1 
ATOM   788   N N   . LEU A  1 99  ? -19.535 -19.701 -0.432  1.00 51.86  ? 99  LEU A N   1 
ATOM   789   C CA  . LEU A  1 99  ? -20.489 -20.781 -0.174  1.00 51.39  ? 99  LEU A CA  1 
ATOM   790   C C   . LEU A  1 99  ? -21.268 -20.574 1.123   1.00 50.28  ? 99  LEU A C   1 
ATOM   791   O O   . LEU A  1 99  ? -20.684 -20.310 2.174   1.00 51.07  ? 99  LEU A O   1 
ATOM   792   C CB  . LEU A  1 99  ? -19.767 -22.129 -0.107  1.00 51.67  ? 99  LEU A CB  1 
ATOM   793   C CG  . LEU A  1 99  ? -19.142 -22.715 -1.377  1.00 52.81  ? 99  LEU A CG  1 
ATOM   794   C CD1 . LEU A  1 99  ? -18.397 -23.994 -1.020  1.00 51.66  ? 99  LEU A CD1 1 
ATOM   795   C CD2 . LEU A  1 99  ? -20.222 -22.993 -2.415  1.00 50.66  ? 99  LEU A CD2 1 
ATOM   796   N N   . GLY A  1 100 ? -22.590 -20.677 1.036   1.00 49.21  ? 100 GLY A N   1 
ATOM   797   C CA  . GLY A  1 100 ? -23.433 -20.533 2.213   1.00 48.30  ? 100 GLY A CA  1 
ATOM   798   C C   . GLY A  1 100 ? -23.710 -19.136 2.735   1.00 46.82  ? 100 GLY A C   1 
ATOM   799   O O   . GLY A  1 100 ? -24.342 -18.987 3.780   1.00 44.56  ? 100 GLY A O   1 
ATOM   800   N N   . GLU A  1 101 ? -23.246 -18.120 2.015   1.00 47.19  ? 101 GLU A N   1 
ATOM   801   C CA  . GLU A  1 101 ? -23.443 -16.719 2.395   1.00 47.72  ? 101 GLU A CA  1 
ATOM   802   C C   . GLU A  1 101 ? -24.408 -16.072 1.402   1.00 44.82  ? 101 GLU A C   1 
ATOM   803   O O   . GLU A  1 101 ? -24.119 -16.010 0.214   1.00 42.96  ? 101 GLU A O   1 
ATOM   804   C CB  . GLU A  1 101 ? -22.092 -15.985 2.364   1.00 51.15  ? 101 GLU A CB  1 
ATOM   805   C CG  . GLU A  1 101 ? -22.150 -14.482 2.651   1.00 56.51  ? 101 GLU A CG  1 
ATOM   806   C CD  . GLU A  1 101 ? -20.799 -13.781 2.446   1.00 60.28  ? 101 GLU A CD  1 
ATOM   807   O OE1 . GLU A  1 101 ? -20.438 -13.486 1.280   1.00 57.36  ? 101 GLU A OE1 1 
ATOM   808   O OE2 . GLU A  1 101 ? -20.094 -13.535 3.456   1.00 62.38  ? 101 GLU A OE2 1 
ATOM   809   N N   . PRO A  1 102 ? -25.563 -15.575 1.879   1.00 45.65  ? 102 PRO A N   1 
ATOM   810   C CA  . PRO A  1 102 ? -26.566 -14.933 1.013   1.00 43.96  ? 102 PRO A CA  1 
ATOM   811   C C   . PRO A  1 102 ? -25.946 -13.923 0.058   1.00 43.08  ? 102 PRO A C   1 
ATOM   812   O O   . PRO A  1 102 ? -25.057 -13.158 0.436   1.00 43.43  ? 102 PRO A O   1 
ATOM   813   C CB  . PRO A  1 102 ? -27.505 -14.268 2.007   1.00 42.69  ? 102 PRO A CB  1 
ATOM   814   C CG  . PRO A  1 102 ? -27.457 -15.203 3.167   1.00 46.10  ? 102 PRO A CG  1 
ATOM   815   C CD  . PRO A  1 102 ? -25.971 -15.480 3.293   1.00 45.82  ? 102 PRO A CD  1 
ATOM   816   N N   . ASN A  1 103 ? -26.417 -13.924 -1.181  1.00 41.94  ? 103 ASN A N   1 
ATOM   817   C CA  . ASN A  1 103 ? -25.894 -13.015 -2.180  1.00 41.61  ? 103 ASN A CA  1 
ATOM   818   C C   . ASN A  1 103 ? -26.987 -12.642 -3.172  1.00 42.38  ? 103 ASN A C   1 
ATOM   819   O O   . ASN A  1 103 ? -28.165 -12.911 -2.942  1.00 43.59  ? 103 ASN A O   1 
ATOM   820   C CB  . ASN A  1 103 ? -24.719 -13.661 -2.917  1.00 41.98  ? 103 ASN A CB  1 
ATOM   821   C CG  . ASN A  1 103 ? -23.710 -12.647 -3.396  1.00 41.37  ? 103 ASN A CG  1 
ATOM   822   O OD1 . ASN A  1 103 ? -24.068 -11.632 -3.991  1.00 42.34  ? 103 ASN A OD1 1 
ATOM   823   N ND2 . ASN A  1 103 ? -22.440 -12.914 -3.140  1.00 43.57  ? 103 ASN A ND2 1 
ATOM   824   N N   . ILE A  1 104 ? -26.593 -12.037 -4.286  1.00 41.63  ? 104 ILE A N   1 
ATOM   825   C CA  . ILE A  1 104 ? -27.557 -11.609 -5.286  1.00 40.94  ? 104 ILE A CA  1 
ATOM   826   C C   . ILE A  1 104 ? -27.020 -11.720 -6.708  1.00 40.01  ? 104 ILE A C   1 
ATOM   827   O O   . ILE A  1 104 ? -25.870 -11.383 -6.976  1.00 40.45  ? 104 ILE A O   1 
ATOM   828   C CB  . ILE A  1 104 ? -27.978 -10.150 -5.015  1.00 42.15  ? 104 ILE A CB  1 
ATOM   829   C CG1 . ILE A  1 104 ? -28.684 -10.058 -3.656  1.00 42.46  ? 104 ILE A CG1 1 
ATOM   830   C CG2 . ILE A  1 104 ? -28.876 -9.656  -6.114  1.00 40.57  ? 104 ILE A CG2 1 
ATOM   831   C CD1 . ILE A  1 104 ? -28.960 -8.638  -3.189  1.00 43.28  ? 104 ILE A CD1 1 
ATOM   832   N N   . LEU A  1 105 ? -27.852 -12.218 -7.614  1.00 38.51  ? 105 LEU A N   1 
ATOM   833   C CA  . LEU A  1 105 ? -27.451 -12.340 -9.006  1.00 39.08  ? 105 LEU A CA  1 
ATOM   834   C C   . LEU A  1 105 ? -28.041 -11.167 -9.767  1.00 39.28  ? 105 LEU A C   1 
ATOM   835   O O   . LEU A  1 105 ? -29.237 -10.884 -9.660  1.00 39.12  ? 105 LEU A O   1 
ATOM   836   C CB  . LEU A  1 105 ? -27.933 -13.658 -9.619  1.00 37.20  ? 105 LEU A CB  1 
ATOM   837   C CG  . LEU A  1 105 ? -26.953 -14.830 -9.495  1.00 39.99  ? 105 LEU A CG  1 
ATOM   838   C CD1 . LEU A  1 105 ? -27.496 -16.049 -10.237 1.00 40.25  ? 105 LEU A CD1 1 
ATOM   839   C CD2 . LEU A  1 105 ? -25.607 -14.434 -10.072 1.00 40.46  ? 105 LEU A CD2 1 
ATOM   840   N N   . ILE A  1 106 ? -27.188 -10.487 -10.525 1.00 39.61  ? 106 ILE A N   1 
ATOM   841   C CA  . ILE A  1 106 ? -27.596 -9.329  -11.302 1.00 40.54  ? 106 ILE A CA  1 
ATOM   842   C C   . ILE A  1 106 ? -27.666 -9.629  -12.785 1.00 41.17  ? 106 ILE A C   1 
ATOM   843   O O   . ILE A  1 106 ? -26.675 -10.059 -13.378 1.00 42.17  ? 106 ILE A O   1 
ATOM   844   C CB  . ILE A  1 106 ? -26.600 -8.170  -11.146 1.00 42.35  ? 106 ILE A CB  1 
ATOM   845   C CG1 . ILE A  1 106 ? -26.524 -7.736  -9.682  1.00 40.26  ? 106 ILE A CG1 1 
ATOM   846   C CG2 . ILE A  1 106 ? -27.011 -6.994  -12.054 1.00 41.04  ? 106 ILE A CG2 1 
ATOM   847   C CD1 . ILE A  1 106 ? -25.508 -6.648  -9.457  1.00 41.01  ? 106 ILE A CD1 1 
ATOM   848   N N   . CYS A  1 107 ? -28.836 -9.416  -13.377 1.00 40.59  ? 107 CYS A N   1 
ATOM   849   C CA  . CYS A  1 107 ? -28.983 -9.604  -14.810 1.00 39.49  ? 107 CYS A CA  1 
ATOM   850   C C   . CYS A  1 107 ? -29.051 -8.199  -15.399 1.00 39.45  ? 107 CYS A C   1 
ATOM   851   O O   . CYS A  1 107 ? -30.073 -7.516  -15.281 1.00 38.22  ? 107 CYS A O   1 
ATOM   852   C CB  . CYS A  1 107 ? -30.261 -10.354 -15.156 1.00 40.99  ? 107 CYS A CB  1 
ATOM   853   S SG  . CYS A  1 107 ? -30.270 -10.880 -16.899 1.00 45.87  ? 107 CYS A SG  1 
ATOM   854   N N   . PHE A  1 108 ? -27.953 -7.767  -16.011 1.00 37.96  ? 108 PHE A N   1 
ATOM   855   C CA  . PHE A  1 108 ? -27.876 -6.441  -16.612 1.00 38.41  ? 108 PHE A CA  1 
ATOM   856   C C   . PHE A  1 108 ? -28.228 -6.474  -18.102 1.00 37.78  ? 108 PHE A C   1 
ATOM   857   O O   . PHE A  1 108 ? -27.485 -7.034  -18.917 1.00 38.51  ? 108 PHE A O   1 
ATOM   858   C CB  . PHE A  1 108 ? -26.472 -5.847  -16.401 1.00 38.73  ? 108 PHE A CB  1 
ATOM   859   C CG  . PHE A  1 108 ? -26.309 -4.462  -16.964 1.00 38.64  ? 108 PHE A CG  1 
ATOM   860   C CD1 . PHE A  1 108 ? -27.296 -3.493  -16.762 1.00 38.02  ? 108 PHE A CD1 1 
ATOM   861   C CD2 . PHE A  1 108 ? -25.179 -4.125  -17.707 1.00 37.78  ? 108 PHE A CD2 1 
ATOM   862   C CE1 . PHE A  1 108 ? -27.160 -2.201  -17.297 1.00 34.83  ? 108 PHE A CE1 1 
ATOM   863   C CE2 . PHE A  1 108 ? -25.034 -2.843  -18.244 1.00 36.13  ? 108 PHE A CE2 1 
ATOM   864   C CZ  . PHE A  1 108 ? -26.034 -1.879  -18.037 1.00 34.66  ? 108 PHE A CZ  1 
ATOM   865   N N   . ILE A  1 109 ? -29.368 -5.877  -18.442 1.00 35.68  ? 109 ILE A N   1 
ATOM   866   C CA  . ILE A  1 109 ? -29.857 -5.830  -19.822 1.00 34.62  ? 109 ILE A CA  1 
ATOM   867   C C   . ILE A  1 109 ? -29.610 -4.418  -20.348 1.00 35.67  ? 109 ILE A C   1 
ATOM   868   O O   . ILE A  1 109 ? -30.212 -3.443  -19.888 1.00 35.57  ? 109 ILE A O   1 
ATOM   869   C CB  . ILE A  1 109 ? -31.346 -6.164  -19.859 1.00 34.99  ? 109 ILE A CB  1 
ATOM   870   C CG1 . ILE A  1 109 ? -31.596 -7.416  -19.019 1.00 33.20  ? 109 ILE A CG1 1 
ATOM   871   C CG2 . ILE A  1 109 ? -31.793 -6.414  -21.275 1.00 34.77  ? 109 ILE A CG2 1 
ATOM   872   C CD1 . ILE A  1 109 ? -33.025 -7.574  -18.623 1.00 34.23  ? 109 ILE A CD1 1 
ATOM   873   N N   . ASP A  1 110 ? -28.739 -4.312  -21.339 1.00 35.37  ? 110 ASP A N   1 
ATOM   874   C CA  . ASP A  1 110 ? -28.355 -3.002  -21.826 1.00 37.58  ? 110 ASP A CA  1 
ATOM   875   C C   . ASP A  1 110 ? -28.527 -2.707  -23.326 1.00 36.91  ? 110 ASP A C   1 
ATOM   876   O O   . ASP A  1 110 ? -28.627 -3.616  -24.150 1.00 33.83  ? 110 ASP A O   1 
ATOM   877   C CB  . ASP A  1 110 ? -26.899 -2.799  -21.392 1.00 39.78  ? 110 ASP A CB  1 
ATOM   878   C CG  . ASP A  1 110 ? -26.460 -1.364  -21.439 1.00 43.75  ? 110 ASP A CG  1 
ATOM   879   O OD1 . ASP A  1 110 ? -27.283 -0.457  -21.188 1.00 46.91  ? 110 ASP A OD1 1 
ATOM   880   O OD2 . ASP A  1 110 ? -25.267 -1.147  -21.706 1.00 48.22  ? 110 ASP A OD2 1 
ATOM   881   N N   . LYS A  1 111 ? -28.583 -1.415  -23.650 1.00 37.73  ? 111 LYS A N   1 
ATOM   882   C CA  . LYS A  1 111 ? -28.690 -0.916  -25.029 1.00 36.76  ? 111 LYS A CA  1 
ATOM   883   C C   . LYS A  1 111 ? -29.815 -1.500  -25.863 1.00 36.55  ? 111 LYS A C   1 
ATOM   884   O O   . LYS A  1 111 ? -29.548 -2.141  -26.880 1.00 36.86  ? 111 LYS A O   1 
ATOM   885   C CB  . LYS A  1 111 ? -27.388 -1.173  -25.788 1.00 37.49  ? 111 LYS A CB  1 
ATOM   886   C CG  . LYS A  1 111 ? -26.126 -0.793  -25.065 1.00 43.82  ? 111 LYS A CG  1 
ATOM   887   C CD  . LYS A  1 111 ? -24.896 -1.210  -25.876 1.00 47.88  ? 111 LYS A CD  1 
ATOM   888   C CE  . LYS A  1 111 ? -23.601 -0.804  -25.166 1.00 51.97  ? 111 LYS A CE  1 
ATOM   889   N NZ  . LYS A  1 111 ? -22.367 -1.065  -25.972 1.00 52.69  ? 111 LYS A NZ  1 
ATOM   890   N N   . PHE A  1 112 ? -31.063 -1.289  -25.464 1.00 34.13  ? 112 PHE A N   1 
ATOM   891   C CA  . PHE A  1 112 ? -32.163 -1.823  -26.254 1.00 31.73  ? 112 PHE A CA  1 
ATOM   892   C C   . PHE A  1 112 ? -33.322 -0.851  -26.354 1.00 32.05  ? 112 PHE A C   1 
ATOM   893   O O   . PHE A  1 112 ? -33.400 0.113   -25.593 1.00 31.30  ? 112 PHE A O   1 
ATOM   894   C CB  . PHE A  1 112 ? -32.671 -3.145  -25.664 1.00 31.25  ? 112 PHE A CB  1 
ATOM   895   C CG  . PHE A  1 112 ? -33.209 -3.020  -24.265 1.00 30.21  ? 112 PHE A CG  1 
ATOM   896   C CD1 . PHE A  1 112 ? -32.342 -3.001  -23.169 1.00 27.34  ? 112 PHE A CD1 1 
ATOM   897   C CD2 . PHE A  1 112 ? -34.577 -2.873  -24.047 1.00 27.98  ? 112 PHE A CD2 1 
ATOM   898   C CE1 . PHE A  1 112 ? -32.825 -2.831  -21.889 1.00 27.23  ? 112 PHE A CE1 1 
ATOM   899   C CE2 . PHE A  1 112 ? -35.076 -2.707  -22.767 1.00 28.36  ? 112 PHE A CE2 1 
ATOM   900   C CZ  . PHE A  1 112 ? -34.200 -2.684  -21.679 1.00 28.70  ? 112 PHE A CZ  1 
ATOM   901   N N   . SER A  1 113 ? -34.209 -1.121  -27.313 1.00 31.20  ? 113 SER A N   1 
ATOM   902   C CA  . SER A  1 113 ? -35.417 -0.329  -27.548 1.00 29.50  ? 113 SER A CA  1 
ATOM   903   C C   . SER A  1 113 ? -36.266 -1.095  -28.565 1.00 30.02  ? 113 SER A C   1 
ATOM   904   O O   . SER A  1 113 ? -35.721 -1.747  -29.454 1.00 33.40  ? 113 SER A O   1 
ATOM   905   C CB  . SER A  1 113 ? -35.062 1.052   -28.095 1.00 29.36  ? 113 SER A CB  1 
ATOM   906   O OG  . SER A  1 113 ? -36.179 1.918   -27.995 1.00 28.31  ? 113 SER A OG  1 
ATOM   907   N N   . PRO A  1 114 ? -37.602 -1.030  -28.460 1.00 27.98  ? 114 PRO A N   1 
ATOM   908   C CA  . PRO A  1 114 ? -38.412 -0.301  -27.478 1.00 30.11  ? 114 PRO A CA  1 
ATOM   909   C C   . PRO A  1 114 ? -38.171 -0.808  -26.063 1.00 31.52  ? 114 PRO A C   1 
ATOM   910   O O   . PRO A  1 114 ? -37.504 -1.827  -25.869 1.00 33.24  ? 114 PRO A O   1 
ATOM   911   C CB  . PRO A  1 114 ? -39.846 -0.559  -27.950 1.00 29.57  ? 114 PRO A CB  1 
ATOM   912   C CG  . PRO A  1 114 ? -39.751 -1.945  -28.538 1.00 24.37  ? 114 PRO A CG  1 
ATOM   913   C CD  . PRO A  1 114 ? -38.454 -1.885  -29.311 1.00 27.31  ? 114 PRO A CD  1 
ATOM   914   N N   . PRO A  1 115 ? -38.698 -0.088  -25.056 1.00 32.48  ? 115 PRO A N   1 
ATOM   915   C CA  . PRO A  1 115 ? -38.559 -0.442  -23.645 1.00 32.49  ? 115 PRO A CA  1 
ATOM   916   C C   . PRO A  1 115 ? -39.570 -1.477  -23.141 1.00 35.14  ? 115 PRO A C   1 
ATOM   917   O O   . PRO A  1 115 ? -40.515 -1.134  -22.433 1.00 36.88  ? 115 PRO A O   1 
ATOM   918   C CB  . PRO A  1 115 ? -38.716 0.897   -22.952 1.00 31.58  ? 115 PRO A CB  1 
ATOM   919   C CG  . PRO A  1 115 ? -39.740 1.569   -23.804 1.00 31.46  ? 115 PRO A CG  1 
ATOM   920   C CD  . PRO A  1 115 ? -39.248 1.276   -25.194 1.00 32.15  ? 115 PRO A CD  1 
ATOM   921   N N   . VAL A  1 116 ? -39.365 -2.735  -23.525 1.00 35.85  ? 116 VAL A N   1 
ATOM   922   C CA  . VAL A  1 116 ? -40.201 -3.862  -23.103 1.00 37.28  ? 116 VAL A CA  1 
ATOM   923   C C   . VAL A  1 116 ? -39.369 -5.120  -23.240 1.00 38.43  ? 116 VAL A C   1 
ATOM   924   O O   . VAL A  1 116 ? -38.695 -5.317  -24.242 1.00 39.05  ? 116 VAL A O   1 
ATOM   925   C CB  . VAL A  1 116 ? -41.465 -4.076  -23.974 1.00 37.34  ? 116 VAL A CB  1 
ATOM   926   C CG1 . VAL A  1 116 ? -42.572 -3.140  -23.529 1.00 39.60  ? 116 VAL A CG1 1 
ATOM   927   C CG2 . VAL A  1 116 ? -41.131 -3.877  -25.448 1.00 36.79  ? 116 VAL A CG2 1 
ATOM   928   N N   . VAL A  1 117 ? -39.400 -5.968  -22.225 1.00 39.42  ? 117 VAL A N   1 
ATOM   929   C CA  . VAL A  1 117 ? -38.645 -7.206  -22.283 1.00 43.30  ? 117 VAL A CA  1 
ATOM   930   C C   . VAL A  1 117 ? -39.278 -8.259  -21.397 1.00 45.28  ? 117 VAL A C   1 
ATOM   931   O O   . VAL A  1 117 ? -40.156 -7.961  -20.592 1.00 46.50  ? 117 VAL A O   1 
ATOM   932   C CB  . VAL A  1 117 ? -37.175 -7.008  -21.838 1.00 42.69  ? 117 VAL A CB  1 
ATOM   933   C CG1 . VAL A  1 117 ? -36.389 -6.300  -22.919 1.00 44.31  ? 117 VAL A CG1 1 
ATOM   934   C CG2 . VAL A  1 117 ? -37.129 -6.203  -20.550 1.00 43.17  ? 117 VAL A CG2 1 
ATOM   935   N N   . ASN A  1 118 ? -38.844 -9.497  -21.581 1.00 46.78  ? 118 ASN A N   1 
ATOM   936   C CA  . ASN A  1 118 ? -39.324 -10.606 -20.779 1.00 47.52  ? 118 ASN A CA  1 
ATOM   937   C C   . ASN A  1 118 ? -38.042 -11.248 -20.272 1.00 47.22  ? 118 ASN A C   1 
ATOM   938   O O   . ASN A  1 118 ? -37.228 -11.737 -21.062 1.00 44.83  ? 118 ASN A O   1 
ATOM   939   C CB  . ASN A  1 118 ? -40.139 -11.590 -21.623 1.00 50.37  ? 118 ASN A CB  1 
ATOM   940   C CG  . ASN A  1 118 ? -41.443 -10.988 -22.107 1.00 54.64  ? 118 ASN A CG  1 
ATOM   941   O OD1 . ASN A  1 118 ? -41.976 -10.066 -21.494 1.00 54.21  ? 118 ASN A OD1 1 
ATOM   942   N ND2 . ASN A  1 118 ? -41.980 -11.520 -23.192 1.00 60.98  ? 118 ASN A ND2 1 
ATOM   943   N N   . VAL A  1 119 ? -37.857 -11.188 -18.953 1.00 45.20  ? 119 VAL A N   1 
ATOM   944   C CA  . VAL A  1 119 ? -36.693 -11.742 -18.287 1.00 43.44  ? 119 VAL A CA  1 
ATOM   945   C C   . VAL A  1 119 ? -37.115 -12.921 -17.424 1.00 43.79  ? 119 VAL A C   1 
ATOM   946   O O   . VAL A  1 119 ? -38.059 -12.832 -16.638 1.00 43.24  ? 119 VAL A O   1 
ATOM   947   C CB  . VAL A  1 119 ? -36.007 -10.676 -17.404 1.00 44.06  ? 119 VAL A CB  1 
ATOM   948   C CG1 . VAL A  1 119 ? -34.720 -11.228 -16.812 1.00 43.08  ? 119 VAL A CG1 1 
ATOM   949   C CG2 . VAL A  1 119 ? -35.721 -9.436  -18.231 1.00 43.84  ? 119 VAL A CG2 1 
ATOM   950   N N   . THR A  1 120 ? -36.417 -14.036 -17.591 1.00 44.89  ? 120 THR A N   1 
ATOM   951   C CA  . THR A  1 120 ? -36.714 -15.232 -16.825 1.00 46.41  ? 120 THR A CA  1 
ATOM   952   C C   . THR A  1 120 ? -35.443 -15.731 -16.145 1.00 46.34  ? 120 THR A C   1 
ATOM   953   O O   . THR A  1 120 ? -34.390 -15.874 -16.774 1.00 46.18  ? 120 THR A O   1 
ATOM   954   C CB  . THR A  1 120 ? -37.309 -16.341 -17.741 1.00 49.72  ? 120 THR A CB  1 
ATOM   955   O OG1 . THR A  1 120 ? -38.614 -15.940 -18.195 1.00 50.49  ? 120 THR A OG1 1 
ATOM   956   C CG2 . THR A  1 120 ? -37.426 -17.664 -16.989 1.00 50.24  ? 120 THR A CG2 1 
ATOM   957   N N   . TRP A  1 121 ? -35.545 -15.959 -14.842 1.00 45.96  ? 121 TRP A N   1 
ATOM   958   C CA  . TRP A  1 121 ? -34.422 -16.452 -14.055 1.00 44.06  ? 121 TRP A CA  1 
ATOM   959   C C   . TRP A  1 121 ? -34.571 -17.961 -14.016 1.00 44.83  ? 121 TRP A C   1 
ATOM   960   O O   . TRP A  1 121 ? -35.680 -18.469 -13.907 1.00 44.45  ? 121 TRP A O   1 
ATOM   961   C CB  . TRP A  1 121 ? -34.487 -15.894 -12.630 1.00 40.97  ? 121 TRP A CB  1 
ATOM   962   C CG  . TRP A  1 121 ? -33.923 -14.515 -12.451 1.00 36.40  ? 121 TRP A CG  1 
ATOM   963   C CD1 . TRP A  1 121 ? -34.604 -13.385 -12.072 1.00 35.06  ? 121 TRP A CD1 1 
ATOM   964   C CD2 . TRP A  1 121 ? -32.548 -14.145 -12.525 1.00 31.75  ? 121 TRP A CD2 1 
ATOM   965   N NE1 . TRP A  1 121 ? -33.730 -12.343 -11.891 1.00 31.75  ? 121 TRP A NE1 1 
ATOM   966   C CE2 . TRP A  1 121 ? -32.461 -12.779 -12.163 1.00 31.16  ? 121 TRP A CE2 1 
ATOM   967   C CE3 . TRP A  1 121 ? -31.379 -14.834 -12.856 1.00 31.69  ? 121 TRP A CE3 1 
ATOM   968   C CZ2 . TRP A  1 121 ? -31.247 -12.090 -12.121 1.00 30.35  ? 121 TRP A CZ2 1 
ATOM   969   C CZ3 . TRP A  1 121 ? -30.164 -14.148 -12.815 1.00 31.69  ? 121 TRP A CZ3 1 
ATOM   970   C CH2 . TRP A  1 121 ? -30.111 -12.787 -12.448 1.00 31.58  ? 121 TRP A CH2 1 
ATOM   971   N N   . LEU A  1 122 ? -33.460 -18.678 -14.100 1.00 47.95  ? 122 LEU A N   1 
ATOM   972   C CA  . LEU A  1 122 ? -33.507 -20.127 -14.087 1.00 50.56  ? 122 LEU A CA  1 
ATOM   973   C C   . LEU A  1 122 ? -32.449 -20.715 -13.183 1.00 53.06  ? 122 LEU A C   1 
ATOM   974   O O   . LEU A  1 122 ? -31.257 -20.442 -13.342 1.00 52.39  ? 122 LEU A O   1 
ATOM   975   C CB  . LEU A  1 122 ? -33.310 -20.670 -15.500 1.00 53.59  ? 122 LEU A CB  1 
ATOM   976   C CG  . LEU A  1 122 ? -34.403 -20.356 -16.520 1.00 54.70  ? 122 LEU A CG  1 
ATOM   977   C CD1 . LEU A  1 122 ? -33.815 -20.416 -17.912 1.00 55.83  ? 122 LEU A CD1 1 
ATOM   978   C CD2 . LEU A  1 122 ? -35.561 -21.341 -16.364 1.00 56.74  ? 122 LEU A CD2 1 
ATOM   979   N N   . ARG A  1 123 ? -32.903 -21.534 -12.240 1.00 56.11  ? 123 ARG A N   1 
ATOM   980   C CA  . ARG A  1 123 ? -32.029 -22.211 -11.291 1.00 57.72  ? 123 ARG A CA  1 
ATOM   981   C C   . ARG A  1 123 ? -32.040 -23.699 -11.633 1.00 58.96  ? 123 ARG A C   1 
ATOM   982   O O   . ARG A  1 123 ? -33.089 -24.349 -11.604 1.00 57.78  ? 123 ARG A O   1 
ATOM   983   C CB  . ARG A  1 123 ? -32.540 -21.998 -9.862  1.00 58.99  ? 123 ARG A CB  1 
ATOM   984   C CG  . ARG A  1 123 ? -31.847 -22.844 -8.799  1.00 60.87  ? 123 ARG A CG  1 
ATOM   985   C CD  . ARG A  1 123 ? -32.581 -22.726 -7.466  1.00 63.13  ? 123 ARG A CD  1 
ATOM   986   N NE  . ARG A  1 123 ? -32.481 -21.381 -6.909  1.00 64.23  ? 123 ARG A NE  1 
ATOM   987   C CZ  . ARG A  1 123 ? -33.473 -20.755 -6.284  1.00 66.56  ? 123 ARG A CZ  1 
ATOM   988   N NH1 . ARG A  1 123 ? -34.651 -21.352 -6.134  1.00 65.46  ? 123 ARG A NH1 1 
ATOM   989   N NH2 . ARG A  1 123 ? -33.285 -19.527 -5.805  1.00 68.43  ? 123 ARG A NH2 1 
ATOM   990   N N   . ASN A  1 124 ? -30.870 -24.226 -11.969 1.00 60.17  ? 124 ASN A N   1 
ATOM   991   C CA  . ASN A  1 124 ? -30.733 -25.633 -12.321 1.00 61.96  ? 124 ASN A CA  1 
ATOM   992   C C   . ASN A  1 124 ? -31.545 -25.983 -13.554 1.00 63.69  ? 124 ASN A C   1 
ATOM   993   O O   . ASN A  1 124 ? -31.690 -27.155 -13.883 1.00 64.31  ? 124 ASN A O   1 
ATOM   994   C CB  . ASN A  1 124 ? -31.185 -26.530 -11.171 1.00 62.27  ? 124 ASN A CB  1 
ATOM   995   C CG  . ASN A  1 124 ? -30.463 -26.232 -9.885  1.00 62.87  ? 124 ASN A CG  1 
ATOM   996   O OD1 . ASN A  1 124 ? -29.229 -26.195 -9.843  1.00 61.76  ? 124 ASN A OD1 1 
ATOM   997   N ND2 . ASN A  1 124 ? -31.227 -26.024 -8.818  1.00 63.65  ? 124 ASN A ND2 1 
ATOM   998   N N   . GLY A  1 125 ? -32.087 -24.971 -14.224 1.00 65.02  ? 125 GLY A N   1 
ATOM   999   C CA  . GLY A  1 125 ? -32.872 -25.219 -15.421 1.00 64.62  ? 125 GLY A CA  1 
ATOM   1000  C C   . GLY A  1 125 ? -34.368 -25.057 -15.232 1.00 65.07  ? 125 GLY A C   1 
ATOM   1001  O O   . GLY A  1 125 ? -35.143 -25.270 -16.165 1.00 64.92  ? 125 GLY A O   1 
ATOM   1002  N N   . ARG A  1 126 ? -34.777 -24.686 -14.025 1.00 65.54  ? 126 ARG A N   1 
ATOM   1003  C CA  . ARG A  1 126 ? -36.189 -24.488 -13.718 1.00 67.07  ? 126 ARG A CA  1 
ATOM   1004  C C   . ARG A  1 126 ? -36.453 -23.018 -13.395 1.00 66.94  ? 126 ARG A C   1 
ATOM   1005  O O   . ARG A  1 126 ? -35.611 -22.343 -12.798 1.00 67.78  ? 126 ARG A O   1 
ATOM   1006  C CB  . ARG A  1 126 ? -36.597 -25.373 -12.531 1.00 69.06  ? 126 ARG A CB  1 
ATOM   1007  C CG  . ARG A  1 126 ? -37.627 -24.748 -11.592 1.00 73.39  ? 126 ARG A CG  1 
ATOM   1008  C CD  . ARG A  1 126 ? -38.028 -25.690 -10.454 1.00 76.73  ? 126 ARG A CD  1 
ATOM   1009  N NE  . ARG A  1 126 ? -38.885 -26.772 -10.929 1.00 81.03  ? 126 ARG A NE  1 
ATOM   1010  C CZ  . ARG A  1 126 ? -40.099 -26.593 -11.447 1.00 83.22  ? 126 ARG A CZ  1 
ATOM   1011  N NH1 . ARG A  1 126 ? -40.605 -25.371 -11.552 1.00 83.62  ? 126 ARG A NH1 1 
ATOM   1012  N NH2 . ARG A  1 126 ? -40.806 -27.635 -11.876 1.00 84.04  ? 126 ARG A NH2 1 
ATOM   1013  N N   . PRO A  1 127 ? -37.621 -22.500 -13.806 1.00 65.13  ? 127 PRO A N   1 
ATOM   1014  C CA  . PRO A  1 127 ? -37.966 -21.104 -13.540 1.00 63.84  ? 127 PRO A CA  1 
ATOM   1015  C C   . PRO A  1 127 ? -37.939 -20.775 -12.043 1.00 63.24  ? 127 PRO A C   1 
ATOM   1016  O O   . PRO A  1 127 ? -38.188 -21.635 -11.198 1.00 63.90  ? 127 PRO A O   1 
ATOM   1017  C CB  . PRO A  1 127 ? -39.359 -20.983 -14.148 1.00 64.22  ? 127 PRO A CB  1 
ATOM   1018  C CG  . PRO A  1 127 ? -39.261 -21.879 -15.335 1.00 63.32  ? 127 PRO A CG  1 
ATOM   1019  C CD  . PRO A  1 127 ? -38.576 -23.097 -14.757 1.00 65.34  ? 127 PRO A CD  1 
ATOM   1020  N N   . VAL A  1 128 ? -37.630 -19.522 -11.728 1.00 62.09  ? 128 VAL A N   1 
ATOM   1021  C CA  . VAL A  1 128 ? -37.558 -19.055 -10.349 1.00 59.70  ? 128 VAL A CA  1 
ATOM   1022  C C   . VAL A  1 128 ? -38.350 -17.755 -10.236 1.00 58.96  ? 128 VAL A C   1 
ATOM   1023  O O   . VAL A  1 128 ? -37.975 -16.740 -10.819 1.00 58.96  ? 128 VAL A O   1 
ATOM   1024  C CB  . VAL A  1 128 ? -36.098 -18.777 -9.945  1.00 59.57  ? 128 VAL A CB  1 
ATOM   1025  C CG1 . VAL A  1 128 ? -36.001 -18.518 -8.446  1.00 59.70  ? 128 VAL A CG1 1 
ATOM   1026  C CG2 . VAL A  1 128 ? -35.223 -19.936 -10.355 1.00 58.97  ? 128 VAL A CG2 1 
ATOM   1027  N N   . THR A  1 129 ? -39.439 -17.779 -9.482  1.00 57.55  ? 129 THR A N   1 
ATOM   1028  C CA  . THR A  1 129 ? -40.262 -16.587 -9.326  1.00 56.12  ? 129 THR A CA  1 
ATOM   1029  C C   . THR A  1 129 ? -40.249 -16.061 -7.902  1.00 54.48  ? 129 THR A C   1 
ATOM   1030  O O   . THR A  1 129 ? -40.955 -15.107 -7.584  1.00 55.28  ? 129 THR A O   1 
ATOM   1031  C CB  . THR A  1 129 ? -41.711 -16.879 -9.698  1.00 56.81  ? 129 THR A CB  1 
ATOM   1032  O OG1 . THR A  1 129 ? -42.212 -17.918 -8.847  1.00 56.46  ? 129 THR A OG1 1 
ATOM   1033  C CG2 . THR A  1 129 ? -41.802 -17.324 -11.146 1.00 57.07  ? 129 THR A CG2 1 
ATOM   1034  N N   . GLU A  1 130 ? -39.462 -16.700 -7.045  1.00 53.04  ? 130 GLU A N   1 
ATOM   1035  C CA  . GLU A  1 130 ? -39.365 -16.295 -5.649  1.00 51.60  ? 130 GLU A CA  1 
ATOM   1036  C C   . GLU A  1 130 ? -38.016 -15.638 -5.416  1.00 47.94  ? 130 GLU A C   1 
ATOM   1037  O O   . GLU A  1 130 ? -36.987 -16.182 -5.805  1.00 46.39  ? 130 GLU A O   1 
ATOM   1038  C CB  . GLU A  1 130 ? -39.501 -17.517 -4.730  1.00 54.70  ? 130 GLU A CB  1 
ATOM   1039  C CG  . GLU A  1 130 ? -40.769 -18.353 -4.937  1.00 60.11  ? 130 GLU A CG  1 
ATOM   1040  C CD  . GLU A  1 130 ? -42.030 -17.685 -4.393  1.00 65.16  ? 130 GLU A CD  1 
ATOM   1041  O OE1 . GLU A  1 130 ? -42.421 -16.610 -4.912  1.00 65.90  ? 130 GLU A OE1 1 
ATOM   1042  O OE2 . GLU A  1 130 ? -42.633 -18.241 -3.442  1.00 66.79  ? 130 GLU A OE2 1 
ATOM   1043  N N   . GLY A  1 131 ? -38.024 -14.467 -4.786  1.00 45.70  ? 131 GLY A N   1 
ATOM   1044  C CA  . GLY A  1 131 ? -36.777 -13.780 -4.506  1.00 42.79  ? 131 GLY A CA  1 
ATOM   1045  C C   . GLY A  1 131 ? -36.224 -13.028 -5.702  1.00 42.20  ? 131 GLY A C   1 
ATOM   1046  O O   . GLY A  1 131 ? -35.014 -12.798 -5.814  1.00 42.80  ? 131 GLY A O   1 
ATOM   1047  N N   . VAL A  1 132 ? -37.111 -12.647 -6.608  1.00 40.66  ? 132 VAL A N   1 
ATOM   1048  C CA  . VAL A  1 132 ? -36.700 -11.914 -7.792  1.00 40.50  ? 132 VAL A CA  1 
ATOM   1049  C C   . VAL A  1 132 ? -37.254 -10.502 -7.744  1.00 38.66  ? 132 VAL A C   1 
ATOM   1050  O O   . VAL A  1 132 ? -38.312 -10.263 -7.161  1.00 36.87  ? 132 VAL A O   1 
ATOM   1051  C CB  . VAL A  1 132 ? -37.190 -12.615 -9.092  1.00 41.53  ? 132 VAL A CB  1 
ATOM   1052  C CG1 . VAL A  1 132 ? -36.534 -13.977 -9.219  1.00 41.87  ? 132 VAL A CG1 1 
ATOM   1053  C CG2 . VAL A  1 132 ? -38.705 -12.746 -9.083  1.00 38.61  ? 132 VAL A CG2 1 
ATOM   1054  N N   . SER A  1 133 ? -36.522 -9.567  -8.343  1.00 37.38  ? 133 SER A N   1 
ATOM   1055  C CA  . SER A  1 133 ? -36.951 -8.170  -8.391  1.00 37.41  ? 133 SER A CA  1 
ATOM   1056  C C   . SER A  1 133 ? -36.345 -7.475  -9.603  1.00 37.02  ? 133 SER A C   1 
ATOM   1057  O O   . SER A  1 133 ? -35.430 -7.998  -10.249 1.00 36.49  ? 133 SER A O   1 
ATOM   1058  C CB  . SER A  1 133 ? -36.566 -7.432  -7.106  1.00 33.89  ? 133 SER A CB  1 
ATOM   1059  O OG  . SER A  1 133 ? -35.186 -7.580  -6.827  1.00 33.03  ? 133 SER A OG  1 
ATOM   1060  N N   . GLU A  1 134 ? -36.845 -6.285  -9.902  1.00 37.23  ? 134 GLU A N   1 
ATOM   1061  C CA  . GLU A  1 134 ? -36.371 -5.561  -11.069 1.00 37.44  ? 134 GLU A CA  1 
ATOM   1062  C C   . GLU A  1 134 ? -36.526 -4.050  -10.960 1.00 35.74  ? 134 GLU A C   1 
ATOM   1063  O O   . GLU A  1 134 ? -37.251 -3.528  -10.109 1.00 37.29  ? 134 GLU A O   1 
ATOM   1064  C CB  . GLU A  1 134 ? -37.138 -6.049  -12.306 1.00 39.49  ? 134 GLU A CB  1 
ATOM   1065  C CG  . GLU A  1 134 ? -38.618 -5.649  -12.295 1.00 44.24  ? 134 GLU A CG  1 
ATOM   1066  C CD  . GLU A  1 134 ? -39.394 -6.165  -13.495 1.00 47.36  ? 134 GLU A CD  1 
ATOM   1067  O OE1 . GLU A  1 134 ? -39.569 -7.394  -13.609 1.00 49.82  ? 134 GLU A OE1 1 
ATOM   1068  O OE2 . GLU A  1 134 ? -39.833 -5.341  -14.326 1.00 49.51  ? 134 GLU A OE2 1 
ATOM   1069  N N   . THR A  1 135 ? -35.845 -3.357  -11.855 1.00 34.45  ? 135 THR A N   1 
ATOM   1070  C CA  . THR A  1 135 ? -35.898 -1.903  -11.935 1.00 31.61  ? 135 THR A CA  1 
ATOM   1071  C C   . THR A  1 135 ? -36.820 -1.588  -13.101 1.00 30.91  ? 135 THR A C   1 
ATOM   1072  O O   . THR A  1 135 ? -37.188 -2.486  -13.854 1.00 29.04  ? 135 THR A O   1 
ATOM   1073  C CB  . THR A  1 135 ? -34.524 -1.332  -12.286 1.00 30.92  ? 135 THR A CB  1 
ATOM   1074  O OG1 . THR A  1 135 ? -34.141 -1.790  -13.592 1.00 31.44  ? 135 THR A OG1 1 
ATOM   1075  C CG2 . THR A  1 135 ? -33.495 -1.791  -11.286 1.00 29.10  ? 135 THR A CG2 1 
ATOM   1076  N N   . VAL A  1 136 ? -37.192 -0.322  -13.260 1.00 30.61  ? 136 VAL A N   1 
ATOM   1077  C CA  . VAL A  1 136 ? -38.023 0.051   -14.394 1.00 29.99  ? 136 VAL A CA  1 
ATOM   1078  C C   . VAL A  1 136 ? -36.991 0.303   -15.488 1.00 30.00  ? 136 VAL A C   1 
ATOM   1079  O O   . VAL A  1 136 ? -35.821 -0.001  -15.292 1.00 29.36  ? 136 VAL A O   1 
ATOM   1080  C CB  . VAL A  1 136 ? -38.844 1.327   -14.115 1.00 31.33  ? 136 VAL A CB  1 
ATOM   1081  C CG1 . VAL A  1 136 ? -39.770 1.085   -12.940 1.00 30.84  ? 136 VAL A CG1 1 
ATOM   1082  C CG2 . VAL A  1 136 ? -37.918 2.511   -13.826 1.00 30.20  ? 136 VAL A CG2 1 
ATOM   1083  N N   . PHE A  1 137 ? -37.399 0.850   -16.627 1.00 31.20  ? 137 PHE A N   1 
ATOM   1084  C CA  . PHE A  1 137 ? -36.448 1.102   -17.711 1.00 30.25  ? 137 PHE A CA  1 
ATOM   1085  C C   . PHE A  1 137 ? -35.634 2.364   -17.459 1.00 30.18  ? 137 PHE A C   1 
ATOM   1086  O O   . PHE A  1 137 ? -36.157 3.477   -17.457 1.00 28.08  ? 137 PHE A O   1 
ATOM   1087  C CB  . PHE A  1 137 ? -37.201 1.167   -19.042 1.00 31.55  ? 137 PHE A CB  1 
ATOM   1088  C CG  . PHE A  1 137 ? -37.889 -0.116  -19.381 1.00 33.59  ? 137 PHE A CG  1 
ATOM   1089  C CD1 . PHE A  1 137 ? -37.197 -1.146  -20.013 1.00 33.15  ? 137 PHE A CD1 1 
ATOM   1090  C CD2 . PHE A  1 137 ? -39.190 -0.344  -18.965 1.00 33.38  ? 137 PHE A CD2 1 
ATOM   1091  C CE1 . PHE A  1 137 ? -37.799 -2.389  -20.215 1.00 34.80  ? 137 PHE A CE1 1 
ATOM   1092  C CE2 . PHE A  1 137 ? -39.799 -1.580  -19.160 1.00 33.19  ? 137 PHE A CE2 1 
ATOM   1093  C CZ  . PHE A  1 137 ? -39.108 -2.604  -19.782 1.00 32.73  ? 137 PHE A CZ  1 
ATOM   1094  N N   . LEU A  1 138 ? -34.339 2.167   -17.236 1.00 30.35  ? 138 LEU A N   1 
ATOM   1095  C CA  . LEU A  1 138 ? -33.424 3.262   -16.937 1.00 29.33  ? 138 LEU A CA  1 
ATOM   1096  C C   . LEU A  1 138 ? -32.889 3.926   -18.182 1.00 29.26  ? 138 LEU A C   1 
ATOM   1097  O O   . LEU A  1 138 ? -32.752 3.294   -19.232 1.00 29.96  ? 138 LEU A O   1 
ATOM   1098  C CB  . LEU A  1 138 ? -32.240 2.746   -16.131 1.00 28.27  ? 138 LEU A CB  1 
ATOM   1099  C CG  . LEU A  1 138 ? -32.603 1.862   -14.950 1.00 29.55  ? 138 LEU A CG  1 
ATOM   1100  C CD1 . LEU A  1 138 ? -31.339 1.294   -14.374 1.00 30.99  ? 138 LEU A CD1 1 
ATOM   1101  C CD2 . LEU A  1 138 ? -33.383 2.650   -13.918 1.00 32.44  ? 138 LEU A CD2 1 
ATOM   1102  N N   . PRO A  1 139 ? -32.559 5.213   -18.074 1.00 27.72  ? 139 PRO A N   1 
ATOM   1103  C CA  . PRO A  1 139 ? -32.026 5.946   -19.222 1.00 28.48  ? 139 PRO A CA  1 
ATOM   1104  C C   . PRO A  1 139 ? -30.525 5.722   -19.398 1.00 29.31  ? 139 PRO A C   1 
ATOM   1105  O O   . PRO A  1 139 ? -29.829 5.352   -18.458 1.00 29.69  ? 139 PRO A O   1 
ATOM   1106  C CB  . PRO A  1 139 ? -32.371 7.402   -18.898 1.00 27.64  ? 139 PRO A CB  1 
ATOM   1107  C CG  . PRO A  1 139 ? -32.321 7.449   -17.419 1.00 25.31  ? 139 PRO A CG  1 
ATOM   1108  C CD  . PRO A  1 139 ? -32.896 6.119   -16.961 1.00 27.16  ? 139 PRO A CD  1 
ATOM   1109  N N   . ARG A  1 140 ? -30.056 5.918   -20.627 1.00 30.57  ? 140 ARG A N   1 
ATOM   1110  C CA  . ARG A  1 140 ? -28.649 5.802   -20.991 1.00 32.89  ? 140 ARG A CA  1 
ATOM   1111  C C   . ARG A  1 140 ? -28.331 7.181   -21.550 1.00 34.32  ? 140 ARG A C   1 
ATOM   1112  O O   . ARG A  1 140 ? -29.199 8.051   -21.548 1.00 34.91  ? 140 ARG A O   1 
ATOM   1113  C CB  . ARG A  1 140 ? -28.449 4.752   -22.085 1.00 33.98  ? 140 ARG A CB  1 
ATOM   1114  C CG  . ARG A  1 140 ? -28.456 3.298   -21.618 1.00 36.21  ? 140 ARG A CG  1 
ATOM   1115  C CD  . ARG A  1 140 ? -28.522 2.369   -22.823 1.00 38.60  ? 140 ARG A CD  1 
ATOM   1116  N NE  . ARG A  1 140 ? -27.589 2.817   -23.853 1.00 41.69  ? 140 ARG A NE  1 
ATOM   1117  C CZ  . ARG A  1 140 ? -26.288 2.548   -23.848 1.00 41.68  ? 140 ARG A CZ  1 
ATOM   1118  N NH1 . ARG A  1 140 ? -25.767 1.815   -22.874 1.00 39.15  ? 140 ARG A NH1 1 
ATOM   1119  N NH2 . ARG A  1 140 ? -25.504 3.052   -24.791 1.00 40.78  ? 140 ARG A NH2 1 
ATOM   1120  N N   . ASP A  1 141 ? -27.112 7.388   -22.037 1.00 35.43  ? 141 ASP A N   1 
ATOM   1121  C CA  . ASP A  1 141 ? -26.747 8.687   -22.591 1.00 36.48  ? 141 ASP A CA  1 
ATOM   1122  C C   . ASP A  1 141 ? -27.394 8.899   -23.954 1.00 36.42  ? 141 ASP A C   1 
ATOM   1123  O O   . ASP A  1 141 ? -27.696 10.031  -24.324 1.00 35.36  ? 141 ASP A O   1 
ATOM   1124  C CB  . ASP A  1 141 ? -25.222 8.825   -22.750 1.00 40.43  ? 141 ASP A CB  1 
ATOM   1125  C CG  . ASP A  1 141 ? -24.466 8.708   -21.427 1.00 43.22  ? 141 ASP A CG  1 
ATOM   1126  O OD1 . ASP A  1 141 ? -25.023 9.055   -20.361 1.00 46.39  ? 141 ASP A OD1 1 
ATOM   1127  O OD2 . ASP A  1 141 ? -23.292 8.281   -21.461 1.00 47.87  ? 141 ASP A OD2 1 
ATOM   1128  N N   . ASP A  1 142 ? -27.591 7.812   -24.701 1.00 35.58  ? 142 ASP A N   1 
ATOM   1129  C CA  . ASP A  1 142 ? -28.188 7.895   -26.029 1.00 34.05  ? 142 ASP A CA  1 
ATOM   1130  C C   . ASP A  1 142 ? -29.705 7.800   -26.019 1.00 32.76  ? 142 ASP A C   1 
ATOM   1131  O O   . ASP A  1 142 ? -30.354 8.422   -25.190 1.00 35.37  ? 142 ASP A O   1 
ATOM   1132  C CB  . ASP A  1 142 ? -27.609 6.824   -26.961 1.00 34.60  ? 142 ASP A CB  1 
ATOM   1133  C CG  . ASP A  1 142 ? -27.490 5.459   -26.295 1.00 40.27  ? 142 ASP A CG  1 
ATOM   1134  O OD1 . ASP A  1 142 ? -28.283 5.150   -25.371 1.00 40.82  ? 142 ASP A OD1 1 
ATOM   1135  O OD2 . ASP A  1 142 ? -26.600 4.684   -26.714 1.00 42.94  ? 142 ASP A OD2 1 
ATOM   1136  N N   . HIS A  1 143 ? -30.269 7.027   -26.942 1.00 30.38  ? 143 HIS A N   1 
ATOM   1137  C CA  . HIS A  1 143 ? -31.715 6.892   -27.050 1.00 31.40  ? 143 HIS A CA  1 
ATOM   1138  C C   . HIS A  1 143 ? -32.196 5.541   -26.552 1.00 32.59  ? 143 HIS A C   1 
ATOM   1139  O O   . HIS A  1 143 ? -33.401 5.274   -26.501 1.00 32.78  ? 143 HIS A O   1 
ATOM   1140  C CB  . HIS A  1 143 ? -32.149 7.050   -28.513 1.00 33.08  ? 143 HIS A CB  1 
ATOM   1141  C CG  . HIS A  1 143 ? -31.441 6.125   -29.458 1.00 33.94  ? 143 HIS A CG  1 
ATOM   1142  N ND1 . HIS A  1 143 ? -30.187 6.394   -29.970 1.00 35.12  ? 143 HIS A ND1 1 
ATOM   1143  C CD2 . HIS A  1 143 ? -31.790 4.910   -29.948 1.00 34.25  ? 143 HIS A CD2 1 
ATOM   1144  C CE1 . HIS A  1 143 ? -29.795 5.387   -30.730 1.00 34.77  ? 143 HIS A CE1 1 
ATOM   1145  N NE2 . HIS A  1 143 ? -30.749 4.472   -30.734 1.00 34.76  ? 143 HIS A NE2 1 
ATOM   1146  N N   . LEU A  1 144 ? -31.249 4.691   -26.186 1.00 31.45  ? 144 LEU A N   1 
ATOM   1147  C CA  . LEU A  1 144 ? -31.570 3.351   -25.739 1.00 31.78  ? 144 LEU A CA  1 
ATOM   1148  C C   . LEU A  1 144 ? -31.814 3.214   -24.236 1.00 31.51  ? 144 LEU A C   1 
ATOM   1149  O O   . LEU A  1 144 ? -31.603 4.151   -23.466 1.00 32.40  ? 144 LEU A O   1 
ATOM   1150  C CB  . LEU A  1 144 ? -30.465 2.408   -26.229 1.00 32.62  ? 144 LEU A CB  1 
ATOM   1151  C CG  . LEU A  1 144 ? -30.308 2.510   -27.762 1.00 31.06  ? 144 LEU A CG  1 
ATOM   1152  C CD1 . LEU A  1 144 ? -29.052 1.788   -28.237 1.00 32.97  ? 144 LEU A CD1 1 
ATOM   1153  C CD2 . LEU A  1 144 ? -31.530 1.937   -28.429 1.00 30.02  ? 144 LEU A CD2 1 
ATOM   1154  N N   . PHE A  1 145 ? -32.277 2.041   -23.824 1.00 30.61  ? 145 PHE A N   1 
ATOM   1155  C CA  . PHE A  1 145 ? -32.588 1.800   -22.418 1.00 31.12  ? 145 PHE A CA  1 
ATOM   1156  C C   . PHE A  1 145 ? -31.729 0.714   -21.758 1.00 32.30  ? 145 PHE A C   1 
ATOM   1157  O O   . PHE A  1 145 ? -31.040 -0.059  -22.430 1.00 33.25  ? 145 PHE A O   1 
ATOM   1158  C CB  . PHE A  1 145 ? -34.076 1.421   -22.271 1.00 26.23  ? 145 PHE A CB  1 
ATOM   1159  C CG  . PHE A  1 145 ? -35.050 2.518   -22.688 1.00 23.09  ? 145 PHE A CG  1 
ATOM   1160  C CD1 . PHE A  1 145 ? -35.439 2.662   -24.020 1.00 23.28  ? 145 PHE A CD1 1 
ATOM   1161  C CD2 . PHE A  1 145 ? -35.594 3.380   -21.740 1.00 20.48  ? 145 PHE A CD2 1 
ATOM   1162  C CE1 . PHE A  1 145 ? -36.367 3.645   -24.404 1.00 23.09  ? 145 PHE A CE1 1 
ATOM   1163  C CE2 . PHE A  1 145 ? -36.519 4.368   -22.101 1.00 22.93  ? 145 PHE A CE2 1 
ATOM   1164  C CZ  . PHE A  1 145 ? -36.910 4.503   -23.449 1.00 24.90  ? 145 PHE A CZ  1 
ATOM   1165  N N   . ARG A  1 146 ? -31.761 0.678   -20.430 1.00 33.97  ? 146 ARG A N   1 
ATOM   1166  C CA  . ARG A  1 146 ? -31.038 -0.341  -19.676 1.00 33.77  ? 146 ARG A CA  1 
ATOM   1167  C C   . ARG A  1 146 ? -31.914 -0.762  -18.512 1.00 33.91  ? 146 ARG A C   1 
ATOM   1168  O O   . ARG A  1 146 ? -32.798 -0.013  -18.079 1.00 32.86  ? 146 ARG A O   1 
ATOM   1169  C CB  . ARG A  1 146 ? -29.681 0.169   -19.183 1.00 35.25  ? 146 ARG A CB  1 
ATOM   1170  C CG  . ARG A  1 146 ? -29.721 1.386   -18.283 1.00 40.83  ? 146 ARG A CG  1 
ATOM   1171  C CD  . ARG A  1 146 ? -28.308 1.952   -18.151 1.00 46.25  ? 146 ARG A CD  1 
ATOM   1172  N NE  . ARG A  1 146 ? -28.277 3.210   -17.414 1.00 52.20  ? 146 ARG A NE  1 
ATOM   1173  C CZ  . ARG A  1 146 ? -28.317 3.306   -16.088 1.00 55.71  ? 146 ARG A CZ  1 
ATOM   1174  N NH1 . ARG A  1 146 ? -28.384 2.212   -15.335 1.00 56.24  ? 146 ARG A NH1 1 
ATOM   1175  N NH2 . ARG A  1 146 ? -28.297 4.502   -15.512 1.00 58.06  ? 146 ARG A NH2 1 
ATOM   1176  N N   . LYS A  1 147 ? -31.673 -1.961  -18.000 1.00 33.56  ? 147 LYS A N   1 
ATOM   1177  C CA  . LYS A  1 147 ? -32.492 -2.462  -16.916 1.00 33.06  ? 147 LYS A CA  1 
ATOM   1178  C C   . LYS A  1 147 ? -31.736 -3.512  -16.106 1.00 32.55  ? 147 LYS A C   1 
ATOM   1179  O O   . LYS A  1 147 ? -30.822 -4.169  -16.610 1.00 30.97  ? 147 LYS A O   1 
ATOM   1180  C CB  . LYS A  1 147 ? -33.760 -3.070  -17.521 1.00 34.14  ? 147 LYS A CB  1 
ATOM   1181  C CG  . LYS A  1 147 ? -34.900 -3.261  -16.570 1.00 39.28  ? 147 LYS A CG  1 
ATOM   1182  C CD  . LYS A  1 147 ? -36.128 -3.857  -17.257 1.00 39.88  ? 147 LYS A CD  1 
ATOM   1183  C CE  . LYS A  1 147 ? -37.269 -3.949  -16.249 1.00 44.42  ? 147 LYS A CE  1 
ATOM   1184  N NZ  . LYS A  1 147 ? -38.442 -4.726  -16.713 1.00 45.70  ? 147 LYS A NZ  1 
ATOM   1185  N N   . PHE A  1 148 ? -32.111 -3.654  -14.840 1.00 32.61  ? 148 PHE A N   1 
ATOM   1186  C CA  . PHE A  1 148 ? -31.487 -4.657  -13.989 1.00 33.24  ? 148 PHE A CA  1 
ATOM   1187  C C   . PHE A  1 148 ? -32.539 -5.600  -13.417 1.00 33.68  ? 148 PHE A C   1 
ATOM   1188  O O   . PHE A  1 148 ? -33.613 -5.161  -12.985 1.00 33.06  ? 148 PHE A O   1 
ATOM   1189  C CB  . PHE A  1 148 ? -30.758 -4.036  -12.790 1.00 31.21  ? 148 PHE A CB  1 
ATOM   1190  C CG  . PHE A  1 148 ? -29.607 -3.144  -13.147 1.00 30.70  ? 148 PHE A CG  1 
ATOM   1191  C CD1 . PHE A  1 148 ? -29.819 -1.811  -13.465 1.00 30.02  ? 148 PHE A CD1 1 
ATOM   1192  C CD2 . PHE A  1 148 ? -28.293 -3.614  -13.075 1.00 31.20  ? 148 PHE A CD2 1 
ATOM   1193  C CE1 . PHE A  1 148 ? -28.735 -0.958  -13.695 1.00 31.53  ? 148 PHE A CE1 1 
ATOM   1194  C CE2 . PHE A  1 148 ? -27.203 -2.771  -13.302 1.00 28.41  ? 148 PHE A CE2 1 
ATOM   1195  C CZ  . PHE A  1 148 ? -27.424 -1.442  -13.610 1.00 29.38  ? 148 PHE A CZ  1 
ATOM   1196  N N   . HIS A  1 149 ? -32.243 -6.896  -13.439 1.00 33.03  ? 149 HIS A N   1 
ATOM   1197  C CA  . HIS A  1 149 ? -33.130 -7.861  -12.807 1.00 34.57  ? 149 HIS A CA  1 
ATOM   1198  C C   . HIS A  1 149 ? -32.290 -8.451  -11.687 1.00 34.57  ? 149 HIS A C   1 
ATOM   1199  O O   . HIS A  1 149 ? -31.060 -8.457  -11.778 1.00 31.83  ? 149 HIS A O   1 
ATOM   1200  C CB  . HIS A  1 149 ? -33.616 -8.938  -13.772 1.00 32.51  ? 149 HIS A CB  1 
ATOM   1201  C CG  . HIS A  1 149 ? -34.953 -8.626  -14.372 1.00 35.29  ? 149 HIS A CG  1 
ATOM   1202  N ND1 . HIS A  1 149 ? -35.132 -7.642  -15.322 1.00 34.88  ? 149 HIS A ND1 1 
ATOM   1203  C CD2 . HIS A  1 149 ? -36.180 -9.150  -14.138 1.00 34.39  ? 149 HIS A CD2 1 
ATOM   1204  C CE1 . HIS A  1 149 ? -36.409 -7.576  -15.649 1.00 35.61  ? 149 HIS A CE1 1 
ATOM   1205  N NE2 . HIS A  1 149 ? -37.067 -8.482  -14.945 1.00 36.45  ? 149 HIS A NE2 1 
ATOM   1206  N N   . TYR A  1 150 ? -32.943 -8.926  -10.630 1.00 34.88  ? 150 TYR A N   1 
ATOM   1207  C CA  . TYR A  1 150 ? -32.220 -9.453  -9.479  1.00 35.70  ? 150 TYR A CA  1 
ATOM   1208  C C   . TYR A  1 150 ? -32.771 -10.758 -8.915  1.00 37.89  ? 150 TYR A C   1 
ATOM   1209  O O   . TYR A  1 150 ? -33.982 -11.012 -8.938  1.00 38.30  ? 150 TYR A O   1 
ATOM   1210  C CB  . TYR A  1 150 ? -32.236 -8.419  -8.353  1.00 34.37  ? 150 TYR A CB  1 
ATOM   1211  C CG  . TYR A  1 150 ? -31.688 -7.062  -8.713  1.00 34.29  ? 150 TYR A CG  1 
ATOM   1212  C CD1 . TYR A  1 150 ? -30.315 -6.839  -8.791  1.00 34.05  ? 150 TYR A CD1 1 
ATOM   1213  C CD2 . TYR A  1 150 ? -32.541 -5.983  -8.917  1.00 30.54  ? 150 TYR A CD2 1 
ATOM   1214  C CE1 . TYR A  1 150 ? -29.806 -5.563  -9.054  1.00 32.35  ? 150 TYR A CE1 1 
ATOM   1215  C CE2 . TYR A  1 150 ? -32.044 -4.718  -9.177  1.00 32.53  ? 150 TYR A CE2 1 
ATOM   1216  C CZ  . TYR A  1 150 ? -30.679 -4.513  -9.243  1.00 33.01  ? 150 TYR A CZ  1 
ATOM   1217  O OH  . TYR A  1 150 ? -30.197 -3.250  -9.489  1.00 35.59  ? 150 TYR A OH  1 
ATOM   1218  N N   . LEU A  1 151 ? -31.874 -11.567 -8.365  1.00 37.82  ? 151 LEU A N   1 
ATOM   1219  C CA  . LEU A  1 151 ? -32.286 -12.826 -7.778  1.00 38.62  ? 151 LEU A CA  1 
ATOM   1220  C C   . LEU A  1 151 ? -31.493 -13.127 -6.517  1.00 39.21  ? 151 LEU A C   1 
ATOM   1221  O O   . LEU A  1 151 ? -30.271 -13.284 -6.572  1.00 38.34  ? 151 LEU A O   1 
ATOM   1222  C CB  . LEU A  1 151 ? -32.094 -13.969 -8.774  1.00 39.33  ? 151 LEU A CB  1 
ATOM   1223  C CG  . LEU A  1 151 ? -32.295 -15.363 -8.174  1.00 39.05  ? 151 LEU A CG  1 
ATOM   1224  C CD1 . LEU A  1 151 ? -33.694 -15.456 -7.579  1.00 39.02  ? 151 LEU A CD1 1 
ATOM   1225  C CD2 . LEU A  1 151 ? -32.085 -16.421 -9.243  1.00 39.00  ? 151 LEU A CD2 1 
ATOM   1226  N N   . THR A  1 152 ? -32.179 -13.191 -5.380  1.00 38.62  ? 152 THR A N   1 
ATOM   1227  C CA  . THR A  1 152 ? -31.504 -13.517 -4.130  1.00 38.22  ? 152 THR A CA  1 
ATOM   1228  C C   . THR A  1 152 ? -31.218 -15.018 -4.155  1.00 38.78  ? 152 THR A C   1 
ATOM   1229  O O   . THR A  1 152 ? -32.075 -15.813 -4.541  1.00 38.97  ? 152 THR A O   1 
ATOM   1230  C CB  . THR A  1 152 ? -32.381 -13.189 -2.904  1.00 37.94  ? 152 THR A CB  1 
ATOM   1231  O OG1 . THR A  1 152 ? -33.688 -13.745 -3.081  1.00 38.63  ? 152 THR A OG1 1 
ATOM   1232  C CG2 . THR A  1 152 ? -32.491 -11.686 -2.702  1.00 34.86  ? 152 THR A CG2 1 
ATOM   1233  N N   . PHE A  1 153 ? -30.007 -15.409 -3.782  1.00 39.25  ? 153 PHE A N   1 
ATOM   1234  C CA  . PHE A  1 153 ? -29.668 -16.823 -3.776  1.00 40.22  ? 153 PHE A CA  1 
ATOM   1235  C C   . PHE A  1 153 ? -28.659 -17.151 -2.697  1.00 42.18  ? 153 PHE A C   1 
ATOM   1236  O O   . PHE A  1 153 ? -28.062 -16.266 -2.089  1.00 42.37  ? 153 PHE A O   1 
ATOM   1237  C CB  . PHE A  1 153 ? -29.107 -17.264 -5.134  1.00 37.04  ? 153 PHE A CB  1 
ATOM   1238  C CG  . PHE A  1 153 ? -27.723 -16.758 -5.417  1.00 35.61  ? 153 PHE A CG  1 
ATOM   1239  C CD1 . PHE A  1 153 ? -27.455 -15.392 -5.443  1.00 33.31  ? 153 PHE A CD1 1 
ATOM   1240  C CD2 . PHE A  1 153 ? -26.684 -17.648 -5.679  1.00 37.61  ? 153 PHE A CD2 1 
ATOM   1241  C CE1 . PHE A  1 153 ? -26.187 -14.921 -5.724  1.00 31.11  ? 153 PHE A CE1 1 
ATOM   1242  C CE2 . PHE A  1 153 ? -25.395 -17.180 -5.965  1.00 34.78  ? 153 PHE A CE2 1 
ATOM   1243  C CZ  . PHE A  1 153 ? -25.156 -15.813 -5.987  1.00 34.39  ? 153 PHE A CZ  1 
ATOM   1244  N N   . LEU A  1 154 ? -28.473 -18.444 -2.483  1.00 45.10  ? 154 LEU A N   1 
ATOM   1245  C CA  . LEU A  1 154 ? -27.545 -18.948 -1.496  1.00 45.62  ? 154 LEU A CA  1 
ATOM   1246  C C   . LEU A  1 154 ? -26.521 -19.764 -2.278  1.00 46.79  ? 154 LEU A C   1 
ATOM   1247  O O   . LEU A  1 154 ? -26.804 -20.880 -2.703  1.00 46.55  ? 154 LEU A O   1 
ATOM   1248  C CB  . LEU A  1 154 ? -28.301 -19.830 -0.508  1.00 45.50  ? 154 LEU A CB  1 
ATOM   1249  C CG  . LEU A  1 154 ? -27.888 -19.800 0.958   1.00 47.63  ? 154 LEU A CG  1 
ATOM   1250  C CD1 . LEU A  1 154 ? -27.827 -18.352 1.464   1.00 46.74  ? 154 LEU A CD1 1 
ATOM   1251  C CD2 . LEU A  1 154 ? -28.895 -20.617 1.760   1.00 47.07  ? 154 LEU A CD2 1 
ATOM   1252  N N   . PRO A  1 155 ? -25.323 -19.201 -2.496  1.00 48.85  ? 155 PRO A N   1 
ATOM   1253  C CA  . PRO A  1 155 ? -24.236 -19.851 -3.230  1.00 51.09  ? 155 PRO A CA  1 
ATOM   1254  C C   . PRO A  1 155 ? -24.024 -21.301 -2.829  1.00 54.92  ? 155 PRO A C   1 
ATOM   1255  O O   . PRO A  1 155 ? -23.987 -21.635 -1.643  1.00 56.33  ? 155 PRO A O   1 
ATOM   1256  C CB  . PRO A  1 155 ? -23.039 -18.976 -2.903  1.00 50.07  ? 155 PRO A CB  1 
ATOM   1257  C CG  . PRO A  1 155 ? -23.651 -17.628 -2.847  1.00 49.17  ? 155 PRO A CG  1 
ATOM   1258  C CD  . PRO A  1 155 ? -24.901 -17.871 -2.030  1.00 48.90  ? 155 PRO A CD  1 
ATOM   1259  N N   . SER A  1 156 ? -23.889 -22.153 -3.841  1.00 58.43  ? 156 SER A N   1 
ATOM   1260  C CA  . SER A  1 156 ? -23.691 -23.587 -3.669  1.00 60.02  ? 156 SER A CA  1 
ATOM   1261  C C   . SER A  1 156 ? -22.937 -24.124 -4.875  1.00 61.86  ? 156 SER A C   1 
ATOM   1262  O O   . SER A  1 156 ? -23.095 -23.628 -5.992  1.00 62.02  ? 156 SER A O   1 
ATOM   1263  C CB  . SER A  1 156 ? -25.041 -24.295 -3.570  1.00 61.45  ? 156 SER A CB  1 
ATOM   1264  O OG  . SER A  1 156 ? -24.915 -25.681 -3.845  1.00 65.13  ? 156 SER A OG  1 
ATOM   1265  N N   . THR A  1 157 ? -22.121 -25.144 -4.654  1.00 63.78  ? 157 THR A N   1 
ATOM   1266  C CA  . THR A  1 157 ? -21.359 -25.737 -5.745  1.00 65.85  ? 157 THR A CA  1 
ATOM   1267  C C   . THR A  1 157 ? -22.241 -26.627 -6.627  1.00 67.48  ? 157 THR A C   1 
ATOM   1268  O O   . THR A  1 157 ? -21.850 -26.992 -7.736  1.00 67.84  ? 157 THR A O   1 
ATOM   1269  C CB  . THR A  1 157 ? -20.192 -26.584 -5.203  1.00 65.87  ? 157 THR A CB  1 
ATOM   1270  O OG1 . THR A  1 157 ? -20.698 -27.557 -4.279  1.00 66.35  ? 157 THR A OG1 1 
ATOM   1271  C CG2 . THR A  1 157 ? -19.172 -25.699 -4.502  1.00 64.95  ? 157 THR A CG2 1 
ATOM   1272  N N   . ASP A  1 158 ? -23.436 -26.948 -6.134  1.00 69.49  ? 158 ASP A N   1 
ATOM   1273  C CA  . ASP A  1 158 ? -24.383 -27.821 -6.839  1.00 70.79  ? 158 ASP A CA  1 
ATOM   1274  C C   . ASP A  1 158 ? -25.326 -27.174 -7.866  1.00 70.33  ? 158 ASP A C   1 
ATOM   1275  O O   . ASP A  1 158 ? -25.771 -27.843 -8.805  1.00 69.74  ? 158 ASP A O   1 
ATOM   1276  C CB  . ASP A  1 158 ? -25.250 -28.580 -5.819  1.00 73.17  ? 158 ASP A CB  1 
ATOM   1277  C CG  . ASP A  1 158 ? -24.438 -29.488 -4.905  1.00 75.71  ? 158 ASP A CG  1 
ATOM   1278  O OD1 . ASP A  1 158 ? -23.640 -30.299 -5.428  1.00 75.33  ? 158 ASP A OD1 1 
ATOM   1279  O OD2 . ASP A  1 158 ? -24.611 -29.399 -3.664  1.00 76.17  ? 158 ASP A OD2 1 
ATOM   1280  N N   . ASP A  1 159 ? -25.645 -25.894 -7.692  1.00 69.63  ? 159 ASP A N   1 
ATOM   1281  C CA  . ASP A  1 159 ? -26.574 -25.227 -8.601  1.00 67.44  ? 159 ASP A CA  1 
ATOM   1282  C C   . ASP A  1 159 ? -25.935 -24.333 -9.644  1.00 66.04  ? 159 ASP A C   1 
ATOM   1283  O O   . ASP A  1 159 ? -24.798 -23.891 -9.497  1.00 66.45  ? 159 ASP A O   1 
ATOM   1284  C CB  . ASP A  1 159 ? -27.579 -24.390 -7.810  1.00 68.70  ? 159 ASP A CB  1 
ATOM   1285  C CG  . ASP A  1 159 ? -28.323 -25.198 -6.768  1.00 69.54  ? 159 ASP A CG  1 
ATOM   1286  O OD1 . ASP A  1 159 ? -28.910 -26.243 -7.127  1.00 69.56  ? 159 ASP A OD1 1 
ATOM   1287  O OD2 . ASP A  1 159 ? -28.325 -24.777 -5.591  1.00 69.66  ? 159 ASP A OD2 1 
ATOM   1288  N N   . PHE A  1 160 ? -26.690 -24.068 -10.702 1.00 64.11  ? 160 PHE A N   1 
ATOM   1289  C CA  . PHE A  1 160 ? -26.244 -23.195 -11.783 1.00 63.17  ? 160 PHE A CA  1 
ATOM   1290  C C   . PHE A  1 160 ? -27.448 -22.347 -12.176 1.00 60.49  ? 160 PHE A C   1 
ATOM   1291  O O   . PHE A  1 160 ? -28.585 -22.811 -12.108 1.00 59.30  ? 160 PHE A O   1 
ATOM   1292  C CB  . PHE A  1 160 ? -25.750 -24.011 -12.986 1.00 66.13  ? 160 PHE A CB  1 
ATOM   1293  C CG  . PHE A  1 160 ? -26.752 -25.010 -13.499 1.00 69.33  ? 160 PHE A CG  1 
ATOM   1294  C CD1 . PHE A  1 160 ? -26.925 -26.235 -12.860 1.00 70.00  ? 160 PHE A CD1 1 
ATOM   1295  C CD2 . PHE A  1 160 ? -27.538 -24.718 -14.611 1.00 71.04  ? 160 PHE A CD2 1 
ATOM   1296  C CE1 . PHE A  1 160 ? -27.869 -27.155 -13.319 1.00 70.95  ? 160 PHE A CE1 1 
ATOM   1297  C CE2 . PHE A  1 160 ? -28.486 -25.631 -15.079 1.00 71.92  ? 160 PHE A CE2 1 
ATOM   1298  C CZ  . PHE A  1 160 ? -28.651 -26.851 -14.433 1.00 71.77  ? 160 PHE A CZ  1 
ATOM   1299  N N   . TYR A  1 161 ? -27.208 -21.104 -12.574 1.00 57.29  ? 161 TYR A N   1 
ATOM   1300  C CA  . TYR A  1 161 ? -28.313 -20.233 -12.947 1.00 55.70  ? 161 TYR A CA  1 
ATOM   1301  C C   . TYR A  1 161 ? -28.218 -19.680 -14.365 1.00 55.45  ? 161 TYR A C   1 
ATOM   1302  O O   . TYR A  1 161 ? -27.131 -19.601 -14.946 1.00 54.67  ? 161 TYR A O   1 
ATOM   1303  C CB  . TYR A  1 161 ? -28.423 -19.063 -11.961 1.00 52.98  ? 161 TYR A CB  1 
ATOM   1304  C CG  . TYR A  1 161 ? -28.641 -19.464 -10.521 1.00 47.11  ? 161 TYR A CG  1 
ATOM   1305  C CD1 . TYR A  1 161 ? -27.634 -20.085 -9.783  1.00 46.93  ? 161 TYR A CD1 1 
ATOM   1306  C CD2 . TYR A  1 161 ? -29.852 -19.207 -9.892  1.00 46.04  ? 161 TYR A CD2 1 
ATOM   1307  C CE1 . TYR A  1 161 ? -27.833 -20.435 -8.452  1.00 45.18  ? 161 TYR A CE1 1 
ATOM   1308  C CE2 . TYR A  1 161 ? -30.063 -19.554 -8.563  1.00 44.34  ? 161 TYR A CE2 1 
ATOM   1309  C CZ  . TYR A  1 161 ? -29.052 -20.163 -7.850  1.00 44.28  ? 161 TYR A CZ  1 
ATOM   1310  O OH  . TYR A  1 161 ? -29.259 -20.471 -6.528  1.00 45.78  ? 161 TYR A OH  1 
ATOM   1311  N N   . ASP A  1 162 ? -29.369 -19.290 -14.906 1.00 54.90  ? 162 ASP A N   1 
ATOM   1312  C CA  . ASP A  1 162 ? -29.440 -18.721 -16.246 1.00 55.32  ? 162 ASP A CA  1 
ATOM   1313  C C   . ASP A  1 162 ? -30.467 -17.591 -16.311 1.00 54.68  ? 162 ASP A C   1 
ATOM   1314  O O   . ASP A  1 162 ? -31.588 -17.737 -15.811 1.00 54.98  ? 162 ASP A O   1 
ATOM   1315  C CB  . ASP A  1 162 ? -29.805 -19.807 -17.264 1.00 56.20  ? 162 ASP A CB  1 
ATOM   1316  C CG  . ASP A  1 162 ? -28.660 -20.784 -17.516 1.00 59.00  ? 162 ASP A CG  1 
ATOM   1317  O OD1 . ASP A  1 162 ? -27.618 -20.360 -18.069 1.00 58.42  ? 162 ASP A OD1 1 
ATOM   1318  O OD2 . ASP A  1 162 ? -28.798 -21.976 -17.164 1.00 59.80  ? 162 ASP A OD2 1 
ATOM   1319  N N   . CYS A  1 163 ? -30.074 -16.464 -16.906 1.00 52.67  ? 163 CYS A N   1 
ATOM   1320  C CA  . CYS A  1 163 ? -30.973 -15.321 -17.064 1.00 51.96  ? 163 CYS A CA  1 
ATOM   1321  C C   . CYS A  1 163 ? -31.407 -15.281 -18.524 1.00 52.70  ? 163 CYS A C   1 
ATOM   1322  O O   . CYS A  1 163 ? -30.637 -14.868 -19.390 1.00 54.64  ? 163 CYS A O   1 
ATOM   1323  C CB  . CYS A  1 163 ? -30.280 -13.987 -16.710 1.00 49.68  ? 163 CYS A CB  1 
ATOM   1324  S SG  . CYS A  1 163 ? -31.408 -12.562 -16.920 1.00 49.34  ? 163 CYS A SG  1 
ATOM   1325  N N   . GLU A  1 164 ? -32.632 -15.712 -18.798 1.00 52.38  ? 164 GLU A N   1 
ATOM   1326  C CA  . GLU A  1 164 ? -33.142 -15.734 -20.168 1.00 52.54  ? 164 GLU A CA  1 
ATOM   1327  C C   . GLU A  1 164 ? -33.915 -14.459 -20.508 1.00 51.51  ? 164 GLU A C   1 
ATOM   1328  O O   . GLU A  1 164 ? -34.957 -14.187 -19.918 1.00 51.42  ? 164 GLU A O   1 
ATOM   1329  C CB  . GLU A  1 164 ? -34.047 -16.959 -20.370 1.00 54.24  ? 164 GLU A CB  1 
ATOM   1330  C CG  . GLU A  1 164 ? -34.391 -17.259 -21.824 1.00 58.08  ? 164 GLU A CG  1 
ATOM   1331  C CD  . GLU A  1 164 ? -35.284 -18.486 -21.987 1.00 59.89  ? 164 GLU A CD  1 
ATOM   1332  O OE1 . GLU A  1 164 ? -36.506 -18.390 -21.725 1.00 60.20  ? 164 GLU A OE1 1 
ATOM   1333  O OE2 . GLU A  1 164 ? -34.757 -19.552 -22.374 1.00 60.98  ? 164 GLU A OE2 1 
ATOM   1334  N N   . VAL A  1 165 ? -33.399 -13.687 -21.462 1.00 50.80  ? 165 VAL A N   1 
ATOM   1335  C CA  . VAL A  1 165 ? -34.043 -12.438 -21.882 1.00 50.19  ? 165 VAL A CA  1 
ATOM   1336  C C   . VAL A  1 165 ? -34.584 -12.514 -23.307 1.00 50.01  ? 165 VAL A C   1 
ATOM   1337  O O   . VAL A  1 165 ? -33.891 -12.954 -24.227 1.00 48.44  ? 165 VAL A O   1 
ATOM   1338  C CB  . VAL A  1 165 ? -33.060 -11.232 -21.803 1.00 50.55  ? 165 VAL A CB  1 
ATOM   1339  C CG1 . VAL A  1 165 ? -33.661 -10.015 -22.501 1.00 47.96  ? 165 VAL A CG1 1 
ATOM   1340  C CG2 . VAL A  1 165 ? -32.762 -10.895 -20.345 1.00 48.27  ? 165 VAL A CG2 1 
ATOM   1341  N N   . ASP A  1 166 ? -35.826 -12.070 -23.479 1.00 49.17  ? 166 ASP A N   1 
ATOM   1342  C CA  . ASP A  1 166 ? -36.466 -12.079 -24.785 1.00 49.17  ? 166 ASP A CA  1 
ATOM   1343  C C   . ASP A  1 166 ? -36.947 -10.677 -25.146 1.00 48.50  ? 166 ASP A C   1 
ATOM   1344  O O   . ASP A  1 166 ? -37.695 -10.058 -24.392 1.00 49.49  ? 166 ASP A O   1 
ATOM   1345  C CB  . ASP A  1 166 ? -37.640 -13.064 -24.786 1.00 51.29  ? 166 ASP A CB  1 
ATOM   1346  C CG  . ASP A  1 166 ? -38.163 -13.362 -26.192 1.00 55.29  ? 166 ASP A CG  1 
ATOM   1347  O OD1 . ASP A  1 166 ? -37.344 -13.591 -27.117 1.00 52.35  ? 166 ASP A OD1 1 
ATOM   1348  O OD2 . ASP A  1 166 ? -39.402 -13.379 -26.367 1.00 58.76  ? 166 ASP A OD2 1 
ATOM   1349  N N   . HIS A  1 167 ? -36.499 -10.190 -26.303 1.00 47.03  ? 167 HIS A N   1 
ATOM   1350  C CA  . HIS A  1 167 ? -36.849 -8.862  -26.811 1.00 45.28  ? 167 HIS A CA  1 
ATOM   1351  C C   . HIS A  1 167 ? -37.291 -8.996  -28.272 1.00 46.14  ? 167 HIS A C   1 
ATOM   1352  O O   . HIS A  1 167 ? -36.788 -9.863  -28.993 1.00 45.50  ? 167 HIS A O   1 
ATOM   1353  C CB  . HIS A  1 167 ? -35.624 -7.946  -26.737 1.00 44.71  ? 167 HIS A CB  1 
ATOM   1354  C CG  . HIS A  1 167 ? -35.913 -6.518  -27.067 1.00 42.88  ? 167 HIS A CG  1 
ATOM   1355  N ND1 . HIS A  1 167 ? -36.426 -5.630  -26.144 1.00 44.09  ? 167 HIS A ND1 1 
ATOM   1356  C CD2 . HIS A  1 167 ? -35.773 -5.824  -28.221 1.00 41.63  ? 167 HIS A CD2 1 
ATOM   1357  C CE1 . HIS A  1 167 ? -36.587 -4.449  -26.716 1.00 42.28  ? 167 HIS A CE1 1 
ATOM   1358  N NE2 . HIS A  1 167 ? -36.199 -4.541  -27.976 1.00 44.63  ? 167 HIS A NE2 1 
ATOM   1359  N N   . TRP A  1 168 ? -38.215 -8.141  -28.711 1.00 45.78  ? 168 TRP A N   1 
ATOM   1360  C CA  . TRP A  1 168 ? -38.697 -8.202  -30.087 1.00 46.63  ? 168 TRP A CA  1 
ATOM   1361  C C   . TRP A  1 168 ? -37.548 -8.179  -31.100 1.00 47.34  ? 168 TRP A C   1 
ATOM   1362  O O   . TRP A  1 168 ? -37.684 -8.678  -32.216 1.00 47.92  ? 168 TRP A O   1 
ATOM   1363  C CB  . TRP A  1 168 ? -39.656 -7.044  -30.388 1.00 48.10  ? 168 TRP A CB  1 
ATOM   1364  C CG  . TRP A  1 168 ? -40.966 -7.078  -29.642 1.00 50.73  ? 168 TRP A CG  1 
ATOM   1365  C CD1 . TRP A  1 168 ? -41.423 -6.149  -28.749 1.00 51.90  ? 168 TRP A CD1 1 
ATOM   1366  C CD2 . TRP A  1 168 ? -41.990 -8.077  -29.733 1.00 53.28  ? 168 TRP A CD2 1 
ATOM   1367  N NE1 . TRP A  1 168 ? -42.664 -6.506  -28.277 1.00 51.94  ? 168 TRP A NE1 1 
ATOM   1368  C CE2 . TRP A  1 168 ? -43.037 -7.686  -28.863 1.00 54.11  ? 168 TRP A CE2 1 
ATOM   1369  C CE3 . TRP A  1 168 ? -42.128 -9.266  -30.465 1.00 55.59  ? 168 TRP A CE3 1 
ATOM   1370  C CZ2 . TRP A  1 168 ? -44.210 -8.442  -28.705 1.00 54.97  ? 168 TRP A CZ2 1 
ATOM   1371  C CZ3 . TRP A  1 168 ? -43.301 -10.021 -30.308 1.00 55.92  ? 168 TRP A CZ3 1 
ATOM   1372  C CH2 . TRP A  1 168 ? -44.323 -9.601  -29.433 1.00 54.43  ? 168 TRP A CH2 1 
ATOM   1373  N N   . GLY A  1 169 ? -36.417 -7.605  -30.706 1.00 48.10  ? 169 GLY A N   1 
ATOM   1374  C CA  . GLY A  1 169 ? -35.275 -7.526  -31.601 1.00 47.78  ? 169 GLY A CA  1 
ATOM   1375  C C   . GLY A  1 169 ? -34.382 -8.755  -31.569 1.00 50.22  ? 169 GLY A C   1 
ATOM   1376  O O   . GLY A  1 169 ? -33.335 -8.797  -32.219 1.00 49.75  ? 169 GLY A O   1 
ATOM   1377  N N   . LEU A  1 170 ? -34.780 -9.759  -30.798 1.00 52.18  ? 170 LEU A N   1 
ATOM   1378  C CA  . LEU A  1 170 ? -34.007 -10.989 -30.710 1.00 53.61  ? 170 LEU A CA  1 
ATOM   1379  C C   . LEU A  1 170 ? -34.708 -12.042 -31.540 1.00 56.14  ? 170 LEU A C   1 
ATOM   1380  O O   . LEU A  1 170 ? -35.929 -12.165 -31.482 1.00 55.86  ? 170 LEU A O   1 
ATOM   1381  C CB  . LEU A  1 170 ? -33.916 -11.463 -29.258 1.00 52.87  ? 170 LEU A CB  1 
ATOM   1382  C CG  . LEU A  1 170 ? -33.090 -10.608 -28.293 1.00 52.64  ? 170 LEU A CG  1 
ATOM   1383  C CD1 . LEU A  1 170 ? -33.242 -11.123 -26.868 1.00 50.57  ? 170 LEU A CD1 1 
ATOM   1384  C CD2 . LEU A  1 170 ? -31.638 -10.641 -28.720 1.00 51.88  ? 170 LEU A CD2 1 
ATOM   1385  N N   . GLU A  1 171 ? -33.942 -12.797 -32.317 1.00 59.97  ? 171 GLU A N   1 
ATOM   1386  C CA  . GLU A  1 171 ? -34.523 -13.848 -33.145 1.00 64.28  ? 171 GLU A CA  1 
ATOM   1387  C C   . GLU A  1 171 ? -35.089 -14.921 -32.225 1.00 65.60  ? 171 GLU A C   1 
ATOM   1388  O O   . GLU A  1 171 ? -36.216 -15.387 -32.396 1.00 65.85  ? 171 GLU A O   1 
ATOM   1389  C CB  . GLU A  1 171 ? -33.452 -14.454 -34.050 1.00 68.58  ? 171 GLU A CB  1 
ATOM   1390  C CG  . GLU A  1 171 ? -34.005 -15.329 -35.162 1.00 74.62  ? 171 GLU A CG  1 
ATOM   1391  C CD  . GLU A  1 171 ? -32.925 -15.803 -36.119 1.00 77.92  ? 171 GLU A CD  1 
ATOM   1392  O OE1 . GLU A  1 171 ? -32.041 -16.581 -35.694 1.00 80.09  ? 171 GLU A OE1 1 
ATOM   1393  O OE2 . GLU A  1 171 ? -32.961 -15.394 -37.300 1.00 80.06  ? 171 GLU A OE2 1 
ATOM   1394  N N   . GLU A  1 172 ? -34.289 -15.299 -31.238 1.00 67.08  ? 172 GLU A N   1 
ATOM   1395  C CA  . GLU A  1 172 ? -34.680 -16.308 -30.266 1.00 67.76  ? 172 GLU A CA  1 
ATOM   1396  C C   . GLU A  1 172 ? -34.272 -15.749 -28.898 1.00 66.12  ? 172 GLU A C   1 
ATOM   1397  O O   . GLU A  1 172 ? -33.381 -14.895 -28.819 1.00 64.75  ? 172 GLU A O   1 
ATOM   1398  C CB  . GLU A  1 172 ? -33.932 -17.618 -30.562 1.00 71.84  ? 172 GLU A CB  1 
ATOM   1399  C CG  . GLU A  1 172 ? -34.578 -18.866 -29.979 1.00 78.09  ? 172 GLU A CG  1 
ATOM   1400  C CD  . GLU A  1 172 ? -33.738 -20.119 -30.178 1.00 82.22  ? 172 GLU A CD  1 
ATOM   1401  O OE1 . GLU A  1 172 ? -33.433 -20.459 -31.346 1.00 83.35  ? 172 GLU A OE1 1 
ATOM   1402  O OE2 . GLU A  1 172 ? -33.386 -20.771 -29.163 1.00 84.39  ? 172 GLU A OE2 1 
ATOM   1403  N N   . PRO A  1 173 ? -34.920 -16.207 -27.809 1.00 63.92  ? 173 PRO A N   1 
ATOM   1404  C CA  . PRO A  1 173 ? -34.554 -15.696 -26.485 1.00 61.55  ? 173 PRO A CA  1 
ATOM   1405  C C   . PRO A  1 173 ? -33.055 -15.807 -26.223 1.00 61.92  ? 173 PRO A C   1 
ATOM   1406  O O   . PRO A  1 173 ? -32.393 -16.736 -26.695 1.00 62.00  ? 173 PRO A O   1 
ATOM   1407  C CB  . PRO A  1 173 ? -35.381 -16.564 -25.547 1.00 61.65  ? 173 PRO A CB  1 
ATOM   1408  C CG  . PRO A  1 173 ? -36.632 -16.796 -26.347 1.00 61.94  ? 173 PRO A CG  1 
ATOM   1409  C CD  . PRO A  1 173 ? -36.072 -17.124 -27.713 1.00 62.85  ? 173 PRO A CD  1 
ATOM   1410  N N   . LEU A  1 174 ? -32.528 -14.844 -25.477 1.00 60.62  ? 174 LEU A N   1 
ATOM   1411  C CA  . LEU A  1 174 ? -31.115 -14.804 -25.144 1.00 59.71  ? 174 LEU A CA  1 
ATOM   1412  C C   . LEU A  1 174 ? -30.950 -15.340 -23.723 1.00 60.96  ? 174 LEU A C   1 
ATOM   1413  O O   . LEU A  1 174 ? -31.609 -14.873 -22.794 1.00 61.04  ? 174 LEU A O   1 
ATOM   1414  C CB  . LEU A  1 174 ? -30.625 -13.363 -25.245 1.00 60.10  ? 174 LEU A CB  1 
ATOM   1415  C CG  . LEU A  1 174 ? -29.130 -13.122 -25.427 1.00 62.26  ? 174 LEU A CG  1 
ATOM   1416  C CD1 . LEU A  1 174 ? -28.576 -13.997 -26.543 1.00 62.85  ? 174 LEU A CD1 1 
ATOM   1417  C CD2 . LEU A  1 174 ? -28.911 -11.651 -25.743 1.00 62.24  ? 174 LEU A CD2 1 
ATOM   1418  N N   . ARG A  1 175 ? -30.065 -16.316 -23.557 1.00 60.37  ? 175 ARG A N   1 
ATOM   1419  C CA  . ARG A  1 175 ? -29.850 -16.937 -22.255 1.00 60.08  ? 175 ARG A CA  1 
ATOM   1420  C C   . ARG A  1 175 ? -28.398 -16.916 -21.760 1.00 60.79  ? 175 ARG A C   1 
ATOM   1421  O O   . ARG A  1 175 ? -27.526 -17.568 -22.339 1.00 60.01  ? 175 ARG A O   1 
ATOM   1422  C CB  . ARG A  1 175 ? -30.357 -18.379 -22.317 1.00 60.50  ? 175 ARG A CB  1 
ATOM   1423  C CG  . ARG A  1 175 ? -30.043 -19.231 -21.110 1.00 61.96  ? 175 ARG A CG  1 
ATOM   1424  C CD  . ARG A  1 175 ? -30.482 -20.673 -21.345 1.00 64.06  ? 175 ARG A CD  1 
ATOM   1425  N NE  . ARG A  1 175 ? -31.931 -20.792 -21.479 1.00 64.76  ? 175 ARG A NE  1 
ATOM   1426  C CZ  . ARG A  1 175 ? -32.688 -21.539 -20.682 1.00 66.12  ? 175 ARG A CZ  1 
ATOM   1427  N NH1 . ARG A  1 175 ? -32.126 -22.232 -19.699 1.00 66.29  ? 175 ARG A NH1 1 
ATOM   1428  N NH2 . ARG A  1 175 ? -34.005 -21.587 -20.854 1.00 65.66  ? 175 ARG A NH2 1 
ATOM   1429  N N   . LYS A  1 176 ? -28.148 -16.169 -20.685 1.00 60.43  ? 176 LYS A N   1 
ATOM   1430  C CA  . LYS A  1 176 ? -26.811 -16.083 -20.102 1.00 60.10  ? 176 LYS A CA  1 
ATOM   1431  C C   . LYS A  1 176 ? -26.691 -17.038 -18.921 1.00 60.56  ? 176 LYS A C   1 
ATOM   1432  O O   . LYS A  1 176 ? -27.618 -17.186 -18.129 1.00 61.02  ? 176 LYS A O   1 
ATOM   1433  C CB  . LYS A  1 176 ? -26.510 -14.654 -19.663 1.00 61.25  ? 176 LYS A CB  1 
ATOM   1434  C CG  . LYS A  1 176 ? -26.310 -13.716 -20.834 1.00 63.92  ? 176 LYS A CG  1 
ATOM   1435  C CD  . LYS A  1 176 ? -25.150 -14.188 -21.698 1.00 64.36  ? 176 LYS A CD  1 
ATOM   1436  C CE  . LYS A  1 176 ? -25.004 -13.357 -22.959 1.00 64.75  ? 176 LYS A CE  1 
ATOM   1437  N NZ  . LYS A  1 176 ? -23.733 -13.693 -23.663 1.00 64.96  ? 176 LYS A NZ  1 
ATOM   1438  N N   . HIS A  1 177 ? -25.534 -17.676 -18.804 1.00 61.49  ? 177 HIS A N   1 
ATOM   1439  C CA  . HIS A  1 177 ? -25.303 -18.660 -17.756 1.00 61.41  ? 177 HIS A CA  1 
ATOM   1440  C C   . HIS A  1 177 ? -24.432 -18.184 -16.602 1.00 61.81  ? 177 HIS A C   1 
ATOM   1441  O O   . HIS A  1 177 ? -23.535 -17.355 -16.781 1.00 62.98  ? 177 HIS A O   1 
ATOM   1442  C CB  . HIS A  1 177 ? -24.665 -19.907 -18.377 1.00 62.79  ? 177 HIS A CB  1 
ATOM   1443  C CG  . HIS A  1 177 ? -24.508 -21.050 -17.424 1.00 64.23  ? 177 HIS A CG  1 
ATOM   1444  N ND1 . HIS A  1 177 ? -25.555 -21.876 -17.074 1.00 64.71  ? 177 HIS A ND1 1 
ATOM   1445  C CD2 . HIS A  1 177 ? -23.431 -21.492 -16.733 1.00 64.09  ? 177 HIS A CD2 1 
ATOM   1446  C CE1 . HIS A  1 177 ? -25.130 -22.777 -16.207 1.00 65.40  ? 177 HIS A CE1 1 
ATOM   1447  N NE2 . HIS A  1 177 ? -23.845 -22.565 -15.982 1.00 65.42  ? 177 HIS A NE2 1 
ATOM   1448  N N   . TRP A  1 178 ? -24.702 -18.717 -15.414 1.00 59.95  ? 178 TRP A N   1 
ATOM   1449  C CA  . TRP A  1 178 ? -23.914 -18.380 -14.239 1.00 58.48  ? 178 TRP A CA  1 
ATOM   1450  C C   . TRP A  1 178 ? -23.862 -19.522 -13.234 1.00 59.51  ? 178 TRP A C   1 
ATOM   1451  O O   . TRP A  1 178 ? -24.887 -20.098 -12.874 1.00 58.71  ? 178 TRP A O   1 
ATOM   1452  C CB  . TRP A  1 178 ? -24.468 -17.148 -13.526 1.00 55.61  ? 178 TRP A CB  1 
ATOM   1453  C CG  . TRP A  1 178 ? -23.526 -16.673 -12.461 1.00 53.28  ? 178 TRP A CG  1 
ATOM   1454  C CD1 . TRP A  1 178 ? -22.556 -15.720 -12.592 1.00 52.87  ? 178 TRP A CD1 1 
ATOM   1455  C CD2 . TRP A  1 178 ? -23.377 -17.215 -11.141 1.00 50.65  ? 178 TRP A CD2 1 
ATOM   1456  N NE1 . TRP A  1 178 ? -21.808 -15.641 -11.438 1.00 52.65  ? 178 TRP A NE1 1 
ATOM   1457  C CE2 . TRP A  1 178 ? -22.292 -16.549 -10.534 1.00 49.42  ? 178 TRP A CE2 1 
ATOM   1458  C CE3 . TRP A  1 178 ? -24.053 -18.202 -10.415 1.00 49.94  ? 178 TRP A CE3 1 
ATOM   1459  C CZ2 . TRP A  1 178 ? -21.870 -16.839 -9.237  1.00 48.92  ? 178 TRP A CZ2 1 
ATOM   1460  C CZ3 . TRP A  1 178 ? -23.632 -18.489 -9.126  1.00 46.53  ? 178 TRP A CZ3 1 
ATOM   1461  C CH2 . TRP A  1 178 ? -22.551 -17.810 -8.551  1.00 48.08  ? 178 TRP A CH2 1 
ATOM   1462  N N   . GLU A  1 179 ? -22.656 -19.843 -12.786 1.00 62.27  ? 179 GLU A N   1 
ATOM   1463  C CA  . GLU A  1 179 ? -22.466 -20.878 -11.783 1.00 65.75  ? 179 GLU A CA  1 
ATOM   1464  C C   . GLU A  1 179 ? -21.229 -20.541 -10.968 1.00 67.24  ? 179 GLU A C   1 
ATOM   1465  O O   . GLU A  1 179 ? -20.347 -19.823 -11.437 1.00 67.01  ? 179 GLU A O   1 
ATOM   1466  C CB  . GLU A  1 179 ? -22.342 -22.272 -12.411 1.00 68.28  ? 179 GLU A CB  1 
ATOM   1467  C CG  . GLU A  1 179 ? -21.307 -22.438 -13.519 1.00 71.19  ? 179 GLU A CG  1 
ATOM   1468  C CD  . GLU A  1 179 ? -21.236 -23.877 -14.022 1.00 72.62  ? 179 GLU A CD  1 
ATOM   1469  O OE1 . GLU A  1 179 ? -22.295 -24.442 -14.385 1.00 72.74  ? 179 GLU A OE1 1 
ATOM   1470  O OE2 . GLU A  1 179 ? -20.121 -24.441 -14.056 1.00 74.09  ? 179 GLU A OE2 1 
ATOM   1471  N N   . PHE A  1 180 ? -21.177 -21.043 -9.738  1.00 69.96  ? 180 PHE A N   1 
ATOM   1472  C CA  . PHE A  1 180 ? -20.065 -20.764 -8.834  1.00 72.68  ? 180 PHE A CA  1 
ATOM   1473  C C   . PHE A  1 180 ? -18.691 -21.244 -9.320  1.00 74.36  ? 180 PHE A C   1 
ATOM   1474  O O   . PHE A  1 180 ? -18.583 -22.185 -10.106 1.00 74.22  ? 180 PHE A O   1 
ATOM   1475  C CB  . PHE A  1 180 ? -20.379 -21.360 -7.460  1.00 73.76  ? 180 PHE A CB  1 
ATOM   1476  C CG  . PHE A  1 180 ? -19.340 -21.070 -6.422  1.00 75.31  ? 180 PHE A CG  1 
ATOM   1477  C CD1 . PHE A  1 180 ? -18.935 -19.762 -6.175  1.00 76.45  ? 180 PHE A CD1 1 
ATOM   1478  C CD2 . PHE A  1 180 ? -18.753 -22.103 -5.702  1.00 74.87  ? 180 PHE A CD2 1 
ATOM   1479  C CE1 . PHE A  1 180 ? -17.956 -19.484 -5.227  1.00 77.04  ? 180 PHE A CE1 1 
ATOM   1480  C CE2 . PHE A  1 180 ? -17.777 -21.836 -4.754  1.00 76.43  ? 180 PHE A CE2 1 
ATOM   1481  C CZ  . PHE A  1 180 ? -17.376 -20.524 -4.515  1.00 76.69  ? 180 PHE A CZ  1 
ATOM   1482  N N   . GLU A  1 181 ? -17.647 -20.574 -8.838  1.00 76.11  ? 181 GLU A N   1 
ATOM   1483  C CA  . GLU A  1 181 ? -16.251 -20.874 -9.171  1.00 78.67  ? 181 GLU A CA  1 
ATOM   1484  C C   . GLU A  1 181 ? -15.394 -19.999 -8.239  1.00 80.54  ? 181 GLU A C   1 
ATOM   1485  O O   . GLU A  1 181 ? -15.649 -18.805 -8.118  1.00 80.56  ? 181 GLU A O   1 
ATOM   1486  C CB  . GLU A  1 181 ? -15.970 -20.528 -10.643 1.00 78.13  ? 181 GLU A CB  1 
ATOM   1487  N N   . GLU A  1 182 ? -14.388 -20.577 -7.583  1.00 82.21  ? 182 GLU A N   1 
ATOM   1488  C CA  . GLU A  1 182 ? -13.546 -19.806 -6.657  1.00 86.21  ? 182 GLU A CA  1 
ATOM   1489  C C   . GLU A  1 182 ? -12.356 -20.612 -6.134  1.00 86.03  ? 182 GLU A C   1 
ATOM   1490  O O   . GLU A  1 182 ? -11.202 -20.127 -6.206  1.00 87.70  ? 182 GLU A O   1 
ATOM   1491  C CB  . GLU A  1 182 ? -14.378 -19.339 -5.460  1.00 86.37  ? 182 GLU A CB  1 
ATOM   1492  C CG  . GLU A  1 182 ? -13.641 -18.403 -4.514  1.00 88.26  ? 182 GLU A CG  1 
ATOM   1493  C CD  . GLU A  1 182 ? -14.147 -18.507 -3.082  1.00 89.11  ? 182 GLU A CD  1 
ATOM   1494  O OE1 . GLU A  1 182 ? -15.382 -18.491 -2.875  1.00 89.95  ? 182 GLU A OE1 1 
ATOM   1495  O OE2 . GLU A  1 182 ? -13.303 -18.602 -2.169  1.00 90.08  ? 182 GLU A OE2 1 
ATOM   1496  N N   . GLY B  2 5   ? -39.223 20.750  7.561   1.00 76.20  ? 1   GLY B N   1 
ATOM   1497  C CA  . GLY B  2 5   ? -40.320 20.462  6.590   1.00 77.02  ? 1   GLY B CA  1 
ATOM   1498  C C   . GLY B  2 5   ? -39.835 19.663  5.394   1.00 77.15  ? 1   GLY B C   1 
ATOM   1499  O O   . GLY B  2 5   ? -38.846 20.035  4.755   1.00 77.17  ? 1   GLY B O   1 
ATOM   1500  N N   . LYS B  2 6   ? -40.536 18.570  5.089   1.00 76.63  ? 2   LYS B N   1 
ATOM   1501  C CA  . LYS B  2 6   ? -40.182 17.693  3.968   1.00 75.60  ? 2   LYS B CA  1 
ATOM   1502  C C   . LYS B  2 6   ? -40.255 18.399  2.615   1.00 73.35  ? 2   LYS B C   1 
ATOM   1503  O O   . LYS B  2 6   ? -41.319 18.856  2.191   1.00 72.88  ? 2   LYS B O   1 
ATOM   1504  C CB  . LYS B  2 6   ? -41.085 16.454  3.958   1.00 76.48  ? 2   LYS B CB  1 
ATOM   1505  N N   . LYS B  2 7   ? -39.110 18.466  1.943   1.00 70.36  ? 3   LYS B N   1 
ATOM   1506  C CA  . LYS B  2 7   ? -38.994 19.113  0.643   1.00 66.80  ? 3   LYS B CA  1 
ATOM   1507  C C   . LYS B  2 7   ? -39.716 18.348  -0.455  1.00 62.89  ? 3   LYS B C   1 
ATOM   1508  O O   . LYS B  2 7   ? -39.558 17.136  -0.590  1.00 61.95  ? 3   LYS B O   1 
ATOM   1509  C CB  . LYS B  2 7   ? -37.523 19.241  0.271   1.00 67.30  ? 3   LYS B CB  1 
ATOM   1510  C CG  . LYS B  2 7   ? -36.712 20.108  1.215   1.00 68.08  ? 3   LYS B CG  1 
ATOM   1511  C CD  . LYS B  2 7   ? -35.328 19.514  1.432   1.00 67.11  ? 3   LYS B CD  1 
ATOM   1512  C CE  . LYS B  2 7   ? -34.359 20.540  2.004   1.00 66.25  ? 3   LYS B CE  1 
ATOM   1513  N NZ  . LYS B  2 7   ? -33.949 21.541  0.975   1.00 63.62  ? 3   LYS B NZ  1 
ATOM   1514  N N   . VAL B  2 8   ? -40.502 19.065  -1.249  1.00 59.87  ? 4   VAL B N   1 
ATOM   1515  C CA  . VAL B  2 8   ? -41.232 18.445  -2.343  1.00 56.74  ? 4   VAL B CA  1 
ATOM   1516  C C   . VAL B  2 8   ? -40.465 18.585  -3.663  1.00 54.05  ? 4   VAL B C   1 
ATOM   1517  O O   . VAL B  2 8   ? -40.099 19.693  -4.069  1.00 54.05  ? 4   VAL B O   1 
ATOM   1518  C CB  . VAL B  2 8   ? -42.633 19.084  -2.510  1.00 57.12  ? 4   VAL B CB  1 
ATOM   1519  C CG1 . VAL B  2 8   ? -43.450 18.285  -3.519  1.00 55.37  ? 4   VAL B CG1 1 
ATOM   1520  C CG2 . VAL B  2 8   ? -43.343 19.144  -1.172  1.00 55.49  ? 4   VAL B CG2 1 
ATOM   1521  N N   . ILE B  2 9   ? -40.217 17.462  -4.327  1.00 49.31  ? 5   ILE B N   1 
ATOM   1522  C CA  . ILE B  2 9   ? -39.511 17.479  -5.605  1.00 46.33  ? 5   ILE B CA  1 
ATOM   1523  C C   . ILE B  2 9   ? -40.445 17.959  -6.703  1.00 44.71  ? 5   ILE B C   1 
ATOM   1524  O O   . ILE B  2 9   ? -41.556 17.456  -6.822  1.00 43.41  ? 5   ILE B O   1 
ATOM   1525  C CB  . ILE B  2 9   ? -39.041 16.078  -5.994  1.00 46.47  ? 5   ILE B CB  1 
ATOM   1526  C CG1 . ILE B  2 9   ? -38.140 15.526  -4.898  1.00 43.60  ? 5   ILE B CG1 1 
ATOM   1527  C CG2 . ILE B  2 9   ? -38.338 16.121  -7.353  1.00 44.35  ? 5   ILE B CG2 1 
ATOM   1528  C CD1 . ILE B  2 9   ? -37.749 14.132  -5.111  1.00 44.41  ? 5   ILE B CD1 1 
ATOM   1529  N N   . THR B  2 10  ? -40.006 18.924  -7.506  1.00 43.43  ? 6   THR B N   1 
ATOM   1530  C CA  . THR B  2 10  ? -40.850 19.412  -8.589  1.00 42.97  ? 6   THR B CA  1 
ATOM   1531  C C   . THR B  2 10  ? -40.448 18.750  -9.898  1.00 42.74  ? 6   THR B C   1 
ATOM   1532  O O   . THR B  2 10  ? -39.281 18.425  -10.111 1.00 42.39  ? 6   THR B O   1 
ATOM   1533  C CB  . THR B  2 10  ? -40.762 20.949  -8.761  1.00 43.54  ? 6   THR B CB  1 
ATOM   1534  O OG1 . THR B  2 10  ? -39.414 21.328  -9.046  1.00 46.44  ? 6   THR B OG1 1 
ATOM   1535  C CG2 . THR B  2 10  ? -41.207 21.652  -7.502  1.00 44.89  ? 6   THR B CG2 1 
ATOM   1536  N N   . ALA B  2 11  ? -41.422 18.550  -10.775 1.00 42.70  ? 7   ALA B N   1 
ATOM   1537  C CA  . ALA B  2 11  ? -41.170 17.920  -12.057 1.00 42.43  ? 7   ALA B CA  1 
ATOM   1538  C C   . ALA B  2 11  ? -41.144 18.953  -13.176 1.00 43.16  ? 7   ALA B C   1 
ATOM   1539  O O   . ALA B  2 11  ? -41.718 20.036  -13.044 1.00 42.72  ? 7   ALA B O   1 
ATOM   1540  C CB  . ALA B  2 11  ? -42.254 16.889  -12.335 1.00 42.03  ? 7   ALA B CB  1 
ATOM   1541  N N   . PHE B  2 12  ? -40.470 18.619  -14.272 1.00 43.22  ? 8   PHE B N   1 
ATOM   1542  C CA  . PHE B  2 12  ? -40.417 19.504  -15.423 1.00 46.33  ? 8   PHE B CA  1 
ATOM   1543  C C   . PHE B  2 12  ? -41.788 19.409  -16.070 1.00 49.01  ? 8   PHE B C   1 
ATOM   1544  O O   . PHE B  2 12  ? -42.391 18.338  -16.085 1.00 48.39  ? 8   PHE B O   1 
ATOM   1545  C CB  . PHE B  2 12  ? -39.367 19.032  -16.423 1.00 44.53  ? 8   PHE B CB  1 
ATOM   1546  C CG  . PHE B  2 12  ? -37.961 19.228  -15.960 1.00 43.89  ? 8   PHE B CG  1 
ATOM   1547  C CD1 . PHE B  2 12  ? -37.330 20.458  -16.110 1.00 42.59  ? 8   PHE B CD1 1 
ATOM   1548  C CD2 . PHE B  2 12  ? -37.268 18.183  -15.373 1.00 41.57  ? 8   PHE B CD2 1 
ATOM   1549  C CE1 . PHE B  2 12  ? -36.021 20.644  -15.682 1.00 42.99  ? 8   PHE B CE1 1 
ATOM   1550  C CE2 . PHE B  2 12  ? -35.964 18.355  -14.942 1.00 45.24  ? 8   PHE B CE2 1 
ATOM   1551  C CZ  . PHE B  2 12  ? -35.333 19.592  -15.097 1.00 43.43  ? 8   PHE B CZ  1 
ATOM   1552  N N   . ASN B  2 13  ? -42.286 20.522  -16.590 1.00 52.40  ? 9   ASN B N   1 
ATOM   1553  C CA  . ASN B  2 13  ? -43.591 20.527  -17.240 1.00 57.41  ? 9   ASN B CA  1 
ATOM   1554  C C   . ASN B  2 13  ? -43.377 20.320  -18.733 1.00 57.74  ? 9   ASN B C   1 
ATOM   1555  O O   . ASN B  2 13  ? -42.565 21.015  -19.341 1.00 58.64  ? 9   ASN B O   1 
ATOM   1556  C CB  . ASN B  2 13  ? -44.294 21.864  -17.006 1.00 61.87  ? 9   ASN B CB  1 
ATOM   1557  C CG  . ASN B  2 13  ? -45.681 21.901  -17.605 1.00 65.68  ? 9   ASN B CG  1 
ATOM   1558  O OD1 . ASN B  2 13  ? -46.598 21.232  -17.116 1.00 69.45  ? 9   ASN B OD1 1 
ATOM   1559  N ND2 . ASN B  2 13  ? -45.846 22.677  -18.677 1.00 67.00  ? 9   ASN B ND2 1 
ATOM   1560  N N   . GLU B  2 14  ? -44.095 19.364  -19.316 1.00 58.10  ? 10  GLU B N   1 
ATOM   1561  C CA  . GLU B  2 14  ? -43.966 19.073  -20.740 1.00 58.88  ? 10  GLU B CA  1 
ATOM   1562  C C   . GLU B  2 14  ? -45.003 19.821  -21.556 1.00 57.01  ? 10  GLU B C   1 
ATOM   1563  O O   . GLU B  2 14  ? -46.144 19.990  -21.126 1.00 56.85  ? 10  GLU B O   1 
ATOM   1564  C CB  . GLU B  2 14  ? -44.131 17.577  -20.996 1.00 61.74  ? 10  GLU B CB  1 
ATOM   1565  C CG  . GLU B  2 14  ? -43.322 17.068  -22.178 1.00 66.82  ? 10  GLU B CG  1 
ATOM   1566  C CD  . GLU B  2 14  ? -41.829 17.055  -21.883 1.00 69.74  ? 10  GLU B CD  1 
ATOM   1567  O OE1 . GLU B  2 14  ? -41.188 18.136  -21.918 1.00 69.73  ? 10  GLU B OE1 1 
ATOM   1568  O OE2 . GLU B  2 14  ? -41.306 15.956  -21.591 1.00 70.26  ? 10  GLU B OE2 1 
ATOM   1569  N N   . GLY B  2 15  ? -44.618 20.237  -22.753 1.00 55.40  ? 11  GLY B N   1 
ATOM   1570  C CA  . GLY B  2 15  ? -45.557 20.953  -23.587 1.00 53.48  ? 11  GLY B CA  1 
ATOM   1571  C C   . GLY B  2 15  ? -46.356 20.053  -24.506 1.00 51.79  ? 11  GLY B C   1 
ATOM   1572  O O   . GLY B  2 15  ? -46.004 18.893  -24.737 1.00 51.15  ? 11  GLY B O   1 
ATOM   1573  N N   . LEU B  2 16  ? -47.453 20.590  -25.022 1.00 50.26  ? 12  LEU B N   1 
ATOM   1574  C CA  . LEU B  2 16  ? -48.287 19.851  -25.953 1.00 48.66  ? 12  LEU B CA  1 
ATOM   1575  C C   . LEU B  2 16  ? -47.819 20.205  -27.354 1.00 46.35  ? 12  LEU B C   1 
ATOM   1576  O O   . LEU B  2 16  ? -47.550 21.369  -27.638 1.00 46.00  ? 12  LEU B O   1 
ATOM   1577  C CB  . LEU B  2 16  ? -49.756 20.244  -25.794 1.00 49.82  ? 12  LEU B CB  1 
ATOM   1578  C CG  . LEU B  2 16  ? -50.503 19.625  -24.617 1.00 52.26  ? 12  LEU B CG  1 
ATOM   1579  C CD1 . LEU B  2 16  ? -50.514 18.105  -24.799 1.00 51.47  ? 12  LEU B CD1 1 
ATOM   1580  C CD2 . LEU B  2 16  ? -49.829 20.019  -23.289 1.00 53.18  ? 12  LEU B CD2 1 
ATOM   1581  N N   . LYS B  2 17  ? -47.704 19.196  -28.213 1.00 44.37  ? 13  LYS B N   1 
ATOM   1582  C CA  . LYS B  2 17  ? -47.287 19.408  -29.592 1.00 43.16  ? 13  LYS B CA  1 
ATOM   1583  C C   . LYS B  2 17  ? -48.500 19.660  -30.478 1.00 43.01  ? 13  LYS B C   1 
ATOM   1584  O O   . LYS B  2 17  ? -49.605 19.195  -30.186 1.00 42.13  ? 13  LYS B O   1 
ATOM   1585  C CB  . LYS B  2 17  ? -46.511 18.195  -30.103 1.00 41.34  ? 13  LYS B CB  1 
ATOM   1586  C CG  . LYS B  2 17  ? -45.217 17.952  -29.358 1.00 40.82  ? 13  LYS B CG  1 
ATOM   1587  C CD  . LYS B  2 17  ? -44.475 16.733  -29.891 1.00 39.22  ? 13  LYS B CD  1 
ATOM   1588  C CE  . LYS B  2 17  ? -43.170 16.496  -29.135 1.00 37.25  ? 13  LYS B CE  1 
ATOM   1589  N NZ  . LYS B  2 17  ? -42.483 15.269  -29.629 1.00 37.06  ? 13  LYS B NZ  1 
ATOM   1590  N N   . GLY B  2 18  ? -48.277 20.404  -31.556 1.00 43.68  ? 14  GLY B N   1 
ATOM   1591  C CA  . GLY B  2 18  ? -49.344 20.731  -32.485 1.00 44.02  ? 14  GLY B CA  1 
ATOM   1592  C C   . GLY B  2 18  ? -49.198 20.039  -33.826 1.00 44.39  ? 14  GLY B C   1 
ATOM   1593  O O   . GLY B  2 18  ? -48.372 19.139  -33.986 1.00 43.80  ? 14  GLY B O   1 
ATOM   1594  N N   . GLY B  2 19  ? -50.002 20.467  -34.794 1.00 45.35  ? 15  GLY B N   1 
ATOM   1595  C CA  . GLY B  2 19  ? -49.963 19.868  -36.114 1.00 46.87  ? 15  GLY B CA  1 
ATOM   1596  C C   . GLY B  2 19  ? -48.949 20.494  -37.051 1.00 48.20  ? 15  GLY B C   1 
ATOM   1597  O O   . GLY B  2 19  ? -48.077 21.257  -36.629 1.00 48.03  ? 15  GLY B O   1 
ATOM   1598  N N   . GLY B  2 20  ? -49.069 20.163  -38.334 1.00 49.60  ? 16  GLY B N   1 
ATOM   1599  C CA  . GLY B  2 20  ? -48.151 20.692  -39.327 1.00 50.11  ? 16  GLY B CA  1 
ATOM   1600  C C   . GLY B  2 20  ? -46.806 19.981  -39.338 1.00 49.91  ? 16  GLY B C   1 
ATOM   1601  O O   . GLY B  2 20  ? -46.501 19.194  -38.439 1.00 49.91  ? 16  GLY B O   1 
ATOM   1602  N N   . GLY B  2 21  ? -46.007 20.256  -40.365 1.00 48.07  ? 17  GLY B N   1 
ATOM   1603  C CA  . GLY B  2 21  ? -44.697 19.645  -40.486 1.00 48.91  ? 17  GLY B CA  1 
ATOM   1604  C C   . GLY B  2 21  ? -44.700 18.139  -40.696 1.00 49.00  ? 17  GLY B C   1 
ATOM   1605  O O   . GLY B  2 21  ? -43.768 17.462  -40.274 1.00 49.95  ? 17  GLY B O   1 
ATOM   1606  N N   . SER B  2 22  ? -45.732 17.617  -41.356 1.00 48.84  ? 18  SER B N   1 
ATOM   1607  C CA  . SER B  2 22  ? -45.847 16.184  -41.615 1.00 50.16  ? 18  SER B CA  1 
ATOM   1608  C C   . SER B  2 22  ? -44.828 15.710  -42.641 1.00 50.56  ? 18  SER B C   1 
ATOM   1609  O O   . SER B  2 22  ? -44.524 16.420  -43.595 1.00 51.92  ? 18  SER B O   1 
ATOM   1610  C CB  . SER B  2 22  ? -47.256 15.869  -42.092 1.00 50.03  ? 18  SER B CB  1 
ATOM   1611  O OG  . SER B  2 22  ? -48.192 16.385  -41.163 1.00 51.99  ? 18  SER B OG  1 
ATOM   1612  N N   . LEU B  2 23  ? -44.308 14.504  -42.450 1.00 52.53  ? 19  LEU B N   1 
ATOM   1613  C CA  . LEU B  2 23  ? -43.293 13.976  -43.354 1.00 56.07  ? 19  LEU B CA  1 
ATOM   1614  C C   . LEU B  2 23  ? -43.631 12.631  -43.969 1.00 59.30  ? 19  LEU B C   1 
ATOM   1615  O O   . LEU B  2 23  ? -44.320 11.815  -43.366 1.00 60.36  ? 19  LEU B O   1 
ATOM   1616  C CB  . LEU B  2 23  ? -41.956 13.858  -42.621 1.00 52.79  ? 19  LEU B CB  1 
ATOM   1617  C CG  . LEU B  2 23  ? -41.518 15.104  -41.854 1.00 52.87  ? 19  LEU B CG  1 
ATOM   1618  C CD1 . LEU B  2 23  ? -40.216 14.807  -41.137 1.00 52.09  ? 19  LEU B CD1 1 
ATOM   1619  C CD2 . LEU B  2 23  ? -41.367 16.286  -42.799 1.00 50.88  ? 19  LEU B CD2 1 
ATOM   1620  N N   . VAL B  2 24  ? -43.116 12.410  -45.173 1.00 64.09  ? 20  VAL B N   1 
ATOM   1621  C CA  . VAL B  2 24  ? -43.318 11.172  -45.909 1.00 69.48  ? 20  VAL B CA  1 
ATOM   1622  C C   . VAL B  2 24  ? -42.741 9.991   -45.135 1.00 73.59  ? 20  VAL B C   1 
ATOM   1623  O O   . VAL B  2 24  ? -43.295 8.891   -45.142 1.00 73.21  ? 20  VAL B O   1 
ATOM   1624  C CB  . VAL B  2 24  ? -42.620 11.246  -47.272 1.00 69.98  ? 20  VAL B CB  1 
ATOM   1625  C CG1 . VAL B  2 24  ? -42.828 9.947   -48.034 1.00 71.70  ? 20  VAL B CG1 1 
ATOM   1626  C CG2 . VAL B  2 24  ? -43.151 12.439  -48.059 1.00 69.64  ? 20  VAL B CG2 1 
ATOM   1627  N N   . GLY B  2 25  ? -41.617 10.236  -44.471 1.00 79.52  ? 21  GLY B N   1 
ATOM   1628  C CA  . GLY B  2 25  ? -40.962 9.197   -43.697 1.00 86.26  ? 21  GLY B CA  1 
ATOM   1629  C C   . GLY B  2 25  ? -39.671 8.731   -44.347 1.00 90.42  ? 21  GLY B C   1 
ATOM   1630  O O   . GLY B  2 25  ? -38.720 9.507   -44.482 1.00 90.71  ? 21  GLY B O   1 
ATOM   1631  N N   . GLY B  2 26  ? -39.640 7.462   -44.751 1.00 94.23  ? 22  GLY B N   1 
ATOM   1632  C CA  . GLY B  2 26  ? -38.455 6.911   -45.391 1.00 98.20  ? 22  GLY B CA  1 
ATOM   1633  C C   . GLY B  2 26  ? -38.722 5.632   -46.171 1.00 100.58 ? 22  GLY B C   1 
ATOM   1634  O O   . GLY B  2 26  ? -37.788 4.993   -46.663 1.00 100.34 ? 22  GLY B O   1 
ATOM   1635  N N   . GLY B  2 27  ? -39.997 5.264   -46.288 1.00 102.88 ? 23  GLY B N   1 
ATOM   1636  C CA  . GLY B  2 27  ? -40.367 4.054   -47.006 1.00 105.31 ? 23  GLY B CA  1 
ATOM   1637  C C   . GLY B  2 27  ? -40.626 2.888   -46.064 1.00 106.83 ? 23  GLY B C   1 
ATOM   1638  O O   . GLY B  2 27  ? -41.548 2.932   -45.245 1.00 106.94 ? 23  GLY B O   1 
ATOM   1639  N N   . SER B  2 28  ? -39.809 1.844   -46.183 1.00 108.28 ? 24  SER B N   1 
ATOM   1640  C CA  . SER B  2 28  ? -39.924 0.652   -45.340 1.00 109.35 ? 24  SER B CA  1 
ATOM   1641  C C   . SER B  2 28  ? -38.547 0.197   -44.835 1.00 109.57 ? 24  SER B C   1 
ATOM   1642  O O   . SER B  2 28  ? -37.539 0.338   -45.536 1.00 110.08 ? 24  SER B O   1 
ATOM   1643  C CB  . SER B  2 28  ? -40.588 -0.488  -46.120 1.00 109.39 ? 24  SER B CB  1 
ATOM   1644  O OG  . SER B  2 28  ? -40.687 -1.661  -45.327 1.00 109.27 ? 24  SER B OG  1 
ATOM   1645  N N   . GLY B  2 29  ? -38.511 -0.344  -43.619 1.00 109.07 ? 25  GLY B N   1 
ATOM   1646  C CA  . GLY B  2 29  ? -37.258 -0.807  -43.047 1.00 107.72 ? 25  GLY B CA  1 
ATOM   1647  C C   . GLY B  2 29  ? -37.195 -2.319  -42.931 1.00 106.92 ? 25  GLY B C   1 
ATOM   1648  O O   . GLY B  2 29  ? -36.850 -3.010  -43.894 1.00 106.90 ? 25  GLY B O   1 
ATOM   1649  N N   . GLY B  2 30  ? -37.529 -2.833  -41.748 1.00 105.40 ? 26  GLY B N   1 
ATOM   1650  C CA  . GLY B  2 30  ? -37.506 -4.269  -41.525 1.00 102.72 ? 26  GLY B CA  1 
ATOM   1651  C C   . GLY B  2 30  ? -38.674 -4.993  -42.173 1.00 100.49 ? 26  GLY B C   1 
ATOM   1652  O O   . GLY B  2 30  ? -38.485 -5.791  -43.092 1.00 100.42 ? 26  GLY B O   1 
ATOM   1653  N N   . GLY B  2 31  ? -39.884 -4.715  -41.693 1.00 97.96  ? 27  GLY B N   1 
ATOM   1654  C CA  . GLY B  2 31  ? -41.068 -5.351  -42.241 1.00 94.40  ? 27  GLY B CA  1 
ATOM   1655  C C   . GLY B  2 31  ? -41.604 -6.458  -41.350 1.00 91.99  ? 27  GLY B C   1 
ATOM   1656  O O   . GLY B  2 31  ? -42.723 -6.367  -40.839 1.00 92.32  ? 27  GLY B O   1 
ATOM   1657  N N   . GLY B  2 32  ? -40.799 -7.503  -41.160 1.00 88.76  ? 28  GLY B N   1 
ATOM   1658  C CA  . GLY B  2 32  ? -41.207 -8.623  -40.329 1.00 83.51  ? 28  GLY B CA  1 
ATOM   1659  C C   . GLY B  2 32  ? -41.122 -8.315  -38.847 1.00 79.95  ? 28  GLY B C   1 
ATOM   1660  O O   . GLY B  2 32  ? -41.677 -9.043  -38.022 1.00 80.17  ? 28  GLY B O   1 
ATOM   1661  N N   . SER B  2 33  ? -40.425 -7.234  -38.509 1.00 75.73  ? 29  SER B N   1 
ATOM   1662  C CA  . SER B  2 33  ? -40.268 -6.815  -37.120 1.00 71.06  ? 29  SER B CA  1 
ATOM   1663  C C   . SER B  2 33  ? -41.506 -6.068  -36.621 1.00 67.85  ? 29  SER B C   1 
ATOM   1664  O O   . SER B  2 33  ? -42.040 -5.196  -37.310 1.00 67.98  ? 29  SER B O   1 
ATOM   1665  C CB  . SER B  2 33  ? -39.033 -5.923  -36.980 1.00 71.97  ? 29  SER B CB  1 
ATOM   1666  O OG  . SER B  2 33  ? -39.127 -4.786  -37.820 1.00 73.37  ? 29  SER B OG  1 
ATOM   1667  N N   . ARG B  2 34  ? -41.952 -6.409  -35.416 1.00 63.22  ? 30  ARG B N   1 
ATOM   1668  C CA  . ARG B  2 34  ? -43.129 -5.785  -34.827 1.00 58.33  ? 30  ARG B CA  1 
ATOM   1669  C C   . ARG B  2 34  ? -43.010 -4.271  -34.741 1.00 55.74  ? 30  ARG B C   1 
ATOM   1670  O O   . ARG B  2 34  ? -42.026 -3.744  -34.224 1.00 54.79  ? 30  ARG B O   1 
ATOM   1671  C CB  . ARG B  2 34  ? -43.377 -6.342  -33.424 1.00 57.83  ? 30  ARG B CB  1 
ATOM   1672  C CG  . ARG B  2 34  ? -44.688 -5.880  -32.793 1.00 58.70  ? 30  ARG B CG  1 
ATOM   1673  C CD  . ARG B  2 34  ? -44.873 -6.432  -31.375 1.00 58.67  ? 30  ARG B CD  1 
ATOM   1674  N NE  . ARG B  2 34  ? -44.208 -5.622  -30.355 1.00 60.78  ? 30  ARG B NE  1 
ATOM   1675  C CZ  . ARG B  2 34  ? -44.833 -4.786  -29.524 1.00 60.97  ? 30  ARG B CZ  1 
ATOM   1676  N NH1 . ARG B  2 34  ? -46.151 -4.637  -29.576 1.00 58.97  ? 30  ARG B NH1 1 
ATOM   1677  N NH2 . ARG B  2 34  ? -44.136 -4.092  -28.636 1.00 61.36  ? 30  ARG B NH2 1 
ATOM   1678  N N   . PRO B  2 35  ? -44.013 -3.551  -35.264 1.00 53.13  ? 31  PRO B N   1 
ATOM   1679  C CA  . PRO B  2 35  ? -44.059 -2.089  -35.255 1.00 50.48  ? 31  PRO B CA  1 
ATOM   1680  C C   . PRO B  2 35  ? -44.206 -1.560  -33.831 1.00 48.80  ? 31  PRO B C   1 
ATOM   1681  O O   . PRO B  2 35  ? -44.823 -2.204  -32.981 1.00 48.99  ? 31  PRO B O   1 
ATOM   1682  C CB  . PRO B  2 35  ? -45.302 -1.782  -36.084 1.00 50.08  ? 31  PRO B CB  1 
ATOM   1683  C CG  . PRO B  2 35  ? -45.361 -2.917  -37.029 1.00 50.72  ? 31  PRO B CG  1 
ATOM   1684  C CD  . PRO B  2 35  ? -45.071 -4.089  -36.135 1.00 52.51  ? 31  PRO B CD  1 
ATOM   1685  N N   . TRP B  2 36  ? -43.641 -0.387  -33.576 1.00 45.56  ? 32  TRP B N   1 
ATOM   1686  C CA  . TRP B  2 36  ? -43.742 0.234   -32.265 1.00 42.28  ? 32  TRP B CA  1 
ATOM   1687  C C   . TRP B  2 36  ? -43.592 1.739   -32.391 1.00 40.96  ? 32  TRP B C   1 
ATOM   1688  O O   . TRP B  2 36  ? -43.067 2.228   -33.372 1.00 42.24  ? 32  TRP B O   1 
ATOM   1689  C CB  . TRP B  2 36  ? -42.688 -0.329  -31.317 1.00 40.18  ? 32  TRP B CB  1 
ATOM   1690  C CG  . TRP B  2 36  ? -41.290 -0.241  -31.799 1.00 37.81  ? 32  TRP B CG  1 
ATOM   1691  C CD1 . TRP B  2 36  ? -40.670 -1.076  -32.682 1.00 37.67  ? 32  TRP B CD1 1 
ATOM   1692  C CD2 . TRP B  2 36  ? -40.299 0.692   -31.364 1.00 36.31  ? 32  TRP B CD2 1 
ATOM   1693  N NE1 . TRP B  2 36  ? -39.346 -0.727  -32.820 1.00 33.98  ? 32  TRP B NE1 1 
ATOM   1694  C CE2 . TRP B  2 36  ? -39.093 0.356   -32.019 1.00 35.99  ? 32  TRP B CE2 1 
ATOM   1695  C CE3 . TRP B  2 36  ? -40.310 1.778   -30.480 1.00 34.05  ? 32  TRP B CE3 1 
ATOM   1696  C CZ2 . TRP B  2 36  ? -37.904 1.071   -31.815 1.00 37.73  ? 32  TRP B CZ2 1 
ATOM   1697  C CZ3 . TRP B  2 36  ? -39.129 2.488   -30.277 1.00 34.98  ? 32  TRP B CZ3 1 
ATOM   1698  C CH2 . TRP B  2 36  ? -37.944 2.131   -30.940 1.00 36.84  ? 32  TRP B CH2 1 
ATOM   1699  N N   . PHE B  2 37  ? -44.065 2.475   -31.401 1.00 40.21  ? 33  PHE B N   1 
ATOM   1700  C CA  . PHE B  2 37  ? -43.988 3.924   -31.442 1.00 39.07  ? 33  PHE B CA  1 
ATOM   1701  C C   . PHE B  2 37  ? -43.696 4.434   -30.043 1.00 37.99  ? 33  PHE B C   1 
ATOM   1702  O O   . PHE B  2 37  ? -44.441 4.160   -29.097 1.00 38.34  ? 33  PHE B O   1 
ATOM   1703  C CB  . PHE B  2 37  ? -45.307 4.474   -31.977 1.00 42.13  ? 33  PHE B CB  1 
ATOM   1704  C CG  . PHE B  2 37  ? -45.727 3.835   -33.266 1.00 46.78  ? 33  PHE B CG  1 
ATOM   1705  C CD1 . PHE B  2 37  ? -45.096 4.169   -34.465 1.00 47.39  ? 33  PHE B CD1 1 
ATOM   1706  C CD2 . PHE B  2 37  ? -46.691 2.837   -33.278 1.00 47.83  ? 33  PHE B CD2 1 
ATOM   1707  C CE1 . PHE B  2 37  ? -45.421 3.511   -35.656 1.00 45.90  ? 33  PHE B CE1 1 
ATOM   1708  C CE2 . PHE B  2 37  ? -47.020 2.176   -34.462 1.00 47.74  ? 33  PHE B CE2 1 
ATOM   1709  C CZ  . PHE B  2 37  ? -46.380 2.515   -35.651 1.00 46.92  ? 33  PHE B CZ  1 
ATOM   1710  N N   . LEU B  2 38  ? -42.611 5.192   -29.926 1.00 35.15  ? 34  LEU B N   1 
ATOM   1711  C CA  . LEU B  2 38  ? -42.166 5.715   -28.645 1.00 31.98  ? 34  LEU B CA  1 
ATOM   1712  C C   . LEU B  2 38  ? -41.966 7.232   -28.597 1.00 31.72  ? 34  LEU B C   1 
ATOM   1713  O O   . LEU B  2 38  ? -41.263 7.793   -29.432 1.00 32.28  ? 34  LEU B O   1 
ATOM   1714  C CB  . LEU B  2 38  ? -40.850 5.020   -28.269 1.00 31.20  ? 34  LEU B CB  1 
ATOM   1715  C CG  . LEU B  2 38  ? -40.152 5.401   -26.955 1.00 30.73  ? 34  LEU B CG  1 
ATOM   1716  C CD1 . LEU B  2 38  ? -40.892 4.773   -25.785 1.00 24.33  ? 34  LEU B CD1 1 
ATOM   1717  C CD2 . LEU B  2 38  ? -38.698 4.929   -26.995 1.00 29.77  ? 34  LEU B CD2 1 
ATOM   1718  N N   . GLU B  2 39  ? -42.614 7.880   -27.630 1.00 31.04  ? 35  GLU B N   1 
ATOM   1719  C CA  . GLU B  2 39  ? -42.478 9.316   -27.392 1.00 32.04  ? 35  GLU B CA  1 
ATOM   1720  C C   . GLU B  2 39  ? -41.660 9.318   -26.096 1.00 31.59  ? 35  GLU B C   1 
ATOM   1721  O O   . GLU B  2 39  ? -42.153 8.961   -25.017 1.00 29.03  ? 35  GLU B O   1 
ATOM   1722  C CB  . GLU B  2 39  ? -43.838 9.983   -27.170 1.00 33.82  ? 35  GLU B CB  1 
ATOM   1723  C CG  . GLU B  2 39  ? -43.757 11.452  -26.750 1.00 39.46  ? 35  GLU B CG  1 
ATOM   1724  C CD  . GLU B  2 39  ? -43.144 12.354  -27.823 1.00 42.93  ? 35  GLU B CD  1 
ATOM   1725  O OE1 . GLU B  2 39  ? -42.821 11.849  -28.923 1.00 43.50  ? 35  GLU B OE1 1 
ATOM   1726  O OE2 . GLU B  2 39  ? -42.989 13.571  -27.569 1.00 43.94  ? 35  GLU B OE2 1 
ATOM   1727  N N   . TYR B  2 40  ? -40.404 9.722   -26.230 1.00 31.07  ? 36  TYR B N   1 
ATOM   1728  C CA  . TYR B  2 40  ? -39.453 9.703   -25.140 1.00 30.93  ? 36  TYR B CA  1 
ATOM   1729  C C   . TYR B  2 40  ? -38.775 11.055  -24.936 1.00 32.47  ? 36  TYR B C   1 
ATOM   1730  O O   . TYR B  2 40  ? -38.257 11.684  -25.870 1.00 29.98  ? 36  TYR B O   1 
ATOM   1731  C CB  . TYR B  2 40  ? -38.442 8.603   -25.456 1.00 28.99  ? 36  TYR B CB  1 
ATOM   1732  C CG  . TYR B  2 40  ? -37.442 8.262   -24.381 1.00 28.91  ? 36  TYR B CG  1 
ATOM   1733  C CD1 . TYR B  2 40  ? -37.791 8.261   -23.032 1.00 28.14  ? 36  TYR B CD1 1 
ATOM   1734  C CD2 . TYR B  2 40  ? -36.153 7.873   -24.730 1.00 27.27  ? 36  TYR B CD2 1 
ATOM   1735  C CE1 . TYR B  2 40  ? -36.872 7.876   -22.067 1.00 28.79  ? 36  TYR B CE1 1 
ATOM   1736  C CE2 . TYR B  2 40  ? -35.245 7.493   -23.788 1.00 28.25  ? 36  TYR B CE2 1 
ATOM   1737  C CZ  . TYR B  2 40  ? -35.598 7.493   -22.463 1.00 29.12  ? 36  TYR B CZ  1 
ATOM   1738  O OH  . TYR B  2 40  ? -34.651 7.116   -21.539 1.00 35.30  ? 36  TYR B OH  1 
ATOM   1739  N N   . CYS B  2 41  ? -38.793 11.496  -23.690 1.00 33.34  ? 37  CYS B N   1 
ATOM   1740  C CA  . CYS B  2 41  ? -38.217 12.771  -23.341 1.00 34.91  ? 37  CYS B CA  1 
ATOM   1741  C C   . CYS B  2 41  ? -37.367 12.675  -22.072 1.00 34.73  ? 37  CYS B C   1 
ATOM   1742  O O   . CYS B  2 41  ? -37.788 12.079  -21.068 1.00 32.43  ? 37  CYS B O   1 
ATOM   1743  C CB  . CYS B  2 41  ? -39.339 13.792  -23.159 1.00 37.46  ? 37  CYS B CB  1 
ATOM   1744  S SG  . CYS B  2 41  ? -38.750 15.363  -22.533 1.00 50.71  ? 37  CYS B SG  1 
ATOM   1745  N N   . LYS B  2 42  ? -36.169 13.264  -22.141 1.00 33.05  ? 38  LYS B N   1 
ATOM   1746  C CA  . LYS B  2 42  ? -35.228 13.278  -21.032 1.00 32.88  ? 38  LYS B CA  1 
ATOM   1747  C C   . LYS B  2 42  ? -34.770 14.700  -20.746 1.00 33.81  ? 38  LYS B C   1 
ATOM   1748  O O   . LYS B  2 42  ? -34.180 15.371  -21.599 1.00 33.33  ? 38  LYS B O   1 
ATOM   1749  C CB  . LYS B  2 42  ? -34.016 12.388  -21.332 1.00 33.51  ? 38  LYS B CB  1 
ATOM   1750  C CG  . LYS B  2 42  ? -34.350 10.892  -21.385 1.00 34.55  ? 38  LYS B CG  1 
ATOM   1751  C CD  . LYS B  2 42  ? -33.091 10.013  -21.395 1.00 35.73  ? 38  LYS B CD  1 
ATOM   1752  C CE  . LYS B  2 42  ? -32.262 10.226  -22.657 1.00 38.10  ? 38  LYS B CE  1 
ATOM   1753  N NZ  . LYS B  2 42  ? -30.955 9.502   -22.656 1.00 35.01  ? 38  LYS B NZ  1 
ATOM   1754  N N   . SER B  2 43  ? -35.070 15.157  -19.533 1.00 34.19  ? 39  SER B N   1 
ATOM   1755  C CA  . SER B  2 43  ? -34.711 16.492  -19.075 1.00 35.12  ? 39  SER B CA  1 
ATOM   1756  C C   . SER B  2 43  ? -33.544 16.352  -18.109 1.00 35.72  ? 39  SER B C   1 
ATOM   1757  O O   . SER B  2 43  ? -33.736 15.987  -16.952 1.00 37.33  ? 39  SER B O   1 
ATOM   1758  C CB  . SER B  2 43  ? -35.909 17.132  -18.374 1.00 34.49  ? 39  SER B CB  1 
ATOM   1759  O OG  . SER B  2 43  ? -36.963 17.331  -19.296 1.00 33.44  ? 39  SER B OG  1 
ATOM   1760  N N   . GLU B  2 44  ? -32.338 16.634  -18.594 1.00 36.70  ? 40  GLU B N   1 
ATOM   1761  C CA  . GLU B  2 44  ? -31.122 16.496  -17.790 1.00 38.18  ? 40  GLU B CA  1 
ATOM   1762  C C   . GLU B  2 44  ? -30.587 17.799  -17.208 1.00 38.07  ? 40  GLU B C   1 
ATOM   1763  O O   . GLU B  2 44  ? -30.368 18.771  -17.930 1.00 37.87  ? 40  GLU B O   1 
ATOM   1764  C CB  . GLU B  2 44  ? -30.004 15.884  -18.630 1.00 39.89  ? 40  GLU B CB  1 
ATOM   1765  C CG  . GLU B  2 44  ? -30.464 14.967  -19.738 1.00 44.27  ? 40  GLU B CG  1 
ATOM   1766  C CD  . GLU B  2 44  ? -29.334 14.630  -20.692 1.00 47.30  ? 40  GLU B CD  1 
ATOM   1767  O OE1 . GLU B  2 44  ? -28.491 15.523  -20.935 1.00 48.09  ? 40  GLU B OE1 1 
ATOM   1768  O OE2 . GLU B  2 44  ? -29.291 13.489  -21.207 1.00 48.07  ? 40  GLU B OE2 1 
ATOM   1769  N N   . CYS B  2 45  ? -30.375 17.810  -15.899 1.00 37.94  ? 41  CYS B N   1 
ATOM   1770  C CA  . CYS B  2 45  ? -29.817 18.974  -15.228 1.00 39.75  ? 41  CYS B CA  1 
ATOM   1771  C C   . CYS B  2 45  ? -28.344 18.664  -15.001 1.00 38.91  ? 41  CYS B C   1 
ATOM   1772  O O   . CYS B  2 45  ? -28.018 17.689  -14.329 1.00 37.42  ? 41  CYS B O   1 
ATOM   1773  C CB  . CYS B  2 45  ? -30.460 19.198  -13.861 1.00 43.21  ? 41  CYS B CB  1 
ATOM   1774  S SG  . CYS B  2 45  ? -32.215 19.666  -13.793 1.00 49.28  ? 41  CYS B SG  1 
ATOM   1775  N N   . HIS B  2 46  ? -27.455 19.480  -15.554 1.00 39.70  ? 42  HIS B N   1 
ATOM   1776  C CA  . HIS B  2 46  ? -26.022 19.254  -15.376 1.00 41.61  ? 42  HIS B CA  1 
ATOM   1777  C C   . HIS B  2 46  ? -25.438 20.236  -14.380 1.00 41.82  ? 42  HIS B C   1 
ATOM   1778  O O   . HIS B  2 46  ? -25.524 21.449  -14.554 1.00 43.62  ? 42  HIS B O   1 
ATOM   1779  C CB  . HIS B  2 46  ? -25.310 19.362  -16.720 1.00 40.83  ? 42  HIS B CB  1 
ATOM   1780  C CG  . HIS B  2 46  ? -25.760 18.334  -17.705 1.00 41.98  ? 42  HIS B CG  1 
ATOM   1781  N ND1 . HIS B  2 46  ? -25.127 17.118  -17.852 1.00 42.19  ? 42  HIS B ND1 1 
ATOM   1782  C CD2 . HIS B  2 46  ? -26.819 18.313  -18.549 1.00 41.33  ? 42  HIS B CD2 1 
ATOM   1783  C CE1 . HIS B  2 46  ? -25.775 16.395  -18.747 1.00 41.80  ? 42  HIS B CE1 1 
ATOM   1784  N NE2 . HIS B  2 46  ? -26.806 17.097  -19.185 1.00 40.03  ? 42  HIS B NE2 1 
ATOM   1785  N N   . PHE B  2 47  ? -24.850 19.700  -13.324 1.00 42.63  ? 43  PHE B N   1 
ATOM   1786  C CA  . PHE B  2 47  ? -24.268 20.525  -12.280 1.00 45.40  ? 43  PHE B CA  1 
ATOM   1787  C C   . PHE B  2 47  ? -22.743 20.518  -12.304 1.00 46.86  ? 43  PHE B C   1 
ATOM   1788  O O   . PHE B  2 47  ? -22.114 19.488  -12.528 1.00 45.98  ? 43  PHE B O   1 
ATOM   1789  C CB  . PHE B  2 47  ? -24.766 20.035  -10.925 1.00 43.29  ? 43  PHE B CB  1 
ATOM   1790  C CG  . PHE B  2 47  ? -26.244 20.160  -10.751 1.00 43.70  ? 43  PHE B CG  1 
ATOM   1791  C CD1 . PHE B  2 47  ? -26.796 21.314  -10.202 1.00 41.31  ? 43  PHE B CD1 1 
ATOM   1792  C CD2 . PHE B  2 47  ? -27.095 19.130  -11.157 1.00 43.01  ? 43  PHE B CD2 1 
ATOM   1793  C CE1 . PHE B  2 47  ? -28.174 21.441  -10.055 1.00 41.26  ? 43  PHE B CE1 1 
ATOM   1794  C CE2 . PHE B  2 47  ? -28.476 19.248  -11.016 1.00 40.61  ? 43  PHE B CE2 1 
ATOM   1795  C CZ  . PHE B  2 47  ? -29.016 20.400  -10.466 1.00 40.60  ? 43  PHE B CZ  1 
ATOM   1796  N N   . TYR B  2 48  ? -22.161 21.687  -12.080 1.00 50.46  ? 44  TYR B N   1 
ATOM   1797  C CA  . TYR B  2 48  ? -20.715 21.846  -12.046 1.00 53.69  ? 44  TYR B CA  1 
ATOM   1798  C C   . TYR B  2 48  ? -20.404 22.648  -10.800 1.00 55.93  ? 44  TYR B C   1 
ATOM   1799  O O   . TYR B  2 48  ? -20.813 23.810  -10.671 1.00 55.90  ? 44  TYR B O   1 
ATOM   1800  C CB  . TYR B  2 48  ? -20.238 22.577  -13.296 1.00 54.98  ? 44  TYR B CB  1 
ATOM   1801  C CG  . TYR B  2 48  ? -20.590 21.835  -14.558 1.00 56.50  ? 44  TYR B CG  1 
ATOM   1802  C CD1 . TYR B  2 48  ? -19.940 20.647  -14.893 1.00 56.84  ? 44  TYR B CD1 1 
ATOM   1803  C CD2 . TYR B  2 48  ? -21.615 22.281  -15.389 1.00 56.53  ? 44  TYR B CD2 1 
ATOM   1804  C CE1 . TYR B  2 48  ? -20.307 19.921  -16.017 1.00 56.55  ? 44  TYR B CE1 1 
ATOM   1805  C CE2 . TYR B  2 48  ? -21.988 21.561  -16.519 1.00 56.64  ? 44  TYR B CE2 1 
ATOM   1806  C CZ  . TYR B  2 48  ? -21.331 20.383  -16.821 1.00 56.22  ? 44  TYR B CZ  1 
ATOM   1807  O OH  . TYR B  2 48  ? -21.716 19.647  -17.911 1.00 56.91  ? 44  TYR B OH  1 
ATOM   1808  N N   . ASN B  2 49  ? -19.691 22.015  -9.877  1.00 57.57  ? 45  ASN B N   1 
ATOM   1809  C CA  . ASN B  2 49  ? -19.347 22.652  -8.619  1.00 60.83  ? 45  ASN B CA  1 
ATOM   1810  C C   . ASN B  2 49  ? -20.685 23.028  -7.985  1.00 58.47  ? 45  ASN B C   1 
ATOM   1811  O O   . ASN B  2 49  ? -20.970 24.198  -7.729  1.00 58.39  ? 45  ASN B O   1 
ATOM   1812  C CB  . ASN B  2 49  ? -18.477 23.891  -8.874  1.00 65.79  ? 45  ASN B CB  1 
ATOM   1813  C CG  . ASN B  2 49  ? -17.591 24.243  -7.685  1.00 73.80  ? 45  ASN B CG  1 
ATOM   1814  O OD1 . ASN B  2 49  ? -17.400 23.429  -6.770  1.00 73.92  ? 45  ASN B OD1 1 
ATOM   1815  N ND2 . ASN B  2 49  ? -17.041 25.457  -7.703  1.00 79.96  ? 45  ASN B ND2 1 
ATOM   1816  N N   . GLY B  2 50  ? -21.512 22.011  -7.765  1.00 56.00  ? 46  GLY B N   1 
ATOM   1817  C CA  . GLY B  2 50  ? -22.815 22.222  -7.172  1.00 54.89  ? 46  GLY B CA  1 
ATOM   1818  C C   . GLY B  2 50  ? -23.680 23.104  -8.039  1.00 53.76  ? 46  GLY B C   1 
ATOM   1819  O O   . GLY B  2 50  ? -23.677 22.976  -9.260  1.00 52.16  ? 46  GLY B O   1 
ATOM   1820  N N   . THR B  2 51  ? -24.413 24.006  -7.395  1.00 53.98  ? 47  THR B N   1 
ATOM   1821  C CA  . THR B  2 51  ? -25.301 24.936  -8.074  1.00 54.60  ? 47  THR B CA  1 
ATOM   1822  C C   . THR B  2 51  ? -24.560 26.156  -8.616  1.00 54.15  ? 47  THR B C   1 
ATOM   1823  O O   . THR B  2 51  ? -25.180 27.121  -9.050  1.00 53.76  ? 47  THR B O   1 
ATOM   1824  C CB  . THR B  2 51  ? -26.405 25.415  -7.117  1.00 56.43  ? 47  THR B CB  1 
ATOM   1825  O OG1 . THR B  2 51  ? -25.921 25.363  -5.767  1.00 57.39  ? 47  THR B OG1 1 
ATOM   1826  C CG2 . THR B  2 51  ? -27.638 24.546  -7.241  1.00 57.67  ? 47  THR B CG2 1 
ATOM   1827  N N   . GLN B  2 52  ? -23.232 26.106  -8.595  1.00 54.94  ? 48  GLN B N   1 
ATOM   1828  C CA  . GLN B  2 52  ? -22.412 27.211  -9.086  1.00 57.04  ? 48  GLN B CA  1 
ATOM   1829  C C   . GLN B  2 52  ? -22.726 27.482  -10.556 1.00 56.08  ? 48  GLN B C   1 
ATOM   1830  O O   . GLN B  2 52  ? -22.902 28.627  -10.967 1.00 57.33  ? 48  GLN B O   1 
ATOM   1831  C CB  . GLN B  2 52  ? -20.930 26.874  -8.913  1.00 59.71  ? 48  GLN B CB  1 
ATOM   1832  C CG  . GLN B  2 52  ? -20.065 28.063  -8.549  1.00 64.12  ? 48  GLN B CG  1 
ATOM   1833  C CD  . GLN B  2 52  ? -18.896 28.240  -9.497  1.00 67.75  ? 48  GLN B CD  1 
ATOM   1834  O OE1 . GLN B  2 52  ? -18.033 29.100  -9.285  1.00 69.77  ? 48  GLN B OE1 1 
ATOM   1835  N NE2 . GLN B  2 52  ? -18.860 27.426  -10.554 1.00 68.44  ? 48  GLN B NE2 1 
ATOM   1836  N N   . ARG B  2 53  ? -22.777 26.420  -11.351 1.00 56.02  ? 49  ARG B N   1 
ATOM   1837  C CA  . ARG B  2 53  ? -23.125 26.538  -12.765 1.00 54.97  ? 49  ARG B CA  1 
ATOM   1838  C C   . ARG B  2 53  ? -24.056 25.384  -13.106 1.00 52.11  ? 49  ARG B C   1 
ATOM   1839  O O   . ARG B  2 53  ? -23.689 24.220  -12.956 1.00 50.70  ? 49  ARG B O   1 
ATOM   1840  C CB  . ARG B  2 53  ? -21.887 26.478  -13.661 1.00 57.40  ? 49  ARG B CB  1 
ATOM   1841  C CG  . ARG B  2 53  ? -22.218 26.709  -15.133 1.00 60.87  ? 49  ARG B CG  1 
ATOM   1842  C CD  . ARG B  2 53  ? -20.972 26.782  -15.999 1.00 65.14  ? 49  ARG B CD  1 
ATOM   1843  N NE  . ARG B  2 53  ? -20.666 25.530  -16.690 1.00 68.18  ? 49  ARG B NE  1 
ATOM   1844  C CZ  . ARG B  2 53  ? -21.405 25.017  -17.670 1.00 69.83  ? 49  ARG B CZ  1 
ATOM   1845  N NH1 . ARG B  2 53  ? -22.503 25.647  -18.077 1.00 70.18  ? 49  ARG B NH1 1 
ATOM   1846  N NH2 . ARG B  2 53  ? -21.035 23.885  -18.259 1.00 70.95  ? 49  ARG B NH2 1 
ATOM   1847  N N   . VAL B  2 54  ? -25.266 25.710  -13.543 1.00 49.72  ? 50  VAL B N   1 
ATOM   1848  C CA  . VAL B  2 54  ? -26.247 24.690  -13.894 1.00 47.12  ? 50  VAL B CA  1 
ATOM   1849  C C   . VAL B  2 54  ? -26.645 24.819  -15.357 1.00 45.80  ? 50  VAL B C   1 
ATOM   1850  O O   . VAL B  2 54  ? -26.832 25.918  -15.871 1.00 44.96  ? 50  VAL B O   1 
ATOM   1851  C CB  . VAL B  2 54  ? -27.518 24.812  -13.038 1.00 47.60  ? 50  VAL B CB  1 
ATOM   1852  C CG1 . VAL B  2 54  ? -28.412 23.609  -13.277 1.00 48.46  ? 50  VAL B CG1 1 
ATOM   1853  C CG2 . VAL B  2 54  ? -27.147 24.929  -11.560 1.00 48.54  ? 50  VAL B CG2 1 
ATOM   1854  N N   . ARG B  2 55  ? -26.775 23.684  -16.023 1.00 44.36  ? 51  ARG B N   1 
ATOM   1855  C CA  . ARG B  2 55  ? -27.150 23.671  -17.424 1.00 42.66  ? 51  ARG B CA  1 
ATOM   1856  C C   . ARG B  2 55  ? -28.319 22.710  -17.607 1.00 42.62  ? 51  ARG B C   1 
ATOM   1857  O O   . ARG B  2 55  ? -28.259 21.564  -17.154 1.00 42.61  ? 51  ARG B O   1 
ATOM   1858  C CB  . ARG B  2 55  ? -25.966 23.204  -18.276 1.00 40.19  ? 51  ARG B CB  1 
ATOM   1859  C CG  . ARG B  2 55  ? -26.223 23.263  -19.751 1.00 42.14  ? 51  ARG B CG  1 
ATOM   1860  C CD  . ARG B  2 55  ? -25.133 22.565  -20.535 1.00 41.92  ? 51  ARG B CD  1 
ATOM   1861  N NE  . ARG B  2 55  ? -25.538 22.381  -21.924 1.00 43.97  ? 51  ARG B NE  1 
ATOM   1862  C CZ  . ARG B  2 55  ? -25.193 21.341  -22.675 1.00 43.55  ? 51  ARG B CZ  1 
ATOM   1863  N NH1 . ARG B  2 55  ? -24.425 20.378  -22.180 1.00 42.56  ? 51  ARG B NH1 1 
ATOM   1864  N NH2 . ARG B  2 55  ? -25.638 21.253  -23.918 1.00 44.07  ? 51  ARG B NH2 1 
ATOM   1865  N N   . LEU B  2 56  ? -29.384 23.182  -18.250 1.00 40.03  ? 52  LEU B N   1 
ATOM   1866  C CA  . LEU B  2 56  ? -30.542 22.341  -18.514 1.00 38.41  ? 52  LEU B CA  1 
ATOM   1867  C C   . LEU B  2 56  ? -30.501 21.864  -19.962 1.00 37.34  ? 52  LEU B C   1 
ATOM   1868  O O   . LEU B  2 56  ? -30.390 22.669  -20.883 1.00 39.00  ? 52  LEU B O   1 
ATOM   1869  C CB  . LEU B  2 56  ? -31.854 23.099  -18.275 1.00 37.33  ? 52  LEU B CB  1 
ATOM   1870  C CG  . LEU B  2 56  ? -33.096 22.322  -18.760 1.00 39.99  ? 52  LEU B CG  1 
ATOM   1871  C CD1 . LEU B  2 56  ? -33.156 20.954  -18.057 1.00 38.07  ? 52  LEU B CD1 1 
ATOM   1872  C CD2 . LEU B  2 56  ? -34.375 23.121  -18.505 1.00 37.96  ? 52  LEU B CD2 1 
ATOM   1873  N N   . LEU B  2 57  ? -30.587 20.553  -20.159 1.00 35.91  ? 53  LEU B N   1 
ATOM   1874  C CA  . LEU B  2 57  ? -30.581 19.985  -21.501 1.00 35.01  ? 53  LEU B CA  1 
ATOM   1875  C C   . LEU B  2 57  ? -31.751 19.024  -21.707 1.00 34.88  ? 53  LEU B C   1 
ATOM   1876  O O   . LEU B  2 57  ? -31.646 17.851  -21.361 1.00 37.46  ? 53  LEU B O   1 
ATOM   1877  C CB  . LEU B  2 57  ? -29.273 19.235  -21.754 1.00 33.03  ? 53  LEU B CB  1 
ATOM   1878  C CG  . LEU B  2 57  ? -29.121 18.593  -23.135 1.00 33.79  ? 53  LEU B CG  1 
ATOM   1879  C CD1 . LEU B  2 57  ? -29.338 19.657  -24.196 1.00 33.31  ? 53  LEU B CD1 1 
ATOM   1880  C CD2 . LEU B  2 57  ? -27.742 17.959  -23.287 1.00 31.35  ? 53  LEU B CD2 1 
ATOM   1881  N N   . VAL B  2 58  ? -32.864 19.509  -22.257 1.00 34.25  ? 54  VAL B N   1 
ATOM   1882  C CA  . VAL B  2 58  ? -34.010 18.639  -22.511 1.00 33.65  ? 54  VAL B CA  1 
ATOM   1883  C C   . VAL B  2 58  ? -33.847 17.989  -23.891 1.00 35.00  ? 54  VAL B C   1 
ATOM   1884  O O   . VAL B  2 58  ? -33.481 18.661  -24.853 1.00 36.40  ? 54  VAL B O   1 
ATOM   1885  C CB  . VAL B  2 58  ? -35.351 19.410  -22.476 1.00 33.43  ? 54  VAL B CB  1 
ATOM   1886  C CG1 . VAL B  2 58  ? -36.513 18.429  -22.561 1.00 32.89  ? 54  VAL B CG1 1 
ATOM   1887  C CG2 . VAL B  2 58  ? -35.468 20.216  -21.193 1.00 32.97  ? 54  VAL B CG2 1 
ATOM   1888  N N   . ARG B  2 59  ? -34.107 16.684  -23.988 1.00 34.11  ? 55  ARG B N   1 
ATOM   1889  C CA  . ARG B  2 59  ? -33.970 15.972  -25.259 1.00 33.82  ? 55  ARG B CA  1 
ATOM   1890  C C   . ARG B  2 59  ? -35.192 15.105  -25.575 1.00 32.67  ? 55  ARG B C   1 
ATOM   1891  O O   . ARG B  2 59  ? -35.593 14.256  -24.770 1.00 28.99  ? 55  ARG B O   1 
ATOM   1892  C CB  . ARG B  2 59  ? -32.717 15.099  -25.234 1.00 34.03  ? 55  ARG B CB  1 
ATOM   1893  C CG  . ARG B  2 59  ? -31.445 15.879  -25.009 1.00 36.83  ? 55  ARG B CG  1 
ATOM   1894  C CD  . ARG B  2 59  ? -30.353 14.988  -24.452 1.00 34.23  ? 55  ARG B CD  1 
ATOM   1895  N NE  . ARG B  2 59  ? -29.884 14.028  -25.430 1.00 34.81  ? 55  ARG B NE  1 
ATOM   1896  C CZ  . ARG B  2 59  ? -29.157 12.965  -25.121 1.00 35.38  ? 55  ARG B CZ  1 
ATOM   1897  N NH1 . ARG B  2 59  ? -28.831 12.742  -23.856 1.00 36.48  ? 55  ARG B NH1 1 
ATOM   1898  N NH2 . ARG B  2 59  ? -28.750 12.135  -26.073 1.00 35.96  ? 55  ARG B NH2 1 
ATOM   1899  N N   . TYR B  2 60  ? -35.749 15.323  -26.767 1.00 32.72  ? 56  TYR B N   1 
ATOM   1900  C CA  . TYR B  2 60  ? -36.935 14.624  -27.245 1.00 33.51  ? 56  TYR B CA  1 
ATOM   1901  C C   . TYR B  2 60  ? -36.610 13.566  -28.281 1.00 34.47  ? 56  TYR B C   1 
ATOM   1902  O O   . TYR B  2 60  ? -35.921 13.835  -29.272 1.00 36.48  ? 56  TYR B O   1 
ATOM   1903  C CB  . TYR B  2 60  ? -37.912 15.620  -27.868 1.00 36.21  ? 56  TYR B CB  1 
ATOM   1904  C CG  . TYR B  2 60  ? -38.463 16.636  -26.906 1.00 39.82  ? 56  TYR B CG  1 
ATOM   1905  C CD1 . TYR B  2 60  ? -39.723 16.466  -26.322 1.00 42.94  ? 56  TYR B CD1 1 
ATOM   1906  C CD2 . TYR B  2 60  ? -37.725 17.764  -26.564 1.00 41.58  ? 56  TYR B CD2 1 
ATOM   1907  C CE1 . TYR B  2 60  ? -40.228 17.400  -25.423 1.00 43.98  ? 56  TYR B CE1 1 
ATOM   1908  C CE2 . TYR B  2 60  ? -38.222 18.700  -25.668 1.00 43.54  ? 56  TYR B CE2 1 
ATOM   1909  C CZ  . TYR B  2 60  ? -39.467 18.514  -25.105 1.00 44.95  ? 56  TYR B CZ  1 
ATOM   1910  O OH  . TYR B  2 60  ? -39.951 19.455  -24.226 1.00 50.51  ? 56  TYR B OH  1 
ATOM   1911  N N   . PHE B  2 61  ? -37.128 12.363  -28.062 1.00 32.98  ? 57  PHE B N   1 
ATOM   1912  C CA  . PHE B  2 61  ? -36.899 11.264  -28.984 1.00 32.37  ? 57  PHE B CA  1 
ATOM   1913  C C   . PHE B  2 61  ? -38.233 10.714  -29.466 1.00 34.13  ? 57  PHE B C   1 
ATOM   1914  O O   . PHE B  2 61  ? -39.229 10.721  -28.735 1.00 34.72  ? 57  PHE B O   1 
ATOM   1915  C CB  . PHE B  2 61  ? -36.137 10.112  -28.305 1.00 31.47  ? 57  PHE B CB  1 
ATOM   1916  C CG  . PHE B  2 61  ? -34.824 10.513  -27.664 1.00 30.11  ? 57  PHE B CG  1 
ATOM   1917  C CD1 . PHE B  2 61  ? -34.797 11.281  -26.503 1.00 28.16  ? 57  PHE B CD1 1 
ATOM   1918  C CD2 . PHE B  2 61  ? -33.617 10.101  -28.220 1.00 30.24  ? 57  PHE B CD2 1 
ATOM   1919  C CE1 . PHE B  2 61  ? -33.586 11.636  -25.901 1.00 31.54  ? 57  PHE B CE1 1 
ATOM   1920  C CE2 . PHE B  2 61  ? -32.396 10.450  -27.627 1.00 31.99  ? 57  PHE B CE2 1 
ATOM   1921  C CZ  . PHE B  2 61  ? -32.383 11.221  -26.462 1.00 29.79  ? 57  PHE B CZ  1 
ATOM   1922  N N   . TYR B  2 62  ? -38.258 10.261  -30.710 1.00 33.96  ? 58  TYR B N   1 
ATOM   1923  C CA  . TYR B  2 62  ? -39.438 9.627   -31.261 1.00 33.84  ? 58  TYR B CA  1 
ATOM   1924  C C   . TYR B  2 62  ? -38.824 8.363   -31.794 1.00 34.08  ? 58  TYR B C   1 
ATOM   1925  O O   . TYR B  2 62  ? -38.092 8.406   -32.767 1.00 33.40  ? 58  TYR B O   1 
ATOM   1926  C CB  . TYR B  2 62  ? -40.053 10.411  -32.407 1.00 35.22  ? 58  TYR B CB  1 
ATOM   1927  C CG  . TYR B  2 62  ? -41.150 9.615   -33.063 1.00 37.14  ? 58  TYR B CG  1 
ATOM   1928  C CD1 . TYR B  2 62  ? -42.342 9.362   -32.393 1.00 37.56  ? 58  TYR B CD1 1 
ATOM   1929  C CD2 . TYR B  2 62  ? -40.974 9.058   -34.327 1.00 38.20  ? 58  TYR B CD2 1 
ATOM   1930  C CE1 . TYR B  2 62  ? -43.335 8.579   -32.964 1.00 37.20  ? 58  TYR B CE1 1 
ATOM   1931  C CE2 . TYR B  2 62  ? -41.957 8.267   -34.908 1.00 37.31  ? 58  TYR B CE2 1 
ATOM   1932  C CZ  . TYR B  2 62  ? -43.137 8.036   -34.222 1.00 38.78  ? 58  TYR B CZ  1 
ATOM   1933  O OH  . TYR B  2 62  ? -44.138 7.290   -34.804 1.00 41.33  ? 58  TYR B OH  1 
ATOM   1934  N N   . ASN B  2 63  ? -39.099 7.248   -31.126 1.00 35.86  ? 59  ASN B N   1 
ATOM   1935  C CA  . ASN B  2 63  ? -38.541 5.951   -31.494 1.00 34.43  ? 59  ASN B CA  1 
ATOM   1936  C C   . ASN B  2 63  ? -37.016 5.907   -31.321 1.00 35.33  ? 59  ASN B C   1 
ATOM   1937  O O   . ASN B  2 63  ? -36.532 6.043   -30.204 1.00 32.72  ? 59  ASN B O   1 
ATOM   1938  C CB  . ASN B  2 63  ? -38.961 5.584   -32.914 1.00 34.37  ? 59  ASN B CB  1 
ATOM   1939  C CG  . ASN B  2 63  ? -40.354 4.958   -32.961 1.00 37.95  ? 59  ASN B CG  1 
ATOM   1940  O OD1 . ASN B  2 63  ? -41.316 5.491   -32.391 1.00 36.06  ? 59  ASN B OD1 1 
ATOM   1941  N ND2 . ASN B  2 63  ? -40.465 3.812   -33.638 1.00 40.51  ? 59  ASN B ND2 1 
ATOM   1942  N N   . LEU B  2 64  ? -36.255 5.740   -32.400 1.00 36.50  ? 60  LEU B N   1 
ATOM   1943  C CA  . LEU B  2 64  ? -34.799 5.661   -32.273 1.00 37.60  ? 60  LEU B CA  1 
ATOM   1944  C C   . LEU B  2 64  ? -33.993 6.931   -32.507 1.00 39.60  ? 60  LEU B C   1 
ATOM   1945  O O   . LEU B  2 64  ? -32.766 6.853   -32.586 1.00 40.56  ? 60  LEU B O   1 
ATOM   1946  C CB  . LEU B  2 64  ? -34.237 4.595   -33.212 1.00 36.59  ? 60  LEU B CB  1 
ATOM   1947  C CG  . LEU B  2 64  ? -34.752 3.167   -33.113 1.00 38.95  ? 60  LEU B CG  1 
ATOM   1948  C CD1 . LEU B  2 64  ? -34.011 2.293   -34.135 1.00 37.10  ? 60  LEU B CD1 1 
ATOM   1949  C CD2 . LEU B  2 64  ? -34.539 2.638   -31.703 1.00 39.61  ? 60  LEU B CD2 1 
ATOM   1950  N N   . GLU B  2 65  ? -34.636 8.093   -32.610 1.00 41.26  ? 61  GLU B N   1 
ATOM   1951  C CA  . GLU B  2 65  ? -33.870 9.313   -32.890 1.00 41.98  ? 61  GLU B CA  1 
ATOM   1952  C C   . GLU B  2 65  ? -34.235 10.570  -32.120 1.00 40.63  ? 61  GLU B C   1 
ATOM   1953  O O   . GLU B  2 65  ? -35.407 10.885  -31.943 1.00 41.00  ? 61  GLU B O   1 
ATOM   1954  C CB  . GLU B  2 65  ? -33.969 9.689   -34.370 1.00 46.07  ? 61  GLU B CB  1 
ATOM   1955  C CG  . GLU B  2 65  ? -33.736 8.589   -35.378 1.00 51.89  ? 61  GLU B CG  1 
ATOM   1956  C CD  . GLU B  2 65  ? -34.014 9.073   -36.803 1.00 58.64  ? 61  GLU B CD  1 
ATOM   1957  O OE1 . GLU B  2 65  ? -34.059 8.226   -37.731 1.00 62.68  ? 61  GLU B OE1 1 
ATOM   1958  O OE2 . GLU B  2 65  ? -34.187 10.305  -36.993 1.00 58.80  ? 61  GLU B OE2 1 
ATOM   1959  N N   . GLU B  2 66  ? -33.215 11.299  -31.694 1.00 37.26  ? 62  GLU B N   1 
ATOM   1960  C CA  . GLU B  2 66  ? -33.422 12.555  -31.012 1.00 38.54  ? 62  GLU B CA  1 
ATOM   1961  C C   . GLU B  2 66  ? -33.860 13.464  -32.160 1.00 37.40  ? 62  GLU B C   1 
ATOM   1962  O O   . GLU B  2 66  ? -33.288 13.408  -33.250 1.00 38.21  ? 62  GLU B O   1 
ATOM   1963  C CB  . GLU B  2 66  ? -32.101 13.072  -30.413 1.00 41.75  ? 62  GLU B CB  1 
ATOM   1964  C CG  . GLU B  2 66  ? -32.255 14.229  -29.425 1.00 46.84  ? 62  GLU B CG  1 
ATOM   1965  C CD  . GLU B  2 66  ? -30.919 14.705  -28.828 1.00 54.22  ? 62  GLU B CD  1 
ATOM   1966  O OE1 . GLU B  2 66  ? -30.067 13.854  -28.469 1.00 54.51  ? 62  GLU B OE1 1 
ATOM   1967  O OE2 . GLU B  2 66  ? -30.727 15.940  -28.701 1.00 56.88  ? 62  GLU B OE2 1 
ATOM   1968  N N   . ASN B  2 67  ? -34.875 14.288  -31.940 1.00 35.37  ? 63  ASN B N   1 
ATOM   1969  C CA  . ASN B  2 67  ? -35.319 15.173  -32.996 1.00 36.34  ? 63  ASN B CA  1 
ATOM   1970  C C   . ASN B  2 67  ? -35.450 16.615  -32.530 1.00 36.69  ? 63  ASN B C   1 
ATOM   1971  O O   . ASN B  2 67  ? -35.595 17.520  -33.348 1.00 37.73  ? 63  ASN B O   1 
ATOM   1972  C CB  . ASN B  2 67  ? -36.661 14.696  -33.538 1.00 36.11  ? 63  ASN B CB  1 
ATOM   1973  C CG  . ASN B  2 67  ? -37.744 14.714  -32.484 1.00 38.74  ? 63  ASN B CG  1 
ATOM   1974  O OD1 . ASN B  2 67  ? -38.071 15.772  -31.927 1.00 37.55  ? 63  ASN B OD1 1 
ATOM   1975  N ND2 . ASN B  2 67  ? -38.309 13.537  -32.193 1.00 38.43  ? 63  ASN B ND2 1 
ATOM   1976  N N   . LEU B  2 68  ? -35.400 16.832  -31.220 1.00 36.09  ? 64  LEU B N   1 
ATOM   1977  C CA  . LEU B  2 68  ? -35.554 18.178  -30.677 1.00 36.09  ? 64  LEU B CA  1 
ATOM   1978  C C   . LEU B  2 68  ? -34.893 18.307  -29.312 1.00 36.93  ? 64  LEU B C   1 
ATOM   1979  O O   . LEU B  2 68  ? -34.736 17.319  -28.592 1.00 37.51  ? 64  LEU B O   1 
ATOM   1980  C CB  . LEU B  2 68  ? -37.038 18.511  -30.525 1.00 34.34  ? 64  LEU B CB  1 
ATOM   1981  C CG  . LEU B  2 68  ? -37.365 19.877  -29.910 1.00 36.87  ? 64  LEU B CG  1 
ATOM   1982  C CD1 . LEU B  2 68  ? -37.149 20.982  -30.956 1.00 34.12  ? 64  LEU B CD1 1 
ATOM   1983  C CD2 . LEU B  2 68  ? -38.811 19.892  -29.425 1.00 36.14  ? 64  LEU B CD2 1 
ATOM   1984  N N   . ARG B  2 69  ? -34.513 19.525  -28.948 1.00 36.51  ? 65  ARG B N   1 
ATOM   1985  C CA  . ARG B  2 69  ? -33.901 19.727  -27.652 1.00 38.89  ? 65  ARG B CA  1 
ATOM   1986  C C   . ARG B  2 69  ? -33.978 21.170  -27.202 1.00 39.17  ? 65  ARG B C   1 
ATOM   1987  O O   . ARG B  2 69  ? -34.242 22.068  -27.997 1.00 38.94  ? 65  ARG B O   1 
ATOM   1988  C CB  . ARG B  2 69  ? -32.439 19.268  -27.661 1.00 40.45  ? 65  ARG B CB  1 
ATOM   1989  C CG  . ARG B  2 69  ? -31.530 20.069  -28.567 1.00 45.08  ? 65  ARG B CG  1 
ATOM   1990  C CD  . ARG B  2 69  ? -30.071 19.797  -28.249 1.00 47.38  ? 65  ARG B CD  1 
ATOM   1991  N NE  . ARG B  2 69  ? -29.793 18.367  -28.148 1.00 50.94  ? 65  ARG B NE  1 
ATOM   1992  C CZ  . ARG B  2 69  ? -28.594 17.849  -27.883 1.00 54.37  ? 65  ARG B CZ  1 
ATOM   1993  N NH1 . ARG B  2 69  ? -27.538 18.641  -27.689 1.00 55.30  ? 65  ARG B NH1 1 
ATOM   1994  N NH2 . ARG B  2 69  ? -28.450 16.533  -27.804 1.00 54.09  ? 65  ARG B NH2 1 
ATOM   1995  N N   . PHE B  2 70  ? -33.784 21.370  -25.904 1.00 38.82  ? 66  PHE B N   1 
ATOM   1996  C CA  . PHE B  2 70  ? -33.780 22.697  -25.320 1.00 38.99  ? 66  PHE B CA  1 
ATOM   1997  C C   . PHE B  2 70  ? -32.552 22.816  -24.430 1.00 38.72  ? 66  PHE B C   1 
ATOM   1998  O O   . PHE B  2 70  ? -32.500 22.227  -23.351 1.00 38.01  ? 66  PHE B O   1 
ATOM   1999  C CB  . PHE B  2 70  ? -35.029 22.938  -24.492 1.00 37.84  ? 66  PHE B CB  1 
ATOM   2000  C CG  . PHE B  2 70  ? -34.997 24.225  -23.728 1.00 37.53  ? 66  PHE B CG  1 
ATOM   2001  C CD1 . PHE B  2 70  ? -34.391 24.294  -22.482 1.00 38.07  ? 66  PHE B CD1 1 
ATOM   2002  C CD2 . PHE B  2 70  ? -35.564 25.374  -24.264 1.00 38.76  ? 66  PHE B CD2 1 
ATOM   2003  C CE1 . PHE B  2 70  ? -34.349 25.485  -21.776 1.00 39.27  ? 66  PHE B CE1 1 
ATOM   2004  C CE2 . PHE B  2 70  ? -35.530 26.572  -23.573 1.00 38.62  ? 66  PHE B CE2 1 
ATOM   2005  C CZ  . PHE B  2 70  ? -34.924 26.632  -22.327 1.00 40.20  ? 66  PHE B CZ  1 
ATOM   2006  N N   . ASP B  2 71  ? -31.565 23.565  -24.910 1.00 39.41  ? 67  ASP B N   1 
ATOM   2007  C CA  . ASP B  2 71  ? -30.312 23.801  -24.192 1.00 40.78  ? 67  ASP B CA  1 
ATOM   2008  C C   . ASP B  2 71  ? -30.474 25.155  -23.495 1.00 41.60  ? 67  ASP B C   1 
ATOM   2009  O O   . ASP B  2 71  ? -30.694 26.164  -24.163 1.00 39.77  ? 67  ASP B O   1 
ATOM   2010  C CB  . ASP B  2 71  ? -29.155 23.877  -25.195 1.00 40.77  ? 67  ASP B CB  1 
ATOM   2011  C CG  . ASP B  2 71  ? -27.789 23.865  -24.528 1.00 43.34  ? 67  ASP B CG  1 
ATOM   2012  O OD1 . ASP B  2 71  ? -27.640 24.428  -23.414 1.00 41.18  ? 67  ASP B OD1 1 
ATOM   2013  O OD2 . ASP B  2 71  ? -26.857 23.293  -25.141 1.00 43.84  ? 67  ASP B OD2 1 
ATOM   2014  N N   . SER B  2 72  ? -30.381 25.180  -22.168 1.00 42.40  ? 68  SER B N   1 
ATOM   2015  C CA  . SER B  2 72  ? -30.534 26.437  -21.440 1.00 45.63  ? 68  SER B CA  1 
ATOM   2016  C C   . SER B  2 72  ? -29.458 27.458  -21.809 1.00 47.53  ? 68  SER B C   1 
ATOM   2017  O O   . SER B  2 72  ? -29.637 28.646  -21.572 1.00 47.97  ? 68  SER B O   1 
ATOM   2018  C CB  . SER B  2 72  ? -30.533 26.204  -19.921 1.00 42.84  ? 68  SER B CB  1 
ATOM   2019  O OG  . SER B  2 72  ? -29.403 25.454  -19.521 1.00 44.97  ? 68  SER B OG  1 
ATOM   2020  N N   . ASP B  2 73  ? -28.346 27.000  -22.382 1.00 49.82  ? 69  ASP B N   1 
ATOM   2021  C CA  . ASP B  2 73  ? -27.284 27.920  -22.792 1.00 51.86  ? 69  ASP B CA  1 
ATOM   2022  C C   . ASP B  2 73  ? -27.719 28.663  -24.055 1.00 53.21  ? 69  ASP B C   1 
ATOM   2023  O O   . ASP B  2 73  ? -27.188 29.733  -24.367 1.00 53.89  ? 69  ASP B O   1 
ATOM   2024  C CB  . ASP B  2 73  ? -25.979 27.185  -23.119 1.00 52.96  ? 69  ASP B CB  1 
ATOM   2025  C CG  . ASP B  2 73  ? -25.338 26.541  -21.913 1.00 55.36  ? 69  ASP B CG  1 
ATOM   2026  O OD1 . ASP B  2 73  ? -25.532 27.043  -20.775 1.00 55.85  ? 69  ASP B OD1 1 
ATOM   2027  O OD2 . ASP B  2 73  ? -24.614 25.537  -22.120 1.00 56.74  ? 69  ASP B OD2 1 
ATOM   2028  N N   . VAL B  2 74  ? -28.662 28.071  -24.792 1.00 52.12  ? 70  VAL B N   1 
ATOM   2029  C CA  . VAL B  2 74  ? -29.168 28.658  -26.026 1.00 49.64  ? 70  VAL B CA  1 
ATOM   2030  C C   . VAL B  2 74  ? -30.428 29.468  -25.764 1.00 49.43  ? 70  VAL B C   1 
ATOM   2031  O O   . VAL B  2 74  ? -30.695 30.453  -26.451 1.00 51.53  ? 70  VAL B O   1 
ATOM   2032  C CB  . VAL B  2 74  ? -29.494 27.580  -27.081 1.00 48.93  ? 70  VAL B CB  1 
ATOM   2033  C CG1 . VAL B  2 74  ? -30.108 28.234  -28.302 1.00 46.87  ? 70  VAL B CG1 1 
ATOM   2034  C CG2 . VAL B  2 74  ? -28.236 26.822  -27.465 1.00 48.47  ? 70  VAL B CG2 1 
ATOM   2035  N N   . GLY B  2 75  ? -31.210 29.040  -24.781 1.00 48.01  ? 71  GLY B N   1 
ATOM   2036  C CA  . GLY B  2 75  ? -32.422 29.758  -24.436 1.00 47.02  ? 71  GLY B CA  1 
ATOM   2037  C C   . GLY B  2 75  ? -33.677 29.446  -25.224 1.00 47.11  ? 71  GLY B C   1 
ATOM   2038  O O   . GLY B  2 75  ? -34.758 29.914  -24.873 1.00 47.50  ? 71  GLY B O   1 
ATOM   2039  N N   . GLU B  2 76  ? -33.553 28.667  -26.290 1.00 47.42  ? 72  GLU B N   1 
ATOM   2040  C CA  . GLU B  2 76  ? -34.721 28.321  -27.092 1.00 47.99  ? 72  GLU B CA  1 
ATOM   2041  C C   . GLU B  2 76  ? -34.634 26.880  -27.572 1.00 47.85  ? 72  GLU B C   1 
ATOM   2042  O O   . GLU B  2 76  ? -33.609 26.229  -27.417 1.00 49.25  ? 72  GLU B O   1 
ATOM   2043  C CB  . GLU B  2 76  ? -34.827 29.239  -28.307 1.00 50.42  ? 72  GLU B CB  1 
ATOM   2044  C CG  . GLU B  2 76  ? -35.033 30.710  -27.986 1.00 54.79  ? 72  GLU B CG  1 
ATOM   2045  C CD  . GLU B  2 76  ? -35.310 31.528  -29.239 1.00 58.69  ? 72  GLU B CD  1 
ATOM   2046  O OE1 . GLU B  2 76  ? -34.507 31.436  -30.191 1.00 61.79  ? 72  GLU B OE1 1 
ATOM   2047  O OE2 . GLU B  2 76  ? -36.328 32.258  -29.280 1.00 60.50  ? 72  GLU B OE2 1 
ATOM   2048  N N   . PHE B  2 77  ? -35.715 26.382  -28.155 1.00 46.48  ? 73  PHE B N   1 
ATOM   2049  C CA  . PHE B  2 77  ? -35.724 25.028  -28.667 1.00 44.57  ? 73  PHE B CA  1 
ATOM   2050  C C   . PHE B  2 77  ? -35.020 25.012  -30.009 1.00 44.02  ? 73  PHE B C   1 
ATOM   2051  O O   . PHE B  2 77  ? -35.012 26.010  -30.717 1.00 45.38  ? 73  PHE B O   1 
ATOM   2052  C CB  . PHE B  2 77  ? -37.160 24.513  -28.841 1.00 42.45  ? 73  PHE B CB  1 
ATOM   2053  C CG  . PHE B  2 77  ? -37.846 24.179  -27.550 1.00 40.68  ? 73  PHE B CG  1 
ATOM   2054  C CD1 . PHE B  2 77  ? -38.509 25.163  -26.821 1.00 41.42  ? 73  PHE B CD1 1 
ATOM   2055  C CD2 . PHE B  2 77  ? -37.802 22.881  -27.043 1.00 40.90  ? 73  PHE B CD2 1 
ATOM   2056  C CE1 . PHE B  2 77  ? -39.125 24.866  -25.598 1.00 41.04  ? 73  PHE B CE1 1 
ATOM   2057  C CE2 . PHE B  2 77  ? -38.409 22.569  -25.826 1.00 40.36  ? 73  PHE B CE2 1 
ATOM   2058  C CZ  . PHE B  2 77  ? -39.074 23.574  -25.099 1.00 41.65  ? 73  PHE B CZ  1 
ATOM   2059  N N   . ARG B  2 78  ? -34.421 23.878  -30.350 1.00 43.74  ? 74  ARG B N   1 
ATOM   2060  C CA  . ARG B  2 78  ? -33.739 23.725  -31.619 1.00 43.42  ? 74  ARG B CA  1 
ATOM   2061  C C   . ARG B  2 78  ? -33.994 22.329  -32.140 1.00 43.81  ? 74  ARG B C   1 
ATOM   2062  O O   . ARG B  2 78  ? -33.851 21.345  -31.418 1.00 45.37  ? 74  ARG B O   1 
ATOM   2063  C CB  . ARG B  2 78  ? -32.235 23.957  -31.464 1.00 44.39  ? 74  ARG B CB  1 
ATOM   2064  C CG  . ARG B  2 78  ? -31.847 25.414  -31.196 1.00 45.67  ? 74  ARG B CG  1 
ATOM   2065  C CD  . ARG B  2 78  ? -32.112 26.335  -32.390 1.00 44.98  ? 74  ARG B CD  1 
ATOM   2066  N NE  . ARG B  2 78  ? -31.746 27.713  -32.066 1.00 47.00  ? 74  ARG B NE  1 
ATOM   2067  C CZ  . ARG B  2 78  ? -32.606 28.669  -31.714 1.00 48.46  ? 74  ARG B CZ  1 
ATOM   2068  N NH1 . ARG B  2 78  ? -33.907 28.420  -31.644 1.00 46.72  ? 74  ARG B NH1 1 
ATOM   2069  N NH2 . ARG B  2 78  ? -32.157 29.882  -31.413 1.00 47.98  ? 74  ARG B NH2 1 
ATOM   2070  N N   . ALA B  2 79  ? -34.393 22.247  -33.399 1.00 45.09  ? 75  ALA B N   1 
ATOM   2071  C CA  . ALA B  2 79  ? -34.675 20.967  -34.015 1.00 43.70  ? 75  ALA B CA  1 
ATOM   2072  C C   . ALA B  2 79  ? -33.348 20.298  -34.284 1.00 43.08  ? 75  ALA B C   1 
ATOM   2073  O O   . ALA B  2 79  ? -32.371 20.967  -34.596 1.00 45.10  ? 75  ALA B O   1 
ATOM   2074  C CB  . ALA B  2 79  ? -35.436 21.169  -35.315 1.00 46.06  ? 75  ALA B CB  1 
ATOM   2075  N N   . VAL B  2 80  ? -33.320 18.979  -34.146 1.00 42.32  ? 76  VAL B N   1 
ATOM   2076  C CA  . VAL B  2 80  ? -32.122 18.186  -34.376 1.00 40.25  ? 76  VAL B CA  1 
ATOM   2077  C C   . VAL B  2 80  ? -32.355 17.457  -35.699 1.00 41.50  ? 76  VAL B C   1 
ATOM   2078  O O   . VAL B  2 80  ? -31.415 17.132  -36.423 1.00 42.40  ? 76  VAL B O   1 
ATOM   2079  C CB  . VAL B  2 80  ? -31.898 17.189  -33.203 1.00 40.56  ? 76  VAL B CB  1 
ATOM   2080  C CG1 . VAL B  2 80  ? -30.680 16.329  -33.447 1.00 38.61  ? 76  VAL B CG1 1 
ATOM   2081  C CG2 . VAL B  2 80  ? -31.734 17.964  -31.904 1.00 40.16  ? 76  VAL B CG2 1 
ATOM   2082  N N   . THR B  2 81  ? -33.624 17.204  -36.005 1.00 41.33  ? 77  THR B N   1 
ATOM   2083  C CA  . THR B  2 81  ? -34.021 16.562  -37.260 1.00 41.14  ? 77  THR B CA  1 
ATOM   2084  C C   . THR B  2 81  ? -35.331 17.229  -37.663 1.00 41.48  ? 77  THR B C   1 
ATOM   2085  O O   . THR B  2 81  ? -35.999 17.835  -36.820 1.00 42.33  ? 77  THR B O   1 
ATOM   2086  C CB  . THR B  2 81  ? -34.251 15.036  -37.120 1.00 38.88  ? 77  THR B CB  1 
ATOM   2087  O OG1 . THR B  2 81  ? -35.306 14.791  -36.182 1.00 43.55  ? 77  THR B OG1 1 
ATOM   2088  C CG2 . THR B  2 81  ? -32.986 14.341  -36.659 1.00 34.45  ? 77  THR B CG2 1 
ATOM   2089  N N   . GLU B  2 82  ? -35.697 17.129  -38.937 1.00 41.89  ? 78  GLU B N   1 
ATOM   2090  C CA  . GLU B  2 82  ? -36.919 17.756  -39.417 1.00 44.44  ? 78  GLU B CA  1 
ATOM   2091  C C   . GLU B  2 82  ? -38.177 17.407  -38.624 1.00 42.36  ? 78  GLU B C   1 
ATOM   2092  O O   . GLU B  2 82  ? -39.085 18.224  -38.520 1.00 41.94  ? 78  GLU B O   1 
ATOM   2093  C CB  . GLU B  2 82  ? -37.123 17.441  -40.901 1.00 50.92  ? 78  GLU B CB  1 
ATOM   2094  C CG  . GLU B  2 82  ? -36.248 18.294  -41.814 1.00 58.17  ? 78  GLU B CG  1 
ATOM   2095  C CD  . GLU B  2 82  ? -36.551 19.781  -41.670 1.00 63.35  ? 78  GLU B CD  1 
ATOM   2096  O OE1 . GLU B  2 82  ? -37.663 20.200  -42.082 1.00 65.36  ? 78  GLU B OE1 1 
ATOM   2097  O OE2 . GLU B  2 82  ? -35.684 20.523  -41.138 1.00 62.55  ? 78  GLU B OE2 1 
ATOM   2098  N N   . LEU B  2 83  ? -38.220 16.214  -38.047 1.00 40.28  ? 79  LEU B N   1 
ATOM   2099  C CA  . LEU B  2 83  ? -39.379 15.790  -37.270 1.00 40.14  ? 79  LEU B CA  1 
ATOM   2100  C C   . LEU B  2 83  ? -39.676 16.693  -36.076 1.00 39.15  ? 79  LEU B C   1 
ATOM   2101  O O   . LEU B  2 83  ? -40.788 16.678  -35.545 1.00 39.33  ? 79  LEU B O   1 
ATOM   2102  C CB  . LEU B  2 83  ? -39.183 14.357  -36.785 1.00 40.26  ? 79  LEU B CB  1 
ATOM   2103  C CG  . LEU B  2 83  ? -40.442 13.513  -36.610 1.00 42.42  ? 79  LEU B CG  1 
ATOM   2104  C CD1 . LEU B  2 83  ? -41.367 13.698  -37.807 1.00 42.70  ? 79  LEU B CD1 1 
ATOM   2105  C CD2 . LEU B  2 83  ? -40.038 12.054  -36.465 1.00 42.70  ? 79  LEU B CD2 1 
ATOM   2106  N N   . GLY B  2 84  ? -38.695 17.492  -35.668 1.00 37.76  ? 80  GLY B N   1 
ATOM   2107  C CA  . GLY B  2 84  ? -38.892 18.368  -34.526 1.00 37.12  ? 80  GLY B CA  1 
ATOM   2108  C C   . GLY B  2 84  ? -39.062 19.829  -34.885 1.00 37.76  ? 80  GLY B C   1 
ATOM   2109  O O   . GLY B  2 84  ? -39.344 20.666  -34.028 1.00 36.84  ? 80  GLY B O   1 
ATOM   2110  N N   . ARG B  2 85  ? -38.888 20.151  -36.156 1.00 39.98  ? 81  ARG B N   1 
ATOM   2111  C CA  . ARG B  2 85  ? -39.043 21.529  -36.597 1.00 42.15  ? 81  ARG B CA  1 
ATOM   2112  C C   . ARG B  2 85  ? -40.404 22.126  -36.196 1.00 41.73  ? 81  ARG B C   1 
ATOM   2113  O O   . ARG B  2 85  ? -40.472 23.251  -35.697 1.00 42.73  ? 81  ARG B O   1 
ATOM   2114  C CB  . ARG B  2 85  ? -38.869 21.608  -38.114 1.00 45.05  ? 81  ARG B CB  1 
ATOM   2115  C CG  . ARG B  2 85  ? -38.960 23.016  -38.642 1.00 51.53  ? 81  ARG B CG  1 
ATOM   2116  C CD  . ARG B  2 85  ? -38.634 23.088  -40.122 1.00 56.07  ? 81  ARG B CD  1 
ATOM   2117  N NE  . ARG B  2 85  ? -39.187 24.306  -40.710 1.00 60.28  ? 81  ARG B NE  1 
ATOM   2118  C CZ  . ARG B  2 85  ? -39.178 24.588  -42.009 1.00 62.20  ? 81  ARG B CZ  1 
ATOM   2119  N NH1 . ARG B  2 85  ? -38.636 23.733  -42.870 1.00 61.89  ? 81  ARG B NH1 1 
ATOM   2120  N NH2 . ARG B  2 85  ? -39.725 25.719  -42.446 1.00 62.95  ? 81  ARG B NH2 1 
ATOM   2121  N N   . PRO B  2 86  ? -41.505 21.378  -36.404 1.00 40.34  ? 82  PRO B N   1 
ATOM   2122  C CA  . PRO B  2 86  ? -42.827 21.903  -36.043 1.00 40.78  ? 82  PRO B CA  1 
ATOM   2123  C C   . PRO B  2 86  ? -42.939 22.345  -34.583 1.00 42.92  ? 82  PRO B C   1 
ATOM   2124  O O   . PRO B  2 86  ? -43.556 23.373  -34.278 1.00 44.48  ? 82  PRO B O   1 
ATOM   2125  C CB  . PRO B  2 86  ? -43.758 20.740  -36.359 1.00 38.82  ? 82  PRO B CB  1 
ATOM   2126  C CG  . PRO B  2 86  ? -43.062 20.049  -37.476 1.00 39.76  ? 82  PRO B CG  1 
ATOM   2127  C CD  . PRO B  2 86  ? -41.628 20.052  -37.036 1.00 38.44  ? 82  PRO B CD  1 
ATOM   2128  N N   . ASP B  2 87  ? -42.345 21.564  -33.684 1.00 42.36  ? 83  ASP B N   1 
ATOM   2129  C CA  . ASP B  2 87  ? -42.400 21.870  -32.266 1.00 42.59  ? 83  ASP B CA  1 
ATOM   2130  C C   . ASP B  2 87  ? -41.601 23.116  -31.953 1.00 44.85  ? 83  ASP B C   1 
ATOM   2131  O O   . ASP B  2 87  ? -42.065 23.998  -31.225 1.00 45.07  ? 83  ASP B O   1 
ATOM   2132  C CB  . ASP B  2 87  ? -41.862 20.689  -31.456 1.00 44.36  ? 83  ASP B CB  1 
ATOM   2133  C CG  . ASP B  2 87  ? -42.583 19.386  -31.773 1.00 46.37  ? 83  ASP B CG  1 
ATOM   2134  O OD1 . ASP B  2 87  ? -43.835 19.373  -31.743 1.00 47.61  ? 83  ASP B OD1 1 
ATOM   2135  O OD2 . ASP B  2 87  ? -41.902 18.377  -32.052 1.00 45.00  ? 83  ASP B OD2 1 
ATOM   2136  N N   . ALA B  2 88  ? -40.395 23.187  -32.512 1.00 45.66  ? 84  ALA B N   1 
ATOM   2137  C CA  . ALA B  2 88  ? -39.507 24.321  -32.298 1.00 45.24  ? 84  ALA B CA  1 
ATOM   2138  C C   . ALA B  2 88  ? -40.205 25.624  -32.635 1.00 46.42  ? 84  ALA B C   1 
ATOM   2139  O O   . ALA B  2 88  ? -40.297 26.528  -31.799 1.00 45.24  ? 84  ALA B O   1 
ATOM   2140  C CB  . ALA B  2 88  ? -38.261 24.168  -33.143 1.00 45.37  ? 84  ALA B CB  1 
ATOM   2141  N N   . GLU B  2 89  ? -40.700 25.714  -33.864 1.00 47.56  ? 85  GLU B N   1 
ATOM   2142  C CA  . GLU B  2 89  ? -41.388 26.914  -34.318 1.00 50.32  ? 85  GLU B CA  1 
ATOM   2143  C C   . GLU B  2 89  ? -42.587 27.195  -33.421 1.00 50.21  ? 85  GLU B C   1 
ATOM   2144  O O   . GLU B  2 89  ? -42.843 28.345  -33.042 1.00 49.41  ? 85  GLU B O   1 
ATOM   2145  C CB  . GLU B  2 89  ? -41.840 26.751  -35.775 1.00 52.92  ? 85  GLU B CB  1 
ATOM   2146  C CG  . GLU B  2 89  ? -40.720 26.301  -36.710 1.00 57.65  ? 85  GLU B CG  1 
ATOM   2147  C CD  . GLU B  2 89  ? -41.112 26.319  -38.184 1.00 61.51  ? 85  GLU B CD  1 
ATOM   2148  O OE1 . GLU B  2 89  ? -42.238 25.886  -38.517 1.00 62.87  ? 85  GLU B OE1 1 
ATOM   2149  O OE2 . GLU B  2 89  ? -40.278 26.756  -39.013 1.00 63.73  ? 85  GLU B OE2 1 
ATOM   2150  N N   . ASN B  2 90  ? -43.311 26.141  -33.061 1.00 49.96  ? 86  ASN B N   1 
ATOM   2151  C CA  . ASN B  2 90  ? -44.473 26.320  -32.209 1.00 50.13  ? 86  ASN B CA  1 
ATOM   2152  C C   . ASN B  2 90  ? -44.112 26.873  -30.841 1.00 50.49  ? 86  ASN B C   1 
ATOM   2153  O O   . ASN B  2 90  ? -44.496 27.991  -30.504 1.00 52.25  ? 86  ASN B O   1 
ATOM   2154  C CB  . ASN B  2 90  ? -45.245 25.012  -32.042 1.00 50.73  ? 86  ASN B CB  1 
ATOM   2155  C CG  . ASN B  2 90  ? -46.327 25.126  -30.990 1.00 51.29  ? 86  ASN B CG  1 
ATOM   2156  O OD1 . ASN B  2 90  ? -46.862 26.209  -30.766 1.00 49.69  ? 86  ASN B OD1 1 
ATOM   2157  N ND2 . ASN B  2 90  ? -46.655 24.014  -30.337 1.00 53.36  ? 86  ASN B ND2 1 
ATOM   2158  N N   . TRP B  2 91  ? -43.368 26.104  -30.055 1.00 50.05  ? 87  TRP B N   1 
ATOM   2159  C CA  . TRP B  2 91  ? -42.992 26.554  -28.722 1.00 49.84  ? 87  TRP B CA  1 
ATOM   2160  C C   . TRP B  2 91  ? -42.124 27.811  -28.685 1.00 50.09  ? 87  TRP B C   1 
ATOM   2161  O O   . TRP B  2 91  ? -42.199 28.579  -27.727 1.00 50.39  ? 87  TRP B O   1 
ATOM   2162  C CB  . TRP B  2 91  ? -42.301 25.426  -27.952 1.00 48.26  ? 87  TRP B CB  1 
ATOM   2163  C CG  . TRP B  2 91  ? -43.177 24.230  -27.780 1.00 48.93  ? 87  TRP B CG  1 
ATOM   2164  C CD1 . TRP B  2 91  ? -44.540 24.210  -27.794 1.00 49.42  ? 87  TRP B CD1 1 
ATOM   2165  C CD2 . TRP B  2 91  ? -42.758 22.874  -27.574 1.00 48.21  ? 87  TRP B CD2 1 
ATOM   2166  N NE1 . TRP B  2 91  ? -44.998 22.926  -27.615 1.00 49.72  ? 87  TRP B NE1 1 
ATOM   2167  C CE2 . TRP B  2 91  ? -43.927 22.087  -27.476 1.00 48.33  ? 87  TRP B CE2 1 
ATOM   2168  C CE3 . TRP B  2 91  ? -41.510 22.249  -27.461 1.00 46.93  ? 87  TRP B CE3 1 
ATOM   2169  C CZ2 . TRP B  2 91  ? -43.885 20.704  -27.273 1.00 49.39  ? 87  TRP B CZ2 1 
ATOM   2170  C CZ3 . TRP B  2 91  ? -41.467 20.876  -27.258 1.00 47.07  ? 87  TRP B CZ3 1 
ATOM   2171  C CH2 . TRP B  2 91  ? -42.649 20.117  -27.166 1.00 47.67  ? 87  TRP B CH2 1 
ATOM   2172  N N   . ASN B  2 92  ? -41.307 28.037  -29.711 1.00 50.55  ? 88  ASN B N   1 
ATOM   2173  C CA  . ASN B  2 92  ? -40.455 29.221  -29.704 1.00 50.67  ? 88  ASN B CA  1 
ATOM   2174  C C   . ASN B  2 92  ? -41.229 30.514  -29.951 1.00 51.56  ? 88  ASN B C   1 
ATOM   2175  O O   . ASN B  2 92  ? -40.708 31.605  -29.725 1.00 52.78  ? 88  ASN B O   1 
ATOM   2176  C CB  . ASN B  2 92  ? -39.305 29.089  -30.721 1.00 49.86  ? 88  ASN B CB  1 
ATOM   2177  C CG  . ASN B  2 92  ? -38.183 28.165  -30.230 1.00 50.28  ? 88  ASN B CG  1 
ATOM   2178  O OD1 . ASN B  2 92  ? -37.980 27.997  -29.020 1.00 48.69  ? 88  ASN B OD1 1 
ATOM   2179  N ND2 . ASN B  2 92  ? -37.444 27.577  -31.168 1.00 48.43  ? 88  ASN B ND2 1 
ATOM   2180  N N   . SER B  2 93  ? -42.474 30.403  -30.401 1.00 51.90  ? 89  SER B N   1 
ATOM   2181  C CA  . SER B  2 93  ? -43.274 31.596  -30.648 1.00 53.11  ? 89  SER B CA  1 
ATOM   2182  C C   . SER B  2 93  ? -44.217 31.865  -29.475 1.00 54.07  ? 89  SER B C   1 
ATOM   2183  O O   . SER B  2 93  ? -45.002 32.809  -29.499 1.00 54.10  ? 89  SER B O   1 
ATOM   2184  C CB  . SER B  2 93  ? -44.068 31.452  -31.956 1.00 52.55  ? 89  SER B CB  1 
ATOM   2185  O OG  . SER B  2 93  ? -44.937 30.329  -31.923 1.00 54.91  ? 89  SER B OG  1 
ATOM   2186  N N   . GLN B  2 94  ? -44.139 31.025  -28.448 1.00 55.69  ? 90  GLN B N   1 
ATOM   2187  C CA  . GLN B  2 94  ? -44.975 31.183  -27.258 1.00 56.67  ? 90  GLN B CA  1 
ATOM   2188  C C   . GLN B  2 94  ? -44.119 31.747  -26.134 1.00 58.05  ? 90  GLN B C   1 
ATOM   2189  O O   . GLN B  2 94  ? -43.568 30.999  -25.339 1.00 59.04  ? 90  GLN B O   1 
ATOM   2190  C CB  . GLN B  2 94  ? -45.539 29.835  -26.809 1.00 56.03  ? 90  GLN B CB  1 
ATOM   2191  C CG  . GLN B  2 94  ? -46.594 29.246  -27.699 1.00 54.18  ? 90  GLN B CG  1 
ATOM   2192  C CD  . GLN B  2 94  ? -46.949 27.825  -27.295 1.00 54.57  ? 90  GLN B CD  1 
ATOM   2193  O OE1 . GLN B  2 94  ? -47.182 27.537  -26.117 1.00 54.47  ? 90  GLN B OE1 1 
ATOM   2194  N NE2 . GLN B  2 94  ? -46.997 26.927  -28.275 1.00 52.67  ? 90  GLN B NE2 1 
ATOM   2195  N N   . PRO B  2 95  ? -44.008 33.079  -26.047 1.00 60.12  ? 91  PRO B N   1 
ATOM   2196  C CA  . PRO B  2 95  ? -43.205 33.726  -25.007 1.00 60.87  ? 91  PRO B CA  1 
ATOM   2197  C C   . PRO B  2 95  ? -43.424 33.235  -23.577 1.00 61.24  ? 91  PRO B C   1 
ATOM   2198  O O   . PRO B  2 95  ? -42.458 33.019  -22.851 1.00 62.09  ? 91  PRO B O   1 
ATOM   2199  C CB  . PRO B  2 95  ? -43.547 35.206  -25.178 1.00 60.90  ? 91  PRO B CB  1 
ATOM   2200  C CG  . PRO B  2 95  ? -44.931 35.170  -25.749 1.00 61.47  ? 91  PRO B CG  1 
ATOM   2201  C CD  . PRO B  2 95  ? -44.799 34.079  -26.780 1.00 60.92  ? 91  PRO B CD  1 
ATOM   2202  N N   . GLU B  2 96  ? -44.677 33.059  -23.166 1.00 62.57  ? 92  GLU B N   1 
ATOM   2203  C CA  . GLU B  2 96  ? -44.950 32.598  -21.802 1.00 63.60  ? 92  GLU B CA  1 
ATOM   2204  C C   . GLU B  2 96  ? -44.303 31.246  -21.546 1.00 62.44  ? 92  GLU B C   1 
ATOM   2205  O O   . GLU B  2 96  ? -43.740 31.004  -20.479 1.00 62.67  ? 92  GLU B O   1 
ATOM   2206  C CB  . GLU B  2 96  ? -46.458 32.481  -21.548 1.00 66.66  ? 92  GLU B CB  1 
ATOM   2207  C CG  . GLU B  2 96  ? -47.230 33.793  -21.666 1.00 70.91  ? 92  GLU B CG  1 
ATOM   2208  C CD  . GLU B  2 96  ? -48.681 33.666  -21.205 1.00 73.27  ? 92  GLU B CD  1 
ATOM   2209  O OE1 . GLU B  2 96  ? -49.389 32.758  -21.696 1.00 73.40  ? 92  GLU B OE1 1 
ATOM   2210  O OE2 . GLU B  2 96  ? -49.115 34.478  -20.354 1.00 74.33  ? 92  GLU B OE2 1 
ATOM   2211  N N   . PHE B  2 97  ? -44.384 30.369  -22.539 1.00 61.25  ? 93  PHE B N   1 
ATOM   2212  C CA  . PHE B  2 97  ? -43.822 29.032  -22.428 1.00 59.65  ? 93  PHE B CA  1 
ATOM   2213  C C   . PHE B  2 97  ? -42.297 29.044  -22.295 1.00 58.63  ? 93  PHE B C   1 
ATOM   2214  O O   . PHE B  2 97  ? -41.743 28.364  -21.437 1.00 58.88  ? 93  PHE B O   1 
ATOM   2215  C CB  . PHE B  2 97  ? -44.239 28.194  -23.640 1.00 58.87  ? 93  PHE B CB  1 
ATOM   2216  C CG  . PHE B  2 97  ? -43.933 26.737  -23.495 1.00 58.73  ? 93  PHE B CG  1 
ATOM   2217  C CD1 . PHE B  2 97  ? -44.469 26.005  -22.437 1.00 59.81  ? 93  PHE B CD1 1 
ATOM   2218  C CD2 . PHE B  2 97  ? -43.094 26.097  -24.398 1.00 57.95  ? 93  PHE B CD2 1 
ATOM   2219  C CE1 . PHE B  2 97  ? -44.172 24.654  -22.279 1.00 59.55  ? 93  PHE B CE1 1 
ATOM   2220  C CE2 . PHE B  2 97  ? -42.789 24.747  -24.252 1.00 58.57  ? 93  PHE B CE2 1 
ATOM   2221  C CZ  . PHE B  2 97  ? -43.329 24.024  -23.189 1.00 60.03  ? 93  PHE B CZ  1 
ATOM   2222  N N   . LEU B  2 98  ? -41.625 29.815  -23.141 1.00 58.04  ? 94  LEU B N   1 
ATOM   2223  C CA  . LEU B  2 98  ? -40.171 29.901  -23.101 1.00 58.75  ? 94  LEU B CA  1 
ATOM   2224  C C   . LEU B  2 98  ? -39.681 30.436  -21.768 1.00 59.42  ? 94  LEU B C   1 
ATOM   2225  O O   . LEU B  2 98  ? -38.694 29.950  -21.216 1.00 59.55  ? 94  LEU B O   1 
ATOM   2226  C CB  . LEU B  2 98  ? -39.652 30.800  -24.226 1.00 58.33  ? 94  LEU B CB  1 
ATOM   2227  C CG  . LEU B  2 98  ? -39.547 30.166  -25.612 1.00 58.31  ? 94  LEU B CG  1 
ATOM   2228  C CD1 . LEU B  2 98  ? -39.070 31.187  -26.628 1.00 56.92  ? 94  LEU B CD1 1 
ATOM   2229  C CD2 . LEU B  2 98  ? -38.573 29.004  -25.543 1.00 59.98  ? 94  LEU B CD2 1 
ATOM   2230  N N   . GLU B  2 99  ? -40.373 31.446  -21.257 1.00 61.25  ? 95  GLU B N   1 
ATOM   2231  C CA  . GLU B  2 99  ? -40.000 32.049  -19.984 1.00 62.14  ? 95  GLU B CA  1 
ATOM   2232  C C   . GLU B  2 99  ? -39.984 30.939  -18.950 1.00 60.47  ? 95  GLU B C   1 
ATOM   2233  O O   . GLU B  2 99  ? -39.001 30.751  -18.240 1.00 59.09  ? 95  GLU B O   1 
ATOM   2234  C CB  . GLU B  2 99  ? -41.018 33.118  -19.587 1.00 64.50  ? 95  GLU B CB  1 
ATOM   2235  C CG  . GLU B  2 99  ? -40.556 34.030  -18.456 1.00 69.49  ? 95  GLU B CG  1 
ATOM   2236  C CD  . GLU B  2 99  ? -41.630 35.020  -18.040 1.00 71.73  ? 95  GLU B CD  1 
ATOM   2237  O OE1 . GLU B  2 99  ? -42.078 35.811  -18.903 1.00 73.37  ? 95  GLU B OE1 1 
ATOM   2238  O OE2 . GLU B  2 99  ? -42.029 35.008  -16.852 1.00 73.44  ? 95  GLU B OE2 1 
ATOM   2239  N N   . GLN B  2 100 ? -41.086 30.200  -18.895 1.00 59.66  ? 96  GLN B N   1 
ATOM   2240  C CA  . GLN B  2 100 ? -41.246 29.083  -17.975 1.00 59.65  ? 96  GLN B CA  1 
ATOM   2241  C C   . GLN B  2 100 ? -40.109 28.061  -18.100 1.00 57.70  ? 96  GLN B C   1 
ATOM   2242  O O   . GLN B  2 100 ? -39.498 27.663  -17.104 1.00 57.08  ? 96  GLN B O   1 
ATOM   2243  C CB  . GLN B  2 100 ? -42.572 28.386  -18.254 1.00 63.62  ? 96  GLN B CB  1 
ATOM   2244  C CG  . GLN B  2 100 ? -42.869 27.235  -17.318 1.00 70.13  ? 96  GLN B CG  1 
ATOM   2245  C CD  . GLN B  2 100 ? -44.072 26.434  -17.765 1.00 73.39  ? 96  GLN B CD  1 
ATOM   2246  O OE1 . GLN B  2 100 ? -45.118 26.997  -18.105 1.00 75.06  ? 96  GLN B OE1 1 
ATOM   2247  N NE2 . GLN B  2 100 ? -43.935 25.111  -17.760 1.00 74.97  ? 96  GLN B NE2 1 
ATOM   2248  N N   . LYS B  2 101 ? -39.831 27.643  -19.330 1.00 54.45  ? 97  LYS B N   1 
ATOM   2249  C CA  . LYS B  2 101 ? -38.787 26.665  -19.581 1.00 52.07  ? 97  LYS B CA  1 
ATOM   2250  C C   . LYS B  2 101 ? -37.431 27.182  -19.121 1.00 52.01  ? 97  LYS B C   1 
ATOM   2251  O O   . LYS B  2 101 ? -36.639 26.443  -18.533 1.00 50.30  ? 97  LYS B O   1 
ATOM   2252  C CB  . LYS B  2 101 ? -38.746 26.311  -21.072 1.00 51.53  ? 97  LYS B CB  1 
ATOM   2253  C CG  . LYS B  2 101 ? -38.395 24.863  -21.323 1.00 50.70  ? 97  LYS B CG  1 
ATOM   2254  C CD  . LYS B  2 101 ? -39.398 23.988  -20.609 1.00 52.13  ? 97  LYS B CD  1 
ATOM   2255  C CE  . LYS B  2 101 ? -38.989 22.542  -20.608 1.00 52.97  ? 97  LYS B CE  1 
ATOM   2256  N NZ  . LYS B  2 101 ? -39.970 21.728  -19.834 1.00 53.77  ? 97  LYS B NZ  1 
ATOM   2257  N N   . ARG B  2 102 ? -37.166 28.454  -19.392 1.00 51.86  ? 98  ARG B N   1 
ATOM   2258  C CA  . ARG B  2 102 ? -35.910 29.075  -18.990 1.00 52.31  ? 98  ARG B CA  1 
ATOM   2259  C C   . ARG B  2 102 ? -35.808 29.167  -17.467 1.00 52.50  ? 98  ARG B C   1 
ATOM   2260  O O   . ARG B  2 102 ? -34.707 29.189  -16.905 1.00 53.34  ? 98  ARG B O   1 
ATOM   2261  C CB  . ARG B  2 102 ? -35.799 30.479  -19.588 1.00 51.84  ? 98  ARG B CB  1 
ATOM   2262  C CG  . ARG B  2 102 ? -35.648 30.497  -21.097 1.00 52.98  ? 98  ARG B CG  1 
ATOM   2263  C CD  . ARG B  2 102 ? -35.638 31.916  -21.613 1.00 52.40  ? 98  ARG B CD  1 
ATOM   2264  N NE  . ARG B  2 102 ? -35.481 31.965  -23.059 1.00 52.67  ? 98  ARG B NE  1 
ATOM   2265  C CZ  . ARG B  2 102 ? -35.934 32.960  -23.811 1.00 54.01  ? 98  ARG B CZ  1 
ATOM   2266  N NH1 . ARG B  2 102 ? -36.570 33.976  -23.242 1.00 54.42  ? 98  ARG B NH1 1 
ATOM   2267  N NH2 . ARG B  2 102 ? -35.758 32.942  -25.125 1.00 54.55  ? 98  ARG B NH2 1 
ATOM   2268  N N   . ALA B  2 103 ? -36.961 29.213  -16.807 1.00 51.49  ? 99  ALA B N   1 
ATOM   2269  C CA  . ALA B  2 103 ? -37.011 29.322  -15.354 1.00 51.75  ? 99  ALA B CA  1 
ATOM   2270  C C   . ALA B  2 103 ? -36.829 27.981  -14.646 1.00 51.47  ? 99  ALA B C   1 
ATOM   2271  O O   . ALA B  2 103 ? -36.472 27.939  -13.467 1.00 51.45  ? 99  ALA B O   1 
ATOM   2272  C CB  . ALA B  2 103 ? -38.331 29.960  -14.927 1.00 51.22  ? 99  ALA B CB  1 
ATOM   2273  N N   . GLU B  2 104 ? -37.064 26.888  -15.359 1.00 50.95  ? 100 GLU B N   1 
ATOM   2274  C CA  . GLU B  2 104 ? -36.926 25.574  -14.755 1.00 51.30  ? 100 GLU B CA  1 
ATOM   2275  C C   . GLU B  2 104 ? -35.496 25.265  -14.321 1.00 51.26  ? 100 GLU B C   1 
ATOM   2276  O O   . GLU B  2 104 ? -35.265 24.337  -13.550 1.00 52.05  ? 100 GLU B O   1 
ATOM   2277  C CB  . GLU B  2 104 ? -37.475 24.506  -15.703 1.00 51.99  ? 100 GLU B CB  1 
ATOM   2278  C CG  . GLU B  2 104 ? -38.947 24.757  -16.053 1.00 52.80  ? 100 GLU B CG  1 
ATOM   2279  C CD  . GLU B  2 104 ? -39.654 23.552  -16.648 1.00 54.38  ? 100 GLU B CD  1 
ATOM   2280  O OE1 . GLU B  2 104 ? -39.050 22.864  -17.496 1.00 54.74  ? 100 GLU B OE1 1 
ATOM   2281  O OE2 . GLU B  2 104 ? -40.827 23.305  -16.280 1.00 55.17  ? 100 GLU B OE2 1 
ATOM   2282  N N   . VAL B  2 105 ? -34.538 26.054  -14.796 1.00 51.25  ? 101 VAL B N   1 
ATOM   2283  C CA  . VAL B  2 105 ? -33.145 25.856  -14.402 1.00 51.80  ? 101 VAL B CA  1 
ATOM   2284  C C   . VAL B  2 105 ? -33.058 26.217  -12.920 1.00 50.06  ? 101 VAL B C   1 
ATOM   2285  O O   . VAL B  2 105 ? -32.182 25.751  -12.192 1.00 48.34  ? 101 VAL B O   1 
ATOM   2286  C CB  . VAL B  2 105 ? -32.188 26.786  -15.192 1.00 52.28  ? 101 VAL B CB  1 
ATOM   2287  C CG1 . VAL B  2 105 ? -30.758 26.490  -14.814 1.00 54.56  ? 101 VAL B CG1 1 
ATOM   2288  C CG2 . VAL B  2 105 ? -32.383 26.592  -16.686 1.00 53.09  ? 101 VAL B CG2 1 
ATOM   2289  N N   . ASP B  2 106 ? -34.003 27.045  -12.491 1.00 49.87  ? 102 ASP B N   1 
ATOM   2290  C CA  . ASP B  2 106 ? -34.076 27.516  -11.118 1.00 50.30  ? 102 ASP B CA  1 
ATOM   2291  C C   . ASP B  2 106 ? -35.166 26.799  -10.325 1.00 48.82  ? 102 ASP B C   1 
ATOM   2292  O O   . ASP B  2 106 ? -34.886 26.226  -9.278  1.00 49.20  ? 102 ASP B O   1 
ATOM   2293  C CB  . ASP B  2 106 ? -34.326 29.027  -11.122 1.00 53.34  ? 102 ASP B CB  1 
ATOM   2294  C CG  . ASP B  2 106 ? -34.247 29.637  -9.743  1.00 56.85  ? 102 ASP B CG  1 
ATOM   2295  O OD1 . ASP B  2 106 ? -33.206 29.454  -9.067  1.00 60.37  ? 102 ASP B OD1 1 
ATOM   2296  O OD2 . ASP B  2 106 ? -35.222 30.309  -9.337  1.00 57.74  ? 102 ASP B OD2 1 
ATOM   2297  N N   . THR B  2 107 ? -36.398 26.824  -10.831 1.00 47.27  ? 103 THR B N   1 
ATOM   2298  C CA  . THR B  2 107 ? -37.526 26.178  -10.160 1.00 47.21  ? 103 THR B CA  1 
ATOM   2299  C C   . THR B  2 107 ? -37.471 24.649  -10.153 1.00 46.86  ? 103 THR B C   1 
ATOM   2300  O O   . THR B  2 107 ? -38.172 24.013  -9.369  1.00 46.72  ? 103 THR B O   1 
ATOM   2301  C CB  . THR B  2 107 ? -38.872 26.569  -10.787 1.00 47.29  ? 103 THR B CB  1 
ATOM   2302  O OG1 . THR B  2 107 ? -38.883 26.188  -12.170 1.00 48.07  ? 103 THR B OG1 1 
ATOM   2303  C CG2 . THR B  2 107 ? -39.105 28.057  -10.656 1.00 49.14  ? 103 THR B CG2 1 
ATOM   2304  N N   . VAL B  2 108 ? -36.661 24.053  -11.021 1.00 46.04  ? 104 VAL B N   1 
ATOM   2305  C CA  . VAL B  2 108 ? -36.567 22.600  -11.037 1.00 45.97  ? 104 VAL B CA  1 
ATOM   2306  C C   . VAL B  2 108 ? -35.172 22.047  -10.756 1.00 45.42  ? 104 VAL B C   1 
ATOM   2307  O O   . VAL B  2 108 ? -34.996 21.279  -9.809  1.00 44.53  ? 104 VAL B O   1 
ATOM   2308  C CB  . VAL B  2 108 ? -37.090 22.008  -12.360 1.00 45.83  ? 104 VAL B CB  1 
ATOM   2309  C CG1 . VAL B  2 108 ? -36.997 20.492  -12.315 1.00 43.88  ? 104 VAL B CG1 1 
ATOM   2310  C CG2 . VAL B  2 108 ? -38.543 22.431  -12.575 1.00 46.63  ? 104 VAL B CG2 1 
ATOM   2311  N N   . CYS B  2 109 ? -34.184 22.429  -11.559 1.00 45.51  ? 105 CYS B N   1 
ATOM   2312  C CA  . CYS B  2 109 ? -32.825 21.931  -11.349 1.00 46.01  ? 105 CYS B CA  1 
ATOM   2313  C C   . CYS B  2 109 ? -32.226 22.320  -9.990  1.00 45.62  ? 105 CYS B C   1 
ATOM   2314  O O   . CYS B  2 109 ? -31.943 21.454  -9.164  1.00 45.07  ? 105 CYS B O   1 
ATOM   2315  C CB  . CYS B  2 109 ? -31.908 22.408  -12.473 1.00 47.00  ? 105 CYS B CB  1 
ATOM   2316  S SG  . CYS B  2 109 ? -32.234 21.683  -14.115 1.00 50.28  ? 105 CYS B SG  1 
ATOM   2317  N N   . ARG B  2 110 ? -32.028 23.615  -9.754  1.00 46.26  ? 106 ARG B N   1 
ATOM   2318  C CA  . ARG B  2 110 ? -31.468 24.074  -8.482  1.00 46.73  ? 106 ARG B CA  1 
ATOM   2319  C C   . ARG B  2 110 ? -32.347 23.654  -7.312  1.00 46.64  ? 106 ARG B C   1 
ATOM   2320  O O   . ARG B  2 110 ? -31.859 23.126  -6.309  1.00 47.10  ? 106 ARG B O   1 
ATOM   2321  C CB  . ARG B  2 110 ? -31.310 25.599  -8.468  1.00 47.58  ? 106 ARG B CB  1 
ATOM   2322  C CG  . ARG B  2 110 ? -30.094 26.099  -9.217  1.00 50.63  ? 106 ARG B CG  1 
ATOM   2323  C CD  . ARG B  2 110 ? -29.628 27.449  -8.663  1.00 54.22  ? 106 ARG B CD  1 
ATOM   2324  N NE  . ARG B  2 110 ? -28.408 27.914  -9.322  1.00 55.23  ? 106 ARG B NE  1 
ATOM   2325  C CZ  . ARG B  2 110 ? -28.336 28.240  -10.610 1.00 55.87  ? 106 ARG B CZ  1 
ATOM   2326  N NH1 . ARG B  2 110 ? -29.422 28.158  -11.376 1.00 55.66  ? 106 ARG B NH1 1 
ATOM   2327  N NH2 . ARG B  2 110 ? -27.174 28.625  -11.137 1.00 56.40  ? 106 ARG B NH2 1 
ATOM   2328  N N   . HIS B  2 111 ? -33.645 23.905  -7.443  1.00 45.47  ? 107 HIS B N   1 
ATOM   2329  C CA  . HIS B  2 111 ? -34.596 23.544  -6.406  1.00 45.59  ? 107 HIS B CA  1 
ATOM   2330  C C   . HIS B  2 111 ? -34.402 22.090  -5.958  1.00 45.11  ? 107 HIS B C   1 
ATOM   2331  O O   . HIS B  2 111 ? -34.158 21.827  -4.777  1.00 44.57  ? 107 HIS B O   1 
ATOM   2332  C CB  . HIS B  2 111 ? -36.029 23.740  -6.915  1.00 46.71  ? 107 HIS B CB  1 
ATOM   2333  C CG  . HIS B  2 111 ? -37.077 23.327  -5.931  1.00 50.69  ? 107 HIS B CG  1 
ATOM   2334  N ND1 . HIS B  2 111 ? -37.392 24.077  -4.818  1.00 51.42  ? 107 HIS B ND1 1 
ATOM   2335  C CD2 . HIS B  2 111 ? -37.841 22.211  -5.860  1.00 51.97  ? 107 HIS B CD2 1 
ATOM   2336  C CE1 . HIS B  2 111 ? -38.304 23.441  -4.105  1.00 51.67  ? 107 HIS B CE1 1 
ATOM   2337  N NE2 . HIS B  2 111 ? -38.593 22.306  -4.715  1.00 52.64  ? 107 HIS B NE2 1 
ATOM   2338  N N   . ASN B  2 112 ? -34.509 21.149  -6.896  1.00 44.46  ? 108 ASN B N   1 
ATOM   2339  C CA  . ASN B  2 112 ? -34.355 19.737  -6.558  1.00 43.57  ? 108 ASN B CA  1 
ATOM   2340  C C   . ASN B  2 112 ? -32.954 19.399  -6.091  1.00 44.07  ? 108 ASN B C   1 
ATOM   2341  O O   . ASN B  2 112 ? -32.780 18.511  -5.246  1.00 43.93  ? 108 ASN B O   1 
ATOM   2342  C CB  . ASN B  2 112 ? -34.702 18.828  -7.736  1.00 42.36  ? 108 ASN B CB  1 
ATOM   2343  C CG  . ASN B  2 112 ? -36.179 18.839  -8.075  1.00 41.64  ? 108 ASN B CG  1 
ATOM   2344  O OD1 . ASN B  2 112 ? -37.025 19.057  -7.210  1.00 41.62  ? 108 ASN B OD1 1 
ATOM   2345  N ND2 . ASN B  2 112 ? -36.496 18.580  -9.343  1.00 39.32  ? 108 ASN B ND2 1 
ATOM   2346  N N   . TYR B  2 113 ? -31.952 20.087  -6.633  1.00 43.18  ? 109 TYR B N   1 
ATOM   2347  C CA  . TYR B  2 113 ? -30.581 19.807  -6.221  1.00 44.58  ? 109 TYR B CA  1 
ATOM   2348  C C   . TYR B  2 113 ? -30.422 20.050  -4.723  1.00 45.29  ? 109 TYR B C   1 
ATOM   2349  O O   . TYR B  2 113 ? -29.803 19.251  -4.023  1.00 45.30  ? 109 TYR B O   1 
ATOM   2350  C CB  . TYR B  2 113 ? -29.581 20.682  -6.976  1.00 44.49  ? 109 TYR B CB  1 
ATOM   2351  C CG  . TYR B  2 113 ? -28.146 20.346  -6.646  1.00 45.68  ? 109 TYR B CG  1 
ATOM   2352  C CD1 . TYR B  2 113 ? -27.431 19.417  -7.407  1.00 46.68  ? 109 TYR B CD1 1 
ATOM   2353  C CD2 . TYR B  2 113 ? -27.516 20.911  -5.536  1.00 45.72  ? 109 TYR B CD2 1 
ATOM   2354  C CE1 . TYR B  2 113 ? -26.126 19.060  -7.065  1.00 46.83  ? 109 TYR B CE1 1 
ATOM   2355  C CE2 . TYR B  2 113 ? -26.217 20.561  -5.188  1.00 46.17  ? 109 TYR B CE2 1 
ATOM   2356  C CZ  . TYR B  2 113 ? -25.529 19.637  -5.953  1.00 47.41  ? 109 TYR B CZ  1 
ATOM   2357  O OH  . TYR B  2 113 ? -24.245 19.289  -5.603  1.00 50.67  ? 109 TYR B OH  1 
ATOM   2358  N N   . GLU B  2 114 ? -30.978 21.157  -4.237  1.00 46.46  ? 110 GLU B N   1 
ATOM   2359  C CA  . GLU B  2 114 ? -30.888 21.493  -2.821  1.00 48.46  ? 110 GLU B CA  1 
ATOM   2360  C C   . GLU B  2 114 ? -31.565 20.453  -1.947  1.00 48.20  ? 110 GLU B C   1 
ATOM   2361  O O   . GLU B  2 114 ? -31.222 20.306  -0.778  1.00 49.39  ? 110 GLU B O   1 
ATOM   2362  C CB  . GLU B  2 114 ? -31.486 22.878  -2.564  1.00 50.58  ? 110 GLU B CB  1 
ATOM   2363  C CG  . GLU B  2 114 ? -30.539 24.007  -2.965  1.00 57.51  ? 110 GLU B CG  1 
ATOM   2364  C CD  . GLU B  2 114 ? -31.204 25.365  -2.973  1.00 61.93  ? 110 GLU B CD  1 
ATOM   2365  O OE1 . GLU B  2 114 ? -31.787 25.742  -1.933  1.00 65.23  ? 110 GLU B OE1 1 
ATOM   2366  O OE2 . GLU B  2 114 ? -31.142 26.055  -4.018  1.00 63.49  ? 110 GLU B OE2 1 
ATOM   2367  N N   . ILE B  2 115 ? -32.521 19.727  -2.523  1.00 47.69  ? 111 ILE B N   1 
ATOM   2368  C CA  . ILE B  2 115 ? -33.237 18.684  -1.798  1.00 44.91  ? 111 ILE B CA  1 
ATOM   2369  C C   . ILE B  2 115 ? -32.398 17.407  -1.775  1.00 44.86  ? 111 ILE B C   1 
ATOM   2370  O O   . ILE B  2 115 ? -32.306 16.741  -0.747  1.00 44.87  ? 111 ILE B O   1 
ATOM   2371  C CB  . ILE B  2 115 ? -34.603 18.383  -2.459  1.00 44.39  ? 111 ILE B CB  1 
ATOM   2372  C CG1 . ILE B  2 115 ? -35.469 19.639  -2.455  1.00 42.79  ? 111 ILE B CG1 1 
ATOM   2373  C CG2 . ILE B  2 115 ? -35.309 17.249  -1.730  1.00 42.95  ? 111 ILE B CG2 1 
ATOM   2374  C CD1 . ILE B  2 115 ? -36.818 19.460  -3.120  1.00 40.79  ? 111 ILE B CD1 1 
ATOM   2375  N N   . PHE B  2 116 ? -31.786 17.064  -2.906  1.00 44.79  ? 112 PHE B N   1 
ATOM   2376  C CA  . PHE B  2 116 ? -30.964 15.856  -2.976  1.00 45.58  ? 112 PHE B CA  1 
ATOM   2377  C C   . PHE B  2 116 ? -29.597 16.086  -2.328  1.00 46.57  ? 112 PHE B C   1 
ATOM   2378  O O   . PHE B  2 116 ? -28.867 15.138  -2.025  1.00 46.35  ? 112 PHE B O   1 
ATOM   2379  C CB  . PHE B  2 116 ? -30.766 15.408  -4.432  1.00 43.98  ? 112 PHE B CB  1 
ATOM   2380  C CG  . PHE B  2 116 ? -32.047 15.124  -5.163  1.00 43.71  ? 112 PHE B CG  1 
ATOM   2381  C CD1 . PHE B  2 116 ? -33.078 14.425  -4.544  1.00 43.04  ? 112 PHE B CD1 1 
ATOM   2382  C CD2 . PHE B  2 116 ? -32.230 15.566  -6.475  1.00 41.24  ? 112 PHE B CD2 1 
ATOM   2383  C CE1 . PHE B  2 116 ? -34.277 14.175  -5.222  1.00 42.19  ? 112 PHE B CE1 1 
ATOM   2384  C CE2 . PHE B  2 116 ? -33.416 15.322  -7.153  1.00 38.93  ? 112 PHE B CE2 1 
ATOM   2385  C CZ  . PHE B  2 116 ? -34.442 14.626  -6.525  1.00 40.39  ? 112 PHE B CZ  1 
ATOM   2386  N N   . ASP B  2 117 ? -29.250 17.351  -2.118  1.00 47.87  ? 113 ASP B N   1 
ATOM   2387  C CA  . ASP B  2 117 ? -27.973 17.663  -1.505  1.00 49.33  ? 113 ASP B CA  1 
ATOM   2388  C C   . ASP B  2 117 ? -27.953 17.303  -0.023  1.00 48.48  ? 113 ASP B C   1 
ATOM   2389  O O   . ASP B  2 117 ? -26.916 17.413  0.623   1.00 48.22  ? 113 ASP B O   1 
ATOM   2390  C CB  . ASP B  2 117 ? -27.635 19.141  -1.692  1.00 51.38  ? 113 ASP B CB  1 
ATOM   2391  C CG  . ASP B  2 117 ? -26.202 19.454  -1.317  1.00 54.04  ? 113 ASP B CG  1 
ATOM   2392  O OD1 . ASP B  2 117 ? -25.308 18.649  -1.664  1.00 55.71  ? 113 ASP B OD1 1 
ATOM   2393  O OD2 . ASP B  2 117 ? -25.966 20.503  -0.684  1.00 57.05  ? 113 ASP B OD2 1 
ATOM   2394  N N   . ASN B  2 118 ? -29.092 16.858  0.507   1.00 47.68  ? 114 ASN B N   1 
ATOM   2395  C CA  . ASN B  2 118 ? -29.176 16.471  1.913   1.00 49.39  ? 114 ASN B CA  1 
ATOM   2396  C C   . ASN B  2 118 ? -28.918 14.986  2.158   1.00 48.80  ? 114 ASN B C   1 
ATOM   2397  O O   . ASN B  2 118 ? -28.585 14.590  3.278   1.00 48.44  ? 114 ASN B O   1 
ATOM   2398  C CB  . ASN B  2 118 ? -30.545 16.832  2.505   1.00 51.27  ? 114 ASN B CB  1 
ATOM   2399  C CG  . ASN B  2 118 ? -30.805 18.324  2.506   1.00 53.45  ? 114 ASN B CG  1 
ATOM   2400  O OD1 . ASN B  2 118 ? -29.918 19.120  2.830   1.00 54.49  ? 114 ASN B OD1 1 
ATOM   2401  N ND2 . ASN B  2 118 ? -32.028 18.713  2.156   1.00 51.60  ? 114 ASN B ND2 1 
ATOM   2402  N N   . PHE B  2 119 ? -29.078 14.159  1.128   1.00 47.86  ? 115 PHE B N   1 
ATOM   2403  C CA  . PHE B  2 119 ? -28.849 12.730  1.305   1.00 46.51  ? 115 PHE B CA  1 
ATOM   2404  C C   . PHE B  2 119 ? -28.184 12.028  0.130   1.00 45.85  ? 115 PHE B C   1 
ATOM   2405  O O   . PHE B  2 119 ? -27.438 11.070  0.324   1.00 45.76  ? 115 PHE B O   1 
ATOM   2406  C CB  . PHE B  2 119 ? -30.155 12.011  1.669   1.00 44.32  ? 115 PHE B CB  1 
ATOM   2407  C CG  . PHE B  2 119 ? -31.237 12.115  0.622   1.00 44.09  ? 115 PHE B CG  1 
ATOM   2408  C CD1 . PHE B  2 119 ? -31.857 13.333  0.351   1.00 43.22  ? 115 PHE B CD1 1 
ATOM   2409  C CD2 . PHE B  2 119 ? -31.657 10.980  -0.074  1.00 41.91  ? 115 PHE B CD2 1 
ATOM   2410  C CE1 . PHE B  2 119 ? -32.877 13.419  -0.599  1.00 43.05  ? 115 PHE B CE1 1 
ATOM   2411  C CE2 . PHE B  2 119 ? -32.671 11.056  -1.020  1.00 42.42  ? 115 PHE B CE2 1 
ATOM   2412  C CZ  . PHE B  2 119 ? -33.285 12.277  -1.284  1.00 41.96  ? 115 PHE B CZ  1 
ATOM   2413  N N   . LEU B  2 120 ? -28.424 12.506  -1.086  1.00 43.85  ? 116 LEU B N   1 
ATOM   2414  C CA  . LEU B  2 120 ? -27.813 11.861  -2.237  1.00 41.88  ? 116 LEU B CA  1 
ATOM   2415  C C   . LEU B  2 120 ? -26.379 12.304  -2.466  1.00 41.26  ? 116 LEU B C   1 
ATOM   2416  O O   . LEU B  2 120 ? -25.478 11.468  -2.554  1.00 41.60  ? 116 LEU B O   1 
ATOM   2417  C CB  . LEU B  2 120 ? -28.639 12.110  -3.501  1.00 39.89  ? 116 LEU B CB  1 
ATOM   2418  C CG  . LEU B  2 120 ? -30.082 11.613  -3.464  1.00 37.68  ? 116 LEU B CG  1 
ATOM   2419  C CD1 . LEU B  2 120 ? -30.679 11.756  -4.848  1.00 36.59  ? 116 LEU B CD1 1 
ATOM   2420  C CD2 . LEU B  2 120 ? -30.136 10.166  -2.997  1.00 32.82  ? 116 LEU B CD2 1 
ATOM   2421  N N   . VAL B  2 121 ? -26.156 13.611  -2.558  1.00 42.12  ? 117 VAL B N   1 
ATOM   2422  C CA  . VAL B  2 121 ? -24.809 14.117  -2.795  1.00 42.01  ? 117 VAL B CA  1 
ATOM   2423  C C   . VAL B  2 121 ? -23.781 13.592  -1.783  1.00 43.68  ? 117 VAL B C   1 
ATOM   2424  O O   . VAL B  2 121 ? -22.692 13.163  -2.168  1.00 45.41  ? 117 VAL B O   1 
ATOM   2425  C CB  . VAL B  2 121 ? -24.798 15.651  -2.800  1.00 41.73  ? 117 VAL B CB  1 
ATOM   2426  C CG1 . VAL B  2 121 ? -23.414 16.164  -3.182  1.00 39.40  ? 117 VAL B CG1 1 
ATOM   2427  C CG2 . VAL B  2 121 ? -25.843 16.157  -3.771  1.00 38.75  ? 117 VAL B CG2 1 
ATOM   2428  N N   . PRO B  2 122 ? -24.112 13.618  -0.477  1.00 44.56  ? 118 PRO B N   1 
ATOM   2429  C CA  . PRO B  2 122 ? -23.198 13.135  0.564   1.00 44.54  ? 118 PRO B CA  1 
ATOM   2430  C C   . PRO B  2 122 ? -23.224 11.618  0.822   1.00 45.91  ? 118 PRO B C   1 
ATOM   2431  O O   . PRO B  2 122 ? -22.502 11.118  1.685   1.00 45.68  ? 118 PRO B O   1 
ATOM   2432  C CB  . PRO B  2 122 ? -23.641 13.926  1.789   1.00 43.36  ? 118 PRO B CB  1 
ATOM   2433  C CG  . PRO B  2 122 ? -25.116 14.010  1.596   1.00 44.82  ? 118 PRO B CG  1 
ATOM   2434  C CD  . PRO B  2 122 ? -25.240 14.357  0.129   1.00 45.24  ? 118 PRO B CD  1 
ATOM   2435  N N   . ARG B  2 123 ? -24.046 10.879  0.086   1.00 45.62  ? 119 ARG B N   1 
ATOM   2436  C CA  . ARG B  2 123 ? -24.113 9.440   0.301   1.00 45.71  ? 119 ARG B CA  1 
ATOM   2437  C C   . ARG B  2 123 ? -22.719 8.795   0.188   1.00 45.89  ? 119 ARG B C   1 
ATOM   2438  O O   . ARG B  2 123 ? -21.986 9.020   -0.777  1.00 45.64  ? 119 ARG B O   1 
ATOM   2439  C CB  . ARG B  2 123 ? -25.079 8.810   -0.701  1.00 46.48  ? 119 ARG B CB  1 
ATOM   2440  C CG  . ARG B  2 123 ? -25.371 7.340   -0.442  1.00 48.11  ? 119 ARG B CG  1 
ATOM   2441  C CD  . ARG B  2 123 ? -26.200 6.718   -1.557  1.00 47.20  ? 119 ARG B CD  1 
ATOM   2442  N NE  . ARG B  2 123 ? -26.244 5.266   -1.419  1.00 49.79  ? 119 ARG B NE  1 
ATOM   2443  C CZ  . ARG B  2 123 ? -26.977 4.622   -0.516  1.00 50.07  ? 119 ARG B CZ  1 
ATOM   2444  N NH1 . ARG B  2 123 ? -27.742 5.308   0.326   1.00 49.81  ? 119 ARG B NH1 1 
ATOM   2445  N NH2 . ARG B  2 123 ? -26.922 3.296   -0.437  1.00 47.43  ? 119 ARG B NH2 1 
ATOM   2446  N N   . ARG B  2 124 ? -22.353 8.002   1.190   1.00 47.22  ? 120 ARG B N   1 
ATOM   2447  C CA  . ARG B  2 124 ? -21.053 7.328   1.216   1.00 48.32  ? 120 ARG B CA  1 
ATOM   2448  C C   . ARG B  2 124 ? -21.205 5.908   1.752   1.00 48.94  ? 120 ARG B C   1 
ATOM   2449  O O   . ARG B  2 124 ? -21.854 5.688   2.773   1.00 49.84  ? 120 ARG B O   1 
ATOM   2450  C CB  . ARG B  2 124 ? -20.072 8.083   2.122   1.00 48.49  ? 120 ARG B CB  1 
ATOM   2451  C CG  . ARG B  2 124 ? -19.767 9.520   1.710   1.00 50.88  ? 120 ARG B CG  1 
ATOM   2452  C CD  . ARG B  2 124 ? -18.665 9.595   0.667   1.00 52.07  ? 120 ARG B CD  1 
ATOM   2453  N NE  . ARG B  2 124 ? -18.492 10.953  0.151   1.00 56.47  ? 120 ARG B NE  1 
ATOM   2454  C CZ  . ARG B  2 124 ? -19.383 11.592  -0.607  1.00 57.85  ? 120 ARG B CZ  1 
ATOM   2455  N NH1 . ARG B  2 124 ? -20.520 10.998  -0.947  1.00 58.47  ? 120 ARG B NH1 1 
ATOM   2456  N NH2 . ARG B  2 124 ? -19.142 12.830  -1.027  1.00 58.29  ? 120 ARG B NH2 1 
ATOM   2457  N N   . VAL B  2 125 ? -20.606 4.946   1.063   1.00 49.31  ? 121 VAL B N   1 
ATOM   2458  C CA  . VAL B  2 125 ? -20.656 3.557   1.492   1.00 49.26  ? 121 VAL B CA  1 
ATOM   2459  C C   . VAL B  2 125 ? -19.273 2.957   1.286   1.00 49.95  ? 121 VAL B C   1 
ATOM   2460  O O   . VAL B  2 125 ? -18.753 2.902   0.171   1.00 48.76  ? 121 VAL B O   1 
ATOM   2461  C CB  . VAL B  2 125 ? -21.710 2.752   0.708   1.00 49.89  ? 121 VAL B CB  1 
ATOM   2462  C CG1 . VAL B  2 125 ? -21.655 1.277   1.113   1.00 47.82  ? 121 VAL B CG1 1 
ATOM   2463  C CG2 . VAL B  2 125 ? -23.098 3.324   0.989   1.00 49.43  ? 121 VAL B CG2 1 
ATOM   2464  N N   . GLU B  2 126 ? -18.685 2.517   2.388   1.00 51.62  ? 122 GLU B N   1 
ATOM   2465  C CA  . GLU B  2 126 ? -17.346 1.960   2.391   1.00 52.70  ? 122 GLU B CA  1 
ATOM   2466  C C   . GLU B  2 126 ? -17.154 0.673   1.623   1.00 51.19  ? 122 GLU B C   1 
ATOM   2467  O O   . GLU B  2 126 ? -17.902 -0.291  1.790   1.00 51.99  ? 122 GLU B O   1 
ATOM   2468  C CB  . GLU B  2 126 ? -16.881 1.760   3.832   1.00 55.39  ? 122 GLU B CB  1 
ATOM   2469  C CG  . GLU B  2 126 ? -16.508 3.049   4.534   1.00 60.04  ? 122 GLU B CG  1 
ATOM   2470  C CD  . GLU B  2 126 ? -16.063 2.825   5.967   1.00 63.03  ? 122 GLU B CD  1 
ATOM   2471  O OE1 . GLU B  2 126 ? -15.176 1.968   6.200   1.00 62.40  ? 122 GLU B OE1 1 
ATOM   2472  O OE2 . GLU B  2 126 ? -16.601 3.517   6.860   1.00 65.45  ? 122 GLU B OE2 1 
ATOM   2473  N N   . PRO B  2 127 ? -16.126 0.637   0.770   1.00 50.10  ? 123 PRO B N   1 
ATOM   2474  C CA  . PRO B  2 127 ? -15.858 -0.567  -0.012  1.00 49.99  ? 123 PRO B CA  1 
ATOM   2475  C C   . PRO B  2 127 ? -15.411 -1.696  0.895   1.00 50.29  ? 123 PRO B C   1 
ATOM   2476  O O   . PRO B  2 127 ? -15.065 -1.481  2.049   1.00 49.40  ? 123 PRO B O   1 
ATOM   2477  C CB  . PRO B  2 127 ? -14.748 -0.125  -0.959  1.00 48.78  ? 123 PRO B CB  1 
ATOM   2478  C CG  . PRO B  2 127 ? -14.021 0.919   -0.157  1.00 47.37  ? 123 PRO B CG  1 
ATOM   2479  C CD  . PRO B  2 127 ? -15.152 1.699   0.460   1.00 48.28  ? 123 PRO B CD  1 
ATOM   2480  N N   . THR B  2 128 ? -15.441 -2.902  0.359   1.00 52.02  ? 124 THR B N   1 
ATOM   2481  C CA  . THR B  2 128 ? -15.014 -4.075  1.081   1.00 53.01  ? 124 THR B CA  1 
ATOM   2482  C C   . THR B  2 128 ? -13.930 -4.654  0.193   1.00 55.36  ? 124 THR B C   1 
ATOM   2483  O O   . THR B  2 128 ? -14.214 -5.251  -0.843  1.00 56.98  ? 124 THR B O   1 
ATOM   2484  C CB  . THR B  2 128 ? -16.159 -5.073  1.229   1.00 52.97  ? 124 THR B CB  1 
ATOM   2485  O OG1 . THR B  2 128 ? -17.242 -4.446  1.923   1.00 52.58  ? 124 THR B OG1 1 
ATOM   2486  C CG2 . THR B  2 128 ? -15.703 -6.292  2.005   1.00 52.68  ? 124 THR B CG2 1 
ATOM   2487  N N   . VAL B  2 129 ? -12.681 -4.442  0.587   1.00 56.75  ? 125 VAL B N   1 
ATOM   2488  C CA  . VAL B  2 129 ? -11.553 -4.926  -0.183  1.00 57.68  ? 125 VAL B CA  1 
ATOM   2489  C C   . VAL B  2 129 ? -11.151 -6.338  0.211   1.00 59.75  ? 125 VAL B C   1 
ATOM   2490  O O   . VAL B  2 129 ? -11.238 -6.722  1.374   1.00 60.75  ? 125 VAL B O   1 
ATOM   2491  C CB  . VAL B  2 129 ? -10.349 -3.994  -0.023  1.00 56.61  ? 125 VAL B CB  1 
ATOM   2492  C CG1 . VAL B  2 129 ? -9.198  -4.489  -0.872  1.00 57.37  ? 125 VAL B CG1 1 
ATOM   2493  C CG2 . VAL B  2 129 ? -10.738 -2.586  -0.425  1.00 56.26  ? 125 VAL B CG2 1 
ATOM   2494  N N   . THR B  2 130 ? -10.710 -7.099  -0.784  1.00 62.83  ? 126 THR B N   1 
ATOM   2495  C CA  . THR B  2 130 ? -10.281 -8.482  -0.615  1.00 65.23  ? 126 THR B CA  1 
ATOM   2496  C C   . THR B  2 130 ? -9.223  -8.773  -1.665  1.00 67.33  ? 126 THR B C   1 
ATOM   2497  O O   . THR B  2 130 ? -9.270  -8.225  -2.762  1.00 68.67  ? 126 THR B O   1 
ATOM   2498  C CB  . THR B  2 130 ? -11.454 -9.452  -0.827  1.00 65.97  ? 126 THR B CB  1 
ATOM   2499  O OG1 . THR B  2 130 ? -12.342 -9.374  0.292   1.00 67.36  ? 126 THR B OG1 1 
ATOM   2500  C CG2 . THR B  2 130 ? -10.956 -10.877 -0.985  1.00 66.26  ? 126 THR B CG2 1 
ATOM   2501  N N   . VAL B  2 131 ? -8.269  -9.634  -1.331  1.00 69.12  ? 127 VAL B N   1 
ATOM   2502  C CA  . VAL B  2 131 ? -7.212  -9.987  -2.265  1.00 70.81  ? 127 VAL B CA  1 
ATOM   2503  C C   . VAL B  2 131 ? -7.104  -11.493 -2.400  1.00 73.91  ? 127 VAL B C   1 
ATOM   2504  O O   . VAL B  2 131 ? -7.421  -12.227 -1.467  1.00 74.64  ? 127 VAL B O   1 
ATOM   2505  C CB  . VAL B  2 131 ? -5.860  -9.433  -1.802  1.00 70.82  ? 127 VAL B CB  1 
ATOM   2506  C CG1 . VAL B  2 131 ? -4.760  -9.926  -2.721  1.00 71.25  ? 127 VAL B CG1 1 
ATOM   2507  C CG2 . VAL B  2 131 ? -5.901  -7.911  -1.797  1.00 71.01  ? 127 VAL B CG2 1 
ATOM   2508  N N   . TYR B  2 132 ? -6.665  -11.952 -3.568  1.00 77.04  ? 128 TYR B N   1 
ATOM   2509  C CA  . TYR B  2 132 ? -6.506  -13.379 -3.819  1.00 79.50  ? 128 TYR B CA  1 
ATOM   2510  C C   . TYR B  2 132 ? -6.046  -13.663 -5.243  1.00 83.04  ? 128 TYR B C   1 
ATOM   2511  O O   . TYR B  2 132 ? -6.333  -12.902 -6.163  1.00 84.34  ? 128 TYR B O   1 
ATOM   2512  C CB  . TYR B  2 132 ? -7.816  -14.117 -3.527  1.00 78.72  ? 128 TYR B CB  1 
ATOM   2513  C CG  . TYR B  2 132 ? -8.979  -13.703 -4.390  1.00 78.21  ? 128 TYR B CG  1 
ATOM   2514  C CD1 . TYR B  2 132 ? -9.132  -14.214 -5.679  1.00 78.15  ? 128 TYR B CD1 1 
ATOM   2515  C CD2 . TYR B  2 132 ? -9.939  -12.811 -3.915  1.00 77.92  ? 128 TYR B CD2 1 
ATOM   2516  C CE1 . TYR B  2 132 ? -10.214 -13.851 -6.474  1.00 77.56  ? 128 TYR B CE1 1 
ATOM   2517  C CE2 . TYR B  2 132 ? -11.025 -12.439 -4.702  1.00 77.98  ? 128 TYR B CE2 1 
ATOM   2518  C CZ  . TYR B  2 132 ? -11.157 -12.963 -5.980  1.00 77.69  ? 128 TYR B CZ  1 
ATOM   2519  O OH  . TYR B  2 132 ? -12.229 -12.601 -6.767  1.00 77.79  ? 128 TYR B OH  1 
ATOM   2520  N N   . PRO B  2 133 ? -5.316  -14.770 -5.438  1.00 85.98  ? 129 PRO B N   1 
ATOM   2521  C CA  . PRO B  2 133 ? -4.790  -15.190 -6.739  1.00 88.22  ? 129 PRO B CA  1 
ATOM   2522  C C   . PRO B  2 133 ? -5.805  -15.957 -7.586  1.00 91.77  ? 129 PRO B C   1 
ATOM   2523  O O   . PRO B  2 133 ? -6.911  -16.253 -7.127  1.00 92.59  ? 129 PRO B O   1 
ATOM   2524  C CB  . PRO B  2 133 ? -3.611  -16.063 -6.348  1.00 88.23  ? 129 PRO B CB  1 
ATOM   2525  C CG  . PRO B  2 133 ? -4.154  -16.775 -5.148  1.00 86.95  ? 129 PRO B CG  1 
ATOM   2526  C CD  . PRO B  2 133 ? -4.823  -15.659 -4.369  1.00 86.15  ? 129 PRO B CD  1 
ATOM   2527  N N   . THR B  2 134 ? -5.417  -16.277 -8.819  1.00 94.75  ? 130 THR B N   1 
ATOM   2528  C CA  . THR B  2 134 ? -6.272  -17.024 -9.741  1.00 97.74  ? 130 THR B CA  1 
ATOM   2529  C C   . THR B  2 134 ? -5.453  -17.860 -10.724 1.00 100.46 ? 130 THR B C   1 
ATOM   2530  O O   . THR B  2 134 ? -4.229  -17.727 -10.802 1.00 100.04 ? 130 THR B O   1 
ATOM   2531  C CB  . THR B  2 134 ? -7.189  -16.090 -10.562 1.00 98.43  ? 130 THR B CB  1 
ATOM   2532  O OG1 . THR B  2 134 ? -6.398  -15.071 -11.188 1.00 99.04  ? 130 THR B OG1 1 
ATOM   2533  C CG2 . THR B  2 134 ? -8.246  -15.455 -9.673  1.00 98.71  ? 130 THR B CG2 1 
ATOM   2534  N N   . LYS B  2 135 ? -6.148  -18.717 -11.470 1.00 103.99 ? 131 LYS B N   1 
ATOM   2535  C CA  . LYS B  2 135 ? -5.530  -19.593 -12.465 1.00 107.57 ? 131 LYS B CA  1 
ATOM   2536  C C   . LYS B  2 135 ? -4.666  -20.691 -11.848 1.00 110.19 ? 131 LYS B C   1 
ATOM   2537  O O   . LYS B  2 135 ? -3.476  -20.489 -11.595 1.00 110.54 ? 131 LYS B O   1 
ATOM   2538  C CB  . LYS B  2 135 ? -4.687  -18.775 -13.449 1.00 107.61 ? 131 LYS B CB  1 
ATOM   2539  C CG  . LYS B  2 135 ? -5.260  -18.692 -14.854 1.00 107.86 ? 131 LYS B CG  1 
ATOM   2540  C CD  . LYS B  2 135 ? -4.295  -17.967 -15.773 1.00 108.42 ? 131 LYS B CD  1 
ATOM   2541  C CE  . LYS B  2 135 ? -4.758  -17.998 -17.216 1.00 108.81 ? 131 LYS B CE  1 
ATOM   2542  N NZ  . LYS B  2 135 ? -3.755  -17.346 -18.104 1.00 108.79 ? 131 LYS B NZ  1 
ATOM   2543  N N   . THR B  2 136 ? -5.273  -21.852 -11.614 1.00 113.11 ? 132 THR B N   1 
ATOM   2544  C CA  . THR B  2 136 ? -4.571  -22.997 -11.036 1.00 115.87 ? 132 THR B CA  1 
ATOM   2545  C C   . THR B  2 136 ? -4.433  -24.099 -12.088 1.00 117.92 ? 132 THR B C   1 
ATOM   2546  O O   . THR B  2 136 ? -3.319  -24.491 -12.444 1.00 118.68 ? 132 THR B O   1 
ATOM   2547  C CB  . THR B  2 136 ? -5.329  -23.520 -9.818  1.00 115.35 ? 132 THR B CB  1 
ATOM   2548  N N   . GLN B  2 137 ? -5.571  -24.590 -12.576 1.00 119.62 ? 133 GLN B N   1 
ATOM   2549  C CA  . GLN B  2 137 ? -5.616  -25.636 -13.601 1.00 121.16 ? 133 GLN B CA  1 
ATOM   2550  C C   . GLN B  2 137 ? -4.756  -26.860 -13.278 1.00 122.33 ? 133 GLN B C   1 
ATOM   2551  O O   . GLN B  2 137 ? -4.687  -27.300 -12.127 1.00 122.62 ? 133 GLN B O   1 
ATOM   2552  C CB  . GLN B  2 137 ? -5.207  -25.049 -14.958 1.00 121.10 ? 133 GLN B CB  1 
ATOM   2553  N N   . PRO B  2 138 ? -4.110  -27.409 -14.304 1.00 123.21 ? 134 PRO B N   1 
ATOM   2554  C CA  . PRO B  2 138 ? -3.252  -28.579 -14.141 1.00 123.95 ? 134 PRO B CA  1 
ATOM   2555  C C   . PRO B  2 138 ? -1.778  -28.175 -14.045 1.00 124.47 ? 134 PRO B C   1 
ATOM   2556  O O   . PRO B  2 138 ? -1.077  -28.572 -13.109 1.00 124.87 ? 134 PRO B O   1 
ATOM   2557  C CB  . PRO B  2 138 ? -3.461  -29.546 -15.305 1.00 123.34 ? 134 PRO B CB  1 
ATOM   2558  N N   . LEU B  2 139 ? -1.311  -27.385 -15.011 1.00 124.28 ? 135 LEU B N   1 
ATOM   2559  C CA  . LEU B  2 139 ? 0.080   -26.932 -15.024 1.00 123.91 ? 135 LEU B CA  1 
ATOM   2560  C C   . LEU B  2 139 ? 0.178   -25.410 -14.897 1.00 123.43 ? 135 LEU B C   1 
ATOM   2561  O O   . LEU B  2 139 ? 0.194   -24.690 -15.898 1.00 123.32 ? 135 LEU B O   1 
ATOM   2562  C CB  . LEU B  2 139 ? 0.773   -27.399 -16.305 1.00 123.91 ? 135 LEU B CB  1 
ATOM   2563  N N   . GLU B  2 140 ? 0.246   -24.931 -13.657 1.00 122.56 ? 136 GLU B N   1 
ATOM   2564  C CA  . GLU B  2 140 ? 0.344   -23.499 -13.376 1.00 121.58 ? 136 GLU B CA  1 
ATOM   2565  C C   . GLU B  2 140 ? 0.638   -23.263 -11.891 1.00 120.47 ? 136 GLU B C   1 
ATOM   2566  O O   . GLU B  2 140 ? -0.098  -23.735 -11.022 1.00 120.47 ? 136 GLU B O   1 
ATOM   2567  C CB  . GLU B  2 140 ? -0.956  -22.799 -13.774 1.00 121.82 ? 136 GLU B CB  1 
ATOM   2568  N N   . HIS B  2 141 ? 1.710   -22.525 -11.607 1.00 118.53 ? 137 HIS B N   1 
ATOM   2569  C CA  . HIS B  2 141 ? 2.100   -22.246 -10.227 1.00 116.54 ? 137 HIS B CA  1 
ATOM   2570  C C   . HIS B  2 141 ? 1.994   -20.772 -9.829  1.00 115.04 ? 137 HIS B C   1 
ATOM   2571  O O   . HIS B  2 141 ? 2.076   -20.443 -8.643  1.00 114.94 ? 137 HIS B O   1 
ATOM   2572  C CB  . HIS B  2 141 ? 3.522   -22.750 -9.983  1.00 116.26 ? 137 HIS B CB  1 
ATOM   2573  N N   . HIS B  2 142 ? 1.810   -19.888 -10.809 1.00 112.98 ? 138 HIS B N   1 
ATOM   2574  C CA  . HIS B  2 142 ? 1.703   -18.450 -10.535 1.00 110.21 ? 138 HIS B CA  1 
ATOM   2575  C C   . HIS B  2 142 ? 1.098   -17.660 -11.702 1.00 107.53 ? 138 HIS B C   1 
ATOM   2576  O O   . HIS B  2 142 ? 1.422   -17.912 -12.866 1.00 107.95 ? 138 HIS B O   1 
ATOM   2577  C CB  . HIS B  2 142 ? 3.083   -17.885 -10.185 1.00 110.54 ? 138 HIS B CB  1 
ATOM   2578  N N   . ASN B  2 143 ? 0.229   -16.701 -11.385 1.00 103.28 ? 139 ASN B N   1 
ATOM   2579  C CA  . ASN B  2 143 ? -0.413  -15.876 -12.410 1.00 98.50  ? 139 ASN B CA  1 
ATOM   2580  C C   . ASN B  2 143 ? -0.875  -14.504 -11.913 1.00 94.20  ? 139 ASN B C   1 
ATOM   2581  O O   . ASN B  2 143 ? -0.077  -13.697 -11.430 1.00 93.38  ? 139 ASN B O   1 
ATOM   2582  C CB  . ASN B  2 143 ? -1.611  -16.617 -13.019 1.00 99.94  ? 139 ASN B CB  1 
ATOM   2583  C CG  . ASN B  2 143 ? -1.280  -17.280 -14.345 1.00 100.76 ? 139 ASN B CG  1 
ATOM   2584  O OD1 . ASN B  2 143 ? -0.772  -16.633 -15.265 1.00 101.31 ? 139 ASN B OD1 1 
ATOM   2585  N ND2 . ASN B  2 143 ? -1.579  -18.572 -14.456 1.00 100.98 ? 139 ASN B ND2 1 
ATOM   2586  N N   . LEU B  2 144 ? -2.175  -14.256 -12.046 1.00 88.61  ? 140 LEU B N   1 
ATOM   2587  C CA  . LEU B  2 144 ? -2.792  -12.997 -11.644 1.00 82.73  ? 140 LEU B CA  1 
ATOM   2588  C C   . LEU B  2 144 ? -3.011  -12.896 -10.143 1.00 79.47  ? 140 LEU B C   1 
ATOM   2589  O O   . LEU B  2 144 ? -3.035  -13.903 -9.438  1.00 78.71  ? 140 LEU B O   1 
ATOM   2590  C CB  . LEU B  2 144 ? -4.147  -12.834 -12.341 1.00 83.86  ? 140 LEU B CB  1 
ATOM   2591  C CG  . LEU B  2 144 ? -4.192  -12.637 -13.856 1.00 84.09  ? 140 LEU B CG  1 
ATOM   2592  C CD1 . LEU B  2 144 ? -5.592  -12.950 -14.366 1.00 83.66  ? 140 LEU B CD1 1 
ATOM   2593  C CD2 . LEU B  2 144 ? -3.786  -11.209 -14.203 1.00 83.86  ? 140 LEU B CD2 1 
ATOM   2594  N N   . LEU B  2 145 ? -3.182  -11.663 -9.674  1.00 74.99  ? 141 LEU B N   1 
ATOM   2595  C CA  . LEU B  2 145 ? -3.437  -11.376 -8.269  1.00 70.29  ? 141 LEU B CA  1 
ATOM   2596  C C   . LEU B  2 145 ? -4.628  -10.417 -8.262  1.00 68.62  ? 141 LEU B C   1 
ATOM   2597  O O   . LEU B  2 145 ? -4.490  -9.223  -8.526  1.00 69.97  ? 141 LEU B O   1 
ATOM   2598  C CB  . LEU B  2 145 ? -2.209  -10.728 -7.633  1.00 71.49  ? 141 LEU B CB  1 
ATOM   2599  C CG  . LEU B  2 145 ? -2.165  -10.690 -6.104  1.00 72.99  ? 141 LEU B CG  1 
ATOM   2600  C CD1 . LEU B  2 145 ? -2.362  -12.098 -5.549  1.00 73.51  ? 141 LEU B CD1 1 
ATOM   2601  C CD2 . LEU B  2 145 ? -0.832  -10.116 -5.642  1.00 72.53  ? 141 LEU B CD2 1 
ATOM   2602  N N   . VAL B  2 146 ? -5.801  -10.957 -7.959  1.00 64.75  ? 142 VAL B N   1 
ATOM   2603  C CA  . VAL B  2 146 ? -7.046  -10.198 -7.962  1.00 60.67  ? 142 VAL B CA  1 
ATOM   2604  C C   . VAL B  2 146 ? -7.364  -9.309  -6.770  1.00 60.01  ? 142 VAL B C   1 
ATOM   2605  O O   . VAL B  2 146 ? -7.564  -9.810  -5.670  1.00 61.56  ? 142 VAL B O   1 
ATOM   2606  C CB  . VAL B  2 146 ? -8.242  -11.147 -8.113  1.00 59.96  ? 142 VAL B CB  1 
ATOM   2607  C CG1 . VAL B  2 146 ? -9.527  -10.343 -8.271  1.00 60.28  ? 142 VAL B CG1 1 
ATOM   2608  C CG2 . VAL B  2 146 ? -8.024  -12.071 -9.288  1.00 58.53  ? 142 VAL B CG2 1 
ATOM   2609  N N   . CYS B  2 147 ? -7.424  -7.997  -6.978  1.00 58.03  ? 143 CYS B N   1 
ATOM   2610  C CA  . CYS B  2 147 ? -7.811  -7.104  -5.892  1.00 55.66  ? 143 CYS B CA  1 
ATOM   2611  C C   . CYS B  2 147 ? -9.291  -6.808  -6.131  1.00 54.46  ? 143 CYS B C   1 
ATOM   2612  O O   . CYS B  2 147 ? -9.657  -6.151  -7.107  1.00 53.63  ? 143 CYS B O   1 
ATOM   2613  C CB  . CYS B  2 147 ? -7.035  -5.791  -5.903  1.00 56.78  ? 143 CYS B CB  1 
ATOM   2614  S SG  . CYS B  2 147 ? -7.506  -4.741  -4.487  1.00 61.41  ? 143 CYS B SG  1 
ATOM   2615  N N   . SER B  2 148 ? -10.140 -7.315  -5.245  1.00 52.21  ? 144 SER B N   1 
ATOM   2616  C CA  . SER B  2 148 ? -11.582 -7.134  -5.359  1.00 48.94  ? 144 SER B CA  1 
ATOM   2617  C C   . SER B  2 148 ? -12.069 -6.010  -4.468  1.00 47.87  ? 144 SER B C   1 
ATOM   2618  O O   . SER B  2 148 ? -11.807 -6.004  -3.270  1.00 48.31  ? 144 SER B O   1 
ATOM   2619  C CB  . SER B  2 148 ? -12.296 -8.435  -4.982  1.00 48.68  ? 144 SER B CB  1 
ATOM   2620  O OG  . SER B  2 148 ? -13.689 -8.243  -4.823  1.00 47.61  ? 144 SER B OG  1 
ATOM   2621  N N   . VAL B  2 149 ? -12.772 -5.053  -5.060  1.00 46.03  ? 145 VAL B N   1 
ATOM   2622  C CA  . VAL B  2 149 ? -13.307 -3.934  -4.307  1.00 44.97  ? 145 VAL B CA  1 
ATOM   2623  C C   . VAL B  2 149 ? -14.786 -3.918  -4.618  1.00 46.41  ? 145 VAL B C   1 
ATOM   2624  O O   . VAL B  2 149 ? -15.175 -3.719  -5.769  1.00 47.35  ? 145 VAL B O   1 
ATOM   2625  C CB  . VAL B  2 149 ? -12.691 -2.590  -4.757  1.00 44.14  ? 145 VAL B CB  1 
ATOM   2626  C CG1 . VAL B  2 149 ? -13.131 -1.479  -3.823  1.00 44.10  ? 145 VAL B CG1 1 
ATOM   2627  C CG2 . VAL B  2 149 ? -11.186 -2.680  -4.768  1.00 43.82  ? 145 VAL B CG2 1 
ATOM   2628  N N   . SER B  2 150 ? -15.623 -4.133  -3.610  1.00 46.93  ? 146 SER B N   1 
ATOM   2629  C CA  . SER B  2 150 ? -17.049 -4.134  -3.874  1.00 46.48  ? 146 SER B CA  1 
ATOM   2630  C C   . SER B  2 150 ? -17.907 -3.354  -2.893  1.00 47.24  ? 146 SER B C   1 
ATOM   2631  O O   . SER B  2 150 ? -17.434 -2.858  -1.870  1.00 47.93  ? 146 SER B O   1 
ATOM   2632  C CB  . SER B  2 150 ? -17.560 -5.583  -3.993  1.00 46.26  ? 146 SER B CB  1 
ATOM   2633  O OG  . SER B  2 150 ? -17.257 -6.354  -2.848  1.00 44.52  ? 146 SER B OG  1 
ATOM   2634  N N   . ASP B  2 151 ? -19.179 -3.231  -3.251  1.00 48.42  ? 147 ASP B N   1 
ATOM   2635  C CA  . ASP B  2 151 ? -20.170 -2.547  -2.440  1.00 49.36  ? 147 ASP B CA  1 
ATOM   2636  C C   . ASP B  2 151 ? -19.738 -1.167  -1.952  1.00 48.49  ? 147 ASP B C   1 
ATOM   2637  O O   . ASP B  2 151 ? -19.603 -0.962  -0.754  1.00 49.25  ? 147 ASP B O   1 
ATOM   2638  C CB  . ASP B  2 151 ? -20.519 -3.419  -1.234  1.00 52.95  ? 147 ASP B CB  1 
ATOM   2639  C CG  . ASP B  2 151 ? -21.957 -3.247  -0.790  1.00 57.72  ? 147 ASP B CG  1 
ATOM   2640  O OD1 . ASP B  2 151 ? -22.864 -3.603  -1.580  1.00 62.16  ? 147 ASP B OD1 1 
ATOM   2641  O OD2 . ASP B  2 151 ? -22.181 -2.757  0.337   1.00 57.36  ? 147 ASP B OD2 1 
ATOM   2642  N N   . PHE B  2 152 ? -19.524 -0.221  -2.864  1.00 45.81  ? 148 PHE B N   1 
ATOM   2643  C CA  . PHE B  2 152 ? -19.122 1.123   -2.453  1.00 43.12  ? 148 PHE B CA  1 
ATOM   2644  C C   . PHE B  2 152 ? -19.839 2.208   -3.249  1.00 42.54  ? 148 PHE B C   1 
ATOM   2645  O O   . PHE B  2 152 ? -20.359 1.953   -4.333  1.00 42.69  ? 148 PHE B O   1 
ATOM   2646  C CB  . PHE B  2 152 ? -17.597 1.292   -2.573  1.00 39.72  ? 148 PHE B CB  1 
ATOM   2647  C CG  . PHE B  2 152 ? -17.074 1.158   -3.974  1.00 37.20  ? 148 PHE B CG  1 
ATOM   2648  C CD1 . PHE B  2 152 ? -17.046 2.252   -4.830  1.00 37.53  ? 148 PHE B CD1 1 
ATOM   2649  C CD2 . PHE B  2 152 ? -16.631 -0.067  -4.445  1.00 36.66  ? 148 PHE B CD2 1 
ATOM   2650  C CE1 . PHE B  2 152 ? -16.583 2.123   -6.135  1.00 37.04  ? 148 PHE B CE1 1 
ATOM   2651  C CE2 . PHE B  2 152 ? -16.168 -0.208  -5.743  1.00 36.61  ? 148 PHE B CE2 1 
ATOM   2652  C CZ  . PHE B  2 152 ? -16.143 0.891   -6.592  1.00 36.63  ? 148 PHE B CZ  1 
ATOM   2653  N N   . TYR B  2 153 ? -19.859 3.418   -2.697  1.00 42.16  ? 149 TYR B N   1 
ATOM   2654  C CA  . TYR B  2 153 ? -20.510 4.558   -3.332  1.00 41.43  ? 149 TYR B CA  1 
ATOM   2655  C C   . TYR B  2 153 ? -19.952 5.846   -2.731  1.00 43.00  ? 149 TYR B C   1 
ATOM   2656  O O   . TYR B  2 153 ? -19.763 5.935   -1.522  1.00 43.59  ? 149 TYR B O   1 
ATOM   2657  C CB  . TYR B  2 153 ? -22.023 4.499   -3.097  1.00 38.79  ? 149 TYR B CB  1 
ATOM   2658  C CG  . TYR B  2 153 ? -22.790 5.546   -3.861  1.00 35.30  ? 149 TYR B CG  1 
ATOM   2659  C CD1 . TYR B  2 153 ? -22.833 6.868   -3.420  1.00 34.04  ? 149 TYR B CD1 1 
ATOM   2660  C CD2 . TYR B  2 153 ? -23.392 5.236   -5.084  1.00 32.36  ? 149 TYR B CD2 1 
ATOM   2661  C CE1 . TYR B  2 153 ? -23.451 7.859   -4.184  1.00 34.83  ? 149 TYR B CE1 1 
ATOM   2662  C CE2 . TYR B  2 153 ? -24.005 6.214   -5.855  1.00 30.40  ? 149 TYR B CE2 1 
ATOM   2663  C CZ  . TYR B  2 153 ? -24.031 7.520   -5.403  1.00 33.14  ? 149 TYR B CZ  1 
ATOM   2664  O OH  . TYR B  2 153 ? -24.626 8.485   -6.169  1.00 35.33  ? 149 TYR B OH  1 
ATOM   2665  N N   . PRO B  2 154 ? -19.690 6.867   -3.566  1.00 44.29  ? 150 PRO B N   1 
ATOM   2666  C CA  . PRO B  2 154 ? -19.868 6.924   -5.021  1.00 43.86  ? 150 PRO B CA  1 
ATOM   2667  C C   . PRO B  2 154 ? -18.847 6.135   -5.847  1.00 45.51  ? 150 PRO B C   1 
ATOM   2668  O O   . PRO B  2 154 ? -18.022 5.394   -5.309  1.00 43.72  ? 150 PRO B O   1 
ATOM   2669  C CB  . PRO B  2 154 ? -19.828 8.421   -5.308  1.00 44.00  ? 150 PRO B CB  1 
ATOM   2670  C CG  . PRO B  2 154 ? -18.919 8.936   -4.251  1.00 43.54  ? 150 PRO B CG  1 
ATOM   2671  C CD  . PRO B  2 154 ? -19.388 8.205   -3.032  1.00 44.42  ? 150 PRO B CD  1 
ATOM   2672  N N   . GLY B  2 155 ? -18.906 6.326   -7.163  1.00 47.46  ? 151 GLY B N   1 
ATOM   2673  C CA  . GLY B  2 155 ? -18.045 5.604   -8.083  1.00 49.24  ? 151 GLY B CA  1 
ATOM   2674  C C   . GLY B  2 155 ? -16.577 5.949   -8.236  1.00 50.41  ? 151 GLY B C   1 
ATOM   2675  O O   . GLY B  2 155 ? -15.804 5.105   -8.691  1.00 48.73  ? 151 GLY B O   1 
ATOM   2676  N N   . ASN B  2 156 ? -16.179 7.168   -7.887  1.00 52.07  ? 152 ASN B N   1 
ATOM   2677  C CA  . ASN B  2 156 ? -14.776 7.548   -8.026  1.00 54.24  ? 152 ASN B CA  1 
ATOM   2678  C C   . ASN B  2 156 ? -13.868 6.830   -7.020  1.00 55.01  ? 152 ASN B C   1 
ATOM   2679  O O   . ASN B  2 156 ? -13.669 7.290   -5.893  1.00 55.38  ? 152 ASN B O   1 
ATOM   2680  C CB  . ASN B  2 156 ? -14.615 9.071   -7.906  1.00 55.26  ? 152 ASN B CB  1 
ATOM   2681  C CG  . ASN B  2 156 ? -15.356 9.651   -6.712  1.00 57.31  ? 152 ASN B CG  1 
ATOM   2682  O OD1 . ASN B  2 156 ? -16.581 9.839   -6.744  1.00 56.53  ? 152 ASN B OD1 1 
ATOM   2683  N ND2 . ASN B  2 156 ? -14.613 9.938   -5.646  1.00 57.00  ? 152 ASN B ND2 1 
ATOM   2684  N N   . ILE B  2 157 ? -13.315 5.697   -7.444  1.00 55.69  ? 153 ILE B N   1 
ATOM   2685  C CA  . ILE B  2 157 ? -12.437 4.905   -6.596  1.00 55.27  ? 153 ILE B CA  1 
ATOM   2686  C C   . ILE B  2 157 ? -11.062 4.747   -7.256  1.00 57.18  ? 153 ILE B C   1 
ATOM   2687  O O   . ILE B  2 157 ? -10.963 4.673   -8.481  1.00 56.07  ? 153 ILE B O   1 
ATOM   2688  C CB  . ILE B  2 157 ? -13.056 3.516   -6.334  1.00 53.49  ? 153 ILE B CB  1 
ATOM   2689  C CG1 . ILE B  2 157 ? -12.460 2.914   -5.066  1.00 54.01  ? 153 ILE B CG1 1 
ATOM   2690  C CG2 . ILE B  2 157 ? -12.797 2.587   -7.508  1.00 52.62  ? 153 ILE B CG2 1 
ATOM   2691  C CD1 . ILE B  2 157 ? -13.168 1.663   -4.599  1.00 53.29  ? 153 ILE B CD1 1 
ATOM   2692  N N   . GLU B  2 158 ? -10.003 4.701   -6.449  1.00 59.17  ? 154 GLU B N   1 
ATOM   2693  C CA  . GLU B  2 158 ? -8.646  4.562   -6.981  1.00 61.02  ? 154 GLU B CA  1 
ATOM   2694  C C   . GLU B  2 158 ? -7.935  3.363   -6.364  1.00 60.33  ? 154 GLU B C   1 
ATOM   2695  O O   . GLU B  2 158 ? -7.728  3.306   -5.156  1.00 59.77  ? 154 GLU B O   1 
ATOM   2696  C CB  . GLU B  2 158 ? -7.848  5.840   -6.706  1.00 64.53  ? 154 GLU B CB  1 
ATOM   2697  C CG  . GLU B  2 158 ? -6.613  6.038   -7.586  1.00 70.45  ? 154 GLU B CG  1 
ATOM   2698  C CD  . GLU B  2 158 ? -5.882  7.344   -7.278  1.00 74.11  ? 154 GLU B CD  1 
ATOM   2699  O OE1 . GLU B  2 158 ? -6.562  8.328   -6.896  1.00 75.79  ? 154 GLU B OE1 1 
ATOM   2700  O OE2 . GLU B  2 158 ? -4.635  7.395   -7.429  1.00 74.36  ? 154 GLU B OE2 1 
ATOM   2701  N N   . VAL B  2 159 ? -7.562  2.409   -7.206  1.00 61.05  ? 155 VAL B N   1 
ATOM   2702  C CA  . VAL B  2 159 ? -6.883  1.200   -6.758  1.00 62.42  ? 155 VAL B CA  1 
ATOM   2703  C C   . VAL B  2 159 ? -5.428  1.179   -7.232  1.00 64.95  ? 155 VAL B C   1 
ATOM   2704  O O   . VAL B  2 159 ? -5.150  1.417   -8.406  1.00 65.66  ? 155 VAL B O   1 
ATOM   2705  C CB  . VAL B  2 159 ? -7.599  -0.048  -7.305  1.00 62.10  ? 155 VAL B CB  1 
ATOM   2706  C CG1 . VAL B  2 159 ? -6.936  -1.307  -6.791  1.00 61.73  ? 155 VAL B CG1 1 
ATOM   2707  C CG2 . VAL B  2 159 ? -9.065  -0.012  -6.915  1.00 60.95  ? 155 VAL B CG2 1 
ATOM   2708  N N   . ARG B  2 160 ? -4.505  0.890   -6.317  1.00 66.79  ? 156 ARG B N   1 
ATOM   2709  C CA  . ARG B  2 160 ? -3.079  0.837   -6.641  1.00 68.49  ? 156 ARG B CA  1 
ATOM   2710  C C   . ARG B  2 160 ? -2.429  -0.457  -6.148  1.00 69.48  ? 156 ARG B C   1 
ATOM   2711  O O   . ARG B  2 160 ? -2.740  -0.937  -5.061  1.00 69.40  ? 156 ARG B O   1 
ATOM   2712  C CB  . ARG B  2 160 ? -2.356  2.024   -6.004  1.00 71.11  ? 156 ARG B CB  1 
ATOM   2713  C CG  . ARG B  2 160 ? -2.691  3.372   -6.607  1.00 73.67  ? 156 ARG B CG  1 
ATOM   2714  C CD  . ARG B  2 160 ? -2.149  4.495   -5.734  1.00 76.91  ? 156 ARG B CD  1 
ATOM   2715  N NE  . ARG B  2 160 ? -2.174  5.789   -6.412  1.00 79.41  ? 156 ARG B NE  1 
ATOM   2716  C CZ  . ARG B  2 160 ? -1.372  6.119   -7.422  1.00 80.91  ? 156 ARG B CZ  1 
ATOM   2717  N NH1 . ARG B  2 160 ? -0.476  5.247   -7.871  1.00 80.66  ? 156 ARG B NH1 1 
ATOM   2718  N NH2 . ARG B  2 160 ? -1.470  7.317   -7.989  1.00 81.01  ? 156 ARG B NH2 1 
ATOM   2719  N N   . TRP B  2 161 ? -1.519  -1.009  -6.945  1.00 70.74  ? 157 TRP B N   1 
ATOM   2720  C CA  . TRP B  2 161 ? -0.818  -2.240  -6.584  1.00 72.47  ? 157 TRP B CA  1 
ATOM   2721  C C   . TRP B  2 161 ? 0.625   -1.993  -6.133  1.00 75.68  ? 157 TRP B C   1 
ATOM   2722  O O   . TRP B  2 161 ? 1.357   -1.222  -6.756  1.00 76.39  ? 157 TRP B O   1 
ATOM   2723  C CB  . TRP B  2 161 ? -0.804  -3.207  -7.765  1.00 71.77  ? 157 TRP B CB  1 
ATOM   2724  C CG  . TRP B  2 161 ? -1.978  -4.115  -7.819  1.00 71.47  ? 157 TRP B CG  1 
ATOM   2725  C CD1 . TRP B  2 161 ? -2.962  -4.123  -8.760  1.00 71.43  ? 157 TRP B CD1 1 
ATOM   2726  C CD2 . TRP B  2 161 ? -2.283  -5.177  -6.909  1.00 71.66  ? 157 TRP B CD2 1 
ATOM   2727  N NE1 . TRP B  2 161 ? -3.863  -5.128  -8.498  1.00 71.28  ? 157 TRP B NE1 1 
ATOM   2728  C CE2 . TRP B  2 161 ? -3.470  -5.791  -7.366  1.00 71.33  ? 157 TRP B CE2 1 
ATOM   2729  C CE3 . TRP B  2 161 ? -1.666  -5.672  -5.753  1.00 71.51  ? 157 TRP B CE3 1 
ATOM   2730  C CZ2 . TRP B  2 161 ? -4.058  -6.876  -6.707  1.00 71.14  ? 157 TRP B CZ2 1 
ATOM   2731  C CZ3 . TRP B  2 161 ? -2.250  -6.754  -5.096  1.00 71.68  ? 157 TRP B CZ3 1 
ATOM   2732  C CH2 . TRP B  2 161 ? -3.436  -7.343  -5.578  1.00 71.78  ? 157 TRP B CH2 1 
ATOM   2733  N N   . PHE B  2 162 ? 1.027   -2.657  -5.051  1.00 78.15  ? 158 PHE B N   1 
ATOM   2734  C CA  . PHE B  2 162 ? 2.379   -2.520  -4.507  1.00 79.96  ? 158 PHE B CA  1 
ATOM   2735  C C   . PHE B  2 162 ? 3.101   -3.872  -4.412  1.00 82.10  ? 158 PHE B C   1 
ATOM   2736  O O   . PHE B  2 162 ? 2.496   -4.892  -4.072  1.00 82.12  ? 158 PHE B O   1 
ATOM   2737  C CB  . PHE B  2 162 ? 2.331   -1.891  -3.106  1.00 81.21  ? 158 PHE B CB  1 
ATOM   2738  C CG  . PHE B  2 162 ? 1.968   -0.424  -3.089  1.00 82.11  ? 158 PHE B CG  1 
ATOM   2739  C CD1 . PHE B  2 162 ? 1.511   0.223   -4.234  1.00 82.11  ? 158 PHE B CD1 1 
ATOM   2740  C CD2 . PHE B  2 162 ? 2.068   0.307   -1.908  1.00 82.32  ? 158 PHE B CD2 1 
ATOM   2741  C CE1 . PHE B  2 162 ? 1.157   1.572   -4.203  1.00 82.22  ? 158 PHE B CE1 1 
ATOM   2742  C CE2 . PHE B  2 162 ? 1.717   1.655   -1.869  1.00 82.55  ? 158 PHE B CE2 1 
ATOM   2743  C CZ  . PHE B  2 162 ? 1.260   2.288   -3.020  1.00 81.63  ? 158 PHE B CZ  1 
ATOM   2744  N N   . ARG B  2 163 ? 4.398   -3.866  -4.708  1.00 84.00  ? 159 ARG B N   1 
ATOM   2745  C CA  . ARG B  2 163 ? 5.225   -5.069  -4.639  1.00 85.76  ? 159 ARG B CA  1 
ATOM   2746  C C   . ARG B  2 163 ? 6.439   -4.774  -3.761  1.00 86.95  ? 159 ARG B C   1 
ATOM   2747  O O   . ARG B  2 163 ? 7.337   -4.027  -4.156  1.00 86.72  ? 159 ARG B O   1 
ATOM   2748  C CB  . ARG B  2 163 ? 5.687   -5.489  -6.041  1.00 86.86  ? 159 ARG B CB  1 
ATOM   2749  C CG  . ARG B  2 163 ? 6.597   -6.717  -6.061  1.00 87.93  ? 159 ARG B CG  1 
ATOM   2750  C CD  . ARG B  2 163 ? 6.953   -7.132  -7.483  1.00 88.98  ? 159 ARG B CD  1 
ATOM   2751  N NE  . ARG B  2 163 ? 7.907   -8.240  -7.511  1.00 90.70  ? 159 ARG B NE  1 
ATOM   2752  C CZ  . ARG B  2 163 ? 8.433   -8.749  -8.623  1.00 91.69  ? 159 ARG B CZ  1 
ATOM   2753  N NH1 . ARG B  2 163 ? 8.099   -8.251  -9.806  1.00 92.41  ? 159 ARG B NH1 1 
ATOM   2754  N NH2 . ARG B  2 163 ? 9.293   -9.758  -8.555  1.00 91.96  ? 159 ARG B NH2 1 
ATOM   2755  N N   . ASN B  2 164 ? 6.454   -5.360  -2.567  1.00 88.18  ? 160 ASN B N   1 
ATOM   2756  C CA  . ASN B  2 164 ? 7.545   -5.165  -1.614  1.00 88.95  ? 160 ASN B CA  1 
ATOM   2757  C C   . ASN B  2 164 ? 7.871   -3.683  -1.408  1.00 90.24  ? 160 ASN B C   1 
ATOM   2758  O O   . ASN B  2 164 ? 9.022   -3.264  -1.556  1.00 90.61  ? 160 ASN B O   1 
ATOM   2759  C CB  . ASN B  2 164 ? 8.811   -5.910  -2.074  1.00 88.15  ? 160 ASN B CB  1 
ATOM   2760  C CG  . ASN B  2 164 ? 8.640   -7.422  -2.067  1.00 87.91  ? 160 ASN B CG  1 
ATOM   2761  O OD1 . ASN B  2 164 ? 8.236   -8.008  -1.061  1.00 87.93  ? 160 ASN B OD1 1 
ATOM   2762  N ND2 . ASN B  2 164 ? 8.957   -8.060  -3.189  1.00 87.35  ? 160 ASN B ND2 1 
ATOM   2763  N N   . GLY B  2 165 ? 6.854   -2.894  -1.068  1.00 91.12  ? 161 GLY B N   1 
ATOM   2764  C CA  . GLY B  2 165 ? 7.065   -1.474  -0.835  1.00 91.48  ? 161 GLY B CA  1 
ATOM   2765  C C   . GLY B  2 165 ? 6.922   -0.597  -2.065  1.00 92.53  ? 161 GLY B C   1 
ATOM   2766  O O   . GLY B  2 165 ? 6.320   0.473   -1.996  1.00 91.96  ? 161 GLY B O   1 
ATOM   2767  N N   . LYS B  2 166 ? 7.481   -1.043  -3.187  1.00 93.73  ? 162 LYS B N   1 
ATOM   2768  C CA  . LYS B  2 166 ? 7.415   -0.293  -4.442  1.00 94.92  ? 162 LYS B CA  1 
ATOM   2769  C C   . LYS B  2 166 ? 6.076   -0.543  -5.129  1.00 95.81  ? 162 LYS B C   1 
ATOM   2770  O O   . LYS B  2 166 ? 5.479   -1.605  -4.954  1.00 95.56  ? 162 LYS B O   1 
ATOM   2771  C CB  . LYS B  2 166 ? 8.559   -0.714  -5.370  1.00 95.89  ? 162 LYS B CB  1 
ATOM   2772  C CG  . LYS B  2 166 ? 9.961   -0.346  -4.881  1.00 97.37  ? 162 LYS B CG  1 
ATOM   2773  C CD  . LYS B  2 166 ? 10.325  1.114   -5.177  1.00 98.32  ? 162 LYS B CD  1 
ATOM   2774  C CE  . LYS B  2 166 ? 9.635   2.097   -4.239  1.00 99.26  ? 162 LYS B CE  1 
ATOM   2775  N NZ  . LYS B  2 166 ? 10.091  1.948   -2.824  1.00 99.45  ? 162 LYS B NZ  1 
ATOM   2776  N N   . GLU B  2 167 ? 5.609   0.425   -5.917  1.00 96.33  ? 163 GLU B N   1 
ATOM   2777  C CA  . GLU B  2 167 ? 4.324   0.281   -6.600  1.00 96.12  ? 163 GLU B CA  1 
ATOM   2778  C C   . GLU B  2 167 ? 4.437   -0.119  -8.071  1.00 95.51  ? 163 GLU B C   1 
ATOM   2779  O O   . GLU B  2 167 ? 5.336   0.326   -8.786  1.00 95.64  ? 163 GLU B O   1 
ATOM   2780  C CB  . GLU B  2 167 ? 3.509   1.576   -6.490  1.00 97.89  ? 163 GLU B CB  1 
ATOM   2781  C CG  . GLU B  2 167 ? 3.802   2.623   -7.555  1.00 99.78  ? 163 GLU B CG  1 
ATOM   2782  C CD  . GLU B  2 167 ? 2.892   3.835   -7.435  1.00 100.83 ? 163 GLU B CD  1 
ATOM   2783  O OE1 . GLU B  2 167 ? 1.658   3.648   -7.353  1.00 101.61 ? 163 GLU B OE1 1 
ATOM   2784  O OE2 . GLU B  2 167 ? 3.409   4.973   -7.428  1.00 101.29 ? 163 GLU B OE2 1 
ATOM   2785  N N   . GLU B  2 168 ? 3.508   -0.966  -8.507  1.00 94.37  ? 164 GLU B N   1 
ATOM   2786  C CA  . GLU B  2 168 ? 3.461   -1.449  -9.881  1.00 92.50  ? 164 GLU B CA  1 
ATOM   2787  C C   . GLU B  2 168 ? 2.551   -0.570  -10.714 1.00 91.82  ? 164 GLU B C   1 
ATOM   2788  O O   . GLU B  2 168 ? 1.513   -0.114  -10.239 1.00 92.61  ? 164 GLU B O   1 
ATOM   2789  C CB  . GLU B  2 168 ? 2.939   -2.883  -9.916  1.00 92.97  ? 164 GLU B CB  1 
ATOM   2790  C CG  . GLU B  2 168 ? 3.956   -3.906  -9.481  1.00 94.17  ? 164 GLU B CG  1 
ATOM   2791  C CD  . GLU B  2 168 ? 4.996   -4.157  -10.547 1.00 95.09  ? 164 GLU B CD  1 
ATOM   2792  O OE1 . GLU B  2 168 ? 5.487   -3.172  -11.143 1.00 94.58  ? 164 GLU B OE1 1 
ATOM   2793  O OE2 . GLU B  2 168 ? 5.322   -5.340  -10.786 1.00 96.04  ? 164 GLU B OE2 1 
ATOM   2794  N N   . LYS B  2 169 ? 2.942   -0.340  -11.960 1.00 90.18  ? 165 LYS B N   1 
ATOM   2795  C CA  . LYS B  2 169 ? 2.155   0.480   -12.866 1.00 88.08  ? 165 LYS B CA  1 
ATOM   2796  C C   . LYS B  2 169 ? 1.894   -0.254  -14.173 1.00 86.19  ? 165 LYS B C   1 
ATOM   2797  O O   . LYS B  2 169 ? 1.032   0.145   -14.955 1.00 86.19  ? 165 LYS B O   1 
ATOM   2798  C CB  . LYS B  2 169 ? 2.874   1.807   -13.134 1.00 90.47  ? 165 LYS B CB  1 
ATOM   2799  C CG  . LYS B  2 169 ? 2.646   2.845   -12.046 1.00 92.26  ? 165 LYS B CG  1 
ATOM   2800  C CD  . LYS B  2 169 ? 1.206   3.342   -12.091 1.00 94.66  ? 165 LYS B CD  1 
ATOM   2801  C CE  . LYS B  2 169 ? 0.734   3.877   -10.743 1.00 95.90  ? 165 LYS B CE  1 
ATOM   2802  N NZ  . LYS B  2 169 ? 0.605   2.790   -9.728  1.00 96.58  ? 165 LYS B NZ  1 
ATOM   2803  N N   . THR B  2 170 ? 2.635   -1.336  -14.397 1.00 83.42  ? 166 THR B N   1 
ATOM   2804  C CA  . THR B  2 170 ? 2.488   -2.131  -15.613 1.00 80.30  ? 166 THR B CA  1 
ATOM   2805  C C   . THR B  2 170 ? 1.951   -3.526  -15.302 1.00 77.97  ? 166 THR B C   1 
ATOM   2806  O O   . THR B  2 170 ? 2.273   -4.114  -14.269 1.00 78.27  ? 166 THR B O   1 
ATOM   2807  C CB  . THR B  2 170 ? 3.837   -2.267  -16.367 1.00 81.06  ? 166 THR B CB  1 
ATOM   2808  O OG1 . THR B  2 170 ? 4.757   -3.034  -15.580 1.00 80.24  ? 166 THR B OG1 1 
ATOM   2809  C CG2 . THR B  2 170 ? 4.436   -0.886  -16.638 1.00 80.03  ? 166 THR B CG2 1 
ATOM   2810  N N   . GLY B  2 171 ? 1.131   -4.053  -16.204 1.00 75.60  ? 167 GLY B N   1 
ATOM   2811  C CA  . GLY B  2 171 ? 0.557   -5.371  -16.000 1.00 71.77  ? 167 GLY B CA  1 
ATOM   2812  C C   . GLY B  2 171 ? -0.743  -5.305  -15.223 1.00 69.74  ? 167 GLY B C   1 
ATOM   2813  O O   . GLY B  2 171 ? -1.235  -6.315  -14.733 1.00 69.77  ? 167 GLY B O   1 
ATOM   2814  N N   . ILE B  2 172 ? -1.301  -4.105  -15.113 1.00 67.80  ? 168 ILE B N   1 
ATOM   2815  C CA  . ILE B  2 172 ? -2.550  -3.891  -14.390 1.00 64.46  ? 168 ILE B CA  1 
ATOM   2816  C C   . ILE B  2 172 ? -3.765  -3.988  -15.319 1.00 63.12  ? 168 ILE B C   1 
ATOM   2817  O O   . ILE B  2 172 ? -3.905  -3.193  -16.253 1.00 63.18  ? 168 ILE B O   1 
ATOM   2818  C CB  . ILE B  2 172 ? -2.577  -2.490  -13.736 1.00 64.94  ? 168 ILE B CB  1 
ATOM   2819  C CG1 . ILE B  2 172 ? -1.313  -2.262  -12.901 1.00 64.19  ? 168 ILE B CG1 1 
ATOM   2820  C CG2 . ILE B  2 172 ? -3.828  -2.343  -12.881 1.00 63.77  ? 168 ILE B CG2 1 
ATOM   2821  C CD1 . ILE B  2 172 ? -1.252  -3.071  -11.630 1.00 65.17  ? 168 ILE B CD1 1 
ATOM   2822  N N   . VAL B  2 173 ? -4.637  -4.959  -15.061 1.00 60.23  ? 169 VAL B N   1 
ATOM   2823  C CA  . VAL B  2 173 ? -5.849  -5.130  -15.856 1.00 58.11  ? 169 VAL B CA  1 
ATOM   2824  C C   . VAL B  2 173 ? -7.054  -5.049  -14.924 1.00 56.01  ? 169 VAL B C   1 
ATOM   2825  O O   . VAL B  2 173 ? -6.988  -5.491  -13.782 1.00 55.01  ? 169 VAL B O   1 
ATOM   2826  C CB  . VAL B  2 173 ? -5.874  -6.481  -16.594 1.00 58.37  ? 169 VAL B CB  1 
ATOM   2827  C CG1 . VAL B  2 173 ? -7.144  -6.592  -17.418 1.00 58.97  ? 169 VAL B CG1 1 
ATOM   2828  C CG2 . VAL B  2 173 ? -4.667  -6.597  -17.504 1.00 60.25  ? 169 VAL B CG2 1 
ATOM   2829  N N   . SER B  2 174 ? -8.156  -4.492  -15.422 1.00 53.88  ? 170 SER B N   1 
ATOM   2830  C CA  . SER B  2 174 ? -9.360  -4.320  -14.616 1.00 51.75  ? 170 SER B CA  1 
ATOM   2831  C C   . SER B  2 174 ? -10.692 -4.454  -15.365 1.00 50.26  ? 170 SER B C   1 
ATOM   2832  O O   . SER B  2 174 ? -10.741 -4.361  -16.591 1.00 49.90  ? 170 SER B O   1 
ATOM   2833  C CB  . SER B  2 174 ? -9.302  -2.955  -13.922 1.00 49.74  ? 170 SER B CB  1 
ATOM   2834  O OG  . SER B  2 174 ? -10.591 -2.514  -13.546 1.00 52.34  ? 170 SER B OG  1 
ATOM   2835  N N   . THR B  2 175 ? -11.765 -4.674  -14.605 1.00 47.71  ? 171 THR B N   1 
ATOM   2836  C CA  . THR B  2 175 ? -13.109 -4.800  -15.162 1.00 47.70  ? 171 THR B CA  1 
ATOM   2837  C C   . THR B  2 175 ? -13.737 -3.408  -15.219 1.00 47.68  ? 171 THR B C   1 
ATOM   2838  O O   . THR B  2 175 ? -14.881 -3.237  -15.652 1.00 47.99  ? 171 THR B O   1 
ATOM   2839  C CB  . THR B  2 175 ? -14.016 -5.674  -14.273 1.00 47.29  ? 171 THR B CB  1 
ATOM   2840  O OG1 . THR B  2 175 ? -14.147 -5.061  -12.982 1.00 46.67  ? 171 THR B OG1 1 
ATOM   2841  C CG2 . THR B  2 175 ? -13.436 -7.069  -14.120 1.00 46.30  ? 171 THR B CG2 1 
ATOM   2842  N N   . GLY B  2 176 ? -12.984 -2.414  -14.770 1.00 47.41  ? 172 GLY B N   1 
ATOM   2843  C CA  . GLY B  2 176 ? -13.503 -1.062  -14.761 1.00 46.13  ? 172 GLY B CA  1 
ATOM   2844  C C   . GLY B  2 176 ? -14.570 -0.955  -13.689 1.00 45.61  ? 172 GLY B C   1 
ATOM   2845  O O   . GLY B  2 176 ? -14.790 -1.893  -12.920 1.00 45.00  ? 172 GLY B O   1 
ATOM   2846  N N   . LEU B  2 177 ? -15.238 0.189   -13.650 1.00 43.21  ? 173 LEU B N   1 
ATOM   2847  C CA  . LEU B  2 177 ? -16.285 0.443   -12.676 1.00 42.20  ? 173 LEU B CA  1 
ATOM   2848  C C   . LEU B  2 177 ? -17.600 -0.222  -13.086 1.00 41.36  ? 173 LEU B C   1 
ATOM   2849  O O   . LEU B  2 177 ? -18.130 0.054   -14.155 1.00 42.68  ? 173 LEU B O   1 
ATOM   2850  C CB  . LEU B  2 177 ? -16.479 1.952   -12.538 1.00 41.34  ? 173 LEU B CB  1 
ATOM   2851  C CG  . LEU B  2 177 ? -17.438 2.427   -11.454 1.00 43.01  ? 173 LEU B CG  1 
ATOM   2852  C CD1 . LEU B  2 177 ? -16.907 1.989   -10.080 1.00 43.87  ? 173 LEU B CD1 1 
ATOM   2853  C CD2 . LEU B  2 177 ? -17.575 3.944   -11.527 1.00 41.02  ? 173 LEU B CD2 1 
ATOM   2854  N N   . VAL B  2 178 ? -18.126 -1.101  -12.238 1.00 41.96  ? 174 VAL B N   1 
ATOM   2855  C CA  . VAL B  2 178 ? -19.379 -1.787  -12.543 1.00 40.61  ? 174 VAL B CA  1 
ATOM   2856  C C   . VAL B  2 178 ? -20.534 -1.311  -11.652 1.00 41.30  ? 174 VAL B C   1 
ATOM   2857  O O   . VAL B  2 178 ? -20.470 -1.392  -10.423 1.00 39.07  ? 174 VAL B O   1 
ATOM   2858  C CB  . VAL B  2 178 ? -19.231 -3.319  -12.398 1.00 41.98  ? 174 VAL B CB  1 
ATOM   2859  C CG1 . VAL B  2 178 ? -20.577 -3.998  -12.668 1.00 42.45  ? 174 VAL B CG1 1 
ATOM   2860  C CG2 . VAL B  2 178 ? -18.185 -3.842  -13.376 1.00 40.60  ? 174 VAL B CG2 1 
ATOM   2861  N N   . ARG B  2 179 ? -21.587 -0.816  -12.300 1.00 41.02  ? 175 ARG B N   1 
ATOM   2862  C CA  . ARG B  2 179 ? -22.782 -0.300  -11.633 1.00 37.64  ? 175 ARG B CA  1 
ATOM   2863  C C   . ARG B  2 179 ? -23.788 -1.423  -11.377 1.00 36.80  ? 175 ARG B C   1 
ATOM   2864  O O   . ARG B  2 179 ? -24.241 -2.077  -12.309 1.00 35.89  ? 175 ARG B O   1 
ATOM   2865  C CB  . ARG B  2 179 ? -23.416 0.773   -12.515 1.00 34.02  ? 175 ARG B CB  1 
ATOM   2866  C CG  . ARG B  2 179 ? -24.575 1.496   -11.891 1.00 38.09  ? 175 ARG B CG  1 
ATOM   2867  C CD  . ARG B  2 179 ? -25.201 2.470   -12.890 1.00 39.52  ? 175 ARG B CD  1 
ATOM   2868  N NE  . ARG B  2 179 ? -24.325 3.588   -13.236 1.00 37.95  ? 175 ARG B NE  1 
ATOM   2869  C CZ  . ARG B  2 179 ? -24.066 4.618   -12.434 1.00 41.05  ? 175 ARG B CZ  1 
ATOM   2870  N NH1 . ARG B  2 179 ? -24.612 4.683   -11.221 1.00 41.64  ? 175 ARG B NH1 1 
ATOM   2871  N NH2 . ARG B  2 179 ? -23.275 5.598   -12.853 1.00 40.48  ? 175 ARG B NH2 1 
ATOM   2872  N N   . ASN B  2 180 ? -24.156 -1.630  -10.116 1.00 37.18  ? 176 ASN B N   1 
ATOM   2873  C CA  . ASN B  2 180 ? -25.095 -2.697  -9.770  1.00 37.11  ? 176 ASN B CA  1 
ATOM   2874  C C   . ASN B  2 180 ? -26.559 -2.327  -9.921  1.00 36.64  ? 176 ASN B C   1 
ATOM   2875  O O   . ASN B  2 180 ? -27.432 -3.201  -9.886  1.00 34.33  ? 176 ASN B O   1 
ATOM   2876  C CB  . ASN B  2 180 ? -24.842 -3.186  -8.345  1.00 36.97  ? 176 ASN B CB  1 
ATOM   2877  C CG  . ASN B  2 180 ? -23.439 -3.724  -8.163  1.00 38.22  ? 176 ASN B CG  1 
ATOM   2878  O OD1 . ASN B  2 180 ? -22.924 -4.440  -9.028  1.00 35.97  ? 176 ASN B OD1 1 
ATOM   2879  N ND2 . ASN B  2 180 ? -22.809 -3.390  -7.033  1.00 36.98  ? 176 ASN B ND2 1 
ATOM   2880  N N   . GLY B  2 181 ? -26.823 -1.032  -10.088 1.00 36.66  ? 177 GLY B N   1 
ATOM   2881  C CA  . GLY B  2 181 ? -28.189 -0.573  -10.257 1.00 36.09  ? 177 GLY B CA  1 
ATOM   2882  C C   . GLY B  2 181 ? -28.930 -0.350  -8.956  1.00 37.46  ? 177 GLY B C   1 
ATOM   2883  O O   . GLY B  2 181 ? -30.065 0.122   -8.972  1.00 38.13  ? 177 GLY B O   1 
ATOM   2884  N N   . ASP B  2 182 ? -28.289 -0.682  -7.836  1.00 37.17  ? 178 ASP B N   1 
ATOM   2885  C CA  . ASP B  2 182 ? -28.882 -0.513  -6.509  1.00 37.73  ? 178 ASP B CA  1 
ATOM   2886  C C   . ASP B  2 182 ? -28.159 0.565   -5.676  1.00 37.50  ? 178 ASP B C   1 
ATOM   2887  O O   . ASP B  2 182 ? -28.246 0.575   -4.450  1.00 36.17  ? 178 ASP B O   1 
ATOM   2888  C CB  . ASP B  2 182 ? -28.836 -1.839  -5.755  1.00 39.40  ? 178 ASP B CB  1 
ATOM   2889  C CG  . ASP B  2 182 ? -27.411 -2.320  -5.509  1.00 42.79  ? 178 ASP B CG  1 
ATOM   2890  O OD1 . ASP B  2 182 ? -26.449 -1.599  -5.868  1.00 41.02  ? 178 ASP B OD1 1 
ATOM   2891  O OD2 . ASP B  2 182 ? -27.256 -3.427  -4.953  1.00 45.67  ? 178 ASP B OD2 1 
ATOM   2892  N N   . TRP B  2 183 ? -27.449 1.460   -6.351  1.00 35.55  ? 179 TRP B N   1 
ATOM   2893  C CA  . TRP B  2 183 ? -26.706 2.530   -5.698  1.00 35.05  ? 179 TRP B CA  1 
ATOM   2894  C C   . TRP B  2 183 ? -25.381 2.085   -5.081  1.00 35.29  ? 179 TRP B C   1 
ATOM   2895  O O   . TRP B  2 183 ? -24.890 2.694   -4.135  1.00 35.58  ? 179 TRP B O   1 
ATOM   2896  C CB  . TRP B  2 183 ? -27.566 3.248   -4.649  1.00 33.33  ? 179 TRP B CB  1 
ATOM   2897  C CG  . TRP B  2 183 ? -28.559 4.214   -5.252  1.00 34.61  ? 179 TRP B CG  1 
ATOM   2898  C CD1 . TRP B  2 183 ? -29.786 3.909   -5.776  1.00 33.12  ? 179 TRP B CD1 1 
ATOM   2899  C CD2 . TRP B  2 183 ? -28.401 5.635   -5.405  1.00 31.69  ? 179 TRP B CD2 1 
ATOM   2900  N NE1 . TRP B  2 183 ? -30.397 5.048   -6.238  1.00 34.37  ? 179 TRP B NE1 1 
ATOM   2901  C CE2 . TRP B  2 183 ? -29.572 6.121   -6.024  1.00 32.16  ? 179 TRP B CE2 1 
ATOM   2902  C CE3 . TRP B  2 183 ? -27.383 6.542   -5.078  1.00 31.92  ? 179 TRP B CE3 1 
ATOM   2903  C CZ2 . TRP B  2 183 ? -29.758 7.479   -6.323  1.00 32.87  ? 179 TRP B CZ2 1 
ATOM   2904  C CZ3 . TRP B  2 183 ? -27.564 7.896   -5.375  1.00 28.82  ? 179 TRP B CZ3 1 
ATOM   2905  C CH2 . TRP B  2 183 ? -28.746 8.350   -5.991  1.00 32.04  ? 179 TRP B CH2 1 
ATOM   2906  N N   . THR B  2 184 ? -24.806 1.019   -5.632  1.00 36.48  ? 180 THR B N   1 
ATOM   2907  C CA  . THR B  2 184 ? -23.509 0.513   -5.192  1.00 37.24  ? 180 THR B CA  1 
ATOM   2908  C C   . THR B  2 184 ? -22.730 0.103   -6.431  1.00 38.27  ? 180 THR B C   1 
ATOM   2909  O O   . THR B  2 184 ? -23.320 -0.175  -7.482  1.00 37.90  ? 180 THR B O   1 
ATOM   2910  C CB  . THR B  2 184 ? -23.617 -0.735  -4.281  1.00 38.65  ? 180 THR B CB  1 
ATOM   2911  O OG1 . THR B  2 184 ? -24.225 -1.816  -5.007  1.00 37.60  ? 180 THR B OG1 1 
ATOM   2912  C CG2 . THR B  2 184 ? -24.423 -0.423  -3.034  1.00 37.47  ? 180 THR B CG2 1 
ATOM   2913  N N   . PHE B  2 185 ? -21.407 0.060   -6.291  1.00 38.61  ? 181 PHE B N   1 
ATOM   2914  C CA  . PHE B  2 185 ? -20.501 -0.314  -7.375  1.00 38.13  ? 181 PHE B CA  1 
ATOM   2915  C C   . PHE B  2 185 ? -19.585 -1.465  -6.944  1.00 39.01  ? 181 PHE B C   1 
ATOM   2916  O O   . PHE B  2 185 ? -19.562 -1.861  -5.779  1.00 38.83  ? 181 PHE B O   1 
ATOM   2917  C CB  . PHE B  2 185 ? -19.599 0.863   -7.741  1.00 36.75  ? 181 PHE B CB  1 
ATOM   2918  C CG  . PHE B  2 185 ? -20.308 2.017   -8.391  1.00 36.18  ? 181 PHE B CG  1 
ATOM   2919  C CD1 . PHE B  2 185 ? -20.504 2.042   -9.767  1.00 35.54  ? 181 PHE B CD1 1 
ATOM   2920  C CD2 . PHE B  2 185 ? -20.701 3.117   -7.640  1.00 32.75  ? 181 PHE B CD2 1 
ATOM   2921  C CE1 . PHE B  2 185 ? -21.073 3.152   -10.383 1.00 35.88  ? 181 PHE B CE1 1 
ATOM   2922  C CE2 . PHE B  2 185 ? -21.265 4.222   -8.243  1.00 34.61  ? 181 PHE B CE2 1 
ATOM   2923  C CZ  . PHE B  2 185 ? -21.452 4.245   -9.626  1.00 35.06  ? 181 PHE B CZ  1 
ATOM   2924  N N   . GLN B  2 186 ? -18.820 -1.980  -7.900  1.00 38.95  ? 182 GLN B N   1 
ATOM   2925  C CA  . GLN B  2 186 ? -17.855 -3.036  -7.649  1.00 39.85  ? 182 GLN B CA  1 
ATOM   2926  C C   . GLN B  2 186 ? -16.844 -3.033  -8.785  1.00 42.33  ? 182 GLN B C   1 
ATOM   2927  O O   . GLN B  2 186 ? -17.129 -2.554  -9.894  1.00 42.74  ? 182 GLN B O   1 
ATOM   2928  C CB  . GLN B  2 186 ? -18.529 -4.403  -7.563  1.00 39.01  ? 182 GLN B CB  1 
ATOM   2929  C CG  . GLN B  2 186 ? -19.152 -4.880  -8.850  1.00 38.41  ? 182 GLN B CG  1 
ATOM   2930  C CD  . GLN B  2 186 ? -19.752 -6.266  -8.724  1.00 39.37  ? 182 GLN B CD  1 
ATOM   2931  O OE1 . GLN B  2 186 ? -19.040 -7.254  -8.530  1.00 40.92  ? 182 GLN B OE1 1 
ATOM   2932  N NE2 . GLN B  2 186 ? -21.070 -6.348  -8.831  1.00 38.52  ? 182 GLN B NE2 1 
ATOM   2933  N N   . THR B  2 187 ? -15.655 -3.554  -8.509  1.00 43.69  ? 183 THR B N   1 
ATOM   2934  C CA  . THR B  2 187 ? -14.613 -3.621  -9.522  1.00 45.51  ? 183 THR B CA  1 
ATOM   2935  C C   . THR B  2 187 ? -13.522 -4.597  -9.112  1.00 46.16  ? 183 THR B C   1 
ATOM   2936  O O   . THR B  2 187 ? -13.291 -4.820  -7.925  1.00 47.78  ? 183 THR B O   1 
ATOM   2937  C CB  . THR B  2 187 ? -13.987 -2.228  -9.772  1.00 44.91  ? 183 THR B CB  1 
ATOM   2938  O OG1 . THR B  2 187 ? -13.055 -2.309  -10.856 1.00 48.76  ? 183 THR B OG1 1 
ATOM   2939  C CG2 . THR B  2 187 ? -13.270 -1.729  -8.534  1.00 46.79  ? 183 THR B CG2 1 
ATOM   2940  N N   . LEU B  2 188 ? -12.871 -5.198  -10.099 1.00 46.38  ? 184 LEU B N   1 
ATOM   2941  C CA  . LEU B  2 188 ? -11.781 -6.127  -9.847  1.00 46.62  ? 184 LEU B CA  1 
ATOM   2942  C C   . LEU B  2 188 ? -10.539 -5.540  -10.506 1.00 47.49  ? 184 LEU B C   1 
ATOM   2943  O O   . LEU B  2 188 ? -10.574 -5.218  -11.688 1.00 48.77  ? 184 LEU B O   1 
ATOM   2944  C CB  . LEU B  2 188 ? -12.083 -7.497  -10.469 1.00 45.99  ? 184 LEU B CB  1 
ATOM   2945  C CG  . LEU B  2 188 ? -13.335 -8.254  -10.004 1.00 49.10  ? 184 LEU B CG  1 
ATOM   2946  C CD1 . LEU B  2 188 ? -13.533 -9.518  -10.850 1.00 49.18  ? 184 LEU B CD1 1 
ATOM   2947  C CD2 . LEU B  2 188 ? -13.196 -8.622  -8.533  1.00 48.02  ? 184 LEU B CD2 1 
ATOM   2948  N N   . VAL B  2 189 ? -9.458  -5.366  -9.750  1.00 48.84  ? 185 VAL B N   1 
ATOM   2949  C CA  . VAL B  2 189 ? -8.214  -4.849  -10.324 1.00 50.43  ? 185 VAL B CA  1 
ATOM   2950  C C   . VAL B  2 189 ? -7.177  -5.938  -10.137 1.00 52.93  ? 185 VAL B C   1 
ATOM   2951  O O   . VAL B  2 189 ? -6.861  -6.327  -9.014  1.00 52.69  ? 185 VAL B O   1 
ATOM   2952  C CB  . VAL B  2 189 ? -7.721  -3.562  -9.639  1.00 50.22  ? 185 VAL B CB  1 
ATOM   2953  C CG1 . VAL B  2 189 ? -6.413  -3.124  -10.274 1.00 49.06  ? 185 VAL B CG1 1 
ATOM   2954  C CG2 . VAL B  2 189 ? -8.755  -2.459  -9.786  1.00 47.73  ? 185 VAL B CG2 1 
ATOM   2955  N N   . MET B  2 190 ? -6.646  -6.429  -11.247 1.00 55.98  ? 186 MET B N   1 
ATOM   2956  C CA  . MET B  2 190 ? -5.693  -7.524  -11.206 1.00 58.41  ? 186 MET B CA  1 
ATOM   2957  C C   . MET B  2 190 ? -4.281  -7.183  -11.635 1.00 60.41  ? 186 MET B C   1 
ATOM   2958  O O   . MET B  2 190 ? -4.066  -6.401  -12.554 1.00 60.45  ? 186 MET B O   1 
ATOM   2959  C CB  . MET B  2 190 ? -6.233  -8.661  -12.058 1.00 60.03  ? 186 MET B CB  1 
ATOM   2960  C CG  . MET B  2 190 ? -7.633  -9.047  -11.652 1.00 62.05  ? 186 MET B CG  1 
ATOM   2961  S SD  . MET B  2 190 ? -8.665  -9.427  -13.052 1.00 67.94  ? 186 MET B SD  1 
ATOM   2962  C CE  . MET B  2 190 ? -8.369  -11.226 -13.223 1.00 64.35  ? 186 MET B CE  1 
ATOM   2963  N N   . LEU B  2 191 ? -3.321  -7.792  -10.952 1.00 63.04  ? 187 LEU B N   1 
ATOM   2964  C CA  . LEU B  2 191 ? -1.924  -7.566  -11.248 1.00 65.54  ? 187 LEU B CA  1 
ATOM   2965  C C   . LEU B  2 191 ? -1.344  -8.787  -11.928 1.00 68.72  ? 187 LEU B C   1 
ATOM   2966  O O   . LEU B  2 191 ? -1.495  -9.910  -11.456 1.00 69.39  ? 187 LEU B O   1 
ATOM   2967  C CB  . LEU B  2 191 ? -1.150  -7.263  -9.972  1.00 64.77  ? 187 LEU B CB  1 
ATOM   2968  C CG  . LEU B  2 191 ? 0.342   -7.016  -10.174 1.00 65.24  ? 187 LEU B CG  1 
ATOM   2969  C CD1 . LEU B  2 191 ? 0.556   -6.017  -11.298 1.00 65.72  ? 187 LEU B CD1 1 
ATOM   2970  C CD2 . LEU B  2 191 ? 0.945   -6.508  -8.879  1.00 64.66  ? 187 LEU B CD2 1 
ATOM   2971  N N   . GLU B  2 192 ? -0.691  -8.556  -13.056 1.00 72.66  ? 188 GLU B N   1 
ATOM   2972  C CA  . GLU B  2 192 ? -0.082  -9.629  -13.822 1.00 76.03  ? 188 GLU B CA  1 
ATOM   2973  C C   . GLU B  2 192 ? 1.347   -9.799  -13.329 1.00 77.67  ? 188 GLU B C   1 
ATOM   2974  O O   . GLU B  2 192 ? 2.224   -9.004  -13.662 1.00 78.15  ? 188 GLU B O   1 
ATOM   2975  C CB  . GLU B  2 192 ? -0.103  -9.275  -15.319 1.00 78.85  ? 188 GLU B CB  1 
ATOM   2976  C CG  . GLU B  2 192 ? -1.502  -8.894  -15.828 1.00 83.01  ? 188 GLU B CG  1 
ATOM   2977  C CD  . GLU B  2 192 ? -1.514  -8.380  -17.263 1.00 85.40  ? 188 GLU B CD  1 
ATOM   2978  O OE1 . GLU B  2 192 ? -0.685  -7.501  -17.590 1.00 87.15  ? 188 GLU B OE1 1 
ATOM   2979  O OE2 . GLU B  2 192 ? -2.366  -8.845  -18.058 1.00 85.40  ? 188 GLU B OE2 1 
ATOM   2980  N N   . THR B  2 193 ? 1.571   -10.821 -12.508 1.00 78.95  ? 189 THR B N   1 
ATOM   2981  C CA  . THR B  2 193 ? 2.905   -11.092 -11.985 1.00 79.94  ? 189 THR B CA  1 
ATOM   2982  C C   . THR B  2 193 ? 3.145   -12.583 -11.802 1.00 82.36  ? 189 THR B C   1 
ATOM   2983  O O   . THR B  2 193 ? 2.351   -13.418 -12.245 1.00 82.78  ? 189 THR B O   1 
ATOM   2984  C CB  . THR B  2 193 ? 3.151   -10.392 -10.625 1.00 79.88  ? 189 THR B CB  1 
ATOM   2985  O OG1 . THR B  2 193 ? 2.161   -10.812 -9.677  1.00 79.28  ? 189 THR B OG1 1 
ATOM   2986  C CG2 . THR B  2 193 ? 3.106   -8.880  -10.785 1.00 79.16  ? 189 THR B CG2 1 
ATOM   2987  N N   . VAL B  2 194 ? 4.258   -12.908 -11.154 1.00 84.35  ? 190 VAL B N   1 
ATOM   2988  C CA  . VAL B  2 194 ? 4.614   -14.294 -10.887 1.00 85.41  ? 190 VAL B CA  1 
ATOM   2989  C C   . VAL B  2 194 ? 4.907   -14.431 -9.396  1.00 87.41  ? 190 VAL B C   1 
ATOM   2990  O O   . VAL B  2 194 ? 6.049   -14.264 -8.955  1.00 87.02  ? 190 VAL B O   1 
ATOM   2991  C CB  . VAL B  2 194 ? 5.854   -14.727 -11.691 1.00 85.96  ? 190 VAL B CB  1 
ATOM   2992  C CG1 . VAL B  2 194 ? 6.021   -16.237 -11.597 1.00 85.99  ? 190 VAL B CG1 1 
ATOM   2993  C CG2 . VAL B  2 194 ? 5.715   -14.289 -13.144 1.00 85.86  ? 190 VAL B CG2 1 
ATOM   2994  N N   . PRO B  2 195 ? 3.863   -14.726 -8.601  1.00 88.81  ? 191 PRO B N   1 
ATOM   2995  C CA  . PRO B  2 195 ? 3.925   -14.898 -7.147  1.00 89.52  ? 191 PRO B CA  1 
ATOM   2996  C C   . PRO B  2 195 ? 4.969   -15.910 -6.673  1.00 92.12  ? 191 PRO B C   1 
ATOM   2997  O O   . PRO B  2 195 ? 4.816   -17.123 -6.869  1.00 92.64  ? 191 PRO B O   1 
ATOM   2998  C CB  . PRO B  2 195 ? 2.505   -15.333 -6.794  1.00 90.60  ? 191 PRO B CB  1 
ATOM   2999  C CG  . PRO B  2 195 ? 1.680   -14.620 -7.816  1.00 90.42  ? 191 PRO B CG  1 
ATOM   3000  C CD  . PRO B  2 195 ? 2.474   -14.861 -9.075  1.00 89.36  ? 191 PRO B CD  1 
ATOM   3001  N N   . GLN B  2 196 ? 6.026   -15.395 -6.049  1.00 93.23  ? 192 GLN B N   1 
ATOM   3002  C CA  . GLN B  2 196 ? 7.107   -16.222 -5.514  1.00 93.06  ? 192 GLN B CA  1 
ATOM   3003  C C   . GLN B  2 196 ? 6.863   -16.432 -4.020  1.00 94.51  ? 192 GLN B C   1 
ATOM   3004  O O   . GLN B  2 196 ? 6.023   -15.754 -3.423  1.00 95.11  ? 192 GLN B O   1 
ATOM   3005  C CB  . GLN B  2 196 ? 8.451   -15.522 -5.731  1.00 94.18  ? 192 GLN B CB  1 
ATOM   3006  C CG  . GLN B  2 196 ? 8.824   -15.342 -7.195  1.00 94.64  ? 192 GLN B CG  1 
ATOM   3007  C CD  . GLN B  2 196 ? 9.939   -14.337 -7.387  1.00 95.17  ? 192 GLN B CD  1 
ATOM   3008  O OE1 . GLN B  2 196 ? 10.983  -14.419 -6.742  1.00 94.91  ? 192 GLN B OE1 1 
ATOM   3009  N NE2 . GLN B  2 196 ? 9.723   -13.378 -8.283  1.00 96.43  ? 192 GLN B NE2 1 
ATOM   3010  N N   . SER B  2 197 ? 7.589   -17.369 -3.416  1.00 94.83  ? 193 SER B N   1 
ATOM   3011  C CA  . SER B  2 197 ? 7.424   -17.639 -1.989  1.00 94.45  ? 193 SER B CA  1 
ATOM   3012  C C   . SER B  2 197 ? 7.731   -16.367 -1.207  1.00 95.04  ? 193 SER B C   1 
ATOM   3013  O O   . SER B  2 197 ? 6.876   -15.840 -0.489  1.00 95.31  ? 193 SER B O   1 
ATOM   3014  C CB  . SER B  2 197 ? 8.360   -18.768 -1.544  1.00 95.78  ? 193 SER B CB  1 
ATOM   3015  O OG  . SER B  2 197 ? 9.717   -18.454 -1.818  1.00 96.19  ? 193 SER B OG  1 
ATOM   3016  N N   . GLY B  2 198 ? 8.955   -15.875 -1.359  1.00 94.66  ? 194 GLY B N   1 
ATOM   3017  C CA  . GLY B  2 198 ? 9.348   -14.661 -0.674  1.00 93.58  ? 194 GLY B CA  1 
ATOM   3018  C C   . GLY B  2 198 ? 8.909   -13.449 -1.473  1.00 94.41  ? 194 GLY B C   1 
ATOM   3019  O O   . GLY B  2 198 ? 9.659   -12.949 -2.316  1.00 94.82  ? 194 GLY B O   1 
ATOM   3020  N N   . GLU B  2 199 ? 7.692   -12.979 -1.215  1.00 93.81  ? 195 GLU B N   1 
ATOM   3021  C CA  . GLU B  2 199 ? 7.166   -11.821 -1.926  1.00 92.56  ? 195 GLU B CA  1 
ATOM   3022  C C   . GLU B  2 199 ? 5.976   -11.215 -1.182  1.00 92.04  ? 195 GLU B C   1 
ATOM   3023  O O   . GLU B  2 199 ? 5.080   -11.936 -0.728  1.00 91.49  ? 195 GLU B O   1 
ATOM   3024  C CB  . GLU B  2 199 ? 6.763   -12.233 -3.343  1.00 94.32  ? 195 GLU B CB  1 
ATOM   3025  C CG  . GLU B  2 199 ? 6.818   -11.108 -4.355  1.00 97.02  ? 195 GLU B CG  1 
ATOM   3026  C CD  . GLU B  2 199 ? 6.907   -11.621 -5.784  1.00 98.92  ? 195 GLU B CD  1 
ATOM   3027  O OE1 . GLU B  2 199 ? 5.954   -12.290 -6.239  1.00 99.57  ? 195 GLU B OE1 1 
ATOM   3028  O OE2 . GLU B  2 199 ? 7.936   -11.357 -6.448  1.00 99.15  ? 195 GLU B OE2 1 
ATOM   3029  N N   . VAL B  2 200 ? 5.978   -9.888  -1.059  1.00 90.63  ? 196 VAL B N   1 
ATOM   3030  C CA  . VAL B  2 200 ? 4.915   -9.171  -0.361  1.00 88.38  ? 196 VAL B CA  1 
ATOM   3031  C C   . VAL B  2 200 ? 4.195   -8.171  -1.268  1.00 87.64  ? 196 VAL B C   1 
ATOM   3032  O O   . VAL B  2 200 ? 4.757   -7.142  -1.648  1.00 87.39  ? 196 VAL B O   1 
ATOM   3033  C CB  . VAL B  2 200 ? 5.475   -8.407  0.862   1.00 88.90  ? 196 VAL B CB  1 
ATOM   3034  C CG1 . VAL B  2 200 ? 4.333   -7.887  1.716   1.00 89.41  ? 196 VAL B CG1 1 
ATOM   3035  C CG2 . VAL B  2 200 ? 6.382   -9.314  1.677   1.00 89.39  ? 196 VAL B CG2 1 
ATOM   3036  N N   . TYR B  2 201 ? 2.948   -8.485  -1.605  1.00 85.96  ? 197 TYR B N   1 
ATOM   3037  C CA  . TYR B  2 201 ? 2.122   -7.634  -2.459  1.00 83.43  ? 197 TYR B CA  1 
ATOM   3038  C C   . TYR B  2 201 ? 1.049   -6.945  -1.618  1.00 82.16  ? 197 TYR B C   1 
ATOM   3039  O O   . TYR B  2 201 ? 0.641   -7.466  -0.579  1.00 82.72  ? 197 TYR B O   1 
ATOM   3040  C CB  . TYR B  2 201 ? 1.441   -8.474  -3.543  1.00 85.60  ? 197 TYR B CB  1 
ATOM   3041  C CG  . TYR B  2 201 ? 2.337   -8.903  -4.684  1.00 87.33  ? 197 TYR B CG  1 
ATOM   3042  C CD1 . TYR B  2 201 ? 2.369   -10.234 -5.112  1.00 88.51  ? 197 TYR B CD1 1 
ATOM   3043  C CD2 . TYR B  2 201 ? 3.114   -7.974  -5.370  1.00 88.08  ? 197 TYR B CD2 1 
ATOM   3044  C CE1 . TYR B  2 201 ? 3.153   -10.626 -6.202  1.00 88.93  ? 197 TYR B CE1 1 
ATOM   3045  C CE2 . TYR B  2 201 ? 3.900   -8.353  -6.460  1.00 88.92  ? 197 TYR B CE2 1 
ATOM   3046  C CZ  . TYR B  2 201 ? 3.916   -9.676  -6.871  1.00 89.50  ? 197 TYR B CZ  1 
ATOM   3047  O OH  . TYR B  2 201 ? 4.696   -10.040 -7.947  1.00 89.40  ? 197 TYR B OH  1 
ATOM   3048  N N   . THR B  2 202 ? 0.592   -5.780  -2.070  1.00 79.24  ? 198 THR B N   1 
ATOM   3049  C CA  . THR B  2 202 ? -0.445  -5.042  -1.354  1.00 76.16  ? 198 THR B CA  1 
ATOM   3050  C C   . THR B  2 202 ? -1.323  -4.206  -2.286  1.00 74.49  ? 198 THR B C   1 
ATOM   3051  O O   . THR B  2 202 ? -0.844  -3.636  -3.269  1.00 74.27  ? 198 THR B O   1 
ATOM   3052  C CB  . THR B  2 202 ? 0.166   -4.111  -0.285  1.00 76.92  ? 198 THR B CB  1 
ATOM   3053  O OG1 . THR B  2 202 ? 1.248   -3.368  -0.857  1.00 77.10  ? 198 THR B OG1 1 
ATOM   3054  C CG2 . THR B  2 202 ? 0.672   -4.914  0.891   1.00 76.60  ? 198 THR B CG2 1 
ATOM   3055  N N   . CYS B  2 203 ? -2.615  -4.145  -1.968  1.00 71.55  ? 199 CYS B N   1 
ATOM   3056  C CA  . CYS B  2 203 ? -3.575  -3.379  -2.754  1.00 67.62  ? 199 CYS B CA  1 
ATOM   3057  C C   . CYS B  2 203 ? -4.051  -2.170  -1.946  1.00 66.34  ? 199 CYS B C   1 
ATOM   3058  O O   . CYS B  2 203 ? -4.653  -2.322  -0.886  1.00 65.67  ? 199 CYS B O   1 
ATOM   3059  C CB  . CYS B  2 203 ? -4.780  -4.256  -3.133  1.00 66.28  ? 199 CYS B CB  1 
ATOM   3060  S SG  . CYS B  2 203 ? -5.961  -3.440  -4.263  1.00 66.14  ? 199 CYS B SG  1 
ATOM   3061  N N   . GLN B  2 204 ? -3.770  -0.971  -2.446  1.00 64.45  ? 200 GLN B N   1 
ATOM   3062  C CA  . GLN B  2 204 ? -4.180  0.253   -1.770  1.00 64.01  ? 200 GLN B CA  1 
ATOM   3063  C C   . GLN B  2 204 ? -5.439  0.826   -2.422  1.00 63.44  ? 200 GLN B C   1 
ATOM   3064  O O   . GLN B  2 204 ? -5.468  1.069   -3.632  1.00 63.91  ? 200 GLN B O   1 
ATOM   3065  C CB  . GLN B  2 204 ? -3.042  1.279   -1.818  1.00 65.48  ? 200 GLN B CB  1 
ATOM   3066  C CG  . GLN B  2 204 ? -3.436  2.692   -1.402  1.00 67.25  ? 200 GLN B CG  1 
ATOM   3067  C CD  . GLN B  2 204 ? -2.248  3.644   -1.370  1.00 70.04  ? 200 GLN B CD  1 
ATOM   3068  O OE1 . GLN B  2 204 ? -1.573  3.787   -0.344  1.00 69.57  ? 200 GLN B OE1 1 
ATOM   3069  N NE2 . GLN B  2 204 ? -1.977  4.291   -2.504  1.00 70.38  ? 200 GLN B NE2 1 
ATOM   3070  N N   . VAL B  2 205 ? -6.477  1.041   -1.618  1.00 61.47  ? 201 VAL B N   1 
ATOM   3071  C CA  . VAL B  2 205 ? -7.735  1.572   -2.123  1.00 59.92  ? 201 VAL B CA  1 
ATOM   3072  C C   . VAL B  2 205 ? -8.107  2.917   -1.512  1.00 60.46  ? 201 VAL B C   1 
ATOM   3073  O O   . VAL B  2 205 ? -8.310  3.026   -0.304  1.00 61.65  ? 201 VAL B O   1 
ATOM   3074  C CB  . VAL B  2 205 ? -8.899  0.581   -1.870  1.00 59.94  ? 201 VAL B CB  1 
ATOM   3075  C CG1 . VAL B  2 205 ? -10.233 1.236   -2.212  1.00 58.67  ? 201 VAL B CG1 1 
ATOM   3076  C CG2 . VAL B  2 205 ? -8.703  -0.670  -2.711  1.00 59.56  ? 201 VAL B CG2 1 
ATOM   3077  N N   . GLU B  2 206 ? -8.201  3.934   -2.362  1.00 59.84  ? 202 GLU B N   1 
ATOM   3078  C CA  . GLU B  2 206 ? -8.567  5.281   -1.945  1.00 60.54  ? 202 GLU B CA  1 
ATOM   3079  C C   . GLU B  2 206 ? -10.036 5.500   -2.352  1.00 59.02  ? 202 GLU B C   1 
ATOM   3080  O O   . GLU B  2 206 ? -10.449 5.089   -3.431  1.00 58.58  ? 202 GLU B O   1 
ATOM   3081  C CB  . GLU B  2 206 ? -7.649  6.297   -2.643  1.00 64.24  ? 202 GLU B CB  1 
ATOM   3082  C CG  . GLU B  2 206 ? -6.160  6.124   -2.300  1.00 69.51  ? 202 GLU B CG  1 
ATOM   3083  C CD  . GLU B  2 206 ? -5.217  6.853   -3.262  1.00 72.85  ? 202 GLU B CD  1 
ATOM   3084  O OE1 . GLU B  2 206 ? -5.078  6.416   -4.428  1.00 72.36  ? 202 GLU B OE1 1 
ATOM   3085  O OE2 . GLU B  2 206 ? -4.610  7.868   -2.849  1.00 76.06  ? 202 GLU B OE2 1 
ATOM   3086  N N   . HIS B  2 207 ? -10.822 6.129   -1.485  1.00 58.05  ? 203 HIS B N   1 
ATOM   3087  C CA  . HIS B  2 207 ? -12.238 6.372   -1.763  1.00 56.77  ? 203 HIS B CA  1 
ATOM   3088  C C   . HIS B  2 207 ? -12.768 7.416   -0.788  1.00 56.96  ? 203 HIS B C   1 
ATOM   3089  O O   . HIS B  2 207 ? -12.434 7.391   0.398   1.00 56.21  ? 203 HIS B O   1 
ATOM   3090  C CB  . HIS B  2 207 ? -13.035 5.067   -1.627  1.00 53.75  ? 203 HIS B CB  1 
ATOM   3091  C CG  . HIS B  2 207 ? -14.455 5.166   -2.103  1.00 52.45  ? 203 HIS B CG  1 
ATOM   3092  N ND1 . HIS B  2 207 ? -15.519 5.350   -1.247  1.00 49.87  ? 203 HIS B ND1 1 
ATOM   3093  C CD2 . HIS B  2 207 ? -14.982 5.116   -3.350  1.00 51.23  ? 203 HIS B CD2 1 
ATOM   3094  C CE1 . HIS B  2 207 ? -16.639 5.407   -1.945  1.00 49.80  ? 203 HIS B CE1 1 
ATOM   3095  N NE2 . HIS B  2 207 ? -16.341 5.269   -3.223  1.00 49.86  ? 203 HIS B NE2 1 
ATOM   3096  N N   . PRO B  2 208 ? -13.607 8.347   -1.279  1.00 57.95  ? 204 PRO B N   1 
ATOM   3097  C CA  . PRO B  2 208 ? -14.207 9.432   -0.493  1.00 58.98  ? 204 PRO B CA  1 
ATOM   3098  C C   . PRO B  2 208 ? -14.942 9.069   0.796   1.00 60.47  ? 204 PRO B C   1 
ATOM   3099  O O   . PRO B  2 208 ? -15.316 9.955   1.564   1.00 61.13  ? 204 PRO B O   1 
ATOM   3100  C CB  . PRO B  2 208 ? -15.104 10.143  -1.511  1.00 57.02  ? 204 PRO B CB  1 
ATOM   3101  C CG  . PRO B  2 208 ? -15.404 9.089   -2.510  1.00 57.39  ? 204 PRO B CG  1 
ATOM   3102  C CD  . PRO B  2 208 ? -14.080 8.406   -2.671  1.00 57.01  ? 204 PRO B CD  1 
ATOM   3103  N N   . SER B  2 209 ? -15.147 7.780   1.043   1.00 62.01  ? 205 SER B N   1 
ATOM   3104  C CA  . SER B  2 209 ? -15.825 7.356   2.266   1.00 63.69  ? 205 SER B CA  1 
ATOM   3105  C C   . SER B  2 209 ? -14.782 6.963   3.309   1.00 66.17  ? 205 SER B C   1 
ATOM   3106  O O   . SER B  2 209 ? -15.095 6.820   4.490   1.00 65.91  ? 205 SER B O   1 
ATOM   3107  C CB  . SER B  2 209 ? -16.738 6.159   1.990   1.00 62.90  ? 205 SER B CB  1 
ATOM   3108  O OG  . SER B  2 209 ? -15.983 4.985   1.741   1.00 60.35  ? 205 SER B OG  1 
ATOM   3109  N N   . LEU B  2 210 ? -13.540 6.795   2.856   1.00 68.73  ? 206 LEU B N   1 
ATOM   3110  C CA  . LEU B  2 210 ? -12.432 6.407   3.725   1.00 70.83  ? 206 LEU B CA  1 
ATOM   3111  C C   . LEU B  2 210 ? -11.595 7.605   4.163   1.00 72.48  ? 206 LEU B C   1 
ATOM   3112  O O   . LEU B  2 210 ? -11.042 8.315   3.326   1.00 73.27  ? 206 LEU B O   1 
ATOM   3113  C CB  . LEU B  2 210 ? -11.522 5.414   2.999   1.00 70.12  ? 206 LEU B CB  1 
ATOM   3114  C CG  . LEU B  2 210 ? -12.158 4.164   2.387   1.00 69.86  ? 206 LEU B CG  1 
ATOM   3115  C CD1 . LEU B  2 210 ? -11.107 3.389   1.611   1.00 69.21  ? 206 LEU B CD1 1 
ATOM   3116  C CD2 . LEU B  2 210 ? -12.758 3.301   3.477   1.00 70.12  ? 206 LEU B CD2 1 
ATOM   3117  N N   . THR B  2 211 ? -11.503 7.824   5.472   1.00 74.80  ? 207 THR B N   1 
ATOM   3118  C CA  . THR B  2 211 ? -10.709 8.926   6.015   1.00 76.81  ? 207 THR B CA  1 
ATOM   3119  C C   . THR B  2 211 ? -9.294  8.842   5.447   1.00 77.73  ? 207 THR B C   1 
ATOM   3120  O O   . THR B  2 211 ? -8.747  9.834   4.957   1.00 77.94  ? 207 THR B O   1 
ATOM   3121  C CB  . THR B  2 211 ? -10.621 8.844   7.546   1.00 76.67  ? 207 THR B CB  1 
ATOM   3122  O OG1 . THR B  2 211 ? -10.307 7.499   7.928   1.00 76.77  ? 207 THR B OG1 1 
ATOM   3123  C CG2 . THR B  2 211 ? -11.939 9.258   8.184   1.00 77.19  ? 207 THR B CG2 1 
ATOM   3124  N N   . ASP B  2 212 ? -8.717  7.644   5.526   1.00 78.30  ? 208 ASP B N   1 
ATOM   3125  C CA  . ASP B  2 212 ? -7.377  7.369   5.019   1.00 78.06  ? 208 ASP B CA  1 
ATOM   3126  C C   . ASP B  2 212 ? -7.387  6.054   4.236   1.00 77.42  ? 208 ASP B C   1 
ATOM   3127  O O   . ASP B  2 212 ? -8.143  5.133   4.557   1.00 76.05  ? 208 ASP B O   1 
ATOM   3128  C CB  . ASP B  2 212 ? -6.374  7.287   6.174   1.00 80.39  ? 208 ASP B CB  1 
ATOM   3129  C CG  . ASP B  2 212 ? -6.898  6.476   7.348   1.00 82.65  ? 208 ASP B CG  1 
ATOM   3130  O OD1 . ASP B  2 212 ? -7.400  5.351   7.124   1.00 84.31  ? 208 ASP B OD1 1 
ATOM   3131  O OD2 . ASP B  2 212 ? -6.802  6.962   8.496   1.00 82.84  ? 208 ASP B OD2 1 
ATOM   3132  N N   . PRO B  2 213 ? -6.535  5.951   3.201   1.00 76.90  ? 209 PRO B N   1 
ATOM   3133  C CA  . PRO B  2 213 ? -6.425  4.764   2.349   1.00 75.73  ? 209 PRO B CA  1 
ATOM   3134  C C   . PRO B  2 213 ? -6.519  3.439   3.090   1.00 75.05  ? 209 PRO B C   1 
ATOM   3135  O O   . PRO B  2 213 ? -6.105  3.328   4.240   1.00 74.72  ? 209 PRO B O   1 
ATOM   3136  C CB  . PRO B  2 213 ? -5.071  4.952   1.678   1.00 76.14  ? 209 PRO B CB  1 
ATOM   3137  C CG  . PRO B  2 213 ? -5.000  6.437   1.517   1.00 76.34  ? 209 PRO B CG  1 
ATOM   3138  C CD  . PRO B  2 213 ? -5.488  6.932   2.860   1.00 76.88  ? 209 PRO B CD  1 
ATOM   3139  N N   . VAL B  2 214 ? -7.076  2.441   2.415   1.00 74.65  ? 210 VAL B N   1 
ATOM   3140  C CA  . VAL B  2 214 ? -7.219  1.103   2.974   1.00 73.68  ? 210 VAL B CA  1 
ATOM   3141  C C   . VAL B  2 214 ? -6.315  0.177   2.183   1.00 74.19  ? 210 VAL B C   1 
ATOM   3142  O O   . VAL B  2 214 ? -6.311  0.209   0.952   1.00 75.33  ? 210 VAL B O   1 
ATOM   3143  C CB  . VAL B  2 214 ? -8.667  0.594   2.861   1.00 73.33  ? 210 VAL B CB  1 
ATOM   3144  C CG1 . VAL B  2 214 ? -8.720  -0.902  3.143   1.00 72.92  ? 210 VAL B CG1 1 
ATOM   3145  C CG2 . VAL B  2 214 ? -9.554  1.343   3.839   1.00 73.10  ? 210 VAL B CG2 1 
ATOM   3146  N N   . THR B  2 215 ? -5.543  -0.645  2.882   1.00 73.53  ? 211 THR B N   1 
ATOM   3147  C CA  . THR B  2 215 ? -4.638  -1.564  2.208   1.00 73.08  ? 211 THR B CA  1 
ATOM   3148  C C   . THR B  2 215 ? -4.834  -3.002  2.658   1.00 73.53  ? 211 THR B C   1 
ATOM   3149  O O   . THR B  2 215 ? -5.239  -3.269  3.788   1.00 73.59  ? 211 THR B O   1 
ATOM   3150  C CB  . THR B  2 215 ? -3.167  -1.183  2.447   1.00 73.05  ? 211 THR B CB  1 
ATOM   3151  O OG1 . THR B  2 215 ? -2.865  -1.301  3.842   1.00 73.84  ? 211 THR B OG1 1 
ATOM   3152  C CG2 . THR B  2 215 ? -2.905  0.247   1.998   1.00 72.58  ? 211 THR B CG2 1 
ATOM   3153  N N   . VAL B  2 216 ? -4.551  -3.925  1.751   1.00 74.08  ? 212 VAL B N   1 
ATOM   3154  C CA  . VAL B  2 216 ? -4.668  -5.343  2.029   1.00 75.08  ? 212 VAL B CA  1 
ATOM   3155  C C   . VAL B  2 216 ? -3.396  -5.978  1.500   1.00 77.51  ? 212 VAL B C   1 
ATOM   3156  O O   . VAL B  2 216 ? -3.082  -5.876  0.311   1.00 77.23  ? 212 VAL B O   1 
ATOM   3157  C CB  . VAL B  2 216 ? -5.894  -5.964  1.327   1.00 75.37  ? 212 VAL B CB  1 
ATOM   3158  C CG1 . VAL B  2 216 ? -5.912  -7.466  1.549   1.00 74.55  ? 212 VAL B CG1 1 
ATOM   3159  C CG2 . VAL B  2 216 ? -7.173  -5.344  1.873   1.00 75.06  ? 212 VAL B CG2 1 
ATOM   3160  N N   . GLU B  2 217 ? -2.661  -6.620  2.400   1.00 79.21  ? 213 GLU B N   1 
ATOM   3161  C CA  . GLU B  2 217 ? -1.398  -7.259  2.060   1.00 80.49  ? 213 GLU B CA  1 
ATOM   3162  C C   . GLU B  2 217 ? -1.602  -8.722  1.687   1.00 81.48  ? 213 GLU B C   1 
ATOM   3163  O O   . GLU B  2 217 ? -2.548  -9.365  2.150   1.00 81.80  ? 213 GLU B O   1 
ATOM   3164  C CB  . GLU B  2 217 ? -0.447  -7.139  3.255   1.00 83.23  ? 213 GLU B CB  1 
ATOM   3165  C CG  . GLU B  2 217 ? 1.002   -7.507  2.982   1.00 86.47  ? 213 GLU B CG  1 
ATOM   3166  C CD  . GLU B  2 217 ? 1.889   -7.303  4.205   1.00 88.62  ? 213 GLU B CD  1 
ATOM   3167  O OE1 . GLU B  2 217 ? 1.698   -8.024  5.211   1.00 89.20  ? 213 GLU B OE1 1 
ATOM   3168  O OE2 . GLU B  2 217 ? 2.771   -6.418  4.163   1.00 89.92  ? 213 GLU B OE2 1 
ATOM   3169  N N   . TRP B  2 218 ? -0.717  -9.237  0.838   1.00 82.10  ? 214 TRP B N   1 
ATOM   3170  C CA  . TRP B  2 218 ? -0.785  -10.629 0.405   1.00 82.76  ? 214 TRP B CA  1 
ATOM   3171  C C   . TRP B  2 218 ? 0.598   -11.203 0.116   1.00 84.87  ? 214 TRP B C   1 
ATOM   3172  O O   . TRP B  2 218 ? 1.410   -10.578 -0.569  1.00 85.68  ? 214 TRP B O   1 
ATOM   3173  C CB  . TRP B  2 218 ? -1.634  -10.770 -0.855  1.00 82.02  ? 214 TRP B CB  1 
ATOM   3174  C CG  . TRP B  2 218 ? -1.668  -12.182 -1.355  1.00 82.18  ? 214 TRP B CG  1 
ATOM   3175  C CD1 . TRP B  2 218 ? -2.561  -13.157 -1.008  1.00 82.28  ? 214 TRP B CD1 1 
ATOM   3176  C CD2 . TRP B  2 218 ? -0.734  -12.794 -2.253  1.00 81.87  ? 214 TRP B CD2 1 
ATOM   3177  N NE1 . TRP B  2 218 ? -2.240  -14.338 -1.637  1.00 82.17  ? 214 TRP B NE1 1 
ATOM   3178  C CE2 . TRP B  2 218 ? -1.124  -14.142 -2.407  1.00 81.56  ? 214 TRP B CE2 1 
ATOM   3179  C CE3 . TRP B  2 218 ? 0.396   -12.333 -2.943  1.00 82.28  ? 214 TRP B CE3 1 
ATOM   3180  C CZ2 . TRP B  2 218 ? -0.425  -15.036 -3.223  1.00 81.65  ? 214 TRP B CZ2 1 
ATOM   3181  C CZ3 . TRP B  2 218 ? 1.094   -13.224 -3.757  1.00 81.75  ? 214 TRP B CZ3 1 
ATOM   3182  C CH2 . TRP B  2 218 ? 0.678   -14.559 -3.889  1.00 81.82  ? 214 TRP B CH2 1 
ATOM   3183  N N   . LYS B  2 219 ? 0.854   -12.402 0.632   1.00 86.31  ? 215 LYS B N   1 
ATOM   3184  C CA  . LYS B  2 219 ? 2.130   -13.085 0.425   1.00 87.90  ? 215 LYS B CA  1 
ATOM   3185  C C   . LYS B  2 219 ? 1.837   -14.518 -0.020  1.00 88.92  ? 215 LYS B C   1 
ATOM   3186  O O   . LYS B  2 219 ? 0.780   -15.067 0.303   1.00 89.01  ? 215 LYS B O   1 
ATOM   3187  C CB  . LYS B  2 219 ? 2.947   -13.076 1.725   1.00 89.87  ? 215 LYS B CB  1 
ATOM   3188  C CG  . LYS B  2 219 ? 3.189   -11.672 2.282   1.00 91.93  ? 215 LYS B CG  1 
ATOM   3189  C CD  . LYS B  2 219 ? 3.858   -11.691 3.654   1.00 93.06  ? 215 LYS B CD  1 
ATOM   3190  C CE  . LYS B  2 219 ? 3.939   -10.277 4.237   1.00 94.06  ? 215 LYS B CE  1 
ATOM   3191  N NZ  . LYS B  2 219 ? 4.552   -10.217 5.601   1.00 93.27  ? 215 LYS B NZ  1 
ATOM   3192  N N   . ALA B  2 220 ? 2.761   -15.120 -0.764  1.00 89.45  ? 216 ALA B N   1 
ATOM   3193  C CA  . ALA B  2 220 ? 2.560   -16.482 -1.253  1.00 90.28  ? 216 ALA B CA  1 
ATOM   3194  C C   . ALA B  2 220 ? 2.508   -17.516 -0.127  1.00 91.93  ? 216 ALA B C   1 
ATOM   3195  O O   . ALA B  2 220 ? 2.814   -17.150 1.031   1.00 92.58  ? 216 ALA B O   1 
ATOM   3196  C CB  . ALA B  2 220 ? 3.657   -16.846 -2.245  1.00 90.28  ? 216 ALA B CB  1 
ATOM   3197  N N   . ILE C  1 1   ? -33.318 34.086  -37.277 1.00 91.80  ? 1   ILE C N   1 
ATOM   3198  C CA  . ILE C  1 1   ? -32.509 35.062  -36.487 1.00 91.62  ? 1   ILE C CA  1 
ATOM   3199  C C   . ILE C  1 1   ? -31.339 34.372  -35.772 1.00 90.64  ? 1   ILE C C   1 
ATOM   3200  O O   . ILE C  1 1   ? -31.194 33.143  -35.830 1.00 91.08  ? 1   ILE C O   1 
ATOM   3201  C CB  . ILE C  1 1   ? -33.394 35.797  -35.429 1.00 92.59  ? 1   ILE C CB  1 
ATOM   3202  C CG1 . ILE C  1 1   ? -34.062 34.780  -34.491 1.00 93.35  ? 1   ILE C CG1 1 
ATOM   3203  C CG2 . ILE C  1 1   ? -34.455 36.644  -36.131 1.00 93.09  ? 1   ILE C CG2 1 
ATOM   3204  C CD1 . ILE C  1 1   ? -34.919 35.401  -33.389 1.00 93.30  ? 1   ILE C CD1 1 
ATOM   3205  N N   . LYS C  1 2   ? -30.501 35.172  -35.113 1.00 88.10  ? 2   LYS C N   1 
ATOM   3206  C CA  . LYS C  1 2   ? -29.354 34.655  -34.369 1.00 84.56  ? 2   LYS C CA  1 
ATOM   3207  C C   . LYS C  1 2   ? -28.410 33.870  -35.269 1.00 81.40  ? 2   LYS C C   1 
ATOM   3208  O O   . LYS C  1 2   ? -28.752 32.779  -35.728 1.00 82.70  ? 2   LYS C O   1 
ATOM   3209  C CB  . LYS C  1 2   ? -29.844 33.750  -33.238 1.00 85.31  ? 2   LYS C CB  1 
ATOM   3210  C CG  . LYS C  1 2   ? -30.895 34.390  -32.350 1.00 86.59  ? 2   LYS C CG  1 
ATOM   3211  C CD  . LYS C  1 2   ? -31.593 33.349  -31.492 1.00 87.50  ? 2   LYS C CD  1 
ATOM   3212  C CE  . LYS C  1 2   ? -32.660 33.980  -30.617 1.00 88.42  ? 2   LYS C CE  1 
ATOM   3213  N NZ  . LYS C  1 2   ? -32.072 34.959  -29.657 1.00 89.29  ? 2   LYS C NZ  1 
ATOM   3214  N N   . GLU C  1 3   ? -27.229 34.422  -35.527 1.00 76.47  ? 3   GLU C N   1 
ATOM   3215  C CA  . GLU C  1 3   ? -26.249 33.737  -36.367 1.00 71.44  ? 3   GLU C CA  1 
ATOM   3216  C C   . GLU C  1 3   ? -25.690 32.532  -35.608 1.00 66.68  ? 3   GLU C C   1 
ATOM   3217  O O   . GLU C  1 3   ? -24.695 32.643  -34.891 1.00 65.81  ? 3   GLU C O   1 
ATOM   3218  C CB  . GLU C  1 3   ? -25.099 34.684  -36.744 1.00 72.80  ? 3   GLU C CB  1 
ATOM   3219  C CG  . GLU C  1 3   ? -25.466 35.812  -37.702 1.00 74.74  ? 3   GLU C CG  1 
ATOM   3220  C CD  . GLU C  1 3   ? -25.897 35.314  -39.080 1.00 77.05  ? 3   GLU C CD  1 
ATOM   3221  O OE1 . GLU C  1 3   ? -25.110 34.595  -39.734 1.00 75.54  ? 3   GLU C OE1 1 
ATOM   3222  O OE2 . GLU C  1 3   ? -27.026 35.650  -39.509 1.00 77.74  ? 3   GLU C OE2 1 
ATOM   3223  N N   . GLU C  1 4   ? -26.338 31.383  -35.755 1.00 61.11  ? 4   GLU C N   1 
ATOM   3224  C CA  . GLU C  1 4   ? -25.883 30.179  -35.069 1.00 56.24  ? 4   GLU C CA  1 
ATOM   3225  C C   . GLU C  1 4   ? -25.249 29.253  -36.093 1.00 51.37  ? 4   GLU C C   1 
ATOM   3226  O O   . GLU C  1 4   ? -25.840 28.972  -37.137 1.00 49.23  ? 4   GLU C O   1 
ATOM   3227  C CB  . GLU C  1 4   ? -27.058 29.490  -34.360 1.00 56.78  ? 4   GLU C CB  1 
ATOM   3228  C CG  . GLU C  1 4   ? -27.911 30.436  -33.519 1.00 57.88  ? 4   GLU C CG  1 
ATOM   3229  C CD  . GLU C  1 4   ? -28.774 29.724  -32.487 1.00 60.43  ? 4   GLU C CD  1 
ATOM   3230  O OE1 . GLU C  1 4   ? -29.230 28.586  -32.752 1.00 59.08  ? 4   GLU C OE1 1 
ATOM   3231  O OE2 . GLU C  1 4   ? -29.005 30.319  -31.409 1.00 62.39  ? 4   GLU C OE2 1 
ATOM   3232  N N   . HIS C  1 5   ? -24.038 28.787  -35.799 1.00 46.57  ? 5   HIS C N   1 
ATOM   3233  C CA  . HIS C  1 5   ? -23.325 27.919  -36.730 1.00 43.57  ? 5   HIS C CA  1 
ATOM   3234  C C   . HIS C  1 5   ? -22.460 26.874  -36.058 1.00 41.93  ? 5   HIS C C   1 
ATOM   3235  O O   . HIS C  1 5   ? -22.069 27.010  -34.900 1.00 42.45  ? 5   HIS C O   1 
ATOM   3236  C CB  . HIS C  1 5   ? -22.438 28.766  -37.648 1.00 43.32  ? 5   HIS C CB  1 
ATOM   3237  C CG  . HIS C  1 5   ? -23.200 29.733  -38.495 1.00 42.22  ? 5   HIS C CG  1 
ATOM   3238  N ND1 . HIS C  1 5   ? -23.769 29.376  -39.698 1.00 42.27  ? 5   HIS C ND1 1 
ATOM   3239  C CD2 . HIS C  1 5   ? -23.558 31.019  -38.274 1.00 40.47  ? 5   HIS C CD2 1 
ATOM   3240  C CE1 . HIS C  1 5   ? -24.450 30.400  -40.179 1.00 42.88  ? 5   HIS C CE1 1 
ATOM   3241  N NE2 . HIS C  1 5   ? -24.339 31.408  -39.334 1.00 43.48  ? 5   HIS C NE2 1 
ATOM   3242  N N   . THR C  1 6   ? -22.156 25.824  -36.799 1.00 40.58  ? 6   THR C N   1 
ATOM   3243  C CA  . THR C  1 6   ? -21.301 24.782  -36.277 1.00 41.35  ? 6   THR C CA  1 
ATOM   3244  C C   . THR C  1 6   ? -20.163 24.534  -37.251 1.00 41.19  ? 6   THR C C   1 
ATOM   3245  O O   . THR C  1 6   ? -20.370 24.436  -38.464 1.00 42.20  ? 6   THR C O   1 
ATOM   3246  C CB  . THR C  1 6   ? -22.053 23.448  -36.058 1.00 40.14  ? 6   THR C CB  1 
ATOM   3247  O OG1 . THR C  1 6   ? -23.143 23.641  -35.148 1.00 44.74  ? 6   THR C OG1 1 
ATOM   3248  C CG2 . THR C  1 6   ? -21.128 22.431  -35.433 1.00 42.89  ? 6   THR C CG2 1 
ATOM   3249  N N   . ILE C  1 7   ? -18.957 24.474  -36.700 1.00 39.31  ? 7   ILE C N   1 
ATOM   3250  C CA  . ILE C  1 7   ? -17.750 24.184  -37.458 1.00 38.42  ? 7   ILE C CA  1 
ATOM   3251  C C   . ILE C  1 7   ? -17.193 22.934  -36.796 1.00 35.71  ? 7   ILE C C   1 
ATOM   3252  O O   . ILE C  1 7   ? -17.089 22.875  -35.570 1.00 34.43  ? 7   ILE C O   1 
ATOM   3253  C CB  . ILE C  1 7   ? -16.702 25.323  -37.345 1.00 40.81  ? 7   ILE C CB  1 
ATOM   3254  C CG1 . ILE C  1 7   ? -17.192 26.551  -38.127 1.00 41.21  ? 7   ILE C CG1 1 
ATOM   3255  C CG2 . ILE C  1 7   ? -15.344 24.825  -37.819 1.00 39.52  ? 7   ILE C CG2 1 
ATOM   3256  C CD1 . ILE C  1 7   ? -16.217 27.711  -38.161 1.00 44.75  ? 7   ILE C CD1 1 
ATOM   3257  N N   . ILE C  1 8   ? -16.857 21.928  -37.592 1.00 33.66  ? 8   ILE C N   1 
ATOM   3258  C CA  . ILE C  1 8   ? -16.318 20.703  -37.020 1.00 32.73  ? 8   ILE C CA  1 
ATOM   3259  C C   . ILE C  1 8   ? -15.074 20.196  -37.734 1.00 32.49  ? 8   ILE C C   1 
ATOM   3260  O O   . ILE C  1 8   ? -14.972 20.221  -38.966 1.00 34.28  ? 8   ILE C O   1 
ATOM   3261  C CB  . ILE C  1 8   ? -17.354 19.530  -37.045 1.00 32.46  ? 8   ILE C CB  1 
ATOM   3262  C CG1 . ILE C  1 8   ? -18.657 19.934  -36.352 1.00 33.72  ? 8   ILE C CG1 1 
ATOM   3263  C CG2 . ILE C  1 8   ? -16.780 18.317  -36.330 1.00 30.94  ? 8   ILE C CG2 1 
ATOM   3264  C CD1 . ILE C  1 8   ? -19.763 18.897  -36.511 1.00 30.25  ? 8   ILE C CD1 1 
ATOM   3265  N N   . GLN C  1 9   ? -14.127 19.733  -36.937 1.00 31.26  ? 9   GLN C N   1 
ATOM   3266  C CA  . GLN C  1 9   ? -12.914 19.145  -37.467 1.00 32.69  ? 9   GLN C CA  1 
ATOM   3267  C C   . GLN C  1 9   ? -13.092 17.666  -37.144 1.00 31.55  ? 9   GLN C C   1 
ATOM   3268  O O   . GLN C  1 9   ? -13.208 17.298  -35.974 1.00 30.29  ? 9   GLN C O   1 
ATOM   3269  C CB  . GLN C  1 9   ? -11.664 19.691  -36.757 1.00 31.89  ? 9   GLN C CB  1 
ATOM   3270  C CG  . GLN C  1 9   ? -10.380 18.995  -37.209 1.00 37.12  ? 9   GLN C CG  1 
ATOM   3271  C CD  . GLN C  1 9   ? -9.122  19.532  -36.529 1.00 38.44  ? 9   GLN C CD  1 
ATOM   3272  O OE1 . GLN C  1 9   ? -8.788  20.719  -36.650 1.00 39.42  ? 9   GLN C OE1 1 
ATOM   3273  N NE2 . GLN C  1 9   ? -8.420  18.660  -35.815 1.00 35.45  ? 9   GLN C NE2 1 
ATOM   3274  N N   . ALA C  1 10  ? -13.143 16.826  -38.171 1.00 28.67  ? 10  ALA C N   1 
ATOM   3275  C CA  . ALA C  1 10  ? -13.321 15.402  -37.936 1.00 30.59  ? 10  ALA C CA  1 
ATOM   3276  C C   . ALA C  1 10  ? -12.166 14.626  -38.526 1.00 30.75  ? 10  ALA C C   1 
ATOM   3277  O O   . ALA C  1 10  ? -11.801 14.821  -39.684 1.00 31.59  ? 10  ALA C O   1 
ATOM   3278  C CB  . ALA C  1 10  ? -14.647 14.922  -38.538 1.00 31.40  ? 10  ALA C CB  1 
ATOM   3279  N N   . GLN C  1 11  ? -11.601 13.730  -37.726 1.00 30.91  ? 11  GLN C N   1 
ATOM   3280  C CA  . GLN C  1 11  ? -10.461 12.943  -38.165 1.00 31.68  ? 11  GLN C CA  1 
ATOM   3281  C C   . GLN C  1 11  ? -10.482 11.553  -37.571 1.00 31.19  ? 11  GLN C C   1 
ATOM   3282  O O   . GLN C  1 11  ? -10.973 11.331  -36.459 1.00 32.50  ? 11  GLN C O   1 
ATOM   3283  C CB  . GLN C  1 11  ? -9.164  13.650  -37.756 1.00 34.88  ? 11  GLN C CB  1 
ATOM   3284  C CG  . GLN C  1 11  ? -8.956  13.725  -36.252 1.00 38.19  ? 11  GLN C CG  1 
ATOM   3285  C CD  . GLN C  1 11  ? -7.902  14.744  -35.859 1.00 43.07  ? 11  GLN C CD  1 
ATOM   3286  O OE1 . GLN C  1 11  ? -8.114  15.952  -35.972 1.00 46.87  ? 11  GLN C OE1 1 
ATOM   3287  N NE2 . GLN C  1 11  ? -6.756  14.262  -35.410 1.00 41.40  ? 11  GLN C NE2 1 
ATOM   3288  N N   . PHE C  1 12  ? -9.960  10.600  -38.317 1.00 30.56  ? 12  PHE C N   1 
ATOM   3289  C CA  . PHE C  1 12  ? -9.921  9.255   -37.804 1.00 30.64  ? 12  PHE C CA  1 
ATOM   3290  C C   . PHE C  1 12  ? -8.802  8.481   -38.441 1.00 29.15  ? 12  PHE C C   1 
ATOM   3291  O O   . PHE C  1 12  ? -8.185  8.942   -39.392 1.00 29.45  ? 12  PHE C O   1 
ATOM   3292  C CB  . PHE C  1 12  ? -11.266 8.547   -38.056 1.00 28.86  ? 12  PHE C CB  1 
ATOM   3293  C CG  . PHE C  1 12  ? -11.521 8.203   -39.497 1.00 28.06  ? 12  PHE C CG  1 
ATOM   3294  C CD1 . PHE C  1 12  ? -10.843 7.156   -40.109 1.00 27.60  ? 12  PHE C CD1 1 
ATOM   3295  C CD2 . PHE C  1 12  ? -12.436 8.939   -40.249 1.00 29.06  ? 12  PHE C CD2 1 
ATOM   3296  C CE1 . PHE C  1 12  ? -11.065 6.839   -41.460 1.00 28.30  ? 12  PHE C CE1 1 
ATOM   3297  C CE2 . PHE C  1 12  ? -12.672 8.639   -41.597 1.00 29.97  ? 12  PHE C CE2 1 
ATOM   3298  C CZ  . PHE C  1 12  ? -11.982 7.585   -42.208 1.00 30.36  ? 12  PHE C CZ  1 
ATOM   3299  N N   . TYR C  1 13  ? -8.539  7.310   -37.876 1.00 29.19  ? 13  TYR C N   1 
ATOM   3300  C CA  . TYR C  1 13  ? -7.558  6.385   -38.405 1.00 29.65  ? 13  TYR C CA  1 
ATOM   3301  C C   . TYR C  1 13  ? -8.174  4.996   -38.190 1.00 28.59  ? 13  TYR C C   1 
ATOM   3302  O O   . TYR C  1 13  ? -8.634  4.684   -37.097 1.00 26.46  ? 13  TYR C O   1 
ATOM   3303  C CB  . TYR C  1 13  ? -6.213  6.484   -37.688 1.00 29.63  ? 13  TYR C CB  1 
ATOM   3304  C CG  . TYR C  1 13  ? -5.201  5.596   -38.370 1.00 32.35  ? 13  TYR C CG  1 
ATOM   3305  C CD1 . TYR C  1 13  ? -4.742  5.890   -39.656 1.00 33.88  ? 13  TYR C CD1 1 
ATOM   3306  C CD2 . TYR C  1 13  ? -4.767  4.421   -37.772 1.00 32.77  ? 13  TYR C CD2 1 
ATOM   3307  C CE1 . TYR C  1 13  ? -3.875  5.029   -40.331 1.00 35.67  ? 13  TYR C CE1 1 
ATOM   3308  C CE2 . TYR C  1 13  ? -3.904  3.560   -38.433 1.00 36.79  ? 13  TYR C CE2 1 
ATOM   3309  C CZ  . TYR C  1 13  ? -3.458  3.867   -39.709 1.00 37.01  ? 13  TYR C CZ  1 
ATOM   3310  O OH  . TYR C  1 13  ? -2.573  3.012   -40.336 1.00 40.26  ? 13  TYR C OH  1 
ATOM   3311  N N   . LEU C  1 14  ? -8.150  4.165   -39.228 1.00 29.68  ? 14  LEU C N   1 
ATOM   3312  C CA  . LEU C  1 14  ? -8.785  2.852   -39.181 1.00 32.27  ? 14  LEU C CA  1 
ATOM   3313  C C   . LEU C  1 14  ? -7.919  1.640   -39.478 1.00 33.29  ? 14  LEU C C   1 
ATOM   3314  O O   . LEU C  1 14  ? -7.141  1.631   -40.430 1.00 33.95  ? 14  LEU C O   1 
ATOM   3315  C CB  . LEU C  1 14  ? -9.979  2.850   -40.152 1.00 30.33  ? 14  LEU C CB  1 
ATOM   3316  C CG  . LEU C  1 14  ? -10.703 1.520   -40.365 1.00 31.56  ? 14  LEU C CG  1 
ATOM   3317  C CD1 . LEU C  1 14  ? -11.422 1.165   -39.096 1.00 30.42  ? 14  LEU C CD1 1 
ATOM   3318  C CD2 . LEU C  1 14  ? -11.692 1.618   -41.528 1.00 30.40  ? 14  LEU C CD2 1 
ATOM   3319  N N   . LEU C  1 15  ? -8.095  0.600   -38.668 1.00 34.94  ? 15  LEU C N   1 
ATOM   3320  C CA  . LEU C  1 15  ? -7.365  -0.651  -38.829 1.00 35.40  ? 15  LEU C CA  1 
ATOM   3321  C C   . LEU C  1 15  ? -8.357  -1.791  -38.970 1.00 37.40  ? 15  LEU C C   1 
ATOM   3322  O O   . LEU C  1 15  ? -9.460  -1.734  -38.435 1.00 40.02  ? 15  LEU C O   1 
ATOM   3323  C CB  . LEU C  1 15  ? -6.457  -0.902  -37.626 1.00 34.76  ? 15  LEU C CB  1 
ATOM   3324  C CG  . LEU C  1 15  ? -5.128  -0.149  -37.663 1.00 36.23  ? 15  LEU C CG  1 
ATOM   3325  C CD1 . LEU C  1 15  ? -4.350  -0.371  -36.369 1.00 35.53  ? 15  LEU C CD1 1 
ATOM   3326  C CD2 . LEU C  1 15  ? -4.336  -0.629  -38.864 1.00 34.17  ? 15  LEU C CD2 1 
ATOM   3327  N N   . PRO C  1 16  ? -7.963  -2.866  -39.658 1.00 39.56  ? 16  PRO C N   1 
ATOM   3328  C CA  . PRO C  1 16  ? -6.658  -3.054  -40.291 1.00 40.38  ? 16  PRO C CA  1 
ATOM   3329  C C   . PRO C  1 16  ? -6.540  -2.413  -41.666 1.00 41.76  ? 16  PRO C C   1 
ATOM   3330  O O   . PRO C  1 16  ? -5.569  -2.654  -42.375 1.00 43.88  ? 16  PRO C O   1 
ATOM   3331  C CB  . PRO C  1 16  ? -6.547  -4.568  -40.361 1.00 40.16  ? 16  PRO C CB  1 
ATOM   3332  C CG  . PRO C  1 16  ? -7.958  -4.954  -40.717 1.00 38.18  ? 16  PRO C CG  1 
ATOM   3333  C CD  . PRO C  1 16  ? -8.788  -4.083  -39.791 1.00 39.82  ? 16  PRO C CD  1 
ATOM   3334  N N   . ASP C  1 17  ? -7.512  -1.593  -42.050 1.00 41.82  ? 17  ASP C N   1 
ATOM   3335  C CA  . ASP C  1 17  ? -7.464  -0.961  -43.369 1.00 42.60  ? 17  ASP C CA  1 
ATOM   3336  C C   . ASP C  1 17  ? -6.324  0.036   -43.554 1.00 43.22  ? 17  ASP C C   1 
ATOM   3337  O O   . ASP C  1 17  ? -5.872  0.266   -44.675 1.00 42.55  ? 17  ASP C O   1 
ATOM   3338  C CB  . ASP C  1 17  ? -8.781  -0.251  -43.666 1.00 44.02  ? 17  ASP C CB  1 
ATOM   3339  C CG  . ASP C  1 17  ? -9.973  -1.171  -43.550 1.00 47.06  ? 17  ASP C CG  1 
ATOM   3340  O OD1 . ASP C  1 17  ? -10.313 -1.569  -42.411 1.00 48.23  ? 17  ASP C OD1 1 
ATOM   3341  O OD2 . ASP C  1 17  ? -10.563 -1.504  -44.600 1.00 46.99  ? 17  ASP C OD2 1 
ATOM   3342  N N   . LYS C  1 18  ? -5.862  0.628   -42.455 1.00 44.79  ? 18  LYS C N   1 
ATOM   3343  C CA  . LYS C  1 18  ? -4.799  1.633   -42.503 1.00 44.01  ? 18  LYS C CA  1 
ATOM   3344  C C   . LYS C  1 18  ? -5.268  2.837   -43.308 1.00 43.84  ? 18  LYS C C   1 
ATOM   3345  O O   . LYS C  1 18  ? -4.537  3.350   -44.160 1.00 43.16  ? 18  LYS C O   1 
ATOM   3346  C CB  . LYS C  1 18  ? -3.534  1.078   -43.150 1.00 45.28  ? 18  LYS C CB  1 
ATOM   3347  C CG  . LYS C  1 18  ? -2.812  0.004   -42.378 1.00 47.67  ? 18  LYS C CG  1 
ATOM   3348  C CD  . LYS C  1 18  ? -1.518  -0.308  -43.098 1.00 51.04  ? 18  LYS C CD  1 
ATOM   3349  C CE  . LYS C  1 18  ? -0.601  -1.181  -42.275 1.00 53.20  ? 18  LYS C CE  1 
ATOM   3350  N NZ  . LYS C  1 18  ? 0.777   -1.140  -42.844 1.00 55.79  ? 18  LYS C NZ  1 
ATOM   3351  N N   . ARG C  1 19  ? -6.497  3.269   -43.049 1.00 42.84  ? 19  ARG C N   1 
ATOM   3352  C CA  . ARG C  1 19  ? -7.067  4.425   -43.733 1.00 43.06  ? 19  ARG C CA  1 
ATOM   3353  C C   . ARG C  1 19  ? -7.246  5.532   -42.717 1.00 41.13  ? 19  ARG C C   1 
ATOM   3354  O O   . ARG C  1 19  ? -7.570  5.282   -41.550 1.00 40.43  ? 19  ARG C O   1 
ATOM   3355  C CB  . ARG C  1 19  ? -8.444  4.105   -44.327 1.00 46.54  ? 19  ARG C CB  1 
ATOM   3356  C CG  . ARG C  1 19  ? -8.490  2.940   -45.291 1.00 51.09  ? 19  ARG C CG  1 
ATOM   3357  C CD  . ARG C  1 19  ? -7.737  3.223   -46.578 1.00 52.79  ? 19  ARG C CD  1 
ATOM   3358  N NE  . ARG C  1 19  ? -8.014  2.190   -47.573 1.00 56.27  ? 19  ARG C NE  1 
ATOM   3359  C CZ  . ARG C  1 19  ? -9.204  1.990   -48.140 1.00 57.43  ? 19  ARG C CZ  1 
ATOM   3360  N NH1 . ARG C  1 19  ? -10.249 2.752   -47.821 1.00 55.61  ? 19  ARG C NH1 1 
ATOM   3361  N NH2 . ARG C  1 19  ? -9.350  1.017   -49.031 1.00 59.85  ? 19  ARG C NH2 1 
ATOM   3362  N N   . GLY C  1 20  ? -7.052  6.761   -43.172 1.00 40.22  ? 20  GLY C N   1 
ATOM   3363  C CA  . GLY C  1 20  ? -7.209  7.901   -42.298 1.00 36.47  ? 20  GLY C CA  1 
ATOM   3364  C C   . GLY C  1 20  ? -7.803  9.054   -43.071 1.00 35.85  ? 20  GLY C C   1 
ATOM   3365  O O   . GLY C  1 20  ? -7.678  9.123   -44.295 1.00 33.97  ? 20  GLY C O   1 
ATOM   3366  N N   . GLU C  1 21  ? -8.459  9.961   -42.359 1.00 34.12  ? 21  GLU C N   1 
ATOM   3367  C CA  . GLU C  1 21  ? -9.053  11.117  -42.996 1.00 32.12  ? 21  GLU C CA  1 
ATOM   3368  C C   . GLU C  1 21  ? -9.072  12.299  -42.052 1.00 30.21  ? 21  GLU C C   1 
ATOM   3369  O O   . GLU C  1 21  ? -9.080  12.151  -40.832 1.00 29.25  ? 21  GLU C O   1 
ATOM   3370  C CB  . GLU C  1 21  ? -10.474 10.799  -43.499 1.00 34.98  ? 21  GLU C CB  1 
ATOM   3371  C CG  . GLU C  1 21  ? -10.482 9.863   -44.720 1.00 38.05  ? 21  GLU C CG  1 
ATOM   3372  C CD  . GLU C  1 21  ? -11.843 9.752   -45.396 1.00 40.80  ? 21  GLU C CD  1 
ATOM   3373  O OE1 . GLU C  1 21  ? -11.923 9.124   -46.476 1.00 40.64  ? 21  GLU C OE1 1 
ATOM   3374  O OE2 . GLU C  1 21  ? -12.829 10.288  -44.849 1.00 38.21  ? 21  GLU C OE2 1 
ATOM   3375  N N   . PHE C  1 22  ? -9.064  13.480  -42.645 1.00 28.92  ? 22  PHE C N   1 
ATOM   3376  C CA  . PHE C  1 22  ? -9.075  14.720  -41.909 1.00 28.67  ? 22  PHE C CA  1 
ATOM   3377  C C   . PHE C  1 22  ? -9.979  15.636  -42.721 1.00 30.46  ? 22  PHE C C   1 
ATOM   3378  O O   . PHE C  1 22  ? -9.755  15.815  -43.917 1.00 31.00  ? 22  PHE C O   1 
ATOM   3379  C CB  . PHE C  1 22  ? -7.653  15.294  -41.867 1.00 27.34  ? 22  PHE C CB  1 
ATOM   3380  C CG  . PHE C  1 22  ? -7.534  16.548  -41.060 1.00 25.88  ? 22  PHE C CG  1 
ATOM   3381  C CD1 . PHE C  1 22  ? -7.130  16.499  -39.735 1.00 23.49  ? 22  PHE C CD1 1 
ATOM   3382  C CD2 . PHE C  1 22  ? -7.892  17.771  -41.605 1.00 24.66  ? 22  PHE C CD2 1 
ATOM   3383  C CE1 . PHE C  1 22  ? -7.098  17.646  -38.965 1.00 22.55  ? 22  PHE C CE1 1 
ATOM   3384  C CE2 . PHE C  1 22  ? -7.863  18.920  -40.840 1.00 25.25  ? 22  PHE C CE2 1 
ATOM   3385  C CZ  . PHE C  1 22  ? -7.466  18.857  -39.515 1.00 24.29  ? 22  PHE C CZ  1 
ATOM   3386  N N   . MET C  1 23  ? -11.015 16.191  -42.103 1.00 32.13  ? 23  MET C N   1 
ATOM   3387  C CA  . MET C  1 23  ? -11.896 17.099  -42.827 1.00 31.64  ? 23  MET C CA  1 
ATOM   3388  C C   . MET C  1 23  ? -12.503 18.141  -41.912 1.00 31.68  ? 23  MET C C   1 
ATOM   3389  O O   . MET C  1 23  ? -12.555 17.957  -40.690 1.00 29.93  ? 23  MET C O   1 
ATOM   3390  C CB  . MET C  1 23  ? -13.010 16.331  -43.549 1.00 31.75  ? 23  MET C CB  1 
ATOM   3391  C CG  . MET C  1 23  ? -14.029 15.628  -42.652 1.00 33.77  ? 23  MET C CG  1 
ATOM   3392  S SD  . MET C  1 23  ? -15.297 16.739  -41.998 1.00 38.56  ? 23  MET C SD  1 
ATOM   3393  C CE  . MET C  1 23  ? -16.442 16.741  -43.382 1.00 35.39  ? 23  MET C CE  1 
ATOM   3394  N N   . PHE C  1 24  ? -12.937 19.243  -42.520 1.00 31.68  ? 24  PHE C N   1 
ATOM   3395  C CA  . PHE C  1 24  ? -13.593 20.330  -41.808 1.00 34.66  ? 24  PHE C CA  1 
ATOM   3396  C C   . PHE C  1 24  ? -15.039 20.350  -42.291 1.00 35.75  ? 24  PHE C C   1 
ATOM   3397  O O   . PHE C  1 24  ? -15.332 19.980  -43.434 1.00 34.96  ? 24  PHE C O   1 
ATOM   3398  C CB  . PHE C  1 24  ? -12.920 21.669  -42.118 1.00 35.62  ? 24  PHE C CB  1 
ATOM   3399  C CG  . PHE C  1 24  ? -12.120 22.228  -40.972 1.00 35.83  ? 24  PHE C CG  1 
ATOM   3400  C CD1 . PHE C  1 24  ? -11.068 21.511  -40.425 1.00 36.21  ? 24  PHE C CD1 1 
ATOM   3401  C CD2 . PHE C  1 24  ? -12.432 23.468  -40.435 1.00 35.59  ? 24  PHE C CD2 1 
ATOM   3402  C CE1 . PHE C  1 24  ? -10.335 22.020  -39.357 1.00 38.42  ? 24  PHE C CE1 1 
ATOM   3403  C CE2 . PHE C  1 24  ? -11.706 23.988  -39.370 1.00 37.39  ? 24  PHE C CE2 1 
ATOM   3404  C CZ  . PHE C  1 24  ? -10.655 23.261  -38.828 1.00 36.10  ? 24  PHE C CZ  1 
ATOM   3405  N N   . ASP C  1 25  ? -15.942 20.795  -41.428 1.00 36.54  ? 25  ASP C N   1 
ATOM   3406  C CA  . ASP C  1 25  ? -17.359 20.821  -41.767 1.00 36.31  ? 25  ASP C CA  1 
ATOM   3407  C C   . ASP C  1 25  ? -17.997 22.117  -41.289 1.00 35.73  ? 25  ASP C C   1 
ATOM   3408  O O   . ASP C  1 25  ? -17.696 22.612  -40.193 1.00 35.08  ? 25  ASP C O   1 
ATOM   3409  C CB  . ASP C  1 25  ? -18.028 19.590  -41.119 1.00 40.28  ? 25  ASP C CB  1 
ATOM   3410  C CG  . ASP C  1 25  ? -19.559 19.595  -41.215 1.00 43.77  ? 25  ASP C CG  1 
ATOM   3411  O OD1 . ASP C  1 25  ? -20.201 20.413  -40.521 1.00 44.02  ? 25  ASP C OD1 1 
ATOM   3412  O OD2 . ASP C  1 25  ? -20.118 18.762  -41.974 1.00 46.14  ? 25  ASP C OD2 1 
ATOM   3413  N N   . PHE C  1 26  ? -18.858 22.681  -42.130 1.00 35.50  ? 26  PHE C N   1 
ATOM   3414  C CA  . PHE C  1 26  ? -19.573 23.907  -41.784 1.00 36.17  ? 26  PHE C CA  1 
ATOM   3415  C C   . PHE C  1 26  ? -21.070 23.623  -41.843 1.00 35.59  ? 26  PHE C C   1 
ATOM   3416  O O   . PHE C  1 26  ? -21.616 23.363  -42.915 1.00 35.99  ? 26  PHE C O   1 
ATOM   3417  C CB  . PHE C  1 26  ? -19.236 25.043  -42.761 1.00 36.11  ? 26  PHE C CB  1 
ATOM   3418  C CG  . PHE C  1 26  ? -19.834 26.369  -42.370 1.00 34.88  ? 26  PHE C CG  1 
ATOM   3419  C CD1 . PHE C  1 26  ? -19.363 27.054  -41.256 1.00 36.74  ? 26  PHE C CD1 1 
ATOM   3420  C CD2 . PHE C  1 26  ? -20.894 26.912  -43.088 1.00 36.39  ? 26  PHE C CD2 1 
ATOM   3421  C CE1 . PHE C  1 26  ? -19.941 28.268  -40.856 1.00 36.25  ? 26  PHE C CE1 1 
ATOM   3422  C CE2 . PHE C  1 26  ? -21.479 28.120  -42.702 1.00 35.17  ? 26  PHE C CE2 1 
ATOM   3423  C CZ  . PHE C  1 26  ? -21.001 28.797  -41.581 1.00 36.22  ? 26  PHE C CZ  1 
ATOM   3424  N N   . ASP C  1 27  ? -21.731 23.669  -40.693 1.00 37.13  ? 27  ASP C N   1 
ATOM   3425  C CA  . ASP C  1 27  ? -23.176 23.412  -40.630 1.00 38.44  ? 27  ASP C CA  1 
ATOM   3426  C C   . ASP C  1 27  ? -23.605 22.131  -41.354 1.00 36.79  ? 27  ASP C C   1 
ATOM   3427  O O   . ASP C  1 27  ? -24.651 22.099  -42.004 1.00 37.62  ? 27  ASP C O   1 
ATOM   3428  C CB  . ASP C  1 27  ? -23.980 24.574  -41.232 1.00 40.39  ? 27  ASP C CB  1 
ATOM   3429  C CG  . ASP C  1 27  ? -23.843 25.865  -40.453 1.00 42.82  ? 27  ASP C CG  1 
ATOM   3430  O OD1 . ASP C  1 27  ? -23.584 25.818  -39.234 1.00 44.47  ? 27  ASP C OD1 1 
ATOM   3431  O OD2 . ASP C  1 27  ? -24.021 26.937  -41.072 1.00 46.31  ? 27  ASP C OD2 1 
ATOM   3432  N N   . GLY C  1 28  ? -22.805 21.081  -41.259 1.00 35.73  ? 28  GLY C N   1 
ATOM   3433  C CA  . GLY C  1 28  ? -23.185 19.841  -41.913 1.00 34.48  ? 28  GLY C CA  1 
ATOM   3434  C C   . GLY C  1 28  ? -22.645 19.666  -43.314 1.00 33.89  ? 28  GLY C C   1 
ATOM   3435  O O   . GLY C  1 28  ? -22.942 18.666  -43.971 1.00 32.85  ? 28  GLY C O   1 
ATOM   3436  N N   . ASP C  1 29  ? -21.867 20.639  -43.781 1.00 33.59  ? 29  ASP C N   1 
ATOM   3437  C CA  . ASP C  1 29  ? -21.274 20.549  -45.109 1.00 35.79  ? 29  ASP C CA  1 
ATOM   3438  C C   . ASP C  1 29  ? -19.754 20.546  -45.041 1.00 35.71  ? 29  ASP C C   1 
ATOM   3439  O O   . ASP C  1 29  ? -19.155 21.277  -44.248 1.00 36.04  ? 29  ASP C O   1 
ATOM   3440  C CB  . ASP C  1 29  ? -21.734 21.708  -45.995 1.00 36.80  ? 29  ASP C CB  1 
ATOM   3441  C CG  . ASP C  1 29  ? -23.127 21.502  -46.532 1.00 37.58  ? 29  ASP C CG  1 
ATOM   3442  O OD1 . ASP C  1 29  ? -23.401 20.403  -47.060 1.00 39.13  ? 29  ASP C OD1 1 
ATOM   3443  O OD2 . ASP C  1 29  ? -23.946 22.433  -46.430 1.00 37.47  ? 29  ASP C OD2 1 
ATOM   3444  N N   . GLU C  1 30  ? -19.135 19.721  -45.875 1.00 34.48  ? 30  GLU C N   1 
ATOM   3445  C CA  . GLU C  1 30  ? -17.690 19.638  -45.912 1.00 35.88  ? 30  GLU C CA  1 
ATOM   3446  C C   . GLU C  1 30  ? -17.053 20.905  -46.492 1.00 34.91  ? 30  GLU C C   1 
ATOM   3447  O O   . GLU C  1 30  ? -17.433 21.362  -47.561 1.00 35.69  ? 30  GLU C O   1 
ATOM   3448  C CB  . GLU C  1 30  ? -17.250 18.428  -46.744 1.00 36.76  ? 30  GLU C CB  1 
ATOM   3449  C CG  . GLU C  1 30  ? -15.749 18.446  -47.079 1.00 38.80  ? 30  GLU C CG  1 
ATOM   3450  C CD  . GLU C  1 30  ? -15.311 17.261  -47.925 1.00 41.51  ? 30  GLU C CD  1 
ATOM   3451  O OE1 . GLU C  1 30  ? -16.184 16.558  -48.478 1.00 41.92  ? 30  GLU C OE1 1 
ATOM   3452  O OE2 . GLU C  1 30  ? -14.086 17.036  -48.052 1.00 41.79  ? 30  GLU C OE2 1 
ATOM   3453  N N   . ILE C  1 31  ? -16.089 21.477  -45.779 1.00 35.57  ? 31  ILE C N   1 
ATOM   3454  C CA  . ILE C  1 31  ? -15.391 22.659  -46.283 1.00 34.43  ? 31  ILE C CA  1 
ATOM   3455  C C   . ILE C  1 31  ? -14.247 22.133  -47.152 1.00 34.68  ? 31  ILE C C   1 
ATOM   3456  O O   . ILE C  1 31  ? -14.030 22.602  -48.272 1.00 36.14  ? 31  ILE C O   1 
ATOM   3457  C CB  . ILE C  1 31  ? -14.818 23.521  -45.139 1.00 34.81  ? 31  ILE C CB  1 
ATOM   3458  C CG1 . ILE C  1 31  ? -15.941 23.917  -44.183 1.00 30.79  ? 31  ILE C CG1 1 
ATOM   3459  C CG2 . ILE C  1 31  ? -14.118 24.774  -45.721 1.00 35.47  ? 31  ILE C CG2 1 
ATOM   3460  C CD1 . ILE C  1 31  ? -15.516 24.852  -43.085 1.00 31.28  ? 31  ILE C CD1 1 
ATOM   3461  N N   . PHE C  1 32  ? -13.542 21.131  -46.632 1.00 33.30  ? 32  PHE C N   1 
ATOM   3462  C CA  . PHE C  1 32  ? -12.435 20.495  -47.341 1.00 34.51  ? 32  PHE C CA  1 
ATOM   3463  C C   . PHE C  1 32  ? -11.974 19.277  -46.563 1.00 35.42  ? 32  PHE C C   1 
ATOM   3464  O O   . PHE C  1 32  ? -12.340 19.087  -45.409 1.00 36.57  ? 32  PHE C O   1 
ATOM   3465  C CB  . PHE C  1 32  ? -11.230 21.439  -47.446 1.00 34.74  ? 32  PHE C CB  1 
ATOM   3466  C CG  . PHE C  1 32  ? -10.601 21.774  -46.111 1.00 32.04  ? 32  PHE C CG  1 
ATOM   3467  C CD1 . PHE C  1 32  ? -11.045 22.867  -45.367 1.00 32.38  ? 32  PHE C CD1 1 
ATOM   3468  C CD2 . PHE C  1 32  ? -9.587  20.983  -45.589 1.00 31.01  ? 32  PHE C CD2 1 
ATOM   3469  C CE1 . PHE C  1 32  ? -10.483 23.166  -44.118 1.00 31.75  ? 32  PHE C CE1 1 
ATOM   3470  C CE2 . PHE C  1 32  ? -9.019  21.271  -44.344 1.00 33.03  ? 32  PHE C CE2 1 
ATOM   3471  C CZ  . PHE C  1 32  ? -9.471  22.367  -43.606 1.00 31.84  ? 32  PHE C CZ  1 
ATOM   3472  N N   . HIS C  1 33  ? -11.151 18.459  -47.196 1.00 36.36  ? 33  HIS C N   1 
ATOM   3473  C CA  . HIS C  1 33  ? -10.579 17.313  -46.512 1.00 38.72  ? 33  HIS C CA  1 
ATOM   3474  C C   . HIS C  1 33  ? -9.138  17.201  -46.994 1.00 40.64  ? 33  HIS C C   1 
ATOM   3475  O O   . HIS C  1 33  ? -8.780  17.777  -48.025 1.00 41.13  ? 33  HIS C O   1 
ATOM   3476  C CB  . HIS C  1 33  ? -11.325 16.041  -46.861 1.00 35.15  ? 33  HIS C CB  1 
ATOM   3477  C CG  . HIS C  1 33  ? -11.189 15.640  -48.292 1.00 33.82  ? 33  HIS C CG  1 
ATOM   3478  N ND1 . HIS C  1 33  ? -12.071 16.054  -49.266 1.00 35.15  ? 33  HIS C ND1 1 
ATOM   3479  C CD2 . HIS C  1 33  ? -10.291 14.841  -48.910 1.00 33.17  ? 33  HIS C CD2 1 
ATOM   3480  C CE1 . HIS C  1 33  ? -11.728 15.518  -50.423 1.00 33.40  ? 33  HIS C CE1 1 
ATOM   3481  N NE2 . HIS C  1 33  ? -10.652 14.777  -50.235 1.00 34.99  ? 33  HIS C NE2 1 
ATOM   3482  N N   . VAL C  1 34  ? -8.307  16.482  -46.253 1.00 43.32  ? 34  VAL C N   1 
ATOM   3483  C CA  . VAL C  1 34  ? -6.928  16.295  -46.673 1.00 45.64  ? 34  VAL C CA  1 
ATOM   3484  C C   . VAL C  1 34  ? -6.706  14.834  -47.043 1.00 49.95  ? 34  VAL C C   1 
ATOM   3485  O O   . VAL C  1 34  ? -6.967  13.928  -46.250 1.00 48.85  ? 34  VAL C O   1 
ATOM   3486  C CB  . VAL C  1 34  ? -5.920  16.706  -45.575 1.00 45.19  ? 34  VAL C CB  1 
ATOM   3487  C CG1 . VAL C  1 34  ? -4.514  16.324  -45.998 1.00 40.84  ? 34  VAL C CG1 1 
ATOM   3488  C CG2 . VAL C  1 34  ? -5.994  18.206  -45.336 1.00 43.01  ? 34  VAL C CG2 1 
ATOM   3489  N N   . ASP C  1 35  ? -6.229  14.630  -48.269 1.00 56.03  ? 35  ASP C N   1 
ATOM   3490  C CA  . ASP C  1 35  ? -5.945  13.307  -48.814 1.00 60.99  ? 35  ASP C CA  1 
ATOM   3491  C C   . ASP C  1 35  ? -4.679  12.729  -48.171 1.00 63.28  ? 35  ASP C C   1 
ATOM   3492  O O   . ASP C  1 35  ? -3.567  13.037  -48.610 1.00 64.21  ? 35  ASP C O   1 
ATOM   3493  C CB  . ASP C  1 35  ? -5.742  13.423  -50.328 1.00 62.80  ? 35  ASP C CB  1 
ATOM   3494  C CG  . ASP C  1 35  ? -5.969  12.109  -51.052 1.00 66.75  ? 35  ASP C CG  1 
ATOM   3495  O OD1 . ASP C  1 35  ? -5.363  11.086  -50.650 1.00 67.70  ? 35  ASP C OD1 1 
ATOM   3496  O OD2 . ASP C  1 35  ? -6.752  12.105  -52.032 1.00 67.61  ? 35  ASP C OD2 1 
ATOM   3497  N N   . ILE C  1 36  ? -4.845  11.889  -47.149 1.00 65.37  ? 36  ILE C N   1 
ATOM   3498  C CA  . ILE C  1 36  ? -3.704  11.293  -46.447 1.00 67.72  ? 36  ILE C CA  1 
ATOM   3499  C C   . ILE C  1 36  ? -2.657  10.694  -47.378 1.00 70.06  ? 36  ILE C C   1 
ATOM   3500  O O   . ILE C  1 36  ? -1.494  10.564  -47.001 1.00 71.78  ? 36  ILE C O   1 
ATOM   3501  C CB  . ILE C  1 36  ? -4.125  10.159  -45.483 1.00 66.57  ? 36  ILE C CB  1 
ATOM   3502  C CG1 . ILE C  1 36  ? -4.542  8.923   -46.287 1.00 68.86  ? 36  ILE C CG1 1 
ATOM   3503  C CG2 . ILE C  1 36  ? -5.244  10.629  -44.583 1.00 66.39  ? 36  ILE C CG2 1 
ATOM   3504  C CD1 . ILE C  1 36  ? -4.805  7.675   -45.443 1.00 68.67  ? 36  ILE C CD1 1 
ATOM   3505  N N   . GLU C  1 37  ? -3.069  10.324  -48.586 1.00 71.28  ? 37  GLU C N   1 
ATOM   3506  C CA  . GLU C  1 37  ? -2.150  9.717   -49.540 1.00 72.45  ? 37  GLU C CA  1 
ATOM   3507  C C   . GLU C  1 37  ? -1.562  10.715  -50.524 1.00 72.41  ? 37  GLU C C   1 
ATOM   3508  O O   . GLU C  1 37  ? -0.458  10.519  -51.032 1.00 73.61  ? 37  GLU C O   1 
ATOM   3509  C CB  . GLU C  1 37  ? -2.863  8.602   -50.306 1.00 74.81  ? 37  GLU C CB  1 
ATOM   3510  C CG  . GLU C  1 37  ? -3.272  7.408   -49.443 1.00 77.24  ? 37  GLU C CG  1 
ATOM   3511  C CD  . GLU C  1 37  ? -2.317  6.230   -49.571 1.00 78.66  ? 37  GLU C CD  1 
ATOM   3512  O OE1 . GLU C  1 37  ? -2.217  5.664   -50.684 1.00 79.76  ? 37  GLU C OE1 1 
ATOM   3513  O OE2 . GLU C  1 37  ? -1.671  5.868   -48.563 1.00 79.31  ? 37  GLU C OE2 1 
ATOM   3514  N N   . LYS C  1 38  ? -2.294  11.787  -50.794 1.00 71.20  ? 38  LYS C N   1 
ATOM   3515  C CA  . LYS C  1 38  ? -1.820  12.791  -51.733 1.00 68.74  ? 38  LYS C CA  1 
ATOM   3516  C C   . LYS C  1 38  ? -1.255  14.021  -51.035 1.00 66.42  ? 38  LYS C C   1 
ATOM   3517  O O   . LYS C  1 38  ? -0.751  14.937  -51.689 1.00 66.65  ? 38  LYS C O   1 
ATOM   3518  C CB  . LYS C  1 38  ? -2.958  13.202  -52.678 1.00 70.35  ? 38  LYS C CB  1 
ATOM   3519  C CG  . LYS C  1 38  ? -2.552  14.223  -53.728 1.00 72.13  ? 38  LYS C CG  1 
ATOM   3520  C CD  . LYS C  1 38  ? -1.309  13.759  -54.489 1.00 74.49  ? 38  LYS C CD  1 
ATOM   3521  C CE  . LYS C  1 38  ? -0.716  14.874  -55.352 1.00 74.79  ? 38  LYS C CE  1 
ATOM   3522  N NZ  . LYS C  1 38  ? -0.242  16.031  -54.536 1.00 75.79  ? 38  LYS C NZ  1 
ATOM   3523  N N   . SER C  1 39  ? -1.327  14.044  -49.709 1.00 63.35  ? 39  SER C N   1 
ATOM   3524  C CA  . SER C  1 39  ? -0.820  15.188  -48.955 1.00 60.84  ? 39  SER C CA  1 
ATOM   3525  C C   . SER C  1 39  ? -1.281  16.496  -49.618 1.00 57.86  ? 39  SER C C   1 
ATOM   3526  O O   . SER C  1 39  ? -0.487  17.405  -49.852 1.00 56.90  ? 39  SER C O   1 
ATOM   3527  C CB  . SER C  1 39  ? 0.714   15.133  -48.897 1.00 60.71  ? 39  SER C CB  1 
ATOM   3528  O OG  . SER C  1 39  ? 1.238   16.188  -48.105 1.00 61.99  ? 39  SER C OG  1 
ATOM   3529  N N   . GLU C  1 40  ? -2.575  16.581  -49.912 1.00 56.42  ? 40  GLU C N   1 
ATOM   3530  C CA  . GLU C  1 40  ? -3.138  17.759  -50.562 1.00 53.61  ? 40  GLU C CA  1 
ATOM   3531  C C   . GLU C  1 40  ? -4.478  18.201  -49.980 1.00 50.95  ? 40  GLU C C   1 
ATOM   3532  O O   . GLU C  1 40  ? -5.374  17.388  -49.763 1.00 51.05  ? 40  GLU C O   1 
ATOM   3533  C CB  . GLU C  1 40  ? -3.310  17.482  -52.057 1.00 55.55  ? 40  GLU C CB  1 
ATOM   3534  C CG  . GLU C  1 40  ? -3.810  18.675  -52.856 1.00 59.00  ? 40  GLU C CG  1 
ATOM   3535  C CD  . GLU C  1 40  ? -4.077  18.342  -54.324 1.00 61.62  ? 40  GLU C CD  1 
ATOM   3536  O OE1 . GLU C  1 40  ? -4.607  19.226  -55.040 1.00 61.74  ? 40  GLU C OE1 1 
ATOM   3537  O OE2 . GLU C  1 40  ? -3.759  17.206  -54.756 1.00 61.08  ? 40  GLU C OE2 1 
ATOM   3538  N N   . THR C  1 41  ? -4.603  19.498  -49.735 1.00 47.07  ? 41  THR C N   1 
ATOM   3539  C CA  . THR C  1 41  ? -5.829  20.062  -49.208 1.00 45.22  ? 41  THR C CA  1 
ATOM   3540  C C   . THR C  1 41  ? -6.825  20.166  -50.359 1.00 45.50  ? 41  THR C C   1 
ATOM   3541  O O   . THR C  1 41  ? -6.582  20.900  -51.309 1.00 47.22  ? 41  THR C O   1 
ATOM   3542  C CB  . THR C  1 41  ? -5.580  21.467  -48.637 1.00 44.88  ? 41  THR C CB  1 
ATOM   3543  O OG1 . THR C  1 41  ? -4.680  21.374  -47.533 1.00 44.44  ? 41  THR C OG1 1 
ATOM   3544  C CG2 . THR C  1 41  ? -6.875  22.101  -48.177 1.00 42.67  ? 41  THR C CG2 1 
ATOM   3545  N N   . ILE C  1 42  ? -7.932  19.425  -50.277 1.00 44.29  ? 42  ILE C N   1 
ATOM   3546  C CA  . ILE C  1 42  ? -8.970  19.431  -51.315 1.00 40.85  ? 42  ILE C CA  1 
ATOM   3547  C C   . ILE C  1 42  ? -10.203 20.201  -50.846 1.00 40.86  ? 42  ILE C C   1 
ATOM   3548  O O   . ILE C  1 42  ? -10.825 19.840  -49.848 1.00 41.54  ? 42  ILE C O   1 
ATOM   3549  C CB  . ILE C  1 42  ? -9.443  18.008  -51.659 1.00 40.13  ? 42  ILE C CB  1 
ATOM   3550  C CG1 . ILE C  1 42  ? -8.244  17.053  -51.785 1.00 35.96  ? 42  ILE C CG1 1 
ATOM   3551  C CG2 . ILE C  1 42  ? -10.276 18.051  -52.926 1.00 34.70  ? 42  ILE C CG2 1 
ATOM   3552  C CD1 . ILE C  1 42  ? -7.291  17.400  -52.906 1.00 37.75  ? 42  ILE C CD1 1 
ATOM   3553  N N   . TRP C  1 43  ? -10.552 21.264  -51.560 1.00 40.16  ? 43  TRP C N   1 
ATOM   3554  C CA  . TRP C  1 43  ? -11.715 22.059  -51.195 1.00 38.69  ? 43  TRP C CA  1 
ATOM   3555  C C   . TRP C  1 43  ? -12.970 21.426  -51.759 1.00 38.51  ? 43  TRP C C   1 
ATOM   3556  O O   . TRP C  1 43  ? -12.945 20.840  -52.844 1.00 37.53  ? 43  TRP C O   1 
ATOM   3557  C CB  . TRP C  1 43  ? -11.559 23.483  -51.716 1.00 38.77  ? 43  TRP C CB  1 
ATOM   3558  C CG  . TRP C  1 43  ? -10.377 24.131  -51.148 1.00 36.67  ? 43  TRP C CG  1 
ATOM   3559  C CD1 . TRP C  1 43  ? -9.116  24.138  -51.670 1.00 38.05  ? 43  TRP C CD1 1 
ATOM   3560  C CD2 . TRP C  1 43  ? -10.294 24.788  -49.878 1.00 36.45  ? 43  TRP C CD2 1 
ATOM   3561  N NE1 . TRP C  1 43  ? -8.248  24.761  -50.796 1.00 34.05  ? 43  TRP C NE1 1 
ATOM   3562  C CE2 . TRP C  1 43  ? -8.945  25.165  -49.690 1.00 34.62  ? 43  TRP C CE2 1 
ATOM   3563  C CE3 . TRP C  1 43  ? -11.227 25.090  -48.878 1.00 36.56  ? 43  TRP C CE3 1 
ATOM   3564  C CZ2 . TRP C  1 43  ? -8.505  25.826  -48.537 1.00 35.29  ? 43  TRP C CZ2 1 
ATOM   3565  C CZ3 . TRP C  1 43  ? -10.786 25.750  -47.729 1.00 37.31  ? 43  TRP C CZ3 1 
ATOM   3566  C CH2 . TRP C  1 43  ? -9.439  26.109  -47.571 1.00 36.34  ? 43  TRP C CH2 1 
ATOM   3567  N N   . ARG C  1 44  ? -14.071 21.541  -51.023 1.00 39.11  ? 44  ARG C N   1 
ATOM   3568  C CA  . ARG C  1 44  ? -15.318 20.937  -51.477 1.00 39.85  ? 44  ARG C CA  1 
ATOM   3569  C C   . ARG C  1 44  ? -15.786 21.625  -52.726 1.00 39.70  ? 44  ARG C C   1 
ATOM   3570  O O   . ARG C  1 44  ? -16.210 20.984  -53.677 1.00 40.51  ? 44  ARG C O   1 
ATOM   3571  C CB  . ARG C  1 44  ? -16.395 21.032  -50.407 1.00 39.93  ? 44  ARG C CB  1 
ATOM   3572  C CG  . ARG C  1 44  ? -17.626 20.238  -50.765 1.00 41.10  ? 44  ARG C CG  1 
ATOM   3573  C CD  . ARG C  1 44  ? -17.252 18.803  -51.062 1.00 36.66  ? 44  ARG C CD  1 
ATOM   3574  N NE  . ARG C  1 44  ? -18.404 18.021  -51.487 1.00 35.71  ? 44  ARG C NE  1 
ATOM   3575  C CZ  . ARG C  1 44  ? -18.860 17.979  -52.731 1.00 36.10  ? 44  ARG C CZ  1 
ATOM   3576  N NH1 . ARG C  1 44  ? -18.250 18.683  -53.676 1.00 36.04  ? 44  ARG C NH1 1 
ATOM   3577  N NH2 . ARG C  1 44  ? -19.908 17.221  -53.033 1.00 29.63  ? 44  ARG C NH2 1 
ATOM   3578  N N   . LEU C  1 45  ? -15.722 22.947  -52.704 1.00 42.59  ? 45  LEU C N   1 
ATOM   3579  C CA  . LEU C  1 45  ? -16.096 23.754  -53.853 1.00 44.40  ? 45  LEU C CA  1 
ATOM   3580  C C   . LEU C  1 45  ? -14.844 24.544  -54.215 1.00 46.96  ? 45  LEU C C   1 
ATOM   3581  O O   . LEU C  1 45  ? -14.293 25.277  -53.385 1.00 43.67  ? 45  LEU C O   1 
ATOM   3582  C CB  . LEU C  1 45  ? -17.253 24.698  -53.506 1.00 42.60  ? 45  LEU C CB  1 
ATOM   3583  C CG  . LEU C  1 45  ? -18.619 24.068  -53.194 1.00 41.36  ? 45  LEU C CG  1 
ATOM   3584  C CD1 . LEU C  1 45  ? -19.636 25.168  -52.974 1.00 40.18  ? 45  LEU C CD1 1 
ATOM   3585  C CD2 . LEU C  1 45  ? -19.064 23.168  -54.342 1.00 40.89  ? 45  LEU C CD2 1 
ATOM   3586  N N   . GLU C  1 46  ? -14.396 24.360  -55.455 1.00 51.04  ? 46  GLU C N   1 
ATOM   3587  C CA  . GLU C  1 46  ? -13.207 25.031  -55.984 1.00 53.63  ? 46  GLU C CA  1 
ATOM   3588  C C   . GLU C  1 46  ? -13.086 26.480  -55.528 1.00 52.87  ? 46  GLU C C   1 
ATOM   3589  O O   . GLU C  1 46  ? -12.021 26.921  -55.108 1.00 52.43  ? 46  GLU C O   1 
ATOM   3590  C CB  . GLU C  1 46  ? -13.231 24.990  -57.511 1.00 57.43  ? 46  GLU C CB  1 
ATOM   3591  C CG  . GLU C  1 46  ? -11.997 25.582  -58.158 1.00 65.36  ? 46  GLU C CG  1 
ATOM   3592  C CD  . GLU C  1 46  ? -12.130 25.712  -59.670 1.00 68.79  ? 46  GLU C CD  1 
ATOM   3593  O OE1 . GLU C  1 46  ? -12.423 24.692  -60.339 1.00 69.96  ? 46  GLU C OE1 1 
ATOM   3594  O OE2 . GLU C  1 46  ? -11.936 26.837  -60.189 1.00 70.96  ? 46  GLU C OE2 1 
ATOM   3595  N N   . GLU C  1 47  ? -14.195 27.203  -55.598 1.00 52.17  ? 47  GLU C N   1 
ATOM   3596  C CA  . GLU C  1 47  ? -14.235 28.609  -55.223 1.00 52.66  ? 47  GLU C CA  1 
ATOM   3597  C C   . GLU C  1 47  ? -13.807 28.930  -53.797 1.00 53.89  ? 47  GLU C C   1 
ATOM   3598  O O   . GLU C  1 47  ? -13.476 30.080  -53.495 1.00 56.12  ? 47  GLU C O   1 
ATOM   3599  C CB  . GLU C  1 47  ? -15.639 29.154  -55.448 1.00 53.31  ? 47  GLU C CB  1 
ATOM   3600  C CG  . GLU C  1 47  ? -16.648 28.570  -54.497 1.00 54.82  ? 47  GLU C CG  1 
ATOM   3601  C CD  . GLU C  1 47  ? -18.061 28.900  -54.881 1.00 54.24  ? 47  GLU C CD  1 
ATOM   3602  O OE1 . GLU C  1 47  ? -18.489 28.477  -55.974 1.00 55.46  ? 47  GLU C OE1 1 
ATOM   3603  O OE2 . GLU C  1 47  ? -18.743 29.578  -54.090 1.00 55.35  ? 47  GLU C OE2 1 
ATOM   3604  N N   . PHE C  1 48  ? -13.825 27.942  -52.908 1.00 53.55  ? 48  PHE C N   1 
ATOM   3605  C CA  . PHE C  1 48  ? -13.425 28.203  -51.527 1.00 51.60  ? 48  PHE C CA  1 
ATOM   3606  C C   . PHE C  1 48  ? -11.935 28.500  -51.418 1.00 51.54  ? 48  PHE C C   1 
ATOM   3607  O O   . PHE C  1 48  ? -11.509 29.204  -50.508 1.00 49.86  ? 48  PHE C O   1 
ATOM   3608  C CB  . PHE C  1 48  ? -13.743 27.014  -50.611 1.00 53.14  ? 48  PHE C CB  1 
ATOM   3609  C CG  . PHE C  1 48  ? -15.207 26.770  -50.400 1.00 53.51  ? 48  PHE C CG  1 
ATOM   3610  C CD1 . PHE C  1 48  ? -16.121 27.815  -50.459 1.00 54.11  ? 48  PHE C CD1 1 
ATOM   3611  C CD2 . PHE C  1 48  ? -15.669 25.494  -50.105 1.00 53.39  ? 48  PHE C CD2 1 
ATOM   3612  C CE1 . PHE C  1 48  ? -17.474 27.591  -50.227 1.00 54.98  ? 48  PHE C CE1 1 
ATOM   3613  C CE2 . PHE C  1 48  ? -17.020 25.258  -49.870 1.00 53.54  ? 48  PHE C CE2 1 
ATOM   3614  C CZ  . PHE C  1 48  ? -17.924 26.305  -49.930 1.00 53.93  ? 48  PHE C CZ  1 
ATOM   3615  N N   . ALA C  1 49  ? -11.145 27.951  -52.339 1.00 51.37  ? 49  ALA C N   1 
ATOM   3616  C CA  . ALA C  1 49  ? -9.701  28.151  -52.314 1.00 52.10  ? 49  ALA C CA  1 
ATOM   3617  C C   . ALA C  1 49  ? -9.284  29.621  -52.323 1.00 53.80  ? 49  ALA C C   1 
ATOM   3618  O O   . ALA C  1 49  ? -8.322  30.001  -51.658 1.00 54.20  ? 49  ALA C O   1 
ATOM   3619  C CB  . ALA C  1 49  ? -9.057  27.424  -53.479 1.00 50.24  ? 49  ALA C CB  1 
ATOM   3620  N N   . LYS C  1 50  ? -10.013 30.457  -53.055 1.00 55.57  ? 50  LYS C N   1 
ATOM   3621  C CA  . LYS C  1 50  ? -9.663  31.869  -53.135 1.00 56.01  ? 50  LYS C CA  1 
ATOM   3622  C C   . LYS C  1 50  ? -9.951  32.659  -51.863 1.00 56.44  ? 50  LYS C C   1 
ATOM   3623  O O   . LYS C  1 50  ? -9.653  33.849  -51.795 1.00 58.02  ? 50  LYS C O   1 
ATOM   3624  C CB  . LYS C  1 50  ? -10.384 32.510  -54.326 1.00 59.41  ? 50  LYS C CB  1 
ATOM   3625  C CG  . LYS C  1 50  ? -10.208 31.715  -55.627 1.00 64.36  ? 50  LYS C CG  1 
ATOM   3626  C CD  . LYS C  1 50  ? -10.705 32.465  -56.865 1.00 67.16  ? 50  LYS C CD  1 
ATOM   3627  C CE  . LYS C  1 50  ? -9.788  33.635  -57.232 1.00 68.78  ? 50  LYS C CE  1 
ATOM   3628  N NZ  . LYS C  1 50  ? -8.407  33.192  -57.586 1.00 69.92  ? 50  LYS C NZ  1 
ATOM   3629  N N   . PHE C  1 51  ? -10.496 32.004  -50.843 1.00 55.03  ? 51  PHE C N   1 
ATOM   3630  C CA  . PHE C  1 51  ? -10.831 32.698  -49.602 1.00 52.71  ? 51  PHE C CA  1 
ATOM   3631  C C   . PHE C  1 51  ? -10.071 32.230  -48.369 1.00 52.24  ? 51  PHE C C   1 
ATOM   3632  O O   . PHE C  1 51  ? -10.300 32.738  -47.272 1.00 51.80  ? 51  PHE C O   1 
ATOM   3633  C CB  . PHE C  1 51  ? -12.331 32.579  -49.330 1.00 54.23  ? 51  PHE C CB  1 
ATOM   3634  C CG  . PHE C  1 51  ? -13.189 33.233  -50.370 1.00 54.84  ? 51  PHE C CG  1 
ATOM   3635  C CD1 . PHE C  1 51  ? -13.512 34.582  -50.276 1.00 56.25  ? 51  PHE C CD1 1 
ATOM   3636  C CD2 . PHE C  1 51  ? -13.664 32.503  -51.455 1.00 56.17  ? 51  PHE C CD2 1 
ATOM   3637  C CE1 . PHE C  1 51  ? -14.301 35.197  -51.247 1.00 55.87  ? 51  PHE C CE1 1 
ATOM   3638  C CE2 . PHE C  1 51  ? -14.452 33.103  -52.432 1.00 56.57  ? 51  PHE C CE2 1 
ATOM   3639  C CZ  . PHE C  1 51  ? -14.771 34.457  -52.328 1.00 56.79  ? 51  PHE C CZ  1 
ATOM   3640  N N   . ALA C  1 52  ? -9.179  31.262  -48.535 1.00 51.18  ? 52  ALA C N   1 
ATOM   3641  C CA  . ALA C  1 52  ? -8.398  30.768  -47.404 1.00 49.69  ? 52  ALA C CA  1 
ATOM   3642  C C   . ALA C  1 52  ? -7.463  29.634  -47.802 1.00 49.32  ? 52  ALA C C   1 
ATOM   3643  O O   . ALA C  1 52  ? -7.434  29.198  -48.954 1.00 49.34  ? 52  ALA C O   1 
ATOM   3644  C CB  . ALA C  1 52  ? -9.329  30.305  -46.281 1.00 51.87  ? 52  ALA C CB  1 
ATOM   3645  N N   . SER C  1 53  ? -6.694  29.153  -46.835 1.00 47.83  ? 53  SER C N   1 
ATOM   3646  C CA  . SER C  1 53  ? -5.767  28.073  -47.101 1.00 45.97  ? 53  SER C CA  1 
ATOM   3647  C C   . SER C  1 53  ? -5.597  27.209  -45.864 1.00 45.05  ? 53  SER C C   1 
ATOM   3648  O O   . SER C  1 53  ? -5.956  27.607  -44.751 1.00 44.43  ? 53  SER C O   1 
ATOM   3649  C CB  . SER C  1 53  ? -4.399  28.635  -47.515 1.00 47.89  ? 53  SER C CB  1 
ATOM   3650  O OG  . SER C  1 53  ? -3.707  29.178  -46.394 1.00 47.14  ? 53  SER C OG  1 
ATOM   3651  N N   . PHE C  1 54  ? -5.039  26.023  -46.074 1.00 43.58  ? 54  PHE C N   1 
ATOM   3652  C CA  . PHE C  1 54  ? -4.783  25.091  -44.998 1.00 41.51  ? 54  PHE C CA  1 
ATOM   3653  C C   . PHE C  1 54  ? -3.576  24.240  -45.379 1.00 43.06  ? 54  PHE C C   1 
ATOM   3654  O O   . PHE C  1 54  ? -3.557  23.635  -46.446 1.00 44.25  ? 54  PHE C O   1 
ATOM   3655  C CB  . PHE C  1 54  ? -5.994  24.180  -44.770 1.00 38.00  ? 54  PHE C CB  1 
ATOM   3656  C CG  . PHE C  1 54  ? -5.830  23.265  -43.598 1.00 32.96  ? 54  PHE C CG  1 
ATOM   3657  C CD1 . PHE C  1 54  ? -6.001  23.739  -42.309 1.00 32.27  ? 54  PHE C CD1 1 
ATOM   3658  C CD2 . PHE C  1 54  ? -5.435  21.948  -43.781 1.00 32.37  ? 54  PHE C CD2 1 
ATOM   3659  C CE1 . PHE C  1 54  ? -5.777  22.912  -41.211 1.00 32.88  ? 54  PHE C CE1 1 
ATOM   3660  C CE2 . PHE C  1 54  ? -5.207  21.114  -42.696 1.00 30.60  ? 54  PHE C CE2 1 
ATOM   3661  C CZ  . PHE C  1 54  ? -5.378  21.595  -41.410 1.00 32.49  ? 54  PHE C CZ  1 
ATOM   3662  N N   . GLU C  1 55  ? -2.579  24.187  -44.500 1.00 44.46  ? 55  GLU C N   1 
ATOM   3663  C CA  . GLU C  1 55  ? -1.364  23.406  -44.743 1.00 45.64  ? 55  GLU C CA  1 
ATOM   3664  C C   . GLU C  1 55  ? -1.653  21.908  -44.567 1.00 44.04  ? 55  GLU C C   1 
ATOM   3665  O O   . GLU C  1 55  ? -1.897  21.443  -43.454 1.00 44.24  ? 55  GLU C O   1 
ATOM   3666  C CB  . GLU C  1 55  ? -0.259  23.842  -43.761 1.00 48.63  ? 55  GLU C CB  1 
ATOM   3667  C CG  . GLU C  1 55  ? -0.098  25.359  -43.644 1.00 54.96  ? 55  GLU C CG  1 
ATOM   3668  C CD  . GLU C  1 55  ? 0.974   25.786  -42.643 1.00 60.60  ? 55  GLU C CD  1 
ATOM   3669  O OE1 . GLU C  1 55  ? 2.176   25.803  -43.010 1.00 63.37  ? 55  GLU C OE1 1 
ATOM   3670  O OE2 . GLU C  1 55  ? 0.614   26.103  -41.483 1.00 62.20  ? 55  GLU C OE2 1 
ATOM   3671  N N   . ALA C  1 56  ? -1.612  21.156  -45.660 1.00 42.18  ? 56  ALA C N   1 
ATOM   3672  C CA  . ALA C  1 56  ? -1.881  19.719  -45.612 1.00 41.79  ? 56  ALA C CA  1 
ATOM   3673  C C   . ALA C  1 56  ? -1.036  18.899  -44.628 1.00 43.71  ? 56  ALA C C   1 
ATOM   3674  O O   . ALA C  1 56  ? -1.554  17.947  -44.017 1.00 42.98  ? 56  ALA C O   1 
ATOM   3675  C CB  . ALA C  1 56  ? -1.753  19.123  -47.003 1.00 39.11  ? 56  ALA C CB  1 
ATOM   3676  N N   . GLN C  1 57  ? 0.252   19.239  -44.484 1.00 43.60  ? 57  GLN C N   1 
ATOM   3677  C CA  . GLN C  1 57  ? 1.133   18.501  -43.578 1.00 42.16  ? 57  GLN C CA  1 
ATOM   3678  C C   . GLN C  1 57  ? 0.644   18.579  -42.140 1.00 41.76  ? 57  GLN C C   1 
ATOM   3679  O O   . GLN C  1 57  ? 0.801   17.629  -41.374 1.00 39.92  ? 57  GLN C O   1 
ATOM   3680  C CB  . GLN C  1 57  ? 2.578   19.015  -43.674 1.00 45.86  ? 57  GLN C CB  1 
ATOM   3681  C CG  . GLN C  1 57  ? 3.355   18.442  -44.850 1.00 45.55  ? 57  GLN C CG  1 
ATOM   3682  C CD  . GLN C  1 57  ? 3.527   16.946  -44.746 1.00 45.33  ? 57  GLN C CD  1 
ATOM   3683  O OE1 . GLN C  1 57  ? 3.702   16.261  -45.750 1.00 44.51  ? 57  GLN C OE1 1 
ATOM   3684  N NE2 . GLN C  1 57  ? 3.488   16.428  -43.521 1.00 45.93  ? 57  GLN C NE2 1 
ATOM   3685  N N   . GLY C  1 58  ? 0.050   19.710  -41.776 1.00 41.56  ? 58  GLY C N   1 
ATOM   3686  C CA  . GLY C  1 58  ? -0.473  19.854  -40.429 1.00 43.41  ? 58  GLY C CA  1 
ATOM   3687  C C   . GLY C  1 58  ? -1.478  18.744  -40.147 1.00 44.56  ? 58  GLY C C   1 
ATOM   3688  O O   . GLY C  1 58  ? -1.444  18.098  -39.089 1.00 45.54  ? 58  GLY C O   1 
ATOM   3689  N N   . ALA C  1 59  ? -2.366  18.506  -41.110 1.00 43.62  ? 59  ALA C N   1 
ATOM   3690  C CA  . ALA C  1 59  ? -3.380  17.460  -40.983 1.00 43.86  ? 59  ALA C CA  1 
ATOM   3691  C C   . ALA C  1 59  ? -2.769  16.059  -40.938 1.00 42.51  ? 59  ALA C C   1 
ATOM   3692  O O   . ALA C  1 59  ? -3.265  15.184  -40.232 1.00 43.42  ? 59  ALA C O   1 
ATOM   3693  C CB  . ALA C  1 59  ? -4.381  17.551  -42.140 1.00 43.24  ? 59  ALA C CB  1 
ATOM   3694  N N   . LEU C  1 60  ? -1.707  15.834  -41.704 1.00 41.79  ? 60  LEU C N   1 
ATOM   3695  C CA  . LEU C  1 60  ? -1.071  14.521  -41.695 1.00 41.38  ? 60  LEU C CA  1 
ATOM   3696  C C   . LEU C  1 60  ? -0.466  14.263  -40.320 1.00 40.54  ? 60  LEU C C   1 
ATOM   3697  O O   . LEU C  1 60  ? -0.405  13.124  -39.856 1.00 39.31  ? 60  LEU C O   1 
ATOM   3698  C CB  . LEU C  1 60  ? 0.007   14.426  -42.775 1.00 40.78  ? 60  LEU C CB  1 
ATOM   3699  C CG  . LEU C  1 60  ? -0.522  14.443  -44.212 1.00 43.43  ? 60  LEU C CG  1 
ATOM   3700  C CD1 . LEU C  1 60  ? 0.571   13.989  -45.180 1.00 40.46  ? 60  LEU C CD1 1 
ATOM   3701  C CD2 . LEU C  1 60  ? -1.715  13.508  -44.319 1.00 42.41  ? 60  LEU C CD2 1 
ATOM   3702  N N   . ALA C  1 61  ? -0.029  15.330  -39.666 1.00 39.54  ? 61  ALA C N   1 
ATOM   3703  C CA  . ALA C  1 61  ? 0.549   15.200  -38.341 1.00 40.42  ? 61  ALA C CA  1 
ATOM   3704  C C   . ALA C  1 61  ? -0.558  14.766  -37.394 1.00 39.35  ? 61  ALA C C   1 
ATOM   3705  O O   . ALA C  1 61  ? -0.373  13.843  -36.610 1.00 40.44  ? 61  ALA C O   1 
ATOM   3706  C CB  . ALA C  1 61  ? 1.159   16.534  -37.886 1.00 39.66  ? 61  ALA C CB  1 
ATOM   3707  N N   . ASN C  1 62  ? -1.713  15.422  -37.476 1.00 41.13  ? 62  ASN C N   1 
ATOM   3708  C CA  . ASN C  1 62  ? -2.842  15.057  -36.626 1.00 40.65  ? 62  ASN C CA  1 
ATOM   3709  C C   . ASN C  1 62  ? -3.218  13.590  -36.829 1.00 40.53  ? 62  ASN C C   1 
ATOM   3710  O O   . ASN C  1 62  ? -3.470  12.871  -35.860 1.00 42.13  ? 62  ASN C O   1 
ATOM   3711  C CB  . ASN C  1 62  ? -4.040  15.959  -36.914 1.00 43.34  ? 62  ASN C CB  1 
ATOM   3712  C CG  . ASN C  1 62  ? -4.078  17.182  -36.015 1.00 46.92  ? 62  ASN C CG  1 
ATOM   3713  O OD1 . ASN C  1 62  ? -3.150  17.991  -36.006 1.00 47.81  ? 62  ASN C OD1 1 
ATOM   3714  N ND2 . ASN C  1 62  ? -5.159  17.318  -35.241 1.00 50.16  ? 62  ASN C ND2 1 
ATOM   3715  N N   . ILE C  1 63  ? -3.245  13.147  -38.084 1.00 38.53  ? 63  ILE C N   1 
ATOM   3716  C CA  . ILE C  1 63  ? -3.569  11.760  -38.404 1.00 37.45  ? 63  ILE C CA  1 
ATOM   3717  C C   . ILE C  1 63  ? -2.576  10.805  -37.737 1.00 37.50  ? 63  ILE C C   1 
ATOM   3718  O O   . ILE C  1 63  ? -2.954  9.743   -37.234 1.00 36.32  ? 63  ILE C O   1 
ATOM   3719  C CB  . ILE C  1 63  ? -3.507  11.495  -39.924 1.00 38.61  ? 63  ILE C CB  1 
ATOM   3720  C CG1 . ILE C  1 63  ? -4.501  12.391  -40.670 1.00 39.54  ? 63  ILE C CG1 1 
ATOM   3721  C CG2 . ILE C  1 63  ? -3.807  10.028  -40.206 1.00 37.24  ? 63  ILE C CG2 1 
ATOM   3722  C CD1 . ILE C  1 63  ? -5.946  12.099  -40.374 1.00 41.40  ? 63  ILE C CD1 1 
ATOM   3723  N N   . ALA C  1 64  ? -1.300  11.181  -37.761 1.00 37.35  ? 64  ALA C N   1 
ATOM   3724  C CA  . ALA C  1 64  ? -0.240  10.382  -37.163 1.00 36.70  ? 64  ALA C CA  1 
ATOM   3725  C C   . ALA C  1 64  ? -0.527  10.223  -35.680 1.00 37.32  ? 64  ALA C C   1 
ATOM   3726  O O   . ALA C  1 64  ? -0.323  9.150   -35.099 1.00 37.03  ? 64  ALA C O   1 
ATOM   3727  C CB  . ALA C  1 64  ? 1.109   11.064  -37.369 1.00 37.96  ? 64  ALA C CB  1 
ATOM   3728  N N   . VAL C  1 65  ? -1.003  11.299  -35.066 1.00 36.98  ? 65  VAL C N   1 
ATOM   3729  C CA  . VAL C  1 65  ? -1.339  11.256  -33.654 1.00 36.55  ? 65  VAL C CA  1 
ATOM   3730  C C   . VAL C  1 65  ? -2.458  10.254  -33.409 1.00 38.01  ? 65  VAL C C   1 
ATOM   3731  O O   . VAL C  1 65  ? -2.415  9.490   -32.438 1.00 38.57  ? 65  VAL C O   1 
ATOM   3732  C CB  . VAL C  1 65  ? -1.794  12.609  -33.159 1.00 35.95  ? 65  VAL C CB  1 
ATOM   3733  C CG1 . VAL C  1 65  ? -2.412  12.465  -31.773 1.00 36.38  ? 65  VAL C CG1 1 
ATOM   3734  C CG2 . VAL C  1 65  ? -0.615  13.563  -33.131 1.00 34.63  ? 65  VAL C CG2 1 
ATOM   3735  N N   . ASN C  1 66  ? -3.462  10.265  -34.285 1.00 36.35  ? 66  ASN C N   1 
ATOM   3736  C CA  . ASN C  1 66  ? -4.583  9.340   -34.167 1.00 38.12  ? 66  ASN C CA  1 
ATOM   3737  C C   . ASN C  1 66  ? -4.108  7.903   -34.361 1.00 37.54  ? 66  ASN C C   1 
ATOM   3738  O O   . ASN C  1 66  ? -4.654  6.974   -33.761 1.00 36.98  ? 66  ASN C O   1 
ATOM   3739  C CB  . ASN C  1 66  ? -5.655  9.651   -35.216 1.00 40.99  ? 66  ASN C CB  1 
ATOM   3740  C CG  . ASN C  1 66  ? -6.321  10.993  -34.996 1.00 44.89  ? 66  ASN C CG  1 
ATOM   3741  O OD1 . ASN C  1 66  ? -6.593  11.718  -35.952 1.00 51.27  ? 66  ASN C OD1 1 
ATOM   3742  N ND2 . ASN C  1 66  ? -6.595  11.330  -33.740 1.00 44.92  ? 66  ASN C ND2 1 
ATOM   3743  N N   . LYS C  1 67  ? -3.090  7.725   -35.199 1.00 36.04  ? 67  LYS C N   1 
ATOM   3744  C CA  . LYS C  1 67  ? -2.541  6.403   -35.481 1.00 36.77  ? 67  LYS C CA  1 
ATOM   3745  C C   . LYS C  1 67  ? -1.879  5.822   -34.232 1.00 36.45  ? 67  LYS C C   1 
ATOM   3746  O O   . LYS C  1 67  ? -2.089  4.663   -33.880 1.00 33.89  ? 67  LYS C O   1 
ATOM   3747  C CB  . LYS C  1 67  ? -1.535  6.497   -36.630 1.00 38.91  ? 67  LYS C CB  1 
ATOM   3748  C CG  . LYS C  1 67  ? -0.994  5.152   -37.102 1.00 44.09  ? 67  LYS C CG  1 
ATOM   3749  C CD  . LYS C  1 67  ? -0.112  5.320   -38.341 1.00 47.91  ? 67  LYS C CD  1 
ATOM   3750  C CE  . LYS C  1 67  ? 0.485   3.989   -38.789 1.00 48.98  ? 67  LYS C CE  1 
ATOM   3751  N NZ  . LYS C  1 67  ? 1.391   3.394   -37.759 1.00 51.00  ? 67  LYS C NZ  1 
ATOM   3752  N N   . ALA C  1 68  ? -1.080  6.641   -33.557 1.00 37.50  ? 68  ALA C N   1 
ATOM   3753  C CA  . ALA C  1 68  ? -0.417  6.207   -32.335 1.00 35.44  ? 68  ALA C CA  1 
ATOM   3754  C C   . ALA C  1 68  ? -1.475  5.987   -31.252 1.00 34.51  ? 68  ALA C C   1 
ATOM   3755  O O   . ALA C  1 68  ? -1.442  4.984   -30.548 1.00 34.48  ? 68  ALA C O   1 
ATOM   3756  C CB  . ALA C  1 68  ? 0.604   7.245   -31.889 1.00 32.61  ? 68  ALA C CB  1 
ATOM   3757  N N   . ASN C  1 69  ? -2.421  6.911   -31.118 1.00 33.35  ? 69  ASN C N   1 
ATOM   3758  C CA  . ASN C  1 69  ? -3.463  6.736   -30.114 1.00 33.60  ? 69  ASN C CA  1 
ATOM   3759  C C   . ASN C  1 69  ? -4.287  5.475   -30.381 1.00 35.22  ? 69  ASN C C   1 
ATOM   3760  O O   . ASN C  1 69  ? -4.742  4.811   -29.440 1.00 37.33  ? 69  ASN C O   1 
ATOM   3761  C CB  . ASN C  1 69  ? -4.389  7.945   -30.065 1.00 32.66  ? 69  ASN C CB  1 
ATOM   3762  C CG  . ASN C  1 69  ? -3.725  9.167   -29.466 1.00 33.55  ? 69  ASN C CG  1 
ATOM   3763  O OD1 . ASN C  1 69  ? -2.728  9.066   -28.757 1.00 34.18  ? 69  ASN C OD1 1 
ATOM   3764  N ND2 . ASN C  1 69  ? -4.293  10.334  -29.734 1.00 33.77  ? 69  ASN C ND2 1 
ATOM   3765  N N   . LEU C  1 70  ? -4.489  5.139   -31.652 1.00 32.50  ? 70  LEU C N   1 
ATOM   3766  C CA  . LEU C  1 70  ? -5.241  3.941   -31.953 1.00 32.21  ? 70  LEU C CA  1 
ATOM   3767  C C   . LEU C  1 70  ? -4.533  2.726   -31.367 1.00 33.72  ? 70  LEU C C   1 
ATOM   3768  O O   . LEU C  1 70  ? -5.174  1.841   -30.794 1.00 34.00  ? 70  LEU C O   1 
ATOM   3769  C CB  . LEU C  1 70  ? -5.414  3.744   -33.461 1.00 30.47  ? 70  LEU C CB  1 
ATOM   3770  C CG  . LEU C  1 70  ? -6.238  2.486   -33.787 1.00 28.39  ? 70  LEU C CG  1 
ATOM   3771  C CD1 . LEU C  1 70  ? -7.563  2.591   -33.063 1.00 24.14  ? 70  LEU C CD1 1 
ATOM   3772  C CD2 . LEU C  1 70  ? -6.476  2.338   -35.286 1.00 27.73  ? 70  LEU C CD2 1 
ATOM   3773  N N   . ASP C  1 71  ? -3.212  2.665   -31.508 1.00 35.92  ? 71  ASP C N   1 
ATOM   3774  C CA  . ASP C  1 71  ? -2.504  1.519   -30.960 1.00 37.23  ? 71  ASP C CA  1 
ATOM   3775  C C   . ASP C  1 71  ? -2.745  1.445   -29.463 1.00 37.91  ? 71  ASP C C   1 
ATOM   3776  O O   . ASP C  1 71  ? -3.023  0.370   -28.931 1.00 38.75  ? 71  ASP C O   1 
ATOM   3777  C CB  . ASP C  1 71  ? -1.006  1.583   -31.256 1.00 38.94  ? 71  ASP C CB  1 
ATOM   3778  C CG  . ASP C  1 71  ? -0.676  1.159   -32.680 1.00 42.84  ? 71  ASP C CG  1 
ATOM   3779  O OD1 . ASP C  1 71  ? -1.388  0.287   -33.241 1.00 42.76  ? 71  ASP C OD1 1 
ATOM   3780  O OD2 . ASP C  1 71  ? 0.305   1.687   -33.237 1.00 43.61  ? 71  ASP C OD2 1 
ATOM   3781  N N   . VAL C  1 72  ? -2.674  2.586   -28.785 1.00 36.68  ? 72  VAL C N   1 
ATOM   3782  C CA  . VAL C  1 72  ? -2.900  2.600   -27.350 1.00 38.15  ? 72  VAL C CA  1 
ATOM   3783  C C   . VAL C  1 72  ? -4.307  2.122   -27.003 1.00 39.29  ? 72  VAL C C   1 
ATOM   3784  O O   . VAL C  1 72  ? -4.492  1.334   -26.078 1.00 39.30  ? 72  VAL C O   1 
ATOM   3785  C CB  . VAL C  1 72  ? -2.688  4.002   -26.761 1.00 39.07  ? 72  VAL C CB  1 
ATOM   3786  C CG1 . VAL C  1 72  ? -3.135  4.021   -25.304 1.00 38.79  ? 72  VAL C CG1 1 
ATOM   3787  C CG2 . VAL C  1 72  ? -1.219  4.391   -26.866 1.00 37.89  ? 72  VAL C CG2 1 
ATOM   3788  N N   . MET C  1 73  ? -5.302  2.595   -27.748 1.00 39.67  ? 73  MET C N   1 
ATOM   3789  C CA  . MET C  1 73  ? -6.677  2.190   -27.493 1.00 39.06  ? 73  MET C CA  1 
ATOM   3790  C C   . MET C  1 73  ? -6.848  0.687   -27.660 1.00 39.46  ? 73  MET C C   1 
ATOM   3791  O O   . MET C  1 73  ? -7.579  0.052   -26.905 1.00 40.09  ? 73  MET C O   1 
ATOM   3792  C CB  . MET C  1 73  ? -7.636  2.926   -28.427 1.00 37.88  ? 73  MET C CB  1 
ATOM   3793  C CG  . MET C  1 73  ? -7.655  4.430   -28.205 1.00 38.41  ? 73  MET C CG  1 
ATOM   3794  S SD  . MET C  1 73  ? -7.807  4.837   -26.457 1.00 38.91  ? 73  MET C SD  1 
ATOM   3795  C CE  . MET C  1 73  ? -9.566  4.831   -26.254 1.00 38.03  ? 73  MET C CE  1 
ATOM   3796  N N   . LYS C  1 74  ? -6.183  0.101   -28.642 1.00 40.03  ? 74  LYS C N   1 
ATOM   3797  C CA  . LYS C  1 74  ? -6.325  -1.335  -28.818 1.00 42.89  ? 74  LYS C CA  1 
ATOM   3798  C C   . LYS C  1 74  ? -5.788  -2.075  -27.595 1.00 44.29  ? 74  LYS C C   1 
ATOM   3799  O O   . LYS C  1 74  ? -6.450  -2.986  -27.087 1.00 45.03  ? 74  LYS C O   1 
ATOM   3800  C CB  . LYS C  1 74  ? -5.596  -1.809  -30.075 1.00 41.80  ? 74  LYS C CB  1 
ATOM   3801  C CG  . LYS C  1 74  ? -6.210  -1.297  -31.359 1.00 41.75  ? 74  LYS C CG  1 
ATOM   3802  C CD  . LYS C  1 74  ? -5.541  -1.900  -32.578 1.00 45.98  ? 74  LYS C CD  1 
ATOM   3803  C CE  . LYS C  1 74  ? -5.695  -3.413  -32.631 1.00 46.96  ? 74  LYS C CE  1 
ATOM   3804  N NZ  . LYS C  1 74  ? -5.108  -3.952  -33.883 1.00 48.73  ? 74  LYS C NZ  1 
ATOM   3805  N N   . GLU C  1 75  ? -4.605  -1.681  -27.119 1.00 44.79  ? 75  GLU C N   1 
ATOM   3806  C CA  . GLU C  1 75  ? -3.999  -2.329  -25.961 1.00 46.12  ? 75  GLU C CA  1 
ATOM   3807  C C   . GLU C  1 75  ? -4.904  -2.152  -24.753 1.00 44.68  ? 75  GLU C C   1 
ATOM   3808  O O   . GLU C  1 75  ? -5.070  -3.076  -23.963 1.00 42.34  ? 75  GLU C O   1 
ATOM   3809  C CB  . GLU C  1 75  ? -2.626  -1.723  -25.641 1.00 50.52  ? 75  GLU C CB  1 
ATOM   3810  C CG  . GLU C  1 75  ? -1.578  -1.816  -26.752 1.00 58.22  ? 75  GLU C CG  1 
ATOM   3811  C CD  . GLU C  1 75  ? -1.202  -3.255  -27.120 1.00 64.13  ? 75  GLU C CD  1 
ATOM   3812  O OE1 . GLU C  1 75  ? -1.555  -4.181  -26.354 1.00 65.22  ? 75  GLU C OE1 1 
ATOM   3813  O OE2 . GLU C  1 75  ? -0.542  -3.438  -28.168 1.00 66.38  ? 75  GLU C OE2 1 
ATOM   3814  N N   . ARG C  1 76  ? -5.493  -0.961  -24.633 1.00 43.32  ? 76  ARG C N   1 
ATOM   3815  C CA  . ARG C  1 76  ? -6.372  -0.625  -23.516 1.00 42.81  ? 76  ARG C CA  1 
ATOM   3816  C C   . ARG C  1 76  ? -7.703  -1.383  -23.486 1.00 43.58  ? 76  ARG C C   1 
ATOM   3817  O O   . ARG C  1 76  ? -8.343  -1.458  -22.434 1.00 44.53  ? 76  ARG C O   1 
ATOM   3818  C CB  . ARG C  1 76  ? -6.651  0.890   -23.492 1.00 41.00  ? 76  ARG C CB  1 
ATOM   3819  C CG  . ARG C  1 76  ? -7.132  1.406   -22.132 1.00 39.53  ? 76  ARG C CG  1 
ATOM   3820  C CD  . ARG C  1 76  ? -7.492  2.899   -22.105 1.00 38.72  ? 76  ARG C CD  1 
ATOM   3821  N NE  . ARG C  1 76  ? -6.404  3.788   -22.490 1.00 35.47  ? 76  ARG C NE  1 
ATOM   3822  C CZ  . ARG C  1 76  ? -6.567  5.086   -22.736 1.00 38.15  ? 76  ARG C CZ  1 
ATOM   3823  N NH1 . ARG C  1 76  ? -7.771  5.638   -22.629 1.00 37.46  ? 76  ARG C NH1 1 
ATOM   3824  N NH2 . ARG C  1 76  ? -5.539  5.832   -23.118 1.00 37.00  ? 76  ARG C NH2 1 
ATOM   3825  N N   . SER C  1 77  ? -8.123  -1.947  -24.614 1.00 43.31  ? 77  SER C N   1 
ATOM   3826  C CA  . SER C  1 77  ? -9.391  -2.671  -24.648 1.00 45.87  ? 77  SER C CA  1 
ATOM   3827  C C   . SER C  1 77  ? -9.162  -4.138  -24.950 1.00 48.70  ? 77  SER C C   1 
ATOM   3828  O O   . SER C  1 77  ? -10.105 -4.879  -25.229 1.00 48.67  ? 77  SER C O   1 
ATOM   3829  C CB  . SER C  1 77  ? -10.316 -2.077  -25.708 1.00 43.05  ? 77  SER C CB  1 
ATOM   3830  O OG  . SER C  1 77  ? -9.782  -2.299  -26.999 1.00 43.17  ? 77  SER C OG  1 
ATOM   3831  N N   . ASN C  1 78  ? -7.900  -4.547  -24.896 1.00 53.23  ? 78  ASN C N   1 
ATOM   3832  C CA  . ASN C  1 78  ? -7.520  -5.930  -25.160 1.00 57.99  ? 78  ASN C CA  1 
ATOM   3833  C C   . ASN C  1 78  ? -8.009  -6.366  -26.541 1.00 59.24  ? 78  ASN C C   1 
ATOM   3834  O O   . ASN C  1 78  ? -8.580  -7.448  -26.695 1.00 60.03  ? 78  ASN C O   1 
ATOM   3835  C CB  . ASN C  1 78  ? -8.101  -6.857  -24.080 1.00 63.02  ? 78  ASN C CB  1 
ATOM   3836  C CG  . ASN C  1 78  ? -7.460  -8.234  -24.086 1.00 68.66  ? 78  ASN C CG  1 
ATOM   3837  O OD1 . ASN C  1 78  ? -6.233  -8.346  -24.047 1.00 70.24  ? 78  ASN C OD1 1 
ATOM   3838  N ND2 . ASN C  1 78  ? -8.277  -9.283  -24.131 1.00 74.05  ? 78  ASN C ND2 1 
ATOM   3839  N N   . ASN C  1 79  ? -7.783  -5.513  -27.537 1.00 59.37  ? 79  ASN C N   1 
ATOM   3840  C CA  . ASN C  1 79  ? -8.185  -5.788  -28.914 1.00 59.44  ? 79  ASN C CA  1 
ATOM   3841  C C   . ASN C  1 79  ? -9.598  -6.338  -29.025 1.00 58.89  ? 79  ASN C C   1 
ATOM   3842  O O   . ASN C  1 79  ? -9.861  -7.237  -29.823 1.00 57.22  ? 79  ASN C O   1 
ATOM   3843  C CB  . ASN C  1 79  ? -7.208  -6.767  -29.571 1.00 62.08  ? 79  ASN C CB  1 
ATOM   3844  C CG  . ASN C  1 79  ? -5.786  -6.234  -29.607 1.00 66.16  ? 79  ASN C CG  1 
ATOM   3845  O OD1 . ASN C  1 79  ? -5.497  -5.238  -30.275 1.00 67.92  ? 79  ASN C OD1 1 
ATOM   3846  N ND2 . ASN C  1 79  ? -4.892  -6.892  -28.878 1.00 66.55  ? 79  ASN C ND2 1 
ATOM   3847  N N   . THR C  1 80  ? -10.504 -5.805  -28.217 1.00 59.01  ? 80  THR C N   1 
ATOM   3848  C CA  . THR C  1 80  ? -11.888 -6.248  -28.265 1.00 59.94  ? 80  THR C CA  1 
ATOM   3849  C C   . THR C  1 80  ? -12.606 -5.400  -29.308 1.00 60.45  ? 80  THR C C   1 
ATOM   3850  O O   . THR C  1 80  ? -12.674 -4.174  -29.192 1.00 61.05  ? 80  THR C O   1 
ATOM   3851  C CB  . THR C  1 80  ? -12.567 -6.100  -26.892 1.00 59.55  ? 80  THR C CB  1 
ATOM   3852  O OG1 . THR C  1 80  ? -11.941 -6.992  -25.963 1.00 59.15  ? 80  THR C OG1 1 
ATOM   3853  C CG2 . THR C  1 80  ? -14.044 -6.439  -26.982 1.00 59.27  ? 80  THR C CG2 1 
ATOM   3854  N N   . PRO C  1 81  ? -13.127 -6.043  -30.360 1.00 60.21  ? 81  PRO C N   1 
ATOM   3855  C CA  . PRO C  1 81  ? -13.826 -5.300  -31.407 1.00 60.88  ? 81  PRO C CA  1 
ATOM   3856  C C   . PRO C  1 81  ? -15.315 -5.127  -31.136 1.00 60.14  ? 81  PRO C C   1 
ATOM   3857  O O   . PRO C  1 81  ? -15.855 -5.680  -30.177 1.00 60.94  ? 81  PRO C O   1 
ATOM   3858  C CB  . PRO C  1 81  ? -13.569 -6.151  -32.646 1.00 60.90  ? 81  PRO C CB  1 
ATOM   3859  C CG  . PRO C  1 81  ? -13.681 -7.537  -32.085 1.00 61.74  ? 81  PRO C CG  1 
ATOM   3860  C CD  . PRO C  1 81  ? -12.894 -7.438  -30.778 1.00 61.32  ? 81  PRO C CD  1 
ATOM   3861  N N   . ASP C  1 82  ? -15.963 -4.345  -31.990 1.00 58.10  ? 82  ASP C N   1 
ATOM   3862  C CA  . ASP C  1 82  ? -17.389 -4.116  -31.883 1.00 56.40  ? 82  ASP C CA  1 
ATOM   3863  C C   . ASP C  1 82  ? -18.047 -4.660  -33.141 1.00 55.45  ? 82  ASP C C   1 
ATOM   3864  O O   . ASP C  1 82  ? -17.365 -5.133  -34.053 1.00 55.97  ? 82  ASP C O   1 
ATOM   3865  C CB  . ASP C  1 82  ? -17.693 -2.622  -31.720 1.00 57.00  ? 82  ASP C CB  1 
ATOM   3866  C CG  . ASP C  1 82  ? -17.423 -2.125  -30.305 1.00 58.10  ? 82  ASP C CG  1 
ATOM   3867  O OD1 . ASP C  1 82  ? -17.196 -2.983  -29.426 1.00 56.59  ? 82  ASP C OD1 1 
ATOM   3868  O OD2 . ASP C  1 82  ? -17.449 -0.890  -30.066 1.00 57.14  ? 82  ASP C OD2 1 
ATOM   3869  N N   . ALA C  1 83  ? -19.373 -4.613  -33.184 1.00 53.49  ? 83  ALA C N   1 
ATOM   3870  C CA  . ALA C  1 83  ? -20.108 -5.103  -34.338 1.00 51.15  ? 83  ALA C CA  1 
ATOM   3871  C C   . ALA C  1 83  ? -20.135 -4.050  -35.436 1.00 49.78  ? 83  ALA C C   1 
ATOM   3872  O O   . ALA C  1 83  ? -20.234 -2.859  -35.160 1.00 50.30  ? 83  ALA C O   1 
ATOM   3873  C CB  . ALA C  1 83  ? -21.521 -5.452  -33.934 1.00 51.21  ? 83  ALA C CB  1 
ATOM   3874  N N   . ASN C  1 84  ? -20.031 -4.496  -36.679 1.00 48.64  ? 84  ASN C N   1 
ATOM   3875  C CA  . ASN C  1 84  ? -20.083 -3.596  -37.824 1.00 47.29  ? 84  ASN C CA  1 
ATOM   3876  C C   . ASN C  1 84  ? -21.511 -3.059  -37.900 1.00 46.88  ? 84  ASN C C   1 
ATOM   3877  O O   . ASN C  1 84  ? -22.460 -3.765  -37.549 1.00 48.19  ? 84  ASN C O   1 
ATOM   3878  C CB  . ASN C  1 84  ? -19.745 -4.366  -39.106 1.00 47.55  ? 84  ASN C CB  1 
ATOM   3879  C CG  . ASN C  1 84  ? -18.323 -4.900  -39.108 1.00 49.30  ? 84  ASN C CG  1 
ATOM   3880  O OD1 . ASN C  1 84  ? -17.368 -4.158  -39.345 1.00 50.81  ? 84  ASN C OD1 1 
ATOM   3881  N ND2 . ASN C  1 84  ? -18.174 -6.187  -38.829 1.00 48.18  ? 84  ASN C ND2 1 
ATOM   3882  N N   . VAL C  1 85  ? -21.670 -1.811  -38.325 1.00 44.42  ? 85  VAL C N   1 
ATOM   3883  C CA  . VAL C  1 85  ? -23.001 -1.234  -38.436 1.00 42.41  ? 85  VAL C CA  1 
ATOM   3884  C C   . VAL C  1 85  ? -23.304 -0.954  -39.902 1.00 43.19  ? 85  VAL C C   1 
ATOM   3885  O O   . VAL C  1 85  ? -22.712 -0.066  -40.519 1.00 43.52  ? 85  VAL C O   1 
ATOM   3886  C CB  . VAL C  1 85  ? -23.128 0.057   -37.618 1.00 40.15  ? 85  VAL C CB  1 
ATOM   3887  C CG1 . VAL C  1 85  ? -24.548 0.603   -37.721 1.00 40.85  ? 85  VAL C CG1 1 
ATOM   3888  C CG2 . VAL C  1 85  ? -22.794 -0.222  -36.169 1.00 39.10  ? 85  VAL C CG2 1 
ATOM   3889  N N   . ALA C  1 86  ? -24.220 -1.746  -40.453 1.00 42.91  ? 86  ALA C N   1 
ATOM   3890  C CA  . ALA C  1 86  ? -24.627 -1.635  -41.847 1.00 40.75  ? 86  ALA C CA  1 
ATOM   3891  C C   . ALA C  1 86  ? -25.301 -0.308  -42.111 1.00 38.94  ? 86  ALA C C   1 
ATOM   3892  O O   . ALA C  1 86  ? -25.967 0.235   -41.237 1.00 38.90  ? 86  ALA C O   1 
ATOM   3893  C CB  . ALA C  1 86  ? -25.576 -2.776  -42.204 1.00 41.26  ? 86  ALA C CB  1 
ATOM   3894  N N   . PRO C  1 87  ? -25.148 0.225   -43.339 1.00 38.86  ? 87  PRO C N   1 
ATOM   3895  C CA  . PRO C  1 87  ? -25.737 1.507   -43.753 1.00 37.00  ? 87  PRO C CA  1 
ATOM   3896  C C   . PRO C  1 87  ? -27.116 1.429   -44.398 1.00 38.56  ? 87  PRO C C   1 
ATOM   3897  O O   . PRO C  1 87  ? -27.501 0.385   -44.921 1.00 36.20  ? 87  PRO C O   1 
ATOM   3898  C CB  . PRO C  1 87  ? -24.731 2.020   -44.761 1.00 34.37  ? 87  PRO C CB  1 
ATOM   3899  C CG  . PRO C  1 87  ? -24.363 0.775   -45.475 1.00 34.45  ? 87  PRO C CG  1 
ATOM   3900  C CD  . PRO C  1 87  ? -24.150 -0.218  -44.330 1.00 35.23  ? 87  PRO C CD  1 
ATOM   3901  N N   . GLU C  1 88  ? -27.843 2.548   -44.339 1.00 40.57  ? 88  GLU C N   1 
ATOM   3902  C CA  . GLU C  1 88  ? -29.138 2.707   -44.996 1.00 42.02  ? 88  GLU C CA  1 
ATOM   3903  C C   . GLU C  1 88  ? -28.705 3.344   -46.312 1.00 41.37  ? 88  GLU C C   1 
ATOM   3904  O O   . GLU C  1 88  ? -27.734 4.108   -46.335 1.00 38.75  ? 88  GLU C O   1 
ATOM   3905  C CB  . GLU C  1 88  ? -30.020 3.720   -44.274 1.00 46.23  ? 88  GLU C CB  1 
ATOM   3906  C CG  . GLU C  1 88  ? -30.789 3.207   -43.087 1.00 54.59  ? 88  GLU C CG  1 
ATOM   3907  C CD  . GLU C  1 88  ? -31.385 4.343   -42.268 1.00 59.62  ? 88  GLU C CD  1 
ATOM   3908  O OE1 . GLU C  1 88  ? -31.859 5.337   -42.870 1.00 62.14  ? 88  GLU C OE1 1 
ATOM   3909  O OE2 . GLU C  1 88  ? -31.388 4.237   -41.022 1.00 63.35  ? 88  GLU C OE2 1 
ATOM   3910  N N   . VAL C  1 89  ? -29.411 3.045   -47.398 1.00 41.42  ? 89  VAL C N   1 
ATOM   3911  C CA  . VAL C  1 89  ? -29.067 3.607   -48.696 1.00 40.49  ? 89  VAL C CA  1 
ATOM   3912  C C   . VAL C  1 89  ? -30.265 4.266   -49.381 1.00 42.38  ? 89  VAL C C   1 
ATOM   3913  O O   . VAL C  1 89  ? -31.377 3.739   -49.361 1.00 42.82  ? 89  VAL C O   1 
ATOM   3914  C CB  . VAL C  1 89  ? -28.495 2.533   -49.633 1.00 38.28  ? 89  VAL C CB  1 
ATOM   3915  C CG1 . VAL C  1 89  ? -27.955 3.193   -50.890 1.00 38.17  ? 89  VAL C CG1 1 
ATOM   3916  C CG2 . VAL C  1 89  ? -27.384 1.759   -48.931 1.00 37.97  ? 89  VAL C CG2 1 
ATOM   3917  N N   . THR C  1 90  ? -30.032 5.428   -49.980 1.00 43.07  ? 90  THR C N   1 
ATOM   3918  C CA  . THR C  1 90  ? -31.085 6.146   -50.680 1.00 43.66  ? 90  THR C CA  1 
ATOM   3919  C C   . THR C  1 90  ? -30.569 6.821   -51.953 1.00 43.51  ? 90  THR C C   1 
ATOM   3920  O O   . THR C  1 90  ? -29.541 7.497   -51.940 1.00 41.23  ? 90  THR C O   1 
ATOM   3921  C CB  . THR C  1 90  ? -31.720 7.205   -49.783 1.00 44.73  ? 90  THR C CB  1 
ATOM   3922  O OG1 . THR C  1 90  ? -32.241 6.578   -48.609 1.00 50.13  ? 90  THR C OG1 1 
ATOM   3923  C CG2 . THR C  1 90  ? -32.859 7.892   -50.505 1.00 47.13  ? 90  THR C CG2 1 
ATOM   3924  N N   . VAL C  1 91  ? -31.295 6.614   -53.050 1.00 43.72  ? 91  VAL C N   1 
ATOM   3925  C CA  . VAL C  1 91  ? -30.957 7.183   -54.350 1.00 42.36  ? 91  VAL C CA  1 
ATOM   3926  C C   . VAL C  1 91  ? -32.027 8.198   -54.751 1.00 41.38  ? 91  VAL C C   1 
ATOM   3927  O O   . VAL C  1 91  ? -33.212 7.887   -54.749 1.00 41.09  ? 91  VAL C O   1 
ATOM   3928  C CB  . VAL C  1 91  ? -30.883 6.078   -55.427 1.00 43.48  ? 91  VAL C CB  1 
ATOM   3929  C CG1 . VAL C  1 91  ? -30.478 6.670   -56.769 1.00 41.38  ? 91  VAL C CG1 1 
ATOM   3930  C CG2 . VAL C  1 91  ? -29.893 5.002   -54.997 1.00 43.63  ? 91  VAL C CG2 1 
ATOM   3931  N N   . LEU C  1 92  ? -31.607 9.415   -55.075 1.00 41.19  ? 92  LEU C N   1 
ATOM   3932  C CA  . LEU C  1 92  ? -32.538 10.461  -55.486 1.00 42.26  ? 92  LEU C CA  1 
ATOM   3933  C C   . LEU C  1 92  ? -31.859 11.412  -56.471 1.00 43.16  ? 92  LEU C C   1 
ATOM   3934  O O   . LEU C  1 92  ? -30.636 11.388  -56.620 1.00 43.87  ? 92  LEU C O   1 
ATOM   3935  C CB  . LEU C  1 92  ? -33.026 11.256  -54.275 1.00 42.04  ? 92  LEU C CB  1 
ATOM   3936  C CG  . LEU C  1 92  ? -32.021 12.213  -53.627 1.00 44.30  ? 92  LEU C CG  1 
ATOM   3937  C CD1 . LEU C  1 92  ? -32.753 13.148  -52.678 1.00 45.58  ? 92  LEU C CD1 1 
ATOM   3938  C CD2 . LEU C  1 92  ? -30.936 11.434  -52.901 1.00 44.15  ? 92  LEU C CD2 1 
ATOM   3939  N N   . SER C  1 93  ? -32.640 12.254  -57.141 1.00 43.13  ? 93  SER C N   1 
ATOM   3940  C CA  . SER C  1 93  ? -32.051 13.181  -58.092 1.00 43.96  ? 93  SER C CA  1 
ATOM   3941  C C   . SER C  1 93  ? -31.695 14.455  -57.367 1.00 43.86  ? 93  SER C C   1 
ATOM   3942  O O   . SER C  1 93  ? -32.329 14.820  -56.380 1.00 44.96  ? 93  SER C O   1 
ATOM   3943  C CB  . SER C  1 93  ? -33.000 13.476  -59.265 1.00 44.36  ? 93  SER C CB  1 
ATOM   3944  O OG  . SER C  1 93  ? -34.150 14.185  -58.854 1.00 43.97  ? 93  SER C OG  1 
ATOM   3945  N N   . ARG C  1 94  ? -30.658 15.117  -57.856 1.00 45.37  ? 94  ARG C N   1 
ATOM   3946  C CA  . ARG C  1 94  ? -30.171 16.347  -57.262 1.00 46.25  ? 94  ARG C CA  1 
ATOM   3947  C C   . ARG C  1 94  ? -31.182 17.470  -57.411 1.00 45.65  ? 94  ARG C C   1 
ATOM   3948  O O   . ARG C  1 94  ? -31.270 18.353  -56.554 1.00 45.06  ? 94  ARG C O   1 
ATOM   3949  C CB  . ARG C  1 94  ? -28.840 16.728  -57.918 1.00 49.65  ? 94  ARG C CB  1 
ATOM   3950  C CG  . ARG C  1 94  ? -28.202 18.000  -57.401 1.00 53.41  ? 94  ARG C CG  1 
ATOM   3951  C CD  . ARG C  1 94  ? -26.838 18.180  -58.018 1.00 57.51  ? 94  ARG C CD  1 
ATOM   3952  N NE  . ARG C  1 94  ? -26.172 19.370  -57.513 1.00 63.70  ? 94  ARG C NE  1 
ATOM   3953  C CZ  . ARG C  1 94  ? -26.602 20.609  -57.727 1.00 67.57  ? 94  ARG C CZ  1 
ATOM   3954  N NH1 . ARG C  1 94  ? -27.702 20.815  -58.443 1.00 68.79  ? 94  ARG C NH1 1 
ATOM   3955  N NH2 . ARG C  1 94  ? -25.933 21.643  -57.225 1.00 68.56  ? 94  ARG C NH2 1 
ATOM   3956  N N   . SER C  1 95  ? -31.937 17.441  -58.505 1.00 45.68  ? 95  SER C N   1 
ATOM   3957  C CA  . SER C  1 95  ? -32.952 18.467  -58.762 1.00 47.21  ? 95  SER C CA  1 
ATOM   3958  C C   . SER C  1 95  ? -34.067 17.853  -59.604 1.00 45.91  ? 95  SER C C   1 
ATOM   3959  O O   . SER C  1 95  ? -33.964 16.699  -60.016 1.00 46.68  ? 95  SER C O   1 
ATOM   3960  C CB  . SER C  1 95  ? -32.327 19.674  -59.476 1.00 46.50  ? 95  SER C CB  1 
ATOM   3961  O OG  . SER C  1 95  ? -31.893 19.335  -60.775 1.00 50.18  ? 95  SER C OG  1 
ATOM   3962  N N   . PRO C  1 96  ? -35.149 18.607  -59.861 1.00 45.71  ? 96  PRO C N   1 
ATOM   3963  C CA  . PRO C  1 96  ? -36.249 18.059  -60.661 1.00 45.84  ? 96  PRO C CA  1 
ATOM   3964  C C   . PRO C  1 96  ? -35.736 17.453  -61.955 1.00 46.69  ? 96  PRO C C   1 
ATOM   3965  O O   . PRO C  1 96  ? -34.856 18.010  -62.603 1.00 46.50  ? 96  PRO C O   1 
ATOM   3966  C CB  . PRO C  1 96  ? -37.138 19.272  -60.900 1.00 44.50  ? 96  PRO C CB  1 
ATOM   3967  C CG  . PRO C  1 96  ? -36.911 20.095  -59.676 1.00 44.90  ? 96  PRO C CG  1 
ATOM   3968  C CD  . PRO C  1 96  ? -35.408 20.018  -59.528 1.00 45.13  ? 96  PRO C CD  1 
ATOM   3969  N N   . VAL C  1 97  ? -36.297 16.309  -62.325 1.00 48.54  ? 97  VAL C N   1 
ATOM   3970  C CA  . VAL C  1 97  ? -35.890 15.602  -63.529 1.00 49.48  ? 97  VAL C CA  1 
ATOM   3971  C C   . VAL C  1 97  ? -36.699 16.006  -64.755 1.00 51.24  ? 97  VAL C C   1 
ATOM   3972  O O   . VAL C  1 97  ? -37.930 15.995  -64.726 1.00 53.17  ? 97  VAL C O   1 
ATOM   3973  C CB  . VAL C  1 97  ? -36.042 14.089  -63.329 1.00 48.00  ? 97  VAL C CB  1 
ATOM   3974  C CG1 . VAL C  1 97  ? -35.434 13.335  -64.505 1.00 47.80  ? 97  VAL C CG1 1 
ATOM   3975  C CG2 . VAL C  1 97  ? -35.399 13.690  -62.026 1.00 47.39  ? 97  VAL C CG2 1 
ATOM   3976  N N   . ASN C  1 98  ? -36.002 16.362  -65.829 1.00 52.26  ? 98  ASN C N   1 
ATOM   3977  C CA  . ASN C  1 98  ? -36.647 16.745  -67.085 1.00 53.33  ? 98  ASN C CA  1 
ATOM   3978  C C   . ASN C  1 98  ? -35.907 16.113  -68.256 1.00 53.44  ? 98  ASN C C   1 
ATOM   3979  O O   . ASN C  1 98  ? -34.728 16.380  -68.465 1.00 53.93  ? 98  ASN C O   1 
ATOM   3980  C CB  . ASN C  1 98  ? -36.642 18.263  -67.249 1.00 54.73  ? 98  ASN C CB  1 
ATOM   3981  C CG  . ASN C  1 98  ? -37.510 18.959  -66.226 1.00 56.20  ? 98  ASN C CG  1 
ATOM   3982  O OD1 . ASN C  1 98  ? -38.716 18.705  -66.148 1.00 58.24  ? 98  ASN C OD1 1 
ATOM   3983  N ND2 . ASN C  1 98  ? -36.906 19.837  -65.429 1.00 52.95  ? 98  ASN C ND2 1 
ATOM   3984  N N   . LEU C  1 99  ? -36.602 15.272  -69.013 1.00 53.81  ? 99  LEU C N   1 
ATOM   3985  C CA  . LEU C  1 99  ? -36.010 14.600  -70.170 1.00 54.46  ? 99  LEU C CA  1 
ATOM   3986  C C   . LEU C  1 99  ? -35.099 15.517  -70.980 1.00 53.64  ? 99  LEU C C   1 
ATOM   3987  O O   . LEU C  1 99  ? -35.423 16.679  -71.213 1.00 52.14  ? 99  LEU C O   1 
ATOM   3988  C CB  . LEU C  1 99  ? -37.118 14.048  -71.068 1.00 53.71  ? 99  LEU C CB  1 
ATOM   3989  C CG  . LEU C  1 99  ? -37.972 13.004  -70.342 1.00 56.25  ? 99  LEU C CG  1 
ATOM   3990  C CD1 . LEU C  1 99  ? -39.259 12.733  -71.117 1.00 56.28  ? 99  LEU C CD1 1 
ATOM   3991  C CD2 . LEU C  1 99  ? -37.150 11.731  -70.145 1.00 55.29  ? 99  LEU C CD2 1 
ATOM   3992  N N   . GLY C  1 100 ? -33.950 14.988  -71.390 1.00 54.83  ? 100 GLY C N   1 
ATOM   3993  C CA  . GLY C  1 100 ? -33.011 15.763  -72.181 1.00 53.80  ? 100 GLY C CA  1 
ATOM   3994  C C   . GLY C  1 100 ? -32.249 16.855  -71.446 1.00 55.14  ? 100 GLY C C   1 
ATOM   3995  O O   . GLY C  1 100 ? -31.320 17.441  -72.002 1.00 54.82  ? 100 GLY C O   1 
ATOM   3996  N N   . GLU C  1 101 ? -32.632 17.132  -70.204 1.00 54.77  ? 101 GLU C N   1 
ATOM   3997  C CA  . GLU C  1 101 ? -31.972 18.159  -69.397 1.00 54.53  ? 101 GLU C CA  1 
ATOM   3998  C C   . GLU C  1 101 ? -30.978 17.510  -68.427 1.00 53.41  ? 101 GLU C C   1 
ATOM   3999  O O   . GLU C  1 101 ? -31.360 16.688  -67.596 1.00 54.71  ? 101 GLU C O   1 
ATOM   4000  C CB  . GLU C  1 101 ? -33.032 18.938  -68.621 1.00 58.56  ? 101 GLU C CB  1 
ATOM   4001  C CG  . GLU C  1 101 ? -32.519 20.119  -67.827 1.00 62.35  ? 101 GLU C CG  1 
ATOM   4002  C CD  . GLU C  1 101 ? -33.589 20.681  -66.909 1.00 66.17  ? 101 GLU C CD  1 
ATOM   4003  O OE1 . GLU C  1 101 ? -33.722 20.175  -65.769 1.00 65.79  ? 101 GLU C OE1 1 
ATOM   4004  O OE2 . GLU C  1 101 ? -34.309 21.614  -67.337 1.00 67.12  ? 101 GLU C OE2 1 
ATOM   4005  N N   . PRO C  1 102 ? -29.689 17.880  -68.512 1.00 52.28  ? 102 PRO C N   1 
ATOM   4006  C CA  . PRO C  1 102 ? -28.651 17.314  -67.635 1.00 50.04  ? 102 PRO C CA  1 
ATOM   4007  C C   . PRO C  1 102 ? -29.045 17.321  -66.167 1.00 48.73  ? 102 PRO C C   1 
ATOM   4008  O O   . PRO C  1 102 ? -29.663 18.273  -65.697 1.00 48.67  ? 102 PRO C O   1 
ATOM   4009  C CB  . PRO C  1 102 ? -27.441 18.216  -67.894 1.00 49.76  ? 102 PRO C CB  1 
ATOM   4010  C CG  . PRO C  1 102 ? -27.644 18.641  -69.303 1.00 51.93  ? 102 PRO C CG  1 
ATOM   4011  C CD  . PRO C  1 102 ? -29.128 18.946  -69.359 1.00 51.33  ? 102 PRO C CD  1 
ATOM   4012  N N   . ASN C  1 103 ? -28.689 16.266  -65.441 1.00 47.65  ? 103 ASN C N   1 
ATOM   4013  C CA  . ASN C  1 103 ? -29.010 16.207  -64.018 1.00 47.09  ? 103 ASN C CA  1 
ATOM   4014  C C   . ASN C  1 103 ? -27.943 15.410  -63.263 1.00 46.51  ? 103 ASN C C   1 
ATOM   4015  O O   . ASN C  1 103 ? -26.891 15.088  -63.815 1.00 48.29  ? 103 ASN C O   1 
ATOM   4016  C CB  . ASN C  1 103 ? -30.387 15.569  -63.803 1.00 45.64  ? 103 ASN C CB  1 
ATOM   4017  C CG  . ASN C  1 103 ? -31.079 16.092  -62.556 1.00 47.65  ? 103 ASN C CG  1 
ATOM   4018  O OD1 . ASN C  1 103 ? -30.441 16.277  -61.517 1.00 49.40  ? 103 ASN C OD1 1 
ATOM   4019  N ND2 . ASN C  1 103 ? -32.388 16.329  -62.647 1.00 44.08  ? 103 ASN C ND2 1 
ATOM   4020  N N   . ILE C  1 104 ? -28.220 15.091  -62.005 1.00 44.79  ? 104 ILE C N   1 
ATOM   4021  C CA  . ILE C  1 104 ? -27.283 14.328  -61.190 1.00 43.14  ? 104 ILE C CA  1 
ATOM   4022  C C   . ILE C  1 104 ? -27.976 13.350  -60.238 1.00 41.28  ? 104 ILE C C   1 
ATOM   4023  O O   . ILE C  1 104 ? -28.855 13.738  -59.472 1.00 41.27  ? 104 ILE C O   1 
ATOM   4024  C CB  . ILE C  1 104 ? -26.389 15.273  -60.361 1.00 43.02  ? 104 ILE C CB  1 
ATOM   4025  C CG1 . ILE C  1 104 ? -25.324 15.901  -61.267 1.00 42.43  ? 104 ILE C CG1 1 
ATOM   4026  C CG2 . ILE C  1 104 ? -25.755 14.512  -59.205 1.00 41.50  ? 104 ILE C CG2 1 
ATOM   4027  C CD1 . ILE C  1 104 ? -24.523 16.999  -60.606 1.00 42.50  ? 104 ILE C CD1 1 
ATOM   4028  N N   . LEU C  1 105 ? -27.585 12.082  -60.299 1.00 39.57  ? 105 LEU C N   1 
ATOM   4029  C CA  . LEU C  1 105 ? -28.149 11.070  -59.416 1.00 38.22  ? 105 LEU C CA  1 
ATOM   4030  C C   . LEU C  1 105 ? -27.367 11.061  -58.104 1.00 37.49  ? 105 LEU C C   1 
ATOM   4031  O O   . LEU C  1 105 ? -26.143 11.014  -58.113 1.00 38.89  ? 105 LEU C O   1 
ATOM   4032  C CB  . LEU C  1 105 ? -28.067 9.683   -60.055 1.00 37.67  ? 105 LEU C CB  1 
ATOM   4033  C CG  . LEU C  1 105 ? -29.290 9.209   -60.852 1.00 42.17  ? 105 LEU C CG  1 
ATOM   4034  C CD1 . LEU C  1 105 ? -29.167 7.702   -61.146 1.00 43.04  ? 105 LEU C CD1 1 
ATOM   4035  C CD2 . LEU C  1 105 ? -30.566 9.478   -60.059 1.00 40.99  ? 105 LEU C CD2 1 
ATOM   4036  N N   . ILE C  1 106 ? -28.070 11.103  -56.978 1.00 36.76  ? 106 ILE C N   1 
ATOM   4037  C CA  . ILE C  1 106 ? -27.425 11.096  -55.671 1.00 36.08  ? 106 ILE C CA  1 
ATOM   4038  C C   . ILE C  1 106 ? -27.630 9.774   -54.920 1.00 37.93  ? 106 ILE C C   1 
ATOM   4039  O O   . ILE C  1 106 ? -28.754 9.321   -54.745 1.00 38.06  ? 106 ILE C O   1 
ATOM   4040  C CB  . ILE C  1 106 ? -27.976 12.224  -54.762 1.00 36.33  ? 106 ILE C CB  1 
ATOM   4041  C CG1 . ILE C  1 106 ? -27.707 13.594  -55.379 1.00 35.67  ? 106 ILE C CG1 1 
ATOM   4042  C CG2 . ILE C  1 106 ? -27.345 12.140  -53.386 1.00 35.05  ? 106 ILE C CG2 1 
ATOM   4043  C CD1 . ILE C  1 106 ? -28.183 14.780  -54.505 1.00 34.27  ? 106 ILE C CD1 1 
ATOM   4044  N N   . CYS C  1 107 ? -26.542 9.154   -54.477 1.00 39.07  ? 107 CYS C N   1 
ATOM   4045  C CA  . CYS C  1 107 ? -26.657 7.926   -53.695 1.00 39.79  ? 107 CYS C CA  1 
ATOM   4046  C C   . CYS C  1 107 ? -26.234 8.220   -52.238 1.00 37.09  ? 107 CYS C C   1 
ATOM   4047  O O   . CYS C  1 107 ? -25.044 8.260   -51.932 1.00 34.79  ? 107 CYS C O   1 
ATOM   4048  C CB  . CYS C  1 107 ? -25.777 6.825   -54.283 1.00 40.93  ? 107 CYS C CB  1 
ATOM   4049  S SG  . CYS C  1 107 ? -26.005 5.234   -53.432 1.00 45.19  ? 107 CYS C SG  1 
ATOM   4050  N N   . PHE C  1 108 ? -27.212 8.430   -51.356 1.00 36.34  ? 108 PHE C N   1 
ATOM   4051  C CA  . PHE C  1 108 ? -26.948 8.744   -49.942 1.00 35.79  ? 108 PHE C CA  1 
ATOM   4052  C C   . PHE C  1 108 ? -26.772 7.509   -49.049 1.00 36.05  ? 108 PHE C C   1 
ATOM   4053  O O   . PHE C  1 108 ? -27.725 6.758   -48.795 1.00 34.28  ? 108 PHE C O   1 
ATOM   4054  C CB  . PHE C  1 108 ? -28.079 9.623   -49.393 1.00 35.84  ? 108 PHE C CB  1 
ATOM   4055  C CG  . PHE C  1 108 ? -27.838 10.143  -47.994 1.00 37.02  ? 108 PHE C CG  1 
ATOM   4056  C CD1 . PHE C  1 108 ? -26.637 10.761  -47.661 1.00 35.98  ? 108 PHE C CD1 1 
ATOM   4057  C CD2 . PHE C  1 108 ? -28.826 10.035  -47.015 1.00 36.94  ? 108 PHE C CD2 1 
ATOM   4058  C CE1 . PHE C  1 108 ? -26.422 11.258  -46.380 1.00 35.20  ? 108 PHE C CE1 1 
ATOM   4059  C CE2 . PHE C  1 108 ? -28.616 10.532  -45.722 1.00 35.40  ? 108 PHE C CE2 1 
ATOM   4060  C CZ  . PHE C  1 108 ? -27.414 11.142  -45.408 1.00 36.71  ? 108 PHE C CZ  1 
ATOM   4061  N N   . ILE C  1 109 ? -25.538 7.310   -48.580 1.00 34.72  ? 109 ILE C N   1 
ATOM   4062  C CA  . ILE C  1 109 ? -25.178 6.192   -47.705 1.00 32.80  ? 109 ILE C CA  1 
ATOM   4063  C C   . ILE C  1 109 ? -25.093 6.761   -46.281 1.00 33.29  ? 109 ILE C C   1 
ATOM   4064  O O   . ILE C  1 109 ? -24.269 7.640   -45.996 1.00 33.15  ? 109 ILE C O   1 
ATOM   4065  C CB  . ILE C  1 109 ? -23.857 5.600   -48.186 1.00 34.80  ? 109 ILE C CB  1 
ATOM   4066  C CG1 . ILE C  1 109 ? -23.924 5.447   -49.715 1.00 33.58  ? 109 ILE C CG1 1 
ATOM   4067  C CG2 . ILE C  1 109 ? -23.611 4.255   -47.547 1.00 31.33  ? 109 ILE C CG2 1 
ATOM   4068  C CD1 . ILE C  1 109 ? -22.704 4.788   -50.335 1.00 38.85  ? 109 ILE C CD1 1 
ATOM   4069  N N   . ASP C  1 110 ? -25.940 6.257   -45.386 1.00 33.27  ? 110 ASP C N   1 
ATOM   4070  C CA  . ASP C  1 110 ? -26.037 6.815   -44.031 1.00 33.98  ? 110 ASP C CA  1 
ATOM   4071  C C   . ASP C  1 110 ? -25.986 5.820   -42.856 1.00 34.42  ? 110 ASP C C   1 
ATOM   4072  O O   . ASP C  1 110 ? -26.212 4.625   -43.033 1.00 34.61  ? 110 ASP C O   1 
ATOM   4073  C CB  . ASP C  1 110 ? -27.339 7.628   -43.997 1.00 34.47  ? 110 ASP C CB  1 
ATOM   4074  C CG  . ASP C  1 110 ? -27.410 8.617   -42.849 1.00 39.67  ? 110 ASP C CG  1 
ATOM   4075  O OD1 . ASP C  1 110 ? -26.370 8.909   -42.223 1.00 39.38  ? 110 ASP C OD1 1 
ATOM   4076  O OD2 . ASP C  1 110 ? -28.527 9.120   -42.587 1.00 40.11  ? 110 ASP C OD2 1 
ATOM   4077  N N   . LYS C  1 111 ? -25.679 6.334   -41.662 1.00 34.40  ? 111 LYS C N   1 
ATOM   4078  C CA  . LYS C  1 111 ? -25.595 5.553   -40.410 1.00 34.11  ? 111 LYS C CA  1 
ATOM   4079  C C   . LYS C  1 111 ? -24.788 4.252   -40.426 1.00 32.89  ? 111 LYS C C   1 
ATOM   4080  O O   . LYS C  1 111 ? -25.318 3.188   -40.091 1.00 31.18  ? 111 LYS C O   1 
ATOM   4081  C CB  . LYS C  1 111 ? -26.997 5.220   -39.902 1.00 36.34  ? 111 LYS C CB  1 
ATOM   4082  C CG  . LYS C  1 111 ? -27.868 6.417   -39.656 1.00 41.27  ? 111 LYS C CG  1 
ATOM   4083  C CD  . LYS C  1 111 ? -29.268 5.967   -39.254 1.00 46.88  ? 111 LYS C CD  1 
ATOM   4084  C CE  . LYS C  1 111 ? -30.225 7.148   -39.170 1.00 50.00  ? 111 LYS C CE  1 
ATOM   4085  N NZ  . LYS C  1 111 ? -30.319 7.876   -40.471 1.00 51.05  ? 111 LYS C NZ  1 
ATOM   4086  N N   . PHE C  1 112 ? -23.510 4.324   -40.785 1.00 30.93  ? 112 PHE C N   1 
ATOM   4087  C CA  . PHE C  1 112 ? -22.692 3.114   -40.824 1.00 29.01  ? 112 PHE C CA  1 
ATOM   4088  C C   . PHE C  1 112 ? -21.309 3.281   -40.207 1.00 29.21  ? 112 PHE C C   1 
ATOM   4089  O O   . PHE C  1 112 ? -20.847 4.398   -39.979 1.00 29.70  ? 112 PHE C O   1 
ATOM   4090  C CB  . PHE C  1 112 ? -22.514 2.647   -42.263 1.00 26.03  ? 112 PHE C CB  1 
ATOM   4091  C CG  . PHE C  1 112 ? -21.801 3.644   -43.138 1.00 26.88  ? 112 PHE C CG  1 
ATOM   4092  C CD1 . PHE C  1 112 ? -22.490 4.704   -43.720 1.00 26.12  ? 112 PHE C CD1 1 
ATOM   4093  C CD2 . PHE C  1 112 ? -20.437 3.513   -43.393 1.00 26.35  ? 112 PHE C CD2 1 
ATOM   4094  C CE1 . PHE C  1 112 ? -21.829 5.621   -44.560 1.00 24.38  ? 112 PHE C CE1 1 
ATOM   4095  C CE2 . PHE C  1 112 ? -19.769 4.414   -44.222 1.00 23.61  ? 112 PHE C CE2 1 
ATOM   4096  C CZ  . PHE C  1 112 ? -20.460 5.468   -44.808 1.00 23.79  ? 112 PHE C CZ  1 
ATOM   4097  N N   . SER C  1 113 ? -20.658 2.150   -39.951 1.00 28.91  ? 113 SER C N   1 
ATOM   4098  C CA  . SER C  1 113 ? -19.307 2.125   -39.393 1.00 28.86  ? 113 SER C CA  1 
ATOM   4099  C C   . SER C  1 113 ? -18.838 0.673   -39.392 1.00 29.24  ? 113 SER C C   1 
ATOM   4100  O O   . SER C  1 113 ? -19.632 -0.238  -39.178 1.00 30.18  ? 113 SER C O   1 
ATOM   4101  C CB  . SER C  1 113 ? -19.295 2.682   -37.968 1.00 28.31  ? 113 SER C CB  1 
ATOM   4102  O OG  . SER C  1 113 ? -17.967 2.979   -37.580 1.00 26.72  ? 113 SER C OG  1 
ATOM   4103  N N   . PRO C  1 114 ? -17.538 0.434   -39.612 1.00 30.14  ? 114 PRO C N   1 
ATOM   4104  C CA  . PRO C  1 114 ? -16.450 1.391   -39.858 1.00 29.77  ? 114 PRO C CA  1 
ATOM   4105  C C   . PRO C  1 114 ? -16.596 2.233   -41.121 1.00 31.32  ? 114 PRO C C   1 
ATOM   4106  O O   . PRO C  1 114 ? -17.451 1.965   -41.973 1.00 29.91  ? 114 PRO C O   1 
ATOM   4107  C CB  . PRO C  1 114 ? -15.216 0.498   -39.907 1.00 28.29  ? 114 PRO C CB  1 
ATOM   4108  C CG  . PRO C  1 114 ? -15.753 -0.776  -40.484 1.00 29.26  ? 114 PRO C CG  1 
ATOM   4109  C CD  . PRO C  1 114 ? -17.064 -0.955  -39.764 1.00 27.49  ? 114 PRO C CD  1 
ATOM   4110  N N   . PRO C  1 115 ? -15.770 3.286   -41.248 1.00 31.91  ? 115 PRO C N   1 
ATOM   4111  C CA  . PRO C  1 115 ? -15.862 4.128   -42.441 1.00 31.34  ? 115 PRO C CA  1 
ATOM   4112  C C   . PRO C  1 115 ? -15.169 3.576   -43.688 1.00 32.73  ? 115 PRO C C   1 
ATOM   4113  O O   . PRO C  1 115 ? -14.219 4.166   -44.184 1.00 34.73  ? 115 PRO C O   1 
ATOM   4114  C CB  . PRO C  1 115 ? -15.275 5.459   -41.970 1.00 30.85  ? 115 PRO C CB  1 
ATOM   4115  C CG  . PRO C  1 115 ? -14.264 5.037   -40.961 1.00 30.14  ? 115 PRO C CG  1 
ATOM   4116  C CD  . PRO C  1 115 ? -15.015 3.975   -40.185 1.00 29.59  ? 115 PRO C CD  1 
ATOM   4117  N N   . VAL C  1 116 ? -15.651 2.434   -44.174 1.00 33.97  ? 116 VAL C N   1 
ATOM   4118  C CA  . VAL C  1 116 ? -15.156 1.796   -45.402 1.00 36.04  ? 116 VAL C CA  1 
ATOM   4119  C C   . VAL C  1 116 ? -16.365 1.228   -46.142 1.00 38.26  ? 116 VAL C C   1 
ATOM   4120  O O   . VAL C  1 116 ? -17.184 0.535   -45.545 1.00 38.79  ? 116 VAL C O   1 
ATOM   4121  C CB  . VAL C  1 116 ? -14.179 0.612   -45.155 1.00 35.80  ? 116 VAL C CB  1 
ATOM   4122  C CG1 . VAL C  1 116 ? -12.757 1.062   -45.394 1.00 38.53  ? 116 VAL C CG1 1 
ATOM   4123  C CG2 . VAL C  1 116 ? -14.334 0.063   -43.762 1.00 33.63  ? 116 VAL C CG2 1 
ATOM   4124  N N   . VAL C  1 117 ? -16.483 1.534   -47.431 1.00 39.82  ? 117 VAL C N   1 
ATOM   4125  C CA  . VAL C  1 117 ? -17.600 1.046   -48.235 1.00 42.41  ? 117 VAL C CA  1 
ATOM   4126  C C   . VAL C  1 117 ? -17.260 0.936   -49.713 1.00 43.95  ? 117 VAL C C   1 
ATOM   4127  O O   . VAL C  1 117 ? -16.497 1.741   -50.239 1.00 45.75  ? 117 VAL C O   1 
ATOM   4128  C CB  . VAL C  1 117 ? -18.829 1.969   -48.137 1.00 40.58  ? 117 VAL C CB  1 
ATOM   4129  C CG1 . VAL C  1 117 ? -19.557 1.740   -46.847 1.00 44.13  ? 117 VAL C CG1 1 
ATOM   4130  C CG2 . VAL C  1 117 ? -18.392 3.405   -48.241 1.00 42.97  ? 117 VAL C CG2 1 
ATOM   4131  N N   . ASN C  1 118 ? -17.821 -0.068  -50.378 1.00 44.67  ? 118 ASN C N   1 
ATOM   4132  C CA  . ASN C  1 118 ? -17.604 -0.231  -51.804 1.00 45.37  ? 118 ASN C CA  1 
ATOM   4133  C C   . ASN C  1 118 ? -18.915 0.157   -52.466 1.00 44.91  ? 118 ASN C C   1 
ATOM   4134  O O   . ASN C  1 118 ? -19.954 -0.444  -52.203 1.00 44.66  ? 118 ASN C O   1 
ATOM   4135  C CB  . ASN C  1 118 ? -17.243 -1.673  -52.151 1.00 48.77  ? 118 ASN C CB  1 
ATOM   4136  C CG  . ASN C  1 118 ? -15.853 -2.060  -51.680 1.00 53.90  ? 118 ASN C CG  1 
ATOM   4137  O OD1 . ASN C  1 118 ? -14.952 -1.217  -51.612 1.00 53.17  ? 118 ASN C OD1 1 
ATOM   4138  N ND2 . ASN C  1 118 ? -15.669 -3.345  -51.379 1.00 59.12  ? 118 ASN C ND2 1 
ATOM   4139  N N   . VAL C  1 119 ? -18.868 1.181   -53.310 1.00 44.71  ? 119 VAL C N   1 
ATOM   4140  C CA  . VAL C  1 119 ? -20.059 1.664   -53.989 1.00 42.65  ? 119 VAL C CA  1 
ATOM   4141  C C   . VAL C  1 119 ? -19.902 1.468   -55.483 1.00 43.31  ? 119 VAL C C   1 
ATOM   4142  O O   . VAL C  1 119 ? -18.865 1.799   -56.056 1.00 43.14  ? 119 VAL C O   1 
ATOM   4143  C CB  . VAL C  1 119 ? -20.275 3.149   -53.689 1.00 42.25  ? 119 VAL C CB  1 
ATOM   4144  C CG1 . VAL C  1 119 ? -21.554 3.653   -54.353 1.00 41.03  ? 119 VAL C CG1 1 
ATOM   4145  C CG2 . VAL C  1 119 ? -20.329 3.349   -52.195 1.00 39.81  ? 119 VAL C CG2 1 
ATOM   4146  N N   . THR C  1 120 ? -20.935 0.916   -56.106 1.00 42.94  ? 120 THR C N   1 
ATOM   4147  C CA  . THR C  1 120 ? -20.924 0.655   -57.535 1.00 43.01  ? 120 THR C CA  1 
ATOM   4148  C C   . THR C  1 120 ? -22.191 1.206   -58.184 1.00 43.75  ? 120 THR C C   1 
ATOM   4149  O O   . THR C  1 120 ? -23.300 0.845   -57.795 1.00 42.03  ? 120 THR C O   1 
ATOM   4150  C CB  . THR C  1 120 ? -20.853 -0.862  -57.818 1.00 44.36  ? 120 THR C CB  1 
ATOM   4151  O OG1 . THR C  1 120 ? -19.617 -1.387  -57.319 1.00 42.92  ? 120 THR C OG1 1 
ATOM   4152  C CG2 . THR C  1 120 ? -20.949 -1.133  -59.323 1.00 44.70  ? 120 THR C CG2 1 
ATOM   4153  N N   . TRP C  1 121 ? -22.022 2.097   -59.158 1.00 43.97  ? 121 TRP C N   1 
ATOM   4154  C CA  . TRP C  1 121 ? -23.162 2.662   -59.864 1.00 43.95  ? 121 TRP C CA  1 
ATOM   4155  C C   . TRP C  1 121 ? -23.449 1.762   -61.047 1.00 46.61  ? 121 TRP C C   1 
ATOM   4156  O O   . TRP C  1 121 ? -22.536 1.184   -61.638 1.00 45.76  ? 121 TRP C O   1 
ATOM   4157  C CB  . TRP C  1 121 ? -22.855 4.059   -60.381 1.00 43.01  ? 121 TRP C CB  1 
ATOM   4158  C CG  . TRP C  1 121 ? -23.036 5.173   -59.399 1.00 40.28  ? 121 TRP C CG  1 
ATOM   4159  C CD1 . TRP C  1 121 ? -22.063 5.983   -58.904 1.00 37.84  ? 121 TRP C CD1 1 
ATOM   4160  C CD2 . TRP C  1 121 ? -24.278 5.698   -58.921 1.00 38.33  ? 121 TRP C CD2 1 
ATOM   4161  N NE1 . TRP C  1 121 ? -22.618 6.991   -58.160 1.00 40.20  ? 121 TRP C NE1 1 
ATOM   4162  C CE2 . TRP C  1 121 ? -23.980 6.840   -58.154 1.00 40.11  ? 121 TRP C CE2 1 
ATOM   4163  C CE3 . TRP C  1 121 ? -25.615 5.317   -59.072 1.00 39.11  ? 121 TRP C CE3 1 
ATOM   4164  C CZ2 . TRP C  1 121 ? -24.972 7.615   -57.539 1.00 39.85  ? 121 TRP C CZ2 1 
ATOM   4165  C CZ3 . TRP C  1 121 ? -26.607 6.085   -58.460 1.00 40.31  ? 121 TRP C CZ3 1 
ATOM   4166  C CH2 . TRP C  1 121 ? -26.276 7.223   -57.704 1.00 42.02  ? 121 TRP C CH2 1 
ATOM   4167  N N   . LEU C  1 122 ? -24.720 1.648   -61.395 1.00 49.99  ? 122 LEU C N   1 
ATOM   4168  C CA  . LEU C  1 122 ? -25.124 0.808   -62.510 1.00 52.97  ? 122 LEU C CA  1 
ATOM   4169  C C   . LEU C  1 122 ? -26.145 1.522   -63.380 1.00 55.55  ? 122 LEU C C   1 
ATOM   4170  O O   . LEU C  1 122 ? -27.117 2.087   -62.870 1.00 57.49  ? 122 LEU C O   1 
ATOM   4171  C CB  . LEU C  1 122 ? -25.718 -0.494  -61.978 1.00 52.49  ? 122 LEU C CB  1 
ATOM   4172  C CG  . LEU C  1 122 ? -24.717 -1.340  -61.187 1.00 53.84  ? 122 LEU C CG  1 
ATOM   4173  C CD1 . LEU C  1 122 ? -25.443 -2.404  -60.379 1.00 53.81  ? 122 LEU C CD1 1 
ATOM   4174  C CD2 . LEU C  1 122 ? -23.715 -1.961  -62.154 1.00 52.08  ? 122 LEU C CD2 1 
ATOM   4175  N N   . ARG C  1 123 ? -25.907 1.518   -64.688 1.00 56.95  ? 123 ARG C N   1 
ATOM   4176  C CA  . ARG C  1 123 ? -26.826 2.136   -65.640 1.00 58.48  ? 123 ARG C CA  1 
ATOM   4177  C C   . ARG C  1 123 ? -27.290 1.013   -66.547 1.00 59.03  ? 123 ARG C C   1 
ATOM   4178  O O   . ARG C  1 123 ? -26.483 0.424   -67.262 1.00 58.96  ? 123 ARG C O   1 
ATOM   4179  C CB  . ARG C  1 123 ? -26.125 3.203   -66.483 1.00 60.24  ? 123 ARG C CB  1 
ATOM   4180  C CG  . ARG C  1 123 ? -27.006 3.788   -67.586 1.00 61.12  ? 123 ARG C CG  1 
ATOM   4181  C CD  . ARG C  1 123 ? -26.151 4.352   -68.703 1.00 61.89  ? 123 ARG C CD  1 
ATOM   4182  N NE  . ARG C  1 123 ? -25.489 5.588   -68.313 1.00 62.91  ? 123 ARG C NE  1 
ATOM   4183  C CZ  . ARG C  1 123 ? -24.352 6.028   -68.844 1.00 64.69  ? 123 ARG C CZ  1 
ATOM   4184  N NH1 . ARG C  1 123 ? -23.737 5.324   -69.790 1.00 63.07  ? 123 ARG C NH1 1 
ATOM   4185  N NH2 . ARG C  1 123 ? -23.832 7.181   -68.433 1.00 64.63  ? 123 ARG C NH2 1 
ATOM   4186  N N   . ASN C  1 124 ? -28.587 0.722   -66.513 1.00 59.72  ? 124 ASN C N   1 
ATOM   4187  C CA  . ASN C  1 124 ? -29.163 -0.351  -67.314 1.00 60.30  ? 124 ASN C CA  1 
ATOM   4188  C C   . ASN C  1 124 ? -28.494 -1.698  -66.967 1.00 61.91  ? 124 ASN C C   1 
ATOM   4189  O O   . ASN C  1 124 ? -28.230 -2.529  -67.845 1.00 61.83  ? 124 ASN C O   1 
ATOM   4190  C CB  . ASN C  1 124 ? -29.026 -0.043  -68.819 1.00 58.02  ? 124 ASN C CB  1 
ATOM   4191  C CG  . ASN C  1 124 ? -29.775 1.227   -69.243 1.00 56.31  ? 124 ASN C CG  1 
ATOM   4192  O OD1 . ASN C  1 124 ? -30.886 1.507   -68.775 1.00 53.06  ? 124 ASN C OD1 1 
ATOM   4193  N ND2 . ASN C  1 124 ? -29.170 1.989   -70.153 1.00 53.37  ? 124 ASN C ND2 1 
ATOM   4194  N N   . GLY C  1 125 ? -28.222 -1.893  -65.677 1.00 62.74  ? 125 GLY C N   1 
ATOM   4195  C CA  . GLY C  1 125 ? -27.606 -3.123  -65.202 1.00 63.20  ? 125 GLY C CA  1 
ATOM   4196  C C   . GLY C  1 125 ? -26.118 -3.245  -65.466 1.00 63.93  ? 125 GLY C C   1 
ATOM   4197  O O   . GLY C  1 125 ? -25.530 -4.303  -65.242 1.00 64.48  ? 125 GLY C O   1 
ATOM   4198  N N   . ARG C  1 126 ? -25.500 -2.162  -65.924 1.00 65.26  ? 126 ARG C N   1 
ATOM   4199  C CA  . ARG C  1 126 ? -24.073 -2.169  -66.245 1.00 66.37  ? 126 ARG C CA  1 
ATOM   4200  C C   . ARG C  1 126 ? -23.266 -1.118  -65.469 1.00 65.32  ? 126 ARG C C   1 
ATOM   4201  O O   . ARG C  1 126 ? -23.702 0.023   -65.306 1.00 65.78  ? 126 ARG C O   1 
ATOM   4202  C CB  . ARG C  1 126 ? -23.913 -1.963  -67.757 1.00 69.33  ? 126 ARG C CB  1 
ATOM   4203  C CG  . ARG C  1 126 ? -22.484 -1.936  -68.282 1.00 72.53  ? 126 ARG C CG  1 
ATOM   4204  C CD  . ARG C  1 126 ? -22.503 -1.732  -69.790 1.00 74.94  ? 126 ARG C CD  1 
ATOM   4205  N NE  . ARG C  1 126 ? -23.027 -2.903  -70.486 1.00 76.19  ? 126 ARG C NE  1 
ATOM   4206  C CZ  . ARG C  1 126 ? -22.333 -4.020  -70.682 1.00 77.31  ? 126 ARG C CZ  1 
ATOM   4207  N NH1 . ARG C  1 126 ? -21.085 -4.115  -70.239 1.00 77.96  ? 126 ARG C NH1 1 
ATOM   4208  N NH2 . ARG C  1 126 ? -22.883 -5.042  -71.317 1.00 77.83  ? 126 ARG C NH2 1 
ATOM   4209  N N   . PRO C  1 127 ? -22.070 -1.497  -64.989 1.00 64.26  ? 127 PRO C N   1 
ATOM   4210  C CA  . PRO C  1 127 ? -21.156 -0.638  -64.224 1.00 62.77  ? 127 PRO C CA  1 
ATOM   4211  C C   . PRO C  1 127 ? -20.786 0.673   -64.923 1.00 61.80  ? 127 PRO C C   1 
ATOM   4212  O O   . PRO C  1 127 ? -20.337 0.655   -66.065 1.00 61.70  ? 127 PRO C O   1 
ATOM   4213  C CB  . PRO C  1 127 ? -19.926 -1.528  -64.039 1.00 63.03  ? 127 PRO C CB  1 
ATOM   4214  C CG  . PRO C  1 127 ? -20.490 -2.903  -64.047 1.00 63.81  ? 127 PRO C CG  1 
ATOM   4215  C CD  . PRO C  1 127 ? -21.483 -2.835  -65.176 1.00 63.82  ? 127 PRO C CD  1 
ATOM   4216  N N   . VAL C  1 128 ? -20.964 1.801   -64.235 1.00 60.03  ? 128 VAL C N   1 
ATOM   4217  C CA  . VAL C  1 128 ? -20.609 3.108   -64.792 1.00 58.53  ? 128 VAL C CA  1 
ATOM   4218  C C   . VAL C  1 128 ? -19.457 3.696   -63.988 1.00 57.48  ? 128 VAL C C   1 
ATOM   4219  O O   . VAL C  1 128 ? -19.536 3.793   -62.760 1.00 57.22  ? 128 VAL C O   1 
ATOM   4220  C CB  . VAL C  1 128 ? -21.771 4.115   -64.723 1.00 59.98  ? 128 VAL C CB  1 
ATOM   4221  C CG1 . VAL C  1 128 ? -21.382 5.398   -65.460 1.00 59.59  ? 128 VAL C CG1 1 
ATOM   4222  C CG2 . VAL C  1 128 ? -23.024 3.511   -65.309 1.00 60.25  ? 128 VAL C CG2 1 
ATOM   4223  N N   . THR C  1 129 ? -18.395 4.100   -64.675 1.00 55.23  ? 129 THR C N   1 
ATOM   4224  C CA  . THR C  1 129 ? -17.239 4.657   -63.994 1.00 54.40  ? 129 THR C CA  1 
ATOM   4225  C C   . THR C  1 129 ? -16.925 6.062   -64.477 1.00 53.02  ? 129 THR C C   1 
ATOM   4226  O O   . THR C  1 129 ? -15.975 6.694   -64.018 1.00 52.86  ? 129 THR C O   1 
ATOM   4227  C CB  . THR C  1 129 ? -16.008 3.760   -64.198 1.00 54.95  ? 129 THR C CB  1 
ATOM   4228  O OG1 . THR C  1 129 ? -15.615 3.784   -65.576 1.00 56.08  ? 129 THR C OG1 1 
ATOM   4229  C CG2 . THR C  1 129 ? -16.335 2.319   -63.799 1.00 54.13  ? 129 THR C CG2 1 
ATOM   4230  N N   . GLU C  1 130 ? -17.738 6.553   -65.400 1.00 51.87  ? 130 GLU C N   1 
ATOM   4231  C CA  . GLU C  1 130 ? -17.543 7.883   -65.942 1.00 51.98  ? 130 GLU C CA  1 
ATOM   4232  C C   . GLU C  1 130 ? -18.622 8.810   -65.387 1.00 50.50  ? 130 GLU C C   1 
ATOM   4233  O O   . GLU C  1 130 ? -19.790 8.432   -65.298 1.00 50.82  ? 130 GLU C O   1 
ATOM   4234  C CB  . GLU C  1 130 ? -17.625 7.827   -67.467 1.00 56.05  ? 130 GLU C CB  1 
ATOM   4235  C CG  . GLU C  1 130 ? -16.798 6.713   -68.082 1.00 60.00  ? 130 GLU C CG  1 
ATOM   4236  C CD  . GLU C  1 130 ? -16.995 6.594   -69.582 1.00 64.07  ? 130 GLU C CD  1 
ATOM   4237  O OE1 . GLU C  1 130 ? -18.154 6.439   -70.038 1.00 64.65  ? 130 GLU C OE1 1 
ATOM   4238  O OE2 . GLU C  1 130 ? -15.983 6.654   -70.311 1.00 66.76  ? 130 GLU C OE2 1 
ATOM   4239  N N   . GLY C  1 131 ? -18.229 10.021  -65.010 1.00 47.41  ? 131 GLY C N   1 
ATOM   4240  C CA  . GLY C  1 131 ? -19.189 10.964  -64.464 1.00 45.67  ? 131 GLY C CA  1 
ATOM   4241  C C   . GLY C  1 131 ? -19.541 10.672  -63.015 1.00 44.90  ? 131 GLY C C   1 
ATOM   4242  O O   . GLY C  1 131 ? -20.489 11.232  -62.464 1.00 43.84  ? 131 GLY C O   1 
ATOM   4243  N N   . VAL C  1 132 ? -18.773 9.788   -62.390 1.00 43.56  ? 132 VAL C N   1 
ATOM   4244  C CA  . VAL C  1 132 ? -19.014 9.436   -61.002 1.00 42.23  ? 132 VAL C CA  1 
ATOM   4245  C C   . VAL C  1 132 ? -18.048 10.178  -60.101 1.00 40.92  ? 132 VAL C C   1 
ATOM   4246  O O   . VAL C  1 132 ? -16.884 10.318  -60.419 1.00 42.35  ? 132 VAL C O   1 
ATOM   4247  C CB  . VAL C  1 132 ? -18.853 7.922   -60.770 1.00 41.28  ? 132 VAL C CB  1 
ATOM   4248  C CG1 . VAL C  1 132 ? -19.786 7.165   -61.689 1.00 39.04  ? 132 VAL C CG1 1 
ATOM   4249  C CG2 . VAL C  1 132 ? -17.422 7.503   -61.014 1.00 39.53  ? 132 VAL C CG2 1 
ATOM   4250  N N   . SER C  1 133 ? -18.546 10.684  -58.986 1.00 40.75  ? 133 SER C N   1 
ATOM   4251  C CA  . SER C  1 133 ? -17.696 11.382  -58.043 1.00 39.92  ? 133 SER C CA  1 
ATOM   4252  C C   . SER C  1 133 ? -18.166 10.980  -56.644 1.00 40.58  ? 133 SER C C   1 
ATOM   4253  O O   . SER C  1 133 ? -19.171 10.279  -56.504 1.00 40.25  ? 133 SER C O   1 
ATOM   4254  C CB  . SER C  1 133 ? -17.782 12.899  -58.253 1.00 40.47  ? 133 SER C CB  1 
ATOM   4255  O OG  . SER C  1 133 ? -19.050 13.435  -57.916 1.00 41.01  ? 133 SER C OG  1 
ATOM   4256  N N   . GLU C  1 134 ? -17.443 11.395  -55.611 1.00 39.88  ? 134 GLU C N   1 
ATOM   4257  C CA  . GLU C  1 134 ? -17.841 11.030  -54.256 1.00 39.26  ? 134 GLU C CA  1 
ATOM   4258  C C   . GLU C  1 134 ? -17.233 11.930  -53.193 1.00 37.24  ? 134 GLU C C   1 
ATOM   4259  O O   . GLU C  1 134 ? -16.240 12.616  -53.425 1.00 39.91  ? 134 GLU C O   1 
ATOM   4260  C CB  . GLU C  1 134 ? -17.461 9.574   -53.973 1.00 39.13  ? 134 GLU C CB  1 
ATOM   4261  C CG  . GLU C  1 134 ? -15.968 9.338   -53.873 1.00 42.67  ? 134 GLU C CG  1 
ATOM   4262  C CD  . GLU C  1 134 ? -15.610 7.863   -53.784 1.00 45.69  ? 134 GLU C CD  1 
ATOM   4263  O OE1 . GLU C  1 134 ? -15.825 7.153   -54.786 1.00 48.85  ? 134 GLU C OE1 1 
ATOM   4264  O OE2 . GLU C  1 134 ? -15.117 7.409   -52.720 1.00 46.47  ? 134 GLU C OE2 1 
ATOM   4265  N N   . THR C  1 135 ? -17.854 11.942  -52.026 1.00 34.98  ? 135 THR C N   1 
ATOM   4266  C CA  . THR C  1 135 ? -17.353 12.729  -50.913 1.00 33.70  ? 135 THR C CA  1 
ATOM   4267  C C   . THR C  1 135 ? -16.521 11.789  -50.045 1.00 32.34  ? 135 THR C C   1 
ATOM   4268  O O   . THR C  1 135 ? -16.425 10.584  -50.324 1.00 31.96  ? 135 THR C O   1 
ATOM   4269  C CB  . THR C  1 135 ? -18.500 13.254  -50.042 1.00 34.59  ? 135 THR C CB  1 
ATOM   4270  O OG1 . THR C  1 135 ? -19.207 12.140  -49.488 1.00 36.99  ? 135 THR C OG1 1 
ATOM   4271  C CG2 . THR C  1 135 ? -19.474 14.086  -50.867 1.00 35.84  ? 135 THR C CG2 1 
ATOM   4272  N N   . VAL C  1 136 ? -15.911 12.340  -49.003 1.00 31.54  ? 136 VAL C N   1 
ATOM   4273  C CA  . VAL C  1 136 ? -15.151 11.527  -48.063 1.00 30.26  ? 136 VAL C CA  1 
ATOM   4274  C C   . VAL C  1 136 ? -16.178 11.104  -47.004 1.00 29.92  ? 136 VAL C C   1 
ATOM   4275  O O   . VAL C  1 136 ? -17.361 11.436  -47.117 1.00 30.06  ? 136 VAL C O   1 
ATOM   4276  C CB  . VAL C  1 136 ? -14.000 12.332  -47.416 1.00 30.95  ? 136 VAL C CB  1 
ATOM   4277  C CG1 . VAL C  1 136 ? -12.921 12.588  -48.452 1.00 29.83  ? 136 VAL C CG1 1 
ATOM   4278  C CG2 . VAL C  1 136 ? -14.525 13.661  -46.837 1.00 28.70  ? 136 VAL C CG2 1 
ATOM   4279  N N   . PHE C  1 137 ? -15.762 10.362  -45.991 1.00 29.27  ? 137 PHE C N   1 
ATOM   4280  C CA  . PHE C  1 137 ? -16.719 9.938   -44.972 1.00 28.10  ? 137 PHE C CA  1 
ATOM   4281  C C   . PHE C  1 137 ? -17.017 11.134  -44.089 1.00 29.73  ? 137 PHE C C   1 
ATOM   4282  O O   . PHE C  1 137 ? -16.160 11.578  -43.334 1.00 30.95  ? 137 PHE C O   1 
ATOM   4283  C CB  . PHE C  1 137 ? -16.146 8.777   -44.173 1.00 27.61  ? 137 PHE C CB  1 
ATOM   4284  C CG  . PHE C  1 137 ? -15.875 7.551   -45.010 1.00 28.06  ? 137 PHE C CG  1 
ATOM   4285  C CD1 . PHE C  1 137 ? -16.812 6.537   -45.102 1.00 27.42  ? 137 PHE C CD1 1 
ATOM   4286  C CD2 . PHE C  1 137 ? -14.696 7.436   -45.736 1.00 28.48  ? 137 PHE C CD2 1 
ATOM   4287  C CE1 . PHE C  1 137 ? -16.585 5.419   -45.906 1.00 27.33  ? 137 PHE C CE1 1 
ATOM   4288  C CE2 . PHE C  1 137 ? -14.458 6.322   -46.545 1.00 31.37  ? 137 PHE C CE2 1 
ATOM   4289  C CZ  . PHE C  1 137 ? -15.408 5.312   -46.628 1.00 30.49  ? 137 PHE C CZ  1 
ATOM   4290  N N   . LEU C  1 138 ? -18.233 11.668  -44.211 1.00 29.05  ? 138 LEU C N   1 
ATOM   4291  C CA  . LEU C  1 138 ? -18.635 12.847  -43.459 1.00 29.33  ? 138 LEU C CA  1 
ATOM   4292  C C   . LEU C  1 138 ? -19.180 12.496  -42.084 1.00 29.60  ? 138 LEU C C   1 
ATOM   4293  O O   . LEU C  1 138 ? -19.582 11.358  -41.838 1.00 33.14  ? 138 LEU C O   1 
ATOM   4294  C CB  . LEU C  1 138 ? -19.701 13.613  -44.248 1.00 31.22  ? 138 LEU C CB  1 
ATOM   4295  C CG  . LEU C  1 138 ? -19.427 13.844  -45.737 1.00 29.45  ? 138 LEU C CG  1 
ATOM   4296  C CD1 . LEU C  1 138 ? -20.693 14.367  -46.424 1.00 27.66  ? 138 LEU C CD1 1 
ATOM   4297  C CD2 . LEU C  1 138 ? -18.277 14.826  -45.892 1.00 28.93  ? 138 LEU C CD2 1 
ATOM   4298  N N   . PRO C  1 139 ? -19.202 13.473  -41.166 1.00 26.88  ? 139 PRO C N   1 
ATOM   4299  C CA  . PRO C  1 139 ? -19.709 13.248  -39.804 1.00 28.75  ? 139 PRO C CA  1 
ATOM   4300  C C   . PRO C  1 139 ? -21.230 13.436  -39.583 1.00 29.68  ? 139 PRO C C   1 
ATOM   4301  O O   . PRO C  1 139 ? -21.900 14.206  -40.281 1.00 27.25  ? 139 PRO C O   1 
ATOM   4302  C CB  . PRO C  1 139 ? -18.908 14.252  -38.977 1.00 24.33  ? 139 PRO C CB  1 
ATOM   4303  C CG  . PRO C  1 139 ? -18.838 15.423  -39.917 1.00 24.50  ? 139 PRO C CG  1 
ATOM   4304  C CD  . PRO C  1 139 ? -18.497 14.766  -41.254 1.00 23.08  ? 139 PRO C CD  1 
ATOM   4305  N N   . ARG C  1 140 ? -21.751 12.716  -38.594 1.00 29.87  ? 140 ARG C N   1 
ATOM   4306  C CA  . ARG C  1 140 ? -23.151 12.813  -38.197 1.00 30.46  ? 140 ARG C CA  1 
ATOM   4307  C C   . ARG C  1 140 ? -23.081 13.338  -36.771 1.00 30.32  ? 140 ARG C C   1 
ATOM   4308  O O   . ARG C  1 140 ? -21.996 13.613  -36.271 1.00 32.61  ? 140 ARG C O   1 
ATOM   4309  C CB  . ARG C  1 140 ? -23.817 11.432  -38.206 1.00 30.24  ? 140 ARG C CB  1 
ATOM   4310  C CG  . ARG C  1 140 ? -24.045 10.845  -39.587 1.00 29.62  ? 140 ARG C CG  1 
ATOM   4311  C CD  . ARG C  1 140 ? -24.425 9.373   -39.497 1.00 34.55  ? 140 ARG C CD  1 
ATOM   4312  N NE  . ARG C  1 140 ? -25.501 9.165   -38.528 1.00 37.77  ? 140 ARG C NE  1 
ATOM   4313  C CZ  . ARG C  1 140 ? -26.774 9.487   -38.733 1.00 38.82  ? 140 ARG C CZ  1 
ATOM   4314  N NH1 . ARG C  1 140 ? -27.157 10.021  -39.888 1.00 37.45  ? 140 ARG C NH1 1 
ATOM   4315  N NH2 . ARG C  1 140 ? -27.658 9.312   -37.761 1.00 39.08  ? 140 ARG C NH2 1 
ATOM   4316  N N   . ASP C  1 141 ? -24.218 13.476  -36.112 1.00 31.71  ? 141 ASP C N   1 
ATOM   4317  C CA  . ASP C  1 141 ? -24.232 13.953  -34.736 1.00 34.72  ? 141 ASP C CA  1 
ATOM   4318  C C   . ASP C  1 141 ? -23.687 12.909  -33.791 1.00 34.96  ? 141 ASP C C   1 
ATOM   4319  O O   . ASP C  1 141 ? -23.219 13.243  -32.725 1.00 38.34  ? 141 ASP C O   1 
ATOM   4320  C CB  . ASP C  1 141 ? -25.653 14.281  -34.273 1.00 39.64  ? 141 ASP C CB  1 
ATOM   4321  C CG  . ASP C  1 141 ? -26.210 15.517  -34.921 1.00 42.84  ? 141 ASP C CG  1 
ATOM   4322  O OD1 . ASP C  1 141 ? -25.432 16.464  -35.150 1.00 47.59  ? 141 ASP C OD1 1 
ATOM   4323  O OD2 . ASP C  1 141 ? -27.430 15.552  -35.183 1.00 46.15  ? 141 ASP C OD2 1 
ATOM   4324  N N   . ASP C  1 142 ? -23.771 11.638  -34.169 1.00 35.63  ? 142 ASP C N   1 
ATOM   4325  C CA  . ASP C  1 142 ? -23.300 10.564  -33.305 1.00 34.73  ? 142 ASP C CA  1 
ATOM   4326  C C   . ASP C  1 142 ? -21.933 9.986   -33.689 1.00 34.72  ? 142 ASP C C   1 
ATOM   4327  O O   . ASP C  1 142 ? -21.044 10.712  -34.142 1.00 35.07  ? 142 ASP C O   1 
ATOM   4328  C CB  . ASP C  1 142 ? -24.342 9.439   -33.260 1.00 34.82  ? 142 ASP C CB  1 
ATOM   4329  C CG  . ASP C  1 142 ? -24.681 8.911   -34.642 1.00 37.79  ? 142 ASP C CG  1 
ATOM   4330  O OD1 . ASP C  1 142 ? -23.869 9.127   -35.566 1.00 39.18  ? 142 ASP C OD1 1 
ATOM   4331  O OD2 . ASP C  1 142 ? -25.742 8.269   -34.819 1.00 39.78  ? 142 ASP C OD2 1 
ATOM   4332  N N   . HIS C  1 143 ? -21.776 8.676   -33.494 1.00 33.08  ? 143 HIS C N   1 
ATOM   4333  C CA  . HIS C  1 143 ? -20.526 7.973   -33.792 1.00 32.27  ? 143 HIS C CA  1 
ATOM   4334  C C   . HIS C  1 143 ? -20.492 7.300   -35.162 1.00 32.36  ? 143 HIS C C   1 
ATOM   4335  O O   . HIS C  1 143 ? -19.511 6.635   -35.498 1.00 30.47  ? 143 HIS C O   1 
ATOM   4336  C CB  . HIS C  1 143 ? -20.292 6.887   -32.763 1.00 33.10  ? 143 HIS C CB  1 
ATOM   4337  C CG  . HIS C  1 143 ? -21.379 5.855   -32.738 1.00 33.97  ? 143 HIS C CG  1 
ATOM   4338  N ND1 . HIS C  1 143 ? -22.597 6.067   -32.131 1.00 34.02  ? 143 HIS C ND1 1 
ATOM   4339  C CD2 . HIS C  1 143 ? -21.436 4.610   -33.266 1.00 34.97  ? 143 HIS C CD2 1 
ATOM   4340  C CE1 . HIS C  1 143 ? -23.359 4.995   -32.280 1.00 35.24  ? 143 HIS C CE1 1 
ATOM   4341  N NE2 . HIS C  1 143 ? -22.676 4.099   -32.964 1.00 33.39  ? 143 HIS C NE2 1 
ATOM   4342  N N   . LEU C  1 144 ? -21.555 7.473   -35.944 1.00 30.20  ? 144 LEU C N   1 
ATOM   4343  C CA  . LEU C  1 144 ? -21.639 6.864   -37.261 1.00 27.60  ? 144 LEU C CA  1 
ATOM   4344  C C   . LEU C  1 144 ? -21.282 7.844   -38.374 1.00 26.66  ? 144 LEU C C   1 
ATOM   4345  O O   . LEU C  1 144 ? -21.235 9.044   -38.157 1.00 24.04  ? 144 LEU C O   1 
ATOM   4346  C CB  . LEU C  1 144 ? -23.047 6.284   -37.461 1.00 26.48  ? 144 LEU C CB  1 
ATOM   4347  C CG  . LEU C  1 144 ? -23.370 5.182   -36.434 1.00 27.19  ? 144 LEU C CG  1 
ATOM   4348  C CD1 . LEU C  1 144 ? -24.858 4.807   -36.450 1.00 27.78  ? 144 LEU C CD1 1 
ATOM   4349  C CD2 . LEU C  1 144 ? -22.508 3.974   -36.718 1.00 23.23  ? 144 LEU C CD2 1 
ATOM   4350  N N   . PHE C  1 145 ? -21.034 7.317   -39.567 1.00 27.52  ? 145 PHE C N   1 
ATOM   4351  C CA  . PHE C  1 145 ? -20.670 8.134   -40.713 1.00 29.17  ? 145 PHE C CA  1 
ATOM   4352  C C   . PHE C  1 145 ? -21.724 8.168   -41.835 1.00 32.09  ? 145 PHE C C   1 
ATOM   4353  O O   . PHE C  1 145 ? -22.626 7.323   -41.900 1.00 32.42  ? 145 PHE C O   1 
ATOM   4354  C CB  . PHE C  1 145 ? -19.361 7.613   -41.326 1.00 29.77  ? 145 PHE C CB  1 
ATOM   4355  C CG  . PHE C  1 145 ? -18.217 7.525   -40.361 1.00 29.57  ? 145 PHE C CG  1 
ATOM   4356  C CD1 . PHE C  1 145 ? -18.081 6.424   -39.516 1.00 28.54  ? 145 PHE C CD1 1 
ATOM   4357  C CD2 . PHE C  1 145 ? -17.260 8.543   -40.305 1.00 29.25  ? 145 PHE C CD2 1 
ATOM   4358  C CE1 . PHE C  1 145 ? -17.005 6.334   -38.624 1.00 27.55  ? 145 PHE C CE1 1 
ATOM   4359  C CE2 . PHE C  1 145 ? -16.187 8.467   -39.421 1.00 28.20  ? 145 PHE C CE2 1 
ATOM   4360  C CZ  . PHE C  1 145 ? -16.056 7.361   -38.578 1.00 28.83  ? 145 PHE C CZ  1 
ATOM   4361  N N   . ARG C  1 146 ? -21.608 9.158   -42.718 1.00 32.26  ? 146 ARG C N   1 
ATOM   4362  C CA  . ARG C  1 146 ? -22.493 9.230   -43.877 1.00 34.40  ? 146 ARG C CA  1 
ATOM   4363  C C   . ARG C  1 146 ? -21.612 9.571   -45.072 1.00 34.92  ? 146 ARG C C   1 
ATOM   4364  O O   . ARG C  1 146 ? -20.513 10.087  -44.895 1.00 35.66  ? 146 ARG C O   1 
ATOM   4365  C CB  . ARG C  1 146 ? -23.636 10.249  -43.694 1.00 35.74  ? 146 ARG C CB  1 
ATOM   4366  C CG  . ARG C  1 146 ? -23.264 11.703  -43.532 1.00 37.75  ? 146 ARG C CG  1 
ATOM   4367  C CD  . ARG C  1 146 ? -24.519 12.499  -43.198 1.00 40.81  ? 146 ARG C CD  1 
ATOM   4368  N NE  . ARG C  1 146 ? -24.225 13.859  -42.741 1.00 49.56  ? 146 ARG C NE  1 
ATOM   4369  C CZ  . ARG C  1 146 ? -23.914 14.886  -43.536 1.00 53.08  ? 146 ARG C CZ  1 
ATOM   4370  N NH1 . ARG C  1 146 ? -23.855 14.740  -44.860 1.00 52.60  ? 146 ARG C NH1 1 
ATOM   4371  N NH2 . ARG C  1 146 ? -23.642 16.067  -43.000 1.00 56.16  ? 146 ARG C NH2 1 
ATOM   4372  N N   . LYS C  1 147 ? -22.076 9.251   -46.278 1.00 35.22  ? 147 LYS C N   1 
ATOM   4373  C CA  . LYS C  1 147 ? -21.300 9.507   -47.480 1.00 34.49  ? 147 LYS C CA  1 
ATOM   4374  C C   . LYS C  1 147 ? -22.222 9.708   -48.688 1.00 33.90  ? 147 LYS C C   1 
ATOM   4375  O O   . LYS C  1 147 ? -23.310 9.136   -48.731 1.00 33.24  ? 147 LYS C O   1 
ATOM   4376  C CB  . LYS C  1 147 ? -20.355 8.325   -47.737 1.00 34.67  ? 147 LYS C CB  1 
ATOM   4377  C CG  . LYS C  1 147 ? -19.310 8.578   -48.799 1.00 37.22  ? 147 LYS C CG  1 
ATOM   4378  C CD  . LYS C  1 147 ? -18.414 7.360   -49.027 1.00 40.96  ? 147 LYS C CD  1 
ATOM   4379  C CE  . LYS C  1 147 ? -17.205 7.740   -49.881 1.00 41.73  ? 147 LYS C CE  1 
ATOM   4380  N NZ  . LYS C  1 147 ? -16.561 6.559   -50.497 1.00 46.01  ? 147 LYS C NZ  1 
ATOM   4381  N N   . PHE C  1 148 ? -21.788 10.534  -49.644 1.00 31.40  ? 148 PHE C N   1 
ATOM   4382  C CA  . PHE C  1 148 ? -22.554 10.787  -50.869 1.00 30.13  ? 148 PHE C CA  1 
ATOM   4383  C C   . PHE C  1 148 ? -21.808 10.337  -52.107 1.00 30.45  ? 148 PHE C C   1 
ATOM   4384  O O   . PHE C  1 148 ? -20.617 10.621  -52.268 1.00 31.13  ? 148 PHE C O   1 
ATOM   4385  C CB  . PHE C  1 148 ? -22.831 12.276  -51.092 1.00 28.90  ? 148 PHE C CB  1 
ATOM   4386  C CG  . PHE C  1 148 ? -23.728 12.893  -50.088 1.00 25.56  ? 148 PHE C CG  1 
ATOM   4387  C CD1 . PHE C  1 148 ? -23.220 13.380  -48.896 1.00 23.13  ? 148 PHE C CD1 1 
ATOM   4388  C CD2 . PHE C  1 148 ? -25.079 13.032  -50.353 1.00 26.57  ? 148 PHE C CD2 1 
ATOM   4389  C CE1 . PHE C  1 148 ? -24.040 14.004  -47.982 1.00 23.76  ? 148 PHE C CE1 1 
ATOM   4390  C CE2 . PHE C  1 148 ? -25.915 13.654  -49.447 1.00 24.72  ? 148 PHE C CE2 1 
ATOM   4391  C CZ  . PHE C  1 148 ? -25.397 14.147  -48.259 1.00 26.66  ? 148 PHE C CZ  1 
ATOM   4392  N N   . HIS C  1 149 ? -22.510 9.644   -52.990 1.00 30.91  ? 149 HIS C N   1 
ATOM   4393  C CA  . HIS C  1 149 ? -21.927 9.244   -54.261 1.00 33.05  ? 149 HIS C CA  1 
ATOM   4394  C C   . HIS C  1 149 ? -22.741 9.932   -55.353 1.00 33.68  ? 149 HIS C C   1 
ATOM   4395  O O   . HIS C  1 149 ? -23.959 10.074  -55.237 1.00 34.25  ? 149 HIS C O   1 
ATOM   4396  C CB  . HIS C  1 149 ? -21.932 7.731   -54.416 1.00 31.70  ? 149 HIS C CB  1 
ATOM   4397  C CG  . HIS C  1 149 ? -20.682 7.094   -53.912 1.00 34.40  ? 149 HIS C CG  1 
ATOM   4398  N ND1 . HIS C  1 149 ? -20.263 7.215   -52.603 1.00 36.08  ? 149 HIS C ND1 1 
ATOM   4399  C CD2 . HIS C  1 149 ? -19.726 6.376   -54.548 1.00 37.06  ? 149 HIS C CD2 1 
ATOM   4400  C CE1 . HIS C  1 149 ? -19.104 6.598   -52.457 1.00 37.24  ? 149 HIS C CE1 1 
ATOM   4401  N NE2 . HIS C  1 149 ? -18.755 6.082   -53.622 1.00 37.22  ? 149 HIS C NE2 1 
ATOM   4402  N N   . TYR C  1 150 ? -22.064 10.382  -56.403 1.00 36.15  ? 150 TYR C N   1 
ATOM   4403  C CA  . TYR C  1 150 ? -22.730 11.107  -57.480 1.00 36.30  ? 150 TYR C CA  1 
ATOM   4404  C C   . TYR C  1 150 ? -22.547 10.516  -58.874 1.00 37.02  ? 150 TYR C C   1 
ATOM   4405  O O   . TYR C  1 150 ? -21.480 10.000  -59.212 1.00 37.78  ? 150 TYR C O   1 
ATOM   4406  C CB  . TYR C  1 150 ? -22.229 12.545  -57.492 1.00 34.71  ? 150 TYR C CB  1 
ATOM   4407  C CG  . TYR C  1 150 ? -22.429 13.284  -56.201 1.00 37.69  ? 150 TYR C CG  1 
ATOM   4408  C CD1 . TYR C  1 150 ? -23.691 13.748  -55.819 1.00 36.83  ? 150 TYR C CD1 1 
ATOM   4409  C CD2 . TYR C  1 150 ? -21.343 13.570  -55.373 1.00 37.81  ? 150 TYR C CD2 1 
ATOM   4410  C CE1 . TYR C  1 150 ? -23.854 14.493  -54.642 1.00 37.33  ? 150 TYR C CE1 1 
ATOM   4411  C CE2 . TYR C  1 150 ? -21.495 14.304  -54.207 1.00 35.12  ? 150 TYR C CE2 1 
ATOM   4412  C CZ  . TYR C  1 150 ? -22.744 14.768  -53.844 1.00 35.15  ? 150 TYR C CZ  1 
ATOM   4413  O OH  . TYR C  1 150 ? -22.859 15.535  -52.700 1.00 36.22  ? 150 TYR C OH  1 
ATOM   4414  N N   . LEU C  1 151 ? -23.593 10.627  -59.688 1.00 37.09  ? 151 LEU C N   1 
ATOM   4415  C CA  . LEU C  1 151 ? -23.562 10.125  -61.057 1.00 39.77  ? 151 LEU C CA  1 
ATOM   4416  C C   . LEU C  1 151 ? -24.268 11.078  -62.014 1.00 41.79  ? 151 LEU C C   1 
ATOM   4417  O O   . LEU C  1 151 ? -25.479 11.291  -61.926 1.00 44.39  ? 151 LEU C O   1 
ATOM   4418  C CB  . LEU C  1 151 ? -24.227 8.747   -61.156 1.00 38.15  ? 151 LEU C CB  1 
ATOM   4419  C CG  . LEU C  1 151 ? -24.378 8.261   -62.601 1.00 38.11  ? 151 LEU C CG  1 
ATOM   4420  C CD1 . LEU C  1 151 ? -22.997 8.139   -63.232 1.00 38.79  ? 151 LEU C CD1 1 
ATOM   4421  C CD2 . LEU C  1 151 ? -25.105 6.923   -62.647 1.00 37.36  ? 151 LEU C CD2 1 
ATOM   4422  N N   . THR C  1 152 ? -23.502 11.664  -62.921 1.00 42.77  ? 152 THR C N   1 
ATOM   4423  C CA  . THR C  1 152 ? -24.066 12.566  -63.909 1.00 43.83  ? 152 THR C CA  1 
ATOM   4424  C C   . THR C  1 152 ? -24.966 11.712  -64.793 1.00 44.17  ? 152 THR C C   1 
ATOM   4425  O O   . THR C  1 152 ? -24.666 10.542  -65.019 1.00 44.29  ? 152 THR C O   1 
ATOM   4426  C CB  . THR C  1 152 ? -22.962 13.161  -64.789 1.00 43.47  ? 152 THR C CB  1 
ATOM   4427  O OG1 . THR C  1 152 ? -22.095 12.102  -65.215 1.00 42.57  ? 152 THR C OG1 1 
ATOM   4428  C CG2 . THR C  1 152 ? -22.159 14.215  -64.026 1.00 42.75  ? 152 THR C CG2 1 
ATOM   4429  N N   . PHE C  1 153 ? -26.072 12.272  -65.270 1.00 43.97  ? 153 PHE C N   1 
ATOM   4430  C CA  . PHE C  1 153 ? -26.941 11.508  -66.156 1.00 45.54  ? 153 PHE C CA  1 
ATOM   4431  C C   . PHE C  1 153 ? -27.903 12.381  -66.959 1.00 46.90  ? 153 PHE C C   1 
ATOM   4432  O O   . PHE C  1 153 ? -28.228 13.508  -66.575 1.00 45.71  ? 153 PHE C O   1 
ATOM   4433  C CB  . PHE C  1 153 ? -27.729 10.448  -65.379 1.00 45.39  ? 153 PHE C CB  1 
ATOM   4434  C CG  . PHE C  1 153 ? -28.919 10.991  -64.638 1.00 46.15  ? 153 PHE C CG  1 
ATOM   4435  C CD1 . PHE C  1 153 ? -28.763 11.963  -63.654 1.00 45.05  ? 153 PHE C CD1 1 
ATOM   4436  C CD2 . PHE C  1 153 ? -30.203 10.528  -64.930 1.00 47.57  ? 153 PHE C CD2 1 
ATOM   4437  C CE1 . PHE C  1 153 ? -29.871 12.469  -62.971 1.00 45.16  ? 153 PHE C CE1 1 
ATOM   4438  C CE2 . PHE C  1 153 ? -31.319 11.027  -64.252 1.00 46.27  ? 153 PHE C CE2 1 
ATOM   4439  C CZ  . PHE C  1 153 ? -31.150 11.999  -63.270 1.00 45.54  ? 153 PHE C CZ  1 
ATOM   4440  N N   . LEU C  1 154 ? -28.331 11.835  -68.091 1.00 48.83  ? 154 LEU C N   1 
ATOM   4441  C CA  . LEU C  1 154 ? -29.257 12.498  -69.001 1.00 49.77  ? 154 LEU C CA  1 
ATOM   4442  C C   . LEU C  1 154 ? -30.548 11.690  -68.932 1.00 50.81  ? 154 LEU C C   1 
ATOM   4443  O O   . LEU C  1 154 ? -30.607 10.567  -69.435 1.00 50.33  ? 154 LEU C O   1 
ATOM   4444  C CB  . LEU C  1 154 ? -28.703 12.466  -70.422 1.00 48.91  ? 154 LEU C CB  1 
ATOM   4445  C CG  . LEU C  1 154 ? -29.413 13.381  -71.407 1.00 47.20  ? 154 LEU C CG  1 
ATOM   4446  C CD1 . LEU C  1 154 ? -29.124 14.834  -71.036 1.00 48.09  ? 154 LEU C CD1 1 
ATOM   4447  C CD2 . LEU C  1 154 ? -28.943 13.079  -72.809 1.00 48.81  ? 154 LEU C CD2 1 
ATOM   4448  N N   . PRO C  1 155 ? -31.593 12.252  -68.302 1.00 52.24  ? 155 PRO C N   1 
ATOM   4449  C CA  . PRO C  1 155 ? -32.915 11.640  -68.116 1.00 54.55  ? 155 PRO C CA  1 
ATOM   4450  C C   . PRO C  1 155 ? -33.571 11.107  -69.379 1.00 58.01  ? 155 PRO C C   1 
ATOM   4451  O O   . PRO C  1 155 ? -33.745 11.838  -70.361 1.00 59.33  ? 155 PRO C O   1 
ATOM   4452  C CB  . PRO C  1 155 ? -33.730 12.760  -67.476 1.00 54.61  ? 155 PRO C CB  1 
ATOM   4453  C CG  . PRO C  1 155 ? -32.687 13.545  -66.722 1.00 54.30  ? 155 PRO C CG  1 
ATOM   4454  C CD  . PRO C  1 155 ? -31.571 13.611  -67.734 1.00 53.01  ? 155 PRO C CD  1 
ATOM   4455  N N   . SER C  1 156 ? -33.952 9.833   -69.337 1.00 59.78  ? 156 SER C N   1 
ATOM   4456  C CA  . SER C  1 156 ? -34.585 9.180   -70.473 1.00 61.20  ? 156 SER C CA  1 
ATOM   4457  C C   . SER C  1 156 ? -35.389 7.978   -69.998 1.00 63.74  ? 156 SER C C   1 
ATOM   4458  O O   . SER C  1 156 ? -34.865 7.104   -69.297 1.00 64.65  ? 156 SER C O   1 
ATOM   4459  C CB  . SER C  1 156 ? -33.520 8.721   -71.475 1.00 60.75  ? 156 SER C CB  1 
ATOM   4460  O OG  . SER C  1 156 ? -34.103 8.297   -72.696 1.00 60.60  ? 156 SER C OG  1 
ATOM   4461  N N   . THR C  1 157 ? -36.659 7.939   -70.396 1.00 64.82  ? 157 THR C N   1 
ATOM   4462  C CA  . THR C  1 157 ? -37.563 6.855   -70.031 1.00 66.16  ? 157 THR C CA  1 
ATOM   4463  C C   . THR C  1 157 ? -37.017 5.491   -70.458 1.00 66.92  ? 157 THR C C   1 
ATOM   4464  O O   . THR C  1 157 ? -37.566 4.453   -70.096 1.00 66.53  ? 157 THR C O   1 
ATOM   4465  C CB  . THR C  1 157 ? -38.938 7.056   -70.682 1.00 67.43  ? 157 THR C CB  1 
ATOM   4466  O OG1 . THR C  1 157 ? -38.810 6.953   -72.104 1.00 70.34  ? 157 THR C OG1 1 
ATOM   4467  C CG2 . THR C  1 157 ? -39.488 8.430   -70.348 1.00 68.63  ? 157 THR C CG2 1 
ATOM   4468  N N   . ASP C  1 158 ? -35.933 5.504   -71.227 1.00 68.74  ? 158 ASP C N   1 
ATOM   4469  C CA  . ASP C  1 158 ? -35.312 4.275   -71.702 1.00 70.72  ? 158 ASP C CA  1 
ATOM   4470  C C   . ASP C  1 158 ? -34.365 3.681   -70.667 1.00 71.04  ? 158 ASP C C   1 
ATOM   4471  O O   . ASP C  1 158 ? -34.221 2.460   -70.574 1.00 71.56  ? 158 ASP C O   1 
ATOM   4472  C CB  . ASP C  1 158 ? -34.511 4.536   -72.981 1.00 73.10  ? 158 ASP C CB  1 
ATOM   4473  C CG  . ASP C  1 158 ? -35.308 5.282   -74.033 1.00 75.34  ? 158 ASP C CG  1 
ATOM   4474  O OD1 . ASP C  1 158 ? -36.447 4.860   -74.319 1.00 76.47  ? 158 ASP C OD1 1 
ATOM   4475  O OD2 . ASP C  1 158 ? -34.792 6.287   -74.577 1.00 75.39  ? 158 ASP C OD2 1 
ATOM   4476  N N   . ASP C  1 159 ? -33.728 4.544   -69.884 1.00 70.10  ? 159 ASP C N   1 
ATOM   4477  C CA  . ASP C  1 159 ? -32.760 4.081   -68.898 1.00 70.10  ? 159 ASP C CA  1 
ATOM   4478  C C   . ASP C  1 159 ? -33.207 3.959   -67.444 1.00 68.87  ? 159 ASP C C   1 
ATOM   4479  O O   . ASP C  1 159 ? -34.072 4.698   -66.969 1.00 68.92  ? 159 ASP C O   1 
ATOM   4480  C CB  . ASP C  1 159 ? -31.527 4.982   -68.930 1.00 71.57  ? 159 ASP C CB  1 
ATOM   4481  C CG  . ASP C  1 159 ? -30.949 5.127   -70.314 1.00 73.49  ? 159 ASP C CG  1 
ATOM   4482  O OD1 . ASP C  1 159 ? -30.600 4.092   -70.927 1.00 75.78  ? 159 ASP C OD1 1 
ATOM   4483  O OD2 . ASP C  1 159 ? -30.843 6.278   -70.789 1.00 74.06  ? 159 ASP C OD2 1 
ATOM   4484  N N   . PHE C  1 160 ? -32.598 3.004   -66.748 1.00 67.04  ? 160 PHE C N   1 
ATOM   4485  C CA  . PHE C  1 160 ? -32.847 2.800   -65.329 1.00 64.61  ? 160 PHE C CA  1 
ATOM   4486  C C   . PHE C  1 160 ? -31.476 2.813   -64.652 1.00 62.70  ? 160 PHE C C   1 
ATOM   4487  O O   . PHE C  1 160 ? -30.451 2.627   -65.312 1.00 62.36  ? 160 PHE C O   1 
ATOM   4488  C CB  . PHE C  1 160 ? -33.602 1.486   -65.061 1.00 65.55  ? 160 PHE C CB  1 
ATOM   4489  C CG  . PHE C  1 160 ? -32.931 0.253   -65.599 1.00 66.25  ? 160 PHE C CG  1 
ATOM   4490  C CD1 . PHE C  1 160 ? -32.857 0.021   -66.969 1.00 67.95  ? 160 PHE C CD1 1 
ATOM   4491  C CD2 . PHE C  1 160 ? -32.437 -0.715  -64.726 1.00 66.60  ? 160 PHE C CD2 1 
ATOM   4492  C CE1 . PHE C  1 160 ? -32.302 -1.167  -67.464 1.00 69.51  ? 160 PHE C CE1 1 
ATOM   4493  C CE2 . PHE C  1 160 ? -31.881 -1.903  -65.202 1.00 67.64  ? 160 PHE C CE2 1 
ATOM   4494  C CZ  . PHE C  1 160 ? -31.814 -2.133  -66.572 1.00 69.43  ? 160 PHE C CZ  1 
ATOM   4495  N N   . TYR C  1 161 ? -31.442 3.057   -63.349 1.00 60.33  ? 161 TYR C N   1 
ATOM   4496  C CA  . TYR C  1 161 ? -30.165 3.120   -62.651 1.00 57.58  ? 161 TYR C CA  1 
ATOM   4497  C C   . TYR C  1 161 ? -30.145 2.317   -61.363 1.00 58.04  ? 161 TYR C C   1 
ATOM   4498  O O   . TYR C  1 161 ? -31.200 1.937   -60.842 1.00 59.11  ? 161 TYR C O   1 
ATOM   4499  C CB  . TYR C  1 161 ? -29.815 4.580   -62.365 1.00 56.17  ? 161 TYR C CB  1 
ATOM   4500  C CG  . TYR C  1 161 ? -29.613 5.415   -63.613 1.00 53.87  ? 161 TYR C CG  1 
ATOM   4501  C CD1 . TYR C  1 161 ? -30.688 5.761   -64.439 1.00 53.12  ? 161 TYR C CD1 1 
ATOM   4502  C CD2 . TYR C  1 161 ? -28.339 5.838   -63.985 1.00 53.02  ? 161 TYR C CD2 1 
ATOM   4503  C CE1 . TYR C  1 161 ? -30.491 6.506   -65.607 1.00 50.98  ? 161 TYR C CE1 1 
ATOM   4504  C CE2 . TYR C  1 161 ? -28.132 6.583   -65.147 1.00 51.13  ? 161 TYR C CE2 1 
ATOM   4505  C CZ  . TYR C  1 161 ? -29.205 6.909   -65.951 1.00 51.83  ? 161 TYR C CZ  1 
ATOM   4506  O OH  . TYR C  1 161 ? -28.972 7.615   -67.106 1.00 51.83  ? 161 TYR C OH  1 
ATOM   4507  N N   . ASP C  1 162 ? -28.939 2.068   -60.854 1.00 57.93  ? 162 ASP C N   1 
ATOM   4508  C CA  . ASP C  1 162 ? -28.747 1.298   -59.623 1.00 56.82  ? 162 ASP C CA  1 
ATOM   4509  C C   . ASP C  1 162 ? -27.464 1.635   -58.851 1.00 55.60  ? 162 ASP C C   1 
ATOM   4510  O O   . ASP C  1 162 ? -26.374 1.667   -59.423 1.00 53.46  ? 162 ASP C O   1 
ATOM   4511  C CB  . ASP C  1 162 ? -28.730 -0.201  -59.937 1.00 57.67  ? 162 ASP C CB  1 
ATOM   4512  C CG  . ASP C  1 162 ? -30.044 -0.696  -60.478 1.00 57.85  ? 162 ASP C CG  1 
ATOM   4513  O OD1 . ASP C  1 162 ? -31.051 -0.602  -59.746 1.00 60.36  ? 162 ASP C OD1 1 
ATOM   4514  O OD2 . ASP C  1 162 ? -30.072 -1.173  -61.633 1.00 58.33  ? 162 ASP C OD2 1 
ATOM   4515  N N   . CYS C  1 163 ? -27.607 1.872   -57.548 1.00 54.38  ? 163 CYS C N   1 
ATOM   4516  C CA  . CYS C  1 163 ? -26.465 2.155   -56.683 1.00 52.14  ? 163 CYS C CA  1 
ATOM   4517  C C   . CYS C  1 163 ? -26.297 0.931   -55.789 1.00 52.70  ? 163 CYS C C   1 
ATOM   4518  O O   . CYS C  1 163 ? -27.188 0.614   -54.995 1.00 52.20  ? 163 CYS C O   1 
ATOM   4519  C CB  . CYS C  1 163 ? -26.714 3.398   -55.809 1.00 51.37  ? 163 CYS C CB  1 
ATOM   4520  S SG  . CYS C  1 163 ? -25.290 3.855   -54.746 1.00 51.37  ? 163 CYS C SG  1 
ATOM   4521  N N   . GLU C  1 164 ? -25.176 0.229   -55.930 1.00 51.71  ? 164 GLU C N   1 
ATOM   4522  C CA  . GLU C  1 164 ? -24.937 -0.944  -55.100 1.00 51.42  ? 164 GLU C CA  1 
ATOM   4523  C C   . GLU C  1 164 ? -23.873 -0.660  -54.038 1.00 51.08  ? 164 GLU C C   1 
ATOM   4524  O O   . GLU C  1 164 ? -22.745 -0.257  -54.339 1.00 53.17  ? 164 GLU C O   1 
ATOM   4525  C CB  . GLU C  1 164 ? -24.516 -2.140  -55.945 1.00 52.10  ? 164 GLU C CB  1 
ATOM   4526  C CG  . GLU C  1 164 ? -24.607 -3.440  -55.166 1.00 55.89  ? 164 GLU C CG  1 
ATOM   4527  C CD  . GLU C  1 164 ? -24.191 -4.648  -55.974 1.00 58.30  ? 164 GLU C CD  1 
ATOM   4528  O OE1 . GLU C  1 164 ? -22.975 -4.839  -56.190 1.00 59.92  ? 164 GLU C OE1 1 
ATOM   4529  O OE2 . GLU C  1 164 ? -25.087 -5.406  -56.398 1.00 60.64  ? 164 GLU C OE2 1 
ATOM   4530  N N   . VAL C  1 165 ? -24.244 -0.876  -52.786 1.00 49.13  ? 165 VAL C N   1 
ATOM   4531  C CA  . VAL C  1 165 ? -23.348 -0.622  -51.674 1.00 45.92  ? 165 VAL C CA  1 
ATOM   4532  C C   . VAL C  1 165 ? -22.990 -1.884  -50.904 1.00 45.89  ? 165 VAL C C   1 
ATOM   4533  O O   . VAL C  1 165 ? -23.864 -2.662  -50.524 1.00 46.30  ? 165 VAL C O   1 
ATOM   4534  C CB  . VAL C  1 165 ? -23.994 0.362   -50.693 1.00 44.63  ? 165 VAL C CB  1 
ATOM   4535  C CG1 . VAL C  1 165 ? -23.086 0.581   -49.514 1.00 43.41  ? 165 VAL C CG1 1 
ATOM   4536  C CG2 . VAL C  1 165 ? -24.295 1.671   -51.401 1.00 43.31  ? 165 VAL C CG2 1 
ATOM   4537  N N   . ASP C  1 166 ? -21.701 -2.079  -50.670 1.00 45.33  ? 166 ASP C N   1 
ATOM   4538  C CA  . ASP C  1 166 ? -21.239 -3.227  -49.906 1.00 45.03  ? 166 ASP C CA  1 
ATOM   4539  C C   . ASP C  1 166 ? -20.467 -2.749  -48.664 1.00 45.23  ? 166 ASP C C   1 
ATOM   4540  O O   . ASP C  1 166 ? -19.624 -1.856  -48.748 1.00 45.20  ? 166 ASP C O   1 
ATOM   4541  C CB  . ASP C  1 166 ? -20.357 -4.121  -50.770 1.00 45.18  ? 166 ASP C CB  1 
ATOM   4542  C CG  . ASP C  1 166 ? -20.092 -5.459  -50.122 1.00 48.31  ? 166 ASP C CG  1 
ATOM   4543  O OD1 . ASP C  1 166 ? -20.929 -5.896  -49.303 1.00 49.63  ? 166 ASP C OD1 1 
ATOM   4544  O OD2 . ASP C  1 166 ? -19.059 -6.084  -50.433 1.00 51.19  ? 166 ASP C OD2 1 
ATOM   4545  N N   . HIS C  1 167 ? -20.764 -3.352  -47.518 1.00 44.39  ? 167 HIS C N   1 
ATOM   4546  C CA  . HIS C  1 167 ? -20.140 -2.986  -46.254 1.00 43.48  ? 167 HIS C CA  1 
ATOM   4547  C C   . HIS C  1 167 ? -20.017 -4.244  -45.406 1.00 44.61  ? 167 HIS C C   1 
ATOM   4548  O O   . HIS C  1 167 ? -20.835 -5.151  -45.534 1.00 45.93  ? 167 HIS C O   1 
ATOM   4549  C CB  . HIS C  1 167 ? -21.022 -1.971  -45.534 1.00 41.68  ? 167 HIS C CB  1 
ATOM   4550  C CG  . HIS C  1 167 ? -20.426 -1.425  -44.273 1.00 43.02  ? 167 HIS C CG  1 
ATOM   4551  N ND1 . HIS C  1 167 ? -19.582 -0.335  -44.260 1.00 40.88  ? 167 HIS C ND1 1 
ATOM   4552  C CD2 . HIS C  1 167 ? -20.591 -1.788  -42.978 1.00 41.44  ? 167 HIS C CD2 1 
ATOM   4553  C CE1 . HIS C  1 167 ? -19.260 -0.044  -43.012 1.00 39.83  ? 167 HIS C CE1 1 
ATOM   4554  N NE2 . HIS C  1 167 ? -19.859 -0.910  -42.215 1.00 40.21  ? 167 HIS C NE2 1 
ATOM   4555  N N   . TRP C  1 168 ? -19.012 -4.298  -44.537 1.00 44.80  ? 168 TRP C N   1 
ATOM   4556  C CA  . TRP C  1 168 ? -18.804 -5.466  -43.689 1.00 45.29  ? 168 TRP C CA  1 
ATOM   4557  C C   . TRP C  1 168 ? -19.995 -5.772  -42.796 1.00 45.76  ? 168 TRP C C   1 
ATOM   4558  O O   . TRP C  1 168 ? -20.072 -6.846  -42.211 1.00 47.33  ? 168 TRP C O   1 
ATOM   4559  C CB  . TRP C  1 168 ? -17.562 -5.290  -42.815 1.00 46.64  ? 168 TRP C CB  1 
ATOM   4560  C CG  . TRP C  1 168 ? -16.297 -5.108  -43.592 1.00 49.03  ? 168 TRP C CG  1 
ATOM   4561  C CD1 . TRP C  1 168 ? -15.597 -3.947  -43.758 1.00 49.43  ? 168 TRP C CD1 1 
ATOM   4562  C CD2 . TRP C  1 168 ? -15.591 -6.110  -44.328 1.00 50.92  ? 168 TRP C CD2 1 
ATOM   4563  N NE1 . TRP C  1 168 ? -14.500 -4.162  -44.553 1.00 51.04  ? 168 TRP C NE1 1 
ATOM   4564  C CE2 . TRP C  1 168 ? -14.470 -5.481  -44.921 1.00 52.15  ? 168 TRP C CE2 1 
ATOM   4565  C CE3 . TRP C  1 168 ? -15.796 -7.481  -44.547 1.00 53.45  ? 168 TRP C CE3 1 
ATOM   4566  C CZ2 . TRP C  1 168 ? -13.553 -6.176  -45.722 1.00 53.22  ? 168 TRP C CZ2 1 
ATOM   4567  C CZ3 . TRP C  1 168 ? -14.883 -8.176  -45.344 1.00 54.61  ? 168 TRP C CZ3 1 
ATOM   4568  C CH2 . TRP C  1 168 ? -13.773 -7.517  -45.922 1.00 55.48  ? 168 TRP C CH2 1 
ATOM   4569  N N   . GLY C  1 169 ? -20.922 -4.832  -42.684 1.00 46.20  ? 169 GLY C N   1 
ATOM   4570  C CA  . GLY C  1 169 ? -22.090 -5.051  -41.852 1.00 45.45  ? 169 GLY C CA  1 
ATOM   4571  C C   . GLY C  1 169 ? -23.268 -5.582  -42.651 1.00 47.94  ? 169 GLY C C   1 
ATOM   4572  O O   . GLY C  1 169 ? -24.357 -5.793  -42.115 1.00 47.63  ? 169 GLY C O   1 
ATOM   4573  N N   . LEU C  1 170 ? -23.057 -5.794  -43.944 1.00 48.77  ? 170 LEU C N   1 
ATOM   4574  C CA  . LEU C  1 170 ? -24.109 -6.315  -44.810 1.00 50.37  ? 170 LEU C CA  1 
ATOM   4575  C C   . LEU C  1 170 ? -23.818 -7.760  -45.216 1.00 53.88  ? 170 LEU C C   1 
ATOM   4576  O O   . LEU C  1 170 ? -22.696 -8.089  -45.622 1.00 53.82  ? 170 LEU C O   1 
ATOM   4577  C CB  . LEU C  1 170 ? -24.238 -5.441  -46.058 1.00 45.20  ? 170 LEU C CB  1 
ATOM   4578  C CG  . LEU C  1 170 ? -24.931 -4.099  -45.823 1.00 43.74  ? 170 LEU C CG  1 
ATOM   4579  C CD1 . LEU C  1 170 ? -24.700 -3.152  -46.981 1.00 42.23  ? 170 LEU C CD1 1 
ATOM   4580  C CD2 . LEU C  1 170 ? -26.411 -4.342  -45.619 1.00 39.80  ? 170 LEU C CD2 1 
ATOM   4581  N N   . GLU C  1 171 ? -24.823 -8.626  -45.091 1.00 57.80  ? 171 GLU C N   1 
ATOM   4582  C CA  . GLU C  1 171 ? -24.656 -10.027 -45.477 1.00 61.02  ? 171 GLU C CA  1 
ATOM   4583  C C   . GLU C  1 171 ? -24.362 -10.097 -46.976 1.00 62.01  ? 171 GLU C C   1 
ATOM   4584  O O   . GLU C  1 171 ? -23.410 -10.749 -47.400 1.00 62.36  ? 171 GLU C O   1 
ATOM   4585  C CB  . GLU C  1 171 ? -25.921 -10.829 -45.160 1.00 64.10  ? 171 GLU C CB  1 
ATOM   4586  C CG  . GLU C  1 171 ? -26.139 -11.123 -43.679 1.00 68.81  ? 171 GLU C CG  1 
ATOM   4587  C CD  . GLU C  1 171 ? -27.400 -11.952 -43.415 1.00 72.02  ? 171 GLU C CD  1 
ATOM   4588  O OE1 . GLU C  1 171 ? -27.597 -12.386 -42.255 1.00 71.80  ? 171 GLU C OE1 1 
ATOM   4589  O OE2 . GLU C  1 171 ? -28.196 -12.166 -44.363 1.00 73.30  ? 171 GLU C OE2 1 
ATOM   4590  N N   . GLU C  1 172 ? -25.184 -9.411  -47.769 1.00 62.38  ? 172 GLU C N   1 
ATOM   4591  C CA  . GLU C  1 172 ? -25.027 -9.368  -49.222 1.00 62.67  ? 172 GLU C CA  1 
ATOM   4592  C C   . GLU C  1 172 ? -25.110 -7.904  -49.654 1.00 61.38  ? 172 GLU C C   1 
ATOM   4593  O O   . GLU C  1 172 ? -25.774 -7.098  -49.000 1.00 61.34  ? 172 GLU C O   1 
ATOM   4594  C CB  . GLU C  1 172 ? -26.146 -10.174 -49.895 1.00 65.97  ? 172 GLU C CB  1 
ATOM   4595  C CG  . GLU C  1 172 ? -27.548 -9.604  -49.649 1.00 71.11  ? 172 GLU C CG  1 
ATOM   4596  C CD  . GLU C  1 172 ? -28.678 -10.531 -50.101 1.00 73.72  ? 172 GLU C CD  1 
ATOM   4597  O OE1 . GLU C  1 172 ? -28.701 -10.919 -51.295 1.00 73.36  ? 172 GLU C OE1 1 
ATOM   4598  O OE2 . GLU C  1 172 ? -29.547 -10.863 -49.255 1.00 74.55  ? 172 GLU C OE2 1 
ATOM   4599  N N   . PRO C  1 173 ? -24.440 -7.538  -50.762 1.00 59.99  ? 173 PRO C N   1 
ATOM   4600  C CA  . PRO C  1 173 ? -24.474 -6.150  -51.234 1.00 58.75  ? 173 PRO C CA  1 
ATOM   4601  C C   . PRO C  1 173 ? -25.893 -5.592  -51.286 1.00 58.94  ? 173 PRO C C   1 
ATOM   4602  O O   . PRO C  1 173 ? -26.825 -6.286  -51.696 1.00 58.78  ? 173 PRO C O   1 
ATOM   4603  C CB  . PRO C  1 173 ? -23.837 -6.244  -52.613 1.00 58.03  ? 173 PRO C CB  1 
ATOM   4604  C CG  . PRO C  1 173 ? -22.834 -7.327  -52.428 1.00 59.02  ? 173 PRO C CG  1 
ATOM   4605  C CD  . PRO C  1 173 ? -23.619 -8.369  -51.658 1.00 58.98  ? 173 PRO C CD  1 
ATOM   4606  N N   . LEU C  1 174 ? -26.054 -4.344  -50.855 1.00 57.80  ? 174 LEU C N   1 
ATOM   4607  C CA  . LEU C  1 174 ? -27.363 -3.703  -50.859 1.00 57.03  ? 174 LEU C CA  1 
ATOM   4608  C C   . LEU C  1 174 ? -27.507 -2.865  -52.119 1.00 57.66  ? 174 LEU C C   1 
ATOM   4609  O O   . LEU C  1 174 ? -26.716 -1.958  -52.362 1.00 57.94  ? 174 LEU C O   1 
ATOM   4610  C CB  . LEU C  1 174 ? -27.526 -2.806  -49.636 1.00 56.06  ? 174 LEU C CB  1 
ATOM   4611  C CG  . LEU C  1 174 ? -28.959 -2.356  -49.369 1.00 55.69  ? 174 LEU C CG  1 
ATOM   4612  C CD1 . LEU C  1 174 ? -29.752 -3.547  -48.845 1.00 56.21  ? 174 LEU C CD1 1 
ATOM   4613  C CD2 . LEU C  1 174 ? -28.981 -1.229  -48.357 1.00 55.88  ? 174 LEU C CD2 1 
ATOM   4614  N N   . ARG C  1 175 ? -28.517 -3.171  -52.923 1.00 58.54  ? 175 ARG C N   1 
ATOM   4615  C CA  . ARG C  1 175 ? -28.735 -2.431  -54.155 1.00 58.13  ? 175 ARG C CA  1 
ATOM   4616  C C   . ARG C  1 175 ? -30.038 -1.645  -54.123 1.00 57.91  ? 175 ARG C C   1 
ATOM   4617  O O   . ARG C  1 175 ? -31.068 -2.141  -53.679 1.00 57.59  ? 175 ARG C O   1 
ATOM   4618  C CB  . ARG C  1 175 ? -28.745 -3.383  -55.347 1.00 59.00  ? 175 ARG C CB  1 
ATOM   4619  C CG  . ARG C  1 175 ? -28.961 -2.678  -56.672 1.00 61.99  ? 175 ARG C CG  1 
ATOM   4620  C CD  . ARG C  1 175 ? -29.074 -3.658  -57.821 1.00 61.78  ? 175 ARG C CD  1 
ATOM   4621  N NE  . ARG C  1 175 ? -27.839 -4.395  -58.057 1.00 63.73  ? 175 ARG C NE  1 
ATOM   4622  C CZ  . ARG C  1 175 ? -27.643 -5.212  -59.089 1.00 64.36  ? 175 ARG C CZ  1 
ATOM   4623  N NH1 . ARG C  1 175 ? -28.606 -5.397  -59.985 1.00 64.80  ? 175 ARG C NH1 1 
ATOM   4624  N NH2 . ARG C  1 175 ? -26.483 -5.840  -59.232 1.00 63.86  ? 175 ARG C NH2 1 
ATOM   4625  N N   . LYS C  1 176 ? -29.977 -0.402  -54.579 1.00 58.74  ? 176 LYS C N   1 
ATOM   4626  C CA  . LYS C  1 176 ? -31.157 0.442   -54.631 1.00 58.68  ? 176 LYS C CA  1 
ATOM   4627  C C   . LYS C  1 176 ? -31.375 0.831   -56.084 1.00 58.59  ? 176 LYS C C   1 
ATOM   4628  O O   . LYS C  1 176 ? -30.428 1.170   -56.801 1.00 59.13  ? 176 LYS C O   1 
ATOM   4629  C CB  . LYS C  1 176 ? -30.981 1.674   -53.750 1.00 60.13  ? 176 LYS C CB  1 
ATOM   4630  C CG  . LYS C  1 176 ? -30.971 1.362   -52.262 1.00 62.36  ? 176 LYS C CG  1 
ATOM   4631  C CD  . LYS C  1 176 ? -32.283 0.751   -51.773 1.00 63.14  ? 176 LYS C CD  1 
ATOM   4632  C CE  . LYS C  1 176 ? -32.248 0.566   -50.251 1.00 66.66  ? 176 LYS C CE  1 
ATOM   4633  N NZ  . LYS C  1 176 ? -33.442 -0.127  -49.673 1.00 66.80  ? 176 LYS C NZ  1 
ATOM   4634  N N   . HIS C  1 177 ? -32.632 0.771   -56.507 1.00 57.40  ? 177 HIS C N   1 
ATOM   4635  C CA  . HIS C  1 177 ? -33.003 1.049   -57.879 1.00 56.22  ? 177 HIS C CA  1 
ATOM   4636  C C   . HIS C  1 177 ? -33.636 2.417   -58.105 1.00 55.65  ? 177 HIS C C   1 
ATOM   4637  O O   . HIS C  1 177 ? -34.290 2.966   -57.221 1.00 55.09  ? 177 HIS C O   1 
ATOM   4638  C CB  . HIS C  1 177 ? -33.954 -0.051  -58.349 1.00 57.65  ? 177 HIS C CB  1 
ATOM   4639  C CG  . HIS C  1 177 ? -34.414 0.111   -59.760 1.00 60.18  ? 177 HIS C CG  1 
ATOM   4640  N ND1 . HIS C  1 177 ? -33.592 -0.125  -60.842 1.00 61.26  ? 177 HIS C ND1 1 
ATOM   4641  C CD2 . HIS C  1 177 ? -35.601 0.520   -60.268 1.00 60.66  ? 177 HIS C CD2 1 
ATOM   4642  C CE1 . HIS C  1 177 ? -34.253 0.132   -61.956 1.00 61.03  ? 177 HIS C CE1 1 
ATOM   4643  N NE2 . HIS C  1 177 ? -35.474 0.526   -61.636 1.00 61.63  ? 177 HIS C NE2 1 
ATOM   4644  N N   . TRP C  1 178 ? -33.437 2.963   -59.301 1.00 55.20  ? 178 TRP C N   1 
ATOM   4645  C CA  . TRP C  1 178 ? -34.010 4.258   -59.646 1.00 57.44  ? 178 TRP C CA  1 
ATOM   4646  C C   . TRP C  1 178 ? -34.269 4.355   -61.148 1.00 60.30  ? 178 TRP C C   1 
ATOM   4647  O O   . TRP C  1 178 ? -33.485 3.855   -61.953 1.00 59.90  ? 178 TRP C O   1 
ATOM   4648  C CB  . TRP C  1 178 ? -33.073 5.396   -59.236 1.00 54.64  ? 178 TRP C CB  1 
ATOM   4649  C CG  . TRP C  1 178 ? -33.703 6.754   -59.375 1.00 52.25  ? 178 TRP C CG  1 
ATOM   4650  C CD1 . TRP C  1 178 ? -34.356 7.454   -58.406 1.00 52.60  ? 178 TRP C CD1 1 
ATOM   4651  C CD2 . TRP C  1 178 ? -33.783 7.547   -60.565 1.00 50.52  ? 178 TRP C CD2 1 
ATOM   4652  N NE1 . TRP C  1 178 ? -34.838 8.635   -58.916 1.00 52.50  ? 178 TRP C NE1 1 
ATOM   4653  C CE2 . TRP C  1 178 ? -34.502 8.715   -60.240 1.00 50.97  ? 178 TRP C CE2 1 
ATOM   4654  C CE3 . TRP C  1 178 ? -33.318 7.383   -61.876 1.00 50.70  ? 178 TRP C CE3 1 
ATOM   4655  C CZ2 . TRP C  1 178 ? -34.769 9.717   -61.178 1.00 51.51  ? 178 TRP C CZ2 1 
ATOM   4656  C CZ3 . TRP C  1 178 ? -33.582 8.378   -62.808 1.00 50.39  ? 178 TRP C CZ3 1 
ATOM   4657  C CH2 . TRP C  1 178 ? -34.303 9.531   -62.453 1.00 51.08  ? 178 TRP C CH2 1 
ATOM   4658  N N   . GLU C  1 179 ? -35.370 5.003   -61.517 1.00 63.86  ? 179 GLU C N   1 
ATOM   4659  C CA  . GLU C  1 179 ? -35.722 5.187   -62.924 1.00 67.52  ? 179 GLU C CA  1 
ATOM   4660  C C   . GLU C  1 179 ? -36.691 6.345   -63.100 1.00 69.48  ? 179 GLU C C   1 
ATOM   4661  O O   . GLU C  1 179 ? -37.425 6.701   -62.177 1.00 69.68  ? 179 GLU C O   1 
ATOM   4662  C CB  . GLU C  1 179 ? -36.328 3.910   -63.509 1.00 69.64  ? 179 GLU C CB  1 
ATOM   4663  C CG  . GLU C  1 179 ? -37.445 3.301   -62.684 1.00 73.38  ? 179 GLU C CG  1 
ATOM   4664  C CD  . GLU C  1 179 ? -38.038 2.061   -63.338 1.00 75.55  ? 179 GLU C CD  1 
ATOM   4665  O OE1 . GLU C  1 179 ? -37.254 1.222   -63.839 1.00 75.32  ? 179 GLU C OE1 1 
ATOM   4666  O OE2 . GLU C  1 179 ? -39.285 1.927   -63.341 1.00 76.57  ? 179 GLU C OE2 1 
ATOM   4667  N N   . PHE C  1 180 ? -36.688 6.935   -64.291 1.00 71.66  ? 180 PHE C N   1 
ATOM   4668  C CA  . PHE C  1 180 ? -37.555 8.067   -64.579 1.00 73.42  ? 180 PHE C CA  1 
ATOM   4669  C C   . PHE C  1 180 ? -39.036 7.738   -64.411 1.00 75.46  ? 180 PHE C C   1 
ATOM   4670  O O   . PHE C  1 180 ? -39.468 6.609   -64.651 1.00 74.80  ? 180 PHE C O   1 
ATOM   4671  C CB  . PHE C  1 180 ? -37.306 8.575   -65.999 1.00 73.33  ? 180 PHE C CB  1 
ATOM   4672  C CG  . PHE C  1 180 ? -38.149 9.753   -66.368 1.00 73.29  ? 180 PHE C CG  1 
ATOM   4673  C CD1 . PHE C  1 180 ? -37.972 10.975  -65.730 1.00 73.90  ? 180 PHE C CD1 1 
ATOM   4674  C CD2 . PHE C  1 180 ? -39.150 9.631   -67.322 1.00 73.84  ? 180 PHE C CD2 1 
ATOM   4675  C CE1 . PHE C  1 180 ? -38.785 12.064  -66.037 1.00 74.81  ? 180 PHE C CE1 1 
ATOM   4676  C CE2 . PHE C  1 180 ? -39.971 10.712  -67.640 1.00 74.65  ? 180 PHE C CE2 1 
ATOM   4677  C CZ  . PHE C  1 180 ? -39.791 11.931  -66.996 1.00 74.84  ? 180 PHE C CZ  1 
ATOM   4678  N N   . GLU C  1 181 ? -39.801 8.742   -63.990 1.00 77.94  ? 181 GLU C N   1 
ATOM   4679  C CA  . GLU C  1 181 ? -41.240 8.613   -63.787 1.00 80.48  ? 181 GLU C CA  1 
ATOM   4680  C C   . GLU C  1 181 ? -41.885 9.929   -64.201 1.00 82.89  ? 181 GLU C C   1 
ATOM   4681  O O   . GLU C  1 181 ? -41.511 10.990  -63.699 1.00 83.36  ? 181 GLU C O   1 
ATOM   4682  C CB  . GLU C  1 181 ? -41.540 8.322   -62.327 1.00 80.94  ? 181 GLU C CB  1 
ATOM   4683  N N   . GLU C  1 182 ? -42.846 9.866   -65.118 1.00 85.42  ? 182 GLU C N   1 
ATOM   4684  C CA  . GLU C  1 182 ? -43.517 11.075  -65.593 1.00 87.99  ? 182 GLU C CA  1 
ATOM   4685  C C   . GLU C  1 182 ? -44.349 11.735  -64.489 1.00 89.50  ? 182 GLU C C   1 
ATOM   4686  O O   . GLU C  1 182 ? -44.044 12.900  -64.139 1.00 90.02  ? 182 GLU C O   1 
ATOM   4687  C CB  . GLU C  1 182 ? -44.401 10.744  -66.798 1.00 87.89  ? 182 GLU C CB  1 
ATOM   4688  N N   . GLY D  2 5   ? -6.603  38.177  -46.593 1.00 84.12  ? 1   GLY D N   1 
ATOM   4689  C CA  . GLY D  2 5   ? -5.127  38.252  -46.827 1.00 84.86  ? 1   GLY D CA  1 
ATOM   4690  C C   . GLY D  2 5   ? -4.353  37.203  -46.049 1.00 84.85  ? 1   GLY D C   1 
ATOM   4691  O O   . GLY D  2 5   ? -4.223  37.298  -44.824 1.00 84.42  ? 1   GLY D O   1 
ATOM   4692  N N   . LYS D  2 6   ? -3.836  36.204  -46.766 1.00 84.38  ? 2   LYS D N   1 
ATOM   4693  C CA  . LYS D  2 6   ? -3.073  35.114  -46.156 1.00 83.07  ? 2   LYS D CA  1 
ATOM   4694  C C   . LYS D  2 6   ? -3.852  34.458  -45.011 1.00 81.44  ? 2   LYS D C   1 
ATOM   4695  O O   . LYS D  2 6   ? -3.273  34.111  -43.980 1.00 82.45  ? 2   LYS D O   1 
ATOM   4696  C CB  . LYS D  2 6   ? -1.729  35.640  -45.643 1.00 83.04  ? 2   LYS D CB  1 
ATOM   4697  N N   . LYS D  2 7   ? -5.160  34.284  -45.196 1.00 78.75  ? 3   LYS D N   1 
ATOM   4698  C CA  . LYS D  2 7   ? -6.002  33.689  -44.161 1.00 74.78  ? 3   LYS D CA  1 
ATOM   4699  C C   . LYS D  2 7   ? -5.807  32.177  -44.046 1.00 71.50  ? 3   LYS D C   1 
ATOM   4700  O O   . LYS D  2 7   ? -6.322  31.399  -44.857 1.00 71.30  ? 3   LYS D O   1 
ATOM   4701  C CB  . LYS D  2 7   ? -7.469  34.028  -44.431 1.00 77.22  ? 3   LYS D CB  1 
ATOM   4702  C CG  . LYS D  2 7   ? -7.726  35.531  -44.530 1.00 80.08  ? 3   LYS D CG  1 
ATOM   4703  C CD  . LYS D  2 7   ? -9.194  35.893  -44.315 1.00 82.15  ? 3   LYS D CD  1 
ATOM   4704  C CE  . LYS D  2 7   ? -9.398  37.405  -44.377 1.00 83.01  ? 3   LYS D CE  1 
ATOM   4705  N NZ  . LYS D  2 7   ? -10.710 37.835  -43.810 1.00 83.51  ? 3   LYS D NZ  1 
ATOM   4706  N N   . VAL D  2 8   ? -5.058  31.775  -43.020 1.00 65.67  ? 4   VAL D N   1 
ATOM   4707  C CA  . VAL D  2 8   ? -4.750  30.370  -42.773 1.00 60.71  ? 4   VAL D CA  1 
ATOM   4708  C C   . VAL D  2 8   ? -5.620  29.724  -41.695 1.00 57.68  ? 4   VAL D C   1 
ATOM   4709  O O   . VAL D  2 8   ? -5.583  30.120  -40.528 1.00 57.38  ? 4   VAL D O   1 
ATOM   4710  C CB  . VAL D  2 8   ? -3.273  30.199  -42.351 1.00 60.33  ? 4   VAL D CB  1 
ATOM   4711  C CG1 . VAL D  2 8   ? -2.958  28.723  -42.117 1.00 59.25  ? 4   VAL D CG1 1 
ATOM   4712  C CG2 . VAL D  2 8   ? -2.364  30.773  -43.419 1.00 59.57  ? 4   VAL D CG2 1 
ATOM   4713  N N   . ILE D  2 9   ? -6.393  28.721  -42.091 1.00 52.86  ? 5   ILE D N   1 
ATOM   4714  C CA  . ILE D  2 9   ? -7.247  28.017  -41.141 1.00 49.22  ? 5   ILE D CA  1 
ATOM   4715  C C   . ILE D  2 9   ? -6.367  27.195  -40.201 1.00 46.93  ? 5   ILE D C   1 
ATOM   4716  O O   . ILE D  2 9   ? -5.487  26.460  -40.648 1.00 45.29  ? 5   ILE D O   1 
ATOM   4717  C CB  . ILE D  2 9   ? -8.205  27.056  -41.861 1.00 48.74  ? 5   ILE D CB  1 
ATOM   4718  C CG1 . ILE D  2 9   ? -9.032  27.818  -42.900 1.00 46.06  ? 5   ILE D CG1 1 
ATOM   4719  C CG2 . ILE D  2 9   ? -9.109  26.379  -40.846 1.00 48.26  ? 5   ILE D CG2 1 
ATOM   4720  C CD1 . ILE D  2 9   ? -9.647  26.928  -43.957 1.00 46.46  ? 5   ILE D CD1 1 
ATOM   4721  N N   . THR D  2 10  ? -6.600  27.317  -38.900 1.00 45.18  ? 6   THR D N   1 
ATOM   4722  C CA  . THR D  2 10  ? -5.813  26.567  -37.937 1.00 44.84  ? 6   THR D CA  1 
ATOM   4723  C C   . THR D  2 10  ? -6.572  25.327  -37.501 1.00 44.64  ? 6   THR D C   1 
ATOM   4724  O O   . THR D  2 10  ? -7.801  25.346  -37.427 1.00 45.81  ? 6   THR D O   1 
ATOM   4725  C CB  . THR D  2 10  ? -5.491  27.413  -36.691 1.00 45.74  ? 6   THR D CB  1 
ATOM   4726  O OG1 . THR D  2 10  ? -6.708  27.745  -36.014 1.00 48.67  ? 6   THR D OG1 1 
ATOM   4727  C CG2 . THR D  2 10  ? -4.772  28.697  -37.090 1.00 46.19  ? 6   THR D CG2 1 
ATOM   4728  N N   . ALA D  2 11  ? -5.839  24.257  -37.209 1.00 43.76  ? 7   ALA D N   1 
ATOM   4729  C CA  . ALA D  2 11  ? -6.441  23.001  -36.778 1.00 43.05  ? 7   ALA D CA  1 
ATOM   4730  C C   . ALA D  2 11  ? -6.290  22.812  -35.286 1.00 44.64  ? 7   ALA D C   1 
ATOM   4731  O O   . ALA D  2 11  ? -5.394  23.389  -34.663 1.00 44.73  ? 7   ALA D O   1 
ATOM   4732  C CB  . ALA D  2 11  ? -5.795  21.833  -37.496 1.00 40.13  ? 7   ALA D CB  1 
ATOM   4733  N N   . PHE D  2 12  ? -7.179  22.006  -34.713 1.00 45.05  ? 8   PHE D N   1 
ATOM   4734  C CA  . PHE D  2 12  ? -7.131  21.705  -33.288 1.00 46.00  ? 8   PHE D CA  1 
ATOM   4735  C C   . PHE D  2 12  ? -5.955  20.767  -33.123 1.00 48.09  ? 8   PHE D C   1 
ATOM   4736  O O   . PHE D  2 12  ? -5.693  19.942  -33.997 1.00 48.29  ? 8   PHE D O   1 
ATOM   4737  C CB  . PHE D  2 12  ? -8.403  20.988  -32.840 1.00 44.74  ? 8   PHE D CB  1 
ATOM   4738  C CG  . PHE D  2 12  ? -9.617  21.857  -32.825 1.00 43.94  ? 8   PHE D CG  1 
ATOM   4739  C CD1 . PHE D  2 12  ? -9.888  22.661  -31.726 1.00 46.06  ? 8   PHE D CD1 1 
ATOM   4740  C CD2 . PHE D  2 12  ? -10.495 21.870  -33.903 1.00 40.78  ? 8   PHE D CD2 1 
ATOM   4741  C CE1 . PHE D  2 12  ? -11.023 23.470  -31.696 1.00 46.21  ? 8   PHE D CE1 1 
ATOM   4742  C CE2 . PHE D  2 12  ? -11.624 22.665  -33.887 1.00 42.67  ? 8   PHE D CE2 1 
ATOM   4743  C CZ  . PHE D  2 12  ? -11.893 23.471  -32.780 1.00 45.48  ? 8   PHE D CZ  1 
ATOM   4744  N N   . ASN D  2 13  ? -5.246  20.880  -32.008 1.00 51.07  ? 9   ASN D N   1 
ATOM   4745  C CA  . ASN D  2 13  ? -4.097  20.020  -31.779 1.00 55.49  ? 9   ASN D CA  1 
ATOM   4746  C C   . ASN D  2 13  ? -4.471  18.852  -30.886 1.00 56.34  ? 9   ASN D C   1 
ATOM   4747  O O   . ASN D  2 13  ? -4.916  19.040  -29.764 1.00 57.74  ? 9   ASN D O   1 
ATOM   4748  C CB  . ASN D  2 13  ? -2.967  20.811  -31.139 1.00 59.80  ? 9   ASN D CB  1 
ATOM   4749  C CG  . ASN D  2 13  ? -1.667  20.054  -31.156 1.00 63.41  ? 9   ASN D CG  1 
ATOM   4750  O OD1 . ASN D  2 13  ? -1.221  19.602  -32.213 1.00 62.06  ? 9   ASN D OD1 1 
ATOM   4751  N ND2 . ASN D  2 13  ? -1.046  19.905  -29.986 1.00 67.12  ? 9   ASN D ND2 1 
ATOM   4752  N N   . GLU D  2 14  ? -4.265  17.640  -31.375 1.00 57.41  ? 10  GLU D N   1 
ATOM   4753  C CA  . GLU D  2 14  ? -4.636  16.454  -30.617 1.00 58.89  ? 10  GLU D CA  1 
ATOM   4754  C C   . GLU D  2 14  ? -3.551  16.027  -29.638 1.00 57.35  ? 10  GLU D C   1 
ATOM   4755  O O   . GLU D  2 14  ? -2.364  16.075  -29.959 1.00 57.77  ? 10  GLU D O   1 
ATOM   4756  C CB  . GLU D  2 14  ? -4.938  15.305  -31.577 1.00 62.36  ? 10  GLU D CB  1 
ATOM   4757  C CG  . GLU D  2 14  ? -6.018  14.361  -31.082 1.00 67.50  ? 10  GLU D CG  1 
ATOM   4758  C CD  . GLU D  2 14  ? -7.395  15.007  -31.089 1.00 71.28  ? 10  GLU D CD  1 
ATOM   4759  O OE1 . GLU D  2 14  ? -7.697  15.818  -30.179 1.00 71.92  ? 10  GLU D OE1 1 
ATOM   4760  O OE2 . GLU D  2 14  ? -8.167  14.716  -32.029 1.00 72.17  ? 10  GLU D OE2 1 
ATOM   4761  N N   . GLY D  2 15  ? -3.959  15.626  -28.439 1.00 54.21  ? 11  GLY D N   1 
ATOM   4762  C CA  . GLY D  2 15  ? -2.994  15.192  -27.447 1.00 50.71  ? 11  GLY D CA  1 
ATOM   4763  C C   . GLY D  2 15  ? -2.684  13.716  -27.607 1.00 48.83  ? 11  GLY D C   1 
ATOM   4764  O O   . GLY D  2 15  ? -3.477  12.982  -28.195 1.00 48.37  ? 11  GLY D O   1 
ATOM   4765  N N   . LEU D  2 16  ? -1.532  13.279  -27.098 1.00 46.46  ? 12  LEU D N   1 
ATOM   4766  C CA  . LEU D  2 16  ? -1.133  11.875  -27.179 1.00 44.00  ? 12  LEU D CA  1 
ATOM   4767  C C   . LEU D  2 16  ? -1.610  11.113  -25.951 1.00 43.68  ? 12  LEU D C   1 
ATOM   4768  O O   . LEU D  2 16  ? -1.543  11.622  -24.839 1.00 44.42  ? 12  LEU D O   1 
ATOM   4769  C CB  . LEU D  2 16  ? 0.385   11.760  -27.297 1.00 44.52  ? 12  LEU D CB  1 
ATOM   4770  C CG  . LEU D  2 16  ? 1.006   11.990  -28.679 1.00 44.95  ? 12  LEU D CG  1 
ATOM   4771  C CD1 . LEU D  2 16  ? 0.559   10.879  -29.614 1.00 44.22  ? 12  LEU D CD1 1 
ATOM   4772  C CD2 . LEU D  2 16  ? 0.619   13.355  -29.227 1.00 44.98  ? 12  LEU D CD2 1 
ATOM   4773  N N   . LYS D  2 17  ? -2.086  9.890   -26.147 1.00 42.73  ? 13  LYS D N   1 
ATOM   4774  C CA  . LYS D  2 17  ? -2.582  9.093   -25.037 1.00 41.78  ? 13  LYS D CA  1 
ATOM   4775  C C   . LYS D  2 17  ? -1.489  8.247   -24.425 1.00 42.27  ? 13  LYS D C   1 
ATOM   4776  O O   . LYS D  2 17  ? -0.549  7.843   -25.107 1.00 41.64  ? 13  LYS D O   1 
ATOM   4777  C CB  . LYS D  2 17  ? -3.741  8.209   -25.505 1.00 41.06  ? 13  LYS D CB  1 
ATOM   4778  C CG  . LYS D  2 17  ? -4.951  9.003   -25.987 1.00 39.75  ? 13  LYS D CG  1 
ATOM   4779  C CD  . LYS D  2 17  ? -6.086  8.083   -26.437 1.00 39.83  ? 13  LYS D CD  1 
ATOM   4780  C CE  . LYS D  2 17  ? -7.276  8.878   -26.946 1.00 40.06  ? 13  LYS D CE  1 
ATOM   4781  N NZ  . LYS D  2 17  ? -8.343  7.965   -27.442 1.00 41.71  ? 13  LYS D NZ  1 
ATOM   4782  N N   . GLY D  2 18  ? -1.614  7.997   -23.126 1.00 42.91  ? 14  GLY D N   1 
ATOM   4783  C CA  . GLY D  2 18  ? -0.622  7.200   -22.423 1.00 43.49  ? 14  GLY D CA  1 
ATOM   4784  C C   . GLY D  2 18  ? -1.114  5.811   -22.073 1.00 44.22  ? 14  GLY D C   1 
ATOM   4785  O O   . GLY D  2 18  ? -2.192  5.406   -22.502 1.00 44.76  ? 14  GLY D O   1 
ATOM   4786  N N   . GLY D  2 19  ? -0.327  5.083   -21.284 1.00 45.11  ? 15  GLY D N   1 
ATOM   4787  C CA  . GLY D  2 19  ? -0.697  3.733   -20.891 1.00 46.46  ? 15  GLY D CA  1 
ATOM   4788  C C   . GLY D  2 19  ? -1.548  3.706   -19.632 1.00 48.54  ? 15  GLY D C   1 
ATOM   4789  O O   . GLY D  2 19  ? -1.914  4.755   -19.099 1.00 48.76  ? 15  GLY D O   1 
ATOM   4790  N N   . GLY D  2 20  ? -1.869  2.508   -19.154 1.00 49.19  ? 16  GLY D N   1 
ATOM   4791  C CA  . GLY D  2 20  ? -2.677  2.391   -17.953 1.00 50.56  ? 16  GLY D CA  1 
ATOM   4792  C C   . GLY D  2 20  ? -4.171  2.391   -18.228 1.00 52.18  ? 16  GLY D C   1 
ATOM   4793  O O   . GLY D  2 20  ? -4.610  2.712   -19.330 1.00 52.59  ? 16  GLY D O   1 
ATOM   4794  N N   . GLY D  2 21  ? -4.951  2.020   -17.220 1.00 53.36  ? 17  GLY D N   1 
ATOM   4795  C CA  . GLY D  2 21  ? -6.395  1.990   -17.357 1.00 52.79  ? 17  GLY D CA  1 
ATOM   4796  C C   . GLY D  2 21  ? -6.916  0.849   -18.205 1.00 53.32  ? 17  GLY D C   1 
ATOM   4797  O O   . GLY D  2 21  ? -8.074  0.867   -18.606 1.00 54.30  ? 17  GLY D O   1 
ATOM   4798  N N   . SER D  2 22  ? -6.083  -0.150  -18.475 1.00 53.50  ? 18  SER D N   1 
ATOM   4799  C CA  . SER D  2 22  ? -6.515  -1.273  -19.305 1.00 55.38  ? 18  SER D CA  1 
ATOM   4800  C C   . SER D  2 22  ? -7.742  -2.014  -18.782 1.00 55.98  ? 18  SER D C   1 
ATOM   4801  O O   . SER D  2 22  ? -7.952  -2.106  -17.573 1.00 55.60  ? 18  SER D O   1 
ATOM   4802  C CB  . SER D  2 22  ? -5.355  -2.236  -19.506 1.00 55.59  ? 18  SER D CB  1 
ATOM   4803  O OG  . SER D  2 22  ? -4.380  -1.608  -20.321 1.00 60.63  ? 18  SER D OG  1 
ATOM   4804  N N   . LEU D  2 23  ? -8.546  -2.545  -19.703 1.00 56.60  ? 19  LEU D N   1 
ATOM   4805  C CA  . LEU D  2 23  ? -9.775  -3.247  -19.339 1.00 57.98  ? 19  LEU D CA  1 
ATOM   4806  C C   . LEU D  2 23  ? -9.881  -4.645  -19.923 1.00 61.32  ? 19  LEU D C   1 
ATOM   4807  O O   . LEU D  2 23  ? -9.231  -4.970  -20.912 1.00 62.37  ? 19  LEU D O   1 
ATOM   4808  C CB  . LEU D  2 23  ? -10.993 -2.434  -19.784 1.00 54.32  ? 19  LEU D CB  1 
ATOM   4809  C CG  . LEU D  2 23  ? -11.009 -0.956  -19.382 1.00 53.47  ? 19  LEU D CG  1 
ATOM   4810  C CD1 . LEU D  2 23  ? -12.333 -0.333  -19.806 1.00 50.65  ? 19  LEU D CD1 1 
ATOM   4811  C CD2 . LEU D  2 23  ? -10.809 -0.823  -17.876 1.00 51.97  ? 19  LEU D CD2 1 
ATOM   4812  N N   . VAL D  2 24  ? -10.728 -5.460  -19.309 1.00 65.15  ? 20  VAL D N   1 
ATOM   4813  C CA  . VAL D  2 24  ? -10.940 -6.830  -19.745 1.00 69.76  ? 20  VAL D CA  1 
ATOM   4814  C C   . VAL D  2 24  ? -11.640 -6.916  -21.100 1.00 73.18  ? 20  VAL D C   1 
ATOM   4815  O O   . VAL D  2 24  ? -11.153 -7.571  -22.021 1.00 72.74  ? 20  VAL D O   1 
ATOM   4816  C CB  . VAL D  2 24  ? -11.775 -7.600  -18.702 1.00 70.26  ? 20  VAL D CB  1 
ATOM   4817  C CG1 . VAL D  2 24  ? -12.014 -9.025  -19.171 1.00 70.84  ? 20  VAL D CG1 1 
ATOM   4818  C CG2 . VAL D  2 24  ? -11.059 -7.588  -17.362 1.00 69.40  ? 20  VAL D CG2 1 
ATOM   4819  N N   . GLY D  2 25  ? -12.786 -6.256  -21.214 1.00 77.86  ? 21  GLY D N   1 
ATOM   4820  C CA  . GLY D  2 25  ? -13.533 -6.283  -22.462 1.00 83.59  ? 21  GLY D CA  1 
ATOM   4821  C C   . GLY D  2 25  ? -14.510 -7.447  -22.515 1.00 87.27  ? 21  GLY D C   1 
ATOM   4822  O O   . GLY D  2 25  ? -14.396 -8.390  -21.724 1.00 87.81  ? 21  GLY D O   1 
ATOM   4823  N N   . GLY D  2 26  ? -15.467 -7.392  -23.442 1.00 89.94  ? 22  GLY D N   1 
ATOM   4824  C CA  . GLY D  2 26  ? -16.446 -8.464  -23.553 1.00 92.92  ? 22  GLY D CA  1 
ATOM   4825  C C   . GLY D  2 26  ? -17.131 -8.606  -24.904 1.00 94.90  ? 22  GLY D C   1 
ATOM   4826  O O   . GLY D  2 26  ? -16.782 -7.922  -25.869 1.00 95.18  ? 22  GLY D O   1 
ATOM   4827  N N   . GLY D  2 27  ? -18.116 -9.502  -24.964 1.00 96.43  ? 23  GLY D N   1 
ATOM   4828  C CA  . GLY D  2 27  ? -18.849 -9.746  -26.196 1.00 97.81  ? 23  GLY D CA  1 
ATOM   4829  C C   . GLY D  2 27  ? -19.576 -8.535  -26.751 1.00 98.70  ? 23  GLY D C   1 
ATOM   4830  O O   . GLY D  2 27  ? -20.712 -8.244  -26.369 1.00 98.81  ? 23  GLY D O   1 
ATOM   4831  N N   . SER D  2 28  ? -18.917 -7.830  -27.664 1.00 99.35  ? 24  SER D N   1 
ATOM   4832  C CA  . SER D  2 28  ? -19.493 -6.645  -28.282 1.00 99.47  ? 24  SER D CA  1 
ATOM   4833  C C   . SER D  2 28  ? -20.201 -7.013  -29.581 1.00 99.73  ? 24  SER D C   1 
ATOM   4834  O O   . SER D  2 28  ? -21.425 -6.908  -29.689 1.00 99.70  ? 24  SER D O   1 
ATOM   4835  C CB  . SER D  2 28  ? -18.397 -5.615  -28.563 1.00 99.08  ? 24  SER D CB  1 
ATOM   4836  O OG  . SER D  2 28  ? -17.746 -5.221  -27.369 1.00 99.15  ? 24  SER D OG  1 
ATOM   4837  N N   . GLY D  2 29  ? -19.424 -7.450  -30.566 1.00 99.76  ? 25  GLY D N   1 
ATOM   4838  C CA  . GLY D  2 29  ? -20.000 -7.821  -31.843 1.00 99.80  ? 25  GLY D CA  1 
ATOM   4839  C C   . GLY D  2 29  ? -19.048 -8.655  -32.672 1.00 99.76  ? 25  GLY D C   1 
ATOM   4840  O O   . GLY D  2 29  ? -19.210 -8.770  -33.887 1.00 99.88  ? 25  GLY D O   1 
ATOM   4841  N N   . GLY D  2 30  ? -18.050 -9.236  -32.012 1.00 99.44  ? 26  GLY D N   1 
ATOM   4842  C CA  . GLY D  2 30  ? -17.081 -10.064 -32.707 1.00 98.72  ? 26  GLY D CA  1 
ATOM   4843  C C   . GLY D  2 30  ? -17.610 -11.447 -33.054 1.00 97.82  ? 26  GLY D C   1 
ATOM   4844  O O   . GLY D  2 30  ? -18.781 -11.761 -32.813 1.00 98.11  ? 26  GLY D O   1 
ATOM   4845  N N   . GLY D  2 31  ? -16.740 -12.277 -33.621 1.00 96.07  ? 27  GLY D N   1 
ATOM   4846  C CA  . GLY D  2 31  ? -17.131 -13.621 -34.002 1.00 93.28  ? 27  GLY D CA  1 
ATOM   4847  C C   . GLY D  2 31  ? -16.963 -13.839 -35.493 1.00 91.25  ? 27  GLY D C   1 
ATOM   4848  O O   . GLY D  2 31  ? -15.864 -14.133 -35.968 1.00 91.55  ? 27  GLY D O   1 
ATOM   4849  N N   . GLY D  2 32  ? -18.054 -13.693 -36.238 1.00 88.72  ? 28  GLY D N   1 
ATOM   4850  C CA  . GLY D  2 32  ? -17.988 -13.876 -37.676 1.00 85.22  ? 28  GLY D CA  1 
ATOM   4851  C C   . GLY D  2 32  ? -17.685 -12.574 -38.392 1.00 82.37  ? 28  GLY D C   1 
ATOM   4852  O O   . GLY D  2 32  ? -17.082 -12.570 -39.470 1.00 82.37  ? 28  GLY D O   1 
ATOM   4853  N N   . SER D  2 33  ? -18.105 -11.466 -37.786 1.00 78.61  ? 29  SER D N   1 
ATOM   4854  C CA  . SER D  2 33  ? -17.886 -10.140 -38.356 1.00 74.08  ? 29  SER D CA  1 
ATOM   4855  C C   . SER D  2 33  ? -16.400 -9.811  -38.369 1.00 69.78  ? 29  SER D C   1 
ATOM   4856  O O   . SER D  2 33  ? -15.650 -10.216 -37.477 1.00 70.18  ? 29  SER D O   1 
ATOM   4857  C CB  . SER D  2 33  ? -18.637 -9.080  -37.542 1.00 76.12  ? 29  SER D CB  1 
ATOM   4858  O OG  . SER D  2 33  ? -18.108 -8.973  -36.227 1.00 78.89  ? 29  SER D OG  1 
ATOM   4859  N N   . ARG D  2 34  ? -15.976 -9.073  -39.385 1.00 64.04  ? 30  ARG D N   1 
ATOM   4860  C CA  . ARG D  2 34  ? -14.577 -8.705  -39.501 1.00 58.48  ? 30  ARG D CA  1 
ATOM   4861  C C   . ARG D  2 34  ? -14.208 -7.696  -38.426 1.00 53.73  ? 30  ARG D C   1 
ATOM   4862  O O   . ARG D  2 34  ? -14.898 -6.697  -38.237 1.00 53.28  ? 30  ARG D O   1 
ATOM   4863  C CB  . ARG D  2 34  ? -14.294 -8.098  -40.873 1.00 59.11  ? 30  ARG D CB  1 
ATOM   4864  C CG  . ARG D  2 34  ? -12.818 -8.053  -41.200 1.00 60.28  ? 30  ARG D CG  1 
ATOM   4865  C CD  . ARG D  2 34  ? -12.516 -7.082  -42.317 1.00 59.15  ? 30  ARG D CD  1 
ATOM   4866  N NE  . ARG D  2 34  ? -12.924 -5.734  -41.947 1.00 61.91  ? 30  ARG D NE  1 
ATOM   4867  C CZ  . ARG D  2 34  ? -12.339 -4.628  -42.393 1.00 61.66  ? 30  ARG D CZ  1 
ATOM   4868  N NH1 . ARG D  2 34  ? -11.308 -4.707  -43.227 1.00 60.89  ? 30  ARG D NH1 1 
ATOM   4869  N NH2 . ARG D  2 34  ? -12.792 -3.442  -42.009 1.00 60.94  ? 30  ARG D NH2 1 
ATOM   4870  N N   . PRO D  2 35  ? -13.111 -7.951  -37.702 1.00 50.31  ? 31  PRO D N   1 
ATOM   4871  C CA  . PRO D  2 35  ? -12.640 -7.057  -36.640 1.00 46.90  ? 31  PRO D CA  1 
ATOM   4872  C C   . PRO D  2 35  ? -12.123 -5.750  -37.233 1.00 44.56  ? 31  PRO D C   1 
ATOM   4873  O O   . PRO D  2 35  ? -11.515 -5.739  -38.308 1.00 44.95  ? 31  PRO D O   1 
ATOM   4874  C CB  . PRO D  2 35  ? -11.511 -7.850  -35.985 1.00 46.75  ? 31  PRO D CB  1 
ATOM   4875  C CG  . PRO D  2 35  ? -11.830 -9.279  -36.326 1.00 48.42  ? 31  PRO D CG  1 
ATOM   4876  C CD  . PRO D  2 35  ? -12.295 -9.173  -37.749 1.00 49.52  ? 31  PRO D CD  1 
ATOM   4877  N N   . TRP D  2 36  ? -12.375 -4.647  -36.541 1.00 41.36  ? 32  TRP D N   1 
ATOM   4878  C CA  . TRP D  2 36  ? -11.908 -3.350  -36.992 1.00 38.26  ? 32  TRP D CA  1 
ATOM   4879  C C   . TRP D  2 36  ? -11.671 -2.470  -35.771 1.00 39.01  ? 32  TRP D C   1 
ATOM   4880  O O   . TRP D  2 36  ? -12.315 -2.644  -34.733 1.00 37.46  ? 32  TRP D O   1 
ATOM   4881  C CB  . TRP D  2 36  ? -12.916 -2.709  -37.952 1.00 36.07  ? 32  TRP D CB  1 
ATOM   4882  C CG  . TRP D  2 36  ? -14.299 -2.645  -37.428 1.00 33.35  ? 32  TRP D CG  1 
ATOM   4883  C CD1 . TRP D  2 36  ? -15.224 -3.656  -37.404 1.00 33.57  ? 32  TRP D CD1 1 
ATOM   4884  C CD2 . TRP D  2 36  ? -14.924 -1.513  -36.823 1.00 31.62  ? 32  TRP D CD2 1 
ATOM   4885  N NE1 . TRP D  2 36  ? -16.390 -3.217  -36.817 1.00 30.40  ? 32  TRP D NE1 1 
ATOM   4886  C CE2 . TRP D  2 36  ? -16.232 -1.905  -36.452 1.00 31.48  ? 32  TRP D CE2 1 
ATOM   4887  C CE3 . TRP D  2 36  ? -14.507 -0.206  -36.559 1.00 28.65  ? 32  TRP D CE3 1 
ATOM   4888  C CZ2 . TRP D  2 36  ? -17.122 -1.033  -35.832 1.00 30.70  ? 32  TRP D CZ2 1 
ATOM   4889  C CZ3 . TRP D  2 36  ? -15.392 0.659   -35.943 1.00 32.09  ? 32  TRP D CZ3 1 
ATOM   4890  C CH2 . TRP D  2 36  ? -16.686 0.243   -35.587 1.00 32.07  ? 32  TRP D CH2 1 
ATOM   4891  N N   . PHE D  2 37  ? -10.729 -1.539  -35.902 1.00 37.22  ? 33  PHE D N   1 
ATOM   4892  C CA  . PHE D  2 37  ? -10.362 -0.640  -34.814 1.00 36.65  ? 33  PHE D CA  1 
ATOM   4893  C C   . PHE D  2 37  ? -10.324 0.774   -35.366 1.00 34.47  ? 33  PHE D C   1 
ATOM   4894  O O   . PHE D  2 37  ? -9.649  1.058   -36.363 1.00 34.01  ? 33  PHE D O   1 
ATOM   4895  C CB  . PHE D  2 37  ? -9.005  -1.083  -34.254 1.00 38.07  ? 33  PHE D CB  1 
ATOM   4896  C CG  . PHE D  2 37  ? -8.965  -2.546  -33.941 1.00 38.25  ? 33  PHE D CG  1 
ATOM   4897  C CD1 . PHE D  2 37  ? -9.504  -3.030  -32.749 1.00 40.71  ? 33  PHE D CD1 1 
ATOM   4898  C CD2 . PHE D  2 37  ? -8.518  -3.461  -34.893 1.00 38.75  ? 33  PHE D CD2 1 
ATOM   4899  C CE1 . PHE D  2 37  ? -9.608  -4.410  -32.513 1.00 40.05  ? 33  PHE D CE1 1 
ATOM   4900  C CE2 . PHE D  2 37  ? -8.616  -4.836  -34.670 1.00 37.84  ? 33  PHE D CE2 1 
ATOM   4901  C CZ  . PHE D  2 37  ? -9.163  -5.310  -33.480 1.00 38.27  ? 33  PHE D CZ  1 
ATOM   4902  N N   . LEU D  2 38  ? -11.056 1.655   -34.702 1.00 32.18  ? 34  LEU D N   1 
ATOM   4903  C CA  . LEU D  2 38  ? -11.185 3.027   -35.141 1.00 30.57  ? 34  LEU D CA  1 
ATOM   4904  C C   . LEU D  2 38  ? -10.983 4.063   -34.048 1.00 30.07  ? 34  LEU D C   1 
ATOM   4905  O O   . LEU D  2 38  ? -11.646 4.024   -33.013 1.00 30.60  ? 34  LEU D O   1 
ATOM   4906  C CB  . LEU D  2 38  ? -12.576 3.192   -35.754 1.00 31.29  ? 34  LEU D CB  1 
ATOM   4907  C CG  . LEU D  2 38  ? -13.035 4.596   -36.138 1.00 32.84  ? 34  LEU D CG  1 
ATOM   4908  C CD1 . LEU D  2 38  ? -12.322 5.033   -37.405 1.00 27.02  ? 34  LEU D CD1 1 
ATOM   4909  C CD2 . LEU D  2 38  ? -14.556 4.600   -36.319 1.00 31.62  ? 34  LEU D CD2 1 
ATOM   4910  N N   . GLU D  2 39  ? -10.061 4.988   -34.288 1.00 29.02  ? 35  GLU D N   1 
ATOM   4911  C CA  . GLU D  2 39  ? -9.769  6.078   -33.363 1.00 29.22  ? 35  GLU D CA  1 
ATOM   4912  C C   . GLU D  2 39  ? -10.366 7.258   -34.117 1.00 29.32  ? 35  GLU D C   1 
ATOM   4913  O O   . GLU D  2 39  ? -9.843  7.689   -35.143 1.00 27.24  ? 35  GLU D O   1 
ATOM   4914  C CB  . GLU D  2 39  ? -8.257  6.254   -33.189 1.00 30.39  ? 35  GLU D CB  1 
ATOM   4915  C CG  . GLU D  2 39  ? -7.856  7.475   -32.355 1.00 34.41  ? 35  GLU D CG  1 
ATOM   4916  C CD  . GLU D  2 39  ? -8.304  7.390   -30.895 1.00 38.91  ? 35  GLU D CD  1 
ATOM   4917  O OE1 . GLU D  2 39  ? -8.890  6.351   -30.505 1.00 41.57  ? 35  GLU D OE1 1 
ATOM   4918  O OE2 . GLU D  2 39  ? -8.066  8.365   -30.134 1.00 37.82  ? 35  GLU D OE2 1 
ATOM   4919  N N   . TYR D  2 40  ? -11.488 7.743   -33.614 1.00 29.32  ? 36  TYR D N   1 
ATOM   4920  C CA  . TYR D  2 40  ? -12.242 8.806   -34.244 1.00 28.37  ? 36  TYR D CA  1 
ATOM   4921  C C   . TYR D  2 40  ? -12.384 10.004  -33.344 1.00 27.96  ? 36  TYR D C   1 
ATOM   4922  O O   . TYR D  2 40  ? -12.759 9.875   -32.184 1.00 29.98  ? 36  TYR D O   1 
ATOM   4923  C CB  . TYR D  2 40  ? -13.622 8.247   -34.596 1.00 29.31  ? 36  TYR D CB  1 
ATOM   4924  C CG  . TYR D  2 40  ? -14.511 9.171   -35.379 1.00 27.35  ? 36  TYR D CG  1 
ATOM   4925  C CD1 . TYR D  2 40  ? -13.987 10.008  -36.359 1.00 26.70  ? 36  TYR D CD1 1 
ATOM   4926  C CD2 . TYR D  2 40  ? -15.889 9.159   -35.184 1.00 28.14  ? 36  TYR D CD2 1 
ATOM   4927  C CE1 . TYR D  2 40  ? -14.812 10.810  -37.133 1.00 29.02  ? 36  TYR D CE1 1 
ATOM   4928  C CE2 . TYR D  2 40  ? -16.722 9.952   -35.949 1.00 29.71  ? 36  TYR D CE2 1 
ATOM   4929  C CZ  . TYR D  2 40  ? -16.178 10.773  -36.927 1.00 30.34  ? 36  TYR D CZ  1 
ATOM   4930  O OH  . TYR D  2 40  ? -16.999 11.524  -37.719 1.00 32.36  ? 36  TYR D OH  1 
ATOM   4931  N N   . CYS D  2 41  ? -12.112 11.178  -33.886 1.00 28.77  ? 37  CYS D N   1 
ATOM   4932  C CA  . CYS D  2 41  ? -12.206 12.395  -33.102 1.00 32.08  ? 37  CYS D CA  1 
ATOM   4933  C C   . CYS D  2 41  ? -12.921 13.534  -33.814 1.00 31.67  ? 37  CYS D C   1 
ATOM   4934  O O   . CYS D  2 41  ? -12.643 13.827  -34.976 1.00 32.52  ? 37  CYS D O   1 
ATOM   4935  C CB  . CYS D  2 41  ? -10.808 12.863  -32.715 1.00 34.31  ? 37  CYS D CB  1 
ATOM   4936  S SG  . CYS D  2 41  ? -10.859 14.215  -31.554 1.00 46.67  ? 37  CYS D SG  1 
ATOM   4937  N N   . LYS D  2 42  ? -13.846 14.177  -33.112 1.00 33.41  ? 38  LYS D N   1 
ATOM   4938  C CA  . LYS D  2 42  ? -14.574 15.312  -33.673 1.00 32.61  ? 38  LYS D CA  1 
ATOM   4939  C C   . LYS D  2 42  ? -14.508 16.484  -32.716 1.00 33.48  ? 38  LYS D C   1 
ATOM   4940  O O   . LYS D  2 42  ? -14.816 16.353  -31.531 1.00 32.11  ? 38  LYS D O   1 
ATOM   4941  C CB  . LYS D  2 42  ? -16.041 14.964  -33.947 1.00 30.92  ? 38  LYS D CB  1 
ATOM   4942  C CG  . LYS D  2 42  ? -16.218 13.957  -35.074 1.00 34.32  ? 38  LYS D CG  1 
ATOM   4943  C CD  . LYS D  2 42  ? -17.684 13.734  -35.439 1.00 35.83  ? 38  LYS D CD  1 
ATOM   4944  C CE  . LYS D  2 42  ? -18.473 13.101  -34.314 1.00 36.18  ? 38  LYS D CE  1 
ATOM   4945  N NZ  . LYS D  2 42  ? -19.887 12.937  -34.729 1.00 37.73  ? 38  LYS D NZ  1 
ATOM   4946  N N   . SER D  2 43  ? -14.081 17.630  -33.237 1.00 35.01  ? 39  SER D N   1 
ATOM   4947  C CA  . SER D  2 43  ? -13.981 18.852  -32.444 1.00 36.06  ? 39  SER D CA  1 
ATOM   4948  C C   . SER D  2 43  ? -14.992 19.832  -33.008 1.00 36.72  ? 39  SER D C   1 
ATOM   4949  O O   . SER D  2 43  ? -14.848 20.309  -34.139 1.00 36.68  ? 39  SER D O   1 
ATOM   4950  C CB  . SER D  2 43  ? -12.573 19.442  -32.545 1.00 35.20  ? 39  SER D CB  1 
ATOM   4951  O OG  . SER D  2 43  ? -11.603 18.455  -32.254 1.00 36.14  ? 39  SER D OG  1 
ATOM   4952  N N   . GLU D  2 44  ? -16.003 20.146  -32.211 1.00 37.76  ? 40  GLU D N   1 
ATOM   4953  C CA  . GLU D  2 44  ? -17.053 21.033  -32.669 1.00 40.88  ? 40  GLU D CA  1 
ATOM   4954  C C   . GLU D  2 44  ? -17.055 22.417  -32.033 1.00 42.15  ? 40  GLU D C   1 
ATOM   4955  O O   . GLU D  2 44  ? -16.977 22.568  -30.804 1.00 43.25  ? 40  GLU D O   1 
ATOM   4956  C CB  . GLU D  2 44  ? -18.415 20.370  -32.436 1.00 42.09  ? 40  GLU D CB  1 
ATOM   4957  C CG  . GLU D  2 44  ? -18.335 18.855  -32.264 1.00 46.41  ? 40  GLU D CG  1 
ATOM   4958  C CD  . GLU D  2 44  ? -19.687 18.204  -32.019 1.00 47.38  ? 40  GLU D CD  1 
ATOM   4959  O OE1 . GLU D  2 44  ? -20.371 18.569  -31.033 1.00 45.56  ? 40  GLU D OE1 1 
ATOM   4960  O OE2 . GLU D  2 44  ? -20.060 17.318  -32.821 1.00 49.51  ? 40  GLU D OE2 1 
ATOM   4961  N N   . CYS D  2 45  ? -17.149 23.429  -32.886 1.00 42.33  ? 41  CYS D N   1 
ATOM   4962  C CA  . CYS D  2 45  ? -17.216 24.805  -32.423 1.00 43.69  ? 41  CYS D CA  1 
ATOM   4963  C C   . CYS D  2 45  ? -18.644 25.246  -32.668 1.00 42.96  ? 41  CYS D C   1 
ATOM   4964  O O   . CYS D  2 45  ? -19.073 25.392  -33.812 1.00 42.27  ? 41  CYS D O   1 
ATOM   4965  C CB  . CYS D  2 45  ? -16.293 25.721  -33.219 1.00 44.17  ? 41  CYS D CB  1 
ATOM   4966  S SG  . CYS D  2 45  ? -14.497 25.483  -33.024 1.00 50.04  ? 41  CYS D SG  1 
ATOM   4967  N N   . HIS D  2 46  ? -19.384 25.427  -31.585 1.00 44.18  ? 42  HIS D N   1 
ATOM   4968  C CA  . HIS D  2 46  ? -20.764 25.873  -31.664 1.00 44.59  ? 42  HIS D CA  1 
ATOM   4969  C C   . HIS D  2 46  ? -20.754 27.386  -31.473 1.00 45.75  ? 42  HIS D C   1 
ATOM   4970  O O   . HIS D  2 46  ? -20.185 27.887  -30.500 1.00 46.78  ? 42  HIS D O   1 
ATOM   4971  C CB  . HIS D  2 46  ? -21.577 25.208  -30.557 1.00 43.44  ? 42  HIS D CB  1 
ATOM   4972  C CG  . HIS D  2 46  ? -21.582 23.714  -30.633 1.00 44.38  ? 42  HIS D CG  1 
ATOM   4973  N ND1 . HIS D  2 46  ? -22.429 23.014  -31.467 1.00 46.30  ? 42  HIS D ND1 1 
ATOM   4974  C CD2 . HIS D  2 46  ? -20.804 22.789  -30.023 1.00 44.09  ? 42  HIS D CD2 1 
ATOM   4975  C CE1 . HIS D  2 46  ? -22.168 21.721  -31.370 1.00 46.71  ? 42  HIS D CE1 1 
ATOM   4976  N NE2 . HIS D  2 46  ? -21.186 21.559  -30.501 1.00 45.61  ? 42  HIS D NE2 1 
ATOM   4977  N N   . PHE D  2 47  ? -21.370 28.104  -32.408 1.00 46.81  ? 43  PHE D N   1 
ATOM   4978  C CA  . PHE D  2 47  ? -21.444 29.563  -32.357 1.00 47.61  ? 43  PHE D CA  1 
ATOM   4979  C C   . PHE D  2 47  ? -22.875 30.093  -32.172 1.00 50.60  ? 43  PHE D C   1 
ATOM   4980  O O   . PHE D  2 47  ? -23.821 29.627  -32.820 1.00 49.58  ? 43  PHE D O   1 
ATOM   4981  C CB  . PHE D  2 47  ? -20.870 30.152  -33.647 1.00 46.13  ? 43  PHE D CB  1 
ATOM   4982  C CG  . PHE D  2 47  ? -19.440 29.778  -33.904 1.00 45.84  ? 43  PHE D CG  1 
ATOM   4983  C CD1 . PHE D  2 47  ? -18.401 30.504  -33.327 1.00 43.68  ? 43  PHE D CD1 1 
ATOM   4984  C CD2 . PHE D  2 47  ? -19.132 28.684  -34.709 1.00 43.94  ? 43  PHE D CD2 1 
ATOM   4985  C CE1 . PHE D  2 47  ? -17.074 30.145  -33.548 1.00 45.72  ? 43  PHE D CE1 1 
ATOM   4986  C CE2 . PHE D  2 47  ? -17.807 28.314  -34.938 1.00 45.58  ? 43  PHE D CE2 1 
ATOM   4987  C CZ  . PHE D  2 47  ? -16.773 29.041  -34.357 1.00 44.50  ? 43  PHE D CZ  1 
ATOM   4988  N N   . TYR D  2 48  ? -23.017 31.081  -31.293 1.00 54.40  ? 44  TYR D N   1 
ATOM   4989  C CA  . TYR D  2 48  ? -24.307 31.716  -31.030 1.00 57.01  ? 44  TYR D CA  1 
ATOM   4990  C C   . TYR D  2 48  ? -24.162 33.222  -31.267 1.00 58.69  ? 44  TYR D C   1 
ATOM   4991  O O   . TYR D  2 48  ? -23.589 33.954  -30.458 1.00 57.91  ? 44  TYR D O   1 
ATOM   4992  C CB  . TYR D  2 48  ? -24.745 31.400  -29.603 1.00 57.52  ? 44  TYR D CB  1 
ATOM   4993  C CG  . TYR D  2 48  ? -24.880 29.907  -29.380 1.00 59.75  ? 44  TYR D CG  1 
ATOM   4994  C CD1 . TYR D  2 48  ? -25.874 29.172  -30.032 1.00 60.33  ? 44  TYR D CD1 1 
ATOM   4995  C CD2 . TYR D  2 48  ? -23.976 29.216  -28.575 1.00 60.69  ? 44  TYR D CD2 1 
ATOM   4996  C CE1 . TYR D  2 48  ? -25.958 27.788  -29.893 1.00 60.94  ? 44  TYR D CE1 1 
ATOM   4997  C CE2 . TYR D  2 48  ? -24.055 27.823  -28.428 1.00 60.47  ? 44  TYR D CE2 1 
ATOM   4998  C CZ  . TYR D  2 48  ? -25.045 27.121  -29.092 1.00 60.53  ? 44  TYR D CZ  1 
ATOM   4999  O OH  . TYR D  2 48  ? -25.110 25.752  -28.977 1.00 61.81  ? 44  TYR D OH  1 
ATOM   5000  N N   . ASN D  2 49  ? -24.696 33.663  -32.400 1.00 61.68  ? 45  ASN D N   1 
ATOM   5001  C CA  . ASN D  2 49  ? -24.615 35.053  -32.847 1.00 65.20  ? 45  ASN D CA  1 
ATOM   5002  C C   . ASN D  2 49  ? -23.155 35.365  -33.146 1.00 65.05  ? 45  ASN D C   1 
ATOM   5003  O O   . ASN D  2 49  ? -22.538 36.219  -32.500 1.00 65.55  ? 45  ASN D O   1 
ATOM   5004  C CB  . ASN D  2 49  ? -25.124 36.049  -31.803 1.00 70.23  ? 45  ASN D CB  1 
ATOM   5005  C CG  . ASN D  2 49  ? -25.504 37.381  -32.434 1.00 76.02  ? 45  ASN D CG  1 
ATOM   5006  O OD1 . ASN D  2 49  ? -26.481 37.438  -33.186 1.00 78.00  ? 45  ASN D OD1 1 
ATOM   5007  N ND2 . ASN D  2 49  ? -24.744 38.445  -32.177 1.00 80.30  ? 45  ASN D ND2 1 
ATOM   5008  N N   . GLY D  2 50  ? -22.602 34.659  -34.125 1.00 63.42  ? 46  GLY D N   1 
ATOM   5009  C CA  . GLY D  2 50  ? -21.217 34.871  -34.484 1.00 61.76  ? 46  GLY D CA  1 
ATOM   5010  C C   . GLY D  2 50  ? -20.261 34.480  -33.372 1.00 61.63  ? 46  GLY D C   1 
ATOM   5011  O O   . GLY D  2 50  ? -20.385 33.408  -32.780 1.00 61.31  ? 46  GLY D O   1 
ATOM   5012  N N   . THR D  2 51  ? -19.316 35.364  -33.073 1.00 60.32  ? 47  THR D N   1 
ATOM   5013  C CA  . THR D  2 51  ? -18.321 35.095  -32.049 1.00 59.29  ? 47  THR D CA  1 
ATOM   5014  C C   . THR D  2 51  ? -18.676 35.582  -30.644 1.00 59.12  ? 47  THR D C   1 
ATOM   5015  O O   . THR D  2 51  ? -17.858 35.496  -29.723 1.00 56.99  ? 47  THR D O   1 
ATOM   5016  C CB  . THR D  2 51  ? -16.967 35.689  -32.471 1.00 60.66  ? 47  THR D CB  1 
ATOM   5017  O OG1 . THR D  2 51  ? -17.163 37.027  -32.945 1.00 62.03  ? 47  THR D OG1 1 
ATOM   5018  C CG2 . THR D  2 51  ? -16.341 34.850  -33.583 1.00 59.14  ? 47  THR D CG2 1 
ATOM   5019  N N   . GLN D  2 52  ? -19.898 36.073  -30.472 1.00 59.68  ? 48  GLN D N   1 
ATOM   5020  C CA  . GLN D  2 52  ? -20.326 36.566  -29.166 1.00 60.95  ? 48  GLN D CA  1 
ATOM   5021  C C   . GLN D  2 52  ? -20.128 35.475  -28.120 1.00 60.90  ? 48  GLN D C   1 
ATOM   5022  O O   . GLN D  2 52  ? -19.374 35.659  -27.165 1.00 60.80  ? 48  GLN D O   1 
ATOM   5023  C CB  . GLN D  2 52  ? -21.797 36.999  -29.213 1.00 64.41  ? 48  GLN D CB  1 
ATOM   5024  C CG  . GLN D  2 52  ? -22.279 37.759  -27.978 1.00 66.84  ? 48  GLN D CG  1 
ATOM   5025  C CD  . GLN D  2 52  ? -23.578 38.523  -28.228 1.00 70.53  ? 48  GLN D CD  1 
ATOM   5026  O OE1 . GLN D  2 52  ? -23.662 39.342  -29.152 1.00 72.07  ? 48  GLN D OE1 1 
ATOM   5027  N NE2 . GLN D  2 52  ? -24.594 38.262  -27.404 1.00 70.16  ? 48  GLN D NE2 1 
ATOM   5028  N N   . ARG D  2 53  ? -20.809 34.344  -28.308 1.00 59.32  ? 49  ARG D N   1 
ATOM   5029  C CA  . ARG D  2 53  ? -20.697 33.205  -27.399 1.00 57.57  ? 49  ARG D CA  1 
ATOM   5030  C C   . ARG D  2 53  ? -20.295 31.973  -28.200 1.00 55.11  ? 49  ARG D C   1 
ATOM   5031  O O   . ARG D  2 53  ? -20.927 31.630  -29.199 1.00 56.18  ? 49  ARG D O   1 
ATOM   5032  C CB  . ARG D  2 53  ? -22.029 32.932  -26.688 1.00 59.91  ? 49  ARG D CB  1 
ATOM   5033  C CG  . ARG D  2 53  ? -21.900 31.996  -25.471 1.00 62.88  ? 49  ARG D CG  1 
ATOM   5034  C CD  . ARG D  2 53  ? -23.229 31.819  -24.741 1.00 66.36  ? 49  ARG D CD  1 
ATOM   5035  N NE  . ARG D  2 53  ? -24.042 30.745  -25.307 1.00 70.58  ? 49  ARG D NE  1 
ATOM   5036  C CZ  . ARG D  2 53  ? -23.745 29.455  -25.188 1.00 72.96  ? 49  ARG D CZ  1 
ATOM   5037  N NH1 . ARG D  2 53  ? -22.655 29.086  -24.521 1.00 74.03  ? 49  ARG D NH1 1 
ATOM   5038  N NH2 . ARG D  2 53  ? -24.531 28.534  -25.734 1.00 73.33  ? 49  ARG D NH2 1 
ATOM   5039  N N   . VAL D  2 54  ? -19.241 31.306  -27.759 1.00 52.40  ? 50  VAL D N   1 
ATOM   5040  C CA  . VAL D  2 54  ? -18.766 30.122  -28.447 1.00 49.17  ? 50  VAL D CA  1 
ATOM   5041  C C   . VAL D  2 54  ? -18.486 28.982  -27.497 1.00 47.61  ? 50  VAL D C   1 
ATOM   5042  O O   . VAL D  2 54  ? -17.962 29.178  -26.404 1.00 45.86  ? 50  VAL D O   1 
ATOM   5043  C CB  . VAL D  2 54  ? -17.490 30.420  -29.225 1.00 49.98  ? 50  VAL D CB  1 
ATOM   5044  C CG1 . VAL D  2 54  ? -16.926 29.133  -29.818 1.00 50.93  ? 50  VAL D CG1 1 
ATOM   5045  C CG2 . VAL D  2 54  ? -17.788 31.425  -30.313 1.00 50.59  ? 50  VAL D CG2 1 
ATOM   5046  N N   . ARG D  2 55  ? -18.841 27.779  -27.927 1.00 47.00  ? 51  ARG D N   1 
ATOM   5047  C CA  . ARG D  2 55  ? -18.609 26.598  -27.111 1.00 44.54  ? 51  ARG D CA  1 
ATOM   5048  C C   . ARG D  2 55  ? -17.842 25.573  -27.907 1.00 42.21  ? 51  ARG D C   1 
ATOM   5049  O O   . ARG D  2 55  ? -18.192 25.252  -29.043 1.00 41.34  ? 51  ARG D O   1 
ATOM   5050  C CB  . ARG D  2 55  ? -19.930 25.991  -26.652 1.00 45.46  ? 51  ARG D CB  1 
ATOM   5051  C CG  . ARG D  2 55  ? -19.779 24.759  -25.788 1.00 45.92  ? 51  ARG D CG  1 
ATOM   5052  C CD  . ARG D  2 55  ? -21.142 24.151  -25.493 1.00 45.96  ? 51  ARG D CD  1 
ATOM   5053  N NE  . ARG D  2 55  ? -21.017 22.866  -24.823 1.00 45.85  ? 51  ARG D NE  1 
ATOM   5054  C CZ  . ARG D  2 55  ? -21.806 21.827  -25.065 1.00 44.88  ? 51  ARG D CZ  1 
ATOM   5055  N NH1 . ARG D  2 55  ? -22.779 21.934  -25.960 1.00 45.59  ? 51  ARG D NH1 1 
ATOM   5056  N NH2 . ARG D  2 55  ? -21.610 20.679  -24.429 1.00 43.24  ? 51  ARG D NH2 1 
ATOM   5057  N N   . LEU D  2 56  ? -16.775 25.076  -27.307 1.00 39.41  ? 52  LEU D N   1 
ATOM   5058  C CA  . LEU D  2 56  ? -15.966 24.075  -27.953 1.00 38.86  ? 52  LEU D CA  1 
ATOM   5059  C C   . LEU D  2 56  ? -16.263 22.744  -27.279 1.00 39.07  ? 52  LEU D C   1 
ATOM   5060  O O   . LEU D  2 56  ? -16.227 22.638  -26.047 1.00 39.07  ? 52  LEU D O   1 
ATOM   5061  C CB  . LEU D  2 56  ? -14.487 24.416  -27.805 1.00 37.97  ? 52  LEU D CB  1 
ATOM   5062  C CG  . LEU D  2 56  ? -13.497 23.359  -28.304 1.00 38.85  ? 52  LEU D CG  1 
ATOM   5063  C CD1 . LEU D  2 56  ? -13.744 23.077  -29.788 1.00 37.52  ? 52  LEU D CD1 1 
ATOM   5064  C CD2 . LEU D  2 56  ? -12.064 23.850  -28.069 1.00 37.05  ? 52  LEU D CD2 1 
ATOM   5065  N N   . LEU D  2 57  ? -16.577 21.738  -28.088 1.00 37.48  ? 53  LEU D N   1 
ATOM   5066  C CA  . LEU D  2 57  ? -16.865 20.402  -27.567 1.00 35.97  ? 53  LEU D CA  1 
ATOM   5067  C C   . LEU D  2 57  ? -16.147 19.392  -28.436 1.00 35.04  ? 53  LEU D C   1 
ATOM   5068  O O   . LEU D  2 57  ? -16.496 19.203  -29.600 1.00 37.16  ? 53  LEU D O   1 
ATOM   5069  C CB  . LEU D  2 57  ? -18.368 20.118  -27.576 1.00 34.39  ? 53  LEU D CB  1 
ATOM   5070  C CG  . LEU D  2 57  ? -18.801 18.715  -27.120 1.00 35.99  ? 53  LEU D CG  1 
ATOM   5071  C CD1 . LEU D  2 57  ? -18.311 18.443  -25.697 1.00 32.72  ? 53  LEU D CD1 1 
ATOM   5072  C CD2 . LEU D  2 57  ? -20.331 18.607  -27.181 1.00 32.50  ? 53  LEU D CD2 1 
ATOM   5073  N N   . VAL D  2 58  ? -15.113 18.781  -27.871 1.00 33.54  ? 54  VAL D N   1 
ATOM   5074  C CA  . VAL D  2 58  ? -14.330 17.779  -28.566 1.00 31.63  ? 54  VAL D CA  1 
ATOM   5075  C C   . VAL D  2 58  ? -14.803 16.433  -28.070 1.00 31.27  ? 54  VAL D C   1 
ATOM   5076  O O   . VAL D  2 58  ? -14.965 16.235  -26.861 1.00 31.74  ? 54  VAL D O   1 
ATOM   5077  C CB  . VAL D  2 58  ? -12.835 17.914  -28.254 1.00 33.85  ? 54  VAL D CB  1 
ATOM   5078  C CG1 . VAL D  2 58  ? -12.053 16.796  -28.955 1.00 29.74  ? 54  VAL D CG1 1 
ATOM   5079  C CG2 . VAL D  2 58  ? -12.343 19.298  -28.691 1.00 33.67  ? 54  VAL D CG2 1 
ATOM   5080  N N   . ARG D  2 59  ? -15.017 15.511  -29.001 1.00 30.28  ? 55  ARG D N   1 
ATOM   5081  C CA  . ARG D  2 59  ? -15.508 14.182  -28.660 1.00 30.97  ? 55  ARG D CA  1 
ATOM   5082  C C   . ARG D  2 59  ? -14.623 13.088  -29.205 1.00 29.36  ? 55  ARG D C   1 
ATOM   5083  O O   . ARG D  2 59  ? -14.290 13.075  -30.384 1.00 28.00  ? 55  ARG D O   1 
ATOM   5084  C CB  . ARG D  2 59  ? -16.927 14.008  -29.194 1.00 32.24  ? 55  ARG D CB  1 
ATOM   5085  C CG  . ARG D  2 59  ? -17.873 15.062  -28.681 1.00 36.53  ? 55  ARG D CG  1 
ATOM   5086  C CD  . ARG D  2 59  ? -19.029 15.247  -29.609 1.00 35.28  ? 55  ARG D CD  1 
ATOM   5087  N NE  . ARG D  2 59  ? -20.002 14.173  -29.510 1.00 37.87  ? 55  ARG D NE  1 
ATOM   5088  C CZ  . ARG D  2 59  ? -21.029 14.041  -30.348 1.00 40.52  ? 55  ARG D CZ  1 
ATOM   5089  N NH1 . ARG D  2 59  ? -21.190 14.915  -31.339 1.00 38.01  ? 55  ARG D NH1 1 
ATOM   5090  N NH2 . ARG D  2 59  ? -21.903 13.057  -30.188 1.00 38.44  ? 55  ARG D NH2 1 
ATOM   5091  N N   . TYR D  2 60  ? -14.260 12.163  -28.329 1.00 29.21  ? 56  TYR D N   1 
ATOM   5092  C CA  . TYR D  2 60  ? -13.405 11.056  -28.701 1.00 32.62  ? 56  TYR D CA  1 
ATOM   5093  C C   . TYR D  2 60  ? -14.189 9.766   -28.781 1.00 32.29  ? 56  TYR D C   1 
ATOM   5094  O O   . TYR D  2 60  ? -14.927 9.423   -27.860 1.00 35.03  ? 56  TYR D O   1 
ATOM   5095  C CB  . TYR D  2 60  ? -12.272 10.908  -27.683 1.00 33.44  ? 56  TYR D CB  1 
ATOM   5096  C CG  . TYR D  2 60  ? -11.327 12.072  -27.682 1.00 38.07  ? 56  TYR D CG  1 
ATOM   5097  C CD1 . TYR D  2 60  ? -10.176 12.067  -28.475 1.00 40.47  ? 56  TYR D CD1 1 
ATOM   5098  C CD2 . TYR D  2 60  ? -11.581 13.191  -26.893 1.00 40.71  ? 56  TYR D CD2 1 
ATOM   5099  C CE1 . TYR D  2 60  ? -9.300  13.145  -28.478 1.00 40.64  ? 56  TYR D CE1 1 
ATOM   5100  C CE2 . TYR D  2 60  ? -10.715 14.274  -26.890 1.00 44.56  ? 56  TYR D CE2 1 
ATOM   5101  C CZ  . TYR D  2 60  ? -9.577  14.246  -27.683 1.00 44.63  ? 56  TYR D CZ  1 
ATOM   5102  O OH  . TYR D  2 60  ? -8.730  15.337  -27.674 1.00 50.68  ? 56  TYR D OH  1 
ATOM   5103  N N   . PHE D  2 61  ? -14.025 9.049   -29.882 1.00 30.90  ? 57  PHE D N   1 
ATOM   5104  C CA  . PHE D  2 61  ? -14.728 7.793   -30.043 1.00 29.75  ? 57  PHE D CA  1 
ATOM   5105  C C   . PHE D  2 61  ? -13.767 6.677   -30.354 1.00 28.90  ? 57  PHE D C   1 
ATOM   5106  O O   . PHE D  2 61  ? -12.867 6.846   -31.164 1.00 29.12  ? 57  PHE D O   1 
ATOM   5107  C CB  . PHE D  2 61  ? -15.718 7.845   -31.214 1.00 30.94  ? 57  PHE D CB  1 
ATOM   5108  C CG  . PHE D  2 61  ? -16.702 8.964   -31.144 1.00 29.64  ? 57  PHE D CG  1 
ATOM   5109  C CD1 . PHE D  2 61  ? -16.354 10.239  -31.576 1.00 28.44  ? 57  PHE D CD1 1 
ATOM   5110  C CD2 . PHE D  2 61  ? -17.995 8.735   -30.680 1.00 30.78  ? 57  PHE D CD2 1 
ATOM   5111  C CE1 . PHE D  2 61  ? -17.286 11.278  -31.551 1.00 29.22  ? 57  PHE D CE1 1 
ATOM   5112  C CE2 . PHE D  2 61  ? -18.940 9.768   -30.648 1.00 31.52  ? 57  PHE D CE2 1 
ATOM   5113  C CZ  . PHE D  2 61  ? -18.580 11.043  -31.087 1.00 30.41  ? 57  PHE D CZ  1 
ATOM   5114  N N   . TYR D  2 62  ? -13.947 5.539   -29.706 1.00 28.25  ? 58  TYR D N   1 
ATOM   5115  C CA  . TYR D  2 62  ? -13.145 4.380   -30.032 1.00 29.71  ? 58  TYR D CA  1 
ATOM   5116  C C   . TYR D  2 62  ? -14.198 3.435   -30.576 1.00 31.16  ? 58  TYR D C   1 
ATOM   5117  O O   . TYR D  2 62  ? -15.178 3.150   -29.898 1.00 31.61  ? 58  TYR D O   1 
ATOM   5118  C CB  . TYR D  2 62  ? -12.483 3.773   -28.808 1.00 30.87  ? 58  TYR D CB  1 
ATOM   5119  C CG  . TYR D  2 62  ? -11.812 2.465   -29.122 1.00 31.74  ? 58  TYR D CG  1 
ATOM   5120  C CD1 . TYR D  2 62  ? -10.855 2.377   -30.134 1.00 32.80  ? 58  TYR D CD1 1 
ATOM   5121  C CD2 . TYR D  2 62  ? -12.153 1.303   -28.436 1.00 32.28  ? 58  TYR D CD2 1 
ATOM   5122  C CE1 . TYR D  2 62  ? -10.264 1.162   -30.452 1.00 33.61  ? 58  TYR D CE1 1 
ATOM   5123  C CE2 . TYR D  2 62  ? -11.568 0.095   -28.743 1.00 32.05  ? 58  TYR D CE2 1 
ATOM   5124  C CZ  . TYR D  2 62  ? -10.628 0.028   -29.746 1.00 34.97  ? 58  TYR D CZ  1 
ATOM   5125  O OH  . TYR D  2 62  ? -10.039 -1.179  -30.030 1.00 40.12  ? 58  TYR D OH  1 
ATOM   5126  N N   . ASN D  2 63  ? -14.011 2.978   -31.810 1.00 33.47  ? 59  ASN D N   1 
ATOM   5127  C CA  . ASN D  2 63  ? -14.960 2.095   -32.465 1.00 34.81  ? 59  ASN D CA  1 
ATOM   5128  C C   . ASN D  2 63  ? -16.359 2.702   -32.423 1.00 35.59  ? 59  ASN D C   1 
ATOM   5129  O O   . ASN D  2 63  ? -16.539 3.780   -32.976 1.00 38.15  ? 59  ASN D O   1 
ATOM   5130  C CB  . ASN D  2 63  ? -14.900 0.703   -31.842 1.00 36.65  ? 59  ASN D CB  1 
ATOM   5131  C CG  . ASN D  2 63  ? -13.541 0.039   -32.065 1.00 40.33  ? 59  ASN D CG  1 
ATOM   5132  O OD1 . ASN D  2 63  ? -12.795 0.427   -32.963 1.00 40.54  ? 59  ASN D OD1 1 
ATOM   5133  N ND2 . ASN D  2 63  ? -13.222 -0.967  -31.259 1.00 44.70  ? 59  ASN D ND2 1 
ATOM   5134  N N   . LEU D  2 64  ? -17.336 2.060   -31.780 1.00 34.24  ? 60  LEU D N   1 
ATOM   5135  C CA  . LEU D  2 64  ? -18.696 2.618   -31.732 1.00 34.81  ? 60  LEU D CA  1 
ATOM   5136  C C   . LEU D  2 64  ? -19.048 3.440   -30.499 1.00 35.73  ? 60  LEU D C   1 
ATOM   5137  O O   . LEU D  2 64  ? -20.188 3.867   -30.352 1.00 35.25  ? 60  LEU D O   1 
ATOM   5138  C CB  . LEU D  2 64  ? -19.753 1.516   -31.818 1.00 34.34  ? 60  LEU D CB  1 
ATOM   5139  C CG  . LEU D  2 64  ? -19.838 0.575   -33.017 1.00 36.35  ? 60  LEU D CG  1 
ATOM   5140  C CD1 . LEU D  2 64  ? -21.049 -0.342  -32.808 1.00 34.01  ? 60  LEU D CD1 1 
ATOM   5141  C CD2 . LEU D  2 64  ? -19.980 1.362   -34.320 1.00 35.66  ? 60  LEU D CD2 1 
ATOM   5142  N N   . GLU D  2 65  ? -18.094 3.682   -29.613 1.00 38.22  ? 61  GLU D N   1 
ATOM   5143  C CA  . GLU D  2 65  ? -18.430 4.405   -28.397 1.00 39.19  ? 61  GLU D CA  1 
ATOM   5144  C C   . GLU D  2 65  ? -17.676 5.691   -28.114 1.00 37.65  ? 61  GLU D C   1 
ATOM   5145  O O   . GLU D  2 65  ? -16.492 5.814   -28.391 1.00 37.87  ? 61  GLU D O   1 
ATOM   5146  C CB  . GLU D  2 65  ? -18.270 3.479   -27.188 1.00 42.24  ? 61  GLU D CB  1 
ATOM   5147  C CG  . GLU D  2 65  ? -19.558 2.864   -26.674 1.00 48.99  ? 61  GLU D CG  1 
ATOM   5148  C CD  . GLU D  2 65  ? -19.530 2.635   -25.156 1.00 53.72  ? 61  GLU D CD  1 
ATOM   5149  O OE1 . GLU D  2 65  ? -18.842 1.693   -24.682 1.00 54.02  ? 61  GLU D OE1 1 
ATOM   5150  O OE2 . GLU D  2 65  ? -20.195 3.415   -24.435 1.00 55.04  ? 61  GLU D OE2 1 
ATOM   5151  N N   . GLU D  2 66  ? -18.389 6.651   -27.549 1.00 36.92  ? 62  GLU D N   1 
ATOM   5152  C CA  . GLU D  2 66  ? -17.802 7.920   -27.158 1.00 38.84  ? 62  GLU D CA  1 
ATOM   5153  C C   . GLU D  2 66  ? -17.240 7.635   -25.763 1.00 38.27  ? 62  GLU D C   1 
ATOM   5154  O O   . GLU D  2 66  ? -17.953 7.145   -24.888 1.00 38.82  ? 62  GLU D O   1 
ATOM   5155  C CB  . GLU D  2 66  ? -18.890 8.983   -27.088 1.00 41.26  ? 62  GLU D CB  1 
ATOM   5156  C CG  . GLU D  2 66  ? -18.410 10.361  -26.716 1.00 47.21  ? 62  GLU D CG  1 
ATOM   5157  C CD  . GLU D  2 66  ? -19.550 11.359  -26.664 1.00 51.11  ? 62  GLU D CD  1 
ATOM   5158  O OE1 . GLU D  2 66  ? -20.418 11.318  -27.566 1.00 51.34  ? 62  GLU D OE1 1 
ATOM   5159  O OE2 . GLU D  2 66  ? -19.574 12.185  -25.723 1.00 55.53  ? 62  GLU D OE2 1 
ATOM   5160  N N   . ASN D  2 67  ? -15.973 7.933   -25.534 1.00 36.39  ? 63  ASN D N   1 
ATOM   5161  C CA  . ASN D  2 67  ? -15.415 7.629   -24.224 1.00 35.99  ? 63  ASN D CA  1 
ATOM   5162  C C   . ASN D  2 67  ? -14.846 8.830   -23.504 1.00 35.27  ? 63  ASN D C   1 
ATOM   5163  O O   . ASN D  2 67  ? -14.591 8.782   -22.304 1.00 36.85  ? 63  ASN D O   1 
ATOM   5164  C CB  . ASN D  2 67  ? -14.323 6.571   -24.371 1.00 34.73  ? 63  ASN D CB  1 
ATOM   5165  C CG  . ASN D  2 67  ? -13.218 7.011   -25.303 1.00 35.52  ? 63  ASN D CG  1 
ATOM   5166  O OD1 . ASN D  2 67  ? -12.629 8.072   -25.117 1.00 39.35  ? 63  ASN D OD1 1 
ATOM   5167  N ND2 . ASN D  2 67  ? -12.931 6.202   -26.312 1.00 35.42  ? 63  ASN D ND2 1 
ATOM   5168  N N   . LEU D  2 68  ? -14.655 9.918   -24.229 1.00 34.12  ? 64  LEU D N   1 
ATOM   5169  C CA  . LEU D  2 68  ? -14.070 11.092  -23.612 1.00 34.36  ? 64  LEU D CA  1 
ATOM   5170  C C   . LEU D  2 68  ? -14.499 12.367  -24.310 1.00 32.91  ? 64  LEU D C   1 
ATOM   5171  O O   . LEU D  2 68  ? -14.809 12.350  -25.504 1.00 31.26  ? 64  LEU D O   1 
ATOM   5172  C CB  . LEU D  2 68  ? -12.544 10.954  -23.670 1.00 34.19  ? 64  LEU D CB  1 
ATOM   5173  C CG  . LEU D  2 68  ? -11.632 12.069  -23.170 1.00 34.50  ? 64  LEU D CG  1 
ATOM   5174  C CD1 . LEU D  2 68  ? -11.489 11.997  -21.648 1.00 33.49  ? 64  LEU D CD1 1 
ATOM   5175  C CD2 . LEU D  2 68  ? -10.280 11.923  -23.831 1.00 33.42  ? 64  LEU D CD2 1 
ATOM   5176  N N   . ARG D  2 69  ? -14.525 13.468  -23.564 1.00 33.72  ? 65  ARG D N   1 
ATOM   5177  C CA  . ARG D  2 69  ? -14.862 14.761  -24.149 1.00 37.99  ? 65  ARG D CA  1 
ATOM   5178  C C   . ARG D  2 69  ? -14.232 15.955  -23.442 1.00 38.43  ? 65  ARG D C   1 
ATOM   5179  O O   . ARG D  2 69  ? -13.767 15.859  -22.305 1.00 40.11  ? 65  ARG D O   1 
ATOM   5180  C CB  . ARG D  2 69  ? -16.377 14.963  -24.212 1.00 39.04  ? 65  ARG D CB  1 
ATOM   5181  C CG  . ARG D  2 69  ? -17.064 15.042  -22.884 1.00 44.28  ? 65  ARG D CG  1 
ATOM   5182  C CD  . ARG D  2 69  ? -18.523 15.456  -23.075 1.00 47.75  ? 65  ARG D CD  1 
ATOM   5183  N NE  . ARG D  2 69  ? -19.206 14.646  -24.081 1.00 48.37  ? 65  ARG D NE  1 
ATOM   5184  C CZ  . ARG D  2 69  ? -20.432 14.903  -24.518 1.00 50.97  ? 65  ARG D CZ  1 
ATOM   5185  N NH1 . ARG D  2 69  ? -21.098 15.946  -24.033 1.00 50.52  ? 65  ARG D NH1 1 
ATOM   5186  N NH2 . ARG D  2 69  ? -20.989 14.129  -25.441 1.00 50.49  ? 65  ARG D NH2 1 
ATOM   5187  N N   . PHE D  2 70  ? -14.199 17.082  -24.143 1.00 38.27  ? 66  PHE D N   1 
ATOM   5188  C CA  . PHE D  2 70  ? -13.675 18.309  -23.577 1.00 38.21  ? 66  PHE D CA  1 
ATOM   5189  C C   . PHE D  2 70  ? -14.671 19.398  -23.905 1.00 38.17  ? 66  PHE D C   1 
ATOM   5190  O O   . PHE D  2 70  ? -14.844 19.769  -25.064 1.00 38.37  ? 66  PHE D O   1 
ATOM   5191  C CB  . PHE D  2 70  ? -12.302 18.660  -24.153 1.00 37.58  ? 66  PHE D CB  1 
ATOM   5192  C CG  . PHE D  2 70  ? -11.774 19.971  -23.663 1.00 37.20  ? 66  PHE D CG  1 
ATOM   5193  C CD1 . PHE D  2 70  ? -12.188 21.161  -24.246 1.00 37.03  ? 66  PHE D CD1 1 
ATOM   5194  C CD2 . PHE D  2 70  ? -10.926 20.024  -22.564 1.00 39.51  ? 66  PHE D CD2 1 
ATOM   5195  C CE1 . PHE D  2 70  ? -11.775 22.388  -23.743 1.00 40.48  ? 66  PHE D CE1 1 
ATOM   5196  C CE2 . PHE D  2 70  ? -10.499 21.254  -22.043 1.00 39.24  ? 66  PHE D CE2 1 
ATOM   5197  C CZ  . PHE D  2 70  ? -10.926 22.437  -22.633 1.00 40.26  ? 66  PHE D CZ  1 
ATOM   5198  N N   . ASP D  2 71  ? -15.338 19.895  -22.876 1.00 38.86  ? 67  ASP D N   1 
ATOM   5199  C CA  . ASP D  2 71  ? -16.338 20.939  -23.042 1.00 41.89  ? 67  ASP D CA  1 
ATOM   5200  C C   . ASP D  2 71  ? -15.755 22.253  -22.515 1.00 42.81  ? 67  ASP D C   1 
ATOM   5201  O O   . ASP D  2 71  ? -15.485 22.389  -21.321 1.00 40.46  ? 67  ASP D O   1 
ATOM   5202  C CB  . ASP D  2 71  ? -17.600 20.564  -22.260 1.00 42.21  ? 67  ASP D CB  1 
ATOM   5203  C CG  . ASP D  2 71  ? -18.772 21.454  -22.585 1.00 45.39  ? 67  ASP D CG  1 
ATOM   5204  O OD1 . ASP D  2 71  ? -18.541 22.599  -23.032 1.00 46.18  ? 67  ASP D OD1 1 
ATOM   5205  O OD2 . ASP D  2 71  ? -19.928 21.017  -22.381 1.00 47.29  ? 67  ASP D OD2 1 
ATOM   5206  N N   . SER D  2 72  ? -15.569 23.217  -23.411 1.00 45.50  ? 68  SER D N   1 
ATOM   5207  C CA  . SER D  2 72  ? -14.996 24.498  -23.035 1.00 47.35  ? 68  SER D CA  1 
ATOM   5208  C C   . SER D  2 72  ? -15.697 25.114  -21.837 1.00 49.37  ? 68  SER D C   1 
ATOM   5209  O O   . SER D  2 72  ? -15.045 25.694  -20.964 1.00 51.13  ? 68  SER D O   1 
ATOM   5210  C CB  . SER D  2 72  ? -15.007 25.464  -24.226 1.00 46.46  ? 68  SER D CB  1 
ATOM   5211  O OG  . SER D  2 72  ? -16.287 25.561  -24.809 1.00 50.53  ? 68  SER D OG  1 
ATOM   5212  N N   . ASP D  2 73  ? -17.017 24.974  -21.783 1.00 50.23  ? 69  ASP D N   1 
ATOM   5213  C CA  . ASP D  2 73  ? -17.796 25.518  -20.671 1.00 50.56  ? 69  ASP D CA  1 
ATOM   5214  C C   . ASP D  2 73  ? -17.534 24.748  -19.375 1.00 50.10  ? 69  ASP D C   1 
ATOM   5215  O O   . ASP D  2 73  ? -18.003 25.134  -18.306 1.00 51.49  ? 69  ASP D O   1 
ATOM   5216  C CB  . ASP D  2 73  ? -19.297 25.504  -21.013 1.00 53.14  ? 69  ASP D CB  1 
ATOM   5217  C CG  . ASP D  2 73  ? -19.643 26.430  -22.192 1.00 57.09  ? 69  ASP D CG  1 
ATOM   5218  O OD1 . ASP D  2 73  ? -18.722 27.108  -22.709 1.00 57.64  ? 69  ASP D OD1 1 
ATOM   5219  O OD2 . ASP D  2 73  ? -20.830 26.487  -22.599 1.00 57.16  ? 69  ASP D OD2 1 
ATOM   5220  N N   . VAL D  2 74  ? -16.788 23.652  -19.470 1.00 48.88  ? 70  VAL D N   1 
ATOM   5221  C CA  . VAL D  2 74  ? -16.455 22.856  -18.289 1.00 47.18  ? 70  VAL D CA  1 
ATOM   5222  C C   . VAL D  2 74  ? -15.007 23.140  -17.883 1.00 48.32  ? 70  VAL D C   1 
ATOM   5223  O O   . VAL D  2 74  ? -14.686 23.215  -16.695 1.00 48.10  ? 70  VAL D O   1 
ATOM   5224  C CB  . VAL D  2 74  ? -16.639 21.356  -18.562 1.00 44.49  ? 70  VAL D CB  1 
ATOM   5225  C CG1 . VAL D  2 74  ? -16.194 20.550  -17.363 1.00 43.00  ? 70  VAL D CG1 1 
ATOM   5226  C CG2 . VAL D  2 74  ? -18.102 21.070  -18.874 1.00 44.81  ? 70  VAL D CG2 1 
ATOM   5227  N N   . GLY D  2 75  ? -14.136 23.294  -18.877 1.00 48.04  ? 71  GLY D N   1 
ATOM   5228  C CA  . GLY D  2 75  ? -12.750 23.611  -18.596 1.00 48.82  ? 71  GLY D CA  1 
ATOM   5229  C C   . GLY D  2 75  ? -11.742 22.484  -18.599 1.00 49.62  ? 71  GLY D C   1 
ATOM   5230  O O   . GLY D  2 75  ? -10.562 22.742  -18.810 1.00 48.94  ? 71  GLY D O   1 
ATOM   5231  N N   . GLU D  2 76  ? -12.184 21.250  -18.365 1.00 50.50  ? 72  GLU D N   1 
ATOM   5232  C CA  . GLU D  2 76  ? -11.267 20.109  -18.349 1.00 50.47  ? 72  GLU D CA  1 
ATOM   5233  C C   . GLU D  2 76  ? -11.854 18.928  -19.106 1.00 49.22  ? 72  GLU D C   1 
ATOM   5234  O O   . GLU D  2 76  ? -13.009 18.972  -19.518 1.00 49.19  ? 72  GLU D O   1 
ATOM   5235  C CB  . GLU D  2 76  ? -10.987 19.659  -16.911 1.00 52.89  ? 72  GLU D CB  1 
ATOM   5236  C CG  . GLU D  2 76  ? -10.575 20.757  -15.941 1.00 55.46  ? 72  GLU D CG  1 
ATOM   5237  C CD  . GLU D  2 76  ? -10.145 20.193  -14.594 1.00 58.27  ? 72  GLU D CD  1 
ATOM   5238  O OE1 . GLU D  2 76  ? -10.873 19.327  -14.058 1.00 58.47  ? 72  GLU D OE1 1 
ATOM   5239  O OE2 . GLU D  2 76  ? -9.084  20.616  -14.072 1.00 60.15  ? 72  GLU D OE2 1 
ATOM   5240  N N   . PHE D  2 77  ? -11.051 17.875  -19.278 1.00 47.68  ? 73  PHE D N   1 
ATOM   5241  C CA  . PHE D  2 77  ? -11.494 16.661  -19.964 1.00 45.00  ? 73  PHE D CA  1 
ATOM   5242  C C   . PHE D  2 77  ? -12.357 15.849  -19.013 1.00 43.31  ? 73  PHE D C   1 
ATOM   5243  O O   . PHE D  2 77  ? -12.229 15.972  -17.807 1.00 41.37  ? 73  PHE D O   1 
ATOM   5244  C CB  . PHE D  2 77  ? -10.306 15.794  -20.390 1.00 45.89  ? 73  PHE D CB  1 
ATOM   5245  C CG  . PHE D  2 77  ? -9.539  16.337  -21.557 1.00 47.37  ? 73  PHE D CG  1 
ATOM   5246  C CD1 . PHE D  2 77  ? -8.450  17.187  -21.362 1.00 48.51  ? 73  PHE D CD1 1 
ATOM   5247  C CD2 . PHE D  2 77  ? -9.909  16.009  -22.856 1.00 46.60  ? 73  PHE D CD2 1 
ATOM   5248  C CE1 . PHE D  2 77  ? -7.735  17.704  -22.450 1.00 47.02  ? 73  PHE D CE1 1 
ATOM   5249  C CE2 . PHE D  2 77  ? -9.203  16.521  -23.951 1.00 48.14  ? 73  PHE D CE2 1 
ATOM   5250  C CZ  . PHE D  2 77  ? -8.112  17.372  -23.745 1.00 47.05  ? 73  PHE D CZ  1 
ATOM   5251  N N   . ARG D  2 78  ? -13.234 15.016  -19.561 1.00 43.45  ? 74  ARG D N   1 
ATOM   5252  C CA  . ARG D  2 78  ? -14.106 14.186  -18.737 1.00 42.82  ? 74  ARG D CA  1 
ATOM   5253  C C   . ARG D  2 78  ? -14.419 12.883  -19.426 1.00 40.86  ? 74  ARG D C   1 
ATOM   5254  O O   . ARG D  2 78  ? -14.949 12.873  -20.535 1.00 42.37  ? 74  ARG D O   1 
ATOM   5255  C CB  . ARG D  2 78  ? -15.417 14.914  -18.436 1.00 43.58  ? 74  ARG D CB  1 
ATOM   5256  C CG  . ARG D  2 78  ? -15.283 16.069  -17.470 1.00 45.52  ? 74  ARG D CG  1 
ATOM   5257  C CD  . ARG D  2 78  ? -15.030 15.600  -16.039 1.00 46.84  ? 74  ARG D CD  1 
ATOM   5258  N NE  . ARG D  2 78  ? -14.837 16.759  -15.177 1.00 51.97  ? 74  ARG D NE  1 
ATOM   5259  C CZ  . ARG D  2 78  ? -13.653 17.299  -14.896 1.00 52.63  ? 74  ARG D CZ  1 
ATOM   5260  N NH1 . ARG D  2 78  ? -12.544 16.770  -15.393 1.00 53.28  ? 74  ARG D NH1 1 
ATOM   5261  N NH2 . ARG D  2 78  ? -13.585 18.401  -14.159 1.00 52.50  ? 74  ARG D NH2 1 
ATOM   5262  N N   . ALA D  2 79  ? -14.090 11.781  -18.769 1.00 38.75  ? 75  ALA D N   1 
ATOM   5263  C CA  . ALA D  2 79  ? -14.355 10.469  -19.323 1.00 36.78  ? 75  ALA D CA  1 
ATOM   5264  C C   . ALA D  2 79  ? -15.856 10.279  -19.490 1.00 36.93  ? 75  ALA D C   1 
ATOM   5265  O O   . ALA D  2 79  ? -16.626 10.670  -18.623 1.00 39.56  ? 75  ALA D O   1 
ATOM   5266  C CB  . ALA D  2 79  ? -13.803 9.408   -18.402 1.00 34.44  ? 75  ALA D CB  1 
ATOM   5267  N N   . VAL D  2 80  ? -16.272 9.702   -20.612 1.00 36.64  ? 76  VAL D N   1 
ATOM   5268  C CA  . VAL D  2 80  ? -17.682 9.434   -20.848 1.00 36.07  ? 76  VAL D CA  1 
ATOM   5269  C C   . VAL D  2 80  ? -17.901 7.975   -20.481 1.00 37.53  ? 76  VAL D C   1 
ATOM   5270  O O   . VAL D  2 80  ? -19.012 7.560   -20.154 1.00 39.80  ? 76  VAL D O   1 
ATOM   5271  C CB  . VAL D  2 80  ? -18.065 9.659   -22.321 1.00 36.30  ? 76  VAL D CB  1 
ATOM   5272  C CG1 . VAL D  2 80  ? -19.481 9.194   -22.563 1.00 32.40  ? 76  VAL D CG1 1 
ATOM   5273  C CG2 . VAL D  2 80  ? -17.935 11.140  -22.669 1.00 34.59  ? 76  VAL D CG2 1 
ATOM   5274  N N   . THR D  2 81  ? -16.824 7.199   -20.542 1.00 37.82  ? 77  THR D N   1 
ATOM   5275  C CA  . THR D  2 81  ? -16.857 5.791   -20.185 1.00 40.69  ? 77  THR D CA  1 
ATOM   5276  C C   . THR D  2 81  ? -15.496 5.415   -19.605 1.00 42.97  ? 77  THR D C   1 
ATOM   5277  O O   . THR D  2 81  ? -14.540 6.181   -19.721 1.00 45.22  ? 77  THR D O   1 
ATOM   5278  C CB  . THR D  2 81  ? -17.145 4.884   -21.395 1.00 41.44  ? 77  THR D CB  1 
ATOM   5279  O OG1 . THR D  2 81  ? -16.130 5.072   -22.390 1.00 43.20  ? 77  THR D OG1 1 
ATOM   5280  C CG2 . THR D  2 81  ? -18.500 5.192   -21.974 1.00 38.19  ? 77  THR D CG2 1 
ATOM   5281  N N   . GLU D  2 82  ? -15.421 4.241   -18.982 1.00 43.60  ? 78  GLU D N   1 
ATOM   5282  C CA  . GLU D  2 82  ? -14.191 3.759   -18.363 1.00 44.99  ? 78  GLU D CA  1 
ATOM   5283  C C   . GLU D  2 82  ? -12.984 3.934   -19.269 1.00 43.43  ? 78  GLU D C   1 
ATOM   5284  O O   . GLU D  2 82  ? -11.967 4.515   -18.888 1.00 44.10  ? 78  GLU D O   1 
ATOM   5285  C CB  . GLU D  2 82  ? -14.331 2.276   -17.993 1.00 46.97  ? 78  GLU D CB  1 
ATOM   5286  C CG  . GLU D  2 82  ? -15.053 2.029   -16.688 1.00 54.00  ? 78  GLU D CG  1 
ATOM   5287  C CD  . GLU D  2 82  ? -14.321 2.645   -15.503 1.00 59.43  ? 78  GLU D CD  1 
ATOM   5288  O OE1 . GLU D  2 82  ? -13.179 2.209   -15.217 1.00 61.06  ? 78  GLU D OE1 1 
ATOM   5289  O OE2 . GLU D  2 82  ? -14.881 3.570   -14.864 1.00 61.28  ? 78  GLU D OE2 1 
ATOM   5290  N N   . LEU D  2 83  ? -13.124 3.419   -20.477 1.00 41.58  ? 79  LEU D N   1 
ATOM   5291  C CA  . LEU D  2 83  ? -12.082 3.458   -21.480 1.00 41.08  ? 79  LEU D CA  1 
ATOM   5292  C C   . LEU D  2 83  ? -11.397 4.823   -21.656 1.00 40.83  ? 79  LEU D C   1 
ATOM   5293  O O   . LEU D  2 83  ? -10.222 4.883   -22.031 1.00 41.16  ? 79  LEU D O   1 
ATOM   5294  C CB  . LEU D  2 83  ? -12.680 2.971   -22.797 1.00 38.82  ? 79  LEU D CB  1 
ATOM   5295  C CG  . LEU D  2 83  ? -11.789 2.189   -23.749 1.00 40.87  ? 79  LEU D CG  1 
ATOM   5296  C CD1 . LEU D  2 83  ? -10.844 1.248   -23.007 1.00 37.98  ? 79  LEU D CD1 1 
ATOM   5297  C CD2 . LEU D  2 83  ? -12.699 1.422   -24.672 1.00 39.26  ? 79  LEU D CD2 1 
ATOM   5298  N N   . GLY D  2 84  ? -12.108 5.910   -21.373 1.00 37.78  ? 80  GLY D N   1 
ATOM   5299  C CA  . GLY D  2 84  ? -11.513 7.223   -21.528 1.00 38.99  ? 80  GLY D CA  1 
ATOM   5300  C C   . GLY D  2 84  ? -10.979 7.827   -20.239 1.00 41.09  ? 80  GLY D C   1 
ATOM   5301  O O   . GLY D  2 84  ? -10.424 8.932   -20.233 1.00 39.34  ? 80  GLY D O   1 
ATOM   5302  N N   . ARG D  2 85  ? -11.122 7.098   -19.140 1.00 42.65  ? 81  ARG D N   1 
ATOM   5303  C CA  . ARG D  2 85  ? -10.660 7.600   -17.851 1.00 45.39  ? 81  ARG D CA  1 
ATOM   5304  C C   . ARG D  2 85  ? -9.162  7.959   -17.797 1.00 44.42  ? 81  ARG D C   1 
ATOM   5305  O O   . ARG D  2 85  ? -8.798  9.052   -17.355 1.00 43.84  ? 81  ARG D O   1 
ATOM   5306  C CB  . ARG D  2 85  ? -10.984 6.582   -16.752 1.00 48.89  ? 81  ARG D CB  1 
ATOM   5307  C CG  . ARG D  2 85  ? -10.698 7.089   -15.350 1.00 55.49  ? 81  ARG D CG  1 
ATOM   5308  C CD  . ARG D  2 85  ? -10.712 5.962   -14.327 1.00 60.83  ? 81  ARG D CD  1 
ATOM   5309  N NE  . ARG D  2 85  ? -10.265 6.414   -13.009 1.00 64.95  ? 81  ARG D NE  1 
ATOM   5310  C CZ  . ARG D  2 85  ? -9.870  5.601   -12.029 1.00 66.46  ? 81  ARG D CZ  1 
ATOM   5311  N NH1 . ARG D  2 85  ? -9.862  4.285   -12.216 1.00 64.30  ? 81  ARG D NH1 1 
ATOM   5312  N NH2 . ARG D  2 85  ? -9.485  6.104   -10.857 1.00 66.90  ? 81  ARG D NH2 1 
ATOM   5313  N N   . PRO D  2 86  ? -8.279  7.052   -18.259 1.00 43.01  ? 82  PRO D N   1 
ATOM   5314  C CA  . PRO D  2 86  ? -6.830  7.295   -18.241 1.00 43.14  ? 82  PRO D CA  1 
ATOM   5315  C C   . PRO D  2 86  ? -6.420  8.614   -18.875 1.00 44.10  ? 82  PRO D C   1 
ATOM   5316  O O   . PRO D  2 86  ? -5.578  9.336   -18.341 1.00 44.73  ? 82  PRO D O   1 
ATOM   5317  C CB  . PRO D  2 86  ? -6.262  6.106   -19.017 1.00 41.60  ? 82  PRO D CB  1 
ATOM   5318  C CG  . PRO D  2 86  ? -7.293  5.043   -18.830 1.00 41.65  ? 82  PRO D CG  1 
ATOM   5319  C CD  . PRO D  2 86  ? -8.584  5.792   -18.957 1.00 41.09  ? 82  PRO D CD  1 
ATOM   5320  N N   . ASP D  2 87  ? -7.020  8.916   -20.021 1.00 43.94  ? 83  ASP D N   1 
ATOM   5321  C CA  . ASP D  2 87  ? -6.699  10.129  -20.749 1.00 43.80  ? 83  ASP D CA  1 
ATOM   5322  C C   . ASP D  2 87  ? -7.204  11.353  -20.013 1.00 44.82  ? 83  ASP D C   1 
ATOM   5323  O O   . ASP D  2 87  ? -6.596  12.417  -20.071 1.00 45.94  ? 83  ASP D O   1 
ATOM   5324  C CB  . ASP D  2 87  ? -7.308  10.065  -22.147 1.00 44.53  ? 83  ASP D CB  1 
ATOM   5325  C CG  . ASP D  2 87  ? -7.002  8.760   -22.850 1.00 45.15  ? 83  ASP D CG  1 
ATOM   5326  O OD1 . ASP D  2 87  ? -5.837  8.323   -22.798 1.00 46.96  ? 83  ASP D OD1 1 
ATOM   5327  O OD2 . ASP D  2 87  ? -7.919  8.169   -23.456 1.00 44.86  ? 83  ASP D OD2 1 
ATOM   5328  N N   . ALA D  2 88  ? -8.324  11.203  -19.321 1.00 44.98  ? 84  ALA D N   1 
ATOM   5329  C CA  . ALA D  2 88  ? -8.880  12.314  -18.572 1.00 46.95  ? 84  ALA D CA  1 
ATOM   5330  C C   . ALA D  2 88  ? -7.845  12.719  -17.524 1.00 47.80  ? 84  ALA D C   1 
ATOM   5331  O O   . ALA D  2 88  ? -7.410  13.877  -17.452 1.00 46.32  ? 84  ALA D O   1 
ATOM   5332  C CB  . ALA D  2 88  ? -10.190 11.894  -17.899 1.00 44.38  ? 84  ALA D CB  1 
ATOM   5333  N N   . GLU D  2 89  ? -7.440  11.733  -16.733 1.00 49.52  ? 85  GLU D N   1 
ATOM   5334  C CA  . GLU D  2 89  ? -6.472  11.925  -15.667 1.00 52.23  ? 85  GLU D CA  1 
ATOM   5335  C C   . GLU D  2 89  ? -5.123  12.424  -16.175 1.00 52.06  ? 85  GLU D C   1 
ATOM   5336  O O   . GLU D  2 89  ? -4.555  13.369  -15.622 1.00 52.19  ? 85  GLU D O   1 
ATOM   5337  C CB  . GLU D  2 89  ? -6.318  10.611  -14.901 1.00 54.42  ? 85  GLU D CB  1 
ATOM   5338  C CG  . GLU D  2 89  ? -7.683  10.024  -14.539 1.00 59.49  ? 85  GLU D CG  1 
ATOM   5339  C CD  . GLU D  2 89  ? -7.625  8.750   -13.711 1.00 62.13  ? 85  GLU D CD  1 
ATOM   5340  O OE1 . GLU D  2 89  ? -6.890  7.806   -14.086 1.00 63.27  ? 85  GLU D OE1 1 
ATOM   5341  O OE2 . GLU D  2 89  ? -8.343  8.693   -12.687 1.00 62.90  ? 85  GLU D OE2 1 
ATOM   5342  N N   . ASN D  2 90  ? -4.619  11.811  -17.239 1.00 51.65  ? 86  ASN D N   1 
ATOM   5343  C CA  . ASN D  2 90  ? -3.334  12.220  -17.791 1.00 50.99  ? 86  ASN D CA  1 
ATOM   5344  C C   . ASN D  2 90  ? -3.352  13.656  -18.292 1.00 51.15  ? 86  ASN D C   1 
ATOM   5345  O O   . ASN D  2 90  ? -2.519  14.474  -17.900 1.00 51.40  ? 86  ASN D O   1 
ATOM   5346  C CB  . ASN D  2 90  ? -2.916  11.283  -18.930 1.00 51.97  ? 86  ASN D CB  1 
ATOM   5347  C CG  . ASN D  2 90  ? -1.681  11.774  -19.673 1.00 51.46  ? 86  ASN D CG  1 
ATOM   5348  O OD1 . ASN D  2 90  ? -0.868  12.506  -19.125 1.00 54.03  ? 86  ASN D OD1 1 
ATOM   5349  N ND2 . ASN D  2 90  ? -1.532  11.356  -20.918 1.00 51.20  ? 86  ASN D ND2 1 
ATOM   5350  N N   . TRP D  2 91  ? -4.316  13.972  -19.143 1.00 50.29  ? 87  TRP D N   1 
ATOM   5351  C CA  . TRP D  2 91  ? -4.389  15.307  -19.705 1.00 50.75  ? 87  TRP D CA  1 
ATOM   5352  C C   . TRP D  2 91  ? -4.758  16.443  -18.755 1.00 51.61  ? 87  TRP D C   1 
ATOM   5353  O O   . TRP D  2 91  ? -4.276  17.562  -18.917 1.00 51.64  ? 87  TRP D O   1 
ATOM   5354  C CB  . TRP D  2 91  ? -5.324  15.300  -20.916 1.00 50.01  ? 87  TRP D CB  1 
ATOM   5355  C CG  . TRP D  2 91  ? -4.811  14.428  -22.027 1.00 49.51  ? 87  TRP D CG  1 
ATOM   5356  C CD1 . TRP D  2 91  ? -3.542  13.929  -22.159 1.00 48.97  ? 87  TRP D CD1 1 
ATOM   5357  C CD2 . TRP D  2 91  ? -5.536  13.986  -23.180 1.00 48.12  ? 87  TRP D CD2 1 
ATOM   5358  N NE1 . TRP D  2 91  ? -3.435  13.209  -23.322 1.00 48.77  ? 87  TRP D NE1 1 
ATOM   5359  C CE2 . TRP D  2 91  ? -4.643  13.228  -23.969 1.00 48.46  ? 87  TRP D CE2 1 
ATOM   5360  C CE3 . TRP D  2 91  ? -6.852  14.157  -23.626 1.00 46.98  ? 87  TRP D CE3 1 
ATOM   5361  C CZ2 . TRP D  2 91  ? -5.028  12.642  -25.180 1.00 47.34  ? 87  TRP D CZ2 1 
ATOM   5362  C CZ3 . TRP D  2 91  ? -7.232  13.575  -24.828 1.00 44.97  ? 87  TRP D CZ3 1 
ATOM   5363  C CH2 . TRP D  2 91  ? -6.324  12.829  -25.590 1.00 45.12  ? 87  TRP D CH2 1 
ATOM   5364  N N   . ASN D  2 92  ? -5.604  16.183  -17.766 1.00 53.03  ? 88  ASN D N   1 
ATOM   5365  C CA  . ASN D  2 92  ? -5.971  17.252  -16.841 1.00 52.76  ? 88  ASN D CA  1 
ATOM   5366  C C   . ASN D  2 92  ? -4.812  17.601  -15.906 1.00 52.95  ? 88  ASN D C   1 
ATOM   5367  O O   . ASN D  2 92  ? -4.786  18.685  -15.322 1.00 53.82  ? 88  ASN D O   1 
ATOM   5368  C CB  . ASN D  2 92  ? -7.203  16.868  -16.021 1.00 50.95  ? 88  ASN D CB  1 
ATOM   5369  C CG  . ASN D  2 92  ? -8.459  16.781  -16.863 1.00 50.14  ? 88  ASN D CG  1 
ATOM   5370  O OD1 . ASN D  2 92  ? -8.720  17.642  -17.701 1.00 49.98  ? 88  ASN D OD1 1 
ATOM   5371  N ND2 . ASN D  2 92  ? -9.251  15.744  -16.633 1.00 49.85  ? 88  ASN D ND2 1 
ATOM   5372  N N   . SER D  2 93  ? -3.853  16.690  -15.775 1.00 52.57  ? 89  SER D N   1 
ATOM   5373  C CA  . SER D  2 93  ? -2.701  16.931  -14.912 1.00 53.63  ? 89  SER D CA  1 
ATOM   5374  C C   . SER D  2 93  ? -1.587  17.659  -15.672 1.00 53.19  ? 89  SER D C   1 
ATOM   5375  O O   . SER D  2 93  ? -0.491  17.850  -15.148 1.00 53.48  ? 89  SER D O   1 
ATOM   5376  C CB  . SER D  2 93  ? -2.154  15.611  -14.363 1.00 52.66  ? 89  SER D CB  1 
ATOM   5377  O OG  . SER D  2 93  ? -1.179  15.068  -15.239 1.00 55.89  ? 89  SER D OG  1 
ATOM   5378  N N   . GLN D  2 94  ? -1.865  18.049  -16.910 1.00 52.81  ? 90  GLN D N   1 
ATOM   5379  C CA  . GLN D  2 94  ? -0.883  18.757  -17.721 1.00 53.78  ? 90  GLN D CA  1 
ATOM   5380  C C   . GLN D  2 94  ? -1.357  20.190  -17.900 1.00 55.30  ? 90  GLN D C   1 
ATOM   5381  O O   . GLN D  2 94  ? -1.926  20.533  -18.932 1.00 55.13  ? 90  GLN D O   1 
ATOM   5382  C CB  . GLN D  2 94  ? -0.738  18.095  -19.092 1.00 52.46  ? 90  GLN D CB  1 
ATOM   5383  C CG  . GLN D  2 94  ? -0.039  16.746  -19.089 1.00 50.97  ? 90  GLN D CG  1 
ATOM   5384  C CD  . GLN D  2 94  ? -0.116  16.058  -20.443 1.00 51.06  ? 90  GLN D CD  1 
ATOM   5385  O OE1 . GLN D  2 94  ? 0.091   16.690  -21.481 1.00 49.93  ? 90  GLN D OE1 1 
ATOM   5386  N NE2 . GLN D  2 94  ? -0.404  14.755  -20.440 1.00 47.85  ? 90  GLN D NE2 1 
ATOM   5387  N N   . PRO D  2 95  ? -1.115  21.050  -16.896 1.00 57.08  ? 91  PRO D N   1 
ATOM   5388  C CA  . PRO D  2 95  ? -1.531  22.455  -16.953 1.00 58.21  ? 91  PRO D CA  1 
ATOM   5389  C C   . PRO D  2 95  ? -1.205  23.150  -18.265 1.00 58.81  ? 91  PRO D C   1 
ATOM   5390  O O   . PRO D  2 95  ? -2.017  23.908  -18.794 1.00 58.49  ? 91  PRO D O   1 
ATOM   5391  C CB  . PRO D  2 95  ? -0.803  23.084  -15.763 1.00 58.14  ? 91  PRO D CB  1 
ATOM   5392  C CG  . PRO D  2 95  ? 0.399   22.216  -15.594 1.00 58.68  ? 91  PRO D CG  1 
ATOM   5393  C CD  . PRO D  2 95  ? -0.181  20.836  -15.778 1.00 58.20  ? 91  PRO D CD  1 
ATOM   5394  N N   . GLU D  2 96  ? -0.013  22.894  -18.787 1.00 60.21  ? 92  GLU D N   1 
ATOM   5395  C CA  . GLU D  2 96  ? 0.388   23.513  -20.039 1.00 61.87  ? 92  GLU D CA  1 
ATOM   5396  C C   . GLU D  2 96  ? -0.600  23.133  -21.138 1.00 59.89  ? 92  GLU D C   1 
ATOM   5397  O O   . GLU D  2 96  ? -1.091  23.996  -21.870 1.00 58.78  ? 92  GLU D O   1 
ATOM   5398  C CB  . GLU D  2 96  ? 1.816   23.082  -20.433 1.00 65.71  ? 92  GLU D CB  1 
ATOM   5399  C CG  . GLU D  2 96  ? 2.919   23.566  -19.478 1.00 70.42  ? 92  GLU D CG  1 
ATOM   5400  C CD  . GLU D  2 96  ? 4.317   23.561  -20.107 1.00 73.89  ? 92  GLU D CD  1 
ATOM   5401  O OE1 . GLU D  2 96  ? 4.793   22.485  -20.549 1.00 75.90  ? 92  GLU D OE1 1 
ATOM   5402  O OE2 . GLU D  2 96  ? 4.947   24.643  -20.156 1.00 74.78  ? 92  GLU D OE2 1 
ATOM   5403  N N   . PHE D  2 97  ? -0.902  21.841  -21.233 1.00 58.08  ? 93  PHE D N   1 
ATOM   5404  C CA  . PHE D  2 97  ? -1.820  21.342  -22.252 1.00 58.26  ? 93  PHE D CA  1 
ATOM   5405  C C   . PHE D  2 97  ? -3.234  21.890  -22.082 1.00 57.61  ? 93  PHE D C   1 
ATOM   5406  O O   . PHE D  2 97  ? -3.818  22.415  -23.033 1.00 56.14  ? 93  PHE D O   1 
ATOM   5407  C CB  . PHE D  2 97  ? -1.857  19.812  -22.230 1.00 58.21  ? 93  PHE D CB  1 
ATOM   5408  C CG  . PHE D  2 97  ? -2.628  19.207  -23.367 1.00 57.35  ? 93  PHE D CG  1 
ATOM   5409  C CD1 . PHE D  2 97  ? -2.369  19.585  -24.681 1.00 56.57  ? 93  PHE D CD1 1 
ATOM   5410  C CD2 . PHE D  2 97  ? -3.593  18.235  -23.129 1.00 57.66  ? 93  PHE D CD2 1 
ATOM   5411  C CE1 . PHE D  2 97  ? -3.058  19.001  -25.741 1.00 56.13  ? 93  PHE D CE1 1 
ATOM   5412  C CE2 . PHE D  2 97  ? -4.287  17.645  -24.188 1.00 56.93  ? 93  PHE D CE2 1 
ATOM   5413  C CZ  . PHE D  2 97  ? -4.017  18.031  -25.493 1.00 55.70  ? 93  PHE D CZ  1 
ATOM   5414  N N   . LEU D  2 98  ? -3.779  21.769  -20.874 1.00 57.51  ? 94  LEU D N   1 
ATOM   5415  C CA  . LEU D  2 98  ? -5.121  22.261  -20.606 1.00 58.31  ? 94  LEU D CA  1 
ATOM   5416  C C   . LEU D  2 98  ? -5.276  23.698  -21.063 1.00 60.00  ? 94  LEU D C   1 
ATOM   5417  O O   . LEU D  2 98  ? -6.216  24.041  -21.782 1.00 60.49  ? 94  LEU D O   1 
ATOM   5418  C CB  . LEU D  2 98  ? -5.435  22.172  -19.121 1.00 57.65  ? 94  LEU D CB  1 
ATOM   5419  C CG  . LEU D  2 98  ? -5.943  20.816  -18.645 1.00 59.82  ? 94  LEU D CG  1 
ATOM   5420  C CD1 . LEU D  2 98  ? -6.266  20.894  -17.157 1.00 59.82  ? 94  LEU D CD1 1 
ATOM   5421  C CD2 . LEU D  2 98  ? -7.185  20.432  -19.436 1.00 58.54  ? 94  LEU D CD2 1 
ATOM   5422  N N   . GLU D  2 99  ? -4.341  24.538  -20.641 1.00 61.40  ? 95  GLU D N   1 
ATOM   5423  C CA  . GLU D  2 99  ? -4.368  25.945  -20.998 1.00 63.06  ? 95  GLU D CA  1 
ATOM   5424  C C   . GLU D  2 99  ? -4.464  26.096  -22.516 1.00 62.78  ? 95  GLU D C   1 
ATOM   5425  O O   . GLU D  2 99  ? -5.259  26.892  -23.022 1.00 62.95  ? 95  GLU D O   1 
ATOM   5426  C CB  . GLU D  2 99  ? -3.106  26.633  -20.469 1.00 66.61  ? 95  GLU D CB  1 
ATOM   5427  C CG  . GLU D  2 99  ? -3.281  28.112  -20.143 1.00 71.46  ? 95  GLU D CG  1 
ATOM   5428  C CD  . GLU D  2 99  ? -4.236  28.363  -18.971 1.00 74.68  ? 95  GLU D CD  1 
ATOM   5429  O OE1 . GLU D  2 99  ? -4.341  29.535  -18.536 1.00 76.66  ? 95  GLU D OE1 1 
ATOM   5430  O OE2 . GLU D  2 99  ? -4.879  27.399  -18.489 1.00 74.30  ? 95  GLU D OE2 1 
ATOM   5431  N N   . GLN D  2 100 ? -3.660  25.322  -23.240 1.00 61.44  ? 96  GLN D N   1 
ATOM   5432  C CA  . GLN D  2 100 ? -3.669  25.377  -24.699 1.00 60.17  ? 96  GLN D CA  1 
ATOM   5433  C C   . GLN D  2 100 ? -5.041  24.989  -25.242 1.00 57.71  ? 96  GLN D C   1 
ATOM   5434  O O   . GLN D  2 100 ? -5.538  25.602  -26.183 1.00 56.97  ? 96  GLN D O   1 
ATOM   5435  C CB  . GLN D  2 100 ? -2.611  24.431  -25.282 1.00 63.27  ? 96  GLN D CB  1 
ATOM   5436  C CG  . GLN D  2 100 ? -2.470  24.522  -26.804 1.00 67.77  ? 96  GLN D CG  1 
ATOM   5437  C CD  . GLN D  2 100 ? -1.647  23.383  -27.397 1.00 71.22  ? 96  GLN D CD  1 
ATOM   5438  O OE1 . GLN D  2 100 ? -0.501  23.150  -26.998 1.00 72.92  ? 96  GLN D OE1 1 
ATOM   5439  N NE2 . GLN D  2 100 ? -2.234  22.666  -28.356 1.00 72.73  ? 96  GLN D NE2 1 
ATOM   5440  N N   . LYS D  2 101 ? -5.647  23.970  -24.639 1.00 55.37  ? 97  LYS D N   1 
ATOM   5441  C CA  . LYS D  2 101 ? -6.955  23.483  -25.063 1.00 53.86  ? 97  LYS D CA  1 
ATOM   5442  C C   . LYS D  2 101 ? -8.038  24.530  -24.812 1.00 53.85  ? 97  LYS D C   1 
ATOM   5443  O O   . LYS D  2 101 ? -8.873  24.807  -25.680 1.00 52.15  ? 97  LYS D O   1 
ATOM   5444  C CB  . LYS D  2 101 ? -7.297  22.186  -24.317 1.00 53.99  ? 97  LYS D CB  1 
ATOM   5445  C CG  . LYS D  2 101 ? -8.124  21.203  -25.130 1.00 53.47  ? 97  LYS D CG  1 
ATOM   5446  C CD  . LYS D  2 101 ? -7.377  20.803  -26.389 1.00 53.93  ? 97  LYS D CD  1 
ATOM   5447  C CE  . LYS D  2 101 ? -8.284  20.105  -27.389 1.00 53.36  ? 97  LYS D CE  1 
ATOM   5448  N NZ  . LYS D  2 101 ? -7.601  19.947  -28.713 1.00 52.10  ? 97  LYS D NZ  1 
ATOM   5449  N N   . ARG D  2 102 ? -8.005  25.117  -23.619 1.00 53.77  ? 98  ARG D N   1 
ATOM   5450  C CA  . ARG D  2 102 ? -8.968  26.138  -23.237 1.00 52.54  ? 98  ARG D CA  1 
ATOM   5451  C C   . ARG D  2 102 ? -8.889  27.385  -24.112 1.00 52.47  ? 98  ARG D C   1 
ATOM   5452  O O   . ARG D  2 102 ? -9.855  28.136  -24.200 1.00 53.42  ? 98  ARG D O   1 
ATOM   5453  C CB  . ARG D  2 102 ? -8.758  26.537  -21.780 1.00 52.16  ? 98  ARG D CB  1 
ATOM   5454  C CG  . ARG D  2 102 ? -9.090  25.452  -20.778 1.00 53.18  ? 98  ARG D CG  1 
ATOM   5455  C CD  . ARG D  2 102 ? -8.544  25.809  -19.412 1.00 52.65  ? 98  ARG D CD  1 
ATOM   5456  N NE  . ARG D  2 102 ? -8.994  24.892  -18.371 1.00 55.60  ? 98  ARG D NE  1 
ATOM   5457  C CZ  . ARG D  2 102 ? -8.406  24.770  -17.183 1.00 56.53  ? 98  ARG D CZ  1 
ATOM   5458  N NH1 . ARG D  2 102 ? -7.341  25.506  -16.896 1.00 57.07  ? 98  ARG D NH1 1 
ATOM   5459  N NH2 . ARG D  2 102 ? -8.883  23.922  -16.276 1.00 56.41  ? 98  ARG D NH2 1 
ATOM   5460  N N   . ALA D  2 103 ? -7.754  27.607  -24.765 1.00 51.57  ? 99  ALA D N   1 
ATOM   5461  C CA  . ALA D  2 103 ? -7.603  28.796  -25.608 1.00 52.36  ? 99  ALA D CA  1 
ATOM   5462  C C   . ALA D  2 103 ? -7.997  28.562  -27.061 1.00 52.83  ? 99  ALA D C   1 
ATOM   5463  O O   . ALA D  2 103 ? -8.172  29.513  -27.835 1.00 51.72  ? 99  ALA D O   1 
ATOM   5464  C CB  . ALA D  2 103 ? -6.165  29.309  -25.542 1.00 52.71  ? 99  ALA D CB  1 
ATOM   5465  N N   . GLU D  2 104 ? -8.133  27.293  -27.431 1.00 52.84  ? 100 GLU D N   1 
ATOM   5466  C CA  . GLU D  2 104 ? -8.491  26.950  -28.795 1.00 51.29  ? 100 GLU D CA  1 
ATOM   5467  C C   . GLU D  2 104 ? -9.835  27.544  -29.164 1.00 49.75  ? 100 GLU D C   1 
ATOM   5468  O O   . GLU D  2 104 ? -10.150 27.713  -30.341 1.00 49.90  ? 100 GLU D O   1 
ATOM   5469  C CB  . GLU D  2 104 ? -8.478  25.435  -28.963 1.00 51.93  ? 100 GLU D CB  1 
ATOM   5470  C CG  . GLU D  2 104 ? -7.090  24.877  -28.739 1.00 57.14  ? 100 GLU D CG  1 
ATOM   5471  C CD  . GLU D  2 104 ? -6.926  23.451  -29.199 1.00 58.37  ? 100 GLU D CD  1 
ATOM   5472  O OE1 . GLU D  2 104 ? -7.675  22.584  -28.708 1.00 60.97  ? 100 GLU D OE1 1 
ATOM   5473  O OE2 . GLU D  2 104 ? -6.041  23.199  -30.045 1.00 58.48  ? 100 GLU D OE2 1 
ATOM   5474  N N   . VAL D  2 105 ? -10.621 27.880  -28.151 1.00 48.87  ? 101 VAL D N   1 
ATOM   5475  C CA  . VAL D  2 105 ? -11.924 28.485  -28.388 1.00 50.73  ? 101 VAL D CA  1 
ATOM   5476  C C   . VAL D  2 105 ? -11.702 29.824  -29.092 1.00 50.80  ? 101 VAL D C   1 
ATOM   5477  O O   . VAL D  2 105 ? -12.572 30.317  -29.805 1.00 50.43  ? 101 VAL D O   1 
ATOM   5478  C CB  . VAL D  2 105 ? -12.676 28.706  -27.062 1.00 53.09  ? 101 VAL D CB  1 
ATOM   5479  C CG1 . VAL D  2 105 ? -14.163 28.899  -27.330 1.00 53.23  ? 101 VAL D CG1 1 
ATOM   5480  C CG2 . VAL D  2 105 ? -12.448 27.512  -26.138 1.00 53.81  ? 101 VAL D CG2 1 
ATOM   5481  N N   . ASP D  2 106 ? -10.518 30.403  -28.889 1.00 52.00  ? 102 ASP D N   1 
ATOM   5482  C CA  . ASP D  2 106 ? -10.155 31.666  -29.526 1.00 51.05  ? 102 ASP D CA  1 
ATOM   5483  C C   . ASP D  2 106 ? -9.160  31.426  -30.655 1.00 50.09  ? 102 ASP D C   1 
ATOM   5484  O O   . ASP D  2 106 ? -9.353  31.907  -31.771 1.00 50.88  ? 102 ASP D O   1 
ATOM   5485  C CB  . ASP D  2 106 ? -9.527  32.635  -28.516 1.00 53.05  ? 102 ASP D CB  1 
ATOM   5486  C CG  . ASP D  2 106 ? -10.514 33.123  -27.481 1.00 54.82  ? 102 ASP D CG  1 
ATOM   5487  O OD1 . ASP D  2 106 ? -11.515 33.757  -27.878 1.00 56.38  ? 102 ASP D OD1 1 
ATOM   5488  O OD2 . ASP D  2 106 ? -10.289 32.876  -26.274 1.00 54.61  ? 102 ASP D OD2 1 
ATOM   5489  N N   . THR D  2 107 ? -8.099  30.675  -30.367 1.00 49.47  ? 103 THR D N   1 
ATOM   5490  C CA  . THR D  2 107 ? -7.071  30.417  -31.374 1.00 49.60  ? 103 THR D CA  1 
ATOM   5491  C C   . THR D  2 107 ? -7.541  29.578  -32.544 1.00 48.55  ? 103 THR D C   1 
ATOM   5492  O O   . THR D  2 107 ? -6.936  29.618  -33.613 1.00 49.31  ? 103 THR D O   1 
ATOM   5493  C CB  . THR D  2 107 ? -5.817  29.744  -30.767 1.00 50.33  ? 103 THR D CB  1 
ATOM   5494  O OG1 . THR D  2 107 ? -6.159  28.453  -30.255 1.00 50.75  ? 103 THR D OG1 1 
ATOM   5495  C CG2 . THR D  2 107 ? -5.252  30.601  -29.635 1.00 50.63  ? 103 THR D CG2 1 
ATOM   5496  N N   . VAL D  2 108 ? -8.617  28.821  -32.354 1.00 48.37  ? 104 VAL D N   1 
ATOM   5497  C CA  . VAL D  2 108 ? -9.139  27.996  -33.439 1.00 47.82  ? 104 VAL D CA  1 
ATOM   5498  C C   . VAL D  2 108 ? -10.569 28.339  -33.846 1.00 46.97  ? 104 VAL D C   1 
ATOM   5499  O O   . VAL D  2 108 ? -10.810 28.733  -34.987 1.00 46.82  ? 104 VAL D O   1 
ATOM   5500  C CB  . VAL D  2 108 ? -9.071  26.490  -33.097 1.00 48.65  ? 104 VAL D CB  1 
ATOM   5501  C CG1 . VAL D  2 108 ? -9.653  25.664  -34.252 1.00 48.11  ? 104 VAL D CG1 1 
ATOM   5502  C CG2 . VAL D  2 108 ? -7.618  26.079  -32.852 1.00 47.84  ? 104 VAL D CG2 1 
ATOM   5503  N N   . CYS D  2 109 ? -11.512 28.193  -32.918 1.00 47.14  ? 105 CYS D N   1 
ATOM   5504  C CA  . CYS D  2 109 ? -12.915 28.475  -33.210 1.00 46.52  ? 105 CYS D CA  1 
ATOM   5505  C C   . CYS D  2 109 ? -13.144 29.888  -33.750 1.00 46.66  ? 105 CYS D C   1 
ATOM   5506  O O   . CYS D  2 109 ? -13.500 30.066  -34.920 1.00 45.45  ? 105 CYS D O   1 
ATOM   5507  C CB  . CYS D  2 109 ? -13.775 28.265  -31.964 1.00 46.99  ? 105 CYS D CB  1 
ATOM   5508  S SG  . CYS D  2 109 ? -13.963 26.549  -31.362 1.00 51.22  ? 105 CYS D SG  1 
ATOM   5509  N N   . ARG D  2 110 ? -12.952 30.891  -32.899 1.00 47.20  ? 106 ARG D N   1 
ATOM   5510  C CA  . ARG D  2 110 ? -13.142 32.278  -33.324 1.00 47.67  ? 106 ARG D CA  1 
ATOM   5511  C C   . ARG D  2 110 ? -12.241 32.650  -34.496 1.00 47.59  ? 106 ARG D C   1 
ATOM   5512  O O   . ARG D  2 110 ? -12.660 33.376  -35.400 1.00 47.34  ? 106 ARG D O   1 
ATOM   5513  C CB  . ARG D  2 110 ? -12.897 33.246  -32.162 1.00 46.54  ? 106 ARG D CB  1 
ATOM   5514  C CG  . ARG D  2 110 ? -14.030 33.272  -31.147 1.00 48.93  ? 106 ARG D CG  1 
ATOM   5515  C CD  . ARG D  2 110 ? -13.955 34.498  -30.247 1.00 48.66  ? 106 ARG D CD  1 
ATOM   5516  N NE  . ARG D  2 110 ? -15.115 34.597  -29.365 1.00 49.31  ? 106 ARG D NE  1 
ATOM   5517  C CZ  . ARG D  2 110 ? -15.244 33.958  -28.204 1.00 49.86  ? 106 ARG D CZ  1 
ATOM   5518  N NH1 . ARG D  2 110 ? -14.282 33.161  -27.755 1.00 48.47  ? 106 ARG D NH1 1 
ATOM   5519  N NH2 . ARG D  2 110 ? -16.350 34.110  -27.491 1.00 51.33  ? 106 ARG D NH2 1 
ATOM   5520  N N   . HIS D  2 111 ? -11.008 32.150  -34.488 1.00 47.91  ? 107 HIS D N   1 
ATOM   5521  C CA  . HIS D  2 111 ? -10.080 32.451  -35.572 1.00 48.27  ? 107 HIS D CA  1 
ATOM   5522  C C   . HIS D  2 111 ? -10.670 31.987  -36.895 1.00 48.20  ? 107 HIS D C   1 
ATOM   5523  O O   . HIS D  2 111 ? -10.859 32.794  -37.809 1.00 50.13  ? 107 HIS D O   1 
ATOM   5524  C CB  . HIS D  2 111 ? -8.722  31.769  -35.353 1.00 50.32  ? 107 HIS D CB  1 
ATOM   5525  C CG  . HIS D  2 111 ? -7.810  31.841  -36.544 1.00 53.24  ? 107 HIS D CG  1 
ATOM   5526  N ND1 . HIS D  2 111 ? -7.165  33.001  -36.925 1.00 55.14  ? 107 HIS D ND1 1 
ATOM   5527  C CD2 . HIS D  2 111 ? -7.462  30.901  -37.457 1.00 53.50  ? 107 HIS D CD2 1 
ATOM   5528  C CE1 . HIS D  2 111 ? -6.461  32.772  -38.021 1.00 55.32  ? 107 HIS D CE1 1 
ATOM   5529  N NE2 . HIS D  2 111 ? -6.625  31.505  -38.365 1.00 55.72  ? 107 HIS D NE2 1 
ATOM   5530  N N   . ASN D  2 112 ? -10.970 30.693  -36.994 1.00 46.26  ? 108 ASN D N   1 
ATOM   5531  C CA  . ASN D  2 112 ? -11.523 30.149  -38.227 1.00 44.15  ? 108 ASN D CA  1 
ATOM   5532  C C   . ASN D  2 112 ? -12.878 30.750  -38.555 1.00 42.74  ? 108 ASN D C   1 
ATOM   5533  O O   . ASN D  2 112 ? -13.235 30.877  -39.723 1.00 40.83  ? 108 ASN D O   1 
ATOM   5534  C CB  . ASN D  2 112 ? -11.650 28.625  -38.147 1.00 43.85  ? 108 ASN D CB  1 
ATOM   5535  C CG  . ASN D  2 112 ? -10.311 27.928  -38.021 1.00 43.03  ? 108 ASN D CG  1 
ATOM   5536  O OD1 . ASN D  2 112 ? -9.353  28.268  -38.708 1.00 44.10  ? 108 ASN D OD1 1 
ATOM   5537  N ND2 . ASN D  2 112 ? -10.245 26.929  -37.153 1.00 42.79  ? 108 ASN D ND2 1 
ATOM   5538  N N   . TYR D  2 113 ? -13.637 31.124  -37.532 1.00 43.92  ? 109 TYR D N   1 
ATOM   5539  C CA  . TYR D  2 113 ? -14.955 31.705  -37.776 1.00 46.92  ? 109 TYR D CA  1 
ATOM   5540  C C   . TYR D  2 113 ? -14.835 32.988  -38.590 1.00 48.32  ? 109 TYR D C   1 
ATOM   5541  O O   . TYR D  2 113 ? -15.652 33.257  -39.476 1.00 48.75  ? 109 TYR D O   1 
ATOM   5542  C CB  . TYR D  2 113 ? -15.679 32.016  -36.464 1.00 46.65  ? 109 TYR D CB  1 
ATOM   5543  C CG  . TYR D  2 113 ? -17.104 32.487  -36.682 1.00 49.70  ? 109 TYR D CG  1 
ATOM   5544  C CD1 . TYR D  2 113 ? -18.130 31.576  -36.956 1.00 50.97  ? 109 TYR D CD1 1 
ATOM   5545  C CD2 . TYR D  2 113 ? -17.422 33.849  -36.670 1.00 50.26  ? 109 TYR D CD2 1 
ATOM   5546  C CE1 . TYR D  2 113 ? -19.440 32.010  -37.219 1.00 50.99  ? 109 TYR D CE1 1 
ATOM   5547  C CE2 . TYR D  2 113 ? -18.728 34.296  -36.933 1.00 51.60  ? 109 TYR D CE2 1 
ATOM   5548  C CZ  . TYR D  2 113 ? -19.730 33.371  -37.208 1.00 52.58  ? 109 TYR D CZ  1 
ATOM   5549  O OH  . TYR D  2 113 ? -21.008 33.815  -37.486 1.00 52.71  ? 109 TYR D OH  1 
ATOM   5550  N N   . GLU D  2 114 ? -13.813 33.783  -38.285 1.00 49.76  ? 110 GLU D N   1 
ATOM   5551  C CA  . GLU D  2 114 ? -13.599 35.041  -38.990 1.00 51.72  ? 110 GLU D CA  1 
ATOM   5552  C C   . GLU D  2 114 ? -13.139 34.811  -40.421 1.00 49.50  ? 110 GLU D C   1 
ATOM   5553  O O   . GLU D  2 114 ? -13.419 35.612  -41.304 1.00 49.80  ? 110 GLU D O   1 
ATOM   5554  C CB  . GLU D  2 114 ? -12.606 35.902  -38.218 1.00 53.36  ? 110 GLU D CB  1 
ATOM   5555  C CG  . GLU D  2 114 ? -13.184 36.366  -36.896 1.00 57.98  ? 110 GLU D CG  1 
ATOM   5556  C CD  . GLU D  2 114 ? -12.132 36.898  -35.957 1.00 62.44  ? 110 GLU D CD  1 
ATOM   5557  O OE1 . GLU D  2 114 ? -11.371 37.794  -36.380 1.00 66.91  ? 110 GLU D OE1 1 
ATOM   5558  O OE2 . GLU D  2 114 ? -12.068 36.427  -34.796 1.00 64.05  ? 110 GLU D OE2 1 
ATOM   5559  N N   . ILE D  2 115 ? -12.446 33.709  -40.656 1.00 47.90  ? 111 ILE D N   1 
ATOM   5560  C CA  . ILE D  2 115 ? -12.016 33.404  -42.007 1.00 46.98  ? 111 ILE D CA  1 
ATOM   5561  C C   . ILE D  2 115 ? -13.237 32.974  -42.803 1.00 47.35  ? 111 ILE D C   1 
ATOM   5562  O O   . ILE D  2 115 ? -13.450 33.430  -43.925 1.00 48.17  ? 111 ILE D O   1 
ATOM   5563  C CB  . ILE D  2 115 ? -10.989 32.262  -42.038 1.00 46.76  ? 111 ILE D CB  1 
ATOM   5564  C CG1 . ILE D  2 115 ? -9.685  32.725  -41.379 1.00 46.07  ? 111 ILE D CG1 1 
ATOM   5565  C CG2 . ILE D  2 115 ? -10.796 31.782  -43.483 1.00 44.72  ? 111 ILE D CG2 1 
ATOM   5566  C CD1 . ILE D  2 115 ? -8.591  31.669  -41.347 1.00 46.94  ? 111 ILE D CD1 1 
ATOM   5567  N N   . PHE D  2 116 ? -14.050 32.104  -42.209 1.00 47.46  ? 112 PHE D N   1 
ATOM   5568  C CA  . PHE D  2 116 ? -15.251 31.601  -42.874 1.00 46.50  ? 112 PHE D CA  1 
ATOM   5569  C C   . PHE D  2 116 ? -16.374 32.623  -42.957 1.00 48.39  ? 112 PHE D C   1 
ATOM   5570  O O   . PHE D  2 116 ? -17.246 32.531  -43.823 1.00 49.05  ? 112 PHE D O   1 
ATOM   5571  C CB  . PHE D  2 116 ? -15.762 30.342  -42.168 1.00 44.58  ? 112 PHE D CB  1 
ATOM   5572  C CG  . PHE D  2 116 ? -14.774 29.207  -42.162 1.00 42.03  ? 112 PHE D CG  1 
ATOM   5573  C CD1 . PHE D  2 116 ? -13.948 28.981  -43.263 1.00 40.81  ? 112 PHE D CD1 1 
ATOM   5574  C CD2 . PHE D  2 116 ? -14.673 28.366  -41.065 1.00 39.83  ? 112 PHE D CD2 1 
ATOM   5575  C CE1 . PHE D  2 116 ? -13.035 27.937  -43.272 1.00 39.71  ? 112 PHE D CE1 1 
ATOM   5576  C CE2 . PHE D  2 116 ? -13.759 27.313  -41.062 1.00 40.26  ? 112 PHE D CE2 1 
ATOM   5577  C CZ  . PHE D  2 116 ? -12.940 27.100  -42.169 1.00 39.07  ? 112 PHE D CZ  1 
ATOM   5578  N N   . ASP D  2 117 ? -16.354 33.604  -42.065 1.00 50.82  ? 113 ASP D N   1 
ATOM   5579  C CA  . ASP D  2 117 ? -17.389 34.632  -42.059 1.00 53.04  ? 113 ASP D CA  1 
ATOM   5580  C C   . ASP D  2 117 ? -17.378 35.461  -43.346 1.00 52.91  ? 113 ASP D C   1 
ATOM   5581  O O   . ASP D  2 117 ? -18.270 36.270  -43.572 1.00 52.28  ? 113 ASP D O   1 
ATOM   5582  C CB  . ASP D  2 117 ? -17.192 35.558  -40.857 1.00 57.32  ? 113 ASP D CB  1 
ATOM   5583  C CG  . ASP D  2 117 ? -18.458 36.294  -40.471 1.00 60.34  ? 113 ASP D CG  1 
ATOM   5584  O OD1 . ASP D  2 117 ? -19.114 36.881  -41.357 1.00 62.86  ? 113 ASP D OD1 1 
ATOM   5585  O OD2 . ASP D  2 117 ? -18.797 36.286  -39.268 1.00 63.78  ? 113 ASP D OD2 1 
ATOM   5586  N N   . ASN D  2 118 ? -16.372 35.259  -44.193 1.00 53.84  ? 114 ASN D N   1 
ATOM   5587  C CA  . ASN D  2 118 ? -16.271 36.023  -45.438 1.00 53.88  ? 114 ASN D CA  1 
ATOM   5588  C C   . ASN D  2 118 ? -16.877 35.359  -46.669 1.00 53.75  ? 114 ASN D C   1 
ATOM   5589  O O   . ASN D  2 118 ? -17.258 36.053  -47.617 1.00 55.90  ? 114 ASN D O   1 
ATOM   5590  C CB  . ASN D  2 118 ? -14.807 36.389  -45.733 1.00 54.05  ? 114 ASN D CB  1 
ATOM   5591  C CG  . ASN D  2 118 ? -14.250 37.399  -44.749 1.00 53.86  ? 114 ASN D CG  1 
ATOM   5592  O OD1 . ASN D  2 118 ? -14.844 38.453  -44.523 1.00 55.36  ? 114 ASN D OD1 1 
ATOM   5593  N ND2 . ASN D  2 118 ? -13.107 37.082  -44.156 1.00 56.10  ? 114 ASN D ND2 1 
ATOM   5594  N N   . PHE D  2 119 ? -16.962 34.030  -46.678 1.00 52.10  ? 115 PHE D N   1 
ATOM   5595  C CA  . PHE D  2 119 ? -17.543 33.345  -47.827 1.00 50.42  ? 115 PHE D CA  1 
ATOM   5596  C C   . PHE D  2 119 ? -18.577 32.265  -47.505 1.00 50.35  ? 115 PHE D C   1 
ATOM   5597  O O   . PHE D  2 119 ? -19.448 31.974  -48.329 1.00 50.95  ? 115 PHE D O   1 
ATOM   5598  C CB  . PHE D  2 119 ? -16.445 32.766  -48.723 1.00 49.29  ? 115 PHE D CB  1 
ATOM   5599  C CG  . PHE D  2 119 ? -15.499 31.831  -48.024 1.00 48.33  ? 115 PHE D CG  1 
ATOM   5600  C CD1 . PHE D  2 119 ? -14.706 32.272  -46.967 1.00 47.32  ? 115 PHE D CD1 1 
ATOM   5601  C CD2 . PHE D  2 119 ? -15.356 30.519  -48.467 1.00 46.70  ? 115 PHE D CD2 1 
ATOM   5602  C CE1 . PHE D  2 119 ? -13.783 31.424  -46.364 1.00 46.59  ? 115 PHE D CE1 1 
ATOM   5603  C CE2 . PHE D  2 119 ? -14.437 29.662  -47.872 1.00 47.58  ? 115 PHE D CE2 1 
ATOM   5604  C CZ  . PHE D  2 119 ? -13.646 30.114  -46.817 1.00 46.25  ? 115 PHE D CZ  1 
ATOM   5605  N N   . LEU D  2 120 ? -18.501 31.678  -46.315 1.00 49.37  ? 116 LEU D N   1 
ATOM   5606  C CA  . LEU D  2 120 ? -19.461 30.638  -45.942 1.00 46.86  ? 116 LEU D CA  1 
ATOM   5607  C C   . LEU D  2 120 ? -20.716 31.223  -45.286 1.00 47.08  ? 116 LEU D C   1 
ATOM   5608  O O   . LEU D  2 120 ? -21.812 31.098  -45.819 1.00 47.34  ? 116 LEU D O   1 
ATOM   5609  C CB  . LEU D  2 120 ? -18.790 29.606  -45.023 1.00 44.00  ? 116 LEU D CB  1 
ATOM   5610  C CG  . LEU D  2 120 ? -17.579 28.892  -45.657 1.00 42.24  ? 116 LEU D CG  1 
ATOM   5611  C CD1 . LEU D  2 120 ? -16.945 27.915  -44.667 1.00 41.09  ? 116 LEU D CD1 1 
ATOM   5612  C CD2 . LEU D  2 120 ? -18.017 28.164  -46.911 1.00 37.64  ? 116 LEU D CD2 1 
ATOM   5613  N N   . VAL D  2 121 ? -20.556 31.880  -44.146 1.00 47.26  ? 117 VAL D N   1 
ATOM   5614  C CA  . VAL D  2 121 ? -21.696 32.469  -43.451 1.00 47.25  ? 117 VAL D CA  1 
ATOM   5615  C C   . VAL D  2 121 ? -22.632 33.305  -44.329 1.00 47.90  ? 117 VAL D C   1 
ATOM   5616  O O   . VAL D  2 121 ? -23.851 33.268  -44.151 1.00 49.02  ? 117 VAL D O   1 
ATOM   5617  C CB  . VAL D  2 121 ? -21.230 33.334  -42.269 1.00 47.02  ? 117 VAL D CB  1 
ATOM   5618  C CG1 . VAL D  2 121 ? -22.423 33.918  -41.545 1.00 45.29  ? 117 VAL D CG1 1 
ATOM   5619  C CG2 . VAL D  2 121 ? -20.404 32.492  -41.329 1.00 47.16  ? 117 VAL D CG2 1 
ATOM   5620  N N   . PRO D  2 122 ? -22.080 34.088  -45.270 1.00 48.96  ? 118 PRO D N   1 
ATOM   5621  C CA  . PRO D  2 122 ? -22.967 34.892  -46.120 1.00 47.87  ? 118 PRO D CA  1 
ATOM   5622  C C   . PRO D  2 122 ? -23.401 34.210  -47.421 1.00 47.14  ? 118 PRO D C   1 
ATOM   5623  O O   . PRO D  2 122 ? -24.214 34.754  -48.163 1.00 47.64  ? 118 PRO D O   1 
ATOM   5624  C CB  . PRO D  2 122 ? -22.144 36.154  -46.368 1.00 48.16  ? 118 PRO D CB  1 
ATOM   5625  C CG  . PRO D  2 122 ? -20.772 35.610  -46.475 1.00 49.28  ? 118 PRO D CG  1 
ATOM   5626  C CD  . PRO D  2 122 ? -20.702 34.614  -45.323 1.00 48.78  ? 118 PRO D CD  1 
ATOM   5627  N N   . ARG D  2 123 ? -22.866 33.023  -47.697 1.00 46.69  ? 119 ARG D N   1 
ATOM   5628  C CA  . ARG D  2 123 ? -23.220 32.285  -48.912 1.00 46.13  ? 119 ARG D CA  1 
ATOM   5629  C C   . ARG D  2 123 ? -24.739 32.187  -49.096 1.00 45.95  ? 119 ARG D C   1 
ATOM   5630  O O   . ARG D  2 123 ? -25.480 31.875  -48.165 1.00 45.57  ? 119 ARG D O   1 
ATOM   5631  C CB  . ARG D  2 123 ? -22.621 30.876  -48.868 1.00 44.90  ? 119 ARG D CB  1 
ATOM   5632  C CG  . ARG D  2 123 ? -22.931 30.026  -50.097 1.00 46.12  ? 119 ARG D CG  1 
ATOM   5633  C CD  . ARG D  2 123 ? -22.524 28.575  -49.882 1.00 46.31  ? 119 ARG D CD  1 
ATOM   5634  N NE  . ARG D  2 123 ? -23.151 27.674  -50.848 1.00 46.93  ? 119 ARG D NE  1 
ATOM   5635  C CZ  . ARG D  2 123 ? -22.790 27.558  -52.121 1.00 46.68  ? 119 ARG D CZ  1 
ATOM   5636  N NH1 . ARG D  2 123 ? -21.791 28.285  -52.607 1.00 47.67  ? 119 ARG D NH1 1 
ATOM   5637  N NH2 . ARG D  2 123 ? -23.437 26.714  -52.909 1.00 48.13  ? 119 ARG D NH2 1 
ATOM   5638  N N   . ARG D  2 124 ? -25.202 32.460  -50.306 1.00 47.54  ? 120 ARG D N   1 
ATOM   5639  C CA  . ARG D  2 124 ? -26.630 32.407  -50.592 1.00 49.07  ? 120 ARG D CA  1 
ATOM   5640  C C   . ARG D  2 124 ? -26.836 31.965  -52.024 1.00 49.00  ? 120 ARG D C   1 
ATOM   5641  O O   . ARG D  2 124 ? -26.139 32.421  -52.927 1.00 51.30  ? 120 ARG D O   1 
ATOM   5642  C CB  . ARG D  2 124 ? -27.271 33.785  -50.396 1.00 48.81  ? 120 ARG D CB  1 
ATOM   5643  C CG  . ARG D  2 124 ? -27.094 34.374  -49.006 1.00 50.29  ? 120 ARG D CG  1 
ATOM   5644  C CD  . ARG D  2 124 ? -28.397 34.370  -48.250 1.00 53.21  ? 120 ARG D CD  1 
ATOM   5645  N NE  . ARG D  2 124 ? -28.285 34.958  -46.916 1.00 56.39  ? 120 ARG D NE  1 
ATOM   5646  C CZ  . ARG D  2 124 ? -27.554 34.452  -45.924 1.00 58.10  ? 120 ARG D CZ  1 
ATOM   5647  N NH1 . ARG D  2 124 ? -26.849 33.338  -46.106 1.00 57.88  ? 120 ARG D NH1 1 
ATOM   5648  N NH2 . ARG D  2 124 ? -27.542 35.053  -44.738 1.00 58.07  ? 120 ARG D NH2 1 
ATOM   5649  N N   . VAL D  2 125 ? -27.783 31.061  -52.222 1.00 48.18  ? 121 VAL D N   1 
ATOM   5650  C CA  . VAL D  2 125 ? -28.111 30.565  -53.546 1.00 48.79  ? 121 VAL D CA  1 
ATOM   5651  C C   . VAL D  2 125 ? -29.629 30.613  -53.583 1.00 51.87  ? 121 VAL D C   1 
ATOM   5652  O O   . VAL D  2 125 ? -30.283 30.267  -52.593 1.00 53.10  ? 121 VAL D O   1 
ATOM   5653  C CB  . VAL D  2 125 ? -27.615 29.119  -53.741 1.00 47.13  ? 121 VAL D CB  1 
ATOM   5654  C CG1 . VAL D  2 125 ? -28.073 28.583  -55.085 1.00 43.84  ? 121 VAL D CG1 1 
ATOM   5655  C CG2 . VAL D  2 125 ? -26.096 29.083  -53.641 1.00 47.02  ? 121 VAL D CG2 1 
ATOM   5656  N N   . GLU D  2 126 ? -30.199 31.053  -54.701 1.00 52.57  ? 122 GLU D N   1 
ATOM   5657  C CA  . GLU D  2 126 ? -31.651 31.148  -54.788 1.00 52.12  ? 122 GLU D CA  1 
ATOM   5658  C C   . GLU D  2 126 ? -32.327 29.879  -55.276 1.00 49.29  ? 122 GLU D C   1 
ATOM   5659  O O   . GLU D  2 126 ? -31.903 29.247  -56.251 1.00 46.76  ? 122 GLU D O   1 
ATOM   5660  C CB  . GLU D  2 126 ? -32.078 32.324  -55.675 1.00 54.93  ? 122 GLU D CB  1 
ATOM   5661  C CG  . GLU D  2 126 ? -31.614 33.684  -55.168 1.00 59.96  ? 122 GLU D CG  1 
ATOM   5662  C CD  . GLU D  2 126 ? -32.270 34.847  -55.911 1.00 63.42  ? 122 GLU D CD  1 
ATOM   5663  O OE1 . GLU D  2 126 ? -32.603 34.687  -57.110 1.00 64.21  ? 122 GLU D OE1 1 
ATOM   5664  O OE2 . GLU D  2 126 ? -32.440 35.926  -55.296 1.00 63.66  ? 122 GLU D OE2 1 
ATOM   5665  N N   . PRO D  2 127 ? -33.406 29.490  -54.588 1.00 47.72  ? 123 PRO D N   1 
ATOM   5666  C CA  . PRO D  2 127 ? -34.154 28.290  -54.949 1.00 47.49  ? 123 PRO D CA  1 
ATOM   5667  C C   . PRO D  2 127 ? -34.779 28.382  -56.336 1.00 48.56  ? 123 PRO D C   1 
ATOM   5668  O O   . PRO D  2 127 ? -34.993 29.467  -56.873 1.00 46.67  ? 123 PRO D O   1 
ATOM   5669  C CB  . PRO D  2 127 ? -35.211 28.202  -53.848 1.00 46.23  ? 123 PRO D CB  1 
ATOM   5670  C CG  . PRO D  2 127 ? -35.442 29.636  -53.484 1.00 45.62  ? 123 PRO D CG  1 
ATOM   5671  C CD  . PRO D  2 127 ? -34.025 30.167  -53.434 1.00 45.74  ? 123 PRO D CD  1 
ATOM   5672  N N   . THR D  2 128 ? -35.046 27.218  -56.910 1.00 49.10  ? 124 THR D N   1 
ATOM   5673  C CA  . THR D  2 128 ? -35.693 27.113  -58.197 1.00 50.51  ? 124 THR D CA  1 
ATOM   5674  C C   . THR D  2 128 ? -37.043 26.496  -57.839 1.00 52.05  ? 124 THR D C   1 
ATOM   5675  O O   . THR D  2 128 ? -37.128 25.305  -57.565 1.00 54.17  ? 124 THR D O   1 
ATOM   5676  C CB  . THR D  2 128 ? -34.910 26.174  -59.114 1.00 50.32  ? 124 THR D CB  1 
ATOM   5677  O OG1 . THR D  2 128 ? -33.608 26.725  -59.351 1.00 53.49  ? 124 THR D OG1 1 
ATOM   5678  C CG2 . THR D  2 128 ? -35.622 25.995  -60.431 1.00 50.06  ? 124 THR D CG2 1 
ATOM   5679  N N   . VAL D  2 129 ? -38.090 27.308  -57.812 1.00 52.84  ? 125 VAL D N   1 
ATOM   5680  C CA  . VAL D  2 129 ? -39.417 26.821  -57.451 1.00 53.59  ? 125 VAL D CA  1 
ATOM   5681  C C   . VAL D  2 129 ? -40.242 26.329  -58.637 1.00 55.89  ? 125 VAL D C   1 
ATOM   5682  O O   . VAL D  2 129 ? -40.431 27.047  -59.611 1.00 57.78  ? 125 VAL D O   1 
ATOM   5683  C CB  . VAL D  2 129 ? -40.199 27.918  -56.709 1.00 52.46  ? 125 VAL D CB  1 
ATOM   5684  C CG1 . VAL D  2 129 ? -41.480 27.348  -56.122 1.00 50.46  ? 125 VAL D CG1 1 
ATOM   5685  C CG2 . VAL D  2 129 ? -39.327 28.511  -55.607 1.00 49.96  ? 125 VAL D CG2 1 
ATOM   5686  N N   . THR D  2 130 ? -40.740 25.100  -58.538 1.00 58.06  ? 126 THR D N   1 
ATOM   5687  C CA  . THR D  2 130 ? -41.546 24.485  -59.596 1.00 59.55  ? 126 THR D CA  1 
ATOM   5688  C C   . THR D  2 130 ? -42.801 23.849  -58.998 1.00 60.31  ? 126 THR D C   1 
ATOM   5689  O O   . THR D  2 130 ? -42.774 23.382  -57.865 1.00 60.21  ? 126 THR D O   1 
ATOM   5690  C CB  . THR D  2 130 ? -40.726 23.395  -60.322 1.00 59.99  ? 126 THR D CB  1 
ATOM   5691  O OG1 . THR D  2 130 ? -39.621 24.012  -60.986 1.00 61.62  ? 126 THR D OG1 1 
ATOM   5692  C CG2 . THR D  2 130 ? -41.568 22.645  -61.349 1.00 61.09  ? 126 THR D CG2 1 
ATOM   5693  N N   . VAL D  2 131 ? -43.896 23.832  -59.757 1.00 61.87  ? 127 VAL D N   1 
ATOM   5694  C CA  . VAL D  2 131 ? -45.153 23.245  -59.287 1.00 62.03  ? 127 VAL D CA  1 
ATOM   5695  C C   . VAL D  2 131 ? -45.757 22.299  -60.319 1.00 63.29  ? 127 VAL D C   1 
ATOM   5696  O O   . VAL D  2 131 ? -45.785 22.606  -61.503 1.00 64.07  ? 127 VAL D O   1 
ATOM   5697  C CB  . VAL D  2 131 ? -46.180 24.336  -58.955 1.00 60.35  ? 127 VAL D CB  1 
ATOM   5698  C CG1 . VAL D  2 131 ? -47.521 23.704  -58.629 1.00 62.23  ? 127 VAL D CG1 1 
ATOM   5699  C CG2 . VAL D  2 131 ? -45.700 25.151  -57.775 1.00 58.16  ? 127 VAL D CG2 1 
ATOM   5700  N N   . TYR D  2 132 ? -46.241 21.148  -59.864 1.00 66.01  ? 128 TYR D N   1 
ATOM   5701  C CA  . TYR D  2 132 ? -46.838 20.157  -60.759 1.00 69.04  ? 128 TYR D CA  1 
ATOM   5702  C C   . TYR D  2 132 ? -47.571 19.053  -59.990 1.00 71.87  ? 128 TYR D C   1 
ATOM   5703  O O   . TYR D  2 132 ? -47.291 18.805  -58.817 1.00 70.91  ? 128 TYR D O   1 
ATOM   5704  C CB  . TYR D  2 132 ? -45.754 19.535  -61.633 1.00 67.65  ? 128 TYR D CB  1 
ATOM   5705  C CG  . TYR D  2 132 ? -44.676 18.850  -60.837 1.00 67.35  ? 128 TYR D CG  1 
ATOM   5706  C CD1 . TYR D  2 132 ? -44.828 17.532  -60.408 1.00 66.40  ? 128 TYR D CD1 1 
ATOM   5707  C CD2 . TYR D  2 132 ? -43.520 19.534  -60.471 1.00 67.36  ? 128 TYR D CD2 1 
ATOM   5708  C CE1 . TYR D  2 132 ? -43.853 16.913  -59.632 1.00 66.69  ? 128 TYR D CE1 1 
ATOM   5709  C CE2 . TYR D  2 132 ? -42.539 18.929  -59.696 1.00 66.80  ? 128 TYR D CE2 1 
ATOM   5710  C CZ  . TYR D  2 132 ? -42.708 17.619  -59.278 1.00 66.90  ? 128 TYR D CZ  1 
ATOM   5711  O OH  . TYR D  2 132 ? -41.731 17.024  -58.510 1.00 65.27  ? 128 TYR D OH  1 
ATOM   5712  N N   . PRO D  2 133 ? -48.531 18.381  -60.647 1.00 75.12  ? 129 PRO D N   1 
ATOM   5713  C CA  . PRO D  2 133 ? -49.312 17.301  -60.039 1.00 78.34  ? 129 PRO D CA  1 
ATOM   5714  C C   . PRO D  2 133 ? -48.752 15.917  -60.359 1.00 80.70  ? 129 PRO D C   1 
ATOM   5715  O O   . PRO D  2 133 ? -48.092 15.729  -61.380 1.00 80.05  ? 129 PRO D O   1 
ATOM   5716  C CB  . PRO D  2 133 ? -50.680 17.504  -60.657 1.00 77.54  ? 129 PRO D CB  1 
ATOM   5717  C CG  . PRO D  2 133 ? -50.312 17.825  -62.065 1.00 76.57  ? 129 PRO D CG  1 
ATOM   5718  C CD  . PRO D  2 133 ? -49.173 18.828  -61.897 1.00 76.24  ? 129 PRO D CD  1 
ATOM   5719  N N   . THR D  2 134 ? -49.019 14.950  -59.486 1.00 84.53  ? 130 THR D N   1 
ATOM   5720  C CA  . THR D  2 134 ? -48.549 13.586  -59.706 1.00 89.06  ? 130 THR D CA  1 
ATOM   5721  C C   . THR D  2 134 ? -49.697 12.576  -59.686 1.00 91.71  ? 130 THR D C   1 
ATOM   5722  O O   . THR D  2 134 ? -50.759 12.836  -59.109 1.00 90.87  ? 130 THR D O   1 
ATOM   5723  C CB  . THR D  2 134 ? -47.485 13.170  -58.663 1.00 88.06  ? 130 THR D CB  1 
ATOM   5724  O OG1 . THR D  2 134 ? -47.949 13.485  -57.347 1.00 88.56  ? 130 THR D OG1 1 
ATOM   5725  C CG2 . THR D  2 134 ? -46.169 13.884  -58.932 1.00 87.72  ? 130 THR D CG2 1 
ATOM   5726  N N   . LYS D  2 135 ? -49.462 11.427  -60.323 1.00 95.44  ? 131 LYS D N   1 
ATOM   5727  C CA  . LYS D  2 135 ? -50.441 10.345  -60.437 1.00 98.74  ? 131 LYS D CA  1 
ATOM   5728  C C   . LYS D  2 135 ? -51.528 10.685  -61.458 1.00 101.72 ? 131 LYS D C   1 
ATOM   5729  O O   . LYS D  2 135 ? -52.395 11.520  -61.199 1.00 102.61 ? 131 LYS D O   1 
ATOM   5730  C CB  . LYS D  2 135 ? -51.084 10.029  -59.079 1.00 97.66  ? 131 LYS D CB  1 
ATOM   5731  C CG  . LYS D  2 135 ? -50.302 9.030   -58.243 1.00 96.97  ? 131 LYS D CG  1 
ATOM   5732  C CD  . LYS D  2 135 ? -51.179 8.393   -57.173 1.00 96.68  ? 131 LYS D CD  1 
ATOM   5733  C CE  . LYS D  2 135 ? -50.503 7.179   -56.560 1.00 94.88  ? 131 LYS D CE  1 
ATOM   5734  N NZ  . LYS D  2 135 ? -51.383 6.502   -55.575 1.00 95.31  ? 131 LYS D NZ  1 
ATOM   5735  N N   . THR D  2 136 ? -51.473 10.035  -62.620 1.00 104.69 ? 132 THR D N   1 
ATOM   5736  C CA  . THR D  2 136 ? -52.445 10.271  -63.689 1.00 106.95 ? 132 THR D CA  1 
ATOM   5737  C C   . THR D  2 136 ? -52.996 8.968   -64.282 1.00 108.43 ? 132 THR D C   1 
ATOM   5738  O O   . THR D  2 136 ? -54.187 8.668   -64.143 1.00 108.49 ? 132 THR D O   1 
ATOM   5739  C CB  . THR D  2 136 ? -51.807 11.122  -64.792 1.00 106.90 ? 132 THR D CB  1 
ATOM   5740  N N   . GLN D  2 137 ? -52.123 8.212   -64.949 1.00 109.81 ? 133 GLN D N   1 
ATOM   5741  C CA  . GLN D  2 137 ? -52.475 6.934   -65.576 1.00 110.97 ? 133 GLN D CA  1 
ATOM   5742  C C   . GLN D  2 137 ? -53.129 7.089   -66.954 1.00 111.39 ? 133 GLN D C   1 
ATOM   5743  O O   . GLN D  2 137 ? -52.475 6.900   -67.985 1.00 111.39 ? 133 GLN D O   1 
ATOM   5744  C CB  . GLN D  2 137 ? -53.387 6.117   -64.647 1.00 111.01 ? 133 GLN D CB  1 
ATOM   5745  N N   . PRO D  2 138 ? -54.417 7.429   -66.967 1.00 111.48 ? 134 PRO D N   1 
ATOM   5746  C CA  . PRO D  2 138 ? -55.155 7.595   -68.218 1.00 111.13 ? 134 PRO D CA  1 
ATOM   5747  C C   . PRO D  2 138 ? -55.834 8.967   -68.335 1.00 110.48 ? 134 PRO D C   1 
ATOM   5748  O O   . PRO D  2 138 ? -55.159 9.993   -68.448 1.00 110.37 ? 134 PRO D O   1 
ATOM   5749  C CB  . PRO D  2 138 ? -56.195 6.476   -68.359 1.00 111.29 ? 134 PRO D CB  1 
ATOM   5750  N N   . LEU D  2 139 ? -57.168 8.973   -68.312 1.00 109.20 ? 135 LEU D N   1 
ATOM   5751  C CA  . LEU D  2 139 ? -57.953 10.203  -68.421 1.00 107.37 ? 135 LEU D CA  1 
ATOM   5752  C C   . LEU D  2 139 ? -57.469 11.279  -67.448 1.00 106.48 ? 135 LEU D C   1 
ATOM   5753  O O   . LEU D  2 139 ? -57.787 12.461  -67.614 1.00 106.49 ? 135 LEU D O   1 
ATOM   5754  C CB  . LEU D  2 139 ? -59.431 9.900   -68.181 1.00 106.68 ? 135 LEU D CB  1 
ATOM   5755  N N   . GLU D  2 140 ? -56.708 10.849  -66.438 1.00 104.74 ? 136 GLU D N   1 
ATOM   5756  C CA  . GLU D  2 140 ? -56.128 11.712  -65.401 1.00 102.34 ? 136 GLU D CA  1 
ATOM   5757  C C   . GLU D  2 140 ? -56.961 11.833  -64.120 1.00 100.30 ? 136 GLU D C   1 
ATOM   5758  O O   . GLU D  2 140 ? -58.182 12.006  -64.159 1.00 100.41 ? 136 GLU D O   1 
ATOM   5759  C CB  . GLU D  2 140 ? -55.825 13.112  -65.968 1.00 102.68 ? 136 GLU D CB  1 
ATOM   5760  N N   . HIS D  2 141 ? -56.272 11.736  -62.987 1.00 97.40  ? 137 HIS D N   1 
ATOM   5761  C CA  . HIS D  2 141 ? -56.877 11.838  -61.661 1.00 93.65  ? 137 HIS D CA  1 
ATOM   5762  C C   . HIS D  2 141 ? -55.761 12.161  -60.668 1.00 90.69  ? 137 HIS D C   1 
ATOM   5763  O O   . HIS D  2 141 ? -55.112 11.260  -60.133 1.00 90.20  ? 137 HIS D O   1 
ATOM   5764  C CB  . HIS D  2 141 ? -57.552 10.515  -61.269 1.00 93.79  ? 137 HIS D CB  1 
ATOM   5765  C CG  . HIS D  2 141 ? -58.010 10.465  -59.841 1.00 94.13  ? 137 HIS D CG  1 
ATOM   5766  N ND1 . HIS D  2 141 ? -58.415 9.296   -59.230 1.00 94.20  ? 137 HIS D ND1 1 
ATOM   5767  C CD2 . HIS D  2 141 ? -58.107 11.432  -58.896 1.00 93.71  ? 137 HIS D CD2 1 
ATOM   5768  C CE1 . HIS D  2 141 ? -58.735 9.544   -57.973 1.00 93.97  ? 137 HIS D CE1 1 
ATOM   5769  N NE2 . HIS D  2 141 ? -58.557 10.833  -57.744 1.00 93.53  ? 137 HIS D NE2 1 
ATOM   5770  N N   . HIS D  2 142 ? -55.538 13.448  -60.423 1.00 86.66  ? 138 HIS D N   1 
ATOM   5771  C CA  . HIS D  2 142 ? -54.492 13.861  -59.501 1.00 82.65  ? 138 HIS D CA  1 
ATOM   5772  C C   . HIS D  2 142 ? -55.036 14.096  -58.106 1.00 79.61  ? 138 HIS D C   1 
ATOM   5773  O O   . HIS D  2 142 ? -56.128 14.641  -57.941 1.00 79.83  ? 138 HIS D O   1 
ATOM   5774  C CB  . HIS D  2 142 ? -53.825 15.142  -60.000 1.00 83.43  ? 138 HIS D CB  1 
ATOM   5775  C CG  . HIS D  2 142 ? -53.464 15.107  -61.451 1.00 84.59  ? 138 HIS D CG  1 
ATOM   5776  N ND1 . HIS D  2 142 ? -54.378 15.361  -62.450 1.00 85.16  ? 138 HIS D ND1 1 
ATOM   5777  C CD2 . HIS D  2 142 ? -52.296 14.816  -62.073 1.00 85.15  ? 138 HIS D CD2 1 
ATOM   5778  C CE1 . HIS D  2 142 ? -53.789 15.230  -63.626 1.00 85.87  ? 138 HIS D CE1 1 
ATOM   5779  N NE2 . HIS D  2 142 ? -52.526 14.899  -63.425 1.00 85.30  ? 138 HIS D NE2 1 
ATOM   5780  N N   . ASN D  2 143 ? -54.273 13.675  -57.103 1.00 76.17  ? 139 ASN D N   1 
ATOM   5781  C CA  . ASN D  2 143 ? -54.661 13.863  -55.709 1.00 72.34  ? 139 ASN D CA  1 
ATOM   5782  C C   . ASN D  2 143 ? -53.535 14.536  -54.954 1.00 69.68  ? 139 ASN D C   1 
ATOM   5783  O O   . ASN D  2 143 ? -53.638 14.782  -53.753 1.00 69.74  ? 139 ASN D O   1 
ATOM   5784  C CB  . ASN D  2 143 ? -54.994 12.530  -55.031 1.00 72.87  ? 139 ASN D CB  1 
ATOM   5785  C CG  . ASN D  2 143 ? -54.440 11.332  -55.776 1.00 74.06  ? 139 ASN D CG  1 
ATOM   5786  O OD1 . ASN D  2 143 ? -53.283 11.320  -56.203 1.00 73.67  ? 139 ASN D OD1 1 
ATOM   5787  N ND2 . ASN D  2 143 ? -55.268 10.304  -55.924 1.00 74.61  ? 139 ASN D ND2 1 
ATOM   5788  N N   . LEU D  2 144 ? -52.458 14.844  -55.667 1.00 67.11  ? 140 LEU D N   1 
ATOM   5789  C CA  . LEU D  2 144 ? -51.308 15.481  -55.049 1.00 64.66  ? 140 LEU D CA  1 
ATOM   5790  C C   . LEU D  2 144 ? -50.703 16.567  -55.935 1.00 60.94  ? 140 LEU D C   1 
ATOM   5791  O O   . LEU D  2 144 ? -50.426 16.352  -57.115 1.00 60.05  ? 140 LEU D O   1 
ATOM   5792  C CB  . LEU D  2 144 ? -50.253 14.422  -54.729 1.00 64.58  ? 140 LEU D CB  1 
ATOM   5793  C CG  . LEU D  2 144 ? -49.177 14.768  -53.699 1.00 65.91  ? 140 LEU D CG  1 
ATOM   5794  C CD1 . LEU D  2 144 ? -49.824 15.115  -52.363 1.00 66.02  ? 140 LEU D CD1 1 
ATOM   5795  C CD2 . LEU D  2 144 ? -48.241 13.580  -53.535 1.00 66.69  ? 140 LEU D CD2 1 
ATOM   5796  N N   . LEU D  2 145 ? -50.509 17.738  -55.348 1.00 57.18  ? 141 LEU D N   1 
ATOM   5797  C CA  . LEU D  2 145 ? -49.929 18.871  -56.046 1.00 55.54  ? 141 LEU D CA  1 
ATOM   5798  C C   . LEU D  2 145 ? -48.551 19.109  -55.409 1.00 54.03  ? 141 LEU D C   1 
ATOM   5799  O O   . LEU D  2 145 ? -48.446 19.425  -54.222 1.00 53.53  ? 141 LEU D O   1 
ATOM   5800  C CB  . LEU D  2 145 ? -50.832 20.087  -55.867 1.00 54.79  ? 141 LEU D CB  1 
ATOM   5801  C CG  . LEU D  2 145 ? -50.680 21.268  -56.819 1.00 55.06  ? 141 LEU D CG  1 
ATOM   5802  C CD1 . LEU D  2 145 ? -50.971 20.827  -58.248 1.00 57.12  ? 141 LEU D CD1 1 
ATOM   5803  C CD2 . LEU D  2 145 ? -51.642 22.360  -56.404 1.00 53.69  ? 141 LEU D CD2 1 
ATOM   5804  N N   . VAL D  2 146 ? -47.496 18.947  -56.199 1.00 51.53  ? 142 VAL D N   1 
ATOM   5805  C CA  . VAL D  2 146 ? -46.142 19.100  -55.695 1.00 49.26  ? 142 VAL D CA  1 
ATOM   5806  C C   . VAL D  2 146 ? -45.451 20.426  -55.955 1.00 48.56  ? 142 VAL D C   1 
ATOM   5807  O O   . VAL D  2 146 ? -45.305 20.850  -57.100 1.00 47.01  ? 142 VAL D O   1 
ATOM   5808  C CB  . VAL D  2 146 ? -45.219 18.018  -56.264 1.00 47.88  ? 142 VAL D CB  1 
ATOM   5809  C CG1 . VAL D  2 146 ? -43.833 18.160  -55.659 1.00 46.73  ? 142 VAL D CG1 1 
ATOM   5810  C CG2 . VAL D  2 146 ? -45.791 16.645  -55.990 1.00 46.50  ? 142 VAL D CG2 1 
ATOM   5811  N N   . CYS D  2 147 ? -45.023 21.074  -54.880 1.00 47.11  ? 143 CYS D N   1 
ATOM   5812  C CA  . CYS D  2 147 ? -44.285 22.307  -55.006 1.00 47.17  ? 143 CYS D CA  1 
ATOM   5813  C C   . CYS D  2 147 ? -42.841 21.875  -54.786 1.00 46.88  ? 143 CYS D C   1 
ATOM   5814  O O   . CYS D  2 147 ? -42.462 21.492  -53.682 1.00 45.20  ? 143 CYS D O   1 
ATOM   5815  C CB  . CYS D  2 147 ? -44.677 23.317  -53.932 1.00 49.63  ? 143 CYS D CB  1 
ATOM   5816  S SG  . CYS D  2 147 ? -43.701 24.853  -54.052 1.00 50.44  ? 143 CYS D SG  1 
ATOM   5817  N N   . SER D  2 148 ? -42.043 21.918  -55.844 1.00 46.35  ? 144 SER D N   1 
ATOM   5818  C CA  . SER D  2 148 ? -40.643 21.529  -55.755 1.00 46.70  ? 144 SER D CA  1 
ATOM   5819  C C   . SER D  2 148 ? -39.720 22.728  -55.578 1.00 46.20  ? 144 SER D C   1 
ATOM   5820  O O   . SER D  2 148 ? -39.698 23.645  -56.403 1.00 47.34  ? 144 SER D O   1 
ATOM   5821  C CB  . SER D  2 148 ? -40.226 20.756  -57.000 1.00 44.34  ? 144 SER D CB  1 
ATOM   5822  O OG  . SER D  2 148 ? -38.822 20.625  -57.035 1.00 49.02  ? 144 SER D OG  1 
ATOM   5823  N N   . VAL D  2 149 ? -38.965 22.707  -54.488 1.00 44.68  ? 145 VAL D N   1 
ATOM   5824  C CA  . VAL D  2 149 ? -38.022 23.764  -54.178 1.00 44.95  ? 145 VAL D CA  1 
ATOM   5825  C C   . VAL D  2 149 ? -36.623 23.141  -54.178 1.00 45.24  ? 145 VAL D C   1 
ATOM   5826  O O   . VAL D  2 149 ? -36.316 22.277  -53.358 1.00 47.01  ? 145 VAL D O   1 
ATOM   5827  C CB  . VAL D  2 149 ? -38.348 24.385  -52.802 1.00 44.30  ? 145 VAL D CB  1 
ATOM   5828  C CG1 . VAL D  2 149 ? -37.381 25.505  -52.482 1.00 44.53  ? 145 VAL D CG1 1 
ATOM   5829  C CG2 . VAL D  2 149 ? -39.771 24.913  -52.804 1.00 44.99  ? 145 VAL D CG2 1 
ATOM   5830  N N   . SER D  2 150 ? -35.773 23.568  -55.102 1.00 45.12  ? 146 SER D N   1 
ATOM   5831  C CA  . SER D  2 150 ? -34.437 23.000  -55.182 1.00 46.25  ? 146 SER D CA  1 
ATOM   5832  C C   . SER D  2 150 ? -33.267 23.980  -55.330 1.00 47.08  ? 146 SER D C   1 
ATOM   5833  O O   . SER D  2 150 ? -33.461 25.180  -55.544 1.00 46.42  ? 146 SER D O   1 
ATOM   5834  C CB  . SER D  2 150 ? -34.403 21.993  -56.326 1.00 46.09  ? 146 SER D CB  1 
ATOM   5835  O OG  . SER D  2 150 ? -35.052 22.522  -57.465 1.00 49.50  ? 146 SER D OG  1 
ATOM   5836  N N   . ASP D  2 151 ? -32.056 23.434  -55.193 1.00 46.91  ? 147 ASP D N   1 
ATOM   5837  C CA  . ASP D  2 151 ? -30.802 24.169  -55.331 1.00 46.26  ? 147 ASP D CA  1 
ATOM   5838  C C   . ASP D  2 151 ? -30.733 25.477  -54.559 1.00 45.31  ? 147 ASP D C   1 
ATOM   5839  O O   . ASP D  2 151 ? -30.567 26.540  -55.153 1.00 46.80  ? 147 ASP D O   1 
ATOM   5840  C CB  . ASP D  2 151 ? -30.545 24.455  -56.808 1.00 48.97  ? 147 ASP D CB  1 
ATOM   5841  C CG  . ASP D  2 151 ? -30.710 23.223  -57.671 1.00 54.50  ? 147 ASP D CG  1 
ATOM   5842  O OD1 . ASP D  2 151 ? -29.860 22.309  -57.569 1.00 57.69  ? 147 ASP D OD1 1 
ATOM   5843  O OD2 . ASP D  2 151 ? -31.698 23.165  -58.445 1.00 56.92  ? 147 ASP D OD2 1 
ATOM   5844  N N   . PHE D  2 152 ? -30.842 25.411  -53.241 1.00 42.80  ? 148 PHE D N   1 
ATOM   5845  C CA  . PHE D  2 152 ? -30.785 26.624  -52.449 1.00 40.64  ? 148 PHE D CA  1 
ATOM   5846  C C   . PHE D  2 152 ? -29.891 26.487  -51.221 1.00 40.93  ? 148 PHE D C   1 
ATOM   5847  O O   . PHE D  2 152 ? -29.506 25.373  -50.846 1.00 38.20  ? 148 PHE D O   1 
ATOM   5848  C CB  . PHE D  2 152 ? -32.207 27.051  -52.046 1.00 38.20  ? 148 PHE D CB  1 
ATOM   5849  C CG  . PHE D  2 152 ? -32.954 26.036  -51.214 1.00 37.51  ? 148 PHE D CG  1 
ATOM   5850  C CD1 . PHE D  2 152 ? -32.819 26.015  -49.823 1.00 35.21  ? 148 PHE D CD1 1 
ATOM   5851  C CD2 . PHE D  2 152 ? -33.837 25.141  -51.811 1.00 35.54  ? 148 PHE D CD2 1 
ATOM   5852  C CE1 . PHE D  2 152 ? -33.557 25.123  -49.035 1.00 32.25  ? 148 PHE D CE1 1 
ATOM   5853  C CE2 . PHE D  2 152 ? -34.580 24.241  -51.028 1.00 37.53  ? 148 PHE D CE2 1 
ATOM   5854  C CZ  . PHE D  2 152 ? -34.437 24.238  -49.634 1.00 32.63  ? 148 PHE D CZ  1 
ATOM   5855  N N   . TYR D  2 153 ? -29.551 27.630  -50.621 1.00 39.34  ? 149 TYR D N   1 
ATOM   5856  C CA  . TYR D  2 153 ? -28.714 27.672  -49.432 1.00 39.37  ? 149 TYR D CA  1 
ATOM   5857  C C   . TYR D  2 153 ? -28.804 29.072  -48.842 1.00 41.27  ? 149 TYR D C   1 
ATOM   5858  O O   . TYR D  2 153 ? -28.820 30.059  -49.574 1.00 40.84  ? 149 TYR D O   1 
ATOM   5859  C CB  . TYR D  2 153 ? -27.257 27.343  -49.789 1.00 39.80  ? 149 TYR D CB  1 
ATOM   5860  C CG  . TYR D  2 153 ? -26.341 27.221  -48.592 1.00 39.26  ? 149 TYR D CG  1 
ATOM   5861  C CD1 . TYR D  2 153 ? -25.998 28.343  -47.836 1.00 39.48  ? 149 TYR D CD1 1 
ATOM   5862  C CD2 . TYR D  2 153 ? -25.876 25.971  -48.165 1.00 38.99  ? 149 TYR D CD2 1 
ATOM   5863  C CE1 . TYR D  2 153 ? -25.235 28.227  -46.688 1.00 39.64  ? 149 TYR D CE1 1 
ATOM   5864  C CE2 . TYR D  2 153 ? -25.106 25.846  -47.013 1.00 37.82  ? 149 TYR D CE2 1 
ATOM   5865  C CZ  . TYR D  2 153 ? -24.798 26.975  -46.280 1.00 39.47  ? 149 TYR D CZ  1 
ATOM   5866  O OH  . TYR D  2 153 ? -24.104 26.870  -45.104 1.00 41.68  ? 149 TYR D OH  1 
ATOM   5867  N N   . PRO D  2 154 ? -28.876 29.178  -47.506 1.00 41.56  ? 150 PRO D N   1 
ATOM   5868  C CA  . PRO D  2 154 ? -28.878 28.068  -46.549 1.00 42.80  ? 150 PRO D CA  1 
ATOM   5869  C C   . PRO D  2 154 ? -30.176 27.240  -46.542 1.00 44.60  ? 150 PRO D C   1 
ATOM   5870  O O   . PRO D  2 154 ? -31.100 27.520  -47.304 1.00 42.85  ? 150 PRO D O   1 
ATOM   5871  C CB  . PRO D  2 154 ? -28.581 28.764  -45.219 1.00 42.45  ? 150 PRO D CB  1 
ATOM   5872  C CG  . PRO D  2 154 ? -29.196 30.103  -45.395 1.00 41.72  ? 150 PRO D CG  1 
ATOM   5873  C CD  . PRO D  2 154 ? -28.822 30.475  -46.811 1.00 42.28  ? 150 PRO D CD  1 
ATOM   5874  N N   . GLY D  2 155 ? -30.228 26.224  -45.679 1.00 46.17  ? 151 GLY D N   1 
ATOM   5875  C CA  . GLY D  2 155 ? -31.381 25.336  -45.608 1.00 48.28  ? 151 GLY D CA  1 
ATOM   5876  C C   . GLY D  2 155 ? -32.700 25.858  -45.067 1.00 50.03  ? 151 GLY D C   1 
ATOM   5877  O O   . GLY D  2 155 ? -33.762 25.386  -45.476 1.00 49.05  ? 151 GLY D O   1 
ATOM   5878  N N   . ASN D  2 156 ? -32.651 26.812  -44.142 1.00 52.89  ? 152 ASN D N   1 
ATOM   5879  C CA  . ASN D  2 156 ? -33.874 27.364  -43.576 1.00 55.23  ? 152 ASN D CA  1 
ATOM   5880  C C   . ASN D  2 156 ? -34.737 27.959  -44.685 1.00 55.19  ? 152 ASN D C   1 
ATOM   5881  O O   . ASN D  2 156 ? -34.406 28.986  -45.267 1.00 53.87  ? 152 ASN D O   1 
ATOM   5882  C CB  . ASN D  2 156 ? -33.546 28.426  -42.522 1.00 58.17  ? 152 ASN D CB  1 
ATOM   5883  C CG  . ASN D  2 156 ? -32.529 29.443  -43.010 1.00 61.57  ? 152 ASN D CG  1 
ATOM   5884  O OD1 . ASN D  2 156 ? -31.377 29.101  -43.289 1.00 64.54  ? 152 ASN D OD1 1 
ATOM   5885  N ND2 . ASN D  2 156 ? -32.949 30.702  -43.113 1.00 61.56  ? 152 ASN D ND2 1 
ATOM   5886  N N   . ILE D  2 157 ? -35.849 27.295  -44.976 1.00 55.55  ? 153 ILE D N   1 
ATOM   5887  C CA  . ILE D  2 157 ? -36.751 27.750  -46.023 1.00 55.70  ? 153 ILE D CA  1 
ATOM   5888  C C   . ILE D  2 157 ? -38.195 27.620  -45.533 1.00 56.90  ? 153 ILE D C   1 
ATOM   5889  O O   . ILE D  2 157 ? -38.491 26.813  -44.652 1.00 57.01  ? 153 ILE D O   1 
ATOM   5890  C CB  . ILE D  2 157 ? -36.533 26.920  -47.307 1.00 53.64  ? 153 ILE D CB  1 
ATOM   5891  C CG1 . ILE D  2 157 ? -37.054 27.679  -48.521 1.00 51.66  ? 153 ILE D CG1 1 
ATOM   5892  C CG2 . ILE D  2 157 ? -37.219 25.572  -47.180 1.00 52.61  ? 153 ILE D CG2 1 
ATOM   5893  C CD1 . ILE D  2 157 ? -36.596 27.086  -49.834 1.00 49.76  ? 153 ILE D CD1 1 
ATOM   5894  N N   . GLU D  2 158 ? -39.092 28.417  -46.100 1.00 57.61  ? 154 GLU D N   1 
ATOM   5895  C CA  . GLU D  2 158 ? -40.490 28.387  -45.686 1.00 58.69  ? 154 GLU D CA  1 
ATOM   5896  C C   . GLU D  2 158 ? -41.404 28.254  -46.899 1.00 57.17  ? 154 GLU D C   1 
ATOM   5897  O O   . GLU D  2 158 ? -41.342 29.066  -47.818 1.00 57.57  ? 154 GLU D O   1 
ATOM   5898  C CB  . GLU D  2 158 ? -40.803 29.669  -44.920 1.00 61.58  ? 154 GLU D CB  1 
ATOM   5899  C CG  . GLU D  2 158 ? -42.068 29.653  -44.090 1.00 65.77  ? 154 GLU D CG  1 
ATOM   5900  C CD  . GLU D  2 158 ? -42.224 30.947  -43.299 1.00 69.76  ? 154 GLU D CD  1 
ATOM   5901  O OE1 . GLU D  2 158 ? -41.279 31.302  -42.554 1.00 68.86  ? 154 GLU D OE1 1 
ATOM   5902  O OE2 . GLU D  2 158 ? -43.283 31.607  -43.422 1.00 71.36  ? 154 GLU D OE2 1 
ATOM   5903  N N   . VAL D  2 159 ? -42.242 27.222  -46.903 1.00 56.10  ? 155 VAL D N   1 
ATOM   5904  C CA  . VAL D  2 159 ? -43.162 26.977  -48.012 1.00 56.59  ? 155 VAL D CA  1 
ATOM   5905  C C   . VAL D  2 159 ? -44.615 26.964  -47.548 1.00 56.86  ? 155 VAL D C   1 
ATOM   5906  O O   . VAL D  2 159 ? -44.934 26.399  -46.503 1.00 57.15  ? 155 VAL D O   1 
ATOM   5907  C CB  . VAL D  2 159 ? -42.852 25.630  -48.706 1.00 55.21  ? 155 VAL D CB  1 
ATOM   5908  C CG1 . VAL D  2 159 ? -43.830 25.383  -49.845 1.00 53.96  ? 155 VAL D CG1 1 
ATOM   5909  C CG2 . VAL D  2 159 ? -41.435 25.635  -49.225 1.00 53.87  ? 155 VAL D CG2 1 
ATOM   5910  N N   . ARG D  2 160 ? -45.490 27.591  -48.330 1.00 57.62  ? 156 ARG D N   1 
ATOM   5911  C CA  . ARG D  2 160 ? -46.914 27.656  -48.007 1.00 59.41  ? 156 ARG D CA  1 
ATOM   5912  C C   . ARG D  2 160 ? -47.735 27.426  -49.263 1.00 59.45  ? 156 ARG D C   1 
ATOM   5913  O O   . ARG D  2 160 ? -47.303 27.774  -50.360 1.00 60.23  ? 156 ARG D O   1 
ATOM   5914  C CB  . ARG D  2 160 ? -47.282 29.027  -47.440 1.00 61.45  ? 156 ARG D CB  1 
ATOM   5915  C CG  . ARG D  2 160 ? -46.732 29.340  -46.066 1.00 65.16  ? 156 ARG D CG  1 
ATOM   5916  C CD  . ARG D  2 160 ? -47.045 30.788  -45.699 1.00 68.89  ? 156 ARG D CD  1 
ATOM   5917  N NE  . ARG D  2 160 ? -46.478 31.180  -44.409 1.00 72.98  ? 156 ARG D NE  1 
ATOM   5918  C CZ  . ARG D  2 160 ? -46.369 32.441  -43.995 1.00 75.47  ? 156 ARG D CZ  1 
ATOM   5919  N NH1 . ARG D  2 160 ? -46.790 33.435  -44.772 1.00 76.10  ? 156 ARG D NH1 1 
ATOM   5920  N NH2 . ARG D  2 160 ? -45.833 32.713  -42.807 1.00 75.93  ? 156 ARG D NH2 1 
ATOM   5921  N N   . TRP D  2 161 ? -48.920 26.845  -49.101 1.00 58.61  ? 157 TRP D N   1 
ATOM   5922  C CA  . TRP D  2 161 ? -49.803 26.591  -50.235 1.00 58.75  ? 157 TRP D CA  1 
ATOM   5923  C C   . TRP D  2 161 ? -51.062 27.451  -50.165 1.00 60.49  ? 157 TRP D C   1 
ATOM   5924  O O   . TRP D  2 161 ? -51.641 27.638  -49.093 1.00 60.25  ? 157 TRP D O   1 
ATOM   5925  C CB  . TRP D  2 161 ? -50.219 25.125  -50.281 1.00 51.35  ? 157 TRP D CB  1 
ATOM   5926  C CG  . TRP D  2 161 ? -49.346 24.244  -51.094 1.00 44.46  ? 157 TRP D CG  1 
ATOM   5927  C CD1 . TRP D  2 161 ? -48.562 23.233  -50.635 1.00 44.12  ? 157 TRP D CD1 1 
ATOM   5928  C CD2 . TRP D  2 161 ? -49.264 24.198  -52.523 1.00 42.42  ? 157 TRP D CD2 1 
ATOM   5929  N NE1 . TRP D  2 161 ? -48.003 22.546  -51.687 1.00 43.52  ? 157 TRP D NE1 1 
ATOM   5930  C CE2 . TRP D  2 161 ? -48.419 23.117  -52.859 1.00 41.46  ? 157 TRP D CE2 1 
ATOM   5931  C CE3 . TRP D  2 161 ? -49.827 24.960  -53.554 1.00 40.70  ? 157 TRP D CE3 1 
ATOM   5932  C CZ2 . TRP D  2 161 ? -48.124 22.777  -54.182 1.00 41.29  ? 157 TRP D CZ2 1 
ATOM   5933  C CZ3 . TRP D  2 161 ? -49.534 24.622  -54.875 1.00 40.12  ? 157 TRP D CZ3 1 
ATOM   5934  C CH2 . TRP D  2 161 ? -48.689 23.538  -55.174 1.00 41.93  ? 157 TRP D CH2 1 
ATOM   5935  N N   . PHE D  2 162 ? -51.483 27.967  -51.315 1.00 63.52  ? 158 PHE D N   1 
ATOM   5936  C CA  . PHE D  2 162 ? -52.676 28.796  -51.383 1.00 68.40  ? 158 PHE D CA  1 
ATOM   5937  C C   . PHE D  2 162 ? -53.630 28.302  -52.465 1.00 71.01  ? 158 PHE D C   1 
ATOM   5938  O O   . PHE D  2 162 ? -53.210 27.905  -53.555 1.00 70.99  ? 158 PHE D O   1 
ATOM   5939  C CB  . PHE D  2 162 ? -52.306 30.259  -51.660 1.00 68.64  ? 158 PHE D CB  1 
ATOM   5940  C CG  . PHE D  2 162 ? -51.569 30.931  -50.529 1.00 69.06  ? 158 PHE D CG  1 
ATOM   5941  C CD1 . PHE D  2 162 ? -50.223 30.660  -50.291 1.00 69.82  ? 158 PHE D CD1 1 
ATOM   5942  C CD2 . PHE D  2 162 ? -52.225 31.830  -49.694 1.00 69.14  ? 158 PHE D CD2 1 
ATOM   5943  C CE1 . PHE D  2 162 ? -49.543 31.276  -49.236 1.00 69.71  ? 158 PHE D CE1 1 
ATOM   5944  C CE2 . PHE D  2 162 ? -51.554 32.452  -48.637 1.00 69.27  ? 158 PHE D CE2 1 
ATOM   5945  C CZ  . PHE D  2 162 ? -50.211 32.173  -48.408 1.00 70.07  ? 158 PHE D CZ  1 
ATOM   5946  N N   . ARG D  2 163 ? -54.919 28.326  -52.152 1.00 75.01  ? 159 ARG D N   1 
ATOM   5947  C CA  . ARG D  2 163 ? -55.953 27.894  -53.086 1.00 79.43  ? 159 ARG D CA  1 
ATOM   5948  C C   . ARG D  2 163 ? -56.905 29.073  -53.278 1.00 80.49  ? 159 ARG D C   1 
ATOM   5949  O O   . ARG D  2 163 ? -57.525 29.548  -52.322 1.00 80.25  ? 159 ARG D O   1 
ATOM   5950  C CB  . ARG D  2 163 ? -56.688 26.678  -52.507 1.00 81.96  ? 159 ARG D CB  1 
ATOM   5951  C CG  . ARG D  2 163 ? -57.699 25.992  -53.420 1.00 84.03  ? 159 ARG D CG  1 
ATOM   5952  C CD  . ARG D  2 163 ? -58.067 24.640  -52.814 1.00 86.97  ? 159 ARG D CD  1 
ATOM   5953  N NE  . ARG D  2 163 ? -59.189 23.976  -53.473 1.00 89.80  ? 159 ARG D NE  1 
ATOM   5954  C CZ  . ARG D  2 163 ? -59.663 22.787  -53.105 1.00 91.89  ? 159 ARG D CZ  1 
ATOM   5955  N NH1 . ARG D  2 163 ? -59.105 22.139  -52.087 1.00 92.43  ? 159 ARG D NH1 1 
ATOM   5956  N NH2 . ARG D  2 163 ? -60.698 22.245  -53.741 1.00 91.70  ? 159 ARG D NH2 1 
ATOM   5957  N N   . ASN D  2 164 ? -57.002 29.552  -54.514 1.00 81.61  ? 160 ASN D N   1 
ATOM   5958  C CA  . ASN D  2 164 ? -57.863 30.686  -54.828 1.00 83.03  ? 160 ASN D CA  1 
ATOM   5959  C C   . ASN D  2 164 ? -57.667 31.807  -53.808 1.00 83.60  ? 160 ASN D C   1 
ATOM   5960  O O   . ASN D  2 164 ? -58.633 32.311  -53.239 1.00 83.72  ? 160 ASN D O   1 
ATOM   5961  C CB  . ASN D  2 164 ? -59.341 30.267  -54.836 1.00 82.87  ? 160 ASN D CB  1 
ATOM   5962  C CG  . ASN D  2 164 ? -59.656 29.217  -55.889 1.00 83.05  ? 160 ASN D CG  1 
ATOM   5963  O OD1 . ASN D  2 164 ? -59.239 29.327  -57.043 1.00 83.62  ? 160 ASN D OD1 1 
ATOM   5964  N ND2 . ASN D  2 164 ? -60.414 28.199  -55.497 1.00 82.40  ? 160 ASN D ND2 1 
ATOM   5965  N N   . GLY D  2 165 ? -56.415 32.178  -53.561 1.00 84.45  ? 161 GLY D N   1 
ATOM   5966  C CA  . GLY D  2 165 ? -56.138 33.250  -52.620 1.00 85.40  ? 161 GLY D CA  1 
ATOM   5967  C C   . GLY D  2 165 ? -56.110 32.871  -51.151 1.00 86.22  ? 161 GLY D C   1 
ATOM   5968  O O   . GLY D  2 165 ? -55.424 33.520  -50.361 1.00 85.98  ? 161 GLY D O   1 
ATOM   5969  N N   . LYS D  2 166 ? -56.852 31.836  -50.770 1.00 87.35  ? 162 LYS D N   1 
ATOM   5970  C CA  . LYS D  2 166 ? -56.883 31.400  -49.374 1.00 88.77  ? 162 LYS D CA  1 
ATOM   5971  C C   . LYS D  2 166 ? -55.819 30.330  -49.138 1.00 88.82  ? 162 LYS D C   1 
ATOM   5972  O O   . LYS D  2 166 ? -55.690 29.395  -49.930 1.00 88.55  ? 162 LYS D O   1 
ATOM   5973  C CB  . LYS D  2 166 ? -58.267 30.844  -49.029 1.00 89.61  ? 162 LYS D CB  1 
ATOM   5974  C CG  . LYS D  2 166 ? -59.406 31.802  -49.349 1.00 90.79  ? 162 LYS D CG  1 
ATOM   5975  C CD  . LYS D  2 166 ? -60.755 31.256  -48.900 1.00 92.10  ? 162 LYS D CD  1 
ATOM   5976  C CE  . LYS D  2 166 ? -61.869 32.254  -49.204 1.00 93.55  ? 162 LYS D CE  1 
ATOM   5977  N NZ  . LYS D  2 166 ? -63.209 31.819  -48.707 1.00 93.83  ? 162 LYS D NZ  1 
ATOM   5978  N N   . GLU D  2 167 ? -55.057 30.465  -48.054 1.00 88.96  ? 163 GLU D N   1 
ATOM   5979  C CA  . GLU D  2 167 ? -54.004 29.496  -47.751 1.00 89.70  ? 163 GLU D CA  1 
ATOM   5980  C C   . GLU D  2 167 ? -54.577 28.144  -47.344 1.00 89.54  ? 163 GLU D C   1 
ATOM   5981  O O   . GLU D  2 167 ? -55.777 28.008  -47.113 1.00 89.86  ? 163 GLU D O   1 
ATOM   5982  C CB  . GLU D  2 167 ? -53.092 30.006  -46.624 1.00 89.84  ? 163 GLU D CB  1 
ATOM   5983  C CG  . GLU D  2 167 ? -51.795 29.199  -46.479 1.00 90.87  ? 163 GLU D CG  1 
ATOM   5984  C CD  . GLU D  2 167 ? -50.928 29.637  -45.308 1.00 92.14  ? 163 GLU D CD  1 
ATOM   5985  O OE1 . GLU D  2 167 ? -50.756 30.860  -45.105 1.00 93.07  ? 163 GLU D OE1 1 
ATOM   5986  O OE2 . GLU D  2 167 ? -50.401 28.753  -44.597 1.00 92.53  ? 163 GLU D OE2 1 
ATOM   5987  N N   . GLU D  2 168 ? -53.703 27.146  -47.270 1.00 89.35  ? 164 GLU D N   1 
ATOM   5988  C CA  . GLU D  2 168 ? -54.080 25.796  -46.870 1.00 88.39  ? 164 GLU D CA  1 
ATOM   5989  C C   . GLU D  2 168 ? -53.146 25.414  -45.729 1.00 86.81  ? 164 GLU D C   1 
ATOM   5990  O O   . GLU D  2 168 ? -51.942 25.651  -45.803 1.00 86.91  ? 164 GLU D O   1 
ATOM   5991  C CB  . GLU D  2 168 ? -53.895 24.816  -48.033 1.00 89.09  ? 164 GLU D CB  1 
ATOM   5992  C CG  . GLU D  2 168 ? -54.741 25.111  -49.266 1.00 91.19  ? 164 GLU D CG  1 
ATOM   5993  C CD  . GLU D  2 168 ? -56.202 24.723  -49.096 1.00 93.05  ? 164 GLU D CD  1 
ATOM   5994  O OE1 . GLU D  2 168 ? -56.870 25.278  -48.198 1.00 93.76  ? 164 GLU D OE1 1 
ATOM   5995  O OE2 . GLU D  2 168 ? -56.682 23.862  -49.865 1.00 94.06  ? 164 GLU D OE2 1 
ATOM   5996  N N   . LYS D  2 169 ? -53.696 24.842  -44.667 1.00 85.63  ? 165 LYS D N   1 
ATOM   5997  C CA  . LYS D  2 169 ? -52.874 24.437  -43.536 1.00 84.09  ? 165 LYS D CA  1 
ATOM   5998  C C   . LYS D  2 169 ? -53.122 22.988  -43.154 1.00 82.25  ? 165 LYS D C   1 
ATOM   5999  O O   . LYS D  2 169 ? -52.755 22.554  -42.063 1.00 83.42  ? 165 LYS D O   1 
ATOM   6000  C CB  . LYS D  2 169 ? -53.128 25.345  -42.332 1.00 84.93  ? 165 LYS D CB  1 
ATOM   6001  C CG  . LYS D  2 169 ? -52.492 26.717  -42.463 1.00 86.54  ? 165 LYS D CG  1 
ATOM   6002  C CD  . LYS D  2 169 ? -52.575 27.496  -41.160 1.00 87.06  ? 165 LYS D CD  1 
ATOM   6003  C CE  . LYS D  2 169 ? -51.746 28.769  -41.238 1.00 87.21  ? 165 LYS D CE  1 
ATOM   6004  N NZ  . LYS D  2 169 ? -50.316 28.475  -41.557 1.00 86.91  ? 165 LYS D NZ  1 
ATOM   6005  N N   . THR D  2 170 ? -53.745 22.244  -44.061 1.00 79.38  ? 166 THR D N   1 
ATOM   6006  C CA  . THR D  2 170 ? -54.035 20.832  -43.833 1.00 76.51  ? 166 THR D CA  1 
ATOM   6007  C C   . THR D  2 170 ? -53.857 20.057  -45.137 1.00 73.51  ? 166 THR D C   1 
ATOM   6008  O O   . THR D  2 170 ? -54.184 20.553  -46.215 1.00 72.46  ? 166 THR D O   1 
ATOM   6009  C CB  . THR D  2 170 ? -55.480 20.625  -43.332 1.00 77.45  ? 166 THR D CB  1 
ATOM   6010  O OG1 . THR D  2 170 ? -56.403 20.976  -44.371 1.00 77.43  ? 166 THR D OG1 1 
ATOM   6011  C CG2 . THR D  2 170 ? -55.751 21.487  -42.104 1.00 77.49  ? 166 THR D CG2 1 
ATOM   6012  N N   . GLY D  2 171 ? -53.340 18.838  -45.034 1.00 70.85  ? 167 GLY D N   1 
ATOM   6013  C CA  . GLY D  2 171 ? -53.129 18.030  -46.222 1.00 67.47  ? 167 GLY D CA  1 
ATOM   6014  C C   . GLY D  2 171 ? -51.741 18.241  -46.800 1.00 64.61  ? 167 GLY D C   1 
ATOM   6015  O O   . GLY D  2 171 ? -51.448 17.801  -47.912 1.00 62.84  ? 167 GLY D O   1 
ATOM   6016  N N   . ILE D  2 172 ? -50.888 18.916  -46.032 1.00 61.63  ? 168 ILE D N   1 
ATOM   6017  C CA  . ILE D  2 172 ? -49.521 19.197  -46.447 1.00 59.47  ? 168 ILE D CA  1 
ATOM   6018  C C   . ILE D  2 172 ? -48.565 18.092  -45.996 1.00 57.35  ? 168 ILE D C   1 
ATOM   6019  O O   . ILE D  2 172 ? -48.523 17.724  -44.825 1.00 57.33  ? 168 ILE D O   1 
ATOM   6020  C CB  . ILE D  2 172 ? -49.030 20.542  -45.860 1.00 59.14  ? 168 ILE D CB  1 
ATOM   6021  C CG1 . ILE D  2 172 ? -49.962 21.681  -46.285 1.00 58.87  ? 168 ILE D CG1 1 
ATOM   6022  C CG2 . ILE D  2 172 ? -47.623 20.825  -46.327 1.00 58.18  ? 168 ILE D CG2 1 
ATOM   6023  C CD1 . ILE D  2 172 ? -50.001 21.922  -47.767 1.00 57.69  ? 168 ILE D CD1 1 
ATOM   6024  N N   . VAL D  2 173 ? -47.802 17.563  -46.943 1.00 55.79  ? 169 VAL D N   1 
ATOM   6025  C CA  . VAL D  2 173 ? -46.833 16.510  -46.665 1.00 54.13  ? 169 VAL D CA  1 
ATOM   6026  C C   . VAL D  2 173 ? -45.506 16.941  -47.266 1.00 51.97  ? 169 VAL D C   1 
ATOM   6027  O O   . VAL D  2 173 ? -45.486 17.678  -48.247 1.00 50.91  ? 169 VAL D O   1 
ATOM   6028  C CB  . VAL D  2 173 ? -47.247 15.190  -47.315 1.00 53.79  ? 169 VAL D CB  1 
ATOM   6029  C CG1 . VAL D  2 173 ? -46.286 14.090  -46.899 1.00 53.83  ? 169 VAL D CG1 1 
ATOM   6030  C CG2 . VAL D  2 173 ? -48.681 14.852  -46.929 1.00 55.18  ? 169 VAL D CG2 1 
ATOM   6031  N N   . SER D  2 174 ? -44.399 16.478  -46.697 1.00 49.67  ? 170 SER D N   1 
ATOM   6032  C CA  . SER D  2 174 ? -43.104 16.877  -47.217 1.00 47.80  ? 170 SER D CA  1 
ATOM   6033  C C   . SER D  2 174 ? -42.021 15.825  -47.053 1.00 46.28  ? 170 SER D C   1 
ATOM   6034  O O   . SER D  2 174 ? -42.078 14.994  -46.150 1.00 44.31  ? 170 SER D O   1 
ATOM   6035  C CB  . SER D  2 174 ? -42.672 18.178  -46.542 1.00 46.60  ? 170 SER D CB  1 
ATOM   6036  O OG  . SER D  2 174 ? -41.406 18.597  -47.008 1.00 47.70  ? 170 SER D OG  1 
ATOM   6037  N N   . THR D  2 175 ? -41.035 15.865  -47.943 1.00 46.63  ? 171 THR D N   1 
ATOM   6038  C CA  . THR D  2 175 ? -39.913 14.928  -47.895 1.00 46.80  ? 171 THR D CA  1 
ATOM   6039  C C   . THR D  2 175 ? -38.905 15.441  -46.886 1.00 45.16  ? 171 THR D C   1 
ATOM   6040  O O   . THR D  2 175 ? -37.933 14.761  -46.566 1.00 46.70  ? 171 THR D O   1 
ATOM   6041  C CB  . THR D  2 175 ? -39.168 14.827  -49.248 1.00 47.67  ? 171 THR D CB  1 
ATOM   6042  O OG1 . THR D  2 175 ? -38.750 16.140  -49.662 1.00 46.84  ? 171 THR D OG1 1 
ATOM   6043  C CG2 . THR D  2 175 ? -40.050 14.193  -50.301 1.00 47.32  ? 171 THR D CG2 1 
ATOM   6044  N N   . GLY D  2 176 ? -39.139 16.652  -46.400 1.00 44.32  ? 172 GLY D N   1 
ATOM   6045  C CA  . GLY D  2 176 ? -38.227 17.248  -45.444 1.00 43.43  ? 172 GLY D CA  1 
ATOM   6046  C C   . GLY D  2 176 ? -37.073 17.960  -46.136 1.00 41.05  ? 172 GLY D C   1 
ATOM   6047  O O   . GLY D  2 176 ? -36.909 17.885  -47.354 1.00 39.41  ? 172 GLY D O   1 
ATOM   6048  N N   . LEU D  2 177 ? -36.270 18.662  -45.354 1.00 39.39  ? 173 LEU D N   1 
ATOM   6049  C CA  . LEU D  2 177 ? -35.133 19.371  -45.901 1.00 39.28  ? 173 LEU D CA  1 
ATOM   6050  C C   . LEU D  2 177 ? -34.081 18.342  -46.297 1.00 38.94  ? 173 LEU D C   1 
ATOM   6051  O O   . LEU D  2 177 ? -33.507 17.688  -45.440 1.00 41.55  ? 173 LEU D O   1 
ATOM   6052  C CB  . LEU D  2 177 ? -34.561 20.294  -44.840 1.00 38.89  ? 173 LEU D CB  1 
ATOM   6053  C CG  . LEU D  2 177 ? -33.415 21.171  -45.313 1.00 41.59  ? 173 LEU D CG  1 
ATOM   6054  C CD1 . LEU D  2 177 ? -33.974 22.277  -46.215 1.00 40.45  ? 173 LEU D CD1 1 
ATOM   6055  C CD2 . LEU D  2 177 ? -32.701 21.762  -44.105 1.00 40.14  ? 173 LEU D CD2 1 
ATOM   6056  N N   . VAL D  2 178 ? -33.814 18.182  -47.582 1.00 36.90  ? 174 VAL D N   1 
ATOM   6057  C CA  . VAL D  2 178 ? -32.811 17.209  -47.977 1.00 36.26  ? 174 VAL D CA  1 
ATOM   6058  C C   . VAL D  2 178 ? -31.481 17.845  -48.400 1.00 35.99  ? 174 VAL D C   1 
ATOM   6059  O O   . VAL D  2 178 ? -31.429 18.709  -49.281 1.00 33.89  ? 174 VAL D O   1 
ATOM   6060  C CB  . VAL D  2 178 ? -33.329 16.301  -49.111 1.00 36.42  ? 174 VAL D CB  1 
ATOM   6061  C CG1 . VAL D  2 178 ? -32.289 15.246  -49.454 1.00 31.88  ? 174 VAL D CG1 1 
ATOM   6062  C CG2 . VAL D  2 178 ? -34.632 15.651  -48.686 1.00 36.72  ? 174 VAL D CG2 1 
ATOM   6063  N N   . ARG D  2 179 ? -30.411 17.394  -47.749 1.00 35.29  ? 175 ARG D N   1 
ATOM   6064  C CA  . ARG D  2 179 ? -29.061 17.870  -48.006 1.00 34.16  ? 175 ARG D CA  1 
ATOM   6065  C C   . ARG D  2 179 ? -28.514 17.092  -49.197 1.00 33.41  ? 175 ARG D C   1 
ATOM   6066  O O   . ARG D  2 179 ? -28.543 15.864  -49.194 1.00 32.47  ? 175 ARG D O   1 
ATOM   6067  C CB  . ARG D  2 179 ? -28.211 17.620  -46.760 1.00 34.59  ? 175 ARG D CB  1 
ATOM   6068  C CG  . ARG D  2 179 ? -26.823 18.238  -46.776 1.00 35.17  ? 175 ARG D CG  1 
ATOM   6069  C CD  . ARG D  2 179 ? -26.087 17.908  -45.493 1.00 33.78  ? 175 ARG D CD  1 
ATOM   6070  N NE  . ARG D  2 179 ? -26.733 18.462  -44.307 1.00 35.88  ? 175 ARG D NE  1 
ATOM   6071  C CZ  . ARG D  2 179 ? -26.705 19.747  -43.967 1.00 38.97  ? 175 ARG D CZ  1 
ATOM   6072  N NH1 . ARG D  2 179 ? -26.062 20.626  -44.727 1.00 40.51  ? 175 ARG D NH1 1 
ATOM   6073  N NH2 . ARG D  2 179 ? -27.305 20.157  -42.856 1.00 39.30  ? 175 ARG D NH2 1 
ATOM   6074  N N   . ASN D  2 180 ? -28.040 17.799  -50.221 1.00 33.23  ? 176 ASN D N   1 
ATOM   6075  C CA  . ASN D  2 180 ? -27.497 17.140  -51.408 1.00 34.15  ? 176 ASN D CA  1 
ATOM   6076  C C   . ASN D  2 180 ? -26.004 16.814  -51.291 1.00 32.77  ? 176 ASN D C   1 
ATOM   6077  O O   . ASN D  2 180 ? -25.474 16.042  -52.076 1.00 31.02  ? 176 ASN D O   1 
ATOM   6078  C CB  . ASN D  2 180 ? -27.734 17.992  -52.665 1.00 37.72  ? 176 ASN D CB  1 
ATOM   6079  C CG  . ASN D  2 180 ? -29.194 18.022  -53.095 1.00 42.22  ? 176 ASN D CG  1 
ATOM   6080  O OD1 . ASN D  2 180 ? -29.895 16.997  -53.081 1.00 41.92  ? 176 ASN D OD1 1 
ATOM   6081  N ND2 . ASN D  2 180 ? -29.656 19.200  -53.505 1.00 43.56  ? 176 ASN D ND2 1 
ATOM   6082  N N   . GLY D  2 181 ? -25.328 17.427  -50.328 1.00 33.11  ? 177 GLY D N   1 
ATOM   6083  C CA  . GLY D  2 181 ? -23.918 17.151  -50.130 1.00 36.69  ? 177 GLY D CA  1 
ATOM   6084  C C   . GLY D  2 181 ? -22.947 18.125  -50.771 1.00 38.82  ? 177 GLY D C   1 
ATOM   6085  O O   . GLY D  2 181 ? -21.762 18.143  -50.418 1.00 39.14  ? 177 GLY D O   1 
ATOM   6086  N N   . ASP D  2 182 ? -23.441 18.943  -51.697 1.00 39.02  ? 178 ASP D N   1 
ATOM   6087  C CA  . ASP D  2 182 ? -22.598 19.899  -52.410 1.00 39.23  ? 178 ASP D CA  1 
ATOM   6088  C C   . ASP D  2 182 ? -22.931 21.341  -52.058 1.00 39.14  ? 178 ASP D C   1 
ATOM   6089  O O   . ASP D  2 182 ? -22.731 22.245  -52.863 1.00 39.67  ? 178 ASP D O   1 
ATOM   6090  C CB  . ASP D  2 182 ? -22.770 19.706  -53.913 1.00 39.96  ? 178 ASP D CB  1 
ATOM   6091  C CG  . ASP D  2 182 ? -24.225 19.790  -54.340 1.00 44.35  ? 178 ASP D CG  1 
ATOM   6092  O OD1 . ASP D  2 182 ? -25.003 20.496  -53.658 1.00 44.03  ? 178 ASP D OD1 1 
ATOM   6093  O OD2 . ASP D  2 182 ? -24.590 19.158  -55.358 1.00 45.76  ? 178 ASP D OD2 1 
ATOM   6094  N N   . TRP D  2 183 ? -23.447 21.542  -50.854 1.00 38.78  ? 179 TRP D N   1 
ATOM   6095  C CA  . TRP D  2 183 ? -23.830 22.860  -50.359 1.00 38.30  ? 179 TRP D CA  1 
ATOM   6096  C C   . TRP D  2 183 ? -25.180 23.379  -50.855 1.00 38.33  ? 179 TRP D C   1 
ATOM   6097  O O   . TRP D  2 183 ? -25.475 24.574  -50.744 1.00 40.93  ? 179 TRP D O   1 
ATOM   6098  C CB  . TRP D  2 183 ? -22.728 23.886  -50.628 1.00 34.90  ? 179 TRP D CB  1 
ATOM   6099  C CG  . TRP D  2 183 ? -21.529 23.647  -49.786 1.00 31.67  ? 179 TRP D CG  1 
ATOM   6100  C CD1 . TRP D  2 183 ? -20.597 22.660  -49.950 1.00 30.56  ? 179 TRP D CD1 1 
ATOM   6101  C CD2 . TRP D  2 183 ? -21.151 24.364  -48.607 1.00 29.55  ? 179 TRP D CD2 1 
ATOM   6102  N NE1 . TRP D  2 183 ? -19.667 22.720  -48.944 1.00 29.90  ? 179 TRP D NE1 1 
ATOM   6103  C CE2 . TRP D  2 183 ? -19.982 23.757  -48.106 1.00 28.15  ? 179 TRP D CE2 1 
ATOM   6104  C CE3 . TRP D  2 183 ? -21.688 25.461  -47.922 1.00 30.61  ? 179 TRP D CE3 1 
ATOM   6105  C CZ2 . TRP D  2 183 ? -19.339 24.208  -46.953 1.00 27.78  ? 179 TRP D CZ2 1 
ATOM   6106  C CZ3 . TRP D  2 183 ? -21.045 25.911  -46.770 1.00 30.22  ? 179 TRP D CZ3 1 
ATOM   6107  C CH2 . TRP D  2 183 ? -19.884 25.284  -46.301 1.00 27.18  ? 179 TRP D CH2 1 
ATOM   6108  N N   . THR D  2 184 ? -25.992 22.479  -51.400 1.00 37.21  ? 180 THR D N   1 
ATOM   6109  C CA  . THR D  2 184 ? -27.340 22.828  -51.839 1.00 38.82  ? 180 THR D CA  1 
ATOM   6110  C C   . THR D  2 184 ? -28.338 21.917  -51.133 1.00 39.87  ? 180 THR D C   1 
ATOM   6111  O O   . THR D  2 184 ? -28.000 20.826  -50.662 1.00 38.78  ? 180 THR D O   1 
ATOM   6112  C CB  . THR D  2 184 ? -27.565 22.656  -53.357 1.00 40.09  ? 180 THR D CB  1 
ATOM   6113  O OG1 . THR D  2 184 ? -27.482 21.266  -53.711 1.00 39.05  ? 180 THR D OG1 1 
ATOM   6114  C CG2 . THR D  2 184 ? -26.542 23.470  -54.143 1.00 40.77  ? 180 THR D CG2 1 
ATOM   6115  N N   . PHE D  2 185 ? -29.574 22.383  -51.079 1.00 39.94  ? 181 PHE D N   1 
ATOM   6116  C CA  . PHE D  2 185 ? -30.657 21.651  -50.457 1.00 39.97  ? 181 PHE D CA  1 
ATOM   6117  C C   . PHE D  2 185 ? -31.789 21.556  -51.469 1.00 41.82  ? 181 PHE D C   1 
ATOM   6118  O O   . PHE D  2 185 ? -31.819 22.293  -52.461 1.00 43.22  ? 181 PHE D O   1 
ATOM   6119  C CB  . PHE D  2 185 ? -31.177 22.416  -49.238 1.00 39.00  ? 181 PHE D CB  1 
ATOM   6120  C CG  . PHE D  2 185 ? -30.257 22.388  -48.052 1.00 40.69  ? 181 PHE D CG  1 
ATOM   6121  C CD1 . PHE D  2 185 ? -30.238 21.293  -47.196 1.00 41.36  ? 181 PHE D CD1 1 
ATOM   6122  C CD2 . PHE D  2 185 ? -29.455 23.477  -47.757 1.00 41.03  ? 181 PHE D CD2 1 
ATOM   6123  C CE1 . PHE D  2 185 ? -29.445 21.290  -46.067 1.00 41.46  ? 181 PHE D CE1 1 
ATOM   6124  C CE2 . PHE D  2 185 ? -28.658 23.484  -46.631 1.00 42.00  ? 181 PHE D CE2 1 
ATOM   6125  C CZ  . PHE D  2 185 ? -28.654 22.386  -45.778 1.00 42.68  ? 181 PHE D CZ  1 
ATOM   6126  N N   . GLN D  2 186 ? -32.720 20.648  -51.210 1.00 40.31  ? 182 GLN D N   1 
ATOM   6127  C CA  . GLN D  2 186 ? -33.896 20.493  -52.045 1.00 38.89  ? 182 GLN D CA  1 
ATOM   6128  C C   . GLN D  2 186 ? -34.983 20.022  -51.096 1.00 40.24  ? 182 GLN D C   1 
ATOM   6129  O O   . GLN D  2 186 ? -34.690 19.629  -49.967 1.00 38.32  ? 182 GLN D O   1 
ATOM   6130  C CB  . GLN D  2 186 ? -33.671 19.479  -53.166 1.00 32.44  ? 182 GLN D CB  1 
ATOM   6131  C CG  . GLN D  2 186 ? -33.471 18.061  -52.710 1.00 33.36  ? 182 GLN D CG  1 
ATOM   6132  C CD  . GLN D  2 186 ? -33.440 17.090  -53.867 1.00 31.04  ? 182 GLN D CD  1 
ATOM   6133  O OE1 . GLN D  2 186 ? -34.446 16.873  -54.533 1.00 33.73  ? 182 GLN D OE1 1 
ATOM   6134  N NE2 . GLN D  2 186 ? -32.281 16.512  -54.121 1.00 31.60  ? 182 GLN D NE2 1 
ATOM   6135  N N   . THR D  2 187 ? -36.232 20.070  -51.544 1.00 42.07  ? 183 THR D N   1 
ATOM   6136  C CA  . THR D  2 187 ? -37.347 19.652  -50.707 1.00 43.56  ? 183 THR D CA  1 
ATOM   6137  C C   . THR D  2 187 ? -38.609 19.632  -51.531 1.00 44.21  ? 183 THR D C   1 
ATOM   6138  O O   . THR D  2 187 ? -38.763 20.423  -52.459 1.00 44.65  ? 183 THR D O   1 
ATOM   6139  C CB  . THR D  2 187 ? -37.561 20.624  -49.521 1.00 45.22  ? 183 THR D CB  1 
ATOM   6140  O OG1 . THR D  2 187 ? -38.596 20.124  -48.665 1.00 48.34  ? 183 THR D OG1 1 
ATOM   6141  C CG2 . THR D  2 187 ? -37.969 21.996  -50.024 1.00 46.82  ? 183 THR D CG2 1 
ATOM   6142  N N   . LEU D  2 188 ? -39.506 18.713  -51.198 1.00 45.07  ? 184 LEU D N   1 
ATOM   6143  C CA  . LEU D  2 188 ? -40.781 18.609  -51.886 1.00 44.45  ? 184 LEU D CA  1 
ATOM   6144  C C   . LEU D  2 188 ? -41.896 18.811  -50.866 1.00 46.35  ? 184 LEU D C   1 
ATOM   6145  O O   . LEU D  2 188 ? -42.059 18.009  -49.938 1.00 48.17  ? 184 LEU D O   1 
ATOM   6146  C CB  . LEU D  2 188 ? -40.943 17.241  -52.544 1.00 41.57  ? 184 LEU D CB  1 
ATOM   6147  C CG  . LEU D  2 188 ? -39.979 16.820  -53.649 1.00 43.46  ? 184 LEU D CG  1 
ATOM   6148  C CD1 . LEU D  2 188 ? -40.515 15.540  -54.274 1.00 42.33  ? 184 LEU D CD1 1 
ATOM   6149  C CD2 . LEU D  2 188 ? -39.833 17.910  -54.708 1.00 40.58  ? 184 LEU D CD2 1 
ATOM   6150  N N   . VAL D  2 189 ? -42.644 19.896  -51.022 1.00 46.85  ? 185 VAL D N   1 
ATOM   6151  C CA  . VAL D  2 189 ? -43.756 20.189  -50.138 1.00 47.35  ? 185 VAL D CA  1 
ATOM   6152  C C   . VAL D  2 189 ? -45.016 19.871  -50.935 1.00 48.37  ? 185 VAL D C   1 
ATOM   6153  O O   . VAL D  2 189 ? -45.367 20.594  -51.857 1.00 50.03  ? 185 VAL D O   1 
ATOM   6154  C CB  . VAL D  2 189 ? -43.755 21.672  -49.715 1.00 48.29  ? 185 VAL D CB  1 
ATOM   6155  C CG1 . VAL D  2 189 ? -45.000 21.981  -48.895 1.00 48.73  ? 185 VAL D CG1 1 
ATOM   6156  C CG2 . VAL D  2 189 ? -42.504 21.980  -48.901 1.00 47.26  ? 185 VAL D CG2 1 
ATOM   6157  N N   . MET D  2 190 ? -45.688 18.781  -50.585 1.00 49.68  ? 186 MET D N   1 
ATOM   6158  C CA  . MET D  2 190 ? -46.891 18.374  -51.296 1.00 51.65  ? 186 MET D CA  1 
ATOM   6159  C C   . MET D  2 190 ? -48.210 18.714  -50.604 1.00 51.33  ? 186 MET D C   1 
ATOM   6160  O O   . MET D  2 190 ? -48.299 18.739  -49.378 1.00 50.06  ? 186 MET D O   1 
ATOM   6161  C CB  . MET D  2 190 ? -46.819 16.879  -51.580 1.00 53.53  ? 186 MET D CB  1 
ATOM   6162  C CG  . MET D  2 190 ? -45.633 16.516  -52.444 1.00 56.45  ? 186 MET D CG  1 
ATOM   6163  S SD  . MET D  2 190 ? -44.856 14.999  -51.901 1.00 65.17  ? 186 MET D SD  1 
ATOM   6164  C CE  . MET D  2 190 ? -44.982 13.947  -53.408 1.00 60.44  ? 186 MET D CE  1 
ATOM   6165  N N   . LEU D  2 191 ? -49.226 18.999  -51.415 1.00 52.60  ? 187 LEU D N   1 
ATOM   6166  C CA  . LEU D  2 191 ? -50.562 19.330  -50.920 1.00 53.59  ? 187 LEU D CA  1 
ATOM   6167  C C   . LEU D  2 191 ? -51.556 18.304  -51.447 1.00 53.61  ? 187 LEU D C   1 
ATOM   6168  O O   . LEU D  2 191 ? -51.552 17.976  -52.631 1.00 51.00  ? 187 LEU D O   1 
ATOM   6169  C CB  . LEU D  2 191 ? -50.980 20.730  -51.379 1.00 52.87  ? 187 LEU D CB  1 
ATOM   6170  C CG  . LEU D  2 191 ? -52.436 21.127  -51.108 1.00 52.38  ? 187 LEU D CG  1 
ATOM   6171  C CD1 . LEU D  2 191 ? -52.676 21.259  -49.616 1.00 51.09  ? 187 LEU D CD1 1 
ATOM   6172  C CD2 . LEU D  2 191 ? -52.750 22.440  -51.803 1.00 50.70  ? 187 LEU D CD2 1 
ATOM   6173  N N   . GLU D  2 192 ? -52.394 17.787  -50.553 1.00 56.82  ? 188 GLU D N   1 
ATOM   6174  C CA  . GLU D  2 192 ? -53.396 16.794  -50.925 1.00 60.87  ? 188 GLU D CA  1 
ATOM   6175  C C   . GLU D  2 192 ? -54.719 17.462  -51.291 1.00 60.09  ? 188 GLU D C   1 
ATOM   6176  O O   . GLU D  2 192 ? -55.422 17.988  -50.432 1.00 60.07  ? 188 GLU D O   1 
ATOM   6177  C CB  . GLU D  2 192 ? -53.611 15.801  -49.773 1.00 63.26  ? 188 GLU D CB  1 
ATOM   6178  C CG  . GLU D  2 192 ? -52.397 14.918  -49.467 1.00 69.09  ? 188 GLU D CG  1 
ATOM   6179  C CD  . GLU D  2 192 ? -52.591 14.042  -48.233 1.00 72.19  ? 188 GLU D CD  1 
ATOM   6180  O OE1 . GLU D  2 192 ? -52.779 14.603  -47.130 1.00 73.83  ? 188 GLU D OE1 1 
ATOM   6181  O OE2 . GLU D  2 192 ? -52.554 12.796  -48.364 1.00 73.16  ? 188 GLU D OE2 1 
ATOM   6182  N N   . THR D  2 193 ? -55.041 17.459  -52.577 1.00 60.25  ? 189 THR D N   1 
ATOM   6183  C CA  . THR D  2 193 ? -56.283 18.049  -53.056 1.00 62.67  ? 189 THR D CA  1 
ATOM   6184  C C   . THR D  2 193 ? -56.655 17.433  -54.387 1.00 61.92  ? 189 THR D C   1 
ATOM   6185  O O   . THR D  2 193 ? -55.820 16.857  -55.077 1.00 60.70  ? 189 THR D O   1 
ATOM   6186  C CB  . THR D  2 193 ? -56.180 19.584  -53.285 1.00 61.63  ? 189 THR D CB  1 
ATOM   6187  O OG1 . THR D  2 193 ? -55.140 19.862  -54.232 1.00 61.93  ? 189 THR D OG1 1 
ATOM   6188  C CG2 . THR D  2 193 ? -55.901 20.310  -51.990 1.00 61.81  ? 189 THR D CG2 1 
ATOM   6189  N N   . VAL D  2 194 ? -57.925 17.548  -54.732 1.00 63.16  ? 190 VAL D N   1 
ATOM   6190  C CA  . VAL D  2 194 ? -58.409 17.041  -55.997 1.00 66.35  ? 190 VAL D CA  1 
ATOM   6191  C C   . VAL D  2 194 ? -58.617 18.285  -56.842 1.00 66.27  ? 190 VAL D C   1 
ATOM   6192  O O   . VAL D  2 194 ? -59.560 19.047  -56.635 1.00 66.49  ? 190 VAL D O   1 
ATOM   6193  C CB  . VAL D  2 194 ? -59.728 16.275  -55.825 1.00 65.88  ? 190 VAL D CB  1 
ATOM   6194  C CG1 . VAL D  2 194 ? -60.345 15.991  -57.172 1.00 65.52  ? 190 VAL D CG1 1 
ATOM   6195  C CG2 . VAL D  2 194 ? -59.466 14.973  -55.090 1.00 66.36  ? 190 VAL D CG2 1 
ATOM   6196  N N   . PRO D  2 195 ? -57.711 18.519  -57.795 1.00 66.85  ? 191 PRO D N   1 
ATOM   6197  C CA  . PRO D  2 195 ? -57.769 19.677  -58.684 1.00 68.03  ? 191 PRO D CA  1 
ATOM   6198  C C   . PRO D  2 195 ? -59.003 19.694  -59.568 1.00 67.16  ? 191 PRO D C   1 
ATOM   6199  O O   . PRO D  2 195 ? -59.292 18.724  -60.262 1.00 66.72  ? 191 PRO D O   1 
ATOM   6200  C CB  . PRO D  2 195 ? -56.487 19.546  -59.498 1.00 67.42  ? 191 PRO D CB  1 
ATOM   6201  C CG  . PRO D  2 195 ? -55.584 18.758  -58.603 1.00 67.12  ? 191 PRO D CG  1 
ATOM   6202  C CD  . PRO D  2 195 ? -56.511 17.717  -58.072 1.00 66.29  ? 191 PRO D CD  1 
ATOM   6203  N N   . GLN D  2 196 ? -59.728 20.806  -59.536 1.00 67.60  ? 192 GLN D N   1 
ATOM   6204  C CA  . GLN D  2 196 ? -60.920 20.962  -60.355 1.00 68.63  ? 192 GLN D CA  1 
ATOM   6205  C C   . GLN D  2 196 ? -60.635 22.032  -61.405 1.00 69.48  ? 192 GLN D C   1 
ATOM   6206  O O   . GLN D  2 196 ? -60.067 23.079  -61.097 1.00 69.01  ? 192 GLN D O   1 
ATOM   6207  C CB  . GLN D  2 196 ? -62.117 21.373  -59.492 1.00 63.56  ? 192 GLN D CB  1 
ATOM   6208  C CG  . GLN D  2 196 ? -62.394 20.437  -58.325 1.00 56.96  ? 192 GLN D CG  1 
ATOM   6209  C CD  . GLN D  2 196 ? -63.709 20.739  -57.625 1.00 54.85  ? 192 GLN D CD  1 
ATOM   6210  O OE1 . GLN D  2 196 ? -64.781 20.569  -58.206 1.00 49.54  ? 192 GLN D OE1 1 
ATOM   6211  N NE2 . GLN D  2 196 ? -63.632 21.191  -56.369 1.00 51.32  ? 192 GLN D NE2 1 
ATOM   6212  N N   . SER D  2 197 ? -61.020 21.739  -62.643 1.00 72.29  ? 193 SER D N   1 
ATOM   6213  C CA  . SER D  2 197 ? -60.835 22.631  -63.786 1.00 75.55  ? 193 SER D CA  1 
ATOM   6214  C C   . SER D  2 197 ? -60.907 24.128  -63.475 1.00 76.07  ? 193 SER D C   1 
ATOM   6215  O O   . SER D  2 197 ? -60.216 24.930  -64.108 1.00 76.73  ? 193 SER D O   1 
ATOM   6216  C CB  . SER D  2 197 ? -61.865 22.292  -64.866 1.00 74.70  ? 193 SER D CB  1 
ATOM   6217  O OG  . SER D  2 197 ? -61.793 23.203  -65.946 1.00 76.78  ? 193 SER D OG  1 
ATOM   6218  N N   . GLY D  2 198 ? -61.739 24.508  -62.511 1.00 76.59  ? 194 GLY D N   1 
ATOM   6219  C CA  . GLY D  2 198 ? -61.854 25.915  -62.172 1.00 78.84  ? 194 GLY D CA  1 
ATOM   6220  C C   . GLY D  2 198 ? -61.202 26.316  -60.861 1.00 79.31  ? 194 GLY D C   1 
ATOM   6221  O O   . GLY D  2 198 ? -61.862 26.892  -59.991 1.00 79.47  ? 194 GLY D O   1 
ATOM   6222  N N   . GLU D  2 199 ? -59.908 26.025  -60.717 1.00 79.23  ? 195 GLU D N   1 
ATOM   6223  C CA  . GLU D  2 199 ? -59.179 26.359  -59.495 1.00 78.94  ? 195 GLU D CA  1 
ATOM   6224  C C   . GLU D  2 199 ? -57.788 26.922  -59.757 1.00 78.15  ? 195 GLU D C   1 
ATOM   6225  O O   . GLU D  2 199 ? -57.153 26.611  -60.766 1.00 77.49  ? 195 GLU D O   1 
ATOM   6226  C CB  . GLU D  2 199 ? -59.034 25.129  -58.602 1.00 78.68  ? 195 GLU D CB  1 
ATOM   6227  C CG  . GLU D  2 199 ? -60.325 24.593  -58.030 1.00 76.75  ? 195 GLU D CG  1 
ATOM   6228  C CD  . GLU D  2 199 ? -60.084 23.399  -57.133 1.00 75.66  ? 195 GLU D CD  1 
ATOM   6229  O OE1 . GLU D  2 199 ? -59.548 22.384  -57.626 1.00 73.30  ? 195 GLU D OE1 1 
ATOM   6230  O OE2 . GLU D  2 199 ? -60.425 23.480  -55.936 1.00 74.75  ? 195 GLU D OE2 1 
ATOM   6231  N N   . VAL D  2 200 ? -57.318 27.739  -58.819 1.00 77.56  ? 196 VAL D N   1 
ATOM   6232  C CA  . VAL D  2 200 ? -56.003 28.361  -58.911 1.00 77.01  ? 196 VAL D CA  1 
ATOM   6233  C C   . VAL D  2 200 ? -55.189 28.087  -57.644 1.00 74.96  ? 196 VAL D C   1 
ATOM   6234  O O   . VAL D  2 200 ? -55.564 28.523  -56.551 1.00 74.44  ? 196 VAL D O   1 
ATOM   6235  C CB  . VAL D  2 200 ? -56.128 29.886  -59.099 1.00 78.14  ? 196 VAL D CB  1 
ATOM   6236  C CG1 . VAL D  2 200 ? -54.748 30.522  -59.171 1.00 78.33  ? 196 VAL D CG1 1 
ATOM   6237  C CG2 . VAL D  2 200 ? -56.919 30.184  -60.360 1.00 78.91  ? 196 VAL D CG2 1 
ATOM   6238  N N   . TYR D  2 201 ? -54.081 27.363  -57.803 1.00 72.28  ? 197 TYR D N   1 
ATOM   6239  C CA  . TYR D  2 201 ? -53.201 27.020  -56.687 1.00 70.06  ? 197 TYR D CA  1 
ATOM   6240  C C   . TYR D  2 201 ? -51.885 27.783  -56.789 1.00 67.65  ? 197 TYR D C   1 
ATOM   6241  O O   . TYR D  2 201 ? -51.342 27.963  -57.879 1.00 66.53  ? 197 TYR D O   1 
ATOM   6242  C CB  . TYR D  2 201 ? -52.891 25.517  -56.674 1.00 68.98  ? 197 TYR D CB  1 
ATOM   6243  C CG  . TYR D  2 201 ? -54.079 24.602  -56.441 1.00 68.07  ? 197 TYR D CG  1 
ATOM   6244  C CD1 . TYR D  2 201 ? -54.926 24.240  -57.488 1.00 66.86  ? 197 TYR D CD1 1 
ATOM   6245  C CD2 . TYR D  2 201 ? -54.352 24.097  -55.169 1.00 67.70  ? 197 TYR D CD2 1 
ATOM   6246  C CE1 . TYR D  2 201 ? -56.013 23.398  -57.272 1.00 66.99  ? 197 TYR D CE1 1 
ATOM   6247  C CE2 . TYR D  2 201 ? -55.436 23.259  -54.942 1.00 66.42  ? 197 TYR D CE2 1 
ATOM   6248  C CZ  . TYR D  2 201 ? -56.262 22.913  -55.995 1.00 67.32  ? 197 TYR D CZ  1 
ATOM   6249  O OH  . TYR D  2 201 ? -57.346 22.095  -55.764 1.00 67.74  ? 197 TYR D OH  1 
ATOM   6250  N N   . THR D  2 202 ? -51.365 28.221  -55.650 1.00 65.74  ? 198 THR D N   1 
ATOM   6251  C CA  . THR D  2 202 ? -50.107 28.954  -55.637 1.00 64.90  ? 198 THR D CA  1 
ATOM   6252  C C   . THR D  2 202 ? -49.173 28.518  -54.514 1.00 63.00  ? 198 THR D C   1 
ATOM   6253  O O   . THR D  2 202 ? -49.609 28.252  -53.389 1.00 61.97  ? 198 THR D O   1 
ATOM   6254  C CB  . THR D  2 202 ? -50.341 30.469  -55.498 1.00 63.85  ? 198 THR D CB  1 
ATOM   6255  O OG1 . THR D  2 202 ? -51.316 30.703  -54.478 1.00 64.22  ? 198 THR D OG1 1 
ATOM   6256  C CG2 . THR D  2 202 ? -50.813 31.069  -56.810 1.00 64.52  ? 198 THR D CG2 1 
ATOM   6257  N N   . CYS D  2 203 ? -47.883 28.446  -54.837 1.00 61.65  ? 199 CYS D N   1 
ATOM   6258  C CA  . CYS D  2 203 ? -46.865 28.070  -53.866 1.00 59.86  ? 199 CYS D CA  1 
ATOM   6259  C C   . CYS D  2 203 ? -46.043 29.321  -53.583 1.00 58.79  ? 199 CYS D C   1 
ATOM   6260  O O   . CYS D  2 203 ? -45.525 29.949  -54.506 1.00 58.56  ? 199 CYS D O   1 
ATOM   6261  C CB  . CYS D  2 203 ? -45.948 26.967  -54.419 1.00 57.90  ? 199 CYS D CB  1 
ATOM   6262  S SG  . CYS D  2 203 ? -44.836 26.274  -53.143 1.00 61.45  ? 199 CYS D SG  1 
ATOM   6263  N N   . GLN D  2 204 ? -45.955 29.692  -52.310 1.00 57.87  ? 200 GLN D N   1 
ATOM   6264  C CA  . GLN D  2 204 ? -45.182 30.851  -51.885 1.00 57.71  ? 200 GLN D CA  1 
ATOM   6265  C C   . GLN D  2 204 ? -43.979 30.402  -51.031 1.00 57.16  ? 200 GLN D C   1 
ATOM   6266  O O   . GLN D  2 204 ? -44.140 29.839  -49.945 1.00 55.28  ? 200 GLN D O   1 
ATOM   6267  C CB  . GLN D  2 204 ? -46.066 31.809  -51.087 1.00 58.25  ? 200 GLN D CB  1 
ATOM   6268  C CG  . GLN D  2 204 ? -45.320 33.010  -50.532 1.00 59.33  ? 200 GLN D CG  1 
ATOM   6269  C CD  . GLN D  2 204 ? -46.162 33.825  -49.587 1.00 59.16  ? 200 GLN D CD  1 
ATOM   6270  O OE1 . GLN D  2 204 ? -47.057 34.564  -50.007 1.00 60.74  ? 200 GLN D OE1 1 
ATOM   6271  N NE2 . GLN D  2 204 ? -45.894 33.685  -48.292 1.00 58.67  ? 200 GLN D NE2 1 
ATOM   6272  N N   . VAL D  2 205 ? -42.774 30.663  -51.533 1.00 57.57  ? 201 VAL D N   1 
ATOM   6273  C CA  . VAL D  2 205 ? -41.540 30.280  -50.848 1.00 56.28  ? 201 VAL D CA  1 
ATOM   6274  C C   . VAL D  2 205 ? -40.763 31.475  -50.306 1.00 56.43  ? 201 VAL D C   1 
ATOM   6275  O O   . VAL D  2 205 ? -40.442 32.403  -51.051 1.00 56.27  ? 201 VAL D O   1 
ATOM   6276  C CB  . VAL D  2 205 ? -40.589 29.517  -51.796 1.00 53.99  ? 201 VAL D CB  1 
ATOM   6277  C CG1 . VAL D  2 205 ? -39.354 29.058  -51.028 1.00 54.14  ? 201 VAL D CG1 1 
ATOM   6278  C CG2 . VAL D  2 205 ? -41.308 28.338  -52.432 1.00 51.62  ? 201 VAL D CG2 1 
ATOM   6279  N N   . GLU D  2 206 ? -40.455 31.443  -49.013 1.00 56.31  ? 202 GLU D N   1 
ATOM   6280  C CA  . GLU D  2 206 ? -39.684 32.505  -48.383 1.00 58.50  ? 202 GLU D CA  1 
ATOM   6281  C C   . GLU D  2 206 ? -38.283 31.977  -48.077 1.00 58.82  ? 202 GLU D C   1 
ATOM   6282  O O   . GLU D  2 206 ? -38.124 30.895  -47.511 1.00 58.46  ? 202 GLU D O   1 
ATOM   6283  C CB  . GLU D  2 206 ? -40.396 32.992  -47.119 1.00 60.25  ? 202 GLU D CB  1 
ATOM   6284  C CG  . GLU D  2 206 ? -41.670 33.773  -47.452 1.00 65.23  ? 202 GLU D CG  1 
ATOM   6285  C CD  . GLU D  2 206 ? -42.452 34.219  -46.229 1.00 68.42  ? 202 GLU D CD  1 
ATOM   6286  O OE1 . GLU D  2 206 ? -43.005 33.350  -45.515 1.00 71.46  ? 202 GLU D OE1 1 
ATOM   6287  O OE2 . GLU D  2 206 ? -42.518 35.443  -45.982 1.00 69.21  ? 202 GLU D OE2 1 
ATOM   6288  N N   . HIS D  2 207 ? -37.267 32.737  -48.474 1.00 59.26  ? 203 HIS D N   1 
ATOM   6289  C CA  . HIS D  2 207 ? -35.883 32.323  -48.278 1.00 60.26  ? 203 HIS D CA  1 
ATOM   6290  C C   . HIS D  2 207 ? -34.970 33.542  -48.149 1.00 61.23  ? 203 HIS D C   1 
ATOM   6291  O O   . HIS D  2 207 ? -35.096 34.507  -48.901 1.00 60.80  ? 203 HIS D O   1 
ATOM   6292  C CB  . HIS D  2 207 ? -35.448 31.443  -49.457 1.00 59.31  ? 203 HIS D CB  1 
ATOM   6293  C CG  . HIS D  2 207 ? -34.119 30.784  -49.267 1.00 60.46  ? 203 HIS D CG  1 
ATOM   6294  N ND1 . HIS D  2 207 ? -32.935 31.362  -49.671 1.00 61.68  ? 203 HIS D ND1 1 
ATOM   6295  C CD2 . HIS D  2 207 ? -33.784 29.604  -48.691 1.00 60.94  ? 203 HIS D CD2 1 
ATOM   6296  C CE1 . HIS D  2 207 ? -31.927 30.567  -49.351 1.00 60.57  ? 203 HIS D CE1 1 
ATOM   6297  N NE2 . HIS D  2 207 ? -32.415 29.495  -48.756 1.00 60.28  ? 203 HIS D NE2 1 
ATOM   6298  N N   . PRO D  2 208 ? -34.029 33.505  -47.193 1.00 62.01  ? 204 PRO D N   1 
ATOM   6299  C CA  . PRO D  2 208 ? -33.084 34.600  -46.944 1.00 62.45  ? 204 PRO D CA  1 
ATOM   6300  C C   . PRO D  2 208 ? -32.336 35.122  -48.165 1.00 62.36  ? 204 PRO D C   1 
ATOM   6301  O O   . PRO D  2 208 ? -31.760 36.204  -48.123 1.00 62.66  ? 204 PRO D O   1 
ATOM   6302  C CB  . PRO D  2 208 ? -32.148 34.015  -45.883 1.00 62.73  ? 204 PRO D CB  1 
ATOM   6303  C CG  . PRO D  2 208 ? -32.199 32.546  -46.159 1.00 63.21  ? 204 PRO D CG  1 
ATOM   6304  C CD  . PRO D  2 208 ? -33.668 32.321  -46.396 1.00 62.33  ? 204 PRO D CD  1 
ATOM   6305  N N   . SER D  2 209 ? -32.349 34.361  -49.249 1.00 62.58  ? 205 SER D N   1 
ATOM   6306  C CA  . SER D  2 209 ? -31.672 34.780  -50.465 1.00 63.76  ? 205 SER D CA  1 
ATOM   6307  C C   . SER D  2 209 ? -32.618 35.592  -51.342 1.00 65.89  ? 205 SER D C   1 
ATOM   6308  O O   . SER D  2 209 ? -32.219 36.111  -52.385 1.00 65.26  ? 205 SER D O   1 
ATOM   6309  C CB  . SER D  2 209 ? -31.188 33.562  -51.249 1.00 62.63  ? 205 SER D CB  1 
ATOM   6310  O OG  . SER D  2 209 ? -32.285 32.853  -51.796 1.00 61.86  ? 205 SER D OG  1 
ATOM   6311  N N   . LEU D  2 210 ? -33.873 35.697  -50.913 1.00 68.26  ? 206 LEU D N   1 
ATOM   6312  C CA  . LEU D  2 210 ? -34.895 36.428  -51.661 1.00 71.01  ? 206 LEU D CA  1 
ATOM   6313  C C   . LEU D  2 210 ? -35.342 37.695  -50.936 1.00 72.71  ? 206 LEU D C   1 
ATOM   6314  O O   . LEU D  2 210 ? -35.799 37.637  -49.791 1.00 73.14  ? 206 LEU D O   1 
ATOM   6315  C CB  . LEU D  2 210 ? -36.112 35.529  -51.891 1.00 70.89  ? 206 LEU D CB  1 
ATOM   6316  C CG  . LEU D  2 210 ? -35.891 34.225  -52.660 1.00 72.02  ? 206 LEU D CG  1 
ATOM   6317  C CD1 . LEU D  2 210 ? -37.040 33.269  -52.391 1.00 71.60  ? 206 LEU D CD1 1 
ATOM   6318  C CD2 . LEU D  2 210 ? -35.760 34.520  -54.145 1.00 72.24  ? 206 LEU D CD2 1 
ATOM   6319  N N   . THR D  2 211 ? -35.216 38.837  -51.608 1.00 73.98  ? 207 THR D N   1 
ATOM   6320  C CA  . THR D  2 211 ? -35.617 40.111  -51.021 1.00 75.62  ? 207 THR D CA  1 
ATOM   6321  C C   . THR D  2 211 ? -37.083 40.012  -50.635 1.00 75.17  ? 207 THR D C   1 
ATOM   6322  O O   . THR D  2 211 ? -37.501 40.510  -49.589 1.00 75.95  ? 207 THR D O   1 
ATOM   6323  C CB  . THR D  2 211 ? -35.459 41.266  -52.024 1.00 76.64  ? 207 THR D CB  1 
ATOM   6324  O OG1 . THR D  2 211 ? -36.369 41.077  -53.116 1.00 78.91  ? 207 THR D OG1 1 
ATOM   6325  C CG2 . THR D  2 211 ? -34.034 41.313  -52.561 1.00 76.26  ? 207 THR D CG2 1 
ATOM   6326  N N   . ASP D  2 212 ? -37.855 39.357  -51.495 1.00 74.86  ? 208 ASP D N   1 
ATOM   6327  C CA  . ASP D  2 212 ? -39.282 39.169  -51.268 1.00 74.48  ? 208 ASP D CA  1 
ATOM   6328  C C   . ASP D  2 212 ? -39.728 37.776  -51.728 1.00 71.95  ? 208 ASP D C   1 
ATOM   6329  O O   . ASP D  2 212 ? -39.157 37.204  -52.659 1.00 70.42  ? 208 ASP D O   1 
ATOM   6330  C CB  . ASP D  2 212 ? -40.090 40.240  -52.019 1.00 76.07  ? 208 ASP D CB  1 
ATOM   6331  C CG  . ASP D  2 212 ? -39.772 41.659  -51.555 1.00 77.39  ? 208 ASP D CG  1 
ATOM   6332  O OD1 . ASP D  2 212 ? -39.919 41.948  -50.345 1.00 77.60  ? 208 ASP D OD1 1 
ATOM   6333  O OD2 . ASP D  2 212 ? -39.383 42.489  -52.408 1.00 77.39  ? 208 ASP D OD2 1 
ATOM   6334  N N   . PRO D  2 213 ? -40.764 37.220  -51.077 1.00 70.66  ? 209 PRO D N   1 
ATOM   6335  C CA  . PRO D  2 213 ? -41.333 35.899  -51.372 1.00 69.58  ? 209 PRO D CA  1 
ATOM   6336  C C   . PRO D  2 213 ? -41.568 35.601  -52.852 1.00 67.45  ? 209 PRO D C   1 
ATOM   6337  O O   . PRO D  2 213 ? -42.029 36.462  -53.604 1.00 67.34  ? 209 PRO D O   1 
ATOM   6338  C CB  . PRO D  2 213 ? -42.637 35.910  -50.582 1.00 69.41  ? 209 PRO D CB  1 
ATOM   6339  C CG  . PRO D  2 213 ? -42.265 36.694  -49.367 1.00 70.74  ? 209 PRO D CG  1 
ATOM   6340  C CD  . PRO D  2 213 ? -41.474 37.849  -49.946 1.00 70.55  ? 209 PRO D CD  1 
ATOM   6341  N N   . VAL D  2 214 ? -41.244 34.376  -53.259 1.00 65.22  ? 210 VAL D N   1 
ATOM   6342  C CA  . VAL D  2 214 ? -41.438 33.933  -54.638 1.00 65.13  ? 210 VAL D CA  1 
ATOM   6343  C C   . VAL D  2 214 ? -42.741 33.148  -54.708 1.00 64.73  ? 210 VAL D C   1 
ATOM   6344  O O   . VAL D  2 214 ? -43.089 32.437  -53.765 1.00 65.47  ? 210 VAL D O   1 
ATOM   6345  C CB  . VAL D  2 214 ? -40.308 32.999  -55.105 1.00 64.29  ? 210 VAL D CB  1 
ATOM   6346  C CG1 . VAL D  2 214 ? -40.618 32.464  -56.493 1.00 63.19  ? 210 VAL D CG1 1 
ATOM   6347  C CG2 . VAL D  2 214 ? -38.989 33.744  -55.110 1.00 66.37  ? 210 VAL D CG2 1 
ATOM   6348  N N   . THR D  2 215 ? -43.462 33.270  -55.816 1.00 63.72  ? 211 THR D N   1 
ATOM   6349  C CA  . THR D  2 215 ? -44.719 32.550  -55.959 1.00 63.76  ? 211 THR D CA  1 
ATOM   6350  C C   . THR D  2 215 ? -44.875 31.935  -57.336 1.00 62.83  ? 211 THR D C   1 
ATOM   6351  O O   . THR D  2 215 ? -44.586 32.568  -58.348 1.00 62.94  ? 211 THR D O   1 
ATOM   6352  C CB  . THR D  2 215 ? -45.942 33.466  -55.713 1.00 63.40  ? 211 THR D CB  1 
ATOM   6353  O OG1 . THR D  2 215 ? -45.986 34.486  -56.720 1.00 64.82  ? 211 THR D OG1 1 
ATOM   6354  C CG2 . THR D  2 215 ? -45.866 34.114  -54.338 1.00 62.11  ? 211 THR D CG2 1 
ATOM   6355  N N   . VAL D  2 216 ? -45.313 30.684  -57.364 1.00 63.04  ? 212 VAL D N   1 
ATOM   6356  C CA  . VAL D  2 216 ? -45.559 29.995  -58.619 1.00 63.98  ? 212 VAL D CA  1 
ATOM   6357  C C   . VAL D  2 216 ? -47.051 29.677  -58.628 1.00 65.54  ? 212 VAL D C   1 
ATOM   6358  O O   . VAL D  2 216 ? -47.625 29.321  -57.597 1.00 65.91  ? 212 VAL D O   1 
ATOM   6359  C CB  . VAL D  2 216 ? -44.734 28.699  -58.740 1.00 61.77  ? 212 VAL D CB  1 
ATOM   6360  C CG1 . VAL D  2 216 ? -45.159 27.917  -59.976 1.00 58.74  ? 212 VAL D CG1 1 
ATOM   6361  C CG2 . VAL D  2 216 ? -43.257 29.042  -58.835 1.00 61.25  ? 212 VAL D CG2 1 
ATOM   6362  N N   . GLU D  2 217 ? -47.679 29.829  -59.786 1.00 66.76  ? 213 GLU D N   1 
ATOM   6363  C CA  . GLU D  2 217 ? -49.104 29.586  -59.904 1.00 68.49  ? 213 GLU D CA  1 
ATOM   6364  C C   . GLU D  2 217 ? -49.348 28.349  -60.758 1.00 68.07  ? 213 GLU D C   1 
ATOM   6365  O O   . GLU D  2 217 ? -48.583 28.060  -61.680 1.00 66.51  ? 213 GLU D O   1 
ATOM   6366  C CB  . GLU D  2 217 ? -49.775 30.815  -60.530 1.00 69.62  ? 213 GLU D CB  1 
ATOM   6367  C CG  . GLU D  2 217 ? -51.292 30.889  -60.371 1.00 73.17  ? 213 GLU D CG  1 
ATOM   6368  C CD  . GLU D  2 217 ? -51.892 32.150  -60.994 1.00 74.33  ? 213 GLU D CD  1 
ATOM   6369  O OE1 . GLU D  2 217 ? -51.705 32.362  -62.214 1.00 75.20  ? 213 GLU D OE1 1 
ATOM   6370  O OE2 . GLU D  2 217 ? -52.553 32.926  -60.266 1.00 74.04  ? 213 GLU D OE2 1 
ATOM   6371  N N   . TRP D  2 218 ? -50.405 27.612  -60.430 1.00 68.19  ? 214 TRP D N   1 
ATOM   6372  C CA  . TRP D  2 218 ? -50.764 26.410  -61.175 1.00 68.92  ? 214 TRP D CA  1 
ATOM   6373  C C   . TRP D  2 218 ? -52.279 26.186  -61.208 1.00 69.61  ? 214 TRP D C   1 
ATOM   6374  O O   . TRP D  2 218 ? -52.929 26.125  -60.166 1.00 69.03  ? 214 TRP D O   1 
ATOM   6375  C CB  . TRP D  2 218 ? -50.089 25.184  -60.561 1.00 65.76  ? 214 TRP D CB  1 
ATOM   6376  C CG  . TRP D  2 218 ? -50.386 23.916  -61.303 1.00 62.70  ? 214 TRP D CG  1 
ATOM   6377  C CD1 . TRP D  2 218 ? -49.641 23.352  -62.295 1.00 61.49  ? 214 TRP D CD1 1 
ATOM   6378  C CD2 . TRP D  2 218 ? -51.533 23.073  -61.135 1.00 61.26  ? 214 TRP D CD2 1 
ATOM   6379  N NE1 . TRP D  2 218 ? -50.250 22.209  -62.758 1.00 59.65  ? 214 TRP D NE1 1 
ATOM   6380  C CE2 . TRP D  2 218 ? -51.414 22.016  -62.062 1.00 60.77  ? 214 TRP D CE2 1 
ATOM   6381  C CE3 . TRP D  2 218 ? -52.653 23.111  -60.292 1.00 60.66  ? 214 TRP D CE3 1 
ATOM   6382  C CZ2 . TRP D  2 218 ? -52.374 21.003  -62.170 1.00 60.24  ? 214 TRP D CZ2 1 
ATOM   6383  C CZ3 . TRP D  2 218 ? -53.606 22.103  -60.400 1.00 59.39  ? 214 TRP D CZ3 1 
ATOM   6384  C CH2 . TRP D  2 218 ? -53.458 21.065  -61.333 1.00 59.03  ? 214 TRP D CH2 1 
ATOM   6385  N N   . LYS D  2 219 ? -52.827 26.063  -62.414 1.00 71.99  ? 215 LYS D N   1 
ATOM   6386  C CA  . LYS D  2 219 ? -54.255 25.819  -62.611 1.00 75.17  ? 215 LYS D CA  1 
ATOM   6387  C C   . LYS D  2 219 ? -54.393 24.563  -63.463 1.00 75.32  ? 215 LYS D C   1 
ATOM   6388  O O   . LYS D  2 219 ? -53.476 24.213  -64.203 1.00 74.09  ? 215 LYS D O   1 
ATOM   6389  C CB  . LYS D  2 219 ? -54.912 26.996  -63.335 1.00 75.77  ? 215 LYS D CB  1 
ATOM   6390  C CG  . LYS D  2 219 ? -54.790 28.332  -62.615 1.00 77.94  ? 215 LYS D CG  1 
ATOM   6391  C CD  . LYS D  2 219 ? -55.374 29.465  -63.456 1.00 79.20  ? 215 LYS D CD  1 
ATOM   6392  C CE  . LYS D  2 219 ? -55.016 30.829  -62.882 1.00 79.72  ? 215 LYS D CE  1 
ATOM   6393  N NZ  . LYS D  2 219 ? -55.550 31.952  -63.705 1.00 79.13  ? 215 LYS D NZ  1 
ATOM   6394  N N   . ALA D  2 220 ? -55.531 23.883  -63.358 1.00 76.96  ? 216 ALA D N   1 
ATOM   6395  C CA  . ALA D  2 220 ? -55.756 22.671  -64.141 1.00 79.35  ? 216 ALA D CA  1 
ATOM   6396  C C   . ALA D  2 220 ? -56.320 23.015  -65.525 1.00 79.91  ? 216 ALA D C   1 
ATOM   6397  O O   . ALA D  2 220 ? -56.906 24.111  -65.656 1.00 81.10  ? 216 ALA D O   1 
ATOM   6398  C CB  . ALA D  2 220 ? -56.715 21.747  -63.396 1.00 79.06  ? 216 ALA D CB  1 
ATOM   6399  N N   . ILE E  1 1   ? 36.649  34.601  -30.979 1.00 90.20  ? 1   ILE E N   1 
ATOM   6400  C CA  . ILE E  1 1   ? 36.583  35.628  -32.066 1.00 90.38  ? 1   ILE E CA  1 
ATOM   6401  C C   . ILE E  1 1   ? 35.134  35.825  -32.523 1.00 89.51  ? 1   ILE E C   1 
ATOM   6402  O O   . ILE E  1 1   ? 34.573  36.916  -32.376 1.00 90.26  ? 1   ILE E O   1 
ATOM   6403  C CB  . ILE E  1 1   ? 37.449  35.211  -33.283 1.00 90.86  ? 1   ILE E CB  1 
ATOM   6404  C CG1 . ILE E  1 1   ? 38.850  34.792  -32.815 1.00 91.67  ? 1   ILE E CG1 1 
ATOM   6405  C CG2 . ILE E  1 1   ? 37.555  36.371  -34.271 1.00 91.16  ? 1   ILE E CG2 1 
ATOM   6406  C CD1 . ILE E  1 1   ? 39.631  35.889  -32.103 1.00 92.17  ? 1   ILE E CD1 1 
ATOM   6407  N N   . LYS E  1 2   ? 34.537  34.771  -33.082 1.00 87.04  ? 2   LYS E N   1 
ATOM   6408  C CA  . LYS E  1 2   ? 33.148  34.826  -33.538 1.00 83.84  ? 2   LYS E CA  1 
ATOM   6409  C C   . LYS E  1 2   ? 32.263  33.920  -32.696 1.00 80.61  ? 2   LYS E C   1 
ATOM   6410  O O   . LYS E  1 2   ? 32.688  32.848  -32.257 1.00 80.69  ? 2   LYS E O   1 
ATOM   6411  C CB  . LYS E  1 2   ? 33.030  34.415  -35.012 1.00 85.48  ? 2   LYS E CB  1 
ATOM   6412  C CG  . LYS E  1 2   ? 33.302  35.532  -36.016 1.00 86.89  ? 2   LYS E CG  1 
ATOM   6413  C CD  . LYS E  1 2   ? 34.776  35.928  -36.053 1.00 88.64  ? 2   LYS E CD  1 
ATOM   6414  C CE  . LYS E  1 2   ? 35.668  34.772  -36.524 1.00 88.45  ? 2   LYS E CE  1 
ATOM   6415  N NZ  . LYS E  1 2   ? 35.380  34.338  -37.926 1.00 87.41  ? 2   LYS E NZ  1 
ATOM   6416  N N   . GLU E  1 3   ? 31.031  34.364  -32.469 1.00 75.65  ? 3   GLU E N   1 
ATOM   6417  C CA  . GLU E  1 3   ? 30.077  33.596  -31.687 1.00 70.84  ? 3   GLU E CA  1 
ATOM   6418  C C   . GLU E  1 3   ? 29.481  32.468  -32.526 1.00 65.19  ? 3   GLU E C   1 
ATOM   6419  O O   . GLU E  1 3   ? 28.415  32.609  -33.112 1.00 63.15  ? 3   GLU E O   1 
ATOM   6420  C CB  . GLU E  1 3   ? 28.963  34.507  -31.162 1.00 73.50  ? 3   GLU E CB  1 
ATOM   6421  C CG  . GLU E  1 3   ? 29.314  35.231  -29.870 1.00 78.40  ? 3   GLU E CG  1 
ATOM   6422  C CD  . GLU E  1 3   ? 29.568  34.271  -28.707 1.00 81.43  ? 3   GLU E CD  1 
ATOM   6423  O OE1 . GLU E  1 3   ? 28.666  33.468  -28.386 1.00 82.74  ? 3   GLU E OE1 1 
ATOM   6424  O OE2 . GLU E  1 3   ? 30.667  34.319  -28.110 1.00 82.92  ? 3   GLU E OE2 1 
ATOM   6425  N N   . GLU E  1 4   ? 30.186  31.347  -32.585 1.00 59.88  ? 4   GLU E N   1 
ATOM   6426  C CA  . GLU E  1 4   ? 29.714  30.204  -33.350 1.00 54.79  ? 4   GLU E CA  1 
ATOM   6427  C C   . GLU E  1 4   ? 29.080  29.207  -32.393 1.00 50.64  ? 4   GLU E C   1 
ATOM   6428  O O   . GLU E  1 4   ? 29.621  28.913  -31.321 1.00 48.32  ? 4   GLU E O   1 
ATOM   6429  C CB  . GLU E  1 4   ? 30.878  29.573  -34.123 1.00 55.74  ? 4   GLU E CB  1 
ATOM   6430  C CG  . GLU E  1 4   ? 31.716  30.612  -34.867 1.00 59.11  ? 4   GLU E CG  1 
ATOM   6431  C CD  . GLU E  1 4   ? 32.716  30.010  -35.827 1.00 61.14  ? 4   GLU E CD  1 
ATOM   6432  O OE1 . GLU E  1 4   ? 33.333  28.979  -35.475 1.00 61.63  ? 4   GLU E OE1 1 
ATOM   6433  O OE2 . GLU E  1 4   ? 32.894  30.581  -36.929 1.00 61.39  ? 4   GLU E OE2 1 
ATOM   6434  N N   . HIS E  1 5   ? 27.909  28.711  -32.767 1.00 46.60  ? 5   HIS E N   1 
ATOM   6435  C CA  . HIS E  1 5   ? 27.200  27.763  -31.922 1.00 44.52  ? 5   HIS E CA  1 
ATOM   6436  C C   . HIS E  1 5   ? 26.337  26.828  -32.749 1.00 41.71  ? 5   HIS E C   1 
ATOM   6437  O O   . HIS E  1 5   ? 26.083  27.062  -33.926 1.00 37.65  ? 5   HIS E O   1 
ATOM   6438  C CB  . HIS E  1 5   ? 26.302  28.505  -30.928 1.00 45.71  ? 5   HIS E CB  1 
ATOM   6439  C CG  . HIS E  1 5   ? 27.045  29.393  -29.981 1.00 47.16  ? 5   HIS E CG  1 
ATOM   6440  N ND1 . HIS E  1 5   ? 27.712  28.910  -28.874 1.00 47.83  ? 5   HIS E ND1 1 
ATOM   6441  C CD2 . HIS E  1 5   ? 27.233  30.736  -29.982 1.00 44.92  ? 5   HIS E CD2 1 
ATOM   6442  C CE1 . HIS E  1 5   ? 28.278  29.918  -28.232 1.00 47.66  ? 5   HIS E CE1 1 
ATOM   6443  N NE2 . HIS E  1 5   ? 28.004  31.035  -28.884 1.00 47.68  ? 5   HIS E NE2 1 
ATOM   6444  N N   . THR E  1 6   ? 25.869  25.776  -32.097 1.00 40.53  ? 6   THR E N   1 
ATOM   6445  C CA  . THR E  1 6   ? 25.027  24.792  -32.740 1.00 40.06  ? 6   THR E CA  1 
ATOM   6446  C C   . THR E  1 6   ? 23.898  24.387  -31.810 1.00 39.59  ? 6   THR E C   1 
ATOM   6447  O O   . THR E  1 6   ? 24.113  24.112  -30.627 1.00 41.80  ? 6   THR E O   1 
ATOM   6448  C CB  . THR E  1 6   ? 25.842  23.542  -33.111 1.00 39.63  ? 6   THR E CB  1 
ATOM   6449  O OG1 . THR E  1 6   ? 26.856  23.907  -34.052 1.00 41.95  ? 6   THR E OG1 1 
ATOM   6450  C CG2 . THR E  1 6   ? 24.955  22.479  -33.731 1.00 39.84  ? 6   THR E CG2 1 
ATOM   6451  N N   . ILE E  1 7   ? 22.686  24.382  -32.344 1.00 37.29  ? 7   ILE E N   1 
ATOM   6452  C CA  . ILE E  1 7   ? 21.531  23.961  -31.574 1.00 37.82  ? 7   ILE E CA  1 
ATOM   6453  C C   . ILE E  1 7   ? 20.990  22.771  -32.343 1.00 35.81  ? 7   ILE E C   1 
ATOM   6454  O O   . ILE E  1 7   ? 20.843  22.837  -33.559 1.00 37.38  ? 7   ILE E O   1 
ATOM   6455  C CB  . ILE E  1 7   ? 20.452  25.058  -31.494 1.00 38.68  ? 7   ILE E CB  1 
ATOM   6456  C CG1 . ILE E  1 7   ? 21.026  26.318  -30.834 1.00 40.85  ? 7   ILE E CG1 1 
ATOM   6457  C CG2 . ILE E  1 7   ? 19.291  24.567  -30.664 1.00 38.30  ? 7   ILE E CG2 1 
ATOM   6458  C CD1 . ILE E  1 7   ? 19.994  27.452  -30.663 1.00 43.55  ? 7   ILE E CD1 1 
ATOM   6459  N N   . ILE E  1 8   ? 20.715  21.675  -31.650 1.00 34.00  ? 8   ILE E N   1 
ATOM   6460  C CA  . ILE E  1 8   ? 20.209  20.488  -32.333 1.00 33.28  ? 8   ILE E CA  1 
ATOM   6461  C C   . ILE E  1 8   ? 18.989  19.865  -31.698 1.00 31.64  ? 8   ILE E C   1 
ATOM   6462  O O   . ILE E  1 8   ? 18.930  19.675  -30.485 1.00 33.23  ? 8   ILE E O   1 
ATOM   6463  C CB  . ILE E  1 8   ? 21.272  19.382  -32.404 1.00 31.98  ? 8   ILE E CB  1 
ATOM   6464  C CG1 . ILE E  1 8   ? 22.554  19.939  -33.033 1.00 34.60  ? 8   ILE E CG1 1 
ATOM   6465  C CG2 . ILE E  1 8   ? 20.722  18.198  -33.184 1.00 29.24  ? 8   ILE E CG2 1 
ATOM   6466  C CD1 . ILE E  1 8   ? 23.704  18.931  -33.125 1.00 33.29  ? 8   ILE E CD1 1 
ATOM   6467  N N   . GLN E  1 9   ? 18.018  19.539  -32.535 1.00 30.73  ? 9   GLN E N   1 
ATOM   6468  C CA  . GLN E  1 9   ? 16.807  18.880  -32.073 1.00 30.05  ? 9   GLN E CA  1 
ATOM   6469  C C   . GLN E  1 9   ? 16.986  17.442  -32.559 1.00 28.46  ? 9   GLN E C   1 
ATOM   6470  O O   . GLN E  1 9   ? 17.088  17.187  -33.763 1.00 28.95  ? 9   GLN E O   1 
ATOM   6471  C CB  . GLN E  1 9   ? 15.553  19.495  -32.719 1.00 31.59  ? 9   GLN E CB  1 
ATOM   6472  C CG  . GLN E  1 9   ? 14.266  18.765  -32.330 1.00 33.30  ? 9   GLN E CG  1 
ATOM   6473  C CD  . GLN E  1 9   ? 13.010  19.376  -32.944 1.00 35.85  ? 9   GLN E CD  1 
ATOM   6474  O OE1 . GLN E  1 9   ? 12.680  20.537  -32.695 1.00 35.65  ? 9   GLN E OE1 1 
ATOM   6475  N NE2 . GLN E  1 9   ? 12.302  18.590  -33.748 1.00 35.99  ? 9   GLN E NE2 1 
ATOM   6476  N N   . ALA E  1 10  ? 17.036  16.504  -31.631 1.00 25.11  ? 10  ALA E N   1 
ATOM   6477  C CA  . ALA E  1 10  ? 17.226  15.110  -31.998 1.00 27.94  ? 10  ALA E CA  1 
ATOM   6478  C C   . ALA E  1 10  ? 16.054  14.283  -31.504 1.00 28.41  ? 10  ALA E C   1 
ATOM   6479  O O   . ALA E  1 10  ? 15.652  14.386  -30.346 1.00 29.49  ? 10  ALA E O   1 
ATOM   6480  C CB  . ALA E  1 10  ? 18.543  14.582  -31.398 1.00 28.48  ? 10  ALA E CB  1 
ATOM   6481  N N   . GLN E  1 11  ? 15.512  13.451  -32.380 1.00 29.02  ? 11  GLN E N   1 
ATOM   6482  C CA  . GLN E  1 11  ? 14.366  12.636  -32.017 1.00 29.64  ? 11  GLN E CA  1 
ATOM   6483  C C   . GLN E  1 11  ? 14.377  11.319  -32.771 1.00 29.48  ? 11  GLN E C   1 
ATOM   6484  O O   . GLN E  1 11  ? 14.908  11.221  -33.879 1.00 28.41  ? 11  GLN E O   1 
ATOM   6485  C CB  . GLN E  1 11  ? 13.078  13.393  -32.340 1.00 31.01  ? 11  GLN E CB  1 
ATOM   6486  C CG  . GLN E  1 11  ? 12.868  13.626  -33.833 1.00 36.79  ? 11  GLN E CG  1 
ATOM   6487  C CD  . GLN E  1 11  ? 11.810  14.675  -34.107 1.00 41.26  ? 11  GLN E CD  1 
ATOM   6488  O OE1 . GLN E  1 11  ? 12.027  15.860  -33.872 1.00 45.63  ? 11  GLN E OE1 1 
ATOM   6489  N NE2 . GLN E  1 11  ? 10.654  14.243  -34.589 1.00 42.63  ? 11  GLN E NE2 1 
ATOM   6490  N N   . PHE E  1 12  ? 13.780  10.301  -32.170 1.00 29.43  ? 12  PHE E N   1 
ATOM   6491  C CA  . PHE E  1 12  ? 13.721  9.009   -32.816 1.00 28.26  ? 12  PHE E CA  1 
ATOM   6492  C C   . PHE E  1 12  ? 12.649  8.150   -32.214 1.00 28.32  ? 12  PHE E C   1 
ATOM   6493  O O   . PHE E  1 12  ? 12.092  8.474   -31.161 1.00 26.80  ? 12  PHE E O   1 
ATOM   6494  C CB  . PHE E  1 12  ? 15.060  8.277   -32.680 1.00 29.00  ? 12  PHE E CB  1 
ATOM   6495  C CG  . PHE E  1 12  ? 15.394  7.862   -31.269 1.00 27.46  ? 12  PHE E CG  1 
ATOM   6496  C CD1 . PHE E  1 12  ? 14.803  6.744   -30.701 1.00 27.63  ? 12  PHE E CD1 1 
ATOM   6497  C CD2 . PHE E  1 12  ? 16.307  8.594   -30.512 1.00 29.91  ? 12  PHE E CD2 1 
ATOM   6498  C CE1 . PHE E  1 12  ? 15.115  6.355   -29.399 1.00 29.70  ? 12  PHE E CE1 1 
ATOM   6499  C CE2 . PHE E  1 12  ? 16.633  8.220   -29.208 1.00 29.69  ? 12  PHE E CE2 1 
ATOM   6500  C CZ  . PHE E  1 12  ? 16.037  7.099   -28.647 1.00 31.76  ? 12  PHE E CZ  1 
ATOM   6501  N N   . TYR E  1 13  ? 12.378  7.048   -32.907 1.00 28.29  ? 13  TYR E N   1 
ATOM   6502  C CA  . TYR E  1 13  ? 11.438  6.051   -32.454 1.00 28.01  ? 13  TYR E CA  1 
ATOM   6503  C C   . TYR E  1 13  ? 12.099  4.719   -32.779 1.00 27.62  ? 13  TYR E C   1 
ATOM   6504  O O   . TYR E  1 13  ? 12.607  4.521   -33.877 1.00 27.40  ? 13  TYR E O   1 
ATOM   6505  C CB  . TYR E  1 13  ? 10.103  6.166   -33.171 1.00 30.44  ? 13  TYR E CB  1 
ATOM   6506  C CG  . TYR E  1 13  ? 9.085   5.250   -32.555 1.00 33.35  ? 13  TYR E CG  1 
ATOM   6507  C CD1 . TYR E  1 13  ? 8.630   5.473   -31.264 1.00 34.08  ? 13  TYR E CD1 1 
ATOM   6508  C CD2 . TYR E  1 13  ? 8.616   4.132   -33.237 1.00 33.73  ? 13  TYR E CD2 1 
ATOM   6509  C CE1 . TYR E  1 13  ? 7.736   4.612   -30.657 1.00 36.83  ? 13  TYR E CE1 1 
ATOM   6510  C CE2 . TYR E  1 13  ? 7.710   3.258   -32.637 1.00 38.35  ? 13  TYR E CE2 1 
ATOM   6511  C CZ  . TYR E  1 13  ? 7.276   3.509   -31.346 1.00 37.70  ? 13  TYR E CZ  1 
ATOM   6512  O OH  . TYR E  1 13  ? 6.365   2.682   -30.744 1.00 40.78  ? 13  TYR E OH  1 
ATOM   6513  N N   . LEU E  1 14  ? 12.085  3.800   -31.826 1.00 30.30  ? 14  LEU E N   1 
ATOM   6514  C CA  . LEU E  1 14  ? 12.736  2.510   -32.012 1.00 31.63  ? 14  LEU E CA  1 
ATOM   6515  C C   . LEU E  1 14  ? 11.855  1.275   -31.861 1.00 32.74  ? 14  LEU E C   1 
ATOM   6516  O O   . LEU E  1 14  ? 11.070  1.162   -30.914 1.00 33.56  ? 14  LEU E O   1 
ATOM   6517  C CB  . LEU E  1 14  ? 13.904  2.406   -31.027 1.00 29.94  ? 14  LEU E CB  1 
ATOM   6518  C CG  . LEU E  1 14  ? 14.622  1.067   -30.941 1.00 28.86  ? 14  LEU E CG  1 
ATOM   6519  C CD1 . LEU E  1 14  ? 15.315  0.767   -32.261 1.00 25.92  ? 14  LEU E CD1 1 
ATOM   6520  C CD2 . LEU E  1 14  ? 15.634  1.117   -29.802 1.00 29.26  ? 14  LEU E CD2 1 
ATOM   6521  N N   . LEU E  1 15  ? 12.007  0.342   -32.797 1.00 34.70  ? 15  LEU E N   1 
ATOM   6522  C CA  . LEU E  1 15  ? 11.275  -0.924  -32.771 1.00 35.18  ? 15  LEU E CA  1 
ATOM   6523  C C   . LEU E  1 15  ? 12.306  -2.034  -32.807 1.00 35.13  ? 15  LEU E C   1 
ATOM   6524  O O   . LEU E  1 15  ? 13.372  -1.867  -33.400 1.00 35.54  ? 15  LEU E O   1 
ATOM   6525  C CB  . LEU E  1 15  ? 10.345  -1.048  -33.980 1.00 33.79  ? 15  LEU E CB  1 
ATOM   6526  C CG  . LEU E  1 15  ? 9.075   -0.209  -33.914 1.00 35.17  ? 15  LEU E CG  1 
ATOM   6527  C CD1 . LEU E  1 15  ? 8.269   -0.402  -35.183 1.00 35.22  ? 15  LEU E CD1 1 
ATOM   6528  C CD2 . LEU E  1 15  ? 8.273   -0.621  -32.688 1.00 34.36  ? 15  LEU E CD2 1 
ATOM   6529  N N   . PRO E  1 16  ? 11.979  -3.207  -32.238 1.00 36.83  ? 16  PRO E N   1 
ATOM   6530  C CA  . PRO E  1 16  ? 10.709  -3.536  -31.585 1.00 38.59  ? 16  PRO E CA  1 
ATOM   6531  C C   . PRO E  1 16  ? 10.503  -3.018  -30.174 1.00 39.73  ? 16  PRO E C   1 
ATOM   6532  O O   . PRO E  1 16  ? 9.462   -3.272  -29.586 1.00 42.02  ? 16  PRO E O   1 
ATOM   6533  C CB  . PRO E  1 16  ? 10.700  -5.056  -31.623 1.00 38.03  ? 16  PRO E CB  1 
ATOM   6534  C CG  . PRO E  1 16  ? 12.130  -5.369  -31.358 1.00 36.82  ? 16  PRO E CG  1 
ATOM   6535  C CD  . PRO E  1 16  ? 12.855  -4.393  -32.276 1.00 36.71  ? 16  PRO E CD  1 
ATOM   6536  N N   . ASP E  1 17  ? 11.467  -2.284  -29.628 1.00 42.09  ? 17  ASP E N   1 
ATOM   6537  C CA  . ASP E  1 17  ? 11.340  -1.774  -28.258 1.00 42.76  ? 17  ASP E CA  1 
ATOM   6538  C C   . ASP E  1 17  ? 10.178  -0.815  -28.019 1.00 43.59  ? 17  ASP E C   1 
ATOM   6539  O O   . ASP E  1 17  ? 9.641   -0.754  -26.910 1.00 43.99  ? 17  ASP E O   1 
ATOM   6540  C CB  . ASP E  1 17  ? 12.627  -1.078  -27.832 1.00 43.57  ? 17  ASP E CB  1 
ATOM   6541  C CG  . ASP E  1 17  ? 13.830  -1.956  -27.990 1.00 47.38  ? 17  ASP E CG  1 
ATOM   6542  O OD1 . ASP E  1 17  ? 14.061  -2.434  -29.117 1.00 50.07  ? 17  ASP E OD1 1 
ATOM   6543  O OD2 . ASP E  1 17  ? 14.548  -2.170  -26.992 1.00 51.35  ? 17  ASP E OD2 1 
ATOM   6544  N N   . LYS E  1 18  ? 9.808   -0.051  -29.046 1.00 43.83  ? 18  LYS E N   1 
ATOM   6545  C CA  . LYS E  1 18  ? 8.724   0.930   -28.930 1.00 45.40  ? 18  LYS E CA  1 
ATOM   6546  C C   . LYS E  1 18  ? 9.179   2.078   -28.032 1.00 45.66  ? 18  LYS E C   1 
ATOM   6547  O O   . LYS E  1 18  ? 8.411   2.591   -27.209 1.00 46.17  ? 18  LYS E O   1 
ATOM   6548  C CB  . LYS E  1 18  ? 7.461   0.269   -28.363 1.00 44.16  ? 18  LYS E CB  1 
ATOM   6549  C CG  . LYS E  1 18  ? 6.945   -0.857  -29.245 1.00 48.16  ? 18  LYS E CG  1 
ATOM   6550  C CD  . LYS E  1 18  ? 5.789   -1.628  -28.633 1.00 51.25  ? 18  LYS E CD  1 
ATOM   6551  C CE  . LYS E  1 18  ? 4.636   -0.718  -28.208 1.00 52.71  ? 18  LYS E CE  1 
ATOM   6552  N NZ  . LYS E  1 18  ? 4.808   -0.201  -26.816 1.00 53.36  ? 18  LYS E NZ  1 
ATOM   6553  N N   . ARG E  1 19  ? 10.443  2.465   -28.207 1.00 44.94  ? 19  ARG E N   1 
ATOM   6554  C CA  . ARG E  1 19  ? 11.067  3.546   -27.446 1.00 44.88  ? 19  ARG E CA  1 
ATOM   6555  C C   . ARG E  1 19  ? 11.176  4.816   -28.284 1.00 42.13  ? 19  ARG E C   1 
ATOM   6556  O O   . ARG E  1 19  ? 11.469  4.772   -29.482 1.00 42.07  ? 19  ARG E O   1 
ATOM   6557  C CB  . ARG E  1 19  ? 12.467  3.125   -26.981 1.00 49.06  ? 19  ARG E CB  1 
ATOM   6558  C CG  . ARG E  1 19  ? 12.474  2.134   -25.839 1.00 54.37  ? 19  ARG E CG  1 
ATOM   6559  C CD  . ARG E  1 19  ? 12.086  2.818   -24.544 1.00 60.74  ? 19  ARG E CD  1 
ATOM   6560  N NE  . ARG E  1 19  ? 11.998  1.877   -23.427 1.00 67.97  ? 19  ARG E NE  1 
ATOM   6561  C CZ  . ARG E  1 19  ? 13.008  1.131   -22.978 1.00 70.38  ? 19  ARG E CZ  1 
ATOM   6562  N NH1 . ARG E  1 19  ? 14.212  1.203   -23.545 1.00 71.05  ? 19  ARG E NH1 1 
ATOM   6563  N NH2 . ARG E  1 19  ? 12.808  0.306   -21.957 1.00 71.62  ? 19  ARG E NH2 1 
ATOM   6564  N N   . GLY E  1 20  ? 10.949  5.954   -27.649 1.00 38.80  ? 20  GLY E N   1 
ATOM   6565  C CA  . GLY E  1 20  ? 11.026  7.205   -28.367 1.00 37.55  ? 20  GLY E CA  1 
ATOM   6566  C C   . GLY E  1 20  ? 11.644  8.287   -27.511 1.00 37.44  ? 20  GLY E C   1 
ATOM   6567  O O   . GLY E  1 20  ? 11.519  8.259   -26.283 1.00 36.29  ? 20  GLY E O   1 
ATOM   6568  N N   . GLU E  1 21  ? 12.325  9.234   -28.152 1.00 34.18  ? 21  GLU E N   1 
ATOM   6569  C CA  . GLU E  1 21  ? 12.939  10.322  -27.424 1.00 34.15  ? 21  GLU E CA  1 
ATOM   6570  C C   . GLU E  1 21  ? 12.970  11.609  -28.230 1.00 32.28  ? 21  GLU E C   1 
ATOM   6571  O O   . GLU E  1 21  ? 13.023  11.599  -29.465 1.00 31.25  ? 21  GLU E O   1 
ATOM   6572  C CB  . GLU E  1 21  ? 14.354  9.934   -26.971 1.00 37.07  ? 21  GLU E CB  1 
ATOM   6573  C CG  . GLU E  1 21  ? 14.354  8.843   -25.888 1.00 41.73  ? 21  GLU E CG  1 
ATOM   6574  C CD  . GLU E  1 21  ? 15.686  8.718   -25.136 1.00 44.28  ? 21  GLU E CD  1 
ATOM   6575  O OE1 . GLU E  1 21  ? 15.731  7.969   -24.129 1.00 43.01  ? 21  GLU E OE1 1 
ATOM   6576  O OE2 . GLU E  1 21  ? 16.679  9.362   -25.553 1.00 43.32  ? 21  GLU E OE2 1 
ATOM   6577  N N   . PHE E  1 22  ? 12.926  12.720  -27.514 1.00 29.04  ? 22  PHE E N   1 
ATOM   6578  C CA  . PHE E  1 22  ? 12.947  14.020  -28.137 1.00 29.32  ? 22  PHE E CA  1 
ATOM   6579  C C   . PHE E  1 22  ? 13.867  14.872  -27.278 1.00 30.32  ? 22  PHE E C   1 
ATOM   6580  O O   . PHE E  1 22  ? 13.697  14.915  -26.063 1.00 29.95  ? 22  PHE E O   1 
ATOM   6581  C CB  . PHE E  1 22  ? 11.530  14.619  -28.135 1.00 27.62  ? 22  PHE E CB  1 
ATOM   6582  C CG  . PHE E  1 22  ? 11.435  15.952  -28.811 1.00 24.99  ? 22  PHE E CG  1 
ATOM   6583  C CD1 . PHE E  1 22  ? 11.059  16.044  -30.147 1.00 23.16  ? 22  PHE E CD1 1 
ATOM   6584  C CD2 . PHE E  1 22  ? 11.769  17.117  -28.128 1.00 26.82  ? 22  PHE E CD2 1 
ATOM   6585  C CE1 . PHE E  1 22  ? 11.021  17.266  -30.793 1.00 21.29  ? 22  PHE E CE1 1 
ATOM   6586  C CE2 . PHE E  1 22  ? 11.732  18.359  -28.775 1.00 26.41  ? 22  PHE E CE2 1 
ATOM   6587  C CZ  . PHE E  1 22  ? 11.357  18.428  -30.112 1.00 23.34  ? 22  PHE E CZ  1 
ATOM   6588  N N   . MET E  1 23  ? 14.847  15.538  -27.882 1.00 31.93  ? 23  MET E N   1 
ATOM   6589  C CA  . MET E  1 23  ? 15.721  16.386  -27.079 1.00 32.71  ? 23  MET E CA  1 
ATOM   6590  C C   . MET E  1 23  ? 16.418  17.486  -27.846 1.00 32.67  ? 23  MET E C   1 
ATOM   6591  O O   . MET E  1 23  ? 16.543  17.433  -29.074 1.00 31.61  ? 23  MET E O   1 
ATOM   6592  C CB  . MET E  1 23  ? 16.757  15.544  -26.310 1.00 32.14  ? 23  MET E CB  1 
ATOM   6593  C CG  . MET E  1 23  ? 17.853  14.864  -27.143 1.00 34.88  ? 23  MET E CG  1 
ATOM   6594  S SD  . MET E  1 23  ? 19.146  15.958  -27.793 1.00 38.52  ? 23  MET E SD  1 
ATOM   6595  C CE  . MET E  1 23  ? 20.217  16.127  -26.395 1.00 35.70  ? 23  MET E CE  1 
ATOM   6596  N N   . PHE E  1 24  ? 16.854  18.498  -27.103 1.00 32.20  ? 24  PHE E N   1 
ATOM   6597  C CA  . PHE E  1 24  ? 17.565  19.621  -27.685 1.00 34.21  ? 24  PHE E CA  1 
ATOM   6598  C C   . PHE E  1 24  ? 18.985  19.571  -27.195 1.00 34.51  ? 24  PHE E C   1 
ATOM   6599  O O   . PHE E  1 24  ? 19.248  19.120  -26.072 1.00 35.19  ? 24  PHE E O   1 
ATOM   6600  C CB  . PHE E  1 24  ? 16.939  20.942  -27.271 1.00 35.05  ? 24  PHE E CB  1 
ATOM   6601  C CG  . PHE E  1 24  ? 16.007  21.500  -28.281 1.00 36.43  ? 24  PHE E CG  1 
ATOM   6602  C CD1 . PHE E  1 24  ? 14.907  20.767  -28.707 1.00 35.63  ? 24  PHE E CD1 1 
ATOM   6603  C CD2 . PHE E  1 24  ? 16.233  22.754  -28.824 1.00 35.85  ? 24  PHE E CD2 1 
ATOM   6604  C CE1 . PHE E  1 24  ? 14.048  21.275  -29.661 1.00 36.64  ? 24  PHE E CE1 1 
ATOM   6605  C CE2 . PHE E  1 24  ? 15.375  23.273  -29.783 1.00 38.18  ? 24  PHE E CE2 1 
ATOM   6606  C CZ  . PHE E  1 24  ? 14.280  22.529  -30.204 1.00 36.66  ? 24  PHE E CZ  1 
ATOM   6607  N N   . ASP E  1 25  ? 19.887  20.055  -28.037 1.00 33.11  ? 25  ASP E N   1 
ATOM   6608  C CA  . ASP E  1 25  ? 21.307  20.047  -27.750 1.00 34.90  ? 25  ASP E CA  1 
ATOM   6609  C C   . ASP E  1 25  ? 21.912  21.408  -28.064 1.00 35.43  ? 25  ASP E C   1 
ATOM   6610  O O   . ASP E  1 25  ? 21.673  21.982  -29.141 1.00 34.34  ? 25  ASP E O   1 
ATOM   6611  C CB  . ASP E  1 25  ? 21.982  18.957  -28.601 1.00 37.01  ? 25  ASP E CB  1 
ATOM   6612  C CG  . ASP E  1 25  ? 23.510  18.992  -28.529 1.00 41.82  ? 25  ASP E CG  1 
ATOM   6613  O OD1 . ASP E  1 25  ? 24.136  19.974  -29.000 1.00 44.48  ? 25  ASP E OD1 1 
ATOM   6614  O OD2 . ASP E  1 25  ? 24.091  18.020  -28.010 1.00 44.77  ? 25  ASP E OD2 1 
ATOM   6615  N N   . PHE E  1 26  ? 22.686  21.922  -27.115 1.00 33.63  ? 26  PHE E N   1 
ATOM   6616  C CA  . PHE E  1 26  ? 23.362  23.190  -27.302 1.00 34.99  ? 26  PHE E CA  1 
ATOM   6617  C C   . PHE E  1 26  ? 24.875  22.927  -27.267 1.00 34.97  ? 26  PHE E C   1 
ATOM   6618  O O   . PHE E  1 26  ? 25.424  22.532  -26.234 1.00 33.48  ? 26  PHE E O   1 
ATOM   6619  C CB  . PHE E  1 26  ? 22.984  24.191  -26.206 1.00 36.19  ? 26  PHE E CB  1 
ATOM   6620  C CG  . PHE E  1 26  ? 23.657  25.520  -26.371 1.00 35.32  ? 26  PHE E CG  1 
ATOM   6621  C CD1 . PHE E  1 26  ? 23.269  26.382  -27.390 1.00 36.39  ? 26  PHE E CD1 1 
ATOM   6622  C CD2 . PHE E  1 26  ? 24.755  25.857  -25.588 1.00 36.11  ? 26  PHE E CD2 1 
ATOM   6623  C CE1 . PHE E  1 26  ? 23.974  27.563  -27.639 1.00 37.69  ? 26  PHE E CE1 1 
ATOM   6624  C CE2 . PHE E  1 26  ? 25.467  27.033  -25.827 1.00 37.21  ? 26  PHE E CE2 1 
ATOM   6625  C CZ  . PHE E  1 26  ? 25.074  27.885  -26.860 1.00 38.21  ? 26  PHE E CZ  1 
ATOM   6626  N N   . ASP E  1 27  ? 25.540  23.136  -28.398 1.00 34.30  ? 27  ASP E N   1 
ATOM   6627  C CA  . ASP E  1 27  ? 26.984  22.903  -28.481 1.00 36.82  ? 27  ASP E CA  1 
ATOM   6628  C C   . ASP E  1 27  ? 27.455  21.566  -27.886 1.00 35.17  ? 27  ASP E C   1 
ATOM   6629  O O   . ASP E  1 27  ? 28.520  21.500  -27.281 1.00 34.57  ? 27  ASP E O   1 
ATOM   6630  C CB  . ASP E  1 27  ? 27.748  24.033  -27.784 1.00 39.86  ? 27  ASP E CB  1 
ATOM   6631  C CG  . ASP E  1 27  ? 27.616  25.361  -28.503 1.00 42.34  ? 27  ASP E CG  1 
ATOM   6632  O OD1 . ASP E  1 27  ? 27.353  25.376  -29.726 1.00 40.06  ? 27  ASP E OD1 1 
ATOM   6633  O OD2 . ASP E  1 27  ? 27.800  26.401  -27.837 1.00 48.31  ? 27  ASP E OD2 1 
ATOM   6634  N N   . GLY E  1 28  ? 26.669  20.508  -28.039 1.00 34.27  ? 28  GLY E N   1 
ATOM   6635  C CA  . GLY E  1 28  ? 27.089  19.229  -27.503 1.00 33.01  ? 28  GLY E CA  1 
ATOM   6636  C C   . GLY E  1 28  ? 26.537  18.836  -26.145 1.00 35.04  ? 28  GLY E C   1 
ATOM   6637  O O   . GLY E  1 28  ? 26.820  17.734  -25.662 1.00 35.63  ? 28  GLY E O   1 
ATOM   6638  N N   . ASP E  1 29  ? 25.775  19.720  -25.508 1.00 35.16  ? 29  ASP E N   1 
ATOM   6639  C CA  . ASP E  1 29  ? 25.181  19.386  -24.215 1.00 36.36  ? 29  ASP E CA  1 
ATOM   6640  C C   . ASP E  1 29  ? 23.662  19.420  -24.295 1.00 35.73  ? 29  ASP E C   1 
ATOM   6641  O O   . ASP E  1 29  ? 23.076  20.155  -25.099 1.00 35.21  ? 29  ASP E O   1 
ATOM   6642  C CB  . ASP E  1 29  ? 25.667  20.337  -23.116 1.00 40.20  ? 29  ASP E CB  1 
ATOM   6643  C CG  . ASP E  1 29  ? 27.132  20.131  -22.775 1.00 42.22  ? 29  ASP E CG  1 
ATOM   6644  O OD1 . ASP E  1 29  ? 27.544  18.970  -22.537 1.00 44.18  ? 29  ASP E OD1 1 
ATOM   6645  O OD2 . ASP E  1 29  ? 27.871  21.132  -22.743 1.00 43.01  ? 29  ASP E OD2 1 
ATOM   6646  N N   . GLU E  1 30  ? 23.028  18.617  -23.454 1.00 34.56  ? 30  GLU E N   1 
ATOM   6647  C CA  . GLU E  1 30  ? 21.579  18.526  -23.433 1.00 35.99  ? 30  GLU E CA  1 
ATOM   6648  C C   . GLU E  1 30  ? 20.935  19.717  -22.736 1.00 35.64  ? 30  GLU E C   1 
ATOM   6649  O O   . GLU E  1 30  ? 21.306  20.072  -21.620 1.00 36.70  ? 30  GLU E O   1 
ATOM   6650  C CB  . GLU E  1 30  ? 21.137  17.242  -22.716 1.00 36.14  ? 30  GLU E CB  1 
ATOM   6651  C CG  . GLU E  1 30  ? 19.632  16.964  -22.840 1.00 38.61  ? 30  GLU E CG  1 
ATOM   6652  C CD  . GLU E  1 30  ? 19.109  15.935  -21.835 1.00 41.57  ? 30  GLU E CD  1 
ATOM   6653  O OE1 . GLU E  1 30  ? 19.902  15.120  -21.297 1.00 43.06  ? 30  GLU E OE1 1 
ATOM   6654  O OE2 . GLU E  1 30  ? 17.885  15.933  -21.587 1.00 39.09  ? 30  GLU E OE2 1 
ATOM   6655  N N   . ILE E  1 31  ? 19.964  20.331  -23.392 1.00 35.51  ? 31  ILE E N   1 
ATOM   6656  C CA  . ILE E  1 31  ? 19.244  21.443  -22.786 1.00 34.97  ? 31  ILE E CA  1 
ATOM   6657  C C   . ILE E  1 31  ? 18.101  20.811  -21.999 1.00 35.01  ? 31  ILE E C   1 
ATOM   6658  O O   . ILE E  1 31  ? 17.909  21.096  -20.813 1.00 36.31  ? 31  ILE E O   1 
ATOM   6659  C CB  . ILE E  1 31  ? 18.667  22.367  -23.847 1.00 34.52  ? 31  ILE E CB  1 
ATOM   6660  C CG1 . ILE E  1 31  ? 19.779  22.813  -24.796 1.00 32.53  ? 31  ILE E CG1 1 
ATOM   6661  C CG2 . ILE E  1 31  ? 18.011  23.549  -23.179 1.00 35.00  ? 31  ILE E CG2 1 
ATOM   6662  C CD1 . ILE E  1 31  ? 19.275  23.534  -26.026 1.00 31.94  ? 31  ILE E CD1 1 
ATOM   6663  N N   . PHE E  1 32  ? 17.362  19.927  -22.671 1.00 33.12  ? 32  PHE E N   1 
ATOM   6664  C CA  . PHE E  1 32  ? 16.239  19.202  -22.070 1.00 33.25  ? 32  PHE E CA  1 
ATOM   6665  C C   . PHE E  1 32  ? 15.822  18.051  -22.985 1.00 32.53  ? 32  PHE E C   1 
ATOM   6666  O O   . PHE E  1 32  ? 16.207  17.993  -24.146 1.00 32.13  ? 32  PHE E O   1 
ATOM   6667  C CB  . PHE E  1 32  ? 15.012  20.114  -21.898 1.00 31.56  ? 32  PHE E CB  1 
ATOM   6668  C CG  . PHE E  1 32  ? 14.419  20.556  -23.199 1.00 30.58  ? 32  PHE E CG  1 
ATOM   6669  C CD1 . PHE E  1 32  ? 14.845  21.734  -23.803 1.00 31.28  ? 32  PHE E CD1 1 
ATOM   6670  C CD2 . PHE E  1 32  ? 13.478  19.757  -23.862 1.00 32.53  ? 32  PHE E CD2 1 
ATOM   6671  C CE1 . PHE E  1 32  ? 14.353  22.120  -25.049 1.00 32.01  ? 32  PHE E CE1 1 
ATOM   6672  C CE2 . PHE E  1 32  ? 12.975  20.128  -25.111 1.00 32.27  ? 32  PHE E CE2 1 
ATOM   6673  C CZ  . PHE E  1 32  ? 13.415  21.316  -25.710 1.00 33.29  ? 32  PHE E CZ  1 
ATOM   6674  N N   . HIS E  1 33  ? 15.016  17.146  -22.449 1.00 32.90  ? 33  HIS E N   1 
ATOM   6675  C CA  . HIS E  1 33  ? 14.503  16.033  -23.227 1.00 35.71  ? 33  HIS E CA  1 
ATOM   6676  C C   . HIS E  1 33  ? 13.071  15.818  -22.768 1.00 37.79  ? 33  HIS E C   1 
ATOM   6677  O O   . HIS E  1 33  ? 12.678  16.292  -21.703 1.00 39.74  ? 33  HIS E O   1 
ATOM   6678  C CB  . HIS E  1 33  ? 15.321  14.760  -23.004 1.00 32.53  ? 33  HIS E CB  1 
ATOM   6679  C CG  . HIS E  1 33  ? 15.179  14.169  -21.637 1.00 33.20  ? 33  HIS E CG  1 
ATOM   6680  N ND1 . HIS E  1 33  ? 16.021  14.489  -20.594 1.00 31.38  ? 33  HIS E ND1 1 
ATOM   6681  C CD2 . HIS E  1 33  ? 14.305  13.255  -21.148 1.00 33.32  ? 33  HIS E CD2 1 
ATOM   6682  C CE1 . HIS E  1 33  ? 15.676  13.796  -19.522 1.00 30.41  ? 33  HIS E CE1 1 
ATOM   6683  N NE2 . HIS E  1 33  ? 14.638  13.040  -19.830 1.00 33.92  ? 33  HIS E NE2 1 
ATOM   6684  N N   . VAL E  1 34  ? 12.275  15.128  -23.566 1.00 39.05  ? 34  VAL E N   1 
ATOM   6685  C CA  . VAL E  1 34  ? 10.910  14.886  -23.147 1.00 42.10  ? 34  VAL E CA  1 
ATOM   6686  C C   . VAL E  1 34  ? 10.667  13.405  -22.858 1.00 45.94  ? 34  VAL E C   1 
ATOM   6687  O O   . VAL E  1 34  ? 11.025  12.518  -23.642 1.00 44.26  ? 34  VAL E O   1 
ATOM   6688  C CB  . VAL E  1 34  ? 9.894   15.402  -24.200 1.00 38.75  ? 34  VAL E CB  1 
ATOM   6689  C CG1 . VAL E  1 34  ? 8.481   15.059  -23.768 1.00 37.94  ? 34  VAL E CG1 1 
ATOM   6690  C CG2 . VAL E  1 34  ? 10.023  16.904  -24.349 1.00 36.27  ? 34  VAL E CG2 1 
ATOM   6691  N N   . ASP E  1 35  ? 10.071  13.145  -21.703 1.00 52.45  ? 35  ASP E N   1 
ATOM   6692  C CA  . ASP E  1 35  ? 9.757   11.779  -21.315 1.00 59.34  ? 35  ASP E CA  1 
ATOM   6693  C C   . ASP E  1 35  ? 8.506   11.364  -22.104 1.00 60.62  ? 35  ASP E C   1 
ATOM   6694  O O   . ASP E  1 35  ? 7.396   11.726  -21.717 1.00 60.33  ? 35  ASP E O   1 
ATOM   6695  C CB  . ASP E  1 35  ? 9.457   11.726  -19.813 1.00 61.96  ? 35  ASP E CB  1 
ATOM   6696  C CG  . ASP E  1 35  ? 9.778   10.370  -19.193 1.00 66.56  ? 35  ASP E CG  1 
ATOM   6697  O OD1 . ASP E  1 35  ? 9.540   9.326   -19.846 1.00 67.83  ? 35  ASP E OD1 1 
ATOM   6698  O OD2 . ASP E  1 35  ? 10.262  10.351  -18.038 1.00 68.40  ? 35  ASP E OD2 1 
ATOM   6699  N N   . ILE E  1 36  ? 8.677   10.622  -23.199 1.00 62.16  ? 36  ILE E N   1 
ATOM   6700  C CA  . ILE E  1 36  ? 7.525   10.195  -23.996 1.00 65.64  ? 36  ILE E CA  1 
ATOM   6701  C C   . ILE E  1 36  ? 6.489   9.509   -23.114 1.00 67.35  ? 36  ILE E C   1 
ATOM   6702  O O   . ILE E  1 36  ? 5.323   9.406   -23.479 1.00 68.24  ? 36  ILE E O   1 
ATOM   6703  C CB  . ILE E  1 36  ? 7.896   9.186   -25.123 1.00 65.31  ? 36  ILE E CB  1 
ATOM   6704  C CG1 . ILE E  1 36  ? 8.226   7.814   -24.516 1.00 66.66  ? 36  ILE E CG1 1 
ATOM   6705  C CG2 . ILE E  1 36  ? 9.048   9.722   -25.945 1.00 66.13  ? 36  ILE E CG2 1 
ATOM   6706  C CD1 . ILE E  1 36  ? 8.364   6.686   -25.530 1.00 65.43  ? 36  ILE E CD1 1 
ATOM   6707  N N   . GLU E  1 37  ? 6.929   9.038   -21.954 1.00 68.49  ? 37  GLU E N   1 
ATOM   6708  C CA  . GLU E  1 37  ? 6.050   8.351   -21.024 1.00 70.20  ? 37  GLU E CA  1 
ATOM   6709  C C   . GLU E  1 37  ? 5.310   9.307   -20.107 1.00 70.24  ? 37  GLU E C   1 
ATOM   6710  O O   . GLU E  1 37  ? 4.083   9.270   -20.017 1.00 71.35  ? 37  GLU E O   1 
ATOM   6711  C CB  . GLU E  1 37  ? 6.854   7.363   -20.181 1.00 72.62  ? 37  GLU E CB  1 
ATOM   6712  C CG  . GLU E  1 37  ? 7.185   6.078   -20.898 1.00 75.55  ? 37  GLU E CG  1 
ATOM   6713  C CD  . GLU E  1 37  ? 5.962   5.218   -21.081 1.00 78.32  ? 37  GLU E CD  1 
ATOM   6714  O OE1 . GLU E  1 37  ? 5.397   4.782   -20.054 1.00 79.76  ? 37  GLU E OE1 1 
ATOM   6715  O OE2 . GLU E  1 37  ? 5.563   4.985   -22.244 1.00 80.05  ? 37  GLU E OE2 1 
ATOM   6716  N N   . LYS E  1 38  ? 6.057   10.161  -19.418 1.00 69.70  ? 38  LYS E N   1 
ATOM   6717  C CA  . LYS E  1 38  ? 5.448   11.111  -18.499 1.00 68.89  ? 38  LYS E CA  1 
ATOM   6718  C C   . LYS E  1 38  ? 5.019   12.418  -19.142 1.00 67.13  ? 38  LYS E C   1 
ATOM   6719  O O   . LYS E  1 38  ? 4.610   13.341  -18.438 1.00 67.50  ? 38  LYS E O   1 
ATOM   6720  C CB  . LYS E  1 38  ? 6.395   11.406  -17.339 1.00 70.52  ? 38  LYS E CB  1 
ATOM   6721  C CG  . LYS E  1 38  ? 6.392   10.333  -16.263 1.00 73.94  ? 38  LYS E CG  1 
ATOM   6722  C CD  . LYS E  1 38  ? 7.438   10.626  -15.192 1.00 75.92  ? 38  LYS E CD  1 
ATOM   6723  C CE  . LYS E  1 38  ? 7.245   9.753   -13.955 1.00 76.32  ? 38  LYS E CE  1 
ATOM   6724  N NZ  . LYS E  1 38  ? 5.969   10.065  -13.243 1.00 76.54  ? 38  LYS E NZ  1 
ATOM   6725  N N   . SER E  1 39  ? 5.105   12.502  -20.468 1.00 63.95  ? 39  SER E N   1 
ATOM   6726  C CA  . SER E  1 39  ? 4.704   13.720  -21.169 1.00 60.48  ? 39  SER E CA  1 
ATOM   6727  C C   . SER E  1 39  ? 5.195   14.924  -20.385 1.00 57.81  ? 39  SER E C   1 
ATOM   6728  O O   . SER E  1 39  ? 4.422   15.827  -20.064 1.00 57.51  ? 39  SER E O   1 
ATOM   6729  C CB  . SER E  1 39  ? 3.176   13.778  -21.287 1.00 60.53  ? 39  SER E CB  1 
ATOM   6730  O OG  . SER E  1 39  ? 2.746   15.055  -21.726 1.00 60.93  ? 39  SER E OG  1 
ATOM   6731  N N   . GLU E  1 40  ? 6.487   14.939  -20.078 1.00 54.87  ? 40  GLU E N   1 
ATOM   6732  C CA  . GLU E  1 40  ? 7.041   16.028  -19.287 1.00 51.23  ? 40  GLU E CA  1 
ATOM   6733  C C   . GLU E  1 40  ? 8.379   16.553  -19.776 1.00 47.38  ? 40  GLU E C   1 
ATOM   6734  O O   . GLU E  1 40  ? 9.247   15.787  -20.196 1.00 46.39  ? 40  GLU E O   1 
ATOM   6735  C CB  . GLU E  1 40  ? 7.179   15.564  -17.837 1.00 53.05  ? 40  GLU E CB  1 
ATOM   6736  C CG  . GLU E  1 40  ? 7.697   16.616  -16.877 1.00 56.44  ? 40  GLU E CG  1 
ATOM   6737  C CD  . GLU E  1 40  ? 7.909   16.059  -15.477 1.00 58.35  ? 40  GLU E CD  1 
ATOM   6738  O OE1 . GLU E  1 40  ? 8.363   16.813  -14.587 1.00 61.21  ? 40  GLU E OE1 1 
ATOM   6739  O OE2 . GLU E  1 40  ? 7.622   14.860  -15.268 1.00 59.74  ? 40  GLU E OE2 1 
ATOM   6740  N N   . THR E  1 41  ? 8.536   17.867  -19.715 1.00 44.18  ? 41  THR E N   1 
ATOM   6741  C CA  . THR E  1 41  ? 9.779   18.505  -20.114 1.00 43.29  ? 41  THR E CA  1 
ATOM   6742  C C   . THR E  1 41  ? 10.743  18.431  -18.927 1.00 44.06  ? 41  THR E C   1 
ATOM   6743  O O   . THR E  1 41  ? 10.434  18.908  -17.835 1.00 44.15  ? 41  THR E O   1 
ATOM   6744  C CB  . THR E  1 41  ? 9.550   19.964  -20.483 1.00 42.01  ? 41  THR E CB  1 
ATOM   6745  O OG1 . THR E  1 41  ? 8.633   20.031  -21.580 1.00 40.81  ? 41  THR E OG1 1 
ATOM   6746  C CG2 . THR E  1 41  ? 10.865  20.625  -20.863 1.00 39.37  ? 41  THR E CG2 1 
ATOM   6747  N N   . ILE E  1 42  ? 11.904  17.825  -19.156 1.00 42.62  ? 42  ILE E N   1 
ATOM   6748  C CA  . ILE E  1 42  ? 12.918  17.631  -18.122 1.00 41.72  ? 42  ILE E CA  1 
ATOM   6749  C C   . ILE E  1 42  ? 14.218  18.317  -18.500 1.00 40.18  ? 42  ILE E C   1 
ATOM   6750  O O   . ILE E  1 42  ? 14.935  17.840  -19.372 1.00 41.64  ? 42  ILE E O   1 
ATOM   6751  C CB  . ILE E  1 42  ? 13.204  16.119  -17.938 1.00 44.05  ? 42  ILE E CB  1 
ATOM   6752  C CG1 . ILE E  1 42  ? 11.881  15.361  -17.840 1.00 42.07  ? 42  ILE E CG1 1 
ATOM   6753  C CG2 . ILE E  1 42  ? 14.052  15.872  -16.687 1.00 40.61  ? 42  ILE E CG2 1 
ATOM   6754  C CD1 . ILE E  1 42  ? 10.961  15.914  -16.783 1.00 44.24  ? 42  ILE E CD1 1 
ATOM   6755  N N   . TRP E  1 43  ? 14.522  19.431  -17.848 1.00 39.41  ? 43  TRP E N   1 
ATOM   6756  C CA  . TRP E  1 43  ? 15.746  20.173  -18.135 1.00 40.45  ? 43  TRP E CA  1 
ATOM   6757  C C   . TRP E  1 43  ? 16.982  19.469  -17.592 1.00 39.30  ? 43  TRP E C   1 
ATOM   6758  O O   . TRP E  1 43  ? 16.924  18.804  -16.564 1.00 36.65  ? 43  TRP E O   1 
ATOM   6759  C CB  . TRP E  1 43  ? 15.649  21.578  -17.555 1.00 40.31  ? 43  TRP E CB  1 
ATOM   6760  C CG  . TRP E  1 43  ? 14.411  22.254  -17.987 1.00 40.96  ? 43  TRP E CG  1 
ATOM   6761  C CD1 . TRP E  1 43  ? 13.180  22.167  -17.399 1.00 40.07  ? 43  TRP E CD1 1 
ATOM   6762  C CD2 . TRP E  1 43  ? 14.249  23.074  -19.146 1.00 41.41  ? 43  TRP E CD2 1 
ATOM   6763  N NE1 . TRP E  1 43  ? 12.261  22.888  -18.123 1.00 41.39  ? 43  TRP E NE1 1 
ATOM   6764  C CE2 . TRP E  1 43  ? 12.888  23.455  -19.201 1.00 41.48  ? 43  TRP E CE2 1 
ATOM   6765  C CE3 . TRP E  1 43  ? 15.120  23.524  -20.147 1.00 41.90  ? 43  TRP E CE3 1 
ATOM   6766  C CZ2 . TRP E  1 43  ? 12.376  24.267  -20.219 1.00 43.68  ? 43  TRP E CZ2 1 
ATOM   6767  C CZ3 . TRP E  1 43  ? 14.614  24.330  -21.163 1.00 43.62  ? 43  TRP E CZ3 1 
ATOM   6768  C CH2 . TRP E  1 43  ? 13.252  24.695  -21.191 1.00 44.74  ? 43  TRP E CH2 1 
ATOM   6769  N N   . ARG E  1 44  ? 18.100  19.611  -18.295 1.00 41.44  ? 44  ARG E N   1 
ATOM   6770  C CA  . ARG E  1 44  ? 19.329  18.963  -17.857 1.00 42.19  ? 44  ARG E CA  1 
ATOM   6771  C C   . ARG E  1 44  ? 19.782  19.606  -16.564 1.00 42.69  ? 44  ARG E C   1 
ATOM   6772  O O   . ARG E  1 44  ? 20.195  18.919  -15.627 1.00 41.40  ? 44  ARG E O   1 
ATOM   6773  C CB  . ARG E  1 44  ? 20.420  19.071  -18.918 1.00 42.68  ? 44  ARG E CB  1 
ATOM   6774  C CG  . ARG E  1 44  ? 21.622  18.218  -18.572 1.00 43.18  ? 44  ARG E CG  1 
ATOM   6775  C CD  . ARG E  1 44  ? 21.185  16.797  -18.274 1.00 42.71  ? 44  ARG E CD  1 
ATOM   6776  N NE  . ARG E  1 44  ? 22.333  15.951  -17.976 1.00 45.00  ? 44  ARG E NE  1 
ATOM   6777  C CZ  . ARG E  1 44  ? 22.954  15.911  -16.805 1.00 43.11  ? 44  ARG E CZ  1 
ATOM   6778  N NH1 . ARG E  1 44  ? 22.536  16.663  -15.800 1.00 44.86  ? 44  ARG E NH1 1 
ATOM   6779  N NH2 . ARG E  1 44  ? 24.008  15.132  -16.650 1.00 40.92  ? 44  ARG E NH2 1 
ATOM   6780  N N   . LEU E  1 45  ? 19.698  20.932  -16.524 1.00 44.17  ? 45  LEU E N   1 
ATOM   6781  C CA  . LEU E  1 45  ? 20.035  21.689  -15.323 1.00 46.88  ? 45  LEU E CA  1 
ATOM   6782  C C   . LEU E  1 45  ? 18.788  22.426  -14.843 1.00 47.39  ? 45  LEU E C   1 
ATOM   6783  O O   . LEU E  1 45  ? 18.255  23.289  -15.540 1.00 46.53  ? 45  LEU E O   1 
ATOM   6784  C CB  . LEU E  1 45  ? 21.165  22.690  -15.596 1.00 47.53  ? 45  LEU E CB  1 
ATOM   6785  C CG  . LEU E  1 45  ? 22.527  22.056  -15.901 1.00 48.00  ? 45  LEU E CG  1 
ATOM   6786  C CD1 . LEU E  1 45  ? 23.605  23.136  -15.927 1.00 47.45  ? 45  LEU E CD1 1 
ATOM   6787  C CD2 . LEU E  1 45  ? 22.853  21.013  -14.834 1.00 44.94  ? 45  LEU E CD2 1 
ATOM   6788  N N   . GLU E  1 46  ? 18.324  22.063  -13.654 1.00 49.98  ? 46  GLU E N   1 
ATOM   6789  C CA  . GLU E  1 46  ? 17.145  22.666  -13.042 1.00 52.98  ? 46  GLU E CA  1 
ATOM   6790  C C   . GLU E  1 46  ? 17.036  24.170  -13.306 1.00 51.93  ? 46  GLU E C   1 
ATOM   6791  O O   . GLU E  1 46  ? 15.969  24.682  -13.617 1.00 52.51  ? 46  GLU E O   1 
ATOM   6792  C CB  . GLU E  1 46  ? 17.176  22.377  -11.535 1.00 57.13  ? 46  GLU E CB  1 
ATOM   6793  C CG  . GLU E  1 46  ? 16.126  23.087  -10.685 1.00 64.25  ? 46  GLU E CG  1 
ATOM   6794  C CD  . GLU E  1 46  ? 16.711  24.232  -9.854  1.00 67.37  ? 46  GLU E CD  1 
ATOM   6795  O OE1 . GLU E  1 46  ? 17.777  24.035  -9.215  1.00 67.56  ? 46  GLU E OE1 1 
ATOM   6796  O OE2 . GLU E  1 46  ? 16.094  25.322  -9.834  1.00 68.93  ? 46  GLU E OE2 1 
ATOM   6797  N N   . GLU E  1 47  ? 18.157  24.865  -13.204 1.00 52.86  ? 47  GLU E N   1 
ATOM   6798  C CA  . GLU E  1 47  ? 18.211  26.307  -13.418 1.00 52.30  ? 47  GLU E CA  1 
ATOM   6799  C C   . GLU E  1 47  ? 17.769  26.783  -14.803 1.00 52.25  ? 47  GLU E C   1 
ATOM   6800  O O   . GLU E  1 47  ? 17.532  27.974  -14.999 1.00 53.95  ? 47  GLU E O   1 
ATOM   6801  C CB  . GLU E  1 47  ? 19.630  26.802  -13.161 1.00 52.24  ? 47  GLU E CB  1 
ATOM   6802  C CG  . GLU E  1 47  ? 20.597  26.358  -14.229 1.00 54.81  ? 47  GLU E CG  1 
ATOM   6803  C CD  . GLU E  1 47  ? 22.042  26.524  -13.820 1.00 56.80  ? 47  GLU E CD  1 
ATOM   6804  O OE1 . GLU E  1 47  ? 22.479  25.809  -12.887 1.00 55.65  ? 47  GLU E OE1 1 
ATOM   6805  O OE2 . GLU E  1 47  ? 22.738  27.368  -14.435 1.00 59.67  ? 47  GLU E OE2 1 
ATOM   6806  N N   . PHE E  1 48  ? 17.668  25.883  -15.773 1.00 51.12  ? 48  PHE E N   1 
ATOM   6807  C CA  . PHE E  1 48  ? 17.256  26.308  -17.111 1.00 50.85  ? 48  PHE E CA  1 
ATOM   6808  C C   . PHE E  1 48  ? 15.766  26.632  -17.178 1.00 50.89  ? 48  PHE E C   1 
ATOM   6809  O O   . PHE E  1 48  ? 15.324  27.391  -18.037 1.00 50.42  ? 48  PHE E O   1 
ATOM   6810  C CB  . PHE E  1 48  ? 17.557  25.223  -18.157 1.00 52.12  ? 48  PHE E CB  1 
ATOM   6811  C CG  . PHE E  1 48  ? 19.023  24.967  -18.383 1.00 52.14  ? 48  PHE E CG  1 
ATOM   6812  C CD1 . PHE E  1 48  ? 19.955  25.988  -18.241 1.00 51.44  ? 48  PHE E CD1 1 
ATOM   6813  C CD2 . PHE E  1 48  ? 19.464  23.703  -18.769 1.00 52.03  ? 48  PHE E CD2 1 
ATOM   6814  C CE1 . PHE E  1 48  ? 21.299  25.756  -18.476 1.00 53.60  ? 48  PHE E CE1 1 
ATOM   6815  C CE2 . PHE E  1 48  ? 20.809  23.457  -19.011 1.00 52.77  ? 48  PHE E CE2 1 
ATOM   6816  C CZ  . PHE E  1 48  ? 21.731  24.484  -18.865 1.00 54.12  ? 48  PHE E CZ  1 
ATOM   6817  N N   . ALA E  1 49  ? 14.996  26.051  -16.268 1.00 52.09  ? 49  ALA E N   1 
ATOM   6818  C CA  . ALA E  1 49  ? 13.547  26.246  -16.248 1.00 53.65  ? 49  ALA E CA  1 
ATOM   6819  C C   . ALA E  1 49  ? 13.119  27.683  -16.007 1.00 54.53  ? 49  ALA E C   1 
ATOM   6820  O O   . ALA E  1 49  ? 12.032  28.079  -16.409 1.00 56.13  ? 49  ALA E O   1 
ATOM   6821  C CB  . ALA E  1 49  ? 12.913  25.334  -15.196 1.00 52.08  ? 49  ALA E CB  1 
ATOM   6822  N N   . LYS E  1 50  ? 13.981  28.458  -15.359 1.00 55.89  ? 50  LYS E N   1 
ATOM   6823  C CA  . LYS E  1 50  ? 13.695  29.851  -15.041 1.00 54.87  ? 50  LYS E CA  1 
ATOM   6824  C C   . LYS E  1 50  ? 13.884  30.773  -16.233 1.00 54.75  ? 50  LYS E C   1 
ATOM   6825  O O   . LYS E  1 50  ? 13.537  31.953  -16.168 1.00 55.94  ? 50  LYS E O   1 
ATOM   6826  C CB  . LYS E  1 50  ? 14.603  30.326  -13.902 1.00 55.98  ? 50  LYS E CB  1 
ATOM   6827  C CG  . LYS E  1 50  ? 14.435  29.555  -12.590 1.00 59.64  ? 50  LYS E CG  1 
ATOM   6828  C CD  . LYS E  1 50  ? 14.880  28.095  -12.710 1.00 62.03  ? 50  LYS E CD  1 
ATOM   6829  C CE  . LYS E  1 50  ? 14.699  27.331  -11.400 1.00 64.02  ? 50  LYS E CE  1 
ATOM   6830  N NZ  . LYS E  1 50  ? 13.269  27.229  -10.966 1.00 64.61  ? 50  LYS E NZ  1 
ATOM   6831  N N   . PHE E  1 51  ? 14.417  30.239  -17.325 1.00 53.26  ? 51  PHE E N   1 
ATOM   6832  C CA  . PHE E  1 51  ? 14.685  31.050  -18.504 1.00 51.48  ? 51  PHE E CA  1 
ATOM   6833  C C   . PHE E  1 51  ? 13.869  30.694  -19.719 1.00 50.67  ? 51  PHE E C   1 
ATOM   6834  O O   . PHE E  1 51  ? 13.876  31.421  -20.712 1.00 50.18  ? 51  PHE E O   1 
ATOM   6835  C CB  . PHE E  1 51  ? 16.165  30.956  -18.858 1.00 53.55  ? 51  PHE E CB  1 
ATOM   6836  C CG  . PHE E  1 51  ? 17.061  31.662  -17.884 1.00 54.88  ? 51  PHE E CG  1 
ATOM   6837  C CD1 . PHE E  1 51  ? 17.388  33.001  -18.072 1.00 54.74  ? 51  PHE E CD1 1 
ATOM   6838  C CD2 . PHE E  1 51  ? 17.539  31.004  -16.756 1.00 54.75  ? 51  PHE E CD2 1 
ATOM   6839  C CE1 . PHE E  1 51  ? 18.174  33.675  -17.153 1.00 54.41  ? 51  PHE E CE1 1 
ATOM   6840  C CE2 . PHE E  1 51  ? 18.327  31.670  -15.829 1.00 55.36  ? 51  PHE E CE2 1 
ATOM   6841  C CZ  . PHE E  1 51  ? 18.645  33.011  -16.028 1.00 56.49  ? 51  PHE E CZ  1 
ATOM   6842  N N   . ALA E  1 52  ? 13.165  29.575  -19.653 1.00 49.68  ? 52  ALA E N   1 
ATOM   6843  C CA  . ALA E  1 52  ? 12.371  29.155  -20.793 1.00 48.37  ? 52  ALA E CA  1 
ATOM   6844  C C   . ALA E  1 52  ? 11.441  28.012  -20.441 1.00 47.98  ? 52  ALA E C   1 
ATOM   6845  O O   . ALA E  1 52  ? 11.518  27.434  -19.357 1.00 49.88  ? 52  ALA E O   1 
ATOM   6846  C CB  . ALA E  1 52  ? 13.294  28.736  -21.928 1.00 48.14  ? 52  ALA E CB  1 
ATOM   6847  N N   . SER E  1 53  ? 10.552  27.697  -21.368 1.00 47.07  ? 53  SER E N   1 
ATOM   6848  C CA  . SER E  1 53  ? 9.618   26.601  -21.187 1.00 46.33  ? 53  SER E CA  1 
ATOM   6849  C C   . SER E  1 53  ? 9.502   25.927  -22.547 1.00 44.17  ? 53  SER E C   1 
ATOM   6850  O O   . SER E  1 53  ? 9.992   26.441  -23.547 1.00 43.40  ? 53  SER E O   1 
ATOM   6851  C CB  . SER E  1 53  ? 8.242   27.119  -20.745 1.00 47.73  ? 53  SER E CB  1 
ATOM   6852  O OG  . SER E  1 53  ? 7.570   27.744  -21.825 1.00 50.50  ? 53  SER E OG  1 
ATOM   6853  N N   . PHE E  1 54  ? 8.859   24.772  -22.583 1.00 42.83  ? 54  PHE E N   1 
ATOM   6854  C CA  . PHE E  1 54  ? 8.675   24.067  -23.832 1.00 41.80  ? 54  PHE E CA  1 
ATOM   6855  C C   . PHE E  1 54  ? 7.548   23.098  -23.604 1.00 42.04  ? 54  PHE E C   1 
ATOM   6856  O O   . PHE E  1 54  ? 7.567   22.340  -22.639 1.00 43.44  ? 54  PHE E O   1 
ATOM   6857  C CB  . PHE E  1 54  ? 9.929   23.296  -24.237 1.00 40.30  ? 54  PHE E CB  1 
ATOM   6858  C CG  . PHE E  1 54  ? 9.749   22.494  -25.490 1.00 37.99  ? 54  PHE E CG  1 
ATOM   6859  C CD1 . PHE E  1 54  ? 9.927   23.082  -26.735 1.00 37.21  ? 54  PHE E CD1 1 
ATOM   6860  C CD2 . PHE E  1 54  ? 9.312   21.173  -25.427 1.00 34.18  ? 54  PHE E CD2 1 
ATOM   6861  C CE1 . PHE E  1 54  ? 9.666   22.362  -27.907 1.00 37.64  ? 54  PHE E CE1 1 
ATOM   6862  C CE2 . PHE E  1 54  ? 9.047   20.449  -26.583 1.00 33.06  ? 54  PHE E CE2 1 
ATOM   6863  C CZ  . PHE E  1 54  ? 9.221   21.039  -27.826 1.00 35.03  ? 54  PHE E CZ  1 
ATOM   6864  N N   . GLU E  1 55  ? 6.574   23.124  -24.502 1.00 42.57  ? 55  GLU E N   1 
ATOM   6865  C CA  . GLU E  1 55  ? 5.399   22.272  -24.397 1.00 43.71  ? 55  GLU E CA  1 
ATOM   6866  C C   . GLU E  1 55  ? 5.676   20.829  -24.806 1.00 41.27  ? 55  GLU E C   1 
ATOM   6867  O O   . GLU E  1 55  ? 5.973   20.544  -25.966 1.00 39.09  ? 55  GLU E O   1 
ATOM   6868  C CB  . GLU E  1 55  ? 4.286   22.868  -25.254 1.00 46.69  ? 55  GLU E CB  1 
ATOM   6869  C CG  . GLU E  1 55  ? 3.957   24.309  -24.875 1.00 54.06  ? 55  GLU E CG  1 
ATOM   6870  C CD  . GLU E  1 55  ? 3.622   25.178  -26.081 1.00 57.34  ? 55  GLU E CD  1 
ATOM   6871  O OE1 . GLU E  1 55  ? 3.011   26.260  -25.894 1.00 59.19  ? 55  GLU E OE1 1 
ATOM   6872  O OE2 . GLU E  1 55  ? 3.980   24.783  -27.213 1.00 56.11  ? 55  GLU E OE2 1 
ATOM   6873  N N   . ALA E  1 56  ? 5.541   19.922  -23.846 1.00 39.45  ? 56  ALA E N   1 
ATOM   6874  C CA  . ALA E  1 56  ? 5.793   18.505  -24.072 1.00 40.58  ? 56  ALA E CA  1 
ATOM   6875  C C   . ALA E  1 56  ? 4.918   17.803  -25.109 1.00 42.13  ? 56  ALA E C   1 
ATOM   6876  O O   . ALA E  1 56  ? 5.422   16.959  -25.853 1.00 42.93  ? 56  ALA E O   1 
ATOM   6877  C CB  . ALA E  1 56  ? 5.729   17.747  -22.737 1.00 37.31  ? 56  ALA E CB  1 
ATOM   6878  N N   . GLN E  1 57  ? 3.622   18.120  -25.158 1.00 43.46  ? 57  GLN E N   1 
ATOM   6879  C CA  . GLN E  1 57  ? 2.729   17.462  -26.116 1.00 43.34  ? 57  GLN E CA  1 
ATOM   6880  C C   . GLN E  1 57  ? 3.217   17.625  -27.542 1.00 41.96  ? 57  GLN E C   1 
ATOM   6881  O O   . GLN E  1 57  ? 3.171   16.683  -28.330 1.00 41.58  ? 57  GLN E O   1 
ATOM   6882  C CB  . GLN E  1 57  ? 1.291   17.988  -25.990 1.00 46.28  ? 57  GLN E CB  1 
ATOM   6883  C CG  . GLN E  1 57  ? 0.558   17.448  -24.782 1.00 45.55  ? 57  GLN E CG  1 
ATOM   6884  C CD  . GLN E  1 57  ? 0.371   15.949  -24.847 1.00 47.64  ? 57  GLN E CD  1 
ATOM   6885  O OE1 . GLN E  1 57  ? 0.206   15.285  -23.823 1.00 47.60  ? 57  GLN E OE1 1 
ATOM   6886  N NE2 . GLN E  1 57  ? 0.388   15.405  -26.058 1.00 47.38  ? 57  GLN E NE2 1 
ATOM   6887  N N   . GLY E  1 58  ? 3.683   18.822  -27.873 1.00 43.28  ? 58  GLY E N   1 
ATOM   6888  C CA  . GLY E  1 58  ? 4.198   19.063  -29.209 1.00 43.21  ? 58  GLY E CA  1 
ATOM   6889  C C   . GLY E  1 58  ? 5.334   18.096  -29.523 1.00 43.26  ? 58  GLY E C   1 
ATOM   6890  O O   . GLY E  1 58  ? 5.531   17.701  -30.673 1.00 44.70  ? 58  GLY E O   1 
ATOM   6891  N N   . ALA E  1 59  ? 6.078   17.699  -28.497 1.00 41.44  ? 59  ALA E N   1 
ATOM   6892  C CA  . ALA E  1 59  ? 7.174   16.767  -28.692 1.00 43.10  ? 59  ALA E CA  1 
ATOM   6893  C C   . ALA E  1 59  ? 6.632   15.361  -28.870 1.00 42.72  ? 59  ALA E C   1 
ATOM   6894  O O   . ALA E  1 59  ? 7.111   14.604  -29.716 1.00 45.67  ? 59  ALA E O   1 
ATOM   6895  C CB  . ALA E  1 59  ? 8.142   16.820  -27.505 1.00 42.48  ? 59  ALA E CB  1 
ATOM   6896  N N   . LEU E  1 60  ? 5.644   14.996  -28.060 1.00 43.01  ? 60  LEU E N   1 
ATOM   6897  C CA  . LEU E  1 60  ? 5.040   13.675  -28.189 1.00 42.36  ? 60  LEU E CA  1 
ATOM   6898  C C   . LEU E  1 60  ? 4.427   13.606  -29.586 1.00 41.44  ? 60  LEU E C   1 
ATOM   6899  O O   . LEU E  1 60  ? 4.394   12.546  -30.210 1.00 40.43  ? 60  LEU E O   1 
ATOM   6900  C CB  . LEU E  1 60  ? 3.972   13.461  -27.108 1.00 43.38  ? 60  LEU E CB  1 
ATOM   6901  C CG  . LEU E  1 60  ? 4.510   13.277  -25.682 1.00 45.15  ? 60  LEU E CG  1 
ATOM   6902  C CD1 . LEU E  1 60  ? 3.376   12.942  -24.715 1.00 43.86  ? 60  LEU E CD1 1 
ATOM   6903  C CD2 . LEU E  1 60  ? 5.527   12.146  -25.683 1.00 44.67  ? 60  LEU E CD2 1 
ATOM   6904  N N   . ALA E  1 61  ? 3.953   14.751  -30.074 1.00 40.72  ? 61  ALA E N   1 
ATOM   6905  C CA  . ALA E  1 61  ? 3.385   14.822  -31.415 1.00 40.65  ? 61  ALA E CA  1 
ATOM   6906  C C   . ALA E  1 61  ? 4.477   14.471  -32.427 1.00 39.54  ? 61  ALA E C   1 
ATOM   6907  O O   . ALA E  1 61  ? 4.286   13.581  -33.237 1.00 41.70  ? 61  ALA E O   1 
ATOM   6908  C CB  . ALA E  1 61  ? 2.839   16.217  -31.692 1.00 38.99  ? 61  ALA E CB  1 
ATOM   6909  N N   . ASN E  1 62  ? 5.614   15.168  -32.380 1.00 40.38  ? 62  ASN E N   1 
ATOM   6910  C CA  . ASN E  1 62  ? 6.735   14.892  -33.287 1.00 41.87  ? 62  ASN E CA  1 
ATOM   6911  C C   . ASN E  1 62  ? 7.122   13.409  -33.251 1.00 41.20  ? 62  ASN E C   1 
ATOM   6912  O O   . ASN E  1 62  ? 7.356   12.793  -34.298 1.00 41.25  ? 62  ASN E O   1 
ATOM   6913  C CB  . ASN E  1 62  ? 7.943   15.756  -32.921 1.00 43.68  ? 62  ASN E CB  1 
ATOM   6914  C CG  . ASN E  1 62  ? 7.971   17.076  -33.676 1.00 47.44  ? 62  ASN E CG  1 
ATOM   6915  O OD1 . ASN E  1 62  ? 7.050   17.885  -33.575 1.00 49.81  ? 62  ASN E OD1 1 
ATOM   6916  N ND2 . ASN E  1 62  ? 9.040   17.297  -34.446 1.00 51.32  ? 62  ASN E ND2 1 
ATOM   6917  N N   . ILE E  1 63  ? 7.180   12.840  -32.047 1.00 39.10  ? 63  ILE E N   1 
ATOM   6918  C CA  . ILE E  1 63  ? 7.510   11.423  -31.885 1.00 38.50  ? 63  ILE E CA  1 
ATOM   6919  C C   . ILE E  1 63  ? 6.481   10.563  -32.646 1.00 37.87  ? 63  ILE E C   1 
ATOM   6920  O O   . ILE E  1 63  ? 6.842   9.599   -33.323 1.00 36.83  ? 63  ILE E O   1 
ATOM   6921  C CB  . ILE E  1 63  ? 7.484   11.009  -30.392 1.00 38.36  ? 63  ILE E CB  1 
ATOM   6922  C CG1 . ILE E  1 63  ? 8.546   11.779  -29.610 1.00 40.13  ? 63  ILE E CG1 1 
ATOM   6923  C CG2 . ILE E  1 63  ? 7.685   9.517   -30.264 1.00 36.47  ? 63  ILE E CG2 1 
ATOM   6924  C CD1 . ILE E  1 63  ? 9.949   11.565  -30.099 1.00 41.48  ? 63  ILE E CD1 1 
ATOM   6925  N N   . ALA E  1 64  ? 5.200   10.913  -32.517 1.00 36.18  ? 64  ALA E N   1 
ATOM   6926  C CA  . ALA E  1 64  ? 4.127   10.191  -33.205 1.00 36.73  ? 64  ALA E CA  1 
ATOM   6927  C C   . ALA E  1 64  ? 4.403   10.206  -34.700 1.00 36.35  ? 64  ALA E C   1 
ATOM   6928  O O   . ALA E  1 64  ? 4.225   9.189   -35.385 1.00 35.55  ? 64  ALA E O   1 
ATOM   6929  C CB  . ALA E  1 64  ? 2.769   10.838  -32.914 1.00 36.28  ? 64  ALA E CB  1 
ATOM   6930  N N   . VAL E  1 65  ? 4.838   11.358  -35.208 1.00 35.66  ? 65  VAL E N   1 
ATOM   6931  C CA  . VAL E  1 65  ? 5.177   11.449  -36.622 1.00 36.20  ? 65  VAL E CA  1 
ATOM   6932  C C   . VAL E  1 65  ? 6.322   10.476  -36.969 1.00 37.07  ? 65  VAL E C   1 
ATOM   6933  O O   . VAL E  1 65  ? 6.277   9.825   -38.009 1.00 36.70  ? 65  VAL E O   1 
ATOM   6934  C CB  . VAL E  1 65  ? 5.610   12.858  -37.019 1.00 35.05  ? 65  VAL E CB  1 
ATOM   6935  C CG1 . VAL E  1 65  ? 6.130   12.833  -38.443 1.00 36.29  ? 65  VAL E CG1 1 
ATOM   6936  C CG2 . VAL E  1 65  ? 4.451   13.819  -36.904 1.00 31.70  ? 65  VAL E CG2 1 
ATOM   6937  N N   . ASN E  1 66  ? 7.340   10.380  -36.109 1.00 35.96  ? 66  ASN E N   1 
ATOM   6938  C CA  . ASN E  1 66  ? 8.470   9.471   -36.347 1.00 38.62  ? 66  ASN E CA  1 
ATOM   6939  C C   . ASN E  1 66  ? 8.010   8.019   -36.306 1.00 38.49  ? 66  ASN E C   1 
ATOM   6940  O O   . ASN E  1 66  ? 8.557   7.153   -36.988 1.00 37.44  ? 66  ASN E O   1 
ATOM   6941  C CB  . ASN E  1 66  ? 9.562   9.665   -35.283 1.00 40.98  ? 66  ASN E CB  1 
ATOM   6942  C CG  . ASN E  1 66  ? 10.220  11.033  -35.357 1.00 44.58  ? 66  ASN E CG  1 
ATOM   6943  O OD1 . ASN E  1 66  ? 10.487  11.656  -34.333 1.00 46.99  ? 66  ASN E OD1 1 
ATOM   6944  N ND2 . ASN E  1 66  ? 10.491  11.502  -36.570 1.00 45.57  ? 66  ASN E ND2 1 
ATOM   6945  N N   . LYS E  1 67  ? 6.996   7.756   -35.496 1.00 39.19  ? 67  LYS E N   1 
ATOM   6946  C CA  . LYS E  1 67  ? 6.472   6.404   -35.352 1.00 38.77  ? 67  LYS E CA  1 
ATOM   6947  C C   . LYS E  1 67  ? 5.794   5.981   -36.641 1.00 36.78  ? 67  LYS E C   1 
ATOM   6948  O O   . LYS E  1 67  ? 5.982   4.865   -37.113 1.00 36.79  ? 67  LYS E O   1 
ATOM   6949  C CB  . LYS E  1 67  ? 5.488   6.369   -34.185 1.00 40.10  ? 67  LYS E CB  1 
ATOM   6950  C CG  . LYS E  1 67  ? 4.939   5.005   -33.846 1.00 44.01  ? 67  LYS E CG  1 
ATOM   6951  C CD  . LYS E  1 67  ? 4.122   5.081   -32.555 1.00 46.51  ? 67  LYS E CD  1 
ATOM   6952  C CE  . LYS E  1 67  ? 3.416   3.765   -32.242 1.00 48.61  ? 67  LYS E CE  1 
ATOM   6953  N NZ  . LYS E  1 67  ? 2.460   3.368   -33.308 1.00 47.29  ? 67  LYS E NZ  1 
ATOM   6954  N N   . ALA E  1 68  ? 5.019   6.892   -37.215 1.00 35.27  ? 68  ALA E N   1 
ATOM   6955  C CA  . ALA E  1 68  ? 4.303   6.629   -38.458 1.00 34.54  ? 68  ALA E CA  1 
ATOM   6956  C C   . ALA E  1 68  ? 5.314   6.452   -39.592 1.00 34.11  ? 68  ALA E C   1 
ATOM   6957  O O   . ALA E  1 68  ? 5.209   5.513   -40.394 1.00 33.08  ? 68  ALA E O   1 
ATOM   6958  C CB  . ALA E  1 68  ? 3.354   7.784   -38.758 1.00 32.54  ? 68  ALA E CB  1 
ATOM   6959  N N   . ASN E  1 69  ? 6.297   7.350   -39.641 1.00 32.32  ? 69  ASN E N   1 
ATOM   6960  C CA  . ASN E  1 69  ? 7.339   7.283   -40.653 1.00 32.73  ? 69  ASN E CA  1 
ATOM   6961  C C   . ASN E  1 69  ? 8.171   6.008   -40.519 1.00 32.81  ? 69  ASN E C   1 
ATOM   6962  O O   . ASN E  1 69  ? 8.631   5.450   -41.518 1.00 31.83  ? 69  ASN E O   1 
ATOM   6963  C CB  . ASN E  1 69  ? 8.261   8.504   -40.565 1.00 33.47  ? 69  ASN E CB  1 
ATOM   6964  C CG  . ASN E  1 69  ? 7.587   9.778   -41.031 1.00 33.47  ? 69  ASN E CG  1 
ATOM   6965  O OD1 . ASN E  1 69  ? 6.587   9.738   -41.744 1.00 33.18  ? 69  ASN E OD1 1 
ATOM   6966  N ND2 . ASN E  1 69  ? 8.145   10.918  -40.646 1.00 34.13  ? 69  ASN E ND2 1 
ATOM   6967  N N   . LEU E  1 70  ? 8.389   5.555   -39.289 1.00 32.43  ? 70  LEU E N   1 
ATOM   6968  C CA  . LEU E  1 70  ? 9.161   4.339   -39.104 1.00 33.11  ? 70  LEU E CA  1 
ATOM   6969  C C   . LEU E  1 70  ? 8.499   3.174   -39.812 1.00 34.44  ? 70  LEU E C   1 
ATOM   6970  O O   . LEU E  1 70  ? 9.187   2.338   -40.382 1.00 35.50  ? 70  LEU E O   1 
ATOM   6971  C CB  . LEU E  1 70  ? 9.322   3.974   -37.623 1.00 29.99  ? 70  LEU E CB  1 
ATOM   6972  C CG  . LEU E  1 70  ? 10.032  2.624   -37.394 1.00 29.49  ? 70  LEU E CG  1 
ATOM   6973  C CD1 . LEU E  1 70  ? 11.375  2.565   -38.133 1.00 25.05  ? 70  LEU E CD1 1 
ATOM   6974  C CD2 . LEU E  1 70  ? 10.246  2.415   -35.920 1.00 27.94  ? 70  LEU E CD2 1 
ATOM   6975  N N   . ASP E  1 71  ? 7.168   3.104   -39.771 1.00 36.15  ? 71  ASP E N   1 
ATOM   6976  C CA  . ASP E  1 71  ? 6.489   1.998   -40.436 1.00 37.87  ? 71  ASP E CA  1 
ATOM   6977  C C   . ASP E  1 71  ? 6.702   2.062   -41.939 1.00 36.21  ? 71  ASP E C   1 
ATOM   6978  O O   . ASP E  1 71  ? 6.939   1.041   -42.578 1.00 37.01  ? 71  ASP E O   1 
ATOM   6979  C CB  . ASP E  1 71  ? 4.985   1.973   -40.106 1.00 40.11  ? 71  ASP E CB  1 
ATOM   6980  C CG  . ASP E  1 71  ? 4.691   1.351   -38.738 1.00 43.92  ? 71  ASP E CG  1 
ATOM   6981  O OD1 . ASP E  1 71  ? 5.480   0.488   -38.269 1.00 45.67  ? 71  ASP E OD1 1 
ATOM   6982  O OD2 . ASP E  1 71  ? 3.659   1.714   -38.134 1.00 46.97  ? 71  ASP E OD2 1 
ATOM   6983  N N   . VAL E  1 72  ? 6.626   3.259   -42.507 1.00 35.16  ? 72  VAL E N   1 
ATOM   6984  C CA  . VAL E  1 72  ? 6.845   3.410   -43.939 1.00 35.20  ? 72  VAL E CA  1 
ATOM   6985  C C   . VAL E  1 72  ? 8.256   2.956   -44.300 1.00 35.46  ? 72  VAL E C   1 
ATOM   6986  O O   . VAL E  1 72  ? 8.449   2.215   -45.276 1.00 35.68  ? 72  VAL E O   1 
ATOM   6987  C CB  . VAL E  1 72  ? 6.658   4.876   -44.394 1.00 36.23  ? 72  VAL E CB  1 
ATOM   6988  C CG1 . VAL E  1 72  ? 7.054   5.025   -45.870 1.00 35.58  ? 72  VAL E CG1 1 
ATOM   6989  C CG2 . VAL E  1 72  ? 5.209   5.304   -44.178 1.00 34.80  ? 72  VAL E CG2 1 
ATOM   6990  N N   . MET E  1 73  ? 9.243   3.397   -43.521 1.00 33.97  ? 73  MET E N   1 
ATOM   6991  C CA  . MET E  1 73  ? 10.617  3.004   -43.791 1.00 36.04  ? 73  MET E CA  1 
ATOM   6992  C C   . MET E  1 73  ? 10.756  1.481   -43.707 1.00 37.60  ? 73  MET E C   1 
ATOM   6993  O O   . MET E  1 73  ? 11.506  0.882   -44.472 1.00 39.78  ? 73  MET E O   1 
ATOM   6994  C CB  . MET E  1 73  ? 11.591  3.679   -42.818 1.00 36.00  ? 73  MET E CB  1 
ATOM   6995  C CG  . MET E  1 73  ? 11.714  5.196   -42.951 1.00 35.39  ? 73  MET E CG  1 
ATOM   6996  S SD  . MET E  1 73  ? 11.892  5.774   -44.650 1.00 36.54  ? 73  MET E SD  1 
ATOM   6997  C CE  . MET E  1 73  ? 13.615  5.390   -44.993 1.00 33.38  ? 73  MET E CE  1 
ATOM   6998  N N   . LYS E  1 74  ? 10.045  0.839   -42.792 1.00 38.34  ? 74  LYS E N   1 
ATOM   6999  C CA  . LYS E  1 74  ? 10.146  -0.615  -42.718 1.00 41.43  ? 74  LYS E CA  1 
ATOM   7000  C C   . LYS E  1 74  ? 9.619   -1.256  -44.004 1.00 41.74  ? 74  LYS E C   1 
ATOM   7001  O O   . LYS E  1 74  ? 10.218  -2.197  -44.507 1.00 42.21  ? 74  LYS E O   1 
ATOM   7002  C CB  . LYS E  1 74  ? 9.395   -1.159  -41.504 1.00 41.00  ? 74  LYS E CB  1 
ATOM   7003  C CG  . LYS E  1 74  ? 10.107  -0.885  -40.194 1.00 42.93  ? 74  LYS E CG  1 
ATOM   7004  C CD  . LYS E  1 74  ? 9.426   -1.578  -39.026 1.00 47.45  ? 74  LYS E CD  1 
ATOM   7005  C CE  . LYS E  1 74  ? 9.533   -3.096  -39.132 1.00 49.15  ? 74  LYS E CE  1 
ATOM   7006  N NZ  . LYS E  1 74  ? 8.883   -3.760  -37.974 1.00 51.76  ? 74  LYS E NZ  1 
ATOM   7007  N N   . GLU E  1 75  ? 8.509   -0.739  -44.532 1.00 42.86  ? 75  GLU E N   1 
ATOM   7008  C CA  . GLU E  1 75  ? 7.934   -1.246  -45.776 1.00 44.59  ? 75  GLU E CA  1 
ATOM   7009  C C   . GLU E  1 75  ? 8.887   -0.987  -46.936 1.00 43.82  ? 75  GLU E C   1 
ATOM   7010  O O   . GLU E  1 75  ? 9.167   -1.881  -47.728 1.00 42.26  ? 75  GLU E O   1 
ATOM   7011  C CB  . GLU E  1 75  ? 6.603   -0.552  -46.088 1.00 48.91  ? 75  GLU E CB  1 
ATOM   7012  C CG  . GLU E  1 75  ? 5.404   -1.078  -45.329 1.00 57.22  ? 75  GLU E CG  1 
ATOM   7013  C CD  . GLU E  1 75  ? 5.002   -2.460  -45.790 1.00 63.44  ? 75  GLU E CD  1 
ATOM   7014  O OE1 . GLU E  1 75  ? 4.381   -2.569  -46.876 1.00 66.04  ? 75  GLU E OE1 1 
ATOM   7015  O OE2 . GLU E  1 75  ? 5.321   -3.441  -45.074 1.00 66.28  ? 75  GLU E OE2 1 
ATOM   7016  N N   . ARG E  1 76  ? 9.383   0.247   -47.020 1.00 43.26  ? 76  ARG E N   1 
ATOM   7017  C CA  . ARG E  1 76  ? 10.285  0.672   -48.086 1.00 42.06  ? 76  ARG E CA  1 
ATOM   7018  C C   . ARG E  1 76  ? 11.609  -0.080  -48.157 1.00 43.07  ? 76  ARG E C   1 
ATOM   7019  O O   . ARG E  1 76  ? 12.274  -0.059  -49.191 1.00 44.67  ? 76  ARG E O   1 
ATOM   7020  C CB  . ARG E  1 76  ? 10.567  2.174   -47.958 1.00 41.79  ? 76  ARG E CB  1 
ATOM   7021  C CG  . ARG E  1 76  ? 11.116  2.826   -49.216 1.00 39.17  ? 76  ARG E CG  1 
ATOM   7022  C CD  . ARG E  1 76  ? 11.505  4.285   -48.980 1.00 36.43  ? 76  ARG E CD  1 
ATOM   7023  N NE  . ARG E  1 76  ? 10.363  5.122   -48.659 1.00 35.12  ? 76  ARG E NE  1 
ATOM   7024  C CZ  . ARG E  1 76  ? 10.450  6.363   -48.182 1.00 37.04  ? 76  ARG E CZ  1 
ATOM   7025  N NH1 . ARG E  1 76  ? 11.635  6.917   -47.965 1.00 36.88  ? 76  ARG E NH1 1 
ATOM   7026  N NH2 . ARG E  1 76  ? 9.351   7.053   -47.918 1.00 34.70  ? 76  ARG E NH2 1 
ATOM   7027  N N   . SER E  1 77  ? 12.011  -0.735  -47.074 1.00 43.63  ? 77  SER E N   1 
ATOM   7028  C CA  . SER E  1 77  ? 13.280  -1.467  -47.092 1.00 46.31  ? 77  SER E CA  1 
ATOM   7029  C C   . SER E  1 77  ? 13.061  -2.963  -46.931 1.00 47.27  ? 77  SER E C   1 
ATOM   7030  O O   . SER E  1 77  ? 14.014  -3.728  -46.784 1.00 46.60  ? 77  SER E O   1 
ATOM   7031  C CB  . SER E  1 77  ? 14.193  -0.976  -45.976 1.00 45.13  ? 77  SER E CB  1 
ATOM   7032  O OG  . SER E  1 77  ? 13.662  -1.344  -44.717 1.00 49.30  ? 77  SER E OG  1 
ATOM   7033  N N   . ASN E  1 78  ? 11.793  -3.358  -46.969 1.00 49.90  ? 78  ASN E N   1 
ATOM   7034  C CA  . ASN E  1 78  ? 11.375  -4.747  -46.823 1.00 53.55  ? 78  ASN E CA  1 
ATOM   7035  C C   . ASN E  1 78  ? 11.883  -5.358  -45.521 1.00 53.23  ? 78  ASN E C   1 
ATOM   7036  O O   . ASN E  1 78  ? 12.391  -6.483  -45.509 1.00 53.04  ? 78  ASN E O   1 
ATOM   7037  C CB  . ASN E  1 78  ? 11.844  -5.589  -48.021 1.00 56.98  ? 78  ASN E CB  1 
ATOM   7038  C CG  . ASN E  1 78  ? 11.267  -7.007  -48.003 1.00 61.28  ? 78  ASN E CG  1 
ATOM   7039  O OD1 . ASN E  1 78  ? 10.048  -7.182  -48.038 1.00 59.64  ? 78  ASN E OD1 1 
ATOM   7040  N ND2 . ASN E  1 78  ? 12.142  -8.011  -47.943 1.00 66.01  ? 78  ASN E ND2 1 
ATOM   7041  N N   . ASN E  1 79  ? 11.740  -4.610  -44.428 1.00 53.67  ? 79  ASN E N   1 
ATOM   7042  C CA  . ASN E  1 79  ? 12.166  -5.068  -43.104 1.00 54.60  ? 79  ASN E CA  1 
ATOM   7043  C C   . ASN E  1 79  ? 13.590  -5.594  -43.065 1.00 53.63  ? 79  ASN E C   1 
ATOM   7044  O O   . ASN E  1 79  ? 13.907  -6.491  -42.287 1.00 51.99  ? 79  ASN E O   1 
ATOM   7045  C CB  . ASN E  1 79  ? 11.228  -6.161  -42.592 1.00 56.15  ? 79  ASN E CB  1 
ATOM   7046  C CG  . ASN E  1 79  ? 9.956   -5.602  -41.993 1.00 60.09  ? 79  ASN E CG  1 
ATOM   7047  O OD1 . ASN E  1 79  ? 9.284   -4.751  -42.592 1.00 60.08  ? 79  ASN E OD1 1 
ATOM   7048  N ND2 . ASN E  1 79  ? 9.609   -6.086  -40.802 1.00 62.59  ? 79  ASN E ND2 1 
ATOM   7049  N N   . THR E  1 80  ? 14.447  -5.047  -43.912 1.00 54.71  ? 80  THR E N   1 
ATOM   7050  C CA  . THR E  1 80  ? 15.832  -5.477  -43.933 1.00 55.92  ? 80  THR E CA  1 
ATOM   7051  C C   . THR E  1 80  ? 16.571  -4.753  -42.804 1.00 57.18  ? 80  THR E C   1 
ATOM   7052  O O   . THR E  1 80  ? 16.597  -3.523  -42.744 1.00 56.52  ? 80  THR E O   1 
ATOM   7053  C CB  . THR E  1 80  ? 16.461  -5.165  -45.276 1.00 55.60  ? 80  THR E CB  1 
ATOM   7054  O OG1 . THR E  1 80  ? 15.649  -5.736  -46.312 1.00 58.22  ? 80  THR E OG1 1 
ATOM   7055  C CG2 . THR E  1 80  ? 17.850  -5.753  -45.352 1.00 54.50  ? 80  THR E CG2 1 
ATOM   7056  N N   . PRO E  1 81  ? 17.153  -5.516  -41.871 1.00 58.17  ? 81  PRO E N   1 
ATOM   7057  C CA  . PRO E  1 81  ? 17.870  -4.900  -40.757 1.00 59.40  ? 81  PRO E CA  1 
ATOM   7058  C C   . PRO E  1 81  ? 19.374  -4.728  -40.962 1.00 59.34  ? 81  PRO E C   1 
ATOM   7059  O O   . PRO E  1 81  ? 19.974  -5.318  -41.867 1.00 60.11  ? 81  PRO E O   1 
ATOM   7060  C CB  . PRO E  1 81  ? 17.556  -5.845  -39.604 1.00 60.09  ? 81  PRO E CB  1 
ATOM   7061  C CG  . PRO E  1 81  ? 17.625  -7.178  -40.284 1.00 58.55  ? 81  PRO E CG  1 
ATOM   7062  C CD  . PRO E  1 81  ? 16.901  -6.946  -41.602 1.00 58.65  ? 81  PRO E CD  1 
ATOM   7063  N N   . ASP E  1 82  ? 19.961  -3.894  -40.109 1.00 58.00  ? 82  ASP E N   1 
ATOM   7064  C CA  . ASP E  1 82  ? 21.389  -3.640  -40.127 1.00 57.27  ? 82  ASP E CA  1 
ATOM   7065  C C   . ASP E  1 82  ? 21.983  -4.311  -38.886 1.00 56.45  ? 82  ASP E C   1 
ATOM   7066  O O   . ASP E  1 82  ? 21.253  -4.741  -37.990 1.00 56.72  ? 82  ASP E O   1 
ATOM   7067  C CB  . ASP E  1 82  ? 21.676  -2.133  -40.111 1.00 57.76  ? 82  ASP E CB  1 
ATOM   7068  C CG  . ASP E  1 82  ? 21.499  -1.483  -41.480 1.00 59.19  ? 82  ASP E CG  1 
ATOM   7069  O OD1 . ASP E  1 82  ? 21.627  -2.197  -42.502 1.00 58.94  ? 82  ASP E OD1 1 
ATOM   7070  O OD2 . ASP E  1 82  ? 21.253  -0.254  -41.535 1.00 59.47  ? 82  ASP E OD2 1 
ATOM   7071  N N   . ALA E  1 83  ? 23.306  -4.417  -38.843 1.00 54.64  ? 83  ALA E N   1 
ATOM   7072  C CA  . ALA E  1 83  ? 23.981  -5.036  -37.709 1.00 51.86  ? 83  ALA E CA  1 
ATOM   7073  C C   . ALA E  1 83  ? 24.064  -4.061  -36.539 1.00 49.87  ? 83  ALA E C   1 
ATOM   7074  O O   . ALA E  1 83  ? 24.150  -2.854  -36.735 1.00 49.51  ? 83  ALA E O   1 
ATOM   7075  C CB  . ALA E  1 83  ? 25.377  -5.477  -38.115 1.00 51.05  ? 83  ALA E CB  1 
ATOM   7076  N N   . ASN E  1 84  ? 24.034  -4.593  -35.324 1.00 47.96  ? 84  ASN E N   1 
ATOM   7077  C CA  . ASN E  1 84  ? 24.121  -3.775  -34.124 1.00 46.39  ? 84  ASN E CA  1 
ATOM   7078  C C   . ASN E  1 84  ? 25.552  -3.261  -33.980 1.00 46.56  ? 84  ASN E C   1 
ATOM   7079  O O   . ASN E  1 84  ? 26.501  -3.987  -34.262 1.00 46.52  ? 84  ASN E O   1 
ATOM   7080  C CB  . ASN E  1 84  ? 23.737  -4.615  -32.907 1.00 47.57  ? 84  ASN E CB  1 
ATOM   7081  C CG  . ASN E  1 84  ? 22.286  -5.069  -32.946 1.00 49.04  ? 84  ASN E CG  1 
ATOM   7082  O OD1 . ASN E  1 84  ? 21.376  -4.304  -32.627 1.00 49.91  ? 84  ASN E OD1 1 
ATOM   7083  N ND2 . ASN E  1 84  ? 22.064  -6.313  -33.356 1.00 49.92  ? 84  ASN E ND2 1 
ATOM   7084  N N   . VAL E  1 85  ? 25.709  -2.003  -33.572 1.00 45.47  ? 85  VAL E N   1 
ATOM   7085  C CA  . VAL E  1 85  ? 27.037  -1.424  -33.390 1.00 43.34  ? 85  VAL E CA  1 
ATOM   7086  C C   . VAL E  1 85  ? 27.320  -1.296  -31.897 1.00 42.70  ? 85  VAL E C   1 
ATOM   7087  O O   . VAL E  1 85  ? 26.737  -0.460  -31.209 1.00 42.50  ? 85  VAL E O   1 
ATOM   7088  C CB  . VAL E  1 85  ? 27.145  -0.042  -34.040 1.00 44.60  ? 85  VAL E CB  1 
ATOM   7089  C CG1 . VAL E  1 85  ? 28.564  0.514   -33.846 1.00 45.81  ? 85  VAL E CG1 1 
ATOM   7090  C CG2 . VAL E  1 85  ? 26.817  -0.142  -35.518 1.00 44.94  ? 85  VAL E CG2 1 
ATOM   7091  N N   . ALA E  1 86  ? 28.218  -2.140  -31.407 1.00 42.31  ? 86  ALA E N   1 
ATOM   7092  C CA  . ALA E  1 86  ? 28.576  -2.164  -29.992 1.00 41.88  ? 86  ALA E CA  1 
ATOM   7093  C C   . ALA E  1 86  ? 29.250  -0.865  -29.561 1.00 39.99  ? 86  ALA E C   1 
ATOM   7094  O O   . ALA E  1 86  ? 29.916  -0.208  -30.353 1.00 37.82  ? 86  ALA E O   1 
ATOM   7095  C CB  . ALA E  1 86  ? 29.490  -3.375  -29.704 1.00 41.31  ? 86  ALA E CB  1 
ATOM   7096  N N   . PRO E  1 87  ? 29.083  -0.484  -28.289 1.00 41.13  ? 87  PRO E N   1 
ATOM   7097  C CA  . PRO E  1 87  ? 29.669  0.748   -27.741 1.00 41.29  ? 87  PRO E CA  1 
ATOM   7098  C C   . PRO E  1 87  ? 31.069  0.634   -27.149 1.00 42.67  ? 87  PRO E C   1 
ATOM   7099  O O   . PRO E  1 87  ? 31.497  -0.442  -26.738 1.00 43.88  ? 87  PRO E O   1 
ATOM   7100  C CB  . PRO E  1 87  ? 28.682  1.132   -26.662 1.00 40.07  ? 87  PRO E CB  1 
ATOM   7101  C CG  . PRO E  1 87  ? 28.342  -0.217  -26.088 1.00 41.37  ? 87  PRO E CG  1 
ATOM   7102  C CD  . PRO E  1 87  ? 28.146  -1.090  -27.324 1.00 40.01  ? 87  PRO E CD  1 
ATOM   7103  N N   . GLU E  1 88  ? 31.767  1.766   -27.118 1.00 43.81  ? 88  GLU E N   1 
ATOM   7104  C CA  . GLU E  1 88  ? 33.083  1.870   -26.501 1.00 45.65  ? 88  GLU E CA  1 
ATOM   7105  C C   . GLU E  1 88  ? 32.688  2.335   -25.101 1.00 46.41  ? 88  GLU E C   1 
ATOM   7106  O O   . GLU E  1 88  ? 31.826  3.204   -24.967 1.00 46.03  ? 88  GLU E O   1 
ATOM   7107  C CB  . GLU E  1 88  ? 33.912  2.971   -27.161 1.00 49.80  ? 88  GLU E CB  1 
ATOM   7108  C CG  . GLU E  1 88  ? 34.722  2.543   -28.368 1.00 56.41  ? 88  GLU E CG  1 
ATOM   7109  C CD  . GLU E  1 88  ? 35.324  3.725   -29.117 1.00 60.41  ? 88  GLU E CD  1 
ATOM   7110  O OE1 . GLU E  1 88  ? 35.778  4.688   -28.456 1.00 61.64  ? 88  GLU E OE1 1 
ATOM   7111  O OE2 . GLU E  1 88  ? 35.350  3.682   -30.369 1.00 63.16  ? 88  GLU E OE2 1 
ATOM   7112  N N   . VAL E  1 89  ? 33.279  1.756   -24.064 1.00 46.05  ? 89  VAL E N   1 
ATOM   7113  C CA  . VAL E  1 89  ? 32.945  2.158   -22.706 1.00 45.66  ? 89  VAL E CA  1 
ATOM   7114  C C   . VAL E  1 89  ? 34.161  2.677   -21.954 1.00 47.85  ? 89  VAL E C   1 
ATOM   7115  O O   . VAL E  1 89  ? 35.225  2.059   -21.978 1.00 48.35  ? 89  VAL E O   1 
ATOM   7116  C CB  . VAL E  1 89  ? 32.323  1.002   -21.916 1.00 43.58  ? 89  VAL E CB  1 
ATOM   7117  C CG1 . VAL E  1 89  ? 32.048  1.437   -20.513 1.00 43.70  ? 89  VAL E CG1 1 
ATOM   7118  C CG2 . VAL E  1 89  ? 31.030  0.575   -22.568 1.00 44.86  ? 89  VAL E CG2 1 
ATOM   7119  N N   . THR E  1 90  ? 33.997  3.823   -21.297 1.00 49.07  ? 90  THR E N   1 
ATOM   7120  C CA  . THR E  1 90  ? 35.076  4.440   -20.533 1.00 48.54  ? 90  THR E CA  1 
ATOM   7121  C C   . THR E  1 90  ? 34.582  4.885   -19.163 1.00 48.78  ? 90  THR E C   1 
ATOM   7122  O O   . THR E  1 90  ? 33.516  5.489   -19.046 1.00 49.54  ? 90  THR E O   1 
ATOM   7123  C CB  . THR E  1 90  ? 35.659  5.667   -21.273 1.00 48.46  ? 90  THR E CB  1 
ATOM   7124  O OG1 . THR E  1 90  ? 36.359  5.234   -22.445 1.00 51.98  ? 90  THR E OG1 1 
ATOM   7125  C CG2 . THR E  1 90  ? 36.632  6.420   -20.386 1.00 49.83  ? 90  THR E CG2 1 
ATOM   7126  N N   . VAL E  1 91  ? 35.351  4.568   -18.125 1.00 48.13  ? 91  VAL E N   1 
ATOM   7127  C CA  . VAL E  1 91  ? 34.999  4.963   -16.761 1.00 46.78  ? 91  VAL E CA  1 
ATOM   7128  C C   . VAL E  1 91  ? 36.071  5.886   -16.196 1.00 47.50  ? 91  VAL E C   1 
ATOM   7129  O O   . VAL E  1 91  ? 37.233  5.490   -16.058 1.00 47.01  ? 91  VAL E O   1 
ATOM   7130  C CB  . VAL E  1 91  ? 34.879  3.760   -15.818 1.00 46.28  ? 91  VAL E CB  1 
ATOM   7131  C CG1 . VAL E  1 91  ? 34.575  4.249   -14.409 1.00 45.22  ? 91  VAL E CG1 1 
ATOM   7132  C CG2 . VAL E  1 91  ? 33.786  2.822   -16.296 1.00 46.76  ? 91  VAL E CG2 1 
ATOM   7133  N N   . LEU E  1 92  ? 35.681  7.114   -15.871 1.00 46.78  ? 92  LEU E N   1 
ATOM   7134  C CA  . LEU E  1 92  ? 36.620  8.082   -15.321 1.00 45.57  ? 92  LEU E CA  1 
ATOM   7135  C C   . LEU E  1 92  ? 35.975  8.854   -14.173 1.00 46.39  ? 92  LEU E C   1 
ATOM   7136  O O   . LEU E  1 92  ? 34.753  8.856   -14.022 1.00 46.49  ? 92  LEU E O   1 
ATOM   7137  C CB  . LEU E  1 92  ? 37.072  9.058   -16.412 1.00 44.59  ? 92  LEU E CB  1 
ATOM   7138  C CG  . LEU E  1 92  ? 36.027  10.024  -16.981 1.00 47.04  ? 92  LEU E CG  1 
ATOM   7139  C CD1 . LEU E  1 92  ? 36.743  11.130  -17.740 1.00 45.49  ? 92  LEU E CD1 1 
ATOM   7140  C CD2 . LEU E  1 92  ? 35.034  9.293   -17.889 1.00 46.36  ? 92  LEU E CD2 1 
ATOM   7141  N N   . SER E  1 93  ? 36.796  9.501   -13.353 1.00 46.30  ? 93  SER E N   1 
ATOM   7142  C CA  . SER E  1 93  ? 36.273  10.282  -12.239 1.00 45.32  ? 93  SER E CA  1 
ATOM   7143  C C   . SER E  1 93  ? 35.836  11.618  -12.815 1.00 45.19  ? 93  SER E C   1 
ATOM   7144  O O   . SER E  1 93  ? 36.473  12.149  -13.723 1.00 43.62  ? 93  SER E O   1 
ATOM   7145  C CB  . SER E  1 93  ? 37.352  10.509  -11.178 1.00 43.92  ? 93  SER E CB  1 
ATOM   7146  O OG  . SER E  1 93  ? 38.372  11.363  -11.676 1.00 43.08  ? 93  SER E OG  1 
ATOM   7147  N N   . ARG E  1 94  ? 34.748  12.166  -12.292 1.00 46.71  ? 94  ARG E N   1 
ATOM   7148  C CA  . ARG E  1 94  ? 34.263  13.438  -12.792 1.00 46.98  ? 94  ARG E CA  1 
ATOM   7149  C C   . ARG E  1 94  ? 35.242  14.539  -12.442 1.00 47.17  ? 94  ARG E C   1 
ATOM   7150  O O   . ARG E  1 94  ? 35.349  15.527  -13.157 1.00 47.33  ? 94  ARG E O   1 
ATOM   7151  C CB  . ARG E  1 94  ? 32.882  13.745  -12.218 1.00 49.50  ? 94  ARG E CB  1 
ATOM   7152  C CG  . ARG E  1 94  ? 32.397  15.139  -12.553 1.00 52.31  ? 94  ARG E CG  1 
ATOM   7153  C CD  . ARG E  1 94  ? 30.960  15.328  -12.145 1.00 55.16  ? 94  ARG E CD  1 
ATOM   7154  N NE  . ARG E  1 94  ? 30.553  16.719  -12.278 1.00 56.71  ? 94  ARG E NE  1 
ATOM   7155  C CZ  . ARG E  1 94  ? 31.014  17.704  -11.518 1.00 58.78  ? 94  ARG E CZ  1 
ATOM   7156  N NH1 . ARG E  1 94  ? 31.904  17.452  -10.563 1.00 57.50  ? 94  ARG E NH1 1 
ATOM   7157  N NH2 . ARG E  1 94  ? 30.572  18.941  -11.705 1.00 60.22  ? 94  ARG E NH2 1 
ATOM   7158  N N   . SER E  1 95  ? 35.952  14.365  -11.333 1.00 47.37  ? 95  SER E N   1 
ATOM   7159  C CA  . SER E  1 95  ? 36.948  15.341  -10.895 1.00 49.45  ? 95  SER E CA  1 
ATOM   7160  C C   . SER E  1 95  ? 38.024  14.670  -10.045 1.00 49.58  ? 95  SER E C   1 
ATOM   7161  O O   . SER E  1 95  ? 37.839  13.557  -9.556  1.00 50.00  ? 95  SER E O   1 
ATOM   7162  C CB  . SER E  1 95  ? 36.286  16.477  -10.105 1.00 50.30  ? 95  SER E CB  1 
ATOM   7163  O OG  . SER E  1 95  ? 35.590  15.991  -8.973  1.00 53.33  ? 95  SER E OG  1 
ATOM   7164  N N   . PRO E  1 96  ? 39.174  15.336  -9.873  1.00 49.85  ? 96  PRO E N   1 
ATOM   7165  C CA  . PRO E  1 96  ? 40.274  14.787  -9.076  1.00 49.86  ? 96  PRO E CA  1 
ATOM   7166  C C   . PRO E  1 96  ? 39.781  14.058  -7.823  1.00 49.58  ? 96  PRO E C   1 
ATOM   7167  O O   . PRO E  1 96  ? 38.960  14.575  -7.073  1.00 48.91  ? 96  PRO E O   1 
ATOM   7168  C CB  . PRO E  1 96  ? 41.094  16.026  -8.763  1.00 50.60  ? 96  PRO E CB  1 
ATOM   7169  C CG  . PRO E  1 96  ? 40.989  16.782  -10.067 1.00 50.42  ? 96  PRO E CG  1 
ATOM   7170  C CD  . PRO E  1 96  ? 39.506  16.687  -10.361 1.00 49.68  ? 96  PRO E CD  1 
ATOM   7171  N N   . VAL E  1 97  ? 40.289  12.851  -7.606  1.00 49.32  ? 97  VAL E N   1 
ATOM   7172  C CA  . VAL E  1 97  ? 39.865  12.040  -6.476  1.00 49.59  ? 97  VAL E CA  1 
ATOM   7173  C C   . VAL E  1 97  ? 40.764  12.113  -5.248  1.00 51.43  ? 97  VAL E C   1 
ATOM   7174  O O   . VAL E  1 97  ? 41.963  11.846  -5.322  1.00 51.54  ? 97  VAL E O   1 
ATOM   7175  C CB  . VAL E  1 97  ? 39.745  10.565  -6.883  1.00 48.04  ? 97  VAL E CB  1 
ATOM   7176  C CG1 . VAL E  1 97  ? 39.192  9.750   -5.728  1.00 48.60  ? 97  VAL E CG1 1 
ATOM   7177  C CG2 . VAL E  1 97  ? 38.853  10.435  -8.083  1.00 47.30  ? 97  VAL E CG2 1 
ATOM   7178  N N   . ASN E  1 98  ? 40.159  12.454  -4.114  1.00 52.53  ? 98  ASN E N   1 
ATOM   7179  C CA  . ASN E  1 98  ? 40.871  12.547  -2.847  1.00 53.33  ? 98  ASN E CA  1 
ATOM   7180  C C   . ASN E  1 98  ? 40.174  11.656  -1.839  1.00 54.32  ? 98  ASN E C   1 
ATOM   7181  O O   . ASN E  1 98  ? 38.963  11.747  -1.675  1.00 55.75  ? 98  ASN E O   1 
ATOM   7182  C CB  . ASN E  1 98  ? 40.871  13.988  -2.354  1.00 53.24  ? 98  ASN E CB  1 
ATOM   7183  C CG  . ASN E  1 98  ? 41.561  14.917  -3.318  1.00 55.16  ? 98  ASN E CG  1 
ATOM   7184  O OD1 . ASN E  1 98  ? 42.711  14.686  -3.688  1.00 55.07  ? 98  ASN E OD1 1 
ATOM   7185  N ND2 . ASN E  1 98  ? 40.866  15.970  -3.741  1.00 54.32  ? 98  ASN E ND2 1 
ATOM   7186  N N   . LEU E  1 99  ? 40.929  10.785  -1.173  1.00 55.65  ? 99  LEU E N   1 
ATOM   7187  C CA  . LEU E  1 99  ? 40.340  9.889   -0.177  1.00 55.47  ? 99  LEU E CA  1 
ATOM   7188  C C   . LEU E  1 99  ? 39.334  10.592  0.725   1.00 54.30  ? 99  LEU E C   1 
ATOM   7189  O O   . LEU E  1 99  ? 39.509  11.765  1.081   1.00 53.73  ? 99  LEU E O   1 
ATOM   7190  C CB  . LEU E  1 99  ? 41.422  9.262   0.703   1.00 57.22  ? 99  LEU E CB  1 
ATOM   7191  C CG  . LEU E  1 99  ? 42.312  8.168   0.118   1.00 60.63  ? 99  LEU E CG  1 
ATOM   7192  C CD1 . LEU E  1 99  ? 43.177  7.580   1.237   1.00 61.14  ? 99  LEU E CD1 1 
ATOM   7193  C CD2 . LEU E  1 99  ? 41.450  7.076   -0.510  1.00 60.73  ? 99  LEU E CD2 1 
ATOM   7194  N N   . GLY E  1 100 ? 38.280  9.859   1.080   1.00 53.59  ? 100 GLY E N   1 
ATOM   7195  C CA  . GLY E  1 100 ? 37.243  10.381  1.955   1.00 54.19  ? 100 GLY E CA  1 
ATOM   7196  C C   . GLY E  1 100 ? 36.421  11.540  1.420   1.00 54.20  ? 100 GLY E C   1 
ATOM   7197  O O   . GLY E  1 100 ? 35.459  11.965  2.063   1.00 56.08  ? 100 GLY E O   1 
ATOM   7198  N N   . GLU E  1 101 ? 36.791  12.057  0.253   1.00 53.00  ? 101 GLU E N   1 
ATOM   7199  C CA  . GLU E  1 101 ? 36.069  13.173  -0.344  1.00 51.96  ? 101 GLU E CA  1 
ATOM   7200  C C   . GLU E  1 101 ? 35.123  12.715  -1.461  1.00 50.94  ? 101 GLU E C   1 
ATOM   7201  O O   . GLU E  1 101 ? 35.560  12.375  -2.569  1.00 48.84  ? 101 GLU E O   1 
ATOM   7202  C CB  . GLU E  1 101 ? 37.056  14.214  -0.884  1.00 54.04  ? 101 GLU E CB  1 
ATOM   7203  C CG  . GLU E  1 101 ? 37.746  15.046  0.191   1.00 56.94  ? 101 GLU E CG  1 
ATOM   7204  C CD  . GLU E  1 101 ? 38.670  16.117  -0.399  1.00 58.62  ? 101 GLU E CD  1 
ATOM   7205  O OE1 . GLU E  1 101 ? 38.318  16.697  -1.452  1.00 58.17  ? 101 GLU E OE1 1 
ATOM   7206  O OE2 . GLU E  1 101 ? 39.742  16.386  0.196   1.00 58.75  ? 101 GLU E OE2 1 
ATOM   7207  N N   . PRO E  1 102 ? 33.808  12.699  -1.173  1.00 48.97  ? 102 PRO E N   1 
ATOM   7208  C CA  . PRO E  1 102 ? 32.763  12.291  -2.115  1.00 48.24  ? 102 PRO E CA  1 
ATOM   7209  C C   . PRO E  1 102 ? 32.930  12.857  -3.530  1.00 47.60  ? 102 PRO E C   1 
ATOM   7210  O O   . PRO E  1 102 ? 33.002  14.077  -3.747  1.00 46.40  ? 102 PRO E O   1 
ATOM   7211  C CB  . PRO E  1 102 ? 31.489  12.762  -1.426  1.00 48.75  ? 102 PRO E CB  1 
ATOM   7212  C CG  . PRO E  1 102 ? 31.816  12.484  0.021   1.00 47.56  ? 102 PRO E CG  1 
ATOM   7213  C CD  . PRO E  1 102 ? 33.224  13.023  0.142   1.00 47.16  ? 102 PRO E CD  1 
ATOM   7214  N N   . ASN E  1 103 ? 32.988  11.943  -4.489  1.00 45.33  ? 103 ASN E N   1 
ATOM   7215  C CA  . ASN E  1 103 ? 33.171  12.299  -5.883  1.00 45.81  ? 103 ASN E CA  1 
ATOM   7216  C C   . ASN E  1 103 ? 32.124  11.567  -6.734  1.00 47.09  ? 103 ASN E C   1 
ATOM   7217  O O   . ASN E  1 103 ? 31.148  11.000  -6.212  1.00 48.60  ? 103 ASN E O   1 
ATOM   7218  C CB  . ASN E  1 103 ? 34.581  11.903  -6.333  1.00 42.71  ? 103 ASN E CB  1 
ATOM   7219  C CG  . ASN E  1 103 ? 35.084  12.739  -7.495  1.00 43.93  ? 103 ASN E CG  1 
ATOM   7220  O OD1 . ASN E  1 103 ? 34.424  12.850  -8.532  1.00 40.90  ? 103 ASN E OD1 1 
ATOM   7221  N ND2 . ASN E  1 103 ? 36.269  13.328  -7.331  1.00 41.06  ? 103 ASN E ND2 1 
ATOM   7222  N N   . ILE E  1 104 ? 32.350  11.570  -8.042  1.00 45.61  ? 104 ILE E N   1 
ATOM   7223  C CA  . ILE E  1 104 ? 31.440  10.945  -8.987  1.00 43.83  ? 104 ILE E CA  1 
ATOM   7224  C C   . ILE E  1 104 ? 32.165  10.132  -10.052 1.00 41.87  ? 104 ILE E C   1 
ATOM   7225  O O   . ILE E  1 104 ? 33.135  10.594  -10.646 1.00 41.14  ? 104 ILE E O   1 
ATOM   7226  C CB  . ILE E  1 104 ? 30.593  12.025  -9.715  1.00 44.59  ? 104 ILE E CB  1 
ATOM   7227  C CG1 . ILE E  1 104 ? 29.675  12.729  -8.713  1.00 44.97  ? 104 ILE E CG1 1 
ATOM   7228  C CG2 . ILE E  1 104 ? 29.784  11.400  -10.846 1.00 44.23  ? 104 ILE E CG2 1 
ATOM   7229  C CD1 . ILE E  1 104 ? 28.833  13.820  -9.333  1.00 42.18  ? 104 ILE E CD1 1 
ATOM   7230  N N   . LEU E  1 105 ? 31.694  8.917   -10.288 1.00 40.21  ? 105 LEU E N   1 
ATOM   7231  C CA  . LEU E  1 105 ? 32.272  8.108   -11.338 1.00 39.37  ? 105 LEU E CA  1 
ATOM   7232  C C   . LEU E  1 105 ? 31.403  8.309   -12.579 1.00 40.09  ? 105 LEU E C   1 
ATOM   7233  O O   . LEU E  1 105 ? 30.170  8.347   -12.501 1.00 41.68  ? 105 LEU E O   1 
ATOM   7234  C CB  . LEU E  1 105 ? 32.310  6.633   -10.949 1.00 37.98  ? 105 LEU E CB  1 
ATOM   7235  C CG  . LEU E  1 105 ? 33.481  6.221   -10.050 1.00 39.69  ? 105 LEU E CG  1 
ATOM   7236  C CD1 . LEU E  1 105 ? 33.565  4.707   -9.978  1.00 38.38  ? 105 LEU E CD1 1 
ATOM   7237  C CD2 . LEU E  1 105 ? 34.780  6.771   -10.620 1.00 38.89  ? 105 LEU E CD2 1 
ATOM   7238  N N   . ILE E  1 106 ? 32.055  8.461   -13.722 1.00 39.18  ? 106 ILE E N   1 
ATOM   7239  C CA  . ILE E  1 106 ? 31.361  8.652   -14.980 1.00 37.02  ? 106 ILE E CA  1 
ATOM   7240  C C   . ILE E  1 106 ? 31.506  7.426   -15.864 1.00 38.29  ? 106 ILE E C   1 
ATOM   7241  O O   . ILE E  1 106 ? 32.622  6.971   -16.125 1.00 39.33  ? 106 ILE E O   1 
ATOM   7242  C CB  . ILE E  1 106 ? 31.935  9.838   -15.769 1.00 34.69  ? 106 ILE E CB  1 
ATOM   7243  C CG1 . ILE E  1 106 ? 31.629  11.159  -15.055 1.00 34.40  ? 106 ILE E CG1 1 
ATOM   7244  C CG2 . ILE E  1 106 ? 31.375  9.828   -17.171 1.00 32.21  ? 106 ILE E CG2 1 
ATOM   7245  C CD1 . ILE E  1 106 ? 32.136  12.377  -15.825 1.00 33.88  ? 106 ILE E CD1 1 
ATOM   7246  N N   . CYS E  1 107 ? 30.391  6.872   -16.318 1.00 37.47  ? 107 CYS E N   1 
ATOM   7247  C CA  . CYS E  1 107 ? 30.495  5.748   -17.226 1.00 38.01  ? 107 CYS E CA  1 
ATOM   7248  C C   . CYS E  1 107 ? 30.081  6.291   -18.592 1.00 36.40  ? 107 CYS E C   1 
ATOM   7249  O O   . CYS E  1 107 ? 28.897  6.474   -18.859 1.00 36.82  ? 107 CYS E O   1 
ATOM   7250  C CB  . CYS E  1 107 ? 29.582  4.607   -16.807 1.00 39.60  ? 107 CYS E CB  1 
ATOM   7251  S SG  . CYS E  1 107 ? 29.910  3.116   -17.794 1.00 46.77  ? 107 CYS E SG  1 
ATOM   7252  N N   . PHE E  1 108 ? 31.072  6.577   -19.434 1.00 35.18  ? 108 PHE E N   1 
ATOM   7253  C CA  . PHE E  1 108 ? 30.852  7.106   -20.778 1.00 32.77  ? 108 PHE E CA  1 
ATOM   7254  C C   . PHE E  1 108 ? 30.670  5.986   -21.797 1.00 33.20  ? 108 PHE E C   1 
ATOM   7255  O O   . PHE E  1 108 ? 31.580  5.182   -22.030 1.00 30.78  ? 108 PHE E O   1 
ATOM   7256  C CB  . PHE E  1 108 ? 32.027  7.986   -21.191 1.00 31.31  ? 108 PHE E CB  1 
ATOM   7257  C CG  . PHE E  1 108 ? 31.819  8.704   -22.485 1.00 30.80  ? 108 PHE E CG  1 
ATOM   7258  C CD1 . PHE E  1 108 ? 30.650  9.431   -22.714 1.00 31.41  ? 108 PHE E CD1 1 
ATOM   7259  C CD2 . PHE E  1 108 ? 32.800  8.684   -23.469 1.00 30.65  ? 108 PHE E CD2 1 
ATOM   7260  C CE1 . PHE E  1 108 ? 30.462  10.128  -23.909 1.00 28.81  ? 108 PHE E CE1 1 
ATOM   7261  C CE2 . PHE E  1 108 ? 32.626  9.374   -24.664 1.00 30.51  ? 108 PHE E CE2 1 
ATOM   7262  C CZ  . PHE E  1 108 ? 31.453  10.098  -24.887 1.00 31.52  ? 108 PHE E CZ  1 
ATOM   7263  N N   . ILE E  1 109 ? 29.480  5.952   -22.395 1.00 32.06  ? 109 ILE E N   1 
ATOM   7264  C CA  . ILE E  1 109 ? 29.103  4.954   -23.393 1.00 29.93  ? 109 ILE E CA  1 
ATOM   7265  C C   . ILE E  1 109 ? 29.023  5.690   -24.741 1.00 30.59  ? 109 ILE E C   1 
ATOM   7266  O O   . ILE E  1 109 ? 28.187  6.570   -24.924 1.00 31.91  ? 109 ILE E O   1 
ATOM   7267  C CB  . ILE E  1 109 ? 27.782  4.359   -22.956 1.00 27.87  ? 109 ILE E CB  1 
ATOM   7268  C CG1 . ILE E  1 109 ? 27.874  4.092   -21.455 1.00 27.43  ? 109 ILE E CG1 1 
ATOM   7269  C CG2 . ILE E  1 109 ? 27.491  3.076   -23.685 1.00 26.57  ? 109 ILE E CG2 1 
ATOM   7270  C CD1 . ILE E  1 109 ? 26.706  3.345   -20.862 1.00 30.19  ? 109 ILE E CD1 1 
ATOM   7271  N N   . ASP E  1 110 ? 29.896  5.327   -25.677 1.00 31.16  ? 110 ASP E N   1 
ATOM   7272  C CA  . ASP E  1 110 ? 29.998  6.022   -26.967 1.00 32.19  ? 110 ASP E CA  1 
ATOM   7273  C C   . ASP E  1 110 ? 29.926  5.144   -28.236 1.00 32.21  ? 110 ASP E C   1 
ATOM   7274  O O   . ASP E  1 110 ? 30.174  3.943   -28.189 1.00 33.01  ? 110 ASP E O   1 
ATOM   7275  C CB  . ASP E  1 110 ? 31.334  6.786   -26.949 1.00 32.51  ? 110 ASP E CB  1 
ATOM   7276  C CG  . ASP E  1 110 ? 31.355  8.000   -27.861 1.00 37.88  ? 110 ASP E CG  1 
ATOM   7277  O OD1 . ASP E  1 110 ? 30.313  8.365   -28.444 1.00 39.65  ? 110 ASP E OD1 1 
ATOM   7278  O OD2 . ASP E  1 110 ? 32.440  8.609   -27.981 1.00 40.32  ? 110 ASP E OD2 1 
ATOM   7279  N N   . LYS E  1 111 ? 29.601  5.766   -29.368 1.00 32.83  ? 111 LYS E N   1 
ATOM   7280  C CA  . LYS E  1 111 ? 29.538  5.100   -30.682 1.00 34.74  ? 111 LYS E CA  1 
ATOM   7281  C C   . LYS E  1 111 ? 28.738  3.798   -30.804 1.00 34.14  ? 111 LYS E C   1 
ATOM   7282  O O   . LYS E  1 111 ? 29.252  2.779   -31.272 1.00 32.57  ? 111 LYS E O   1 
ATOM   7283  C CB  . LYS E  1 111 ? 30.963  4.849   -31.206 1.00 37.64  ? 111 LYS E CB  1 
ATOM   7284  C CG  . LYS E  1 111 ? 31.769  6.115   -31.404 1.00 43.57  ? 111 LYS E CG  1 
ATOM   7285  C CD  . LYS E  1 111 ? 33.232  5.845   -31.715 1.00 46.85  ? 111 LYS E CD  1 
ATOM   7286  C CE  . LYS E  1 111 ? 34.029  7.153   -31.578 1.00 49.76  ? 111 LYS E CE  1 
ATOM   7287  N NZ  . LYS E  1 111 ? 35.515  6.974   -31.579 1.00 52.35  ? 111 LYS E NZ  1 
ATOM   7288  N N   . PHE E  1 112 ? 27.475  3.820   -30.410 1.00 30.62  ? 112 PHE E N   1 
ATOM   7289  C CA  . PHE E  1 112 ? 26.691  2.605   -30.526 1.00 30.96  ? 112 PHE E CA  1 
ATOM   7290  C C   . PHE E  1 112 ? 25.318  2.870   -31.125 1.00 30.50  ? 112 PHE E C   1 
ATOM   7291  O O   . PHE E  1 112 ? 24.901  4.021   -31.290 1.00 31.02  ? 112 PHE E O   1 
ATOM   7292  C CB  . PHE E  1 112 ? 26.515  1.955   -29.164 1.00 28.08  ? 112 PHE E CB  1 
ATOM   7293  C CG  . PHE E  1 112 ? 25.801  2.825   -28.176 1.00 28.20  ? 112 PHE E CG  1 
ATOM   7294  C CD1 . PHE E  1 112 ? 26.486  3.814   -27.479 1.00 26.60  ? 112 PHE E CD1 1 
ATOM   7295  C CD2 . PHE E  1 112 ? 24.452  2.625   -27.910 1.00 25.91  ? 112 PHE E CD2 1 
ATOM   7296  C CE1 . PHE E  1 112 ? 25.843  4.589   -26.522 1.00 28.83  ? 112 PHE E CE1 1 
ATOM   7297  C CE2 . PHE E  1 112 ? 23.795  3.388   -26.957 1.00 27.68  ? 112 PHE E CE2 1 
ATOM   7298  C CZ  . PHE E  1 112 ? 24.487  4.373   -26.257 1.00 29.63  ? 112 PHE E CZ  1 
ATOM   7299  N N   . SER E  1 113 ? 24.624  1.783   -31.436 1.00 29.36  ? 113 SER E N   1 
ATOM   7300  C CA  . SER E  1 113 ? 23.289  1.850   -31.998 1.00 30.35  ? 113 SER E CA  1 
ATOM   7301  C C   . SER E  1 113 ? 22.812  0.410   -32.096 1.00 29.88  ? 113 SER E C   1 
ATOM   7302  O O   . SER E  1 113 ? 23.602  -0.491  -32.380 1.00 30.95  ? 113 SER E O   1 
ATOM   7303  C CB  . SER E  1 113 ? 23.336  2.511   -33.380 1.00 30.01  ? 113 SER E CB  1 
ATOM   7304  O OG  . SER E  1 113 ? 22.042  2.906   -33.782 1.00 30.94  ? 113 SER E OG  1 
ATOM   7305  N N   . PRO E  1 114 ? 21.521  0.164   -31.864 1.00 28.88  ? 114 PRO E N   1 
ATOM   7306  C CA  . PRO E  1 114 ? 20.448  1.096   -31.524 1.00 31.67  ? 114 PRO E CA  1 
ATOM   7307  C C   . PRO E  1 114 ? 20.598  1.764   -30.162 1.00 34.49  ? 114 PRO E C   1 
ATOM   7308  O O   . PRO E  1 114 ? 21.419  1.352   -29.335 1.00 35.43  ? 114 PRO E O   1 
ATOM   7309  C CB  . PRO E  1 114 ? 19.206  0.217   -31.584 1.00 31.14  ? 114 PRO E CB  1 
ATOM   7310  C CG  . PRO E  1 114 ? 19.714  -1.095  -31.139 1.00 30.87  ? 114 PRO E CG  1 
ATOM   7311  C CD  . PRO E  1 114 ? 21.013  -1.216  -31.891 1.00 29.28  ? 114 PRO E CD  1 
ATOM   7312  N N   . PRO E  1 115 ? 19.800  2.815   -29.912 1.00 34.33  ? 115 PRO E N   1 
ATOM   7313  C CA  . PRO E  1 115 ? 19.843  3.541   -28.644 1.00 34.16  ? 115 PRO E CA  1 
ATOM   7314  C C   . PRO E  1 115 ? 19.117  2.804   -27.535 1.00 34.78  ? 115 PRO E C   1 
ATOM   7315  O O   . PRO E  1 115 ? 18.043  3.208   -27.102 1.00 37.45  ? 115 PRO E O   1 
ATOM   7316  C CB  . PRO E  1 115 ? 19.192  4.872   -28.995 1.00 33.37  ? 115 PRO E CB  1 
ATOM   7317  C CG  . PRO E  1 115 ? 18.181  4.465   -30.014 1.00 33.22  ? 115 PRO E CG  1 
ATOM   7318  C CD  . PRO E  1 115 ? 18.981  3.540   -30.894 1.00 33.49  ? 115 PRO E CD  1 
ATOM   7319  N N   . VAL E  1 116 ? 19.703  1.696   -27.105 1.00 36.83  ? 116 VAL E N   1 
ATOM   7320  C CA  . VAL E  1 116 ? 19.159  0.879   -26.021 1.00 38.39  ? 116 VAL E CA  1 
ATOM   7321  C C   . VAL E  1 116 ? 20.344  0.209   -25.343 1.00 38.19  ? 116 VAL E C   1 
ATOM   7322  O O   . VAL E  1 116 ? 21.200  -0.351  -26.010 1.00 38.69  ? 116 VAL E O   1 
ATOM   7323  C CB  . VAL E  1 116 ? 18.208  -0.243  -26.521 1.00 39.70  ? 116 VAL E CB  1 
ATOM   7324  C CG1 . VAL E  1 116 ? 16.801  -0.011  -25.989 1.00 41.67  ? 116 VAL E CG1 1 
ATOM   7325  C CG2 . VAL E  1 116 ? 18.200  -0.292  -28.030 1.00 40.75  ? 116 VAL E CG2 1 
ATOM   7326  N N   . VAL E  1 117 ? 20.406  0.279   -24.020 1.00 40.68  ? 117 VAL E N   1 
ATOM   7327  C CA  . VAL E  1 117 ? 21.502  -0.355  -23.291 1.00 43.19  ? 117 VAL E CA  1 
ATOM   7328  C C   . VAL E  1 117 ? 21.131  -0.651  -21.854 1.00 44.53  ? 117 VAL E C   1 
ATOM   7329  O O   . VAL E  1 117 ? 20.274  0.008   -21.274 1.00 46.64  ? 117 VAL E O   1 
ATOM   7330  C CB  . VAL E  1 117 ? 22.785  0.528   -23.253 1.00 42.06  ? 117 VAL E CB  1 
ATOM   7331  C CG1 . VAL E  1 117 ? 23.469  0.517   -24.592 1.00 43.45  ? 117 VAL E CG1 1 
ATOM   7332  C CG2 . VAL E  1 117 ? 22.428  1.949   -22.846 1.00 40.58  ? 117 VAL E CG2 1 
ATOM   7333  N N   . ASN E  1 118 ? 21.779  -1.662  -21.295 1.00 46.85  ? 118 ASN E N   1 
ATOM   7334  C CA  . ASN E  1 118 ? 21.579  -2.031  -19.907 1.00 47.10  ? 118 ASN E CA  1 
ATOM   7335  C C   . ASN E  1 118 ? 22.896  -1.713  -19.222 1.00 45.96  ? 118 ASN E C   1 
ATOM   7336  O O   . ASN E  1 118 ? 23.950  -2.224  -19.608 1.00 44.93  ? 118 ASN E O   1 
ATOM   7337  C CB  . ASN E  1 118 ? 21.265  -3.519  -19.762 1.00 51.35  ? 118 ASN E CB  1 
ATOM   7338  C CG  . ASN E  1 118 ? 19.895  -3.871  -20.271 1.00 57.28  ? 118 ASN E CG  1 
ATOM   7339  O OD1 . ASN E  1 118 ? 18.920  -3.143  -20.034 1.00 57.18  ? 118 ASN E OD1 1 
ATOM   7340  N ND2 . ASN E  1 118 ? 19.813  -5.007  -20.955 1.00 62.68  ? 118 ASN E ND2 1 
ATOM   7341  N N   . VAL E  1 119 ? 22.828  -0.857  -18.212 1.00 44.78  ? 119 VAL E N   1 
ATOM   7342  C CA  . VAL E  1 119 ? 24.005  -0.452  -17.477 1.00 43.53  ? 119 VAL E CA  1 
ATOM   7343  C C   . VAL E  1 119 ? 23.854  -0.845  -16.018 1.00 43.82  ? 119 VAL E C   1 
ATOM   7344  O O   . VAL E  1 119 ? 22.831  -0.582  -15.395 1.00 43.04  ? 119 VAL E O   1 
ATOM   7345  C CB  . VAL E  1 119 ? 24.201  1.065   -17.602 1.00 43.65  ? 119 VAL E CB  1 
ATOM   7346  C CG1 . VAL E  1 119 ? 25.453  1.505   -16.869 1.00 42.43  ? 119 VAL E CG1 1 
ATOM   7347  C CG2 . VAL E  1 119 ? 24.274  1.434   -19.068 1.00 42.18  ? 119 VAL E CG2 1 
ATOM   7348  N N   . THR E  1 120 ? 24.878  -1.500  -15.488 1.00 45.15  ? 120 THR E N   1 
ATOM   7349  C CA  . THR E  1 120 ? 24.888  -1.937  -14.098 1.00 45.69  ? 120 THR E CA  1 
ATOM   7350  C C   . THR E  1 120 ? 26.163  -1.429  -13.453 1.00 45.44  ? 120 THR E C   1 
ATOM   7351  O O   . THR E  1 120 ? 27.261  -1.726  -13.922 1.00 44.77  ? 120 THR E O   1 
ATOM   7352  C CB  . THR E  1 120 ? 24.884  -3.482  -13.975 1.00 48.37  ? 120 THR E CB  1 
ATOM   7353  O OG1 . THR E  1 120 ? 23.680  -4.013  -14.549 1.00 50.98  ? 120 THR E OG1 1 
ATOM   7354  C CG2 . THR E  1 120 ? 24.971  -3.904  -12.510 1.00 47.87  ? 120 THR E CG2 1 
ATOM   7355  N N   . TRP E  1 121 ? 26.011  -0.641  -12.396 1.00 45.41  ? 121 TRP E N   1 
ATOM   7356  C CA  . TRP E  1 121 ? 27.156  -0.123  -11.668 1.00 46.07  ? 121 TRP E CA  1 
ATOM   7357  C C   . TRP E  1 121 ? 27.521  -1.162  -10.613 1.00 47.57  ? 121 TRP E C   1 
ATOM   7358  O O   . TRP E  1 121 ? 26.644  -1.731  -9.951  1.00 45.64  ? 121 TRP E O   1 
ATOM   7359  C CB  . TRP E  1 121 ? 26.807  1.191   -10.986 1.00 44.64  ? 121 TRP E CB  1 
ATOM   7360  C CG  . TRP E  1 121 ? 27.105  2.408   -11.797 1.00 42.57  ? 121 TRP E CG  1 
ATOM   7361  C CD1 . TRP E  1 121 ? 26.204  3.318   -12.266 1.00 40.97  ? 121 TRP E CD1 1 
ATOM   7362  C CD2 . TRP E  1 121 ? 28.401  2.921   -12.125 1.00 42.12  ? 121 TRP E CD2 1 
ATOM   7363  N NE1 . TRP E  1 121 ? 26.860  4.372   -12.855 1.00 39.65  ? 121 TRP E NE1 1 
ATOM   7364  C CE2 . TRP E  1 121 ? 28.209  4.155   -12.780 1.00 39.34  ? 121 TRP E CE2 1 
ATOM   7365  C CE3 . TRP E  1 121 ? 29.710  2.457   -11.925 1.00 44.18  ? 121 TRP E CE3 1 
ATOM   7366  C CZ2 . TRP E  1 121 ? 29.271  4.935   -13.233 1.00 41.45  ? 121 TRP E CZ2 1 
ATOM   7367  C CZ3 . TRP E  1 121 ? 30.771  3.236   -12.379 1.00 41.98  ? 121 TRP E CZ3 1 
ATOM   7368  C CH2 . TRP E  1 121 ? 30.544  4.460   -13.023 1.00 42.82  ? 121 TRP E CH2 1 
ATOM   7369  N N   . LEU E  1 122 ? 28.814  -1.417  -10.458 1.00 49.60  ? 122 LEU E N   1 
ATOM   7370  C CA  . LEU E  1 122 ? 29.256  -2.402  -9.487  1.00 53.51  ? 122 LEU E CA  1 
ATOM   7371  C C   . LEU E  1 122 ? 30.324  -1.882  -8.549  1.00 55.68  ? 122 LEU E C   1 
ATOM   7372  O O   . LEU E  1 122 ? 31.347  -1.350  -8.982  1.00 56.26  ? 122 LEU E O   1 
ATOM   7373  C CB  . LEU E  1 122 ? 29.759  -3.649  -10.209 1.00 55.01  ? 122 LEU E CB  1 
ATOM   7374  C CG  . LEU E  1 122 ? 28.627  -4.437  -10.874 1.00 57.23  ? 122 LEU E CG  1 
ATOM   7375  C CD1 . LEU E  1 122 ? 29.169  -5.350  -11.963 1.00 59.52  ? 122 LEU E CD1 1 
ATOM   7376  C CD2 . LEU E  1 122 ? 27.885  -5.223  -9.807  1.00 56.81  ? 122 LEU E CD2 1 
ATOM   7377  N N   . ARG E  1 123 ? 30.051  -2.027  -7.256  1.00 57.93  ? 123 ARG E N   1 
ATOM   7378  C CA  . ARG E  1 123 ? 30.970  -1.622  -6.200  1.00 59.84  ? 123 ARG E CA  1 
ATOM   7379  C C   . ARG E  1 123 ? 31.402  -2.913  -5.516  1.00 60.32  ? 123 ARG E C   1 
ATOM   7380  O O   . ARG E  1 123 ? 30.567  -3.665  -5.002  1.00 59.15  ? 123 ARG E O   1 
ATOM   7381  C CB  . ARG E  1 123 ? 30.273  -0.709  -5.190  1.00 61.76  ? 123 ARG E CB  1 
ATOM   7382  C CG  . ARG E  1 123 ? 31.053  -0.504  -3.899  1.00 64.55  ? 123 ARG E CG  1 
ATOM   7383  C CD  . ARG E  1 123 ? 30.277  0.364   -2.933  1.00 66.18  ? 123 ARG E CD  1 
ATOM   7384  N NE  . ARG E  1 123 ? 30.094  1.707   -3.472  1.00 69.83  ? 123 ARG E NE  1 
ATOM   7385  C CZ  . ARG E  1 123 ? 29.297  2.630   -2.943  1.00 70.58  ? 123 ARG E CZ  1 
ATOM   7386  N NH1 . ARG E  1 123 ? 28.596  2.354   -1.848  1.00 70.90  ? 123 ARG E NH1 1 
ATOM   7387  N NH2 . ARG E  1 123 ? 29.200  3.827   -3.513  1.00 70.31  ? 123 ARG E NH2 1 
ATOM   7388  N N   . ASN E  1 124 ? 32.705  -3.166  -5.522  1.00 60.34  ? 124 ASN E N   1 
ATOM   7389  C CA  . ASN E  1 124 ? 33.248  -4.376  -4.924  1.00 61.60  ? 124 ASN E CA  1 
ATOM   7390  C C   . ASN E  1 124 ? 32.490  -5.599  -5.432  1.00 63.67  ? 124 ASN E C   1 
ATOM   7391  O O   . ASN E  1 124 ? 32.164  -6.514  -4.665  1.00 63.27  ? 124 ASN E O   1 
ATOM   7392  C CB  . ASN E  1 124 ? 33.177  -4.300  -3.397  1.00 60.12  ? 124 ASN E CB  1 
ATOM   7393  C CG  . ASN E  1 124 ? 34.001  -3.158  -2.837  1.00 59.94  ? 124 ASN E CG  1 
ATOM   7394  O OD1 . ASN E  1 124 ? 35.128  -2.929  -3.271  1.00 58.80  ? 124 ASN E OD1 1 
ATOM   7395  N ND2 . ASN E  1 124 ? 33.446  -2.439  -1.869  1.00 60.17  ? 124 ASN E ND2 1 
ATOM   7396  N N   . GLY E  1 125 ? 32.209  -5.598  -6.734  1.00 64.56  ? 125 GLY E N   1 
ATOM   7397  C CA  . GLY E  1 125 ? 31.501  -6.705  -7.348  1.00 65.43  ? 125 GLY E CA  1 
ATOM   7398  C C   . GLY E  1 125 ? 30.044  -6.821  -6.947  1.00 66.93  ? 125 GLY E C   1 
ATOM   7399  O O   . GLY E  1 125 ? 29.408  -7.848  -7.181  1.00 68.79  ? 125 GLY E O   1 
ATOM   7400  N N   . ARG E  1 126 ? 29.499  -5.776  -6.343  1.00 67.86  ? 126 ARG E N   1 
ATOM   7401  C CA  . ARG E  1 126 ? 28.104  -5.820  -5.937  1.00 68.37  ? 126 ARG E CA  1 
ATOM   7402  C C   . ARG E  1 126 ? 27.277  -4.734  -6.627  1.00 67.91  ? 126 ARG E C   1 
ATOM   7403  O O   . ARG E  1 126 ? 27.679  -3.569  -6.684  1.00 67.60  ? 126 ARG E O   1 
ATOM   7404  C CB  . ARG E  1 126 ? 27.996  -5.692  -4.415  1.00 69.45  ? 126 ARG E CB  1 
ATOM   7405  C CG  . ARG E  1 126 ? 26.574  -5.758  -3.886  1.00 72.20  ? 126 ARG E CG  1 
ATOM   7406  C CD  . ARG E  1 126 ? 26.561  -6.197  -2.435  1.00 74.52  ? 126 ARG E CD  1 
ATOM   7407  N NE  . ARG E  1 126 ? 27.159  -7.520  -2.299  1.00 76.85  ? 126 ARG E NE  1 
ATOM   7408  C CZ  . ARG E  1 126 ? 26.643  -8.629  -2.819  1.00 77.70  ? 126 ARG E CZ  1 
ATOM   7409  N NH1 . ARG E  1 126 ? 25.510  -8.583  -3.505  1.00 77.63  ? 126 ARG E NH1 1 
ATOM   7410  N NH2 . ARG E  1 126 ? 27.272  -9.785  -2.674  1.00 79.44  ? 126 ARG E NH2 1 
ATOM   7411  N N   . PRO E  1 127 ? 26.113  -5.117  -7.182  1.00 67.83  ? 127 PRO E N   1 
ATOM   7412  C CA  . PRO E  1 127 ? 25.203  -4.200  -7.877  1.00 67.22  ? 127 PRO E CA  1 
ATOM   7413  C C   . PRO E  1 127 ? 24.846  -3.017  -6.987  1.00 67.63  ? 127 PRO E C   1 
ATOM   7414  O O   . PRO E  1 127 ? 24.533  -3.187  -5.806  1.00 68.57  ? 127 PRO E O   1 
ATOM   7415  C CB  . PRO E  1 127 ? 23.996  -5.081  -8.177  1.00 67.92  ? 127 PRO E CB  1 
ATOM   7416  C CG  . PRO E  1 127 ? 24.615  -6.428  -8.381  1.00 67.84  ? 127 PRO E CG  1 
ATOM   7417  C CD  . PRO E  1 127 ? 25.593  -6.496  -7.231  1.00 68.38  ? 127 PRO E CD  1 
ATOM   7418  N N   . VAL E  1 128 ? 24.890  -1.820  -7.555  1.00 66.46  ? 128 VAL E N   1 
ATOM   7419  C CA  . VAL E  1 128 ? 24.587  -0.617  -6.796  1.00 65.09  ? 128 VAL E CA  1 
ATOM   7420  C C   . VAL E  1 128 ? 23.416  0.148   -7.399  1.00 65.78  ? 128 VAL E C   1 
ATOM   7421  O O   . VAL E  1 128 ? 23.377  0.374   -8.609  1.00 66.66  ? 128 VAL E O   1 
ATOM   7422  C CB  . VAL E  1 128 ? 25.808  0.308   -6.756  1.00 65.38  ? 128 VAL E CB  1 
ATOM   7423  C CG1 . VAL E  1 128 ? 25.518  1.512   -5.881  1.00 64.94  ? 128 VAL E CG1 1 
ATOM   7424  C CG2 . VAL E  1 128 ? 27.016  -0.460  -6.245  1.00 65.18  ? 128 VAL E CG2 1 
ATOM   7425  N N   . THR E  1 129 ? 22.468  0.553   -6.553  1.00 65.23  ? 129 THR E N   1 
ATOM   7426  C CA  . THR E  1 129 ? 21.299  1.303   -7.016  1.00 63.55  ? 129 THR E CA  1 
ATOM   7427  C C   . THR E  1 129 ? 21.146  2.686   -6.366  1.00 62.54  ? 129 THR E C   1 
ATOM   7428  O O   . THR E  1 129 ? 20.387  3.525   -6.858  1.00 63.06  ? 129 THR E O   1 
ATOM   7429  C CB  . THR E  1 129 ? 19.990  0.503   -6.785  1.00 65.02  ? 129 THR E CB  1 
ATOM   7430  O OG1 . THR E  1 129 ? 19.779  0.312   -5.381  1.00 65.25  ? 129 THR E OG1 1 
ATOM   7431  C CG2 . THR E  1 129 ? 20.067  -0.854  -7.470  1.00 65.58  ? 129 THR E CG2 1 
ATOM   7432  N N   . GLU E  1 130 ? 21.864  2.921   -5.269  1.00 59.92  ? 130 GLU E N   1 
ATOM   7433  C CA  . GLU E  1 130 ? 21.795  4.201   -4.559  1.00 57.33  ? 130 GLU E CA  1 
ATOM   7434  C C   . GLU E  1 130 ? 22.807  5.190   -5.127  1.00 54.92  ? 130 GLU E C   1 
ATOM   7435  O O   . GLU E  1 130 ? 23.982  4.858   -5.285  1.00 54.88  ? 130 GLU E O   1 
ATOM   7436  C CB  . GLU E  1 130 ? 22.095  4.004   -3.068  1.00 60.38  ? 130 GLU E CB  1 
ATOM   7437  C CG  . GLU E  1 130 ? 21.346  2.854   -2.421  1.00 65.20  ? 130 GLU E CG  1 
ATOM   7438  C CD  . GLU E  1 130 ? 19.949  3.229   -1.971  1.00 67.89  ? 130 GLU E CD  1 
ATOM   7439  O OE1 . GLU E  1 130 ? 19.216  3.880   -2.753  1.00 68.99  ? 130 GLU E OE1 1 
ATOM   7440  O OE2 . GLU E  1 130 ? 19.585  2.854   -0.832  1.00 69.10  ? 130 GLU E OE2 1 
ATOM   7441  N N   . GLY E  1 131 ? 22.351  6.402   -5.424  1.00 51.35  ? 131 GLY E N   1 
ATOM   7442  C CA  . GLY E  1 131 ? 23.245  7.418   -5.949  1.00 47.16  ? 131 GLY E CA  1 
ATOM   7443  C C   . GLY E  1 131 ? 23.640  7.302   -7.412  1.00 46.81  ? 131 GLY E C   1 
ATOM   7444  O O   . GLY E  1 131 ? 24.598  7.945   -7.846  1.00 46.50  ? 131 GLY E O   1 
ATOM   7445  N N   . VAL E  1 132 ? 22.929  6.484   -8.181  1.00 44.67  ? 132 VAL E N   1 
ATOM   7446  C CA  . VAL E  1 132 ? 23.235  6.349   -9.600  1.00 41.92  ? 132 VAL E CA  1 
ATOM   7447  C C   . VAL E  1 132 ? 22.300  7.253   -10.384 1.00 41.38  ? 132 VAL E C   1 
ATOM   7448  O O   . VAL E  1 132 ? 21.209  7.574   -9.924  1.00 41.45  ? 132 VAL E O   1 
ATOM   7449  C CB  . VAL E  1 132 ? 23.021  4.924   -10.092 1.00 43.86  ? 132 VAL E CB  1 
ATOM   7450  C CG1 . VAL E  1 132 ? 23.978  3.973   -9.376  1.00 43.62  ? 132 VAL E CG1 1 
ATOM   7451  C CG2 . VAL E  1 132 ? 21.575  4.521   -9.867  1.00 43.07  ? 132 VAL E CG2 1 
ATOM   7452  N N   . SER E  1 133 ? 22.733  7.676   -11.563 1.00 41.00  ? 133 SER E N   1 
ATOM   7453  C CA  . SER E  1 133 ? 21.910  8.536   -12.406 1.00 39.13  ? 133 SER E CA  1 
ATOM   7454  C C   . SER E  1 133 ? 22.318  8.327   -13.849 1.00 38.67  ? 133 SER E C   1 
ATOM   7455  O O   . SER E  1 133 ? 23.242  7.559   -14.126 1.00 36.16  ? 133 SER E O   1 
ATOM   7456  C CB  . SER E  1 133 ? 22.069  10.014  -12.014 1.00 40.12  ? 133 SER E CB  1 
ATOM   7457  O OG  . SER E  1 133 ? 23.369  10.514  -12.282 1.00 39.61  ? 133 SER E OG  1 
ATOM   7458  N N   . GLU E  1 134 ? 21.639  9.011   -14.769 1.00 38.06  ? 134 GLU E N   1 
ATOM   7459  C CA  . GLU E  1 134 ? 21.945  8.852   -16.183 1.00 36.84  ? 134 GLU E CA  1 
ATOM   7460  C C   . GLU E  1 134 ? 21.283  9.909   -17.053 1.00 35.54  ? 134 GLU E C   1 
ATOM   7461  O O   . GLU E  1 134 ? 20.329  10.550  -16.648 1.00 37.36  ? 134 GLU E O   1 
ATOM   7462  C CB  . GLU E  1 134 ? 21.485  7.467   -16.645 1.00 37.01  ? 134 GLU E CB  1 
ATOM   7463  C CG  . GLU E  1 134 ? 19.964  7.322   -16.711 1.00 36.71  ? 134 GLU E CG  1 
ATOM   7464  C CD  . GLU E  1 134 ? 19.501  5.906   -17.018 1.00 39.57  ? 134 GLU E CD  1 
ATOM   7465  O OE1 . GLU E  1 134 ? 19.502  5.063   -16.094 1.00 41.09  ? 134 GLU E OE1 1 
ATOM   7466  O OE2 . GLU E  1 134 ? 19.140  5.628   -18.184 1.00 40.00  ? 134 GLU E OE2 1 
ATOM   7467  N N   . THR E  1 135 ? 21.810  10.074  -18.256 1.00 34.66  ? 135 THR E N   1 
ATOM   7468  C CA  . THR E  1 135 ? 21.277  11.004  -19.240 1.00 32.86  ? 135 THR E CA  1 
ATOM   7469  C C   . THR E  1 135 ? 20.490  10.147  -20.246 1.00 32.81  ? 135 THR E C   1 
ATOM   7470  O O   . THR E  1 135 ? 20.485  8.914   -20.158 1.00 31.99  ? 135 THR E O   1 
ATOM   7471  C CB  . THR E  1 135 ? 22.417  11.698  -20.037 1.00 35.70  ? 135 THR E CB  1 
ATOM   7472  O OG1 . THR E  1 135 ? 23.185  10.705  -20.745 1.00 34.29  ? 135 THR E OG1 1 
ATOM   7473  C CG2 . THR E  1 135 ? 23.342  12.477  -19.102 1.00 34.49  ? 135 THR E CG2 1 
ATOM   7474  N N   . VAL E  1 136 ? 19.833  10.792  -21.202 1.00 31.38  ? 136 VAL E N   1 
ATOM   7475  C CA  . VAL E  1 136 ? 19.112  10.051  -22.235 1.00 31.15  ? 136 VAL E CA  1 
ATOM   7476  C C   . VAL E  1 136 ? 20.130  9.795   -23.339 1.00 31.45  ? 136 VAL E C   1 
ATOM   7477  O O   . VAL E  1 136 ? 21.308  10.154  -23.206 1.00 31.68  ? 136 VAL E O   1 
ATOM   7478  C CB  . VAL E  1 136 ? 17.927  10.864  -22.823 1.00 31.07  ? 136 VAL E CB  1 
ATOM   7479  C CG1 . VAL E  1 136 ? 16.849  11.051  -21.752 1.00 31.26  ? 136 VAL E CG1 1 
ATOM   7480  C CG2 . VAL E  1 136 ? 18.414  12.214  -23.330 1.00 27.52  ? 136 VAL E CG2 1 
ATOM   7481  N N   . PHE E  1 137 ? 19.698  9.177   -24.427 1.00 30.66  ? 137 PHE E N   1 
ATOM   7482  C CA  . PHE E  1 137 ? 20.622  8.918   -25.522 1.00 29.93  ? 137 PHE E CA  1 
ATOM   7483  C C   . PHE E  1 137 ? 20.943  10.233  -26.229 1.00 30.50  ? 137 PHE E C   1 
ATOM   7484  O O   . PHE E  1 137 ? 20.061  10.896  -26.766 1.00 31.94  ? 137 PHE E O   1 
ATOM   7485  C CB  . PHE E  1 137 ? 20.013  7.887   -26.465 1.00 26.01  ? 137 PHE E CB  1 
ATOM   7486  C CG  . PHE E  1 137 ? 19.825  6.540   -25.819 1.00 27.21  ? 137 PHE E CG  1 
ATOM   7487  C CD1 . PHE E  1 137 ? 20.867  5.619   -25.775 1.00 24.88  ? 137 PHE E CD1 1 
ATOM   7488  C CD2 . PHE E  1 137 ? 18.634  6.225   -25.182 1.00 26.79  ? 137 PHE E CD2 1 
ATOM   7489  C CE1 . PHE E  1 137 ? 20.725  4.415   -25.101 1.00 26.18  ? 137 PHE E CE1 1 
ATOM   7490  C CE2 . PHE E  1 137 ? 18.484  5.016   -24.504 1.00 27.52  ? 137 PHE E CE2 1 
ATOM   7491  C CZ  . PHE E  1 137 ? 19.532  4.111   -24.462 1.00 25.59  ? 137 PHE E CZ  1 
ATOM   7492  N N   . LEU E  1 138 ? 22.216  10.611  -26.217 1.00 30.25  ? 138 LEU E N   1 
ATOM   7493  C CA  . LEU E  1 138 ? 22.644  11.868  -26.823 1.00 29.77  ? 138 LEU E CA  1 
ATOM   7494  C C   . LEU E  1 138 ? 23.142  11.706  -28.248 1.00 29.40  ? 138 LEU E C   1 
ATOM   7495  O O   . LEU E  1 138 ? 23.555  10.620  -28.643 1.00 32.83  ? 138 LEU E O   1 
ATOM   7496  C CB  . LEU E  1 138 ? 23.756  12.486  -25.974 1.00 29.72  ? 138 LEU E CB  1 
ATOM   7497  C CG  . LEU E  1 138 ? 23.532  12.478  -24.462 1.00 30.29  ? 138 LEU E CG  1 
ATOM   7498  C CD1 . LEU E  1 138 ? 24.762  13.047  -23.739 1.00 26.86  ? 138 LEU E CD1 1 
ATOM   7499  C CD2 . LEU E  1 138 ? 22.282  13.291  -24.147 1.00 30.54  ? 138 LEU E CD2 1 
ATOM   7500  N N   . PRO E  1 139 ? 23.115  12.788  -29.041 1.00 27.39  ? 139 PRO E N   1 
ATOM   7501  C CA  . PRO E  1 139 ? 23.588  12.711  -30.427 1.00 29.44  ? 139 PRO E CA  1 
ATOM   7502  C C   . PRO E  1 139 ? 25.106  12.906  -30.564 1.00 32.21  ? 139 PRO E C   1 
ATOM   7503  O O   . PRO E  1 139 ? 25.748  13.470  -29.679 1.00 35.27  ? 139 PRO E O   1 
ATOM   7504  C CB  . PRO E  1 139 ? 22.817  13.839  -31.112 1.00 28.99  ? 139 PRO E CB  1 
ATOM   7505  C CG  . PRO E  1 139 ? 22.733  14.884  -30.018 1.00 25.82  ? 139 PRO E CG  1 
ATOM   7506  C CD  . PRO E  1 139 ? 22.407  14.061  -28.790 1.00 26.28  ? 139 PRO E CD  1 
ATOM   7507  N N   . ARG E  1 140 ? 25.662  12.422  -31.673 1.00 33.77  ? 140 ARG E N   1 
ATOM   7508  C CA  . ARG E  1 140 ? 27.081  12.571  -32.014 1.00 34.89  ? 140 ARG E CA  1 
ATOM   7509  C C   . ARG E  1 140 ? 27.030  13.263  -33.368 1.00 36.49  ? 140 ARG E C   1 
ATOM   7510  O O   . ARG E  1 140 ? 25.958  13.696  -33.787 1.00 38.44  ? 140 ARG E O   1 
ATOM   7511  C CB  . ARG E  1 140 ? 27.764  11.209  -32.165 1.00 35.50  ? 140 ARG E CB  1 
ATOM   7512  C CG  . ARG E  1 140 ? 28.063  10.485  -30.855 1.00 34.26  ? 140 ARG E CG  1 
ATOM   7513  C CD  . ARG E  1 140 ? 28.329  9.021   -31.113 1.00 36.08  ? 140 ARG E CD  1 
ATOM   7514  N NE  . ARG E  1 140 ? 29.315  8.838   -32.182 1.00 39.01  ? 140 ARG E NE  1 
ATOM   7515  C CZ  . ARG E  1 140 ? 30.618  9.082   -32.063 1.00 36.27  ? 140 ARG E CZ  1 
ATOM   7516  N NH1 . ARG E  1 140 ? 31.118  9.515   -30.917 1.00 37.68  ? 140 ARG E NH1 1 
ATOM   7517  N NH2 . ARG E  1 140 ? 31.414  8.913   -33.100 1.00 35.80  ? 140 ARG E NH2 1 
ATOM   7518  N N   . ASP E  1 141 ? 28.157  13.369  -34.066 1.00 38.47  ? 141 ASP E N   1 
ATOM   7519  C CA  . ASP E  1 141 ? 28.155  14.016  -35.389 1.00 39.25  ? 141 ASP E CA  1 
ATOM   7520  C C   . ASP E  1 141 ? 27.663  13.063  -36.479 1.00 37.94  ? 141 ASP E C   1 
ATOM   7521  O O   . ASP E  1 141 ? 27.339  13.490  -37.578 1.00 38.42  ? 141 ASP E O   1 
ATOM   7522  C CB  . ASP E  1 141 ? 29.562  14.497  -35.788 1.00 44.88  ? 141 ASP E CB  1 
ATOM   7523  C CG  . ASP E  1 141 ? 30.175  15.470  -34.785 1.00 49.59  ? 141 ASP E CG  1 
ATOM   7524  O OD1 . ASP E  1 141 ? 29.490  16.426  -34.348 1.00 51.17  ? 141 ASP E OD1 1 
ATOM   7525  O OD2 . ASP E  1 141 ? 31.365  15.279  -34.448 1.00 54.98  ? 141 ASP E OD2 1 
ATOM   7526  N N   . ASP E  1 142 ? 27.640  11.769  -36.186 1.00 36.28  ? 142 ASP E N   1 
ATOM   7527  C CA  . ASP E  1 142 ? 27.192  10.793  -37.162 1.00 34.65  ? 142 ASP E CA  1 
ATOM   7528  C C   . ASP E  1 142 ? 25.805  10.216  -36.869 1.00 34.88  ? 142 ASP E C   1 
ATOM   7529  O O   . ASP E  1 142 ? 24.897  10.928  -36.455 1.00 37.48  ? 142 ASP E O   1 
ATOM   7530  C CB  . ASP E  1 142 ? 28.210  9.655   -37.285 1.00 36.01  ? 142 ASP E CB  1 
ATOM   7531  C CG  . ASP E  1 142 ? 28.614  9.074   -35.939 1.00 35.46  ? 142 ASP E CG  1 
ATOM   7532  O OD1 . ASP E  1 142 ? 27.778  9.025   -35.022 1.00 38.09  ? 142 ASP E OD1 1 
ATOM   7533  O OD2 . ASP E  1 142 ? 29.773  8.644   -35.800 1.00 40.58  ? 142 ASP E OD2 1 
ATOM   7534  N N   . HIS E  1 143 ? 25.656  8.914   -37.078 1.00 32.56  ? 143 HIS E N   1 
ATOM   7535  C CA  . HIS E  1 143 ? 24.381  8.238   -36.879 1.00 30.51  ? 143 HIS E CA  1 
ATOM   7536  C C   . HIS E  1 143 ? 24.317  7.467   -35.574 1.00 28.72  ? 143 HIS E C   1 
ATOM   7537  O O   . HIS E  1 143 ? 23.269  6.953   -35.212 1.00 29.00  ? 143 HIS E O   1 
ATOM   7538  C CB  . HIS E  1 143 ? 24.151  7.282   -38.044 1.00 30.64  ? 143 HIS E CB  1 
ATOM   7539  C CG  . HIS E  1 143 ? 25.277  6.321   -38.251 1.00 32.70  ? 143 HIS E CG  1 
ATOM   7540  N ND1 . HIS E  1 143 ? 25.327  5.087   -37.639 1.00 32.48  ? 143 HIS E ND1 1 
ATOM   7541  C CD2 . HIS E  1 143 ? 26.426  6.436   -38.957 1.00 32.99  ? 143 HIS E CD2 1 
ATOM   7542  C CE1 . HIS E  1 143 ? 26.457  4.483   -37.962 1.00 32.55  ? 143 HIS E CE1 1 
ATOM   7543  N NE2 . HIS E  1 143 ? 27.143  5.281   -38.759 1.00 32.12  ? 143 HIS E NE2 1 
ATOM   7544  N N   . LEU E  1 144 ? 25.437  7.402   -34.867 1.00 26.69  ? 144 LEU E N   1 
ATOM   7545  C CA  . LEU E  1 144 ? 25.527  6.673   -33.609 1.00 26.25  ? 144 LEU E CA  1 
ATOM   7546  C C   . LEU E  1 144 ? 25.162  7.524   -32.372 1.00 27.30  ? 144 LEU E C   1 
ATOM   7547  O O   . LEU E  1 144 ? 24.982  8.737   -32.472 1.00 25.70  ? 144 LEU E O   1 
ATOM   7548  C CB  . LEU E  1 144 ? 26.945  6.082   -33.491 1.00 24.45  ? 144 LEU E CB  1 
ATOM   7549  C CG  . LEU E  1 144 ? 27.344  5.102   -34.624 1.00 23.72  ? 144 LEU E CG  1 
ATOM   7550  C CD1 . LEU E  1 144 ? 28.753  4.583   -34.417 1.00 23.47  ? 144 LEU E CD1 1 
ATOM   7551  C CD2 . LEU E  1 144 ? 26.385  3.921   -34.651 1.00 22.64  ? 144 LEU E CD2 1 
ATOM   7552  N N   . PHE E  1 145 ? 25.043  6.885   -31.213 1.00 27.03  ? 145 PHE E N   1 
ATOM   7553  C CA  . PHE E  1 145 ? 24.679  7.600   -29.988 1.00 30.83  ? 145 PHE E CA  1 
ATOM   7554  C C   . PHE E  1 145 ? 25.729  7.528   -28.875 1.00 32.30  ? 145 PHE E C   1 
ATOM   7555  O O   . PHE E  1 145 ? 26.635  6.698   -28.905 1.00 32.43  ? 145 PHE E O   1 
ATOM   7556  C CB  . PHE E  1 145 ? 23.365  7.049   -29.402 1.00 30.80  ? 145 PHE E CB  1 
ATOM   7557  C CG  . PHE E  1 145 ? 22.196  7.106   -30.342 1.00 29.68  ? 145 PHE E CG  1 
ATOM   7558  C CD1 . PHE E  1 145 ? 22.100  6.223   -31.413 1.00 29.32  ? 145 PHE E CD1 1 
ATOM   7559  C CD2 . PHE E  1 145 ? 21.190  8.048   -30.155 1.00 30.21  ? 145 PHE E CD2 1 
ATOM   7560  C CE1 . PHE E  1 145 ? 21.024  6.276   -32.279 1.00 29.33  ? 145 PHE E CE1 1 
ATOM   7561  C CE2 . PHE E  1 145 ? 20.109  8.112   -31.016 1.00 30.41  ? 145 PHE E CE2 1 
ATOM   7562  C CZ  . PHE E  1 145 ? 20.025  7.220   -32.083 1.00 31.80  ? 145 PHE E CZ  1 
ATOM   7563  N N   . ARG E  1 146 ? 25.594  8.415   -27.893 1.00 33.20  ? 146 ARG E N   1 
ATOM   7564  C CA  . ARG E  1 146 ? 26.482  8.420   -26.739 1.00 33.42  ? 146 ARG E CA  1 
ATOM   7565  C C   . ARG E  1 146 ? 25.593  8.587   -25.522 1.00 33.84  ? 146 ARG E C   1 
ATOM   7566  O O   . ARG E  1 146 ? 24.447  9.018   -25.642 1.00 33.93  ? 146 ARG E O   1 
ATOM   7567  C CB  . ARG E  1 146 ? 27.560  9.518   -26.821 1.00 33.94  ? 146 ARG E CB  1 
ATOM   7568  C CG  . ARG E  1 146 ? 27.133  10.953  -27.051 1.00 34.60  ? 146 ARG E CG  1 
ATOM   7569  C CD  . ARG E  1 146 ? 28.404  11.792  -27.222 1.00 38.44  ? 146 ARG E CD  1 
ATOM   7570  N NE  . ARG E  1 146 ? 28.195  13.173  -27.674 1.00 45.72  ? 146 ARG E NE  1 
ATOM   7571  C CZ  . ARG E  1 146 ? 27.802  14.187  -26.895 1.00 49.97  ? 146 ARG E CZ  1 
ATOM   7572  N NH1 . ARG E  1 146 ? 27.559  14.000  -25.600 1.00 48.53  ? 146 ARG E NH1 1 
ATOM   7573  N NH2 . ARG E  1 146 ? 27.678  15.409  -27.411 1.00 50.03  ? 146 ARG E NH2 1 
ATOM   7574  N N   . LYS E  1 147 ? 26.100  8.210   -24.358 1.00 34.84  ? 147 LYS E N   1 
ATOM   7575  C CA  . LYS E  1 147 ? 25.305  8.297   -23.149 1.00 34.85  ? 147 LYS E CA  1 
ATOM   7576  C C   . LYS E  1 147 ? 26.191  8.290   -21.898 1.00 35.26  ? 147 LYS E C   1 
ATOM   7577  O O   . LYS E  1 147 ? 27.271  7.687   -21.900 1.00 36.86  ? 147 LYS E O   1 
ATOM   7578  C CB  . LYS E  1 147 ? 24.332  7.120   -23.117 1.00 33.93  ? 147 LYS E CB  1 
ATOM   7579  C CG  . LYS E  1 147 ? 23.353  7.169   -21.974 1.00 36.78  ? 147 LYS E CG  1 
ATOM   7580  C CD  . LYS E  1 147 ? 22.392  5.984   -21.974 1.00 37.09  ? 147 LYS E CD  1 
ATOM   7581  C CE  . LYS E  1 147 ? 21.325  6.192   -20.912 1.00 36.77  ? 147 LYS E CE  1 
ATOM   7582  N NZ  . LYS E  1 147 ? 20.404  5.050   -20.824 1.00 40.18  ? 147 LYS E NZ  1 
ATOM   7583  N N   . PHE E  1 148 ? 25.733  8.972   -20.846 1.00 32.70  ? 148 PHE E N   1 
ATOM   7584  C CA  . PHE E  1 148 ? 26.471  9.041   -19.595 1.00 31.55  ? 148 PHE E CA  1 
ATOM   7585  C C   . PHE E  1 148 ? 25.695  8.412   -18.445 1.00 33.87  ? 148 PHE E C   1 
ATOM   7586  O O   . PHE E  1 148 ? 24.468  8.552   -18.341 1.00 34.17  ? 148 PHE E O   1 
ATOM   7587  C CB  . PHE E  1 148 ? 26.761  10.490  -19.171 1.00 27.96  ? 148 PHE E CB  1 
ATOM   7588  C CG  . PHE E  1 148 ? 27.628  11.266  -20.116 1.00 26.11  ? 148 PHE E CG  1 
ATOM   7589  C CD1 . PHE E  1 148 ? 27.106  11.813  -21.268 1.00 25.75  ? 148 PHE E CD1 1 
ATOM   7590  C CD2 . PHE E  1 148 ? 28.968  11.479  -19.827 1.00 26.52  ? 148 PHE E CD2 1 
ATOM   7591  C CE1 . PHE E  1 148 ? 27.899  12.567  -22.127 1.00 25.05  ? 148 PHE E CE1 1 
ATOM   7592  C CE2 . PHE E  1 148 ? 29.771  12.228  -20.671 1.00 25.29  ? 148 PHE E CE2 1 
ATOM   7593  C CZ  . PHE E  1 148 ? 29.236  12.776  -21.827 1.00 27.36  ? 148 PHE E CZ  1 
ATOM   7594  N N   . HIS E  1 149 ? 26.428  7.724   -17.584 1.00 32.20  ? 149 HIS E N   1 
ATOM   7595  C CA  . HIS E  1 149 ? 25.867  7.144   -16.380 1.00 35.50  ? 149 HIS E CA  1 
ATOM   7596  C C   . HIS E  1 149 ? 26.774  7.681   -15.279 1.00 38.26  ? 149 HIS E C   1 
ATOM   7597  O O   . HIS E  1 149 ? 27.971  7.910   -15.501 1.00 40.03  ? 149 HIS E O   1 
ATOM   7598  C CB  . HIS E  1 149 ? 25.886  5.618   -16.409 1.00 34.41  ? 149 HIS E CB  1 
ATOM   7599  C CG  . HIS E  1 149 ? 24.657  5.031   -17.012 1.00 34.51  ? 149 HIS E CG  1 
ATOM   7600  N ND1 . HIS E  1 149 ? 24.332  5.191   -18.341 1.00 33.17  ? 149 HIS E ND1 1 
ATOM   7601  C CD2 . HIS E  1 149 ? 23.637  4.341   -16.453 1.00 34.93  ? 149 HIS E CD2 1 
ATOM   7602  C CE1 . HIS E  1 149 ? 23.162  4.625   -18.574 1.00 34.30  ? 149 HIS E CE1 1 
ATOM   7603  N NE2 . HIS E  1 149 ? 22.719  4.104   -17.444 1.00 36.39  ? 149 HIS E NE2 1 
ATOM   7604  N N   . TYR E  1 150 ? 26.198  7.887   -14.102 1.00 38.15  ? 150 TYR E N   1 
ATOM   7605  C CA  . TYR E  1 150 ? 26.933  8.442   -12.987 1.00 37.04  ? 150 TYR E CA  1 
ATOM   7606  C C   . TYR E  1 150 ? 26.755  7.612   -11.708 1.00 37.50  ? 150 TYR E C   1 
ATOM   7607  O O   . TYR E  1 150 ? 25.711  6.989   -11.491 1.00 36.73  ? 150 TYR E O   1 
ATOM   7608  C CB  . TYR E  1 150 ? 26.460  9.884   -12.747 1.00 33.02  ? 150 TYR E CB  1 
ATOM   7609  C CG  . TYR E  1 150 ? 26.583  10.827  -13.941 1.00 33.18  ? 150 TYR E CG  1 
ATOM   7610  C CD1 . TYR E  1 150 ? 27.834  11.253  -14.415 1.00 31.93  ? 150 TYR E CD1 1 
ATOM   7611  C CD2 . TYR E  1 150 ? 25.443  11.314  -14.590 1.00 31.99  ? 150 TYR E CD2 1 
ATOM   7612  C CE1 . TYR E  1 150 ? 27.933  12.140  -15.505 1.00 27.91  ? 150 TYR E CE1 1 
ATOM   7613  C CE2 . TYR E  1 150 ? 25.539  12.193  -15.679 1.00 25.51  ? 150 TYR E CE2 1 
ATOM   7614  C CZ  . TYR E  1 150 ? 26.772  12.596  -16.130 1.00 26.61  ? 150 TYR E CZ  1 
ATOM   7615  O OH  . TYR E  1 150 ? 26.839  13.427  -17.226 1.00 24.46  ? 150 TYR E OH  1 
ATOM   7616  N N   . LEU E  1 151 ? 27.790  7.605   -10.872 1.00 38.24  ? 151 LEU E N   1 
ATOM   7617  C CA  . LEU E  1 151 ? 27.748  6.889   -9.603  1.00 39.73  ? 151 LEU E CA  1 
ATOM   7618  C C   . LEU E  1 151 ? 28.451  7.714   -8.534  1.00 38.99  ? 151 LEU E C   1 
ATOM   7619  O O   . LEU E  1 151 ? 29.654  7.921   -8.617  1.00 38.85  ? 151 LEU E O   1 
ATOM   7620  C CB  . LEU E  1 151 ? 28.442  5.526   -9.716  1.00 38.83  ? 151 LEU E CB  1 
ATOM   7621  C CG  . LEU E  1 151 ? 28.636  4.770   -8.385  1.00 40.55  ? 151 LEU E CG  1 
ATOM   7622  C CD1 . LEU E  1 151 ? 27.289  4.294   -7.839  1.00 36.22  ? 151 LEU E CD1 1 
ATOM   7623  C CD2 . LEU E  1 151 ? 29.556  3.577   -8.598  1.00 39.62  ? 151 LEU E CD2 1 
ATOM   7624  N N   . THR E  1 152 ? 27.705  8.193   -7.541  1.00 40.72  ? 152 THR E N   1 
ATOM   7625  C CA  . THR E  1 152 ? 28.307  8.975   -6.449  1.00 41.67  ? 152 THR E CA  1 
ATOM   7626  C C   . THR E  1 152 ? 29.043  7.988   -5.555  1.00 42.26  ? 152 THR E C   1 
ATOM   7627  O O   . THR E  1 152 ? 28.511  6.926   -5.228  1.00 42.26  ? 152 THR E O   1 
ATOM   7628  C CB  . THR E  1 152 ? 27.247  9.686   -5.582  1.00 40.45  ? 152 THR E CB  1 
ATOM   7629  O OG1 . THR E  1 152 ? 26.372  8.709   -5.004  1.00 38.83  ? 152 THR E OG1 1 
ATOM   7630  C CG2 . THR E  1 152 ? 26.443  10.658  -6.407  1.00 37.57  ? 152 THR E CG2 1 
ATOM   7631  N N   . PHE E  1 153 ? 30.256  8.327   -5.143  1.00 44.58  ? 153 PHE E N   1 
ATOM   7632  C CA  . PHE E  1 153 ? 31.009  7.393   -4.307  1.00 46.65  ? 153 PHE E CA  1 
ATOM   7633  C C   . PHE E  1 153 ? 31.968  8.044   -3.331  1.00 48.33  ? 153 PHE E C   1 
ATOM   7634  O O   . PHE E  1 153 ? 32.390  9.183   -3.533  1.00 50.24  ? 153 PHE E O   1 
ATOM   7635  C CB  . PHE E  1 153 ? 31.828  6.446   -5.182  1.00 45.70  ? 153 PHE E CB  1 
ATOM   7636  C CG  . PHE E  1 153 ? 33.009  7.106   -5.827  1.00 43.32  ? 153 PHE E CG  1 
ATOM   7637  C CD1 . PHE E  1 153 ? 32.828  8.121   -6.751  1.00 42.00  ? 153 PHE E CD1 1 
ATOM   7638  C CD2 . PHE E  1 153 ? 34.304  6.738   -5.480  1.00 43.90  ? 153 PHE E CD2 1 
ATOM   7639  C CE1 . PHE E  1 153 ? 33.924  8.771   -7.323  1.00 44.68  ? 153 PHE E CE1 1 
ATOM   7640  C CE2 . PHE E  1 153 ? 35.407  7.382   -6.045  1.00 43.07  ? 153 PHE E CE2 1 
ATOM   7641  C CZ  . PHE E  1 153 ? 35.215  8.401   -6.968  1.00 42.42  ? 153 PHE E CZ  1 
ATOM   7642  N N   . LEU E  1 154 ? 32.322  7.293   -2.287  1.00 49.92  ? 154 LEU E N   1 
ATOM   7643  C CA  . LEU E  1 154 ? 33.272  7.758   -1.282  1.00 52.17  ? 154 LEU E CA  1 
ATOM   7644  C C   . LEU E  1 154 ? 34.654  7.180   -1.598  1.00 52.67  ? 154 LEU E C   1 
ATOM   7645  O O   . LEU E  1 154 ? 34.865  5.969   -1.493  1.00 53.56  ? 154 LEU E O   1 
ATOM   7646  C CB  . LEU E  1 154 ? 32.848  7.312   0.116   1.00 52.63  ? 154 LEU E CB  1 
ATOM   7647  C CG  . LEU E  1 154 ? 33.760  7.864   1.220   1.00 54.28  ? 154 LEU E CG  1 
ATOM   7648  C CD1 . LEU E  1 154 ? 33.624  9.396   1.259   1.00 52.23  ? 154 LEU E CD1 1 
ATOM   7649  C CD2 . LEU E  1 154 ? 33.401  7.239   2.575   1.00 54.28  ? 154 LEU E CD2 1 
ATOM   7650  N N   . PRO E  1 155 ? 35.607  8.038   -2.001  1.00 52.88  ? 155 PRO E N   1 
ATOM   7651  C CA  . PRO E  1 155 ? 36.981  7.642   -2.342  1.00 53.93  ? 155 PRO E CA  1 
ATOM   7652  C C   . PRO E  1 155 ? 37.690  6.852   -1.236  1.00 55.15  ? 155 PRO E C   1 
ATOM   7653  O O   . PRO E  1 155 ? 37.923  7.366   -0.145  1.00 54.55  ? 155 PRO E O   1 
ATOM   7654  C CB  . PRO E  1 155 ? 37.668  8.980   -2.612  1.00 53.79  ? 155 PRO E CB  1 
ATOM   7655  C CG  . PRO E  1 155 ? 36.569  9.804   -3.162  1.00 53.90  ? 155 PRO E CG  1 
ATOM   7656  C CD  . PRO E  1 155 ? 35.413  9.478   -2.237  1.00 52.62  ? 155 PRO E CD  1 
ATOM   7657  N N   . SER E  1 156 ? 38.040  5.607   -1.537  1.00 56.95  ? 156 SER E N   1 
ATOM   7658  C CA  . SER E  1 156 ? 38.716  4.745   -0.580  1.00 59.41  ? 156 SER E CA  1 
ATOM   7659  C C   . SER E  1 156 ? 39.731  3.824   -1.248  1.00 61.82  ? 156 SER E C   1 
ATOM   7660  O O   . SER E  1 156 ? 39.604  3.497   -2.429  1.00 62.74  ? 156 SER E O   1 
ATOM   7661  C CB  . SER E  1 156 ? 37.698  3.892   0.166   1.00 59.33  ? 156 SER E CB  1 
ATOM   7662  O OG  . SER E  1 156 ? 38.357  2.913   0.949   1.00 60.92  ? 156 SER E OG  1 
ATOM   7663  N N   . THR E  1 157 ? 40.737  3.405   -0.484  1.00 63.61  ? 157 THR E N   1 
ATOM   7664  C CA  . THR E  1 157 ? 41.767  2.505   -0.999  1.00 64.68  ? 157 THR E CA  1 
ATOM   7665  C C   . THR E  1 157 ? 41.170  1.105   -1.044  1.00 65.45  ? 157 THR E C   1 
ATOM   7666  O O   . THR E  1 157 ? 41.630  0.237   -1.779  1.00 63.77  ? 157 THR E O   1 
ATOM   7667  C CB  . THR E  1 157 ? 43.009  2.461   -0.076  1.00 65.72  ? 157 THR E CB  1 
ATOM   7668  O OG1 . THR E  1 157 ? 42.647  1.869   1.180   1.00 65.70  ? 157 THR E OG1 1 
ATOM   7669  C CG2 . THR E  1 157 ? 43.557  3.863   0.164   1.00 65.38  ? 157 THR E CG2 1 
ATOM   7670  N N   . ASP E  1 158 ? 40.132  0.901   -0.244  1.00 67.19  ? 158 ASP E N   1 
ATOM   7671  C CA  . ASP E  1 158 ? 39.454  -0.386  -0.167  1.00 69.36  ? 158 ASP E CA  1 
ATOM   7672  C C   . ASP E  1 158 ? 38.712  -0.772  -1.458  1.00 68.77  ? 158 ASP E C   1 
ATOM   7673  O O   . ASP E  1 158 ? 39.250  -1.494  -2.298  1.00 69.16  ? 158 ASP E O   1 
ATOM   7674  C CB  . ASP E  1 158 ? 38.472  -0.373  1.016   1.00 71.17  ? 158 ASP E CB  1 
ATOM   7675  C CG  . ASP E  1 158 ? 37.886  -1.747  1.312   1.00 74.05  ? 158 ASP E CG  1 
ATOM   7676  O OD1 . ASP E  1 158 ? 37.194  -2.315  0.431   1.00 74.26  ? 158 ASP E OD1 1 
ATOM   7677  O OD2 . ASP E  1 158 ? 38.122  -2.257  2.433   1.00 75.95  ? 158 ASP E OD2 1 
ATOM   7678  N N   . ASP E  1 159 ? 37.485  -0.276  -1.607  1.00 68.06  ? 159 ASP E N   1 
ATOM   7679  C CA  . ASP E  1 159 ? 36.629  -0.580  -2.756  1.00 66.99  ? 159 ASP E CA  1 
ATOM   7680  C C   . ASP E  1 159 ? 37.166  -0.391  -4.172  1.00 65.87  ? 159 ASP E C   1 
ATOM   7681  O O   . ASP E  1 159 ? 38.078  0.397   -4.420  1.00 66.13  ? 159 ASP E O   1 
ATOM   7682  C CB  . ASP E  1 159 ? 35.304  0.188   -2.631  1.00 67.69  ? 159 ASP E CB  1 
ATOM   7683  C CG  . ASP E  1 159 ? 35.359  1.295   -1.588  1.00 69.11  ? 159 ASP E CG  1 
ATOM   7684  O OD1 . ASP E  1 159 ? 35.435  0.954   -0.388  1.00 70.06  ? 159 ASP E OD1 1 
ATOM   7685  O OD2 . ASP E  1 159 ? 35.327  2.495   -1.962  1.00 67.85  ? 159 ASP E OD2 1 
ATOM   7686  N N   . PHE E  1 160 ? 36.566  -1.140  -5.094  1.00 65.12  ? 160 PHE E N   1 
ATOM   7687  C CA  . PHE E  1 160 ? 36.889  -1.094  -6.518  1.00 63.71  ? 160 PHE E CA  1 
ATOM   7688  C C   . PHE E  1 160 ? 35.553  -1.103  -7.268  1.00 62.00  ? 160 PHE E C   1 
ATOM   7689  O O   . PHE E  1 160 ? 34.580  -1.700  -6.806  1.00 60.20  ? 160 PHE E O   1 
ATOM   7690  C CB  . PHE E  1 160 ? 37.725  -2.305  -6.930  1.00 66.36  ? 160 PHE E CB  1 
ATOM   7691  C CG  . PHE E  1 160 ? 37.048  -3.626  -6.681  1.00 69.23  ? 160 PHE E CG  1 
ATOM   7692  C CD1 . PHE E  1 160 ? 36.889  -4.111  -5.383  1.00 69.66  ? 160 PHE E CD1 1 
ATOM   7693  C CD2 . PHE E  1 160 ? 36.569  -4.388  -7.745  1.00 69.64  ? 160 PHE E CD2 1 
ATOM   7694  C CE1 . PHE E  1 160 ? 36.265  -5.334  -5.146  1.00 70.26  ? 160 PHE E CE1 1 
ATOM   7695  C CE2 . PHE E  1 160 ? 35.941  -5.614  -7.519  1.00 70.35  ? 160 PHE E CE2 1 
ATOM   7696  C CZ  . PHE E  1 160 ? 35.790  -6.088  -6.216  1.00 70.74  ? 160 PHE E CZ  1 
ATOM   7697  N N   . TYR E  1 161 ? 35.504  -0.451  -8.425  1.00 60.64  ? 161 TYR E N   1 
ATOM   7698  C CA  . TYR E  1 161 ? 34.259  -0.367  -9.179  1.00 58.46  ? 161 TYR E CA  1 
ATOM   7699  C C   . TYR E  1 161 ? 34.296  -0.889  -10.610 1.00 58.61  ? 161 TYR E C   1 
ATOM   7700  O O   . TYR E  1 161 ? 35.351  -0.968  -11.246 1.00 58.93  ? 161 TYR E O   1 
ATOM   7701  C CB  . TYR E  1 161 ? 33.772  1.080   -9.195  1.00 57.92  ? 161 TYR E CB  1 
ATOM   7702  C CG  . TYR E  1 161 ? 33.616  1.686   -7.818  1.00 58.10  ? 161 TYR E CG  1 
ATOM   7703  C CD1 . TYR E  1 161 ? 34.731  1.980   -7.026  1.00 57.73  ? 161 TYR E CD1 1 
ATOM   7704  C CD2 . TYR E  1 161 ? 32.351  1.973   -7.304  1.00 57.49  ? 161 TYR E CD2 1 
ATOM   7705  C CE1 . TYR E  1 161 ? 34.585  2.546   -5.763  1.00 56.78  ? 161 TYR E CE1 1 
ATOM   7706  C CE2 . TYR E  1 161 ? 32.199  2.538   -6.044  1.00 57.46  ? 161 TYR E CE2 1 
ATOM   7707  C CZ  . TYR E  1 161 ? 33.317  2.823   -5.282  1.00 56.72  ? 161 TYR E CZ  1 
ATOM   7708  O OH  . TYR E  1 161 ? 33.157  3.405   -4.049  1.00 58.67  ? 161 TYR E OH  1 
ATOM   7709  N N   . ASP E  1 162 ? 33.121  -1.241  -11.110 1.00 57.08  ? 162 ASP E N   1 
ATOM   7710  C CA  . ASP E  1 162 ? 32.989  -1.747  -12.461 1.00 55.65  ? 162 ASP E CA  1 
ATOM   7711  C C   . ASP E  1 162 ? 31.701  -1.223  -13.061 1.00 55.04  ? 162 ASP E C   1 
ATOM   7712  O O   . ASP E  1 162 ? 30.654  -1.263  -12.416 1.00 56.30  ? 162 ASP E O   1 
ATOM   7713  C CB  . ASP E  1 162 ? 32.929  -3.278  -12.464 1.00 56.93  ? 162 ASP E CB  1 
ATOM   7714  C CG  . ASP E  1 162 ? 34.219  -3.925  -11.995 1.00 59.00  ? 162 ASP E CG  1 
ATOM   7715  O OD1 . ASP E  1 162 ? 35.259  -3.748  -12.667 1.00 59.28  ? 162 ASP E OD1 1 
ATOM   7716  O OD2 . ASP E  1 162 ? 34.187  -4.620  -10.955 1.00 59.43  ? 162 ASP E OD2 1 
ATOM   7717  N N   . CYS E  1 163 ? 31.774  -0.713  -14.283 1.00 53.09  ? 163 CYS E N   1 
ATOM   7718  C CA  . CYS E  1 163 ? 30.572  -0.259  -14.965 1.00 51.28  ? 163 CYS E CA  1 
ATOM   7719  C C   . CYS E  1 163 ? 30.260  -1.363  -15.978 1.00 51.53  ? 163 CYS E C   1 
ATOM   7720  O O   . CYS E  1 163 ? 31.036  -1.593  -16.908 1.00 51.12  ? 163 CYS E O   1 
ATOM   7721  C CB  . CYS E  1 163 ? 30.800  1.068   -15.700 1.00 49.88  ? 163 CYS E CB  1 
ATOM   7722  S SG  . CYS E  1 163 ? 29.301  1.594   -16.606 1.00 50.07  ? 163 CYS E SG  1 
ATOM   7723  N N   . GLU E  1 164 ? 29.150  -2.067  -15.787 1.00 49.98  ? 164 GLU E N   1 
ATOM   7724  C CA  . GLU E  1 164 ? 28.795  -3.134  -16.711 1.00 50.70  ? 164 GLU E CA  1 
ATOM   7725  C C   . GLU E  1 164 ? 27.741  -2.687  -17.729 1.00 49.58  ? 164 GLU E C   1 
ATOM   7726  O O   . GLU E  1 164 ? 26.608  -2.355  -17.374 1.00 49.26  ? 164 GLU E O   1 
ATOM   7727  C CB  . GLU E  1 164 ? 28.291  -4.354  -15.938 1.00 53.45  ? 164 GLU E CB  1 
ATOM   7728  C CG  . GLU E  1 164 ? 28.117  -5.585  -16.809 1.00 56.40  ? 164 GLU E CG  1 
ATOM   7729  C CD  . GLU E  1 164 ? 27.723  -6.812  -16.014 1.00 60.47  ? 164 GLU E CD  1 
ATOM   7730  O OE1 . GLU E  1 164 ? 26.635  -6.804  -15.391 1.00 62.13  ? 164 GLU E OE1 1 
ATOM   7731  O OE2 . GLU E  1 164 ? 28.503  -7.788  -16.014 1.00 61.92  ? 164 GLU E OE2 1 
ATOM   7732  N N   . VAL E  1 165 ? 28.124  -2.701  -19.000 1.00 48.46  ? 165 VAL E N   1 
ATOM   7733  C CA  . VAL E  1 165 ? 27.250  -2.282  -20.090 1.00 45.99  ? 165 VAL E CA  1 
ATOM   7734  C C   . VAL E  1 165 ? 26.917  -3.440  -21.025 1.00 45.49  ? 165 VAL E C   1 
ATOM   7735  O O   . VAL E  1 165 ? 27.810  -4.043  -21.615 1.00 45.49  ? 165 VAL E O   1 
ATOM   7736  C CB  . VAL E  1 165 ? 27.927  -1.171  -20.928 1.00 46.10  ? 165 VAL E CB  1 
ATOM   7737  C CG1 . VAL E  1 165 ? 27.059  -0.819  -22.120 1.00 45.92  ? 165 VAL E CG1 1 
ATOM   7738  C CG2 . VAL E  1 165 ? 28.198  0.051   -20.062 1.00 44.27  ? 165 VAL E CG2 1 
ATOM   7739  N N   . ASP E  1 166 ? 25.632  -3.737  -21.171 1.00 45.34  ? 166 ASP E N   1 
ATOM   7740  C CA  . ASP E  1 166 ? 25.194  -4.811  -22.049 1.00 46.31  ? 166 ASP E CA  1 
ATOM   7741  C C   . ASP E  1 166 ? 24.453  -4.186  -23.230 1.00 44.92  ? 166 ASP E C   1 
ATOM   7742  O O   . ASP E  1 166 ? 23.604  -3.321  -23.044 1.00 45.57  ? 166 ASP E O   1 
ATOM   7743  C CB  . ASP E  1 166 ? 24.286  -5.775  -21.280 1.00 48.78  ? 166 ASP E CB  1 
ATOM   7744  C CG  . ASP E  1 166 ? 24.004  -7.061  -22.052 1.00 54.21  ? 166 ASP E CG  1 
ATOM   7745  O OD1 . ASP E  1 166 ? 24.807  -7.415  -22.950 1.00 54.93  ? 166 ASP E OD1 1 
ATOM   7746  O OD2 . ASP E  1 166 ? 22.987  -7.726  -21.746 1.00 55.22  ? 166 ASP E OD2 1 
ATOM   7747  N N   . HIS E  1 167 ? 24.791  -4.616  -24.441 1.00 43.10  ? 167 HIS E N   1 
ATOM   7748  C CA  . HIS E  1 167 ? 24.175  -4.093  -25.662 1.00 42.08  ? 167 HIS E CA  1 
ATOM   7749  C C   . HIS E  1 167 ? 24.027  -5.222  -26.686 1.00 42.08  ? 167 HIS E C   1 
ATOM   7750  O O   . HIS E  1 167 ? 24.875  -6.117  -26.762 1.00 41.88  ? 167 HIS E O   1 
ATOM   7751  C CB  . HIS E  1 167 ? 25.056  -2.989  -26.232 1.00 39.55  ? 167 HIS E CB  1 
ATOM   7752  C CG  . HIS E  1 167 ? 24.502  -2.333  -27.454 1.00 40.72  ? 167 HIS E CG  1 
ATOM   7753  N ND1 . HIS E  1 167 ? 23.521  -1.364  -27.402 1.00 42.64  ? 167 HIS E ND1 1 
ATOM   7754  C CD2 . HIS E  1 167 ? 24.844  -2.450  -28.759 1.00 39.09  ? 167 HIS E CD2 1 
ATOM   7755  C CE1 . HIS E  1 167 ? 23.291  -0.906  -28.620 1.00 38.93  ? 167 HIS E CE1 1 
ATOM   7756  N NE2 . HIS E  1 167 ? 24.081  -1.549  -29.461 1.00 40.20  ? 167 HIS E NE2 1 
ATOM   7757  N N   . TRP E  1 168 ? 22.961  -5.174  -27.478 1.00 42.34  ? 168 TRP E N   1 
ATOM   7758  C CA  . TRP E  1 168 ? 22.710  -6.214  -28.478 1.00 42.73  ? 168 TRP E CA  1 
ATOM   7759  C C   . TRP E  1 168 ? 23.891  -6.480  -29.411 1.00 42.88  ? 168 TRP E C   1 
ATOM   7760  O O   . TRP E  1 168 ? 23.978  -7.537  -30.023 1.00 42.86  ? 168 TRP E O   1 
ATOM   7761  C CB  . TRP E  1 168 ? 21.453  -5.881  -29.301 1.00 42.79  ? 168 TRP E CB  1 
ATOM   7762  C CG  . TRP E  1 168 ? 20.188  -5.940  -28.488 1.00 43.85  ? 168 TRP E CG  1 
ATOM   7763  C CD1 . TRP E  1 168 ? 19.403  -4.886  -28.111 1.00 44.87  ? 168 TRP E CD1 1 
ATOM   7764  C CD2 . TRP E  1 168 ? 19.606  -7.104  -27.891 1.00 45.84  ? 168 TRP E CD2 1 
ATOM   7765  N NE1 . TRP E  1 168 ? 18.376  -5.319  -27.313 1.00 43.50  ? 168 TRP E NE1 1 
ATOM   7766  C CE2 . TRP E  1 168 ? 18.475  -6.677  -27.160 1.00 46.85  ? 168 TRP E CE2 1 
ATOM   7767  C CE3 . TRP E  1 168 ? 19.931  -8.469  -27.901 1.00 47.89  ? 168 TRP E CE3 1 
ATOM   7768  C CZ2 . TRP E  1 168 ? 17.662  -7.572  -26.439 1.00 48.59  ? 168 TRP E CZ2 1 
ATOM   7769  C CZ3 . TRP E  1 168 ? 19.121  -9.360  -27.183 1.00 48.37  ? 168 TRP E CZ3 1 
ATOM   7770  C CH2 . TRP E  1 168 ? 18.001  -8.902  -26.462 1.00 49.44  ? 168 TRP E CH2 1 
ATOM   7771  N N   . GLY E  1 169 ? 24.807  -5.526  -29.504 1.00 43.71  ? 169 GLY E N   1 
ATOM   7772  C CA  . GLY E  1 169 ? 25.955  -5.696  -30.368 1.00 44.08  ? 169 GLY E CA  1 
ATOM   7773  C C   . GLY E  1 169 ? 27.111  -6.381  -29.670 1.00 46.16  ? 169 GLY E C   1 
ATOM   7774  O O   . GLY E  1 169 ? 28.107  -6.713  -30.311 1.00 46.85  ? 169 GLY E O   1 
ATOM   7775  N N   . LEU E  1 170 ? 26.992  -6.596  -28.362 1.00 47.15  ? 170 LEU E N   1 
ATOM   7776  C CA  . LEU E  1 170 ? 28.058  -7.252  -27.599 1.00 49.13  ? 170 LEU E CA  1 
ATOM   7777  C C   . LEU E  1 170 ? 27.806  -8.748  -27.355 1.00 51.62  ? 170 LEU E C   1 
ATOM   7778  O O   . LEU E  1 170 ? 26.712  -9.147  -26.930 1.00 49.56  ? 170 LEU E O   1 
ATOM   7779  C CB  . LEU E  1 170 ? 28.250  -6.550  -26.249 1.00 46.50  ? 170 LEU E CB  1 
ATOM   7780  C CG  . LEU E  1 170 ? 28.782  -5.117  -26.246 1.00 45.79  ? 170 LEU E CG  1 
ATOM   7781  C CD1 . LEU E  1 170 ? 28.503  -4.478  -24.917 1.00 44.21  ? 170 LEU E CD1 1 
ATOM   7782  C CD2 . LEU E  1 170 ? 30.266  -5.108  -26.533 1.00 43.79  ? 170 LEU E CD2 1 
ATOM   7783  N N   . GLU E  1 171 ? 28.825  -9.564  -27.633 1.00 54.63  ? 171 GLU E N   1 
ATOM   7784  C CA  . GLU E  1 171 ? 28.750  -11.009 -27.417 1.00 58.78  ? 171 GLU E CA  1 
ATOM   7785  C C   . GLU E  1 171 ? 28.428  -11.239 -25.951 1.00 59.16  ? 171 GLU E C   1 
ATOM   7786  O O   . GLU E  1 171 ? 27.447  -11.902 -25.604 1.00 59.01  ? 171 GLU E O   1 
ATOM   7787  C CB  . GLU E  1 171 ? 30.094  -11.679 -27.716 1.00 62.67  ? 171 GLU E CB  1 
ATOM   7788  C CG  . GLU E  1 171 ? 30.311  -12.143 -29.152 1.00 68.03  ? 171 GLU E CG  1 
ATOM   7789  C CD  . GLU E  1 171 ? 31.621  -12.923 -29.318 1.00 71.70  ? 171 GLU E CD  1 
ATOM   7790  O OE1 . GLU E  1 171 ? 31.851  -13.465 -30.426 1.00 73.06  ? 171 GLU E OE1 1 
ATOM   7791  O OE2 . GLU E  1 171 ? 32.418  -12.990 -28.344 1.00 71.53  ? 171 GLU E OE2 1 
ATOM   7792  N N   . GLU E  1 172 ? 29.281  -10.676 -25.102 1.00 59.30  ? 172 GLU E N   1 
ATOM   7793  C CA  . GLU E  1 172 ? 29.155  -10.772 -23.653 1.00 61.16  ? 172 GLU E CA  1 
ATOM   7794  C C   . GLU E  1 172 ? 29.204  -9.362  -23.054 1.00 59.58  ? 172 GLU E C   1 
ATOM   7795  O O   . GLU E  1 172 ? 29.916  -8.491  -23.559 1.00 58.29  ? 172 GLU E O   1 
ATOM   7796  C CB  . GLU E  1 172 ? 30.306  -11.620 -23.105 1.00 63.67  ? 172 GLU E CB  1 
ATOM   7797  C CG  . GLU E  1 172 ? 31.659  -11.268 -23.725 1.00 67.45  ? 172 GLU E CG  1 
ATOM   7798  C CD  . GLU E  1 172 ? 32.743  -12.308 -23.450 1.00 70.66  ? 172 GLU E CD  1 
ATOM   7799  O OE1 . GLU E  1 172 ? 33.099  -12.520 -22.265 1.00 72.05  ? 172 GLU E OE1 1 
ATOM   7800  O OE2 . GLU E  1 172 ? 33.238  -12.910 -24.429 1.00 70.48  ? 172 GLU E OE2 1 
ATOM   7801  N N   . PRO E  1 173 ? 28.435  -9.117  -21.979 1.00 58.38  ? 173 PRO E N   1 
ATOM   7802  C CA  . PRO E  1 173 ? 28.416  -7.802  -21.338 1.00 57.99  ? 173 PRO E CA  1 
ATOM   7803  C C   . PRO E  1 173 ? 29.822  -7.259  -21.216 1.00 59.32  ? 173 PRO E C   1 
ATOM   7804  O O   . PRO E  1 173 ? 30.769  -8.021  -21.020 1.00 61.66  ? 173 PRO E O   1 
ATOM   7805  C CB  . PRO E  1 173 ? 27.791  -8.092  -19.985 1.00 56.47  ? 173 PRO E CB  1 
ATOM   7806  C CG  . PRO E  1 173 ? 26.792  -9.138  -20.323 1.00 57.83  ? 173 PRO E CG  1 
ATOM   7807  C CD  . PRO E  1 173 ? 27.553  -10.057 -21.266 1.00 58.43  ? 173 PRO E CD  1 
ATOM   7808  N N   . LEU E  1 174 ? 29.959  -5.947  -21.359 1.00 59.36  ? 174 LEU E N   1 
ATOM   7809  C CA  . LEU E  1 174 ? 31.259  -5.305  -21.256 1.00 59.36  ? 174 LEU E CA  1 
ATOM   7810  C C   . LEU E  1 174 ? 31.357  -4.695  -19.869 1.00 60.11  ? 174 LEU E C   1 
ATOM   7811  O O   . LEU E  1 174 ? 30.398  -4.100  -19.372 1.00 59.98  ? 174 LEU E O   1 
ATOM   7812  C CB  . LEU E  1 174 ? 31.403  -4.218  -22.318 1.00 59.76  ? 174 LEU E CB  1 
ATOM   7813  C CG  . LEU E  1 174 ? 32.763  -3.527  -22.417 1.00 60.26  ? 174 LEU E CG  1 
ATOM   7814  C CD1 . LEU E  1 174 ? 33.862  -4.561  -22.625 1.00 59.68  ? 174 LEU E CD1 1 
ATOM   7815  C CD2 . LEU E  1 174 ? 32.739  -2.545  -23.573 1.00 59.53  ? 174 LEU E CD2 1 
ATOM   7816  N N   . ARG E  1 175 ? 32.513  -4.857  -19.238 1.00 60.35  ? 175 ARG E N   1 
ATOM   7817  C CA  . ARG E  1 175 ? 32.712  -4.324  -17.900 1.00 59.96  ? 175 ARG E CA  1 
ATOM   7818  C C   . ARG E  1 175 ? 34.021  -3.553  -17.798 1.00 59.42  ? 175 ARG E C   1 
ATOM   7819  O O   . ARG E  1 175 ? 35.098  -4.099  -18.024 1.00 59.40  ? 175 ARG E O   1 
ATOM   7820  C CB  . ARG E  1 175 ? 32.693  -5.464  -16.875 1.00 61.20  ? 175 ARG E CB  1 
ATOM   7821  C CG  . ARG E  1 175 ? 32.782  -4.991  -15.442 1.00 62.66  ? 175 ARG E CG  1 
ATOM   7822  C CD  . ARG E  1 175 ? 32.890  -6.151  -14.462 1.00 64.93  ? 175 ARG E CD  1 
ATOM   7823  N NE  . ARG E  1 175 ? 31.715  -7.017  -14.472 1.00 66.60  ? 175 ARG E NE  1 
ATOM   7824  C CZ  . ARG E  1 175 ? 31.510  -7.996  -13.594 1.00 68.08  ? 175 ARG E CZ  1 
ATOM   7825  N NH1 . ARG E  1 175 ? 32.403  -8.227  -12.640 1.00 68.79  ? 175 ARG E NH1 1 
ATOM   7826  N NH2 . ARG E  1 175 ? 30.416  -8.742  -13.664 1.00 67.80  ? 175 ARG E NH2 1 
ATOM   7827  N N   . LYS E  1 176 ? 33.925  -2.270  -17.482 1.00 58.07  ? 176 LYS E N   1 
ATOM   7828  C CA  . LYS E  1 176 ? 35.121  -1.469  -17.337 1.00 58.67  ? 176 LYS E CA  1 
ATOM   7829  C C   . LYS E  1 176 ? 35.379  -1.332  -15.850 1.00 60.06  ? 176 LYS E C   1 
ATOM   7830  O O   . LYS E  1 176 ? 34.463  -1.083  -15.067 1.00 60.90  ? 176 LYS E O   1 
ATOM   7831  C CB  . LYS E  1 176 ? 34.950  -0.103  -17.992 1.00 57.68  ? 176 LYS E CB  1 
ATOM   7832  C CG  . LYS E  1 176 ? 34.838  -0.167  -19.512 1.00 58.64  ? 176 LYS E CG  1 
ATOM   7833  C CD  . LYS E  1 176 ? 35.964  -0.978  -20.158 1.00 58.35  ? 176 LYS E CD  1 
ATOM   7834  C CE  . LYS E  1 176 ? 37.342  -0.372  -19.906 1.00 60.17  ? 176 LYS E CE  1 
ATOM   7835  N NZ  . LYS E  1 176 ? 37.543  0.976   -20.522 1.00 58.90  ? 176 LYS E NZ  1 
ATOM   7836  N N   . HIS E  1 177 ? 36.634  -1.515  -15.464 1.00 60.36  ? 177 HIS E N   1 
ATOM   7837  C CA  . HIS E  1 177 ? 37.017  -1.457  -14.066 1.00 59.44  ? 177 HIS E CA  1 
ATOM   7838  C C   . HIS E  1 177 ? 37.622  -0.115  -13.683 1.00 58.94  ? 177 HIS E C   1 
ATOM   7839  O O   . HIS E  1 177 ? 38.160  0.600   -14.525 1.00 58.28  ? 177 HIS E O   1 
ATOM   7840  C CB  . HIS E  1 177 ? 38.010  -2.584  -13.780 1.00 60.36  ? 177 HIS E CB  1 
ATOM   7841  C CG  . HIS E  1 177 ? 38.458  -2.644  -12.359 1.00 61.61  ? 177 HIS E CG  1 
ATOM   7842  N ND1 . HIS E  1 177 ? 37.594  -2.918  -11.319 1.00 62.19  ? 177 HIS E ND1 1 
ATOM   7843  C CD2 . HIS E  1 177 ? 39.672  -2.434  -11.798 1.00 62.35  ? 177 HIS E CD2 1 
ATOM   7844  C CE1 . HIS E  1 177 ? 38.257  -2.870  -10.178 1.00 63.91  ? 177 HIS E CE1 1 
ATOM   7845  N NE2 . HIS E  1 177 ? 39.519  -2.578  -10.441 1.00 64.43  ? 177 HIS E NE2 1 
ATOM   7846  N N   . TRP E  1 178 ? 37.523  0.223   -12.402 1.00 58.34  ? 178 TRP E N   1 
ATOM   7847  C CA  . TRP E  1 178 ? 38.075  1.473   -11.895 1.00 58.19  ? 178 TRP E CA  1 
ATOM   7848  C C   . TRP E  1 178 ? 38.316  1.368   -10.395 1.00 59.77  ? 178 TRP E C   1 
ATOM   7849  O O   . TRP E  1 178 ? 37.457  0.898   -9.652  1.00 59.00  ? 178 TRP E O   1 
ATOM   7850  C CB  . TRP E  1 178 ? 37.119  2.634   -12.172 1.00 54.57  ? 178 TRP E CB  1 
ATOM   7851  C CG  . TRP E  1 178 ? 37.705  3.991   -11.889 1.00 50.34  ? 178 TRP E CG  1 
ATOM   7852  C CD1 . TRP E  1 178 ? 38.240  4.858   -12.799 1.00 48.53  ? 178 TRP E CD1 1 
ATOM   7853  C CD2 . TRP E  1 178 ? 37.806  4.634   -10.614 1.00 47.77  ? 178 TRP E CD2 1 
ATOM   7854  N NE1 . TRP E  1 178 ? 38.663  6.004   -12.170 1.00 48.61  ? 178 TRP E NE1 1 
ATOM   7855  C CE2 . TRP E  1 178 ? 38.409  5.893   -10.828 1.00 47.47  ? 178 TRP E CE2 1 
ATOM   7856  C CE3 . TRP E  1 178 ? 37.442  4.271   -9.310  1.00 48.61  ? 178 TRP E CE3 1 
ATOM   7857  C CZ2 . TRP E  1 178 ? 38.658  6.793   -9.788  1.00 46.59  ? 178 TRP E CZ2 1 
ATOM   7858  C CZ3 . TRP E  1 178 ? 37.690  5.171   -8.269  1.00 47.54  ? 178 TRP E CZ3 1 
ATOM   7859  C CH2 . TRP E  1 178 ? 38.292  6.417   -8.520  1.00 46.80  ? 178 TRP E CH2 1 
ATOM   7860  N N   . GLU E  1 179 ? 39.493  1.811   -9.966  1.00 62.99  ? 179 GLU E N   1 
ATOM   7861  C CA  . GLU E  1 179 ? 39.882  1.801   -8.558  1.00 66.67  ? 179 GLU E CA  1 
ATOM   7862  C C   . GLU E  1 179 ? 40.725  3.041   -8.295  1.00 68.00  ? 179 GLU E C   1 
ATOM   7863  O O   . GLU E  1 179 ? 41.168  3.706   -9.232  1.00 67.73  ? 179 GLU E O   1 
ATOM   7864  C CB  . GLU E  1 179 ? 40.695  0.541   -8.226  1.00 68.52  ? 179 GLU E CB  1 
ATOM   7865  C CG  . GLU E  1 179 ? 41.882  0.294   -9.160  1.00 72.39  ? 179 GLU E CG  1 
ATOM   7866  C CD  . GLU E  1 179 ? 42.798  -0.834  -8.687  1.00 74.55  ? 179 GLU E CD  1 
ATOM   7867  O OE1 . GLU E  1 179 ? 42.286  -1.939  -8.389  1.00 73.69  ? 179 GLU E OE1 1 
ATOM   7868  O OE2 . GLU E  1 179 ? 44.032  -0.611  -8.622  1.00 75.66  ? 179 GLU E OE2 1 
ATOM   7869  N N   . PHE E  1 180 ? 40.948  3.352   -7.025  1.00 70.79  ? 180 PHE E N   1 
ATOM   7870  C CA  . PHE E  1 180 ? 41.744  4.519   -6.667  1.00 74.25  ? 180 PHE E CA  1 
ATOM   7871  C C   . PHE E  1 180 ? 43.243  4.233   -6.727  1.00 75.00  ? 180 PHE E C   1 
ATOM   7872  O O   . PHE E  1 180 ? 43.687  3.130   -6.411  1.00 74.88  ? 180 PHE E O   1 
ATOM   7873  C CB  . PHE E  1 180 ? 41.370  5.009   -5.266  1.00 76.34  ? 180 PHE E CB  1 
ATOM   7874  C CG  . PHE E  1 180 ? 42.069  6.277   -4.868  1.00 79.18  ? 180 PHE E CG  1 
ATOM   7875  C CD1 . PHE E  1 180 ? 42.037  7.394   -5.704  1.00 80.10  ? 180 PHE E CD1 1 
ATOM   7876  C CD2 . PHE E  1 180 ? 42.750  6.364   -3.657  1.00 79.71  ? 180 PHE E CD2 1 
ATOM   7877  C CE1 . PHE E  1 180 ? 42.674  8.581   -5.337  1.00 81.23  ? 180 PHE E CE1 1 
ATOM   7878  C CE2 . PHE E  1 180 ? 43.390  7.545   -3.281  1.00 79.93  ? 180 PHE E CE2 1 
ATOM   7879  C CZ  . PHE E  1 180 ? 43.352  8.655   -4.121  1.00 80.89  ? 180 PHE E CZ  1 
ATOM   7880  N N   . GLU E  1 181 ? 44.016  5.234   -7.134  1.00 76.09  ? 181 GLU E N   1 
ATOM   7881  C CA  . GLU E  1 181 ? 45.461  5.090   -7.231  1.00 78.67  ? 181 GLU E CA  1 
ATOM   7882  C C   . GLU E  1 181 ? 46.140  6.407   -6.862  1.00 80.82  ? 181 GLU E C   1 
ATOM   7883  O O   . GLU E  1 181 ? 46.367  7.262   -7.722  1.00 82.29  ? 181 GLU E O   1 
ATOM   7884  C CB  . GLU E  1 181 ? 45.854  4.670   -8.645  1.00 77.99  ? 181 GLU E CB  1 
ATOM   7885  N N   . GLU E  1 182 ? 46.458  6.562   -5.578  1.00 81.76  ? 182 GLU E N   1 
ATOM   7886  C CA  . GLU E  1 182 ? 47.105  7.772   -5.074  1.00 82.75  ? 182 GLU E CA  1 
ATOM   7887  C C   . GLU E  1 182 ? 48.386  8.104   -5.843  1.00 83.55  ? 182 GLU E C   1 
ATOM   7888  O O   . GLU E  1 182 ? 48.481  9.241   -6.360  1.00 83.58  ? 182 GLU E O   1 
ATOM   7889  C CB  . GLU E  1 182 ? 47.413  7.612   -3.585  1.00 83.07  ? 182 GLU E CB  1 
ATOM   7890  N N   . GLY F  2 5   ? 5.303   36.006  -28.555 1.00 89.28  ? 1   GLY F N   1 
ATOM   7891  C CA  . GLY F  2 5   ? 5.981   35.010  -27.671 1.00 89.51  ? 1   GLY F CA  1 
ATOM   7892  C C   . GLY F  2 5   ? 7.462   34.862  -27.980 1.00 89.22  ? 1   GLY F C   1 
ATOM   7893  O O   . GLY F  2 5   ? 7.850   34.707  -29.143 1.00 89.57  ? 1   GLY F O   1 
ATOM   7894  N N   . LYS F  2 6   ? 8.291   34.906  -26.938 1.00 87.46  ? 2   LYS F N   1 
ATOM   7895  C CA  . LYS F  2 6   ? 9.738   34.781  -27.099 1.00 84.93  ? 2   LYS F CA  1 
ATOM   7896  C C   . LYS F  2 6   ? 10.377  34.102  -25.890 1.00 82.62  ? 2   LYS F C   1 
ATOM   7897  O O   . LYS F  2 6   ? 11.549  34.330  -25.593 1.00 82.83  ? 2   LYS F O   1 
ATOM   7898  C CB  . LYS F  2 6   ? 10.364  36.162  -27.312 1.00 85.36  ? 2   LYS F CB  1 
ATOM   7899  N N   . LYS F  2 7   ? 9.599   33.276  -25.194 1.00 79.37  ? 3   LYS F N   1 
ATOM   7900  C CA  . LYS F  2 7   ? 10.089  32.558  -24.020 1.00 74.44  ? 3   LYS F CA  1 
ATOM   7901  C C   . LYS F  2 7   ? 9.730   31.080  -24.179 1.00 70.66  ? 3   LYS F C   1 
ATOM   7902  O O   . LYS F  2 7   ? 10.111  30.240  -23.360 1.00 69.72  ? 3   LYS F O   1 
ATOM   7903  C CB  . LYS F  2 7   ? 9.453   33.139  -22.750 1.00 75.96  ? 3   LYS F CB  1 
ATOM   7904  C CG  . LYS F  2 7   ? 10.202  32.826  -21.456 1.00 77.74  ? 3   LYS F CG  1 
ATOM   7905  C CD  . LYS F  2 7   ? 9.717   31.539  -20.796 1.00 78.98  ? 3   LYS F CD  1 
ATOM   7906  C CE  . LYS F  2 7   ? 8.268   31.652  -20.327 1.00 78.96  ? 3   LYS F CE  1 
ATOM   7907  N NZ  . LYS F  2 7   ? 8.078   32.722  -19.303 1.00 78.01  ? 3   LYS F NZ  1 
ATOM   7908  N N   . VAL F  2 8   ? 8.999   30.782  -25.253 1.00 65.27  ? 4   VAL F N   1 
ATOM   7909  C CA  . VAL F  2 8   ? 8.567   29.424  -25.573 1.00 59.85  ? 4   VAL F CA  1 
ATOM   7910  C C   . VAL F  2 8   ? 9.401   28.870  -26.719 1.00 56.65  ? 4   VAL F C   1 
ATOM   7911  O O   . VAL F  2 8   ? 9.363   29.391  -27.840 1.00 54.49  ? 4   VAL F O   1 
ATOM   7912  C CB  . VAL F  2 8   ? 7.085   29.391  -25.994 1.00 60.30  ? 4   VAL F CB  1 
ATOM   7913  C CG1 . VAL F  2 8   ? 6.633   27.955  -26.222 1.00 58.47  ? 4   VAL F CG1 1 
ATOM   7914  C CG2 . VAL F  2 8   ? 6.237   30.053  -24.927 1.00 60.85  ? 4   VAL F CG2 1 
ATOM   7915  N N   . ILE F  2 9   ? 10.149  27.809  -26.426 1.00 52.25  ? 5   ILE F N   1 
ATOM   7916  C CA  . ILE F  2 9   ? 11.009  27.177  -27.419 1.00 49.30  ? 5   ILE F CA  1 
ATOM   7917  C C   . ILE F  2 9   ? 10.176  26.471  -28.478 1.00 47.03  ? 5   ILE F C   1 
ATOM   7918  O O   . ILE F  2 9   ? 9.290   25.677  -28.159 1.00 45.27  ? 5   ILE F O   1 
ATOM   7919  C CB  . ILE F  2 9   ? 11.971  26.165  -26.747 1.00 48.97  ? 5   ILE F CB  1 
ATOM   7920  C CG1 . ILE F  2 9   ? 12.889  26.901  -25.766 1.00 47.23  ? 5   ILE F CG1 1 
ATOM   7921  C CG2 . ILE F  2 9   ? 12.816  25.465  -27.796 1.00 47.15  ? 5   ILE F CG2 1 
ATOM   7922  C CD1 . ILE F  2 9   ? 13.715  25.996  -24.898 1.00 47.24  ? 5   ILE F CD1 1 
ATOM   7923  N N   . THR F  2 10  ? 10.458  26.770  -29.742 1.00 44.93  ? 6   THR F N   1 
ATOM   7924  C CA  . THR F  2 10  ? 9.715   26.154  -30.829 1.00 44.79  ? 6   THR F CA  1 
ATOM   7925  C C   . THR F  2 10  ? 10.457  24.963  -31.424 1.00 44.17  ? 6   THR F C   1 
ATOM   7926  O O   . THR F  2 10  ? 11.680  24.992  -31.604 1.00 44.61  ? 6   THR F O   1 
ATOM   7927  C CB  . THR F  2 10  ? 9.410   27.169  -31.957 1.00 46.06  ? 6   THR F CB  1 
ATOM   7928  O OG1 . THR F  2 10  ? 10.630  27.586  -32.576 1.00 47.24  ? 6   THR F OG1 1 
ATOM   7929  C CG2 . THR F  2 10  ? 8.709   28.395  -31.393 1.00 46.26  ? 6   THR F CG2 1 
ATOM   7930  N N   . ALA F  2 11  ? 9.694   23.920  -31.727 1.00 43.14  ? 7   ALA F N   1 
ATOM   7931  C CA  . ALA F  2 11  ? 10.212  22.688  -32.301 1.00 43.03  ? 7   ALA F CA  1 
ATOM   7932  C C   . ALA F  2 11  ? 10.082  22.654  -33.823 1.00 43.26  ? 7   ALA F C   1 
ATOM   7933  O O   . ALA F  2 11  ? 9.145   23.211  -34.387 1.00 43.03  ? 7   ALA F O   1 
ATOM   7934  C CB  . ALA F  2 11  ? 9.476   21.498  -31.695 1.00 39.85  ? 7   ALA F CB  1 
ATOM   7935  N N   . PHE F  2 12  ? 11.045  22.015  -34.483 1.00 44.31  ? 8   PHE F N   1 
ATOM   7936  C CA  . PHE F  2 12  ? 11.008  21.866  -35.929 1.00 44.63  ? 8   PHE F CA  1 
ATOM   7937  C C   . PHE F  2 12  ? 9.839   20.942  -36.199 1.00 48.09  ? 8   PHE F C   1 
ATOM   7938  O O   . PHE F  2 12  ? 9.576   20.016  -35.422 1.00 47.09  ? 8   PHE F O   1 
ATOM   7939  C CB  . PHE F  2 12  ? 12.276  21.198  -36.444 1.00 43.50  ? 8   PHE F CB  1 
ATOM   7940  C CG  . PHE F  2 12  ? 13.484  22.065  -36.384 1.00 42.33  ? 8   PHE F CG  1 
ATOM   7941  C CD1 . PHE F  2 12  ? 13.746  22.976  -37.394 1.00 44.08  ? 8   PHE F CD1 1 
ATOM   7942  C CD2 . PHE F  2 12  ? 14.367  21.969  -35.321 1.00 42.98  ? 8   PHE F CD2 1 
ATOM   7943  C CE1 . PHE F  2 12  ? 14.879  23.780  -37.353 1.00 45.16  ? 8   PHE F CE1 1 
ATOM   7944  C CE2 . PHE F  2 12  ? 15.502  22.764  -35.265 1.00 44.01  ? 8   PHE F CE2 1 
ATOM   7945  C CZ  . PHE F  2 12  ? 15.760  23.672  -36.284 1.00 45.29  ? 8   PHE F CZ  1 
ATOM   7946  N N   . ASN F  2 13  ? 9.151   21.190  -37.307 1.00 52.17  ? 9   ASN F N   1 
ATOM   7947  C CA  . ASN F  2 13  ? 7.997   20.394  -37.690 1.00 56.74  ? 9   ASN F CA  1 
ATOM   7948  C C   . ASN F  2 13  ? 8.395   19.277  -38.657 1.00 57.09  ? 9   ASN F C   1 
ATOM   7949  O O   . ASN F  2 13  ? 8.925   19.539  -39.737 1.00 57.07  ? 9   ASN F O   1 
ATOM   7950  C CB  . ASN F  2 13  ? 6.952   21.298  -38.333 1.00 59.89  ? 9   ASN F CB  1 
ATOM   7951  C CG  . ASN F  2 13  ? 5.598   20.667  -38.358 1.00 64.22  ? 9   ASN F CG  1 
ATOM   7952  O OD1 . ASN F  2 13  ? 5.028   20.368  -37.309 1.00 67.34  ? 9   ASN F OD1 1 
ATOM   7953  N ND2 . ASN F  2 13  ? 5.067   20.444  -39.556 1.00 67.49  ? 9   ASN F ND2 1 
ATOM   7954  N N   . GLU F  2 14  ? 8.129   18.032  -38.280 1.00 57.06  ? 10  GLU F N   1 
ATOM   7955  C CA  . GLU F  2 14  ? 8.507   16.920  -39.137 1.00 56.98  ? 10  GLU F CA  1 
ATOM   7956  C C   . GLU F  2 14  ? 7.422   16.588  -40.149 1.00 54.73  ? 10  GLU F C   1 
ATOM   7957  O O   . GLU F  2 14  ? 6.237   16.604  -39.828 1.00 53.48  ? 10  GLU F O   1 
ATOM   7958  C CB  . GLU F  2 14  ? 8.815   15.686  -38.294 1.00 60.82  ? 10  GLU F CB  1 
ATOM   7959  C CG  . GLU F  2 14  ? 9.891   14.797  -38.897 1.00 67.16  ? 10  GLU F CG  1 
ATOM   7960  C CD  . GLU F  2 14  ? 11.268  15.438  -38.829 1.00 70.80  ? 10  GLU F CD  1 
ATOM   7961  O OE1 . GLU F  2 14  ? 11.570  16.333  -39.653 1.00 72.32  ? 10  GLU F OE1 1 
ATOM   7962  O OE2 . GLU F  2 14  ? 12.042  15.052  -37.926 1.00 72.80  ? 10  GLU F OE2 1 
ATOM   7963  N N   . GLY F  2 15  ? 7.843   16.292  -41.376 1.00 51.85  ? 11  GLY F N   1 
ATOM   7964  C CA  . GLY F  2 15  ? 6.904   15.952  -42.427 1.00 49.02  ? 11  GLY F CA  1 
ATOM   7965  C C   . GLY F  2 15  ? 6.565   14.472  -42.437 1.00 47.57  ? 11  GLY F C   1 
ATOM   7966  O O   . GLY F  2 15  ? 7.315   13.661  -41.891 1.00 47.65  ? 11  GLY F O   1 
ATOM   7967  N N   . LEU F  2 16  ? 5.434   14.123  -43.049 1.00 44.89  ? 12  LEU F N   1 
ATOM   7968  C CA  . LEU F  2 16  ? 4.982   12.733  -43.133 1.00 43.19  ? 12  LEU F CA  1 
ATOM   7969  C C   . LEU F  2 16  ? 5.445   12.063  -44.412 1.00 42.89  ? 12  LEU F C   1 
ATOM   7970  O O   . LEU F  2 16  ? 5.321   12.623  -45.502 1.00 42.77  ? 12  LEU F O   1 
ATOM   7971  C CB  . LEU F  2 16  ? 3.455   12.653  -43.060 1.00 42.54  ? 12  LEU F CB  1 
ATOM   7972  C CG  . LEU F  2 16  ? 2.835   12.704  -41.664 1.00 44.63  ? 12  LEU F CG  1 
ATOM   7973  C CD1 . LEU F  2 16  ? 3.205   11.431  -40.905 1.00 43.76  ? 12  LEU F CD1 1 
ATOM   7974  C CD2 . LEU F  2 16  ? 3.318   13.948  -40.913 1.00 43.68  ? 12  LEU F CD2 1 
ATOM   7975  N N   . LYS F  2 17  ? 5.964   10.851  -44.286 1.00 40.66  ? 13  LYS F N   1 
ATOM   7976  C CA  . LYS F  2 17  ? 6.447   10.155  -45.459 1.00 40.58  ? 13  LYS F CA  1 
ATOM   7977  C C   . LYS F  2 17  ? 5.346   9.356   -46.136 1.00 41.61  ? 13  LYS F C   1 
ATOM   7978  O O   . LYS F  2 17  ? 4.387   8.943   -45.495 1.00 41.59  ? 13  LYS F O   1 
ATOM   7979  C CB  . LYS F  2 17  ? 7.605   9.237   -45.079 1.00 39.83  ? 13  LYS F CB  1 
ATOM   7980  C CG  . LYS F  2 17  ? 8.818   9.983   -44.531 1.00 40.15  ? 13  LYS F CG  1 
ATOM   7981  C CD  . LYS F  2 17  ? 9.950   9.029   -44.175 1.00 38.72  ? 13  LYS F CD  1 
ATOM   7982  C CE  . LYS F  2 17  ? 11.143  9.763   -43.604 1.00 38.02  ? 13  LYS F CE  1 
ATOM   7983  N NZ  . LYS F  2 17  ? 12.210  8.804   -43.201 1.00 38.41  ? 13  LYS F NZ  1 
ATOM   7984  N N   . GLY F  2 18  ? 5.492   9.124   -47.437 1.00 42.61  ? 14  GLY F N   1 
ATOM   7985  C CA  . GLY F  2 18  ? 4.482   8.376   -48.170 1.00 41.65  ? 14  GLY F CA  1 
ATOM   7986  C C   . GLY F  2 18  ? 5.015   7.108   -48.803 1.00 41.19  ? 14  GLY F C   1 
ATOM   7987  O O   . GLY F  2 18  ? 6.145   6.712   -48.547 1.00 41.50  ? 14  GLY F O   1 
ATOM   7988  N N   . GLY F  2 19  ? 4.196   6.483   -49.642 1.00 43.19  ? 15  GLY F N   1 
ATOM   7989  C CA  . GLY F  2 19  ? 4.569   5.248   -50.312 1.00 43.73  ? 15  GLY F CA  1 
ATOM   7990  C C   . GLY F  2 19  ? 5.446   5.468   -51.527 1.00 44.99  ? 15  GLY F C   1 
ATOM   7991  O O   . GLY F  2 19  ? 5.711   6.607   -51.904 1.00 44.35  ? 15  GLY F O   1 
ATOM   7992  N N   . GLY F  2 20  ? 5.901   4.374   -52.138 1.00 46.90  ? 16  GLY F N   1 
ATOM   7993  C CA  . GLY F  2 20  ? 6.765   4.474   -53.304 1.00 47.76  ? 16  GLY F CA  1 
ATOM   7994  C C   . GLY F  2 20  ? 8.238   4.205   -53.004 1.00 49.25  ? 16  GLY F C   1 
ATOM   7995  O O   . GLY F  2 20  ? 8.651   4.150   -51.845 1.00 49.56  ? 16  GLY F O   1 
ATOM   7996  N N   . GLY F  2 21  ? 9.031   4.036   -54.058 1.00 48.77  ? 17  GLY F N   1 
ATOM   7997  C CA  . GLY F  2 21  ? 10.450  3.777   -53.903 1.00 47.30  ? 17  GLY F CA  1 
ATOM   7998  C C   . GLY F  2 21  ? 10.816  2.568   -53.057 1.00 48.20  ? 17  GLY F C   1 
ATOM   7999  O O   . GLY F  2 21  ? 11.829  2.594   -52.358 1.00 47.33  ? 17  GLY F O   1 
ATOM   8000  N N   . SER F  2 22  ? 10.018  1.505   -53.118 1.00 47.73  ? 18  SER F N   1 
ATOM   8001  C CA  . SER F  2 22  ? 10.304  0.316   -52.326 1.00 48.74  ? 18  SER F CA  1 
ATOM   8002  C C   . SER F  2 22  ? 11.535  -0.408  -52.846 1.00 49.10  ? 18  SER F C   1 
ATOM   8003  O O   . SER F  2 22  ? 11.729  -0.521  -54.056 1.00 50.19  ? 18  SER F O   1 
ATOM   8004  C CB  . SER F  2 22  ? 9.094   -0.593  -52.325 1.00 47.37  ? 18  SER F CB  1 
ATOM   8005  O OG  . SER F  2 22  ? 8.007   0.115   -51.773 1.00 50.05  ? 18  SER F OG  1 
ATOM   8006  N N   . LEU F  2 23  ? 12.361  -0.903  -51.930 1.00 48.38  ? 19  LEU F N   1 
ATOM   8007  C CA  . LEU F  2 23  ? 13.599  -1.562  -52.320 1.00 52.29  ? 19  LEU F CA  1 
ATOM   8008  C C   . LEU F  2 23  ? 13.768  -2.983  -51.794 1.00 55.49  ? 19  LEU F C   1 
ATOM   8009  O O   . LEU F  2 23  ? 13.214  -3.345  -50.759 1.00 54.02  ? 19  LEU F O   1 
ATOM   8010  C CB  . LEU F  2 23  ? 14.791  -0.714  -51.864 1.00 48.47  ? 19  LEU F CB  1 
ATOM   8011  C CG  . LEU F  2 23  ? 14.790  0.761   -52.281 1.00 47.77  ? 19  LEU F CG  1 
ATOM   8012  C CD1 . LEU F  2 23  ? 15.835  1.521   -51.470 1.00 45.97  ? 19  LEU F CD1 1 
ATOM   8013  C CD2 . LEU F  2 23  ? 15.063  0.888   -53.778 1.00 46.42  ? 19  LEU F CD2 1 
ATOM   8014  N N   . VAL F  2 24  ? 14.558  -3.772  -52.522 1.00 60.63  ? 20  VAL F N   1 
ATOM   8015  C CA  . VAL F  2 24  ? 14.845  -5.160  -52.172 1.00 66.23  ? 20  VAL F CA  1 
ATOM   8016  C C   . VAL F  2 24  ? 15.446  -5.203  -50.774 1.00 70.10  ? 20  VAL F C   1 
ATOM   8017  O O   . VAL F  2 24  ? 15.487  -6.254  -50.126 1.00 69.89  ? 20  VAL F O   1 
ATOM   8018  C CB  . VAL F  2 24  ? 15.850  -5.784  -53.164 1.00 66.18  ? 20  VAL F CB  1 
ATOM   8019  C CG1 . VAL F  2 24  ? 16.066  -7.251  -52.842 1.00 68.79  ? 20  VAL F CG1 1 
ATOM   8020  C CG2 . VAL F  2 24  ? 15.337  -5.635  -54.583 1.00 68.06  ? 20  VAL F CG2 1 
ATOM   8021  N N   . GLY F  2 25  ? 15.911  -4.043  -50.320 1.00 74.98  ? 21  GLY F N   1 
ATOM   8022  C CA  . GLY F  2 25  ? 16.501  -3.936  -49.000 1.00 81.07  ? 21  GLY F CA  1 
ATOM   8023  C C   . GLY F  2 25  ? 17.938  -4.422  -48.923 1.00 85.79  ? 21  GLY F C   1 
ATOM   8024  O O   . GLY F  2 25  ? 18.860  -3.628  -48.705 1.00 85.49  ? 21  GLY F O   1 
ATOM   8025  N N   . GLY F  2 26  ? 18.133  -5.728  -49.103 1.00 89.65  ? 22  GLY F N   1 
ATOM   8026  C CA  . GLY F  2 26  ? 19.470  -6.290  -49.028 1.00 94.16  ? 22  GLY F CA  1 
ATOM   8027  C C   . GLY F  2 26  ? 19.994  -6.246  -47.601 1.00 97.30  ? 22  GLY F C   1 
ATOM   8028  O O   . GLY F  2 26  ? 19.875  -7.224  -46.857 1.00 97.66  ? 22  GLY F O   1 
ATOM   8029  N N   . GLY F  2 27  ? 20.569  -5.107  -47.219 1.00 99.83  ? 23  GLY F N   1 
ATOM   8030  C CA  . GLY F  2 27  ? 21.098  -4.943  -45.874 1.00 102.50 ? 23  GLY F CA  1 
ATOM   8031  C C   . GLY F  2 27  ? 22.554  -5.349  -45.726 1.00 104.14 ? 23  GLY F C   1 
ATOM   8032  O O   . GLY F  2 27  ? 23.357  -5.176  -46.649 1.00 104.31 ? 23  GLY F O   1 
ATOM   8033  N N   . SER F  2 28  ? 22.897  -5.881  -44.556 1.00 105.25 ? 24  SER F N   1 
ATOM   8034  C CA  . SER F  2 28  ? 24.260  -6.323  -44.289 1.00 106.04 ? 24  SER F CA  1 
ATOM   8035  C C   . SER F  2 28  ? 24.275  -7.841  -44.083 1.00 105.98 ? 24  SER F C   1 
ATOM   8036  O O   . SER F  2 28  ? 25.040  -8.559  -44.732 1.00 105.93 ? 24  SER F O   1 
ATOM   8037  C CB  . SER F  2 28  ? 24.816  -5.609  -43.050 1.00 106.37 ? 24  SER F CB  1 
ATOM   8038  O OG  . SER F  2 28  ? 26.219  -5.796  -42.934 1.00 106.51 ? 24  SER F OG  1 
ATOM   8039  N N   . GLY F  2 29  ? 23.419  -8.324  -43.185 1.00 105.54 ? 25  GLY F N   1 
ATOM   8040  C CA  . GLY F  2 29  ? 23.350  -9.750  -42.923 1.00 104.92 ? 25  GLY F CA  1 
ATOM   8041  C C   . GLY F  2 29  ? 23.864  -10.144 -41.550 1.00 104.41 ? 25  GLY F C   1 
ATOM   8042  O O   . GLY F  2 29  ? 25.050  -10.437 -41.380 1.00 104.75 ? 25  GLY F O   1 
ATOM   8043  N N   . GLY F  2 30  ? 22.969  -10.156 -40.566 1.00 103.15 ? 26  GLY F N   1 
ATOM   8044  C CA  . GLY F  2 30  ? 23.359  -10.523 -39.217 1.00 100.67 ? 26  GLY F CA  1 
ATOM   8045  C C   . GLY F  2 30  ? 23.106  -11.989 -38.912 1.00 98.86  ? 26  GLY F C   1 
ATOM   8046  O O   . GLY F  2 30  ? 23.998  -12.697 -38.440 1.00 99.10  ? 26  GLY F O   1 
ATOM   8047  N N   . GLY F  2 31  ? 21.889  -12.450 -39.183 1.00 96.41  ? 27  GLY F N   1 
ATOM   8048  C CA  . GLY F  2 31  ? 21.549  -13.836 -38.917 1.00 93.08  ? 27  GLY F CA  1 
ATOM   8049  C C   . GLY F  2 31  ? 21.179  -14.053 -37.460 1.00 90.87  ? 27  GLY F C   1 
ATOM   8050  O O   . GLY F  2 31  ? 20.013  -14.279 -37.132 1.00 91.28  ? 27  GLY F O   1 
ATOM   8051  N N   . GLY F  2 32  ? 22.172  -13.980 -36.579 1.00 88.04  ? 28  GLY F N   1 
ATOM   8052  C CA  . GLY F  2 32  ? 21.913  -14.169 -35.164 1.00 83.72  ? 28  GLY F CA  1 
ATOM   8053  C C   . GLY F  2 32  ? 21.603  -12.873 -34.431 1.00 80.62  ? 28  GLY F C   1 
ATOM   8054  O O   . GLY F  2 32  ? 20.908  -12.882 -33.411 1.00 80.97  ? 28  GLY F O   1 
ATOM   8055  N N   . SER F  2 33  ? 22.115  -11.759 -34.950 1.00 76.27  ? 29  SER F N   1 
ATOM   8056  C CA  . SER F  2 33  ? 21.898  -10.447 -34.342 1.00 71.70  ? 29  SER F CA  1 
ATOM   8057  C C   . SER F  2 33  ? 20.425  -10.047 -34.325 1.00 67.81  ? 29  SER F C   1 
ATOM   8058  O O   . SER F  2 33  ? 19.733  -10.147 -35.338 1.00 67.42  ? 29  SER F O   1 
ATOM   8059  C CB  . SER F  2 33  ? 22.714  -9.386  -35.086 1.00 71.85  ? 29  SER F CB  1 
ATOM   8060  O OG  . SER F  2 33  ? 22.427  -9.409  -36.471 1.00 73.74  ? 29  SER F OG  1 
ATOM   8061  N N   . ARG F  2 34  ? 19.950  -9.591  -33.171 1.00 63.50  ? 30  ARG F N   1 
ATOM   8062  C CA  . ARG F  2 34  ? 18.560  -9.186  -33.044 1.00 58.89  ? 30  ARG F CA  1 
ATOM   8063  C C   . ARG F  2 34  ? 18.234  -8.000  -33.939 1.00 56.56  ? 30  ARG F C   1 
ATOM   8064  O O   . ARG F  2 34  ? 18.980  -7.020  -33.984 1.00 56.54  ? 30  ARG F O   1 
ATOM   8065  C CB  . ARG F  2 34  ? 18.230  -8.803  -31.608 1.00 58.42  ? 30  ARG F CB  1 
ATOM   8066  C CG  . ARG F  2 34  ? 16.748  -8.562  -31.418 1.00 59.87  ? 30  ARG F CG  1 
ATOM   8067  C CD  . ARG F  2 34  ? 16.421  -7.789  -30.145 1.00 60.53  ? 30  ARG F CD  1 
ATOM   8068  N NE  . ARG F  2 34  ? 16.875  -6.405  -30.218 1.00 62.00  ? 30  ARG F NE  1 
ATOM   8069  C CZ  . ARG F  2 34  ? 16.255  -5.386  -29.636 1.00 62.46  ? 30  ARG F CZ  1 
ATOM   8070  N NH1 . ARG F  2 34  ? 15.146  -5.595  -28.940 1.00 61.43  ? 30  ARG F NH1 1 
ATOM   8071  N NH2 . ARG F  2 34  ? 16.756  -4.161  -29.735 1.00 63.27  ? 30  ARG F NH2 1 
ATOM   8072  N N   . PRO F  2 35  ? 17.114  -8.082  -34.672 1.00 53.95  ? 31  PRO F N   1 
ATOM   8073  C CA  . PRO F  2 35  ? 16.640  -7.032  -35.585 1.00 49.99  ? 31  PRO F CA  1 
ATOM   8074  C C   . PRO F  2 35  ? 16.123  -5.798  -34.847 1.00 46.95  ? 31  PRO F C   1 
ATOM   8075  O O   . PRO F  2 35  ? 15.502  -5.915  -33.792 1.00 46.17  ? 31  PRO F O   1 
ATOM   8076  C CB  . PRO F  2 35  ? 15.518  -7.723  -36.353 1.00 49.83  ? 31  PRO F CB  1 
ATOM   8077  C CG  . PRO F  2 35  ? 15.935  -9.159  -36.342 1.00 52.78  ? 31  PRO F CG  1 
ATOM   8078  C CD  . PRO F  2 35  ? 16.395  -9.343  -34.921 1.00 53.02  ? 31  PRO F CD  1 
ATOM   8079  N N   . TRP F  2 36  ? 16.398  -4.623  -35.405 1.00 42.29  ? 32  TRP F N   1 
ATOM   8080  C CA  . TRP F  2 36  ? 15.941  -3.360  -34.841 1.00 39.48  ? 32  TRP F CA  1 
ATOM   8081  C C   . TRP F  2 36  ? 15.650  -2.402  -35.999 1.00 39.01  ? 32  TRP F C   1 
ATOM   8082  O O   . TRP F  2 36  ? 16.204  -2.544  -37.087 1.00 39.76  ? 32  TRP F O   1 
ATOM   8083  C CB  . TRP F  2 36  ? 16.982  -2.765  -33.888 1.00 36.56  ? 32  TRP F CB  1 
ATOM   8084  C CG  . TRP F  2 36  ? 18.329  -2.595  -34.469 1.00 34.88  ? 32  TRP F CG  1 
ATOM   8085  C CD1 . TRP F  2 36  ? 19.247  -3.570  -34.717 1.00 34.99  ? 32  TRP F CD1 1 
ATOM   8086  C CD2 . TRP F  2 36  ? 18.920  -1.367  -34.898 1.00 34.64  ? 32  TRP F CD2 1 
ATOM   8087  N NE1 . TRP F  2 36  ? 20.382  -3.027  -35.276 1.00 32.20  ? 32  TRP F NE1 1 
ATOM   8088  C CE2 . TRP F  2 36  ? 20.204  -1.675  -35.402 1.00 32.42  ? 32  TRP F CE2 1 
ATOM   8089  C CE3 . TRP F  2 36  ? 18.488  -0.032  -34.909 1.00 33.79  ? 32  TRP F CE3 1 
ATOM   8090  C CZ2 . TRP F  2 36  ? 21.057  -0.703  -35.915 1.00 31.28  ? 32  TRP F CZ2 1 
ATOM   8091  C CZ3 . TRP F  2 36  ? 19.338  0.937   -35.419 1.00 32.38  ? 32  TRP F CZ3 1 
ATOM   8092  C CH2 . TRP F  2 36  ? 20.609  0.597   -35.916 1.00 33.06  ? 32  TRP F CH2 1 
ATOM   8093  N N   . PHE F  2 37  ? 14.771  -1.438  -35.765 1.00 36.12  ? 33  PHE F N   1 
ATOM   8094  C CA  . PHE F  2 37  ? 14.382  -0.490  -36.801 1.00 35.18  ? 33  PHE F CA  1 
ATOM   8095  C C   . PHE F  2 37  ? 14.260  0.869   -36.143 1.00 31.48  ? 33  PHE F C   1 
ATOM   8096  O O   . PHE F  2 37  ? 13.437  1.056   -35.258 1.00 30.02  ? 33  PHE F O   1 
ATOM   8097  C CB  . PHE F  2 37  ? 13.038  -0.923  -37.393 1.00 37.72  ? 33  PHE F CB  1 
ATOM   8098  C CG  . PHE F  2 37  ? 12.968  -2.397  -37.681 1.00 40.21  ? 33  PHE F CG  1 
ATOM   8099  C CD1 . PHE F  2 37  ? 13.505  -2.917  -38.854 1.00 42.40  ? 33  PHE F CD1 1 
ATOM   8100  C CD2 . PHE F  2 37  ? 12.432  -3.276  -36.743 1.00 40.51  ? 33  PHE F CD2 1 
ATOM   8101  C CE1 . PHE F  2 37  ? 13.511  -4.293  -39.085 1.00 42.78  ? 33  PHE F CE1 1 
ATOM   8102  C CE2 . PHE F  2 37  ? 12.435  -4.649  -36.966 1.00 42.71  ? 33  PHE F CE2 1 
ATOM   8103  C CZ  . PHE F  2 37  ? 12.976  -5.158  -38.136 1.00 41.13  ? 33  PHE F CZ  1 
ATOM   8104  N N   . LEU F  2 38  ? 15.073  1.807   -36.608 1.00 29.76  ? 34  LEU F N   1 
ATOM   8105  C CA  . LEU F  2 38  ? 15.121  3.141   -36.055 1.00 28.41  ? 34  LEU F CA  1 
ATOM   8106  C C   . LEU F  2 38  ? 14.886  4.257   -37.066 1.00 28.13  ? 34  LEU F C   1 
ATOM   8107  O O   . LEU F  2 38  ? 15.521  4.303   -38.112 1.00 25.24  ? 34  LEU F O   1 
ATOM   8108  C CB  . LEU F  2 38  ? 16.492  3.359   -35.417 1.00 27.93  ? 34  LEU F CB  1 
ATOM   8109  C CG  . LEU F  2 38  ? 16.828  4.692   -34.741 1.00 27.37  ? 34  LEU F CG  1 
ATOM   8110  C CD1 . LEU F  2 38  ? 16.113  4.758   -33.408 1.00 24.30  ? 34  LEU F CD1 1 
ATOM   8111  C CD2 . LEU F  2 38  ? 18.329  4.803   -34.533 1.00 29.12  ? 34  LEU F CD2 1 
ATOM   8112  N N   . GLU F  2 39  ? 13.971  5.155   -36.721 1.00 28.42  ? 35  GLU F N   1 
ATOM   8113  C CA  . GLU F  2 39  ? 13.659  6.325   -37.530 1.00 28.68  ? 35  GLU F CA  1 
ATOM   8114  C C   . GLU F  2 39  ? 14.249  7.436   -36.673 1.00 28.27  ? 35  GLU F C   1 
ATOM   8115  O O   . GLU F  2 39  ? 13.733  7.751   -35.599 1.00 27.51  ? 35  GLU F O   1 
ATOM   8116  C CB  . GLU F  2 39  ? 12.151  6.511   -37.671 1.00 29.54  ? 35  GLU F CB  1 
ATOM   8117  C CG  . GLU F  2 39  ? 11.755  7.815   -38.366 1.00 33.85  ? 35  GLU F CG  1 
ATOM   8118  C CD  . GLU F  2 39  ? 12.203  7.877   -39.831 1.00 39.02  ? 35  GLU F CD  1 
ATOM   8119  O OE1 . GLU F  2 39  ? 12.785  6.890   -40.321 1.00 41.27  ? 35  GLU F OE1 1 
ATOM   8120  O OE2 . GLU F  2 39  ? 11.966  8.911   -40.496 1.00 38.80  ? 35  GLU F OE2 1 
ATOM   8121  N N   . TYR F  2 40  ? 15.320  8.034   -37.174 1.00 26.74  ? 36  TYR F N   1 
ATOM   8122  C CA  . TYR F  2 40  ? 16.056  9.036   -36.434 1.00 27.19  ? 36  TYR F CA  1 
ATOM   8123  C C   . TYR F  2 40  ? 16.274  10.300  -37.246 1.00 27.44  ? 36  TYR F C   1 
ATOM   8124  O O   . TYR F  2 40  ? 16.743  10.271  -38.380 1.00 26.21  ? 36  TYR F O   1 
ATOM   8125  C CB  . TYR F  2 40  ? 17.385  8.393   -36.028 1.00 26.97  ? 36  TYR F CB  1 
ATOM   8126  C CG  . TYR F  2 40  ? 18.321  9.222   -35.199 1.00 26.45  ? 36  TYR F CG  1 
ATOM   8127  C CD1 . TYR F  2 40  ? 17.845  10.041  -34.179 1.00 25.49  ? 36  TYR F CD1 1 
ATOM   8128  C CD2 . TYR F  2 40  ? 19.705  9.106   -35.370 1.00 25.36  ? 36  TYR F CD2 1 
ATOM   8129  C CE1 . TYR F  2 40  ? 18.711  10.716  -33.348 1.00 26.83  ? 36  TYR F CE1 1 
ATOM   8130  C CE2 . TYR F  2 40  ? 20.585  9.774   -34.543 1.00 24.86  ? 36  TYR F CE2 1 
ATOM   8131  C CZ  . TYR F  2 40  ? 20.082  10.573  -33.531 1.00 27.58  ? 36  TYR F CZ  1 
ATOM   8132  O OH  . TYR F  2 40  ? 20.940  11.201  -32.673 1.00 26.87  ? 36  TYR F OH  1 
ATOM   8133  N N   . CYS F  2 41  ? 15.931  11.421  -36.643 1.00 29.33  ? 37  CYS F N   1 
ATOM   8134  C CA  . CYS F  2 41  ? 16.063  12.693  -37.305 1.00 31.75  ? 37  CYS F CA  1 
ATOM   8135  C C   . CYS F  2 41  ? 16.750  13.720  -36.408 1.00 32.18  ? 37  CYS F C   1 
ATOM   8136  O O   . CYS F  2 41  ? 16.471  13.804  -35.212 1.00 33.61  ? 37  CYS F O   1 
ATOM   8137  C CB  . CYS F  2 41  ? 14.680  13.196  -37.688 1.00 34.49  ? 37  CYS F CB  1 
ATOM   8138  S SG  . CYS F  2 41  ? 14.701  14.897  -38.229 1.00 47.70  ? 37  CYS F SG  1 
ATOM   8139  N N   . LYS F  2 42  ? 17.654  14.496  -36.986 1.00 31.52  ? 38  LYS F N   1 
ATOM   8140  C CA  . LYS F  2 42  ? 18.349  15.528  -36.229 1.00 31.00  ? 38  LYS F CA  1 
ATOM   8141  C C   . LYS F  2 42  ? 18.282  16.812  -37.022 1.00 29.79  ? 38  LYS F C   1 
ATOM   8142  O O   . LYS F  2 42  ? 18.627  16.843  -38.202 1.00 27.78  ? 38  LYS F O   1 
ATOM   8143  C CB  . LYS F  2 42  ? 19.825  15.153  -35.995 1.00 32.30  ? 38  LYS F CB  1 
ATOM   8144  C CG  . LYS F  2 42  ? 20.020  13.965  -35.083 1.00 32.07  ? 38  LYS F CG  1 
ATOM   8145  C CD  . LYS F  2 42  ? 21.487  13.753  -34.743 1.00 35.58  ? 38  LYS F CD  1 
ATOM   8146  C CE  . LYS F  2 42  ? 22.269  13.222  -35.925 1.00 35.97  ? 38  LYS F CE  1 
ATOM   8147  N NZ  . LYS F  2 42  ? 23.688  13.035  -35.564 1.00 39.55  ? 38  LYS F NZ  1 
ATOM   8148  N N   . SER F  2 43  ? 17.818  17.871  -36.377 1.00 30.65  ? 39  SER F N   1 
ATOM   8149  C CA  . SER F  2 43  ? 17.734  19.165  -37.038 1.00 32.29  ? 39  SER F CA  1 
ATOM   8150  C C   . SER F  2 43  ? 18.803  20.020  -36.411 1.00 32.82  ? 39  SER F C   1 
ATOM   8151  O O   . SER F  2 43  ? 18.761  20.286  -35.210 1.00 33.60  ? 39  SER F O   1 
ATOM   8152  C CB  . SER F  2 43  ? 16.350  19.775  -36.833 1.00 30.67  ? 39  SER F CB  1 
ATOM   8153  O OG  . SER F  2 43  ? 15.358  18.933  -37.396 1.00 29.12  ? 39  SER F OG  1 
ATOM   8154  N N   . GLU F  2 44  ? 19.776  20.436  -37.213 1.00 35.19  ? 40  GLU F N   1 
ATOM   8155  C CA  . GLU F  2 44  ? 20.874  21.237  -36.676 1.00 38.28  ? 40  GLU F CA  1 
ATOM   8156  C C   . GLU F  2 44  ? 20.864  22.706  -37.086 1.00 37.74  ? 40  GLU F C   1 
ATOM   8157  O O   . GLU F  2 44  ? 20.847  23.026  -38.269 1.00 39.28  ? 40  GLU F O   1 
ATOM   8158  C CB  . GLU F  2 44  ? 22.218  20.626  -37.089 1.00 39.19  ? 40  GLU F CB  1 
ATOM   8159  C CG  . GLU F  2 44  ? 22.313  19.116  -36.926 1.00 44.62  ? 40  GLU F CG  1 
ATOM   8160  C CD  . GLU F  2 44  ? 23.638  18.535  -37.431 1.00 46.04  ? 40  GLU F CD  1 
ATOM   8161  O OE1 . GLU F  2 44  ? 24.123  18.973  -38.501 1.00 46.28  ? 40  GLU F OE1 1 
ATOM   8162  O OE2 . GLU F  2 44  ? 24.184  17.624  -36.766 1.00 46.49  ? 40  GLU F OE2 1 
ATOM   8163  N N   . CYS F  2 45  ? 20.869  23.599  -36.105 1.00 38.77  ? 41  CYS F N   1 
ATOM   8164  C CA  . CYS F  2 45  ? 20.928  25.032  -36.393 1.00 39.67  ? 41  CYS F CA  1 
ATOM   8165  C C   . CYS F  2 45  ? 22.375  25.440  -36.177 1.00 39.48  ? 41  CYS F C   1 
ATOM   8166  O O   . CYS F  2 45  ? 22.889  25.336  -35.066 1.00 37.43  ? 41  CYS F O   1 
ATOM   8167  C CB  . CYS F  2 45  ? 20.049  25.836  -35.442 1.00 40.71  ? 41  CYS F CB  1 
ATOM   8168  S SG  . CYS F  2 45  ? 18.258  25.707  -35.710 1.00 46.77  ? 41  CYS F SG  1 
ATOM   8169  N N   . HIS F  2 46  ? 23.036  25.872  -37.246 1.00 41.30  ? 42  HIS F N   1 
ATOM   8170  C CA  . HIS F  2 46  ? 24.434  26.296  -37.174 1.00 42.77  ? 42  HIS F CA  1 
ATOM   8171  C C   . HIS F  2 46  ? 24.480  27.820  -37.173 1.00 44.00  ? 42  HIS F C   1 
ATOM   8172  O O   . HIS F  2 46  ? 23.983  28.462  -38.098 1.00 44.01  ? 42  HIS F O   1 
ATOM   8173  C CB  . HIS F  2 46  ? 25.218  25.772  -38.374 1.00 43.06  ? 42  HIS F CB  1 
ATOM   8174  C CG  . HIS F  2 46  ? 25.322  24.278  -38.427 1.00 46.18  ? 42  HIS F CG  1 
ATOM   8175  N ND1 . HIS F  2 46  ? 26.182  23.562  -37.620 1.00 44.88  ? 42  HIS F ND1 1 
ATOM   8176  C CD2 . HIS F  2 46  ? 24.677  23.366  -39.194 1.00 43.42  ? 42  HIS F CD2 1 
ATOM   8177  C CE1 . HIS F  2 46  ? 26.063  22.274  -37.891 1.00 43.27  ? 42  HIS F CE1 1 
ATOM   8178  N NE2 . HIS F  2 46  ? 25.157  22.130  -38.842 1.00 43.28  ? 42  HIS F NE2 1 
ATOM   8179  N N   . PHE F  2 47  ? 25.087  28.385  -36.138 1.00 44.02  ? 43  PHE F N   1 
ATOM   8180  C CA  . PHE F  2 47  ? 25.182  29.825  -35.993 1.00 46.74  ? 43  PHE F CA  1 
ATOM   8181  C C   . PHE F  2 47  ? 26.603  30.371  -36.162 1.00 49.79  ? 43  PHE F C   1 
ATOM   8182  O O   . PHE F  2 47  ? 27.567  29.853  -35.592 1.00 49.27  ? 43  PHE F O   1 
ATOM   8183  C CB  . PHE F  2 47  ? 24.630  30.225  -34.624 1.00 43.76  ? 43  PHE F CB  1 
ATOM   8184  C CG  . PHE F  2 47  ? 23.185  29.867  -34.429 1.00 43.73  ? 43  PHE F CG  1 
ATOM   8185  C CD1 . PHE F  2 47  ? 22.177  30.723  -34.866 1.00 42.68  ? 43  PHE F CD1 1 
ATOM   8186  C CD2 . PHE F  2 47  ? 22.828  28.661  -33.829 1.00 43.32  ? 43  PHE F CD2 1 
ATOM   8187  C CE1 . PHE F  2 47  ? 20.834  30.385  -34.706 1.00 42.13  ? 43  PHE F CE1 1 
ATOM   8188  C CE2 . PHE F  2 47  ? 21.485  28.312  -33.664 1.00 42.68  ? 43  PHE F CE2 1 
ATOM   8189  C CZ  . PHE F  2 47  ? 20.488  29.174  -34.104 1.00 41.67  ? 43  PHE F CZ  1 
ATOM   8190  N N   . TYR F  2 48  ? 26.713  31.426  -36.960 1.00 53.23  ? 44  TYR F N   1 
ATOM   8191  C CA  . TYR F  2 48  ? 27.982  32.087  -37.202 1.00 56.98  ? 44  TYR F CA  1 
ATOM   8192  C C   . TYR F  2 48  ? 27.838  33.560  -36.806 1.00 59.24  ? 44  TYR F C   1 
ATOM   8193  O O   . TYR F  2 48  ? 27.093  34.322  -37.431 1.00 58.15  ? 44  TYR F O   1 
ATOM   8194  C CB  . TYR F  2 48  ? 28.355  31.925  -38.667 1.00 57.15  ? 44  TYR F CB  1 
ATOM   8195  C CG  . TYR F  2 48  ? 28.506  30.472  -39.034 1.00 58.38  ? 44  TYR F CG  1 
ATOM   8196  C CD1 . TYR F  2 48  ? 29.494  29.685  -38.442 1.00 59.33  ? 44  TYR F CD1 1 
ATOM   8197  C CD2 . TYR F  2 48  ? 27.647  29.870  -39.944 1.00 58.87  ? 44  TYR F CD2 1 
ATOM   8198  C CE1 . TYR F  2 48  ? 29.622  28.327  -38.750 1.00 59.34  ? 44  TYR F CE1 1 
ATOM   8199  C CE2 . TYR F  2 48  ? 27.766  28.510  -40.261 1.00 59.43  ? 44  TYR F CE2 1 
ATOM   8200  C CZ  . TYR F  2 48  ? 28.754  27.748  -39.662 1.00 58.78  ? 44  TYR F CZ  1 
ATOM   8201  O OH  . TYR F  2 48  ? 28.878  26.416  -39.989 1.00 60.13  ? 44  TYR F OH  1 
ATOM   8202  N N   . ASN F  2 49  ? 28.549  33.944  -35.747 1.00 63.03  ? 45  ASN F N   1 
ATOM   8203  C CA  . ASN F  2 49  ? 28.491  35.305  -35.219 1.00 65.82  ? 45  ASN F CA  1 
ATOM   8204  C C   . ASN F  2 49  ? 27.027  35.573  -34.869 1.00 65.47  ? 45  ASN F C   1 
ATOM   8205  O O   . ASN F  2 49  ? 26.386  36.465  -35.425 1.00 66.47  ? 45  ASN F O   1 
ATOM   8206  C CB  . ASN F  2 49  ? 28.992  36.328  -36.254 1.00 70.17  ? 45  ASN F CB  1 
ATOM   8207  C CG  . ASN F  2 49  ? 29.202  37.713  -35.649 1.00 75.32  ? 45  ASN F CG  1 
ATOM   8208  O OD1 . ASN F  2 49  ? 29.968  37.856  -34.695 1.00 75.97  ? 45  ASN F OD1 1 
ATOM   8209  N ND2 . ASN F  2 49  ? 28.510  38.717  -36.192 1.00 80.83  ? 45  ASN F ND2 1 
ATOM   8210  N N   . GLY F  2 50  ? 26.504  34.774  -33.946 1.00 64.06  ? 46  GLY F N   1 
ATOM   8211  C CA  . GLY F  2 50  ? 25.120  34.919  -33.539 1.00 62.33  ? 46  GLY F CA  1 
ATOM   8212  C C   . GLY F  2 50  ? 24.148  34.572  -34.655 1.00 63.00  ? 46  GLY F C   1 
ATOM   8213  O O   . GLY F  2 50  ? 24.348  33.606  -35.405 1.00 61.83  ? 46  GLY F O   1 
ATOM   8214  N N   . THR F  2 51  ? 23.093  35.374  -34.773 1.00 62.42  ? 47  THR F N   1 
ATOM   8215  C CA  . THR F  2 51  ? 22.075  35.156  -35.790 1.00 60.49  ? 47  THR F CA  1 
ATOM   8216  C C   . THR F  2 51  ? 22.435  35.771  -37.142 1.00 59.80  ? 47  THR F C   1 
ATOM   8217  O O   . THR F  2 51  ? 21.676  35.651  -38.104 1.00 58.02  ? 47  THR F O   1 
ATOM   8218  C CB  . THR F  2 51  ? 20.707  35.695  -35.313 1.00 61.52  ? 47  THR F CB  1 
ATOM   8219  O OG1 . THR F  2 51  ? 20.814  37.090  -34.992 1.00 63.74  ? 47  THR F OG1 1 
ATOM   8220  C CG2 . THR F  2 51  ? 20.249  34.929  -34.076 1.00 59.58  ? 47  THR F CG2 1 
ATOM   8221  N N   . GLN F  2 52  ? 23.598  36.416  -37.214 1.00 59.72  ? 48  GLN F N   1 
ATOM   8222  C CA  . GLN F  2 52  ? 24.047  37.029  -38.462 1.00 59.42  ? 48  GLN F CA  1 
ATOM   8223  C C   . GLN F  2 52  ? 23.915  36.008  -39.593 1.00 58.65  ? 48  GLN F C   1 
ATOM   8224  O O   . GLN F  2 52  ? 23.187  36.242  -40.555 1.00 58.64  ? 48  GLN F O   1 
ATOM   8225  C CB  . GLN F  2 52  ? 25.498  37.519  -38.336 1.00 61.87  ? 48  GLN F CB  1 
ATOM   8226  C CG  . GLN F  2 52  ? 26.046  38.171  -39.607 1.00 66.86  ? 48  GLN F CG  1 
ATOM   8227  C CD  . GLN F  2 52  ? 27.438  38.771  -39.425 1.00 70.43  ? 48  GLN F CD  1 
ATOM   8228  O OE1 . GLN F  2 52  ? 27.601  39.818  -38.793 1.00 71.81  ? 48  GLN F OE1 1 
ATOM   8229  N NE2 . GLN F  2 52  ? 28.448  38.103  -39.977 1.00 71.14  ? 48  GLN F NE2 1 
ATOM   8230  N N   . ARG F  2 53  ? 24.611  34.877  -39.482 1.00 57.40  ? 49  ARG F N   1 
ATOM   8231  C CA  . ARG F  2 53  ? 24.508  33.836  -40.505 1.00 55.45  ? 49  ARG F CA  1 
ATOM   8232  C C   . ARG F  2 53  ? 24.028  32.528  -39.901 1.00 52.96  ? 49  ARG F C   1 
ATOM   8233  O O   . ARG F  2 53  ? 24.573  32.033  -38.913 1.00 52.78  ? 49  ARG F O   1 
ATOM   8234  C CB  . ARG F  2 53  ? 25.838  33.592  -41.222 1.00 56.87  ? 49  ARG F CB  1 
ATOM   8235  C CG  . ARG F  2 53  ? 25.659  32.716  -42.472 1.00 60.49  ? 49  ARG F CG  1 
ATOM   8236  C CD  . ARG F  2 53  ? 26.913  32.648  -43.342 1.00 65.62  ? 49  ARG F CD  1 
ATOM   8237  N NE  . ARG F  2 53  ? 27.836  31.573  -42.968 1.00 69.72  ? 49  ARG F NE  1 
ATOM   8238  C CZ  . ARG F  2 53  ? 27.582  30.274  -43.125 1.00 71.71  ? 49  ARG F CZ  1 
ATOM   8239  N NH1 . ARG F  2 53  ? 26.423  29.881  -43.649 1.00 72.44  ? 49  ARG F NH1 1 
ATOM   8240  N NH2 . ARG F  2 53  ? 28.490  29.367  -42.774 1.00 71.09  ? 49  ARG F NH2 1 
ATOM   8241  N N   . VAL F  2 54  ? 22.998  31.965  -40.504 1.00 49.98  ? 50  VAL F N   1 
ATOM   8242  C CA  . VAL F  2 54  ? 22.461  30.725  -40.008 1.00 48.33  ? 50  VAL F CA  1 
ATOM   8243  C C   . VAL F  2 54  ? 22.241  29.733  -41.129 1.00 46.99  ? 50  VAL F C   1 
ATOM   8244  O O   . VAL F  2 54  ? 21.806  30.088  -42.229 1.00 45.14  ? 50  VAL F O   1 
ATOM   8245  C CB  . VAL F  2 54  ? 21.128  30.958  -39.280 1.00 49.89  ? 50  VAL F CB  1 
ATOM   8246  C CG1 . VAL F  2 54  ? 20.652  29.662  -38.643 1.00 49.99  ? 50  VAL F CG1 1 
ATOM   8247  C CG2 . VAL F  2 54  ? 21.299  32.035  -38.229 1.00 51.47  ? 50  VAL F CG2 1 
ATOM   8248  N N   . ARG F  2 55  ? 22.568  28.480  -40.840 1.00 45.69  ? 51  ARG F N   1 
ATOM   8249  C CA  . ARG F  2 55  ? 22.391  27.401  -41.796 1.00 42.90  ? 51  ARG F CA  1 
ATOM   8250  C C   . ARG F  2 55  ? 21.638  26.281  -41.090 1.00 41.28  ? 51  ARG F C   1 
ATOM   8251  O O   . ARG F  2 55  ? 22.002  25.848  -39.994 1.00 41.27  ? 51  ARG F O   1 
ATOM   8252  C CB  . ARG F  2 55  ? 23.735  26.889  -42.274 1.00 43.51  ? 51  ARG F CB  1 
ATOM   8253  C CG  . ARG F  2 55  ? 23.606  25.754  -43.254 1.00 45.05  ? 51  ARG F CG  1 
ATOM   8254  C CD  . ARG F  2 55  ? 24.950  25.122  -43.547 1.00 44.94  ? 51  ARG F CD  1 
ATOM   8255  N NE  . ARG F  2 55  ? 24.819  23.979  -44.442 1.00 44.53  ? 51  ARG F NE  1 
ATOM   8256  C CZ  . ARG F  2 55  ? 25.605  22.910  -44.393 1.00 45.25  ? 51  ARG F CZ  1 
ATOM   8257  N NH1 . ARG F  2 55  ? 26.576  22.847  -43.488 1.00 46.02  ? 51  ARG F NH1 1 
ATOM   8258  N NH2 . ARG F  2 55  ? 25.419  21.904  -45.235 1.00 43.60  ? 51  ARG F NH2 1 
ATOM   8259  N N   . LEU F  2 56  ? 20.564  25.831  -41.711 1.00 39.42  ? 52  LEU F N   1 
ATOM   8260  C CA  . LEU F  2 56  ? 19.767  24.766  -41.142 1.00 38.10  ? 52  LEU F CA  1 
ATOM   8261  C C   . LEU F  2 56  ? 20.101  23.481  -41.879 1.00 36.66  ? 52  LEU F C   1 
ATOM   8262  O O   . LEU F  2 56  ? 20.101  23.439  -43.109 1.00 34.68  ? 52  LEU F O   1 
ATOM   8263  C CB  . LEU F  2 56  ? 18.270  25.078  -41.287 1.00 36.96  ? 52  LEU F CB  1 
ATOM   8264  C CG  . LEU F  2 56  ? 17.334  23.986  -40.773 1.00 36.95  ? 52  LEU F CG  1 
ATOM   8265  C CD1 . LEU F  2 56  ? 17.586  23.817  -39.286 1.00 37.42  ? 52  LEU F CD1 1 
ATOM   8266  C CD2 . LEU F  2 56  ? 15.879  24.338  -41.053 1.00 36.25  ? 52  LEU F CD2 1 
ATOM   8267  N N   . LEU F  2 57  ? 20.409  22.438  -41.125 1.00 35.13  ? 53  LEU F N   1 
ATOM   8268  C CA  . LEU F  2 57  ? 20.712  21.165  -41.738 1.00 35.25  ? 53  LEU F CA  1 
ATOM   8269  C C   . LEU F  2 57  ? 19.927  20.089  -41.019 1.00 35.52  ? 53  LEU F C   1 
ATOM   8270  O O   . LEU F  2 57  ? 20.124  19.857  -39.825 1.00 36.66  ? 53  LEU F O   1 
ATOM   8271  C CB  . LEU F  2 57  ? 22.206  20.872  -41.656 1.00 34.88  ? 53  LEU F CB  1 
ATOM   8272  C CG  . LEU F  2 57  ? 22.715  19.649  -42.414 1.00 34.63  ? 53  LEU F CG  1 
ATOM   8273  C CD1 . LEU F  2 57  ? 22.318  19.753  -43.878 1.00 32.80  ? 53  LEU F CD1 1 
ATOM   8274  C CD2 . LEU F  2 57  ? 24.230  19.554  -42.260 1.00 32.42  ? 53  LEU F CD2 1 
ATOM   8275  N N   . VAL F  2 58  ? 19.004  19.465  -41.746 1.00 33.71  ? 54  VAL F N   1 
ATOM   8276  C CA  . VAL F  2 58  ? 18.189  18.399  -41.192 1.00 31.65  ? 54  VAL F CA  1 
ATOM   8277  C C   . VAL F  2 58  ? 18.740  17.106  -41.760 1.00 32.45  ? 54  VAL F C   1 
ATOM   8278  O O   . VAL F  2 58  ? 19.038  17.022  -42.954 1.00 33.63  ? 54  VAL F O   1 
ATOM   8279  C CB  . VAL F  2 58  ? 16.709  18.528  -41.600 1.00 32.65  ? 54  VAL F CB  1 
ATOM   8280  C CG1 . VAL F  2 58  ? 15.893  17.431  -40.916 1.00 30.60  ? 54  VAL F CG1 1 
ATOM   8281  C CG2 . VAL F  2 58  ? 16.181  19.918  -41.231 1.00 31.06  ? 54  VAL F CG2 1 
ATOM   8282  N N   . ARG F  2 59  ? 18.870  16.096  -40.914 1.00 30.22  ? 55  ARG F N   1 
ATOM   8283  C CA  . ARG F  2 59  ? 19.418  14.835  -41.367 1.00 30.88  ? 55  ARG F CA  1 
ATOM   8284  C C   . ARG F  2 59  ? 18.584  13.663  -40.916 1.00 29.78  ? 55  ARG F C   1 
ATOM   8285  O O   . ARG F  2 59  ? 18.292  13.513  -39.726 1.00 28.64  ? 55  ARG F O   1 
ATOM   8286  C CB  . ARG F  2 59  ? 20.846  14.705  -40.855 1.00 34.75  ? 55  ARG F CB  1 
ATOM   8287  C CG  . ARG F  2 59  ? 21.761  15.776  -41.418 1.00 37.29  ? 55  ARG F CG  1 
ATOM   8288  C CD  . ARG F  2 59  ? 22.985  15.918  -40.565 1.00 38.28  ? 55  ARG F CD  1 
ATOM   8289  N NE  . ARG F  2 59  ? 23.838  14.744  -40.640 1.00 37.79  ? 55  ARG F NE  1 
ATOM   8290  C CZ  . ARG F  2 59  ? 24.788  14.491  -39.753 1.00 39.74  ? 55  ARG F CZ  1 
ATOM   8291  N NH1 . ARG F  2 59  ? 24.967  15.335  -38.743 1.00 39.60  ? 55  ARG F NH1 1 
ATOM   8292  N NH2 . ARG F  2 59  ? 25.571  13.425  -39.889 1.00 40.07  ? 55  ARG F NH2 1 
ATOM   8293  N N   . TYR F  2 60  ? 18.215  12.825  -41.875 1.00 28.91  ? 56  TYR F N   1 
ATOM   8294  C CA  . TYR F  2 60  ? 17.377  11.671  -41.598 1.00 30.83  ? 56  TYR F CA  1 
ATOM   8295  C C   . TYR F  2 60  ? 18.141  10.389  -41.660 1.00 30.83  ? 56  TYR F C   1 
ATOM   8296  O O   . TYR F  2 60  ? 18.820  10.105  -42.649 1.00 32.74  ? 56  TYR F O   1 
ATOM   8297  C CB  . TYR F  2 60  ? 16.232  11.576  -42.607 1.00 33.60  ? 56  TYR F CB  1 
ATOM   8298  C CG  . TYR F  2 60  ? 15.226  12.679  -42.492 1.00 38.73  ? 56  TYR F CG  1 
ATOM   8299  C CD1 . TYR F  2 60  ? 14.033  12.499  -41.787 1.00 41.92  ? 56  TYR F CD1 1 
ATOM   8300  C CD2 . TYR F  2 60  ? 15.475  13.918  -43.060 1.00 40.51  ? 56  TYR F CD2 1 
ATOM   8301  C CE1 . TYR F  2 60  ? 13.117  13.541  -41.656 1.00 44.40  ? 56  TYR F CE1 1 
ATOM   8302  C CE2 . TYR F  2 60  ? 14.575  14.957  -42.934 1.00 45.14  ? 56  TYR F CE2 1 
ATOM   8303  C CZ  . TYR F  2 60  ? 13.406  14.769  -42.233 1.00 44.08  ? 56  TYR F CZ  1 
ATOM   8304  O OH  . TYR F  2 60  ? 12.563  15.836  -42.085 1.00 50.13  ? 56  TYR F OH  1 
ATOM   8305  N N   . PHE F  2 61  ? 18.008  9.593   -40.616 1.00 27.11  ? 57  PHE F N   1 
ATOM   8306  C CA  . PHE F  2 61  ? 18.683  8.327   -40.608 1.00 28.13  ? 57  PHE F CA  1 
ATOM   8307  C C   . PHE F  2 61  ? 17.675  7.211   -40.441 1.00 28.33  ? 57  PHE F C   1 
ATOM   8308  O O   . PHE F  2 61  ? 16.687  7.369   -39.725 1.00 27.32  ? 57  PHE F O   1 
ATOM   8309  C CB  . PHE F  2 61  ? 19.682  8.242   -39.454 1.00 29.14  ? 57  PHE F CB  1 
ATOM   8310  C CG  . PHE F  2 61  ? 20.646  9.380   -39.393 1.00 28.29  ? 57  PHE F CG  1 
ATOM   8311  C CD1 . PHE F  2 61  ? 20.254  10.612  -38.886 1.00 26.90  ? 57  PHE F CD1 1 
ATOM   8312  C CD2 . PHE F  2 61  ? 21.948  9.225   -39.856 1.00 29.54  ? 57  PHE F CD2 1 
ATOM   8313  C CE1 . PHE F  2 61  ? 21.147  11.674  -38.844 1.00 29.66  ? 57  PHE F CE1 1 
ATOM   8314  C CE2 . PHE F  2 61  ? 22.860  10.288  -39.820 1.00 29.36  ? 57  PHE F CE2 1 
ATOM   8315  C CZ  . PHE F  2 61  ? 22.454  11.517  -39.312 1.00 27.70  ? 57  PHE F CZ  1 
ATOM   8316  N N   . TYR F  2 62  ? 17.917  6.102   -41.131 1.00 27.72  ? 58  TYR F N   1 
ATOM   8317  C CA  . TYR F  2 62  ? 17.110  4.900   -40.982 1.00 31.05  ? 58  TYR F CA  1 
ATOM   8318  C C   . TYR F  2 62  ? 18.140  3.868   -40.553 1.00 32.78  ? 58  TYR F C   1 
ATOM   8319  O O   . TYR F  2 62  ? 19.011  3.503   -41.333 1.00 30.21  ? 58  TYR F O   1 
ATOM   8320  C CB  . TYR F  2 62  ? 16.478  4.434   -42.287 1.00 32.76  ? 58  TYR F CB  1 
ATOM   8321  C CG  . TYR F  2 62  ? 15.771  3.103   -42.123 1.00 33.46  ? 58  TYR F CG  1 
ATOM   8322  C CD1 . TYR F  2 62  ? 14.742  2.952   -41.192 1.00 33.87  ? 58  TYR F CD1 1 
ATOM   8323  C CD2 . TYR F  2 62  ? 16.157  1.981   -42.867 1.00 34.49  ? 58  TYR F CD2 1 
ATOM   8324  C CE1 . TYR F  2 62  ? 14.113  1.714   -41.004 1.00 33.95  ? 58  TYR F CE1 1 
ATOM   8325  C CE2 . TYR F  2 62  ? 15.537  0.742   -42.686 1.00 33.97  ? 58  TYR F CE2 1 
ATOM   8326  C CZ  . TYR F  2 62  ? 14.516  0.618   -41.751 1.00 36.34  ? 58  TYR F CZ  1 
ATOM   8327  O OH  . TYR F  2 62  ? 13.903  -0.601  -41.557 1.00 38.50  ? 58  TYR F OH  1 
ATOM   8328  N N   . ASN F  2 63  ? 18.051  3.405   -39.311 1.00 34.66  ? 59  ASN F N   1 
ATOM   8329  C CA  . ASN F  2 63  ? 19.022  2.447   -38.802 1.00 36.18  ? 59  ASN F CA  1 
ATOM   8330  C C   . ASN F  2 63  ? 20.411  3.086   -38.808 1.00 37.19  ? 59  ASN F C   1 
ATOM   8331  O O   . ASN F  2 63  ? 20.605  4.092   -38.143 1.00 39.21  ? 59  ASN F O   1 
ATOM   8332  C CB  . ASN F  2 63  ? 18.998  1.159   -39.629 1.00 38.53  ? 59  ASN F CB  1 
ATOM   8333  C CG  . ASN F  2 63  ? 17.916  0.188   -39.161 1.00 42.30  ? 59  ASN F CG  1 
ATOM   8334  O OD1 . ASN F  2 63  ? 16.771  0.574   -38.951 1.00 41.89  ? 59  ASN F OD1 1 
ATOM   8335  N ND2 . ASN F  2 63  ? 18.283  -1.082  -38.998 1.00 46.92  ? 59  ASN F ND2 1 
ATOM   8336  N N   . LEU F  2 64  ? 21.360  2.545   -39.567 1.00 36.14  ? 60  LEU F N   1 
ATOM   8337  C CA  . LEU F  2 64  ? 22.718  3.088   -39.575 1.00 36.94  ? 60  LEU F CA  1 
ATOM   8338  C C   . LEU F  2 64  ? 23.089  4.002   -40.737 1.00 38.28  ? 60  LEU F C   1 
ATOM   8339  O O   . LEU F  2 64  ? 24.234  4.413   -40.833 1.00 36.04  ? 60  LEU F O   1 
ATOM   8340  C CB  . LEU F  2 64  ? 23.751  1.960   -39.562 1.00 36.76  ? 60  LEU F CB  1 
ATOM   8341  C CG  . LEU F  2 64  ? 23.753  0.870   -38.496 1.00 37.56  ? 60  LEU F CG  1 
ATOM   8342  C CD1 . LEU F  2 64  ? 24.722  -0.226  -38.928 1.00 36.06  ? 60  LEU F CD1 1 
ATOM   8343  C CD2 . LEU F  2 64  ? 24.157  1.447   -37.145 1.00 37.51  ? 60  LEU F CD2 1 
ATOM   8344  N N   . GLU F  2 65  ? 22.148  4.313   -41.623 1.00 40.48  ? 61  GLU F N   1 
ATOM   8345  C CA  . GLU F  2 65  ? 22.471  5.160   -42.764 1.00 41.09  ? 61  GLU F CA  1 
ATOM   8346  C C   . GLU F  2 65  ? 21.653  6.437   -42.855 1.00 40.00  ? 61  GLU F C   1 
ATOM   8347  O O   . GLU F  2 65  ? 20.450  6.450   -42.564 1.00 38.13  ? 61  GLU F O   1 
ATOM   8348  C CB  . GLU F  2 65  ? 22.287  4.382   -44.071 1.00 44.42  ? 61  GLU F CB  1 
ATOM   8349  C CG  . GLU F  2 65  ? 23.143  3.136   -44.203 1.00 52.14  ? 61  GLU F CG  1 
ATOM   8350  C CD  . GLU F  2 65  ? 22.779  2.318   -45.438 1.00 57.25  ? 61  GLU F CD  1 
ATOM   8351  O OE1 . GLU F  2 65  ? 22.892  2.863   -46.565 1.00 57.78  ? 61  GLU F OE1 1 
ATOM   8352  O OE2 . GLU F  2 65  ? 22.375  1.137   -45.277 1.00 58.50  ? 61  GLU F OE2 1 
ATOM   8353  N N   . GLU F  2 66  ? 22.324  7.511   -43.256 1.00 37.22  ? 62  GLU F N   1 
ATOM   8354  C CA  . GLU F  2 66  ? 21.672  8.793   -43.458 1.00 38.32  ? 62  GLU F CA  1 
ATOM   8355  C C   . GLU F  2 66  ? 21.096  8.646   -44.875 1.00 36.04  ? 62  GLU F C   1 
ATOM   8356  O O   . GLU F  2 66  ? 21.795  8.190   -45.779 1.00 35.59  ? 62  GLU F O   1 
ATOM   8357  C CB  . GLU F  2 66  ? 22.714  9.919   -43.415 1.00 40.55  ? 62  GLU F CB  1 
ATOM   8358  C CG  . GLU F  2 66  ? 22.133  11.329  -43.416 1.00 46.44  ? 62  GLU F CG  1 
ATOM   8359  C CD  . GLU F  2 66  ? 23.201  12.411  -43.533 1.00 50.20  ? 62  GLU F CD  1 
ATOM   8360  O OE1 . GLU F  2 66  ? 24.124  12.449  -42.689 1.00 49.42  ? 62  GLU F OE1 1 
ATOM   8361  O OE2 . GLU F  2 66  ? 23.110  13.227  -44.478 1.00 53.36  ? 62  GLU F OE2 1 
ATOM   8362  N N   . ASN F  2 67  ? 19.831  8.987   -45.087 1.00 33.31  ? 63  ASN F N   1 
ATOM   8363  C CA  . ASN F  2 67  ? 19.300  8.833   -46.438 1.00 33.93  ? 63  ASN F CA  1 
ATOM   8364  C C   . ASN F  2 67  ? 18.716  10.084  -47.052 1.00 33.40  ? 63  ASN F C   1 
ATOM   8365  O O   . ASN F  2 67  ? 18.380  10.104  -48.232 1.00 33.98  ? 63  ASN F O   1 
ATOM   8366  C CB  . ASN F  2 67  ? 18.249  7.716   -46.491 1.00 34.29  ? 63  ASN F CB  1 
ATOM   8367  C CG  . ASN F  2 67  ? 17.140  7.923   -45.510 1.00 35.24  ? 63  ASN F CG  1 
ATOM   8368  O OD1 . ASN F  2 67  ? 16.370  8.877   -45.612 1.00 37.22  ? 63  ASN F OD1 1 
ATOM   8369  N ND2 . ASN F  2 67  ? 17.054  7.034   -44.532 1.00 37.33  ? 63  ASN F ND2 1 
ATOM   8370  N N   . LEU F  2 68  ? 18.617  11.144  -46.272 1.00 32.90  ? 64  LEU F N   1 
ATOM   8371  C CA  . LEU F  2 68  ? 18.034  12.353  -46.807 1.00 34.46  ? 64  LEU F CA  1 
ATOM   8372  C C   . LEU F  2 68  ? 18.425  13.527  -45.949 1.00 33.67  ? 64  LEU F C   1 
ATOM   8373  O O   . LEU F  2 68  ? 18.656  13.364  -44.758 1.00 32.94  ? 64  LEU F O   1 
ATOM   8374  C CB  . LEU F  2 68  ? 16.513  12.207  -46.796 1.00 33.21  ? 64  LEU F CB  1 
ATOM   8375  C CG  . LEU F  2 68  ? 15.629  13.340  -47.296 1.00 34.87  ? 64  LEU F CG  1 
ATOM   8376  C CD1 . LEU F  2 68  ? 15.413  13.211  -48.796 1.00 33.88  ? 64  LEU F CD1 1 
ATOM   8377  C CD2 . LEU F  2 68  ? 14.292  13.256  -46.583 1.00 35.68  ? 64  LEU F CD2 1 
ATOM   8378  N N   . ARG F  2 69  ? 18.496  14.709  -46.551 1.00 35.08  ? 65  ARG F N   1 
ATOM   8379  C CA  . ARG F  2 69  ? 18.807  15.909  -45.789 1.00 39.47  ? 65  ARG F CA  1 
ATOM   8380  C C   . ARG F  2 69  ? 18.159  17.163  -46.369 1.00 39.79  ? 65  ARG F C   1 
ATOM   8381  O O   . ARG F  2 69  ? 17.718  17.183  -47.516 1.00 41.52  ? 65  ARG F O   1 
ATOM   8382  C CB  . ARG F  2 69  ? 20.327  16.109  -45.673 1.00 42.04  ? 65  ARG F CB  1 
ATOM   8383  C CG  . ARG F  2 69  ? 21.057  16.233  -46.984 1.00 46.66  ? 65  ARG F CG  1 
ATOM   8384  C CD  . ARG F  2 69  ? 22.477  16.736  -46.753 1.00 49.67  ? 65  ARG F CD  1 
ATOM   8385  N NE  . ARG F  2 69  ? 23.262  15.840  -45.907 1.00 50.98  ? 65  ARG F NE  1 
ATOM   8386  C CZ  . ARG F  2 69  ? 24.486  16.115  -45.463 1.00 51.94  ? 65  ARG F CZ  1 
ATOM   8387  N NH1 . ARG F  2 69  ? 25.072  17.269  -45.785 1.00 51.60  ? 65  ARG F NH1 1 
ATOM   8388  N NH2 . ARG F  2 69  ? 25.125  15.240  -44.694 1.00 49.39  ? 65  ARG F NH2 1 
ATOM   8389  N N   . PHE F  2 70  ? 18.049  18.197  -45.545 1.00 40.16  ? 66  PHE F N   1 
ATOM   8390  C CA  . PHE F  2 70  ? 17.508  19.474  -46.001 1.00 39.09  ? 66  PHE F CA  1 
ATOM   8391  C C   . PHE F  2 70  ? 18.483  20.533  -45.529 1.00 37.15  ? 66  PHE F C   1 
ATOM   8392  O O   . PHE F  2 70  ? 18.601  20.790  -44.334 1.00 35.80  ? 66  PHE F O   1 
ATOM   8393  C CB  . PHE F  2 70  ? 16.113  19.756  -45.438 1.00 37.81  ? 66  PHE F CB  1 
ATOM   8394  C CG  . PHE F  2 70  ? 15.607  21.129  -45.768 1.00 37.70  ? 66  PHE F CG  1 
ATOM   8395  C CD1 . PHE F  2 70  ? 15.978  22.224  -44.993 1.00 37.40  ? 66  PHE F CD1 1 
ATOM   8396  C CD2 . PHE F  2 70  ? 14.805  21.340  -46.886 1.00 40.27  ? 66  PHE F CD2 1 
ATOM   8397  C CE1 . PHE F  2 70  ? 15.560  23.508  -45.321 1.00 37.48  ? 66  PHE F CE1 1 
ATOM   8398  C CE2 . PHE F  2 70  ? 14.380  22.628  -47.225 1.00 38.33  ? 66  PHE F CE2 1 
ATOM   8399  C CZ  . PHE F  2 70  ? 14.762  23.711  -46.440 1.00 38.54  ? 66  PHE F CZ  1 
ATOM   8400  N N   . ASP F  2 71  ? 19.197  21.108  -46.488 1.00 37.11  ? 67  ASP F N   1 
ATOM   8401  C CA  . ASP F  2 71  ? 20.196  22.138  -46.240 1.00 39.47  ? 67  ASP F CA  1 
ATOM   8402  C C   . ASP F  2 71  ? 19.559  23.495  -46.561 1.00 41.05  ? 67  ASP F C   1 
ATOM   8403  O O   . ASP F  2 71  ? 19.197  23.760  -47.710 1.00 40.64  ? 67  ASP F O   1 
ATOM   8404  C CB  . ASP F  2 71  ? 21.396  21.895  -47.159 1.00 39.34  ? 67  ASP F CB  1 
ATOM   8405  C CG  . ASP F  2 71  ? 22.600  22.725  -46.781 1.00 40.77  ? 67  ASP F CG  1 
ATOM   8406  O OD1 . ASP F  2 71  ? 22.412  23.847  -46.262 1.00 41.73  ? 67  ASP F OD1 1 
ATOM   8407  O OD2 . ASP F  2 71  ? 23.735  22.263  -47.019 1.00 39.54  ? 67  ASP F OD2 1 
ATOM   8408  N N   . SER F  2 72  ? 19.429  24.356  -45.559 1.00 40.77  ? 68  SER F N   1 
ATOM   8409  C CA  . SER F  2 72  ? 18.808  25.651  -45.786 1.00 43.87  ? 68  SER F CA  1 
ATOM   8410  C C   . SER F  2 72  ? 19.510  26.466  -46.869 1.00 45.01  ? 68  SER F C   1 
ATOM   8411  O O   . SER F  2 72  ? 18.946  27.427  -47.381 1.00 46.22  ? 68  SER F O   1 
ATOM   8412  C CB  . SER F  2 72  ? 18.728  26.461  -44.479 1.00 43.58  ? 68  SER F CB  1 
ATOM   8413  O OG  . SER F  2 72  ? 20.007  26.773  -43.972 1.00 43.28  ? 68  SER F OG  1 
ATOM   8414  N N   . ASP F  2 73  ? 20.734  26.097  -47.222 1.00 45.67  ? 69  ASP F N   1 
ATOM   8415  C CA  . ASP F  2 73  ? 21.435  26.837  -48.261 1.00 47.49  ? 69  ASP F CA  1 
ATOM   8416  C C   . ASP F  2 73  ? 21.137  26.242  -49.625 1.00 46.87  ? 69  ASP F C   1 
ATOM   8417  O O   . ASP F  2 73  ? 21.493  26.809  -50.651 1.00 47.92  ? 69  ASP F O   1 
ATOM   8418  C CB  . ASP F  2 73  ? 22.940  26.857  -48.007 1.00 48.28  ? 69  ASP F CB  1 
ATOM   8419  C CG  . ASP F  2 73  ? 23.305  27.609  -46.742 1.00 51.39  ? 69  ASP F CG  1 
ATOM   8420  O OD1 . ASP F  2 73  ? 22.750  28.705  -46.504 1.00 53.36  ? 69  ASP F OD1 1 
ATOM   8421  O OD2 . ASP F  2 73  ? 24.155  27.109  -45.984 1.00 55.88  ? 69  ASP F OD2 1 
ATOM   8422  N N   . VAL F  2 74  ? 20.479  25.091  -49.628 1.00 46.23  ? 70  VAL F N   1 
ATOM   8423  C CA  . VAL F  2 74  ? 20.098  24.443  -50.868 1.00 44.13  ? 70  VAL F CA  1 
ATOM   8424  C C   . VAL F  2 74  ? 18.632  24.797  -51.121 1.00 44.69  ? 70  VAL F C   1 
ATOM   8425  O O   . VAL F  2 74  ? 18.250  25.118  -52.243 1.00 45.80  ? 70  VAL F O   1 
ATOM   8426  C CB  . VAL F  2 74  ? 20.266  22.924  -50.783 1.00 42.09  ? 70  VAL F CB  1 
ATOM   8427  C CG1 . VAL F  2 74  ? 19.712  22.287  -52.028 1.00 41.29  ? 70  VAL F CG1 1 
ATOM   8428  C CG2 . VAL F  2 74  ? 21.739  22.570  -50.634 1.00 41.15  ? 70  VAL F CG2 1 
ATOM   8429  N N   . GLY F  2 75  ? 17.816  24.745  -50.071 1.00 44.63  ? 71  GLY F N   1 
ATOM   8430  C CA  . GLY F  2 75  ? 16.416  25.105  -50.206 1.00 45.82  ? 71  GLY F CA  1 
ATOM   8431  C C   . GLY F  2 75  ? 15.418  24.003  -50.494 1.00 45.71  ? 71  GLY F C   1 
ATOM   8432  O O   . GLY F  2 75  ? 14.221  24.255  -50.458 1.00 45.47  ? 71  GLY F O   1 
ATOM   8433  N N   . GLU F  2 76  ? 15.899  22.800  -50.798 1.00 47.05  ? 72  GLU F N   1 
ATOM   8434  C CA  . GLU F  2 76  ? 15.033  21.654  -51.084 1.00 47.25  ? 72  GLU F CA  1 
ATOM   8435  C C   . GLU F  2 76  ? 15.637  20.417  -50.438 1.00 45.94  ? 72  GLU F C   1 
ATOM   8436  O O   . GLU F  2 76  ? 16.799  20.430  -50.035 1.00 45.88  ? 72  GLU F O   1 
ATOM   8437  C CB  . GLU F  2 76  ? 14.931  21.382  -52.588 1.00 49.54  ? 72  GLU F CB  1 
ATOM   8438  C CG  . GLU F  2 76  ? 14.269  22.454  -53.429 1.00 53.92  ? 72  GLU F CG  1 
ATOM   8439  C CD  . GLU F  2 76  ? 13.967  21.961  -54.840 1.00 57.00  ? 72  GLU F CD  1 
ATOM   8440  O OE1 . GLU F  2 76  ? 14.859  21.330  -55.453 1.00 59.24  ? 72  GLU F OE1 1 
ATOM   8441  O OE2 . GLU F  2 76  ? 12.847  22.203  -55.342 1.00 58.73  ? 72  GLU F OE2 1 
ATOM   8442  N N   . PHE F  2 77  ? 14.853  19.349  -50.346 1.00 43.26  ? 73  PHE F N   1 
ATOM   8443  C CA  . PHE F  2 77  ? 15.346  18.111  -49.771 1.00 40.90  ? 73  PHE F CA  1 
ATOM   8444  C C   . PHE F  2 77  ? 16.178  17.418  -50.850 1.00 41.11  ? 73  PHE F C   1 
ATOM   8445  O O   . PHE F  2 77  ? 15.892  17.533  -52.038 1.00 40.59  ? 73  PHE F O   1 
ATOM   8446  C CB  . PHE F  2 77  ? 14.193  17.192  -49.348 1.00 39.15  ? 73  PHE F CB  1 
ATOM   8447  C CG  . PHE F  2 77  ? 13.399  17.692  -48.168 1.00 39.72  ? 73  PHE F CG  1 
ATOM   8448  C CD1 . PHE F  2 77  ? 12.328  18.567  -48.345 1.00 41.42  ? 73  PHE F CD1 1 
ATOM   8449  C CD2 . PHE F  2 77  ? 13.714  17.275  -46.874 1.00 40.29  ? 73  PHE F CD2 1 
ATOM   8450  C CE1 . PHE F  2 77  ? 11.579  19.023  -47.251 1.00 40.08  ? 73  PHE F CE1 1 
ATOM   8451  C CE2 . PHE F  2 77  ? 12.976  17.724  -45.773 1.00 39.06  ? 73  PHE F CE2 1 
ATOM   8452  C CZ  . PHE F  2 77  ? 11.903  18.602  -45.966 1.00 40.96  ? 73  PHE F CZ  1 
ATOM   8453  N N   . ARG F  2 78  ? 17.218  16.708  -50.437 1.00 40.83  ? 74  ARG F N   1 
ATOM   8454  C CA  . ARG F  2 78  ? 18.066  15.993  -51.379 1.00 39.68  ? 74  ARG F CA  1 
ATOM   8455  C C   . ARG F  2 78  ? 18.344  14.619  -50.805 1.00 38.71  ? 74  ARG F C   1 
ATOM   8456  O O   . ARG F  2 78  ? 18.783  14.492  -49.672 1.00 40.11  ? 74  ARG F O   1 
ATOM   8457  C CB  . ARG F  2 78  ? 19.376  16.749  -51.597 1.00 39.38  ? 74  ARG F CB  1 
ATOM   8458  C CG  . ARG F  2 78  ? 19.237  18.014  -52.421 1.00 39.38  ? 74  ARG F CG  1 
ATOM   8459  C CD  . ARG F  2 78  ? 18.938  17.688  -53.896 1.00 40.86  ? 74  ARG F CD  1 
ATOM   8460  N NE  . ARG F  2 78  ? 18.770  18.905  -54.690 1.00 41.07  ? 74  ARG F NE  1 
ATOM   8461  C CZ  . ARG F  2 78  ? 17.621  19.551  -54.869 1.00 41.57  ? 74  ARG F CZ  1 
ATOM   8462  N NH1 . ARG F  2 78  ? 16.500  19.099  -54.321 1.00 41.14  ? 74  ARG F NH1 1 
ATOM   8463  N NH2 . ARG F  2 78  ? 17.601  20.670  -55.587 1.00 40.89  ? 74  ARG F NH2 1 
ATOM   8464  N N   . ALA F  2 79  ? 18.063  13.586  -51.580 1.00 37.80  ? 75  ALA F N   1 
ATOM   8465  C CA  . ALA F  2 79  ? 18.294  12.231  -51.117 1.00 37.26  ? 75  ALA F CA  1 
ATOM   8466  C C   . ALA F  2 79  ? 19.789  12.032  -50.929 1.00 37.60  ? 75  ALA F C   1 
ATOM   8467  O O   . ALA F  2 79  ? 20.585  12.604  -51.670 1.00 37.07  ? 75  ALA F O   1 
ATOM   8468  C CB  . ALA F  2 79  ? 17.758  11.234  -52.139 1.00 35.65  ? 75  ALA F CB  1 
ATOM   8469  N N   . VAL F  2 80  ? 20.164  11.238  -49.928 1.00 38.67  ? 76  VAL F N   1 
ATOM   8470  C CA  . VAL F  2 80  ? 21.565  10.931  -49.668 1.00 38.02  ? 76  VAL F CA  1 
ATOM   8471  C C   . VAL F  2 80  ? 21.779  9.518   -50.181 1.00 39.24  ? 76  VAL F C   1 
ATOM   8472  O O   . VAL F  2 80  ? 22.877  9.159   -50.600 1.00 41.36  ? 76  VAL F O   1 
ATOM   8473  C CB  . VAL F  2 80  ? 21.902  11.010  -48.165 1.00 38.28  ? 76  VAL F CB  1 
ATOM   8474  C CG1 . VAL F  2 80  ? 23.309  10.488  -47.910 1.00 35.88  ? 76  VAL F CG1 1 
ATOM   8475  C CG2 . VAL F  2 80  ? 21.807  12.448  -47.704 1.00 38.60  ? 76  VAL F CG2 1 
ATOM   8476  N N   . THR F  2 81  ? 20.715  8.718   -50.141 1.00 40.07  ? 77  THR F N   1 
ATOM   8477  C CA  . THR F  2 81  ? 20.743  7.340   -50.645 1.00 40.93  ? 77  THR F CA  1 
ATOM   8478  C C   . THR F  2 81  ? 19.380  7.030   -51.267 1.00 42.25  ? 77  THR F C   1 
ATOM   8479  O O   . THR F  2 81  ? 18.402  7.737   -51.010 1.00 43.08  ? 77  THR F O   1 
ATOM   8480  C CB  . THR F  2 81  ? 21.019  6.303   -49.523 1.00 41.09  ? 77  THR F CB  1 
ATOM   8481  O OG1 . THR F  2 81  ? 19.922  6.285   -48.603 1.00 41.58  ? 77  THR F OG1 1 
ATOM   8482  C CG2 . THR F  2 81  ? 22.302  6.642   -48.772 1.00 37.41  ? 77  THR F CG2 1 
ATOM   8483  N N   . GLU F  2 82  ? 19.320  5.991   -52.094 1.00 44.20  ? 78  GLU F N   1 
ATOM   8484  C CA  . GLU F  2 82  ? 18.070  5.583   -52.751 1.00 46.12  ? 78  GLU F CA  1 
ATOM   8485  C C   . GLU F  2 82  ? 16.845  5.665   -51.842 1.00 43.93  ? 78  GLU F C   1 
ATOM   8486  O O   . GLU F  2 82  ? 15.804  6.202   -52.217 1.00 44.13  ? 78  GLU F O   1 
ATOM   8487  C CB  . GLU F  2 82  ? 18.188  4.145   -53.240 1.00 51.04  ? 78  GLU F CB  1 
ATOM   8488  C CG  . GLU F  2 82  ? 18.853  3.972   -54.578 1.00 58.62  ? 78  GLU F CG  1 
ATOM   8489  C CD  . GLU F  2 82  ? 19.423  2.579   -54.728 1.00 63.80  ? 78  GLU F CD  1 
ATOM   8490  O OE1 . GLU F  2 82  ? 18.698  1.604   -54.413 1.00 66.19  ? 78  GLU F OE1 1 
ATOM   8491  O OE2 . GLU F  2 82  ? 20.596  2.459   -55.156 1.00 66.86  ? 78  GLU F OE2 1 
ATOM   8492  N N   . LEU F  2 83  ? 17.000  5.109   -50.647 1.00 40.90  ? 79  LEU F N   1 
ATOM   8493  C CA  . LEU F  2 83  ? 15.958  5.050   -49.632 1.00 38.45  ? 79  LEU F CA  1 
ATOM   8494  C C   . LEU F  2 83  ? 15.312  6.403   -49.336 1.00 36.09  ? 79  LEU F C   1 
ATOM   8495  O O   . LEU F  2 83  ? 14.130  6.477   -48.999 1.00 33.63  ? 79  LEU F O   1 
ATOM   8496  C CB  . LEU F  2 83  ? 16.557  4.445   -48.354 1.00 35.92  ? 79  LEU F CB  1 
ATOM   8497  C CG  . LEU F  2 83  ? 15.685  3.604   -47.424 1.00 37.01  ? 79  LEU F CG  1 
ATOM   8498  C CD1 . LEU F  2 83  ? 14.757  2.694   -48.219 1.00 34.64  ? 79  LEU F CD1 1 
ATOM   8499  C CD2 . LEU F  2 83  ? 16.599  2.779   -46.526 1.00 34.10  ? 79  LEU F CD2 1 
ATOM   8500  N N   . GLY F  2 84  ? 16.082  7.476   -49.467 1.00 36.09  ? 80  GLY F N   1 
ATOM   8501  C CA  . GLY F  2 84  ? 15.533  8.793   -49.196 1.00 35.67  ? 80  GLY F CA  1 
ATOM   8502  C C   . GLY F  2 84  ? 14.870  9.465   -50.388 1.00 36.34  ? 80  GLY F C   1 
ATOM   8503  O O   . GLY F  2 84  ? 14.198  10.483  -50.236 1.00 36.49  ? 80  GLY F O   1 
ATOM   8504  N N   . ARG F  2 85  ? 15.045  8.887   -51.573 1.00 38.36  ? 81  ARG F N   1 
ATOM   8505  C CA  . ARG F  2 85  ? 14.495  9.451   -52.803 1.00 40.50  ? 81  ARG F CA  1 
ATOM   8506  C C   . ARG F  2 85  ? 12.983  9.772   -52.828 1.00 40.58  ? 81  ARG F C   1 
ATOM   8507  O O   . ARG F  2 85  ? 12.579  10.882  -53.202 1.00 38.63  ? 81  ARG F O   1 
ATOM   8508  C CB  . ARG F  2 85  ? 14.836  8.533   -53.973 1.00 42.23  ? 81  ARG F CB  1 
ATOM   8509  C CG  . ARG F  2 85  ? 14.324  9.049   -55.300 1.00 50.21  ? 81  ARG F CG  1 
ATOM   8510  C CD  . ARG F  2 85  ? 14.558  8.039   -56.407 1.00 57.76  ? 81  ARG F CD  1 
ATOM   8511  N NE  . ARG F  2 85  ? 14.073  8.530   -57.694 1.00 63.95  ? 81  ARG F NE  1 
ATOM   8512  C CZ  . ARG F  2 85  ? 14.132  7.837   -58.827 1.00 65.88  ? 81  ARG F CZ  1 
ATOM   8513  N NH1 . ARG F  2 85  ? 14.655  6.614   -58.835 1.00 66.52  ? 81  ARG F NH1 1 
ATOM   8514  N NH2 . ARG F  2 85  ? 13.673  8.372   -59.954 1.00 67.10  ? 81  ARG F NH2 1 
ATOM   8515  N N   . PRO F  2 86  ? 12.132  8.810   -52.428 1.00 40.85  ? 82  PRO F N   1 
ATOM   8516  C CA  . PRO F  2 86  ? 10.681  9.039   -52.430 1.00 41.65  ? 82  PRO F CA  1 
ATOM   8517  C C   . PRO F  2 86  ? 10.266  10.245  -51.607 1.00 42.57  ? 82  PRO F C   1 
ATOM   8518  O O   . PRO F  2 86  ? 9.342   10.968  -51.968 1.00 43.96  ? 82  PRO F O   1 
ATOM   8519  C CB  . PRO F  2 86  ? 10.120  7.744   -51.852 1.00 42.60  ? 82  PRO F CB  1 
ATOM   8520  C CG  . PRO F  2 86  ? 11.188  6.720   -52.170 1.00 43.00  ? 82  PRO F CG  1 
ATOM   8521  C CD  . PRO F  2 86  ? 12.452  7.476   -51.893 1.00 41.06  ? 82  PRO F CD  1 
ATOM   8522  N N   . ASP F  2 87  ? 10.958  10.470  -50.498 1.00 43.06  ? 83  ASP F N   1 
ATOM   8523  C CA  . ASP F  2 87  ? 10.615  11.586  -49.637 1.00 44.08  ? 83  ASP F CA  1 
ATOM   8524  C C   . ASP F  2 87  ? 10.986  12.938  -50.221 1.00 44.20  ? 83  ASP F C   1 
ATOM   8525  O O   . ASP F  2 87  ? 10.278  13.921  -50.000 1.00 45.41  ? 83  ASP F O   1 
ATOM   8526  C CB  . ASP F  2 87  ? 11.262  11.399  -48.270 1.00 44.77  ? 83  ASP F CB  1 
ATOM   8527  C CG  . ASP F  2 87  ? 10.922  10.058  -47.660 1.00 47.45  ? 83  ASP F CG  1 
ATOM   8528  O OD1 . ASP F  2 87  ? 9.725   9.704   -47.685 1.00 48.60  ? 83  ASP F OD1 1 
ATOM   8529  O OD2 . ASP F  2 87  ? 11.835  9.357   -47.162 1.00 47.36  ? 83  ASP F OD2 1 
ATOM   8530  N N   . ALA F  2 88  ? 12.086  12.992  -50.966 1.00 44.02  ? 84  ALA F N   1 
ATOM   8531  C CA  . ALA F  2 88  ? 12.520  14.247  -51.573 1.00 45.98  ? 84  ALA F CA  1 
ATOM   8532  C C   . ALA F  2 88  ? 11.532  14.651  -52.662 1.00 46.02  ? 84  ALA F C   1 
ATOM   8533  O O   . ALA F  2 88  ? 11.050  15.778  -52.693 1.00 45.44  ? 84  ALA F O   1 
ATOM   8534  C CB  . ALA F  2 88  ? 13.935  14.097  -52.165 1.00 45.05  ? 84  ALA F CB  1 
ATOM   8535  N N   . GLU F  2 89  ? 11.226  13.716  -53.551 1.00 47.61  ? 85  GLU F N   1 
ATOM   8536  C CA  . GLU F  2 89  ? 10.293  13.989  -54.634 1.00 50.72  ? 85  GLU F CA  1 
ATOM   8537  C C   . GLU F  2 89  ? 8.939   14.363  -54.034 1.00 50.64  ? 85  GLU F C   1 
ATOM   8538  O O   . GLU F  2 89  ? 8.318   15.342  -54.451 1.00 50.72  ? 85  GLU F O   1 
ATOM   8539  C CB  . GLU F  2 89  ? 10.182  12.758  -55.550 1.00 52.95  ? 85  GLU F CB  1 
ATOM   8540  C CG  . GLU F  2 89  ? 11.557  12.266  -56.035 1.00 57.26  ? 85  GLU F CG  1 
ATOM   8541  C CD  . GLU F  2 89  ? 11.503  11.005  -56.900 1.00 60.05  ? 85  GLU F CD  1 
ATOM   8542  O OE1 . GLU F  2 89  ? 10.753  10.065  -56.548 1.00 62.00  ? 85  GLU F OE1 1 
ATOM   8543  O OE2 . GLU F  2 89  ? 12.231  10.947  -57.922 1.00 57.88  ? 85  GLU F OE2 1 
ATOM   8544  N N   . ASN F  2 90  ? 8.505   13.612  -53.024 1.00 50.04  ? 86  ASN F N   1 
ATOM   8545  C CA  . ASN F  2 90  ? 7.229   13.887  -52.388 1.00 49.63  ? 86  ASN F CA  1 
ATOM   8546  C C   . ASN F  2 90  ? 7.199   15.232  -51.690 1.00 49.71  ? 86  ASN F C   1 
ATOM   8547  O O   . ASN F  2 90  ? 6.322   16.052  -51.964 1.00 50.79  ? 86  ASN F O   1 
ATOM   8548  C CB  . ASN F  2 90  ? 6.859   12.783  -51.392 1.00 51.42  ? 86  ASN F CB  1 
ATOM   8549  C CG  . ASN F  2 90  ? 5.597   13.117  -50.590 1.00 52.71  ? 86  ASN F CG  1 
ATOM   8550  O OD1 . ASN F  2 90  ? 4.730   13.854  -51.058 1.00 52.43  ? 86  ASN F OD1 1 
ATOM   8551  N ND2 . ASN F  2 90  ? 5.492   12.567  -49.382 1.00 53.41  ? 86  ASN F ND2 1 
ATOM   8552  N N   . TRP F  2 91  ? 8.148   15.481  -50.798 1.00 48.46  ? 87  TRP F N   1 
ATOM   8553  C CA  . TRP F  2 91  ? 8.142   16.757  -50.092 1.00 49.04  ? 87  TRP F CA  1 
ATOM   8554  C C   . TRP F  2 91  ? 8.536   17.963  -50.936 1.00 49.02  ? 87  TRP F C   1 
ATOM   8555  O O   . TRP F  2 91  ? 8.095   19.082  -50.661 1.00 49.25  ? 87  TRP F O   1 
ATOM   8556  C CB  . TRP F  2 91  ? 9.032   16.703  -48.847 1.00 48.53  ? 87  TRP F CB  1 
ATOM   8557  C CG  . TRP F  2 91  ? 8.536   15.768  -47.801 1.00 48.20  ? 87  TRP F CG  1 
ATOM   8558  C CD1 . TRP F  2 91  ? 7.247   15.364  -47.603 1.00 47.74  ? 87  TRP F CD1 1 
ATOM   8559  C CD2 . TRP F  2 91  ? 9.319   15.126  -46.794 1.00 47.71  ? 87  TRP F CD2 1 
ATOM   8560  N NE1 . TRP F  2 91  ? 7.181   14.505  -46.533 1.00 47.40  ? 87  TRP F NE1 1 
ATOM   8561  C CE2 . TRP F  2 91  ? 8.440   14.342  -46.017 1.00 47.31  ? 87  TRP F CE2 1 
ATOM   8562  C CE3 . TRP F  2 91  ? 10.683  15.136  -46.469 1.00 46.79  ? 87  TRP F CE3 1 
ATOM   8563  C CZ2 . TRP F  2 91  ? 8.880   13.574  -44.933 1.00 47.77  ? 87  TRP F CZ2 1 
ATOM   8564  C CZ3 . TRP F  2 91  ? 11.122  14.374  -45.391 1.00 45.81  ? 87  TRP F CZ3 1 
ATOM   8565  C CH2 . TRP F  2 91  ? 10.224  13.603  -44.637 1.00 45.85  ? 87  TRP F CH2 1 
ATOM   8566  N N   . ASN F  2 92  ? 9.363   17.756  -51.955 1.00 48.97  ? 88  ASN F N   1 
ATOM   8567  C CA  . ASN F  2 92  ? 9.766   18.879  -52.787 1.00 49.29  ? 88  ASN F CA  1 
ATOM   8568  C C   . ASN F  2 92  ? 8.639   19.349  -53.712 1.00 50.34  ? 88  ASN F C   1 
ATOM   8569  O O   . ASN F  2 92  ? 8.702   20.455  -54.251 1.00 50.98  ? 88  ASN F O   1 
ATOM   8570  C CB  . ASN F  2 92  ? 11.009  18.534  -53.614 1.00 47.75  ? 88  ASN F CB  1 
ATOM   8571  C CG  . ASN F  2 92  ? 12.288  18.578  -52.800 1.00 46.62  ? 88  ASN F CG  1 
ATOM   8572  O OD1 . ASN F  2 92  ? 12.451  19.416  -51.916 1.00 47.47  ? 88  ASN F OD1 1 
ATOM   8573  N ND2 . ASN F  2 92  ? 13.212  17.687  -53.112 1.00 46.33  ? 88  ASN F ND2 1 
ATOM   8574  N N   . SER F  2 93  ? 7.613   18.518  -53.898 1.00 49.95  ? 89  SER F N   1 
ATOM   8575  C CA  . SER F  2 93  ? 6.492   18.895  -54.754 1.00 51.28  ? 89  SER F CA  1 
ATOM   8576  C C   . SER F  2 93  ? 5.400   19.548  -53.924 1.00 51.72  ? 89  SER F C   1 
ATOM   8577  O O   . SER F  2 93  ? 4.299   19.783  -54.410 1.00 52.92  ? 89  SER F O   1 
ATOM   8578  C CB  . SER F  2 93  ? 5.907   17.676  -55.461 1.00 50.73  ? 89  SER F CB  1 
ATOM   8579  O OG  . SER F  2 93  ? 5.104   16.926  -54.573 1.00 52.56  ? 89  SER F OG  1 
ATOM   8580  N N   . GLN F  2 94  ? 5.710   19.836  -52.667 1.00 52.23  ? 90  GLN F N   1 
ATOM   8581  C CA  . GLN F  2 94  ? 4.750   20.454  -51.771 1.00 53.21  ? 90  GLN F CA  1 
ATOM   8582  C C   . GLN F  2 94  ? 5.220   21.853  -51.396 1.00 55.50  ? 90  GLN F C   1 
ATOM   8583  O O   . GLN F  2 94  ? 5.769   22.080  -50.320 1.00 55.15  ? 90  GLN F O   1 
ATOM   8584  C CB  . GLN F  2 94  ? 4.573   19.594  -50.515 1.00 51.79  ? 90  GLN F CB  1 
ATOM   8585  C CG  . GLN F  2 94  ? 3.887   18.248  -50.755 1.00 50.28  ? 90  GLN F CG  1 
ATOM   8586  C CD  . GLN F  2 94  ? 3.874   17.372  -49.512 1.00 51.27  ? 90  GLN F CD  1 
ATOM   8587  O OE1 . GLN F  2 94  ? 3.633   17.858  -48.402 1.00 51.28  ? 90  GLN F OE1 1 
ATOM   8588  N NE2 . GLN F  2 94  ? 4.125   16.074  -49.689 1.00 47.48  ? 90  GLN F NE2 1 
ATOM   8589  N N   . PRO F  2 95  ? 4.985   22.822  -52.284 1.00 57.88  ? 91  PRO F N   1 
ATOM   8590  C CA  . PRO F  2 95  ? 5.370   24.223  -52.090 1.00 58.69  ? 91  PRO F CA  1 
ATOM   8591  C C   . PRO F  2 95  ? 5.025   24.826  -50.729 1.00 59.70  ? 91  PRO F C   1 
ATOM   8592  O O   . PRO F  2 95  ? 5.805   25.614  -50.191 1.00 59.31  ? 91  PRO F O   1 
ATOM   8593  C CB  . PRO F  2 95  ? 4.665   24.935  -53.242 1.00 58.75  ? 91  PRO F CB  1 
ATOM   8594  C CG  . PRO F  2 95  ? 3.476   24.041  -53.514 1.00 59.40  ? 91  PRO F CG  1 
ATOM   8595  C CD  . PRO F  2 95  ? 4.103   22.684  -53.454 1.00 58.20  ? 91  PRO F CD  1 
ATOM   8596  N N   . GLU F  2 96  ? 3.865   24.474  -50.174 1.00 61.00  ? 92  GLU F N   1 
ATOM   8597  C CA  . GLU F  2 96  ? 3.464   25.007  -48.868 1.00 61.28  ? 92  GLU F CA  1 
ATOM   8598  C C   . GLU F  2 96  ? 4.416   24.499  -47.792 1.00 59.90  ? 92  GLU F C   1 
ATOM   8599  O O   . GLU F  2 96  ? 4.833   25.245  -46.905 1.00 58.82  ? 92  GLU F O   1 
ATOM   8600  C CB  . GLU F  2 96  ? 2.040   24.572  -48.496 1.00 64.34  ? 92  GLU F CB  1 
ATOM   8601  C CG  . GLU F  2 96  ? 0.920   25.169  -49.337 1.00 69.16  ? 92  GLU F CG  1 
ATOM   8602  C CD  . GLU F  2 96  ? -0.441  25.071  -48.644 1.00 71.62  ? 92  GLU F CD  1 
ATOM   8603  O OE1 . GLU F  2 96  ? -0.850  23.953  -48.253 1.00 72.76  ? 92  GLU F OE1 1 
ATOM   8604  O OE2 . GLU F  2 96  ? -1.105  26.118  -48.489 1.00 73.34  ? 92  GLU F OE2 1 
ATOM   8605  N N   . PHE F  2 97  ? 4.744   23.215  -47.875 1.00 58.57  ? 93  PHE F N   1 
ATOM   8606  C CA  . PHE F  2 97  ? 5.636   22.594  -46.911 1.00 57.57  ? 93  PHE F CA  1 
ATOM   8607  C C   . PHE F  2 97  ? 7.057   23.154  -47.037 1.00 56.93  ? 93  PHE F C   1 
ATOM   8608  O O   . PHE F  2 97  ? 7.664   23.515  -46.028 1.00 55.32  ? 93  PHE F O   1 
ATOM   8609  C CB  . PHE F  2 97  ? 5.628   21.074  -47.106 1.00 56.74  ? 93  PHE F CB  1 
ATOM   8610  C CG  . PHE F  2 97  ? 6.442   20.325  -46.094 1.00 56.85  ? 93  PHE F CG  1 
ATOM   8611  C CD1 . PHE F  2 97  ? 6.319   20.604  -44.738 1.00 57.53  ? 93  PHE F CD1 1 
ATOM   8612  C CD2 . PHE F  2 97  ? 7.307   19.312  -46.493 1.00 56.43  ? 93  PHE F CD2 1 
ATOM   8613  C CE1 . PHE F  2 97  ? 7.044   19.881  -43.790 1.00 56.72  ? 93  PHE F CE1 1 
ATOM   8614  C CE2 . PHE F  2 97  ? 8.035   18.585  -45.556 1.00 56.72  ? 93  PHE F CE2 1 
ATOM   8615  C CZ  . PHE F  2 97  ? 7.902   18.869  -44.201 1.00 56.28  ? 93  PHE F CZ  1 
ATOM   8616  N N   . LEU F  2 98  ? 7.576   23.238  -48.265 1.00 55.20  ? 94  LEU F N   1 
ATOM   8617  C CA  . LEU F  2 98  ? 8.920   23.767  -48.488 1.00 56.02  ? 94  LEU F CA  1 
ATOM   8618  C C   . LEU F  2 98  ? 9.053   25.202  -47.979 1.00 56.41  ? 94  LEU F C   1 
ATOM   8619  O O   . LEU F  2 98  ? 10.103  25.599  -47.461 1.00 55.92  ? 94  LEU F O   1 
ATOM   8620  C CB  . LEU F  2 98  ? 9.291   23.724  -49.975 1.00 55.58  ? 94  LEU F CB  1 
ATOM   8621  C CG  . LEU F  2 98  ? 9.714   22.379  -50.578 1.00 57.73  ? 94  LEU F CG  1 
ATOM   8622  C CD1 . LEU F  2 98  ? 10.000  22.538  -52.073 1.00 57.46  ? 94  LEU F CD1 1 
ATOM   8623  C CD2 . LEU F  2 98  ? 10.957  21.872  -49.864 1.00 57.78  ? 94  LEU F CD2 1 
ATOM   8624  N N   . GLU F  2 99  ? 7.983   25.973  -48.120 1.00 56.12  ? 95  GLU F N   1 
ATOM   8625  C CA  . GLU F  2 99  ? 7.988   27.363  -47.682 1.00 57.94  ? 95  GLU F CA  1 
ATOM   8626  C C   . GLU F  2 99  ? 8.128   27.441  -46.159 1.00 56.62  ? 95  GLU F C   1 
ATOM   8627  O O   . GLU F  2 99  ? 8.876   28.268  -45.633 1.00 56.69  ? 95  GLU F O   1 
ATOM   8628  C CB  . GLU F  2 99  ? 6.699   28.056  -48.143 1.00 59.20  ? 95  GLU F CB  1 
ATOM   8629  C CG  . GLU F  2 99  ? 6.816   29.566  -48.299 1.00 63.76  ? 95  GLU F CG  1 
ATOM   8630  C CD  . GLU F  2 99  ? 7.768   29.978  -49.417 1.00 66.93  ? 95  GLU F CD  1 
ATOM   8631  O OE1 . GLU F  2 99  ? 7.947   31.199  -49.626 1.00 69.88  ? 95  GLU F OE1 1 
ATOM   8632  O OE2 . GLU F  2 99  ? 8.339   29.091  -50.090 1.00 67.77  ? 95  GLU F OE2 1 
ATOM   8633  N N   . GLN F  2 100 ? 7.411   26.563  -45.463 1.00 55.53  ? 96  GLN F N   1 
ATOM   8634  C CA  . GLN F  2 100 ? 7.439   26.503  -44.002 1.00 54.72  ? 96  GLN F CA  1 
ATOM   8635  C C   . GLN F  2 100 ? 8.811   26.046  -43.488 1.00 52.14  ? 96  GLN F C   1 
ATOM   8636  O O   . GLN F  2 100 ? 9.333   26.572  -42.498 1.00 48.98  ? 96  GLN F O   1 
ATOM   8637  C CB  . GLN F  2 100 ? 6.365   25.531  -43.510 1.00 56.36  ? 96  GLN F CB  1 
ATOM   8638  C CG  . GLN F  2 100 ? 6.263   25.425  -42.000 1.00 63.01  ? 96  GLN F CG  1 
ATOM   8639  C CD  . GLN F  2 100 ? 5.423   24.238  -41.560 1.00 66.88  ? 96  GLN F CD  1 
ATOM   8640  O OE1 . GLN F  2 100 ? 4.270   24.085  -41.973 1.00 69.26  ? 96  GLN F OE1 1 
ATOM   8641  N NE2 . GLN F  2 100 ? 6.000   23.389  -40.718 1.00 69.33  ? 96  GLN F NE2 1 
ATOM   8642  N N   . LYS F  2 101 ? 9.371   25.053  -44.174 1.00 49.44  ? 97  LYS F N   1 
ATOM   8643  C CA  . LYS F  2 101 ? 10.665  24.489  -43.834 1.00 49.09  ? 97  LYS F CA  1 
ATOM   8644  C C   . LYS F  2 101 ? 11.756  25.550  -44.001 1.00 47.24  ? 97  LYS F C   1 
ATOM   8645  O O   . LYS F  2 101 ? 12.597  25.733  -43.123 1.00 44.10  ? 97  LYS F O   1 
ATOM   8646  C CB  . LYS F  2 101 ? 10.953  23.284  -44.739 1.00 49.00  ? 97  LYS F CB  1 
ATOM   8647  C CG  . LYS F  2 101 ? 11.761  22.195  -44.064 1.00 50.96  ? 97  LYS F CG  1 
ATOM   8648  C CD  . LYS F  2 101 ? 10.976  21.624  -42.898 1.00 51.36  ? 97  LYS F CD  1 
ATOM   8649  C CE  . LYS F  2 101 ? 11.853  20.833  -41.957 1.00 49.99  ? 97  LYS F CE  1 
ATOM   8650  N NZ  . LYS F  2 101 ? 11.069  20.445  -40.756 1.00 50.93  ? 97  LYS F NZ  1 
ATOM   8651  N N   . ARG F  2 102 ? 11.724  26.256  -45.127 1.00 47.00  ? 98  ARG F N   1 
ATOM   8652  C CA  . ARG F  2 102 ? 12.708  27.304  -45.400 1.00 48.22  ? 98  ARG F CA  1 
ATOM   8653  C C   . ARG F  2 102 ? 12.717  28.404  -44.355 1.00 48.44  ? 98  ARG F C   1 
ATOM   8654  O O   . ARG F  2 102 ? 13.763  28.981  -44.072 1.00 50.40  ? 98  ARG F O   1 
ATOM   8655  C CB  . ARG F  2 102 ? 12.451  27.930  -46.763 1.00 46.87  ? 98  ARG F CB  1 
ATOM   8656  C CG  . ARG F  2 102 ? 12.834  27.039  -47.905 1.00 47.71  ? 98  ARG F CG  1 
ATOM   8657  C CD  . ARG F  2 102 ? 12.352  27.605  -49.208 1.00 48.58  ? 98  ARG F CD  1 
ATOM   8658  N NE  . ARG F  2 102 ? 12.869  26.835  -50.327 1.00 52.60  ? 98  ARG F NE  1 
ATOM   8659  C CZ  . ARG F  2 102 ? 12.332  26.830  -51.540 1.00 54.74  ? 98  ARG F CZ  1 
ATOM   8660  N NH1 . ARG F  2 102 ? 11.250  27.557  -51.786 1.00 56.74  ? 98  ARG F NH1 1 
ATOM   8661  N NH2 . ARG F  2 102 ? 12.877  26.100  -52.506 1.00 54.40  ? 98  ARG F NH2 1 
ATOM   8662  N N   . ALA F  2 103 ? 11.553  28.691  -43.782 1.00 47.48  ? 99  ALA F N   1 
ATOM   8663  C CA  . ALA F  2 103 ? 11.435  29.739  -42.774 1.00 48.14  ? 99  ALA F CA  1 
ATOM   8664  C C   . ALA F  2 103 ? 11.775  29.287  -41.353 1.00 49.16  ? 99  ALA F C   1 
ATOM   8665  O O   . ALA F  2 103 ? 11.871  30.116  -40.439 1.00 48.06  ? 99  ALA F O   1 
ATOM   8666  C CB  . ALA F  2 103 ? 10.023  30.328  -42.804 1.00 46.43  ? 99  ALA F CB  1 
ATOM   8667  N N   . GLU F  2 104 ? 11.952  27.984  -41.152 1.00 49.04  ? 100 GLU F N   1 
ATOM   8668  C CA  . GLU F  2 104 ? 12.273  27.502  -39.816 1.00 49.63  ? 100 GLU F CA  1 
ATOM   8669  C C   . GLU F  2 104 ? 13.606  28.068  -39.371 1.00 48.13  ? 100 GLU F C   1 
ATOM   8670  O O   . GLU F  2 104 ? 13.930  28.064  -38.187 1.00 48.78  ? 100 GLU F O   1 
ATOM   8671  C CB  . GLU F  2 104 ? 12.286  25.971  -39.765 1.00 51.35  ? 100 GLU F CB  1 
ATOM   8672  C CG  . GLU F  2 104 ? 10.906  25.366  -39.996 1.00 54.96  ? 100 GLU F CG  1 
ATOM   8673  C CD  . GLU F  2 104 ? 10.798  23.909  -39.579 1.00 57.88  ? 100 GLU F CD  1 
ATOM   8674  O OE1 . GLU F  2 104 ? 11.661  23.093  -39.976 1.00 59.05  ? 100 GLU F OE1 1 
ATOM   8675  O OE2 . GLU F  2 104 ? 9.831   23.579  -38.858 1.00 60.78  ? 100 GLU F OE2 1 
ATOM   8676  N N   . VAL F  2 105 ? 14.372  28.564  -40.330 1.00 47.61  ? 101 VAL F N   1 
ATOM   8677  C CA  . VAL F  2 105 ? 15.661  29.167  -40.044 1.00 48.51  ? 101 VAL F CA  1 
ATOM   8678  C C   . VAL F  2 105 ? 15.423  30.352  -39.112 1.00 49.42  ? 101 VAL F C   1 
ATOM   8679  O O   . VAL F  2 105 ? 16.268  30.674  -38.265 1.00 47.58  ? 101 VAL F O   1 
ATOM   8680  C CB  . VAL F  2 105 ? 16.308  29.674  -41.330 1.00 49.54  ? 101 VAL F CB  1 
ATOM   8681  C CG1 . VAL F  2 105 ? 17.627  30.318  -41.019 1.00 51.22  ? 101 VAL F CG1 1 
ATOM   8682  C CG2 . VAL F  2 105 ? 16.473  28.523  -42.312 1.00 49.89  ? 101 VAL F CG2 1 
ATOM   8683  N N   . ASP F  2 106 ? 14.258  30.986  -39.282 1.00 49.71  ? 102 ASP F N   1 
ATOM   8684  C CA  . ASP F  2 106 ? 13.844  32.141  -38.481 1.00 49.67  ? 102 ASP F CA  1 
ATOM   8685  C C   . ASP F  2 106 ? 12.863  31.723  -37.386 1.00 49.67  ? 102 ASP F C   1 
ATOM   8686  O O   . ASP F  2 106 ? 13.062  32.034  -36.209 1.00 50.98  ? 102 ASP F O   1 
ATOM   8687  C CB  . ASP F  2 106 ? 13.178  33.213  -39.369 1.00 49.96  ? 102 ASP F CB  1 
ATOM   8688  C CG  . ASP F  2 106 ? 14.147  33.849  -40.363 1.00 51.18  ? 102 ASP F CG  1 
ATOM   8689  O OD1 . ASP F  2 106 ? 15.132  34.475  -39.916 1.00 52.50  ? 102 ASP F OD1 1 
ATOM   8690  O OD2 . ASP F  2 106 ? 13.923  33.728  -41.591 1.00 51.21  ? 102 ASP F OD2 1 
ATOM   8691  N N   . THR F  2 107 ? 11.809  31.010  -37.770 1.00 48.36  ? 103 THR F N   1 
ATOM   8692  C CA  . THR F  2 107 ? 10.801  30.581  -36.811 1.00 47.22  ? 103 THR F CA  1 
ATOM   8693  C C   . THR F  2 107 ? 11.325  29.589  -35.783 1.00 46.55  ? 103 THR F C   1 
ATOM   8694  O O   . THR F  2 107 ? 10.716  29.400  -34.729 1.00 46.50  ? 103 THR F O   1 
ATOM   8695  C CB  . THR F  2 107 ? 9.578   29.975  -37.522 1.00 47.67  ? 103 THR F CB  1 
ATOM   8696  O OG1 . THR F  2 107 ? 9.977   28.827  -38.276 1.00 48.93  ? 103 THR F OG1 1 
ATOM   8697  C CG2 . THR F  2 107 ? 8.961   30.995  -38.459 1.00 46.11  ? 103 THR F CG2 1 
ATOM   8698  N N   . VAL F  2 108 ? 12.449  28.947  -36.075 1.00 45.75  ? 104 VAL F N   1 
ATOM   8699  C CA  . VAL F  2 108 ? 13.009  28.007  -35.109 1.00 46.19  ? 104 VAL F CA  1 
ATOM   8700  C C   . VAL F  2 108 ? 14.436  28.345  -34.695 1.00 45.31  ? 104 VAL F C   1 
ATOM   8701  O O   . VAL F  2 108 ? 14.686  28.637  -33.525 1.00 44.88  ? 104 VAL F O   1 
ATOM   8702  C CB  . VAL F  2 108 ? 12.954  26.542  -35.625 1.00 45.60  ? 104 VAL F CB  1 
ATOM   8703  C CG1 . VAL F  2 108 ? 13.582  25.606  -34.602 1.00 43.32  ? 104 VAL F CG1 1 
ATOM   8704  C CG2 . VAL F  2 108 ? 11.502  26.129  -35.859 1.00 44.31  ? 104 VAL F CG2 1 
ATOM   8705  N N   . CYS F  2 109 ? 15.360  28.326  -35.653 1.00 45.18  ? 105 CYS F N   1 
ATOM   8706  C CA  . CYS F  2 109 ? 16.765  28.605  -35.365 1.00 45.88  ? 105 CYS F CA  1 
ATOM   8707  C C   . CYS F  2 109 ? 17.018  29.920  -34.639 1.00 45.67  ? 105 CYS F C   1 
ATOM   8708  O O   . CYS F  2 109 ? 17.350  29.923  -33.449 1.00 43.56  ? 105 CYS F O   1 
ATOM   8709  C CB  . CYS F  2 109 ? 17.590  28.561  -36.651 1.00 45.92  ? 105 CYS F CB  1 
ATOM   8710  S SG  . CYS F  2 109 ? 17.848  26.886  -37.329 1.00 47.11  ? 105 CYS F SG  1 
ATOM   8711  N N   . ARG F  2 110 ? 16.874  31.034  -35.351 1.00 46.32  ? 106 ARG F N   1 
ATOM   8712  C CA  . ARG F  2 110 ? 17.086  32.345  -34.745 1.00 46.03  ? 106 ARG F CA  1 
ATOM   8713  C C   . ARG F  2 110 ? 16.178  32.532  -33.529 1.00 46.53  ? 106 ARG F C   1 
ATOM   8714  O O   . ARG F  2 110 ? 16.610  33.025  -32.481 1.00 45.33  ? 106 ARG F O   1 
ATOM   8715  C CB  . ARG F  2 110 ? 16.822  33.448  -35.765 1.00 46.59  ? 106 ARG F CB  1 
ATOM   8716  C CG  . ARG F  2 110 ? 17.842  33.496  -36.877 1.00 45.18  ? 106 ARG F CG  1 
ATOM   8717  C CD  . ARG F  2 110 ? 17.674  34.754  -37.702 1.00 47.68  ? 106 ARG F CD  1 
ATOM   8718  N NE  . ARG F  2 110 ? 18.798  34.945  -38.611 1.00 47.37  ? 106 ARG F NE  1 
ATOM   8719  C CZ  . ARG F  2 110 ? 18.914  34.368  -39.802 1.00 47.19  ? 106 ARG F CZ  1 
ATOM   8720  N NH1 . ARG F  2 110 ? 17.971  33.557  -40.254 1.00 46.09  ? 106 ARG F NH1 1 
ATOM   8721  N NH2 . ARG F  2 110 ? 19.992  34.591  -40.535 1.00 49.11  ? 106 ARG F NH2 1 
ATOM   8722  N N   . HIS F  2 111 ? 14.921  32.123  -33.666 1.00 46.11  ? 107 HIS F N   1 
ATOM   8723  C CA  . HIS F  2 111 ? 13.984  32.240  -32.562 1.00 46.35  ? 107 HIS F CA  1 
ATOM   8724  C C   . HIS F  2 111 ? 14.578  31.611  -31.308 1.00 46.32  ? 107 HIS F C   1 
ATOM   8725  O O   . HIS F  2 111 ? 14.825  32.304  -30.321 1.00 47.74  ? 107 HIS F O   1 
ATOM   8726  C CB  . HIS F  2 111 ? 12.656  31.552  -32.899 1.00 49.34  ? 107 HIS F CB  1 
ATOM   8727  C CG  . HIS F  2 111 ? 11.689  31.520  -31.755 1.00 51.42  ? 107 HIS F CG  1 
ATOM   8728  N ND1 . HIS F  2 111 ? 11.071  32.653  -31.269 1.00 53.02  ? 107 HIS F ND1 1 
ATOM   8729  C CD2 . HIS F  2 111 ? 11.270  30.499  -30.971 1.00 52.02  ? 107 HIS F CD2 1 
ATOM   8730  C CE1 . HIS F  2 111 ? 10.315  32.331  -30.235 1.00 53.17  ? 107 HIS F CE1 1 
ATOM   8731  N NE2 . HIS F  2 111 ? 10.418  31.030  -30.032 1.00 53.13  ? 107 HIS F NE2 1 
ATOM   8732  N N   . ASN F  2 112 ? 14.813  30.300  -31.342 1.00 45.39  ? 108 ASN F N   1 
ATOM   8733  C CA  . ASN F  2 112 ? 15.364  29.612  -30.174 1.00 44.36  ? 108 ASN F CA  1 
ATOM   8734  C C   . ASN F  2 112 ? 16.725  30.156  -29.752 1.00 43.49  ? 108 ASN F C   1 
ATOM   8735  O O   . ASN F  2 112 ? 17.046  30.193  -28.562 1.00 43.15  ? 108 ASN F O   1 
ATOM   8736  C CB  . ASN F  2 112 ? 15.457  28.104  -30.421 1.00 44.10  ? 108 ASN F CB  1 
ATOM   8737  C CG  . ASN F  2 112 ? 14.099  27.423  -30.399 1.00 43.75  ? 108 ASN F CG  1 
ATOM   8738  O OD1 . ASN F  2 112 ? 13.228  27.766  -29.596 1.00 44.96  ? 108 ASN F OD1 1 
ATOM   8739  N ND2 . ASN F  2 112 ? 13.918  26.440  -31.269 1.00 43.11  ? 108 ASN F ND2 1 
ATOM   8740  N N   . TYR F  2 113 ? 17.517  30.594  -30.723 1.00 44.04  ? 109 TYR F N   1 
ATOM   8741  C CA  . TYR F  2 113 ? 18.828  31.146  -30.414 1.00 46.38  ? 109 TYR F CA  1 
ATOM   8742  C C   . TYR F  2 113 ? 18.692  32.324  -29.458 1.00 47.66  ? 109 TYR F C   1 
ATOM   8743  O O   . TYR F  2 113 ? 19.386  32.400  -28.442 1.00 47.86  ? 109 TYR F O   1 
ATOM   8744  C CB  . TYR F  2 113 ? 19.538  31.633  -31.677 1.00 47.36  ? 109 TYR F CB  1 
ATOM   8745  C CG  . TYR F  2 113 ? 20.958  32.094  -31.407 1.00 49.75  ? 109 TYR F CG  1 
ATOM   8746  C CD1 . TYR F  2 113 ? 22.030  31.215  -31.532 1.00 50.62  ? 109 TYR F CD1 1 
ATOM   8747  C CD2 . TYR F  2 113 ? 21.224  33.399  -30.990 1.00 50.82  ? 109 TYR F CD2 1 
ATOM   8748  C CE1 . TYR F  2 113 ? 23.333  31.615  -31.254 1.00 51.77  ? 109 TYR F CE1 1 
ATOM   8749  C CE2 . TYR F  2 113 ? 22.526  33.816  -30.705 1.00 51.25  ? 109 TYR F CE2 1 
ATOM   8750  C CZ  . TYR F  2 113 ? 23.579  32.918  -30.841 1.00 53.09  ? 109 TYR F CZ  1 
ATOM   8751  O OH  . TYR F  2 113 ? 24.876  33.322  -30.591 1.00 52.62  ? 109 TYR F OH  1 
ATOM   8752  N N   . GLU F  2 114 ? 17.801  33.252  -29.789 1.00 48.76  ? 110 GLU F N   1 
ATOM   8753  C CA  . GLU F  2 114 ? 17.612  34.420  -28.947 1.00 49.77  ? 110 GLU F CA  1 
ATOM   8754  C C   . GLU F  2 114 ? 17.179  34.057  -27.540 1.00 49.03  ? 110 GLU F C   1 
ATOM   8755  O O   . GLU F  2 114 ? 17.510  34.760  -26.591 1.00 50.14  ? 110 GLU F O   1 
ATOM   8756  C CB  . GLU F  2 114 ? 16.617  35.382  -29.595 1.00 53.27  ? 110 GLU F CB  1 
ATOM   8757  C CG  . GLU F  2 114 ? 17.185  36.092  -30.814 1.00 57.02  ? 110 GLU F CG  1 
ATOM   8758  C CD  . GLU F  2 114 ? 16.109  36.662  -31.713 1.00 62.92  ? 110 GLU F CD  1 
ATOM   8759  O OE1 . GLU F  2 114 ? 15.238  37.407  -31.203 1.00 66.75  ? 110 GLU F OE1 1 
ATOM   8760  O OE2 . GLU F  2 114 ? 16.137  36.369  -32.932 1.00 64.26  ? 110 GLU F OE2 1 
ATOM   8761  N N   . ILE F  2 115 ? 16.451  32.957  -27.385 1.00 48.58  ? 111 ILE F N   1 
ATOM   8762  C CA  . ILE F  2 115 ? 16.022  32.553  -26.047 1.00 48.07  ? 111 ILE F CA  1 
ATOM   8763  C C   . ILE F  2 115 ? 17.220  32.004  -25.274 1.00 48.11  ? 111 ILE F C   1 
ATOM   8764  O O   . ILE F  2 115 ? 17.408  32.278  -24.086 1.00 47.27  ? 111 ILE F O   1 
ATOM   8765  C CB  . ILE F  2 115 ? 14.943  31.454  -26.098 1.00 47.25  ? 111 ILE F CB  1 
ATOM   8766  C CG1 . ILE F  2 115 ? 13.734  31.950  -26.892 1.00 48.17  ? 111 ILE F CG1 1 
ATOM   8767  C CG2 . ILE F  2 115 ? 14.515  31.071  -24.682 1.00 46.03  ? 111 ILE F CG2 1 
ATOM   8768  C CD1 . ILE F  2 115 ? 12.650  30.892  -27.100 1.00 47.38  ? 111 ILE F CD1 1 
ATOM   8769  N N   . PHE F  2 116 ? 18.040  31.230  -25.965 1.00 48.29  ? 112 PHE F N   1 
ATOM   8770  C CA  . PHE F  2 116 ? 19.203  30.633  -25.332 1.00 48.39  ? 112 PHE F CA  1 
ATOM   8771  C C   . PHE F  2 116 ? 20.328  31.637  -25.107 1.00 48.58  ? 112 PHE F C   1 
ATOM   8772  O O   . PHE F  2 116 ? 21.217  31.428  -24.276 1.00 47.79  ? 112 PHE F O   1 
ATOM   8773  C CB  . PHE F  2 116 ? 19.682  29.459  -26.182 1.00 45.13  ? 112 PHE F CB  1 
ATOM   8774  C CG  . PHE F  2 116 ? 18.661  28.371  -26.315 1.00 43.25  ? 112 PHE F CG  1 
ATOM   8775  C CD1 . PHE F  2 116 ? 17.872  28.010  -25.218 1.00 41.02  ? 112 PHE F CD1 1 
ATOM   8776  C CD2 . PHE F  2 116 ? 18.495  27.691  -27.516 1.00 39.85  ? 112 PHE F CD2 1 
ATOM   8777  C CE1 . PHE F  2 116 ? 16.937  26.989  -25.319 1.00 40.30  ? 112 PHE F CE1 1 
ATOM   8778  C CE2 . PHE F  2 116 ? 17.560  26.666  -27.627 1.00 39.81  ? 112 PHE F CE2 1 
ATOM   8779  C CZ  . PHE F  2 116 ? 16.780  26.315  -26.529 1.00 40.13  ? 112 PHE F CZ  1 
ATOM   8780  N N   . ASP F  2 117 ? 20.282  32.735  -25.842 1.00 49.64  ? 113 ASP F N   1 
ATOM   8781  C CA  . ASP F  2 117 ? 21.307  33.754  -25.704 1.00 51.98  ? 113 ASP F CA  1 
ATOM   8782  C C   . ASP F  2 117 ? 21.224  34.458  -24.351 1.00 52.09  ? 113 ASP F C   1 
ATOM   8783  O O   . ASP F  2 117 ? 22.098  35.241  -24.001 1.00 52.65  ? 113 ASP F O   1 
ATOM   8784  C CB  . ASP F  2 117 ? 21.180  34.774  -26.835 1.00 53.97  ? 113 ASP F CB  1 
ATOM   8785  C CG  . ASP F  2 117 ? 22.376  35.691  -26.921 1.00 56.70  ? 113 ASP F CG  1 
ATOM   8786  O OD1 . ASP F  2 117 ? 23.514  35.180  -26.899 1.00 58.21  ? 113 ASP F OD1 1 
ATOM   8787  O OD2 . ASP F  2 117 ? 22.183  36.921  -27.019 1.00 61.00  ? 113 ASP F OD2 1 
ATOM   8788  N N   . ASN F  2 118 ? 20.182  34.165  -23.581 1.00 52.56  ? 114 ASN F N   1 
ATOM   8789  C CA  . ASN F  2 118 ? 20.013  34.800  -22.283 1.00 53.09  ? 114 ASN F CA  1 
ATOM   8790  C C   . ASN F  2 118 ? 20.604  34.028  -21.110 1.00 52.16  ? 114 ASN F C   1 
ATOM   8791  O O   . ASN F  2 118 ? 20.773  34.585  -20.028 1.00 54.46  ? 114 ASN F O   1 
ATOM   8792  C CB  . ASN F  2 118 ? 18.525  35.068  -22.021 1.00 55.01  ? 114 ASN F CB  1 
ATOM   8793  C CG  . ASN F  2 118 ? 17.889  35.922  -23.113 1.00 57.98  ? 114 ASN F CG  1 
ATOM   8794  O OD1 . ASN F  2 118 ? 18.432  36.963  -23.498 1.00 58.78  ? 114 ASN F OD1 1 
ATOM   8795  N ND2 . ASN F  2 118 ? 16.732  35.487  -23.615 1.00 58.30  ? 114 ASN F ND2 1 
ATOM   8796  N N   . PHE F  2 119 ? 20.927  32.755  -21.308 1.00 50.67  ? 115 PHE F N   1 
ATOM   8797  C CA  . PHE F  2 119 ? 21.481  31.963  -20.216 1.00 48.33  ? 115 PHE F CA  1 
ATOM   8798  C C   . PHE F  2 119 ? 22.408  30.833  -20.641 1.00 47.86  ? 115 PHE F C   1 
ATOM   8799  O O   . PHE F  2 119 ? 23.163  30.307  -19.822 1.00 48.38  ? 115 PHE F O   1 
ATOM   8800  C CB  . PHE F  2 119 ? 20.352  31.388  -19.366 1.00 46.88  ? 115 PHE F CB  1 
ATOM   8801  C CG  . PHE F  2 119 ? 19.459  30.434  -20.105 1.00 46.65  ? 115 PHE F CG  1 
ATOM   8802  C CD1 . PHE F  2 119 ? 18.839  30.811  -21.289 1.00 45.90  ? 115 PHE F CD1 1 
ATOM   8803  C CD2 . PHE F  2 119 ? 19.213  29.165  -19.598 1.00 45.73  ? 115 PHE F CD2 1 
ATOM   8804  C CE1 . PHE F  2 119 ? 17.992  29.939  -21.952 1.00 47.59  ? 115 PHE F CE1 1 
ATOM   8805  C CE2 . PHE F  2 119 ? 18.368  28.288  -20.255 1.00 46.77  ? 115 PHE F CE2 1 
ATOM   8806  C CZ  . PHE F  2 119 ? 17.755  28.675  -21.433 1.00 46.20  ? 115 PHE F CZ  1 
ATOM   8807  N N   . LEU F  2 120 ? 22.346  30.437  -21.905 1.00 45.99  ? 116 LEU F N   1 
ATOM   8808  C CA  . LEU F  2 120 ? 23.220  29.370  -22.357 1.00 45.84  ? 116 LEU F CA  1 
ATOM   8809  C C   . LEU F  2 120 ? 24.466  30.000  -22.958 1.00 46.80  ? 116 LEU F C   1 
ATOM   8810  O O   . LEU F  2 120 ? 25.556  29.859  -22.404 1.00 48.22  ? 116 LEU F O   1 
ATOM   8811  C CB  . LEU F  2 120 ? 22.518  28.460  -23.379 1.00 44.27  ? 116 LEU F CB  1 
ATOM   8812  C CG  . LEU F  2 120 ? 21.309  27.635  -22.901 1.00 41.63  ? 116 LEU F CG  1 
ATOM   8813  C CD1 . LEU F  2 120 ? 20.924  26.654  -23.997 1.00 40.60  ? 116 LEU F CD1 1 
ATOM   8814  C CD2 . LEU F  2 120 ? 21.623  26.877  -21.621 1.00 38.38  ? 116 LEU F CD2 1 
ATOM   8815  N N   . VAL F  2 121 ? 24.308  30.719  -24.067 1.00 46.94  ? 117 VAL F N   1 
ATOM   8816  C CA  . VAL F  2 121 ? 25.445  31.369  -24.716 1.00 46.69  ? 117 VAL F CA  1 
ATOM   8817  C C   . VAL F  2 121 ? 26.394  32.089  -23.747 1.00 48.32  ? 117 VAL F C   1 
ATOM   8818  O O   . VAL F  2 121 ? 27.609  32.020  -23.903 1.00 50.36  ? 117 VAL F O   1 
ATOM   8819  C CB  . VAL F  2 121 ? 24.972  32.362  -25.787 1.00 46.86  ? 117 VAL F CB  1 
ATOM   8820  C CG1 . VAL F  2 121 ? 26.161  33.115  -26.369 1.00 47.98  ? 117 VAL F CG1 1 
ATOM   8821  C CG2 . VAL F  2 121 ? 24.243  31.615  -26.883 1.00 45.50  ? 117 VAL F CG2 1 
ATOM   8822  N N   . PRO F  2 122 ? 25.857  32.788  -22.732 1.00 49.21  ? 118 PRO F N   1 
ATOM   8823  C CA  . PRO F  2 122 ? 26.744  33.481  -21.794 1.00 49.65  ? 118 PRO F CA  1 
ATOM   8824  C C   . PRO F  2 122 ? 27.297  32.620  -20.658 1.00 51.11  ? 118 PRO F C   1 
ATOM   8825  O O   . PRO F  2 122 ? 28.265  33.019  -20.010 1.00 53.12  ? 118 PRO F O   1 
ATOM   8826  C CB  . PRO F  2 122 ? 25.861  34.601  -21.264 1.00 49.68  ? 118 PRO F CB  1 
ATOM   8827  C CG  . PRO F  2 122 ? 24.526  33.935  -21.198 1.00 49.35  ? 118 PRO F CG  1 
ATOM   8828  C CD  . PRO F  2 122 ? 24.464  33.237  -22.544 1.00 49.70  ? 118 PRO F CD  1 
ATOM   8829  N N   . ARG F  2 123 ? 26.696  31.456  -20.409 1.00 49.90  ? 119 ARG F N   1 
ATOM   8830  C CA  . ARG F  2 123 ? 27.154  30.589  -19.319 1.00 49.30  ? 119 ARG F CA  1 
ATOM   8831  C C   . ARG F  2 123 ? 28.682  30.535  -19.212 1.00 49.66  ? 119 ARG F C   1 
ATOM   8832  O O   . ARG F  2 123 ? 29.387  30.441  -20.218 1.00 49.13  ? 119 ARG F O   1 
ATOM   8833  C CB  . ARG F  2 123 ? 26.599  29.171  -19.479 1.00 47.80  ? 119 ARG F CB  1 
ATOM   8834  C CG  . ARG F  2 123 ? 26.806  28.298  -18.238 1.00 47.06  ? 119 ARG F CG  1 
ATOM   8835  C CD  . ARG F  2 123 ? 26.317  26.889  -18.474 1.00 47.15  ? 119 ARG F CD  1 
ATOM   8836  N NE  . ARG F  2 123 ? 26.988  25.908  -17.624 1.00 47.09  ? 119 ARG F NE  1 
ATOM   8837  C CZ  . ARG F  2 123 ? 26.637  25.624  -16.374 1.00 46.94  ? 119 ARG F CZ  1 
ATOM   8838  N NH1 . ARG F  2 123 ? 25.610  26.249  -15.806 1.00 44.91  ? 119 ARG F NH1 1 
ATOM   8839  N NH2 . ARG F  2 123 ? 27.307  24.695  -15.699 1.00 44.01  ? 119 ARG F NH2 1 
ATOM   8840  N N   . ARG F  2 124 ? 29.175  30.596  -17.977 1.00 50.81  ? 120 ARG F N   1 
ATOM   8841  C CA  . ARG F  2 124 ? 30.609  30.590  -17.684 1.00 51.38  ? 120 ARG F CA  1 
ATOM   8842  C C   . ARG F  2 124 ? 30.848  29.968  -16.316 1.00 51.29  ? 120 ARG F C   1 
ATOM   8843  O O   . ARG F  2 124 ? 30.237  30.385  -15.339 1.00 52.02  ? 120 ARG F O   1 
ATOM   8844  C CB  . ARG F  2 124 ? 31.146  32.023  -17.637 1.00 51.16  ? 120 ARG F CB  1 
ATOM   8845  C CG  . ARG F  2 124 ? 31.005  32.810  -18.916 1.00 53.64  ? 120 ARG F CG  1 
ATOM   8846  C CD  . ARG F  2 124 ? 32.200  32.597  -19.811 1.00 57.44  ? 120 ARG F CD  1 
ATOM   8847  N NE  . ARG F  2 124 ? 32.129  33.396  -21.034 1.00 60.80  ? 120 ARG F NE  1 
ATOM   8848  C CZ  . ARG F  2 124 ? 31.326  33.132  -22.062 1.00 62.89  ? 120 ARG F CZ  1 
ATOM   8849  N NH1 . ARG F  2 124 ? 30.509  32.080  -22.028 1.00 61.88  ? 120 ARG F NH1 1 
ATOM   8850  N NH2 . ARG F  2 124 ? 31.342  33.924  -23.130 1.00 63.08  ? 120 ARG F NH2 1 
ATOM   8851  N N   . VAL F  2 125 ? 31.731  28.981  -16.239 1.00 50.24  ? 121 VAL F N   1 
ATOM   8852  C CA  . VAL F  2 125 ? 32.042  28.367  -14.956 1.00 51.27  ? 121 VAL F CA  1 
ATOM   8853  C C   . VAL F  2 125 ? 33.549  28.217  -14.823 1.00 52.86  ? 121 VAL F C   1 
ATOM   8854  O O   . VAL F  2 125 ? 34.169  27.417  -15.524 1.00 52.95  ? 121 VAL F O   1 
ATOM   8855  C CB  . VAL F  2 125 ? 31.383  26.995  -14.800 1.00 50.74  ? 121 VAL F CB  1 
ATOM   8856  C CG1 . VAL F  2 125 ? 31.893  26.319  -13.539 1.00 50.82  ? 121 VAL F CG1 1 
ATOM   8857  C CG2 . VAL F  2 125 ? 29.875  27.152  -14.733 1.00 51.02  ? 121 VAL F CG2 1 
ATOM   8858  N N   . GLU F  2 126 ? 34.123  28.999  -13.913 1.00 53.87  ? 122 GLU F N   1 
ATOM   8859  C CA  . GLU F  2 126 ? 35.565  29.023  -13.664 1.00 54.05  ? 122 GLU F CA  1 
ATOM   8860  C C   . GLU F  2 126 ? 36.196  27.686  -13.259 1.00 51.97  ? 122 GLU F C   1 
ATOM   8861  O O   . GLU F  2 126 ? 35.716  26.990  -12.361 1.00 51.92  ? 122 GLU F O   1 
ATOM   8862  C CB  . GLU F  2 126 ? 35.864  30.079  -12.601 1.00 56.74  ? 122 GLU F CB  1 
ATOM   8863  C CG  . GLU F  2 126 ? 35.266  31.440  -12.919 1.00 61.15  ? 122 GLU F CG  1 
ATOM   8864  C CD  . GLU F  2 126 ? 35.433  32.430  -11.778 1.00 65.46  ? 122 GLU F CD  1 
ATOM   8865  O OE1 . GLU F  2 126 ? 36.598  32.753  -11.444 1.00 66.14  ? 122 GLU F OE1 1 
ATOM   8866  O OE2 . GLU F  2 126 ? 34.402  32.876  -11.214 1.00 66.33  ? 122 GLU F OE2 1 
ATOM   8867  N N   . PRO F  2 127 ? 37.308  27.324  -13.910 1.00 50.19  ? 123 PRO F N   1 
ATOM   8868  C CA  . PRO F  2 127 ? 38.003  26.067  -13.616 1.00 50.29  ? 123 PRO F CA  1 
ATOM   8869  C C   . PRO F  2 127 ? 38.728  25.984  -12.269 1.00 50.88  ? 123 PRO F C   1 
ATOM   8870  O O   . PRO F  2 127 ? 39.136  26.993  -11.701 1.00 50.92  ? 123 PRO F O   1 
ATOM   8871  C CB  . PRO F  2 127 ? 38.971  25.936  -14.791 1.00 48.17  ? 123 PRO F CB  1 
ATOM   8872  C CG  . PRO F  2 127 ? 39.299  27.340  -15.107 1.00 48.29  ? 123 PRO F CG  1 
ATOM   8873  C CD  . PRO F  2 127 ? 37.947  28.020  -15.040 1.00 48.45  ? 123 PRO F CD  1 
ATOM   8874  N N   . THR F  2 128 ? 38.874  24.764  -11.768 1.00 51.71  ? 124 THR F N   1 
ATOM   8875  C CA  . THR F  2 128 ? 39.588  24.516  -10.527 1.00 53.23  ? 124 THR F CA  1 
ATOM   8876  C C   . THR F  2 128 ? 40.923  23.888  -10.961 1.00 54.70  ? 124 THR F C   1 
ATOM   8877  O O   . THR F  2 128 ? 40.950  22.759  -11.462 1.00 54.94  ? 124 THR F O   1 
ATOM   8878  C CB  . THR F  2 128 ? 38.814  23.527  -9.619  1.00 54.97  ? 124 THR F CB  1 
ATOM   8879  O OG1 . THR F  2 128 ? 37.509  24.053  -9.333  1.00 57.76  ? 124 THR F OG1 1 
ATOM   8880  C CG2 . THR F  2 128 ? 39.560  23.302  -8.305  1.00 52.49  ? 124 THR F CG2 1 
ATOM   8881  N N   . VAL F  2 129 ? 42.019  24.625  -10.789 1.00 53.98  ? 125 VAL F N   1 
ATOM   8882  C CA  . VAL F  2 129 ? 43.341  24.137  -11.185 1.00 53.39  ? 125 VAL F CA  1 
ATOM   8883  C C   . VAL F  2 129 ? 44.164  23.570  -10.032 1.00 54.29  ? 125 VAL F C   1 
ATOM   8884  O O   . VAL F  2 129 ? 44.265  24.169  -8.973  1.00 54.89  ? 125 VAL F O   1 
ATOM   8885  C CB  . VAL F  2 129 ? 44.167  25.247  -11.837 1.00 51.50  ? 125 VAL F CB  1 
ATOM   8886  C CG1 . VAL F  2 129 ? 45.441  24.663  -12.412 1.00 48.85  ? 125 VAL F CG1 1 
ATOM   8887  C CG2 . VAL F  2 129 ? 43.351  25.946  -12.914 1.00 49.97  ? 125 VAL F CG2 1 
ATOM   8888  N N   . THR F  2 130 ? 44.761  22.410  -10.259 1.00 55.90  ? 126 THR F N   1 
ATOM   8889  C CA  . THR F  2 130 ? 45.579  21.745  -9.255  1.00 57.86  ? 126 THR F CA  1 
ATOM   8890  C C   . THR F  2 130 ? 46.779  21.122  -9.950  1.00 57.55  ? 126 THR F C   1 
ATOM   8891  O O   . THR F  2 130 ? 46.669  20.665  -11.082 1.00 57.88  ? 126 THR F O   1 
ATOM   8892  C CB  . THR F  2 130 ? 44.785  20.631  -8.543  1.00 58.45  ? 126 THR F CB  1 
ATOM   8893  O OG1 . THR F  2 130 ? 43.697  21.211  -7.814  1.00 61.15  ? 126 THR F OG1 1 
ATOM   8894  C CG2 . THR F  2 130 ? 45.678  19.865  -7.580  1.00 60.50  ? 126 THR F CG2 1 
ATOM   8895  N N   . VAL F  2 131 ? 47.922  21.106  -9.277  1.00 58.01  ? 127 VAL F N   1 
ATOM   8896  C CA  . VAL F  2 131 ? 49.131  20.535  -9.852  1.00 59.78  ? 127 VAL F CA  1 
ATOM   8897  C C   . VAL F  2 131 ? 49.692  19.435  -8.965  1.00 61.49  ? 127 VAL F C   1 
ATOM   8898  O O   . VAL F  2 131 ? 49.646  19.526  -7.740  1.00 62.38  ? 127 VAL F O   1 
ATOM   8899  C CB  . VAL F  2 131 ? 50.212  21.613  -10.047 1.00 58.28  ? 127 VAL F CB  1 
ATOM   8900  C CG1 . VAL F  2 131 ? 51.457  20.994  -10.643 1.00 56.89  ? 127 VAL F CG1 1 
ATOM   8901  C CG2 . VAL F  2 131 ? 49.684  22.722  -10.946 1.00 57.20  ? 127 VAL F CG2 1 
ATOM   8902  N N   . TYR F  2 132 ? 50.224  18.394  -9.589  1.00 64.83  ? 128 TYR F N   1 
ATOM   8903  C CA  . TYR F  2 132 ? 50.797  17.276  -8.855  1.00 68.37  ? 128 TYR F CA  1 
ATOM   8904  C C   . TYR F  2 132 ? 51.600  16.351  -9.772  1.00 71.19  ? 128 TYR F C   1 
ATOM   8905  O O   . TYR F  2 132 ? 51.384  16.315  -10.984 1.00 70.51  ? 128 TYR F O   1 
ATOM   8906  C CB  . TYR F  2 132 ? 49.686  16.488  -8.164  1.00 67.72  ? 128 TYR F CB  1 
ATOM   8907  C CG  . TYR F  2 132 ? 48.694  15.859  -9.114  1.00 67.65  ? 128 TYR F CG  1 
ATOM   8908  C CD1 . TYR F  2 132 ? 48.970  14.644  -9.739  1.00 67.51  ? 128 TYR F CD1 1 
ATOM   8909  C CD2 . TYR F  2 132 ? 47.487  16.487  -9.403  1.00 67.76  ? 128 TYR F CD2 1 
ATOM   8910  C CE1 . TYR F  2 132 ? 48.067  14.068  -10.629 1.00 67.97  ? 128 TYR F CE1 1 
ATOM   8911  C CE2 . TYR F  2 132 ? 46.576  15.923  -10.291 1.00 68.55  ? 128 TYR F CE2 1 
ATOM   8912  C CZ  . TYR F  2 132 ? 46.871  14.713  -10.900 1.00 68.35  ? 128 TYR F CZ  1 
ATOM   8913  O OH  . TYR F  2 132 ? 45.965  14.149  -11.768 1.00 66.86  ? 128 TYR F OH  1 
ATOM   8914  N N   . PRO F  2 133 ? 52.547  15.596  -9.196  1.00 74.23  ? 129 PRO F N   1 
ATOM   8915  C CA  . PRO F  2 133 ? 53.399  14.662  -9.935  1.00 77.30  ? 129 PRO F CA  1 
ATOM   8916  C C   . PRO F  2 133 ? 52.853  13.238  -9.871  1.00 79.90  ? 129 PRO F C   1 
ATOM   8917  O O   . PRO F  2 133 ? 52.108  12.897  -8.952  1.00 79.46  ? 129 PRO F O   1 
ATOM   8918  C CB  . PRO F  2 133 ? 54.721  14.784  -9.208  1.00 76.11  ? 129 PRO F CB  1 
ATOM   8919  C CG  . PRO F  2 133 ? 54.254  14.837  -7.780  1.00 76.10  ? 129 PRO F CG  1 
ATOM   8920  C CD  . PRO F  2 133 ? 53.064  15.792  -7.828  1.00 74.54  ? 129 PRO F CD  1 
ATOM   8921  N N   . THR F  2 134 ? 53.236  12.412  -10.842 1.00 83.42  ? 130 THR F N   1 
ATOM   8922  C CA  . THR F  2 134 ? 52.792  11.023  -10.883 1.00 87.47  ? 130 THR F CA  1 
ATOM   8923  C C   . THR F  2 134 ? 53.911  10.044  -11.236 1.00 90.14  ? 130 THR F C   1 
ATOM   8924  O O   . THR F  2 134 ? 54.891  10.408  -11.893 1.00 89.61  ? 130 THR F O   1 
ATOM   8925  C CB  . THR F  2 134 ? 51.629  10.827  -11.879 1.00 85.95  ? 130 THR F CB  1 
ATOM   8926  O OG1 . THR F  2 134 ? 51.913  11.522  -13.100 1.00 85.86  ? 130 THR F OG1 1 
ATOM   8927  C CG2 . THR F  2 134 ? 50.334  11.338  -11.282 1.00 85.86  ? 130 THR F CG2 1 
ATOM   8928  N N   . LYS F  2 135 ? 53.735  8.801   -10.782 1.00 93.74  ? 131 LYS F N   1 
ATOM   8929  C CA  . LYS F  2 135 ? 54.671  7.695   -10.989 1.00 97.11  ? 131 LYS F CA  1 
ATOM   8930  C C   . LYS F  2 135 ? 55.825  7.720   -9.988  1.00 100.32 ? 131 LYS F C   1 
ATOM   8931  O O   . LYS F  2 135 ? 56.969  8.011   -10.347 1.00 101.44 ? 131 LYS F O   1 
ATOM   8932  C CB  . LYS F  2 135 ? 55.219  7.703   -12.421 1.00 96.51  ? 131 LYS F CB  1 
ATOM   8933  C CG  . LYS F  2 135 ? 54.176  7.451   -13.497 1.00 95.37  ? 131 LYS F CG  1 
ATOM   8934  C CD  . LYS F  2 135 ? 54.817  7.452   -14.870 1.00 95.21  ? 131 LYS F CD  1 
ATOM   8935  C CE  . LYS F  2 135 ? 53.786  7.350   -15.972 1.00 94.27  ? 131 LYS F CE  1 
ATOM   8936  N NZ  . LYS F  2 135 ? 54.430  7.455   -17.309 1.00 94.27  ? 131 LYS F NZ  1 
ATOM   8937  N N   . THR F  2 136 ? 55.513  7.408   -8.731  1.00 103.45 ? 132 THR F N   1 
ATOM   8938  C CA  . THR F  2 136 ? 56.508  7.385   -7.660  1.00 106.32 ? 132 THR F CA  1 
ATOM   8939  C C   . THR F  2 136 ? 56.334  6.134   -6.798  1.00 108.39 ? 132 THR F C   1 
ATOM   8940  O O   . THR F  2 136 ? 55.239  5.867   -6.293  1.00 108.91 ? 132 THR F O   1 
ATOM   8941  C CB  . THR F  2 136 ? 56.382  8.641   -6.799  1.00 106.24 ? 132 THR F CB  1 
ATOM   8942  N N   . GLN F  2 137 ? 57.423  5.380   -6.637  1.00 110.47 ? 133 GLN F N   1 
ATOM   8943  C CA  . GLN F  2 137 ? 57.444  4.140   -5.855  1.00 111.90 ? 133 GLN F CA  1 
ATOM   8944  C C   . GLN F  2 137 ? 56.817  2.973   -6.626  1.00 112.69 ? 133 GLN F C   1 
ATOM   8945  O O   . GLN F  2 137 ? 56.611  1.893   -6.067  1.00 112.92 ? 133 GLN F O   1 
ATOM   8946  C CB  . GLN F  2 137 ? 56.724  4.336   -4.509  1.00 111.59 ? 133 GLN F CB  1 
ATOM   8947  N N   . PRO F  2 138 ? 56.523  3.197   -7.908  1.00 113.25 ? 134 PRO F N   1 
ATOM   8948  C CA  . PRO F  2 138 ? 55.919  2.174   -8.766  1.00 113.31 ? 134 PRO F CA  1 
ATOM   8949  C C   . PRO F  2 138 ? 55.946  2.548   -10.257 1.00 113.13 ? 134 PRO F C   1 
ATOM   8950  O O   . PRO F  2 138 ? 54.901  2.820   -10.854 1.00 113.01 ? 134 PRO F O   1 
ATOM   8951  C CB  . PRO F  2 138 ? 54.480  1.909   -8.322  1.00 113.50 ? 134 PRO F CB  1 
ATOM   8952  N N   . LEU F  2 139 ? 57.145  2.546   -10.842 1.00 112.84 ? 135 LEU F N   1 
ATOM   8953  C CA  . LEU F  2 139 ? 57.363  2.874   -12.256 1.00 112.02 ? 135 LEU F CA  1 
ATOM   8954  C C   . LEU F  2 139 ? 58.823  3.282   -12.475 1.00 110.95 ? 135 LEU F C   1 
ATOM   8955  O O   . LEU F  2 139 ? 59.463  3.835   -11.577 1.00 110.74 ? 135 LEU F O   1 
ATOM   8956  C CB  . LEU F  2 139 ? 56.432  4.015   -12.699 1.00 112.36 ? 135 LEU F CB  1 
ATOM   8957  N N   . GLU F  2 140 ? 59.346  3.013   -13.669 1.00 109.37 ? 136 GLU F N   1 
ATOM   8958  C CA  . GLU F  2 140 ? 60.730  3.359   -13.993 1.00 107.56 ? 136 GLU F CA  1 
ATOM   8959  C C   . GLU F  2 140 ? 60.881  3.812   -15.447 1.00 106.15 ? 136 GLU F C   1 
ATOM   8960  O O   . GLU F  2 140 ? 60.980  2.984   -16.355 1.00 106.49 ? 136 GLU F O   1 
ATOM   8961  C CB  . GLU F  2 140 ? 61.647  2.163   -13.718 1.00 107.19 ? 136 GLU F CB  1 
ATOM   8962  N N   . HIS F  2 141 ? 60.899  5.128   -15.658 1.00 103.81 ? 137 HIS F N   1 
ATOM   8963  C CA  . HIS F  2 141 ? 61.041  5.701   -16.999 1.00 100.92 ? 137 HIS F CA  1 
ATOM   8964  C C   . HIS F  2 141 ? 61.216  7.224   -16.949 1.00 98.48  ? 137 HIS F C   1 
ATOM   8965  O O   . HIS F  2 141 ? 62.301  7.743   -17.224 1.00 98.76  ? 137 HIS F O   1 
ATOM   8966  C CB  . HIS F  2 141 ? 59.823  5.338   -17.859 1.00 101.35 ? 137 HIS F CB  1 
ATOM   8967  N N   . HIS F  2 142 ? 60.146  7.937   -16.603 1.00 94.52  ? 138 HIS F N   1 
ATOM   8968  C CA  . HIS F  2 142 ? 60.192  9.395   -16.518 1.00 90.09  ? 138 HIS F CA  1 
ATOM   8969  C C   . HIS F  2 142 ? 59.017  9.969   -15.715 1.00 86.74  ? 138 HIS F C   1 
ATOM   8970  O O   . HIS F  2 142 ? 57.848  9.704   -16.014 1.00 86.36  ? 138 HIS F O   1 
ATOM   8971  C CB  . HIS F  2 142 ? 60.212  9.999   -17.926 1.00 89.75  ? 138 HIS F CB  1 
ATOM   8972  N N   . ASN F  2 143 ? 59.332  10.749  -14.686 1.00 81.81  ? 139 ASN F N   1 
ATOM   8973  C CA  . ASN F  2 143 ? 58.297  11.358  -13.872 1.00 76.59  ? 139 ASN F CA  1 
ATOM   8974  C C   . ASN F  2 143 ? 57.442  12.226  -14.778 1.00 73.19  ? 139 ASN F C   1 
ATOM   8975  O O   . ASN F  2 143 ? 57.800  12.480  -15.929 1.00 71.32  ? 139 ASN F O   1 
ATOM   8976  C CB  . ASN F  2 143 ? 58.908  12.205  -12.752 1.00 77.18  ? 139 ASN F CB  1 
ATOM   8977  C CG  . ASN F  2 143 ? 58.933  11.479  -11.419 1.00 77.88  ? 139 ASN F CG  1 
ATOM   8978  O OD1 . ASN F  2 143 ? 59.238  12.067  -10.387 1.00 78.39  ? 139 ASN F OD1 1 
ATOM   8979  N ND2 . ASN F  2 143 ? 58.609  10.192  -11.438 1.00 79.29  ? 139 ASN F ND2 1 
ATOM   8980  N N   . LEU F  2 144 ? 56.313  12.684  -14.252 1.00 70.07  ? 140 LEU F N   1 
ATOM   8981  C CA  . LEU F  2 144 ? 55.392  13.507  -15.023 1.00 67.16  ? 140 LEU F CA  1 
ATOM   8982  C C   . LEU F  2 144 ? 54.684  14.513  -14.116 1.00 63.08  ? 140 LEU F C   1 
ATOM   8983  O O   . LEU F  2 144 ? 54.220  14.170  -13.029 1.00 62.85  ? 140 LEU F O   1 
ATOM   8984  C CB  . LEU F  2 144 ? 54.366  12.596  -15.705 1.00 66.86  ? 140 LEU F CB  1 
ATOM   8985  C CG  . LEU F  2 144 ? 53.477  13.172  -16.803 1.00 68.00  ? 140 LEU F CG  1 
ATOM   8986  C CD1 . LEU F  2 144 ? 54.338  13.675  -17.944 1.00 67.28  ? 140 LEU F CD1 1 
ATOM   8987  C CD2 . LEU F  2 144 ? 52.523  12.090  -17.297 1.00 68.65  ? 140 LEU F CD2 1 
ATOM   8988  N N   . LEU F  2 145 ? 54.606  15.758  -14.560 1.00 58.91  ? 141 LEU F N   1 
ATOM   8989  C CA  . LEU F  2 145 ? 53.945  16.787  -13.775 1.00 56.19  ? 141 LEU F CA  1 
ATOM   8990  C C   . LEU F  2 145 ? 52.543  17.004  -14.352 1.00 54.33  ? 141 LEU F C   1 
ATOM   8991  O O   . LEU F  2 145 ? 52.393  17.385  -15.514 1.00 53.79  ? 141 LEU F O   1 
ATOM   8992  C CB  . LEU F  2 145 ? 54.762  18.075  -13.829 1.00 53.76  ? 141 LEU F CB  1 
ATOM   8993  C CG  . LEU F  2 145 ? 54.587  19.002  -12.630 1.00 54.17  ? 141 LEU F CG  1 
ATOM   8994  C CD1 . LEU F  2 145 ? 54.715  18.201  -11.343 1.00 52.18  ? 141 LEU F CD1 1 
ATOM   8995  C CD2 . LEU F  2 145 ? 55.629  20.109  -12.691 1.00 53.04  ? 141 LEU F CD2 1 
ATOM   8996  N N   . VAL F  2 146 ? 51.516  16.751  -13.548 1.00 51.43  ? 142 VAL F N   1 
ATOM   8997  C CA  . VAL F  2 146 ? 50.146  16.895  -14.025 1.00 49.65  ? 142 VAL F CA  1 
ATOM   8998  C C   . VAL F  2 146 ? 49.444  18.198  -13.650 1.00 48.69  ? 142 VAL F C   1 
ATOM   8999  O O   . VAL F  2 146 ? 49.397  18.585  -12.480 1.00 45.71  ? 142 VAL F O   1 
ATOM   9000  C CB  . VAL F  2 146 ? 49.248  15.723  -13.528 1.00 48.20  ? 142 VAL F CB  1 
ATOM   9001  C CG1 . VAL F  2 146 ? 47.820  15.931  -13.984 1.00 47.07  ? 142 VAL F CG1 1 
ATOM   9002  C CG2 . VAL F  2 146 ? 49.766  14.402  -14.052 1.00 47.79  ? 142 VAL F CG2 1 
ATOM   9003  N N   . CYS F  2 147 ? 48.907  18.877  -14.656 1.00 47.98  ? 143 CYS F N   1 
ATOM   9004  C CA  . CYS F  2 147 ? 48.148  20.087  -14.400 1.00 49.55  ? 143 CYS F CA  1 
ATOM   9005  C C   . CYS F  2 147 ? 46.672  19.774  -14.655 1.00 47.95  ? 143 CYS F C   1 
ATOM   9006  O O   . CYS F  2 147 ? 46.213  19.775  -15.802 1.00 46.64  ? 143 CYS F O   1 
ATOM   9007  C CB  . CYS F  2 147 ? 48.570  21.234  -15.306 1.00 51.65  ? 143 CYS F CB  1 
ATOM   9008  S SG  . CYS F  2 147 ? 47.630  22.740  -14.905 1.00 55.42  ? 143 CYS F SG  1 
ATOM   9009  N N   . SER F  2 148 ? 45.948  19.506  -13.573 1.00 46.27  ? 144 SER F N   1 
ATOM   9010  C CA  . SER F  2 148 ? 44.527  19.175  -13.615 1.00 45.47  ? 144 SER F CA  1 
ATOM   9011  C C   . SER F  2 148 ? 43.604  20.396  -13.636 1.00 44.81  ? 144 SER F C   1 
ATOM   9012  O O   . SER F  2 148 ? 43.611  21.214  -12.719 1.00 47.15  ? 144 SER F O   1 
ATOM   9013  C CB  . SER F  2 148 ? 44.181  18.302  -12.411 1.00 43.71  ? 144 SER F CB  1 
ATOM   9014  O OG  . SER F  2 148 ? 42.796  18.026  -12.347 1.00 47.52  ? 144 SER F OG  1 
ATOM   9015  N N   . VAL F  2 149 ? 42.802  20.508  -14.685 1.00 44.04  ? 145 VAL F N   1 
ATOM   9016  C CA  . VAL F  2 149 ? 41.854  21.609  -14.824 1.00 43.78  ? 145 VAL F CA  1 
ATOM   9017  C C   . VAL F  2 149 ? 40.445  21.011  -14.904 1.00 43.88  ? 145 VAL F C   1 
ATOM   9018  O O   . VAL F  2 149 ? 40.056  20.475  -15.941 1.00 44.41  ? 145 VAL F O   1 
ATOM   9019  C CB  . VAL F  2 149 ? 42.123  22.420  -16.116 1.00 41.49  ? 145 VAL F CB  1 
ATOM   9020  C CG1 . VAL F  2 149 ? 41.249  23.642  -16.138 1.00 39.71  ? 145 VAL F CG1 1 
ATOM   9021  C CG2 . VAL F  2 149 ? 43.587  22.802  -16.207 1.00 39.57  ? 145 VAL F CG2 1 
ATOM   9022  N N   . SER F  2 150 ? 39.673  21.092  -13.826 1.00 43.04  ? 146 SER F N   1 
ATOM   9023  C CA  . SER F  2 150 ? 38.341  20.515  -13.877 1.00 42.57  ? 146 SER F CA  1 
ATOM   9024  C C   . SER F  2 150 ? 37.193  21.460  -13.563 1.00 43.67  ? 146 SER F C   1 
ATOM   9025  O O   . SER F  2 150 ? 37.375  22.484  -12.905 1.00 44.80  ? 146 SER F O   1 
ATOM   9026  C CB  . SER F  2 150 ? 38.262  19.288  -12.956 1.00 43.19  ? 146 SER F CB  1 
ATOM   9027  O OG  . SER F  2 150 ? 38.444  19.640  -11.604 1.00 39.79  ? 146 SER F OG  1 
ATOM   9028  N N   . ASP F  2 151 ? 36.011  21.107  -14.066 1.00 43.83  ? 147 ASP F N   1 
ATOM   9029  C CA  . ASP F  2 151 ? 34.788  21.871  -13.832 1.00 45.31  ? 147 ASP F CA  1 
ATOM   9030  C C   . ASP F  2 151 ? 34.711  23.254  -14.457 1.00 44.07  ? 147 ASP F C   1 
ATOM   9031  O O   . ASP F  2 151 ? 34.373  24.213  -13.774 1.00 44.02  ? 147 ASP F O   1 
ATOM   9032  C CB  . ASP F  2 151 ? 34.548  22.012  -12.330 1.00 48.95  ? 147 ASP F CB  1 
ATOM   9033  C CG  . ASP F  2 151 ? 33.301  21.300  -11.880 1.00 55.70  ? 147 ASP F CG  1 
ATOM   9034  O OD1 . ASP F  2 151 ? 33.276  20.049  -11.947 1.00 60.51  ? 147 ASP F OD1 1 
ATOM   9035  O OD2 . ASP F  2 151 ? 32.338  21.989  -11.474 1.00 59.01  ? 147 ASP F OD2 1 
ATOM   9036  N N   . PHE F  2 152 ? 35.006  23.370  -15.744 1.00 41.71  ? 148 PHE F N   1 
ATOM   9037  C CA  . PHE F  2 152 ? 34.941  24.673  -16.387 1.00 41.17  ? 148 PHE F CA  1 
ATOM   9038  C C   . PHE F  2 152 ? 34.008  24.679  -17.590 1.00 41.68  ? 148 PHE F C   1 
ATOM   9039  O O   . PHE F  2 152 ? 33.687  23.629  -18.138 1.00 41.94  ? 148 PHE F O   1 
ATOM   9040  C CB  . PHE F  2 152 ? 36.349  25.138  -16.790 1.00 40.96  ? 148 PHE F CB  1 
ATOM   9041  C CG  . PHE F  2 152 ? 37.109  24.155  -17.640 1.00 41.61  ? 148 PHE F CG  1 
ATOM   9042  C CD1 . PHE F  2 152 ? 37.042  24.213  -19.029 1.00 41.64  ? 148 PHE F CD1 1 
ATOM   9043  C CD2 . PHE F  2 152 ? 37.896  23.168  -17.051 1.00 41.90  ? 148 PHE F CD2 1 
ATOM   9044  C CE1 . PHE F  2 152 ? 37.750  23.306  -19.822 1.00 39.30  ? 148 PHE F CE1 1 
ATOM   9045  C CE2 . PHE F  2 152 ? 38.604  22.259  -17.834 1.00 39.66  ? 148 PHE F CE2 1 
ATOM   9046  C CZ  . PHE F  2 152 ? 38.530  22.331  -19.224 1.00 38.14  ? 148 PHE F CZ  1 
ATOM   9047  N N   . TYR F  2 153 ? 33.561  25.867  -17.983 1.00 41.51  ? 149 TYR F N   1 
ATOM   9048  C CA  . TYR F  2 153 ? 32.662  26.016  -19.124 1.00 41.26  ? 149 TYR F CA  1 
ATOM   9049  C C   . TYR F  2 153 ? 32.729  27.471  -19.600 1.00 40.86  ? 149 TYR F C   1 
ATOM   9050  O O   . TYR F  2 153 ? 32.768  28.381  -18.785 1.00 43.39  ? 149 TYR F O   1 
ATOM   9051  C CB  . TYR F  2 153 ? 31.221  25.631  -18.719 1.00 39.61  ? 149 TYR F CB  1 
ATOM   9052  C CG  . TYR F  2 153 ? 30.266  25.559  -19.897 1.00 41.14  ? 149 TYR F CG  1 
ATOM   9053  C CD1 . TYR F  2 153 ? 29.884  26.716  -20.579 1.00 41.42  ? 149 TYR F CD1 1 
ATOM   9054  C CD2 . TYR F  2 153 ? 29.836  24.330  -20.405 1.00 41.35  ? 149 TYR F CD2 1 
ATOM   9055  C CE1 . TYR F  2 153 ? 29.122  26.657  -21.732 1.00 41.44  ? 149 TYR F CE1 1 
ATOM   9056  C CE2 . TYR F  2 153 ? 29.063  24.261  -21.567 1.00 40.93  ? 149 TYR F CE2 1 
ATOM   9057  C CZ  . TYR F  2 153 ? 28.715  25.431  -22.224 1.00 42.05  ? 149 TYR F CZ  1 
ATOM   9058  O OH  . TYR F  2 153 ? 27.966  25.395  -23.378 1.00 43.41  ? 149 TYR F OH  1 
ATOM   9059  N N   . PRO F  2 154 ? 32.746  27.713  -20.920 1.00 41.47  ? 150 PRO F N   1 
ATOM   9060  C CA  . PRO F  2 154 ? 32.718  26.780  -22.055 1.00 43.17  ? 150 PRO F CA  1 
ATOM   9061  C C   . PRO F  2 154 ? 33.939  25.860  -22.179 1.00 44.85  ? 150 PRO F C   1 
ATOM   9062  O O   . PRO F  2 154 ? 34.774  25.808  -21.279 1.00 45.94  ? 150 PRO F O   1 
ATOM   9063  C CB  . PRO F  2 154 ? 32.531  27.710  -23.265 1.00 42.25  ? 150 PRO F CB  1 
ATOM   9064  C CG  . PRO F  2 154 ? 33.162  28.970  -22.830 1.00 41.14  ? 150 PRO F CG  1 
ATOM   9065  C CD  . PRO F  2 154 ? 32.711  29.106  -21.395 1.00 40.76  ? 150 PRO F CD  1 
ATOM   9066  N N   . GLY F  2 155 ? 34.035  25.146  -23.298 1.00 46.13  ? 151 GLY F N   1 
ATOM   9067  C CA  . GLY F  2 155 ? 35.128  24.209  -23.506 1.00 48.85  ? 151 GLY F CA  1 
ATOM   9068  C C   . GLY F  2 155 ? 36.513  24.711  -23.887 1.00 50.86  ? 151 GLY F C   1 
ATOM   9069  O O   . GLY F  2 155 ? 37.516  24.140  -23.454 1.00 50.25  ? 151 GLY F O   1 
ATOM   9070  N N   . ASN F  2 156 ? 36.585  25.758  -24.702 1.00 53.57  ? 152 ASN F N   1 
ATOM   9071  C CA  . ASN F  2 156 ? 37.872  26.305  -25.127 1.00 54.97  ? 152 ASN F CA  1 
ATOM   9072  C C   . ASN F  2 156 ? 38.679  26.800  -23.936 1.00 55.41  ? 152 ASN F C   1 
ATOM   9073  O O   . ASN F  2 156 ? 38.243  27.681  -23.199 1.00 55.32  ? 152 ASN F O   1 
ATOM   9074  C CB  . ASN F  2 156 ? 37.652  27.443  -26.118 1.00 57.74  ? 152 ASN F CB  1 
ATOM   9075  C CG  . ASN F  2 156 ? 36.567  28.394  -25.671 1.00 60.66  ? 152 ASN F CG  1 
ATOM   9076  O OD1 . ASN F  2 156 ? 35.405  28.001  -25.490 1.00 62.40  ? 152 ASN F OD1 1 
ATOM   9077  N ND2 . ASN F  2 156 ? 36.934  29.655  -25.484 1.00 62.14  ? 152 ASN F ND2 1 
ATOM   9078  N N   . ILE F  2 157 ? 39.862  26.229  -23.753 1.00 54.93  ? 153 ILE F N   1 
ATOM   9079  C CA  . ILE F  2 157 ? 40.713  26.601  -22.638 1.00 54.86  ? 153 ILE F CA  1 
ATOM   9080  C C   . ILE F  2 157 ? 42.172  26.508  -23.070 1.00 56.96  ? 153 ILE F C   1 
ATOM   9081  O O   . ILE F  2 157 ? 42.509  25.730  -23.964 1.00 57.16  ? 153 ILE F O   1 
ATOM   9082  C CB  . ILE F  2 157 ? 40.459  25.659  -21.437 1.00 53.62  ? 153 ILE F CB  1 
ATOM   9083  C CG1 . ILE F  2 157 ? 40.928  26.312  -20.145 1.00 53.40  ? 153 ILE F CG1 1 
ATOM   9084  C CG2 . ILE F  2 157 ? 41.189  24.335  -21.631 1.00 50.75  ? 153 ILE F CG2 1 
ATOM   9085  C CD1 . ILE F  2 157 ? 40.542  25.524  -18.917 1.00 55.31  ? 153 ILE F CD1 1 
ATOM   9086  N N   . GLU F  2 158 ? 43.037  27.306  -22.450 1.00 57.65  ? 154 GLU F N   1 
ATOM   9087  C CA  . GLU F  2 158 ? 44.458  27.277  -22.787 1.00 59.10  ? 154 GLU F CA  1 
ATOM   9088  C C   . GLU F  2 158 ? 45.303  27.065  -21.547 1.00 58.72  ? 154 GLU F C   1 
ATOM   9089  O O   . GLU F  2 158 ? 45.185  27.796  -20.567 1.00 58.02  ? 154 GLU F O   1 
ATOM   9090  C CB  . GLU F  2 158 ? 44.876  28.569  -23.479 1.00 61.13  ? 154 GLU F CB  1 
ATOM   9091  C CG  . GLU F  2 158 ? 45.721  28.329  -24.714 1.00 65.26  ? 154 GLU F CG  1 
ATOM   9092  C CD  . GLU F  2 158 ? 45.937  29.592  -25.536 1.00 69.41  ? 154 GLU F CD  1 
ATOM   9093  O OE1 . GLU F  2 158 ? 44.928  30.242  -25.907 1.00 68.74  ? 154 GLU F OE1 1 
ATOM   9094  O OE2 . GLU F  2 158 ? 47.116  29.930  -25.811 1.00 70.58  ? 154 GLU F OE2 1 
ATOM   9095  N N   . VAL F  2 159 ? 46.149  26.046  -21.593 1.00 59.31  ? 155 VAL F N   1 
ATOM   9096  C CA  . VAL F  2 159 ? 47.017  25.723  -20.474 1.00 59.72  ? 155 VAL F CA  1 
ATOM   9097  C C   . VAL F  2 159 ? 48.463  25.739  -20.943 1.00 60.07  ? 155 VAL F C   1 
ATOM   9098  O O   . VAL F  2 159 ? 48.782  25.209  -22.002 1.00 58.95  ? 155 VAL F O   1 
ATOM   9099  C CB  . VAL F  2 159 ? 46.693  24.331  -19.904 1.00 60.49  ? 155 VAL F CB  1 
ATOM   9100  C CG1 . VAL F  2 159 ? 47.549  24.060  -18.679 1.00 61.67  ? 155 VAL F CG1 1 
ATOM   9101  C CG2 . VAL F  2 159 ? 45.212  24.244  -19.552 1.00 60.58  ? 155 VAL F CG2 1 
ATOM   9102  N N   . ARG F  2 160 ? 49.325  26.366  -20.150 1.00 61.58  ? 156 ARG F N   1 
ATOM   9103  C CA  . ARG F  2 160 ? 50.746  26.465  -20.458 1.00 63.09  ? 156 ARG F CA  1 
ATOM   9104  C C   . ARG F  2 160 ? 51.570  26.113  -19.231 1.00 62.80  ? 156 ARG F C   1 
ATOM   9105  O O   . ARG F  2 160 ? 51.171  26.397  -18.105 1.00 62.59  ? 156 ARG F O   1 
ATOM   9106  C CB  . ARG F  2 160 ? 51.103  27.881  -20.893 1.00 63.63  ? 156 ARG F CB  1 
ATOM   9107  C CG  . ARG F  2 160 ? 50.632  28.271  -22.271 1.00 67.32  ? 156 ARG F CG  1 
ATOM   9108  C CD  . ARG F  2 160 ? 51.029  29.714  -22.549 1.00 70.51  ? 156 ARG F CD  1 
ATOM   9109  N NE  . ARG F  2 160 ? 50.847  30.087  -23.949 1.00 75.01  ? 156 ARG F NE  1 
ATOM   9110  C CZ  . ARG F  2 160 ? 51.249  31.245  -24.468 1.00 78.16  ? 156 ARG F CZ  1 
ATOM   9111  N NH1 . ARG F  2 160 ? 51.856  32.144  -23.695 1.00 79.58  ? 156 ARG F NH1 1 
ATOM   9112  N NH2 . ARG F  2 160 ? 51.051  31.507  -25.758 1.00 78.11  ? 156 ARG F NH2 1 
ATOM   9113  N N   . TRP F  2 161 ? 52.723  25.496  -19.455 1.00 62.61  ? 157 TRP F N   1 
ATOM   9114  C CA  . TRP F  2 161 ? 53.613  25.116  -18.368 1.00 63.26  ? 157 TRP F CA  1 
ATOM   9115  C C   . TRP F  2 161 ? 54.837  26.024  -18.324 1.00 65.93  ? 157 TRP F C   1 
ATOM   9116  O O   . TRP F  2 161 ? 55.302  26.512  -19.354 1.00 66.17  ? 157 TRP F O   1 
ATOM   9117  C CB  . TRP F  2 161 ? 54.074  23.673  -18.539 1.00 59.26  ? 157 TRP F CB  1 
ATOM   9118  C CG  . TRP F  2 161 ? 53.172  22.664  -17.929 1.00 55.33  ? 157 TRP F CG  1 
ATOM   9119  C CD1 . TRP F  2 161 ? 52.331  21.812  -18.581 1.00 52.43  ? 157 TRP F CD1 1 
ATOM   9120  C CD2 . TRP F  2 161 ? 53.066  22.351  -16.537 1.00 53.03  ? 157 TRP F CD2 1 
ATOM   9121  N NE1 . TRP F  2 161 ? 51.712  20.978  -17.678 1.00 51.49  ? 157 TRP F NE1 1 
ATOM   9122  C CE2 . TRP F  2 161 ? 52.146  21.288  -16.417 1.00 51.58  ? 157 TRP F CE2 1 
ATOM   9123  C CE3 . TRP F  2 161 ? 53.666  22.864  -15.378 1.00 54.85  ? 157 TRP F CE3 1 
ATOM   9124  C CZ2 . TRP F  2 161 ? 51.809  20.722  -15.183 1.00 53.09  ? 157 TRP F CZ2 1 
ATOM   9125  C CZ3 . TRP F  2 161 ? 53.332  22.301  -14.145 1.00 55.69  ? 157 TRP F CZ3 1 
ATOM   9126  C CH2 . TRP F  2 161 ? 52.409  21.238  -14.061 1.00 55.00  ? 157 TRP F CH2 1 
ATOM   9127  N N   . PHE F  2 162 ? 55.366  26.246  -17.125 1.00 69.27  ? 158 PHE F N   1 
ATOM   9128  C CA  . PHE F  2 162 ? 56.540  27.093  -16.970 1.00 71.31  ? 158 PHE F CA  1 
ATOM   9129  C C   . PHE F  2 162 ? 57.566  26.501  -16.023 1.00 71.75  ? 158 PHE F C   1 
ATOM   9130  O O   . PHE F  2 162 ? 57.222  25.986  -14.962 1.00 70.75  ? 158 PHE F O   1 
ATOM   9131  C CB  . PHE F  2 162 ? 56.145  28.487  -16.466 1.00 70.86  ? 158 PHE F CB  1 
ATOM   9132  C CG  . PHE F  2 162 ? 55.397  29.309  -17.476 1.00 71.16  ? 158 PHE F CG  1 
ATOM   9133  C CD1 . PHE F  2 162 ? 54.025  29.150  -17.649 1.00 72.44  ? 158 PHE F CD1 1 
ATOM   9134  C CD2 . PHE F  2 162 ? 56.066  30.235  -18.265 1.00 70.76  ? 158 PHE F CD2 1 
ATOM   9135  C CE1 . PHE F  2 162 ? 53.330  29.904  -18.600 1.00 71.98  ? 158 PHE F CE1 1 
ATOM   9136  C CE2 . PHE F  2 162 ? 55.386  30.993  -19.216 1.00 71.36  ? 158 PHE F CE2 1 
ATOM   9137  C CZ  . PHE F  2 162 ? 54.014  30.828  -19.384 1.00 72.08  ? 158 PHE F CZ  1 
ATOM   9138  N N   . ARG F  2 163 ? 58.830  26.566  -16.430 1.00 74.78  ? 159 ARG F N   1 
ATOM   9139  C CA  . ARG F  2 163 ? 59.931  26.085  -15.607 1.00 77.89  ? 159 ARG F CA  1 
ATOM   9140  C C   . ARG F  2 163 ? 60.816  27.292  -15.299 1.00 79.09  ? 159 ARG F C   1 
ATOM   9141  O O   . ARG F  2 163 ? 61.291  27.970  -16.214 1.00 78.59  ? 159 ARG F O   1 
ATOM   9142  C CB  . ARG F  2 163 ? 60.762  25.024  -16.332 1.00 77.80  ? 159 ARG F CB  1 
ATOM   9143  C CG  . ARG F  2 163 ? 61.994  24.618  -15.526 1.00 79.43  ? 159 ARG F CG  1 
ATOM   9144  C CD  . ARG F  2 163 ? 63.025  23.840  -16.327 1.00 80.43  ? 159 ARG F CD  1 
ATOM   9145  N NE  . ARG F  2 163 ? 62.891  22.397  -16.158 1.00 81.77  ? 159 ARG F NE  1 
ATOM   9146  C CZ  . ARG F  2 163 ? 62.009  21.639  -16.803 1.00 83.04  ? 159 ARG F CZ  1 
ATOM   9147  N NH1 . ARG F  2 163 ? 61.171  22.184  -17.676 1.00 83.84  ? 159 ARG F NH1 1 
ATOM   9148  N NH2 . ARG F  2 163 ? 61.965  20.333  -16.572 1.00 83.49  ? 159 ARG F NH2 1 
ATOM   9149  N N   . ASN F  2 164 ? 61.017  27.557  -14.008 1.00 81.17  ? 160 ASN F N   1 
ATOM   9150  C CA  . ASN F  2 164 ? 61.837  28.676  -13.539 1.00 82.84  ? 160 ASN F CA  1 
ATOM   9151  C C   . ASN F  2 164 ? 61.527  29.981  -14.273 1.00 83.76  ? 160 ASN F C   1 
ATOM   9152  O O   . ASN F  2 164 ? 62.423  30.782  -14.543 1.00 83.23  ? 160 ASN F O   1 
ATOM   9153  C CB  . ASN F  2 164 ? 63.332  28.344  -13.683 1.00 81.95  ? 160 ASN F CB  1 
ATOM   9154  C CG  . ASN F  2 164 ? 63.735  27.094  -12.911 1.00 81.34  ? 160 ASN F CG  1 
ATOM   9155  O OD1 . ASN F  2 164 ? 63.446  26.961  -11.717 1.00 80.22  ? 160 ASN F OD1 1 
ATOM   9156  N ND2 . ASN F  2 164 ? 64.415  26.174  -13.591 1.00 79.24  ? 160 ASN F ND2 1 
ATOM   9157  N N   . GLY F  2 165 ? 60.254  30.190  -14.595 1.00 85.00  ? 161 GLY F N   1 
ATOM   9158  C CA  . GLY F  2 165 ? 59.863  31.403  -15.285 1.00 86.74  ? 161 GLY F CA  1 
ATOM   9159  C C   . GLY F  2 165 ? 59.837  31.261  -16.793 1.00 87.69  ? 161 GLY F C   1 
ATOM   9160  O O   . GLY F  2 165 ? 59.113  31.989  -17.475 1.00 87.99  ? 161 GLY F O   1 
ATOM   9161  N N   . LYS F  2 166 ? 60.629  30.334  -17.321 1.00 88.72  ? 162 LYS F N   1 
ATOM   9162  C CA  . LYS F  2 166 ? 60.667  30.116  -18.763 1.00 90.20  ? 162 LYS F CA  1 
ATOM   9163  C C   . LYS F  2 166 ? 59.639  29.056  -19.152 1.00 89.83  ? 162 LYS F C   1 
ATOM   9164  O O   . LYS F  2 166 ? 59.571  27.988  -18.541 1.00 89.75  ? 162 LYS F O   1 
ATOM   9165  C CB  . LYS F  2 166 ? 62.069  29.679  -19.200 1.00 90.68  ? 162 LYS F CB  1 
ATOM   9166  C CG  . LYS F  2 166 ? 62.261  29.558  -20.713 1.00 92.34  ? 162 LYS F CG  1 
ATOM   9167  C CD  . LYS F  2 166 ? 62.135  30.901  -21.445 1.00 93.01  ? 162 LYS F CD  1 
ATOM   9168  C CE  . LYS F  2 166 ? 60.685  31.346  -21.622 1.00 93.00  ? 162 LYS F CE  1 
ATOM   9169  N NZ  . LYS F  2 166 ? 60.577  32.606  -22.410 1.00 93.03  ? 162 LYS F NZ  1 
ATOM   9170  N N   . GLU F  2 167 ? 58.839  29.359  -20.168 1.00 89.60  ? 163 GLU F N   1 
ATOM   9171  C CA  . GLU F  2 167 ? 57.802  28.445  -20.630 1.00 89.89  ? 163 GLU F CA  1 
ATOM   9172  C C   . GLU F  2 167 ? 58.371  27.220  -21.332 1.00 89.20  ? 163 GLU F C   1 
ATOM   9173  O O   . GLU F  2 167 ? 59.467  27.262  -21.891 1.00 89.57  ? 163 GLU F O   1 
ATOM   9174  C CB  . GLU F  2 167 ? 56.845  29.173  -21.585 1.00 89.99  ? 163 GLU F CB  1 
ATOM   9175  C CG  . GLU F  2 167 ? 55.676  28.323  -22.083 1.00 91.02  ? 163 GLU F CG  1 
ATOM   9176  C CD  . GLU F  2 167 ? 54.794  29.049  -23.091 1.00 92.06  ? 163 GLU F CD  1 
ATOM   9177  O OE1 . GLU F  2 167 ? 54.242  30.118  -22.749 1.00 92.42  ? 163 GLU F OE1 1 
ATOM   9178  O OE2 . GLU F  2 167 ? 54.651  28.550  -24.229 1.00 92.35  ? 163 GLU F OE2 1 
ATOM   9179  N N   . GLU F  2 168 ? 57.611  26.132  -21.284 1.00 88.12  ? 164 GLU F N   1 
ATOM   9180  C CA  . GLU F  2 168 ? 57.978  24.880  -21.932 1.00 86.88  ? 164 GLU F CA  1 
ATOM   9181  C C   . GLU F  2 168 ? 57.066  24.728  -23.144 1.00 85.57  ? 164 GLU F C   1 
ATOM   9182  O O   . GLU F  2 168 ? 55.920  25.179  -23.119 1.00 84.89  ? 164 GLU F O   1 
ATOM   9183  C CB  . GLU F  2 168 ? 57.759  23.703  -20.981 1.00 87.41  ? 164 GLU F CB  1 
ATOM   9184  C CG  . GLU F  2 168 ? 58.764  23.607  -19.849 1.00 88.21  ? 164 GLU F CG  1 
ATOM   9185  C CD  . GLU F  2 168 ? 60.156  23.278  -20.342 1.00 88.68  ? 164 GLU F CD  1 
ATOM   9186  O OE1 . GLU F  2 168 ? 60.304  22.269  -21.065 1.00 88.57  ? 164 GLU F OE1 1 
ATOM   9187  O OE2 . GLU F  2 168 ? 61.099  24.025  -20.005 1.00 89.74  ? 164 GLU F OE2 1 
ATOM   9188  N N   . LYS F  2 169 ? 57.566  24.104  -24.204 1.00 84.47  ? 165 LYS F N   1 
ATOM   9189  C CA  . LYS F  2 169 ? 56.756  23.914  -25.400 1.00 83.10  ? 165 LYS F CA  1 
ATOM   9190  C C   . LYS F  2 169 ? 56.984  22.542  -26.027 1.00 81.45  ? 165 LYS F C   1 
ATOM   9191  O O   . LYS F  2 169 ? 56.732  22.342  -27.213 1.00 82.23  ? 165 LYS F O   1 
ATOM   9192  C CB  . LYS F  2 169 ? 57.048  25.016  -26.424 1.00 84.00  ? 165 LYS F CB  1 
ATOM   9193  C CG  . LYS F  2 169 ? 56.012  25.121  -27.544 1.00 84.67  ? 165 LYS F CG  1 
ATOM   9194  C CD  . LYS F  2 169 ? 56.398  26.196  -28.554 1.00 85.82  ? 165 LYS F CD  1 
ATOM   9195  C CE  . LYS F  2 169 ? 55.357  26.340  -29.657 1.00 85.75  ? 165 LYS F CE  1 
ATOM   9196  N NZ  . LYS F  2 169 ? 55.774  27.338  -30.683 1.00 84.47  ? 165 LYS F NZ  1 
ATOM   9197  N N   . THR F  2 170 ? 57.477  21.603  -25.225 1.00 78.73  ? 166 THR F N   1 
ATOM   9198  C CA  . THR F  2 170 ? 57.709  20.236  -25.683 1.00 75.59  ? 166 THR F CA  1 
ATOM   9199  C C   . THR F  2 170 ? 57.601  19.333  -24.465 1.00 73.01  ? 166 THR F C   1 
ATOM   9200  O O   . THR F  2 170 ? 57.804  19.783  -23.336 1.00 72.83  ? 166 THR F O   1 
ATOM   9201  C CB  . THR F  2 170 ? 59.102  20.056  -26.328 1.00 76.58  ? 166 THR F CB  1 
ATOM   9202  O OG1 . THR F  2 170 ? 60.119  20.451  -25.400 1.00 78.14  ? 166 THR F OG1 1 
ATOM   9203  C CG2 . THR F  2 170 ? 59.215  20.882  -27.602 1.00 77.22  ? 166 THR F CG2 1 
ATOM   9204  N N   . GLY F  2 171 ? 57.282  18.063  -24.690 1.00 69.74  ? 167 GLY F N   1 
ATOM   9205  C CA  . GLY F  2 171 ? 57.129  17.144  -23.580 1.00 65.69  ? 167 GLY F CA  1 
ATOM   9206  C C   . GLY F  2 171 ? 55.772  17.393  -22.952 1.00 62.70  ? 167 GLY F C   1 
ATOM   9207  O O   . GLY F  2 171 ? 55.530  17.046  -21.796 1.00 61.92  ? 167 GLY F O   1 
ATOM   9208  N N   . ILE F  2 172 ? 54.889  18.016  -23.729 1.00 60.19  ? 168 ILE F N   1 
ATOM   9209  C CA  . ILE F  2 172 ? 53.534  18.329  -23.281 1.00 58.07  ? 168 ILE F CA  1 
ATOM   9210  C C   . ILE F  2 172 ? 52.537  17.315  -23.836 1.00 54.79  ? 168 ILE F C   1 
ATOM   9211  O O   . ILE F  2 172 ? 52.415  17.146  -25.044 1.00 53.58  ? 168 ILE F O   1 
ATOM   9212  C CB  . ILE F  2 172 ? 53.091  19.742  -23.751 1.00 57.14  ? 168 ILE F CB  1 
ATOM   9213  C CG1 . ILE F  2 172 ? 54.031  20.812  -23.196 1.00 56.62  ? 168 ILE F CG1 1 
ATOM   9214  C CG2 . ILE F  2 172 ? 51.665  20.011  -23.311 1.00 56.57  ? 168 ILE F CG2 1 
ATOM   9215  C CD1 . ILE F  2 172 ? 54.115  20.842  -21.694 1.00 56.84  ? 168 ILE F CD1 1 
ATOM   9216  N N   . VAL F  2 173 ? 51.828  16.645  -22.941 1.00 54.39  ? 169 VAL F N   1 
ATOM   9217  C CA  . VAL F  2 173 ? 50.828  15.662  -23.324 1.00 54.45  ? 169 VAL F CA  1 
ATOM   9218  C C   . VAL F  2 173 ? 49.506  16.070  -22.684 1.00 53.48  ? 169 VAL F C   1 
ATOM   9219  O O   . VAL F  2 173 ? 49.499  16.720  -21.645 1.00 52.93  ? 169 VAL F O   1 
ATOM   9220  C CB  . VAL F  2 173 ? 51.197  14.262  -22.808 1.00 55.53  ? 169 VAL F CB  1 
ATOM   9221  C CG1 . VAL F  2 173 ? 50.194  13.245  -23.318 1.00 56.17  ? 169 VAL F CG1 1 
ATOM   9222  C CG2 . VAL F  2 173 ? 52.610  13.901  -23.242 1.00 57.13  ? 169 VAL F CG2 1 
ATOM   9223  N N   . SER F  2 174 ? 48.391  15.687  -23.297 1.00 52.50  ? 170 SER F N   1 
ATOM   9224  C CA  . SER F  2 174 ? 47.087  16.024  -22.748 1.00 50.88  ? 170 SER F CA  1 
ATOM   9225  C C   . SER F  2 174 ? 46.064  14.926  -22.983 1.00 50.83  ? 170 SER F C   1 
ATOM   9226  O O   . SER F  2 174 ? 46.184  14.149  -23.927 1.00 49.58  ? 170 SER F O   1 
ATOM   9227  C CB  . SER F  2 174 ? 46.573  17.316  -23.368 1.00 50.90  ? 170 SER F CB  1 
ATOM   9228  O OG  . SER F  2 174 ? 45.259  17.585  -22.923 1.00 51.02  ? 170 SER F OG  1 
ATOM   9229  N N   . THR F  2 175 ? 45.065  14.851  -22.107 1.00 50.78  ? 171 THR F N   1 
ATOM   9230  C CA  . THR F  2 175 ? 44.001  13.862  -22.257 1.00 50.71  ? 171 THR F CA  1 
ATOM   9231  C C   . THR F  2 175 ? 42.987  14.526  -23.165 1.00 50.20  ? 171 THR F C   1 
ATOM   9232  O O   . THR F  2 175 ? 41.990  13.930  -23.548 1.00 51.53  ? 171 THR F O   1 
ATOM   9233  C CB  . THR F  2 175 ? 43.283  13.568  -20.937 1.00 52.07  ? 171 THR F CB  1 
ATOM   9234  O OG1 . THR F  2 175 ? 42.756  14.794  -20.407 1.00 52.41  ? 171 THR F OG1 1 
ATOM   9235  C CG2 . THR F  2 175 ? 44.231  12.920  -19.938 1.00 50.45  ? 171 THR F CG2 1 
ATOM   9236  N N   . GLY F  2 176 ? 43.256  15.780  -23.498 1.00 49.72  ? 172 GLY F N   1 
ATOM   9237  C CA  . GLY F  2 176 ? 42.349  16.523  -24.346 1.00 48.28  ? 172 GLY F CA  1 
ATOM   9238  C C   . GLY F  2 176 ? 41.129  16.964  -23.558 1.00 47.16  ? 172 GLY F C   1 
ATOM   9239  O O   . GLY F  2 176 ? 40.975  16.638  -22.381 1.00 47.52  ? 172 GLY F O   1 
ATOM   9240  N N   . LEU F  2 177 ? 40.261  17.708  -24.227 1.00 45.31  ? 173 LEU F N   1 
ATOM   9241  C CA  . LEU F  2 177 ? 39.034  18.227  -23.645 1.00 42.73  ? 173 LEU F CA  1 
ATOM   9242  C C   . LEU F  2 177 ? 38.036  17.086  -23.413 1.00 41.47  ? 173 LEU F C   1 
ATOM   9243  O O   . LEU F  2 177 ? 37.608  16.419  -24.353 1.00 44.18  ? 173 LEU F O   1 
ATOM   9244  C CB  . LEU F  2 177 ? 38.451  19.261  -24.605 1.00 42.14  ? 173 LEU F CB  1 
ATOM   9245  C CG  . LEU F  2 177 ? 37.412  20.221  -24.058 1.00 44.15  ? 173 LEU F CG  1 
ATOM   9246  C CD1 . LEU F  2 177 ? 38.062  21.167  -23.070 1.00 42.28  ? 173 LEU F CD1 1 
ATOM   9247  C CD2 . LEU F  2 177 ? 36.805  20.989  -25.214 1.00 43.23  ? 173 LEU F CD2 1 
ATOM   9248  N N   . VAL F  2 178 ? 37.673  16.856  -22.159 1.00 39.26  ? 174 VAL F N   1 
ATOM   9249  C CA  . VAL F  2 178 ? 36.743  15.796  -21.817 1.00 35.18  ? 174 VAL F CA  1 
ATOM   9250  C C   . VAL F  2 178 ? 35.425  16.389  -21.377 1.00 35.12  ? 174 VAL F C   1 
ATOM   9251  O O   . VAL F  2 178 ? 35.360  17.163  -20.418 1.00 33.26  ? 174 VAL F O   1 
ATOM   9252  C CB  . VAL F  2 178 ? 37.286  14.917  -20.671 1.00 37.36  ? 174 VAL F CB  1 
ATOM   9253  C CG1 . VAL F  2 178 ? 36.267  13.825  -20.305 1.00 32.81  ? 174 VAL F CG1 1 
ATOM   9254  C CG2 . VAL F  2 178 ? 38.622  14.288  -21.092 1.00 39.53  ? 174 VAL F CG2 1 
ATOM   9255  N N   . ARG F  2 179 ? 34.367  16.017  -22.087 1.00 35.30  ? 175 ARG F N   1 
ATOM   9256  C CA  . ARG F  2 179 ? 33.025  16.491  -21.787 1.00 33.29  ? 175 ARG F CA  1 
ATOM   9257  C C   . ARG F  2 179 ? 32.450  15.556  -20.733 1.00 32.87  ? 175 ARG F C   1 
ATOM   9258  O O   . ARG F  2 179 ? 32.493  14.341  -20.892 1.00 34.20  ? 175 ARG F O   1 
ATOM   9259  C CB  . ARG F  2 179 ? 32.201  16.454  -23.061 1.00 33.24  ? 175 ARG F CB  1 
ATOM   9260  C CG  . ARG F  2 179 ? 30.798  16.965  -22.927 1.00 34.24  ? 175 ARG F CG  1 
ATOM   9261  C CD  . ARG F  2 179 ? 30.074  16.706  -24.220 1.00 33.89  ? 175 ARG F CD  1 
ATOM   9262  N NE  . ARG F  2 179 ? 30.623  17.441  -25.354 1.00 29.82  ? 175 ARG F NE  1 
ATOM   9263  C CZ  . ARG F  2 179 ? 30.417  18.732  -25.589 1.00 30.81  ? 175 ARG F CZ  1 
ATOM   9264  N NH1 . ARG F  2 179 ? 29.676  19.456  -24.763 1.00 33.47  ? 175 ARG F NH1 1 
ATOM   9265  N NH2 . ARG F  2 179 ? 30.928  19.296  -26.673 1.00 30.34  ? 175 ARG F NH2 1 
ATOM   9266  N N   . ASN F  2 180 ? 31.925  16.115  -19.647 1.00 32.38  ? 176 ASN F N   1 
ATOM   9267  C CA  . ASN F  2 180 ? 31.376  15.287  -18.577 1.00 32.85  ? 176 ASN F CA  1 
ATOM   9268  C C   . ASN F  2 180 ? 29.886  14.976  -18.662 1.00 31.29  ? 176 ASN F C   1 
ATOM   9269  O O   . ASN F  2 180 ? 29.370  14.200  -17.863 1.00 31.38  ? 176 ASN F O   1 
ATOM   9270  C CB  . ASN F  2 180 ? 31.681  15.913  -17.208 1.00 33.26  ? 176 ASN F CB  1 
ATOM   9271  C CG  . ASN F  2 180 ? 33.167  15.944  -16.899 1.00 37.26  ? 176 ASN F CG  1 
ATOM   9272  O OD1 . ASN F  2 180 ? 33.852  14.924  -16.981 1.00 33.25  ? 176 ASN F OD1 1 
ATOM   9273  N ND2 . ASN F  2 180 ? 33.673  17.119  -16.535 1.00 38.84  ? 176 ASN F ND2 1 
ATOM   9274  N N   . GLY F  2 181 ? 29.187  15.591  -19.604 1.00 32.86  ? 177 GLY F N   1 
ATOM   9275  C CA  . GLY F  2 181 ? 27.763  15.333  -19.741 1.00 35.98  ? 177 GLY F CA  1 
ATOM   9276  C C   . GLY F  2 181 ? 26.831  16.145  -18.857 1.00 37.53  ? 177 GLY F C   1 
ATOM   9277  O O   . GLY F  2 181 ? 25.616  16.068  -19.000 1.00 40.40  ? 177 GLY F O   1 
ATOM   9278  N N   . ASP F  2 182 ? 27.381  16.931  -17.943 1.00 39.76  ? 178 ASP F N   1 
ATOM   9279  C CA  . ASP F  2 182 ? 26.558  17.743  -17.049 1.00 39.22  ? 178 ASP F CA  1 
ATOM   9280  C C   . ASP F  2 182 ? 26.870  19.218  -17.207 1.00 39.63  ? 178 ASP F C   1 
ATOM   9281  O O   . ASP F  2 182 ? 26.706  19.995  -16.265 1.00 39.87  ? 178 ASP F O   1 
ATOM   9282  C CB  . ASP F  2 182 ? 26.806  17.353  -15.596 1.00 39.54  ? 178 ASP F CB  1 
ATOM   9283  C CG  . ASP F  2 182 ? 28.273  17.474  -15.199 1.00 39.26  ? 178 ASP F CG  1 
ATOM   9284  O OD1 . ASP F  2 182 ? 29.040  18.183  -15.889 1.00 37.21  ? 178 ASP F OD1 1 
ATOM   9285  O OD2 . ASP F  2 182 ? 28.651  16.859  -14.176 1.00 41.69  ? 178 ASP F OD2 1 
ATOM   9286  N N   . TRP F  2 183 ? 27.341  19.585  -18.395 1.00 39.46  ? 179 TRP F N   1 
ATOM   9287  C CA  . TRP F  2 183 ? 27.694  20.960  -18.714 1.00 39.06  ? 179 TRP F CA  1 
ATOM   9288  C C   . TRP F  2 183 ? 29.042  21.444  -18.166 1.00 41.21  ? 179 TRP F C   1 
ATOM   9289  O O   . TRP F  2 183 ? 29.290  22.655  -18.087 1.00 40.84  ? 179 TRP F O   1 
ATOM   9290  C CB  . TRP F  2 183 ? 26.585  21.908  -18.276 1.00 37.51  ? 179 TRP F CB  1 
ATOM   9291  C CG  . TRP F  2 183 ? 25.414  21.875  -19.188 1.00 37.89  ? 179 TRP F CG  1 
ATOM   9292  C CD1 . TRP F  2 183 ? 24.403  20.954  -19.199 1.00 35.14  ? 179 TRP F CD1 1 
ATOM   9293  C CD2 . TRP F  2 183 ? 25.142  22.785  -20.262 1.00 34.79  ? 179 TRP F CD2 1 
ATOM   9294  N NE1 . TRP F  2 183 ? 23.525  21.238  -20.212 1.00 35.46  ? 179 TRP F NE1 1 
ATOM   9295  C CE2 . TRP F  2 183 ? 23.954  22.355  -20.880 1.00 34.22  ? 179 TRP F CE2 1 
ATOM   9296  C CE3 . TRP F  2 183 ? 25.791  23.919  -20.762 1.00 35.75  ? 179 TRP F CE3 1 
ATOM   9297  C CZ2 . TRP F  2 183 ? 23.397  23.022  -21.976 1.00 33.73  ? 179 TRP F CZ2 1 
ATOM   9298  C CZ3 . TRP F  2 183 ? 25.239  24.582  -21.850 1.00 33.37  ? 179 TRP F CZ3 1 
ATOM   9299  C CH2 . TRP F  2 183 ? 24.055  24.132  -22.444 1.00 32.03  ? 179 TRP F CH2 1 
ATOM   9300  N N   . THR F  2 184 ? 29.912  20.509  -17.781 1.00 40.93  ? 180 THR F N   1 
ATOM   9301  C CA  . THR F  2 184 ? 31.245  20.887  -17.313 1.00 40.54  ? 180 THR F CA  1 
ATOM   9302  C C   . THR F  2 184 ? 32.231  20.057  -18.115 1.00 41.64  ? 180 THR F C   1 
ATOM   9303  O O   . THR F  2 184 ? 31.876  19.008  -18.652 1.00 38.99  ? 180 THR F O   1 
ATOM   9304  C CB  . THR F  2 184 ? 31.475  20.599  -15.800 1.00 40.81  ? 180 THR F CB  1 
ATOM   9305  O OG1 . THR F  2 184 ? 31.566  19.186  -15.584 1.00 39.71  ? 180 THR F OG1 1 
ATOM   9306  C CG2 . THR F  2 184 ? 30.332  21.169  -14.955 1.00 40.22  ? 180 THR F CG2 1 
ATOM   9307  N N   . PHE F  2 185 ? 33.463  20.550  -18.201 1.00 42.56  ? 181 PHE F N   1 
ATOM   9308  C CA  . PHE F  2 185 ? 34.545  19.885  -18.917 1.00 41.93  ? 181 PHE F CA  1 
ATOM   9309  C C   . PHE F  2 185 ? 35.662  19.593  -17.905 1.00 43.21  ? 181 PHE F C   1 
ATOM   9310  O O   . PHE F  2 185 ? 35.657  20.129  -16.801 1.00 45.53  ? 181 PHE F O   1 
ATOM   9311  C CB  . PHE F  2 185 ? 35.097  20.807  -20.013 1.00 42.08  ? 181 PHE F CB  1 
ATOM   9312  C CG  . PHE F  2 185 ? 34.194  20.970  -21.216 1.00 41.88  ? 181 PHE F CG  1 
ATOM   9313  C CD1 . PHE F  2 185 ? 34.260  20.066  -22.285 1.00 41.12  ? 181 PHE F CD1 1 
ATOM   9314  C CD2 . PHE F  2 185 ? 33.316  22.053  -21.309 1.00 39.52  ? 181 PHE F CD2 1 
ATOM   9315  C CE1 . PHE F  2 185 ? 33.475  20.243  -23.420 1.00 37.36  ? 181 PHE F CE1 1 
ATOM   9316  C CE2 . PHE F  2 185 ? 32.527  22.237  -22.441 1.00 36.57  ? 181 PHE F CE2 1 
ATOM   9317  C CZ  . PHE F  2 185 ? 32.608  21.330  -23.499 1.00 38.83  ? 181 PHE F CZ  1 
ATOM   9318  N N   . GLN F  2 186 ? 36.604  18.731  -18.275 1.00 42.46  ? 182 GLN F N   1 
ATOM   9319  C CA  . GLN F  2 186 ? 37.746  18.417  -17.425 1.00 41.71  ? 182 GLN F CA  1 
ATOM   9320  C C   . GLN F  2 186 ? 38.900  18.025  -18.335 1.00 44.17  ? 182 GLN F C   1 
ATOM   9321  O O   . GLN F  2 186 ? 38.685  17.592  -19.474 1.00 43.21  ? 182 GLN F O   1 
ATOM   9322  C CB  . GLN F  2 186 ? 37.443  17.293  -16.432 1.00 38.44  ? 182 GLN F CB  1 
ATOM   9323  C CG  . GLN F  2 186 ? 37.316  15.914  -17.015 1.00 39.98  ? 182 GLN F CG  1 
ATOM   9324  C CD  . GLN F  2 186 ? 37.374  14.836  -15.949 1.00 40.88  ? 182 GLN F CD  1 
ATOM   9325  O OE1 . GLN F  2 186 ? 38.418  14.611  -15.326 1.00 43.69  ? 182 GLN F OE1 1 
ATOM   9326  N NE2 . GLN F  2 186 ? 36.255  14.165  -15.727 1.00 41.56  ? 182 GLN F NE2 1 
ATOM   9327  N N   . THR F  2 187 ? 40.125  18.196  -17.850 1.00 44.59  ? 183 THR F N   1 
ATOM   9328  C CA  . THR F  2 187 ? 41.290  17.876  -18.660 1.00 46.38  ? 183 THR F CA  1 
ATOM   9329  C C   . THR F  2 187 ? 42.576  17.756  -17.863 1.00 47.37  ? 183 THR F C   1 
ATOM   9330  O O   . THR F  2 187 ? 42.682  18.236  -16.735 1.00 48.03  ? 183 THR F O   1 
ATOM   9331  C CB  . THR F  2 187 ? 41.494  18.935  -19.774 1.00 47.33  ? 183 THR F CB  1 
ATOM   9332  O OG1 . THR F  2 187 ? 42.591  18.547  -20.612 1.00 49.70  ? 183 THR F OG1 1 
ATOM   9333  C CG2 . THR F  2 187 ? 41.766  20.305  -19.169 1.00 47.92  ? 183 THR F CG2 1 
ATOM   9334  N N   . LEU F  2 188 ? 43.552  17.091  -18.463 1.00 47.74  ? 184 LEU F N   1 
ATOM   9335  C CA  . LEU F  2 188 ? 44.847  16.910  -17.840 1.00 46.26  ? 184 LEU F CA  1 
ATOM   9336  C C   . LEU F  2 188 ? 45.919  17.275  -18.856 1.00 46.61  ? 184 LEU F C   1 
ATOM   9337  O O   . LEU F  2 188 ? 46.020  16.648  -19.912 1.00 48.45  ? 184 LEU F O   1 
ATOM   9338  C CB  . LEU F  2 188 ? 45.028  15.463  -17.386 1.00 44.94  ? 184 LEU F CB  1 
ATOM   9339  C CG  . LEU F  2 188 ? 44.062  14.957  -16.311 1.00 47.45  ? 184 LEU F CG  1 
ATOM   9340  C CD1 . LEU F  2 188 ? 44.348  13.490  -16.013 1.00 46.02  ? 184 LEU F CD1 1 
ATOM   9341  C CD2 . LEU F  2 188 ? 44.210  15.785  -15.041 1.00 46.77  ? 184 LEU F CD2 1 
ATOM   9342  N N   . VAL F  2 189 ? 46.696  18.309  -18.545 1.00 46.61  ? 185 VAL F N   1 
ATOM   9343  C CA  . VAL F  2 189 ? 47.781  18.760  -19.404 1.00 45.34  ? 185 VAL F CA  1 
ATOM   9344  C C   . VAL F  2 189 ? 49.059  18.414  -18.657 1.00 47.38  ? 185 VAL F C   1 
ATOM   9345  O O   . VAL F  2 189 ? 49.449  19.098  -17.714 1.00 47.79  ? 185 VAL F O   1 
ATOM   9346  C CB  . VAL F  2 189 ? 47.719  20.274  -19.641 1.00 43.48  ? 185 VAL F CB  1 
ATOM   9347  C CG1 . VAL F  2 189 ? 48.884  20.711  -20.511 1.00 39.56  ? 185 VAL F CG1 1 
ATOM   9348  C CG2 . VAL F  2 189 ? 46.398  20.633  -20.292 1.00 43.10  ? 185 VAL F CG2 1 
ATOM   9349  N N   . MET F  2 190 ? 49.711  17.346  -19.087 1.00 48.83  ? 186 MET F N   1 
ATOM   9350  C CA  . MET F  2 190 ? 50.910  16.890  -18.422 1.00 50.98  ? 186 MET F CA  1 
ATOM   9351  C C   . MET F  2 190 ? 52.224  17.316  -19.057 1.00 50.84  ? 186 MET F C   1 
ATOM   9352  O O   . MET F  2 190 ? 52.356  17.424  -20.273 1.00 50.40  ? 186 MET F O   1 
ATOM   9353  C CB  . MET F  2 190 ? 50.832  15.377  -18.302 1.00 52.06  ? 186 MET F CB  1 
ATOM   9354  C CG  . MET F  2 190 ? 49.473  14.944  -17.806 1.00 55.31  ? 186 MET F CG  1 
ATOM   9355  S SD  . MET F  2 190 ? 49.142  13.238  -18.142 1.00 60.83  ? 186 MET F SD  1 
ATOM   9356  C CE  . MET F  2 190 ? 48.295  12.740  -16.642 1.00 61.40  ? 186 MET F CE  1 
ATOM   9357  N N   . LEU F  2 191 ? 53.200  17.576  -18.203 1.00 52.47  ? 187 LEU F N   1 
ATOM   9358  C CA  . LEU F  2 191 ? 54.519  17.981  -18.649 1.00 54.43  ? 187 LEU F CA  1 
ATOM   9359  C C   . LEU F  2 191 ? 55.451  16.828  -18.326 1.00 54.29  ? 187 LEU F C   1 
ATOM   9360  O O   . LEU F  2 191 ? 55.457  16.331  -17.207 1.00 53.05  ? 187 LEU F O   1 
ATOM   9361  C CB  . LEU F  2 191 ? 54.955  19.245  -17.914 1.00 52.72  ? 187 LEU F CB  1 
ATOM   9362  C CG  . LEU F  2 191 ? 56.397  19.694  -18.135 1.00 53.50  ? 187 LEU F CG  1 
ATOM   9363  C CD1 . LEU F  2 191 ? 56.655  19.917  -19.609 1.00 53.49  ? 187 LEU F CD1 1 
ATOM   9364  C CD2 . LEU F  2 191 ? 56.645  20.966  -17.349 1.00 53.72  ? 187 LEU F CD2 1 
ATOM   9365  N N   . GLU F  2 192 ? 56.214  16.387  -19.318 1.00 56.97  ? 188 GLU F N   1 
ATOM   9366  C CA  . GLU F  2 192 ? 57.145  15.282  -19.120 1.00 61.46  ? 188 GLU F CA  1 
ATOM   9367  C C   . GLU F  2 192 ? 58.514  15.842  -18.754 1.00 61.12  ? 188 GLU F C   1 
ATOM   9368  O O   . GLU F  2 192 ? 59.216  16.390  -19.603 1.00 59.96  ? 188 GLU F O   1 
ATOM   9369  C CB  . GLU F  2 192 ? 57.232  14.432  -20.394 1.00 62.22  ? 188 GLU F CB  1 
ATOM   9370  C CG  . GLU F  2 192 ? 55.860  14.044  -20.941 1.00 66.79  ? 188 GLU F CG  1 
ATOM   9371  C CD  . GLU F  2 192 ? 55.915  13.236  -22.229 1.00 69.54  ? 188 GLU F CD  1 
ATOM   9372  O OE1 . GLU F  2 192 ? 56.579  13.684  -23.191 1.00 70.95  ? 188 GLU F OE1 1 
ATOM   9373  O OE2 . GLU F  2 192 ? 55.278  12.158  -22.280 1.00 70.98  ? 188 GLU F OE2 1 
ATOM   9374  N N   . THR F  2 193 ? 58.866  15.722  -17.475 1.00 61.79  ? 189 THR F N   1 
ATOM   9375  C CA  . THR F  2 193 ? 60.144  16.205  -16.959 1.00 64.49  ? 189 THR F CA  1 
ATOM   9376  C C   . THR F  2 193 ? 60.486  15.473  -15.667 1.00 63.72  ? 189 THR F C   1 
ATOM   9377  O O   . THR F  2 193 ? 59.643  14.804  -15.075 1.00 61.03  ? 189 THR F O   1 
ATOM   9378  C CB  . THR F  2 193 ? 60.111  17.726  -16.643 1.00 64.69  ? 189 THR F CB  1 
ATOM   9379  O OG1 . THR F  2 193 ? 59.005  18.008  -15.776 1.00 65.09  ? 189 THR F OG1 1 
ATOM   9380  C CG2 . THR F  2 193 ? 59.985  18.551  -17.921 1.00 65.52  ? 189 THR F CG2 1 
ATOM   9381  N N   . VAL F  2 194 ? 61.733  15.607  -15.237 1.00 64.29  ? 190 VAL F N   1 
ATOM   9382  C CA  . VAL F  2 194 ? 62.180  14.972  -14.017 1.00 65.73  ? 190 VAL F CA  1 
ATOM   9383  C C   . VAL F  2 194 ? 62.384  16.063  -12.976 1.00 66.31  ? 190 VAL F C   1 
ATOM   9384  O O   . VAL F  2 194 ? 63.336  16.836  -13.048 1.00 66.97  ? 190 VAL F O   1 
ATOM   9385  C CB  . VAL F  2 194 ? 63.495  14.222  -14.249 1.00 65.43  ? 190 VAL F CB  1 
ATOM   9386  C CG1 . VAL F  2 194 ? 63.888  13.469  -13.004 1.00 63.55  ? 190 VAL F CG1 1 
ATOM   9387  C CG2 . VAL F  2 194 ? 63.343  13.273  -15.419 1.00 64.94  ? 190 VAL F CG2 1 
ATOM   9388  N N   . PRO F  2 195 ? 61.475  16.150  -11.999 1.00 67.80  ? 191 PRO F N   1 
ATOM   9389  C CA  . PRO F  2 195 ? 61.537  17.151  -10.929 1.00 69.98  ? 191 PRO F CA  1 
ATOM   9390  C C   . PRO F  2 195 ? 62.809  17.106  -10.093 1.00 69.29  ? 191 PRO F C   1 
ATOM   9391  O O   . PRO F  2 195 ? 63.182  16.056  -9.572  1.00 69.78  ? 191 PRO F O   1 
ATOM   9392  C CB  . PRO F  2 195 ? 60.294  16.837  -10.104 1.00 69.27  ? 191 PRO F CB  1 
ATOM   9393  C CG  . PRO F  2 195 ? 59.346  16.308  -11.131 1.00 67.89  ? 191 PRO F CG  1 
ATOM   9394  C CD  . PRO F  2 195 ? 60.232  15.371  -11.901 1.00 68.06  ? 191 PRO F CD  1 
ATOM   9395  N N   . GLN F  2 196 ? 63.471  18.254  -9.977  1.00 69.95  ? 192 GLN F N   1 
ATOM   9396  C CA  . GLN F  2 196 ? 64.694  18.365  -9.192  1.00 70.83  ? 192 GLN F CA  1 
ATOM   9397  C C   . GLN F  2 196 ? 64.459  19.356  -8.053  1.00 71.53  ? 192 GLN F C   1 
ATOM   9398  O O   . GLN F  2 196 ? 63.912  20.438  -8.263  1.00 70.40  ? 192 GLN F O   1 
ATOM   9399  C CB  . GLN F  2 196 ? 65.859  18.823  -10.076 1.00 66.94  ? 192 GLN F CB  1 
ATOM   9400  C CG  . GLN F  2 196 ? 66.162  17.864  -11.219 1.00 63.95  ? 192 GLN F CG  1 
ATOM   9401  C CD  . GLN F  2 196 ? 67.468  18.167  -11.939 1.00 62.60  ? 192 GLN F CD  1 
ATOM   9402  O OE1 . GLN F  2 196 ? 68.546  18.112  -11.343 1.00 60.31  ? 192 GLN F OE1 1 
ATOM   9403  N NE2 . GLN F  2 196 ? 67.376  18.479  -13.231 1.00 61.71  ? 192 GLN F NE2 1 
ATOM   9404  N N   . SER F  2 197 ? 64.867  18.965  -6.849  1.00 73.15  ? 193 SER F N   1 
ATOM   9405  C CA  . SER F  2 197 ? 64.702  19.778  -5.647  1.00 75.84  ? 193 SER F CA  1 
ATOM   9406  C C   . SER F  2 197 ? 64.763  21.294  -5.842  1.00 76.01  ? 193 SER F C   1 
ATOM   9407  O O   . SER F  2 197 ? 63.952  22.026  -5.273  1.00 76.31  ? 193 SER F O   1 
ATOM   9408  C CB  . SER F  2 197 ? 65.736  19.361  -4.598  1.00 75.76  ? 193 SER F CB  1 
ATOM   9409  O OG  . SER F  2 197 ? 67.049  19.499  -5.104  1.00 77.66  ? 193 SER F OG  1 
ATOM   9410  N N   . GLY F  2 198 ? 65.714  21.769  -6.638  1.00 76.51  ? 194 GLY F N   1 
ATOM   9411  C CA  . GLY F  2 198 ? 65.831  23.202  -6.848  1.00 77.74  ? 194 GLY F CA  1 
ATOM   9412  C C   . GLY F  2 198 ? 65.110  23.752  -8.065  1.00 77.14  ? 194 GLY F C   1 
ATOM   9413  O O   . GLY F  2 198 ? 65.680  24.553  -8.806  1.00 77.37  ? 194 GLY F O   1 
ATOM   9414  N N   . GLU F  2 199 ? 63.861  23.337  -8.275  1.00 76.99  ? 195 GLU F N   1 
ATOM   9415  C CA  . GLU F  2 199 ? 63.075  23.807  -9.420  1.00 76.75  ? 195 GLU F CA  1 
ATOM   9416  C C   . GLU F  2 199 ? 61.673  24.273  -9.038  1.00 74.71  ? 195 GLU F C   1 
ATOM   9417  O O   . GLU F  2 199 ? 61.072  23.781  -8.081  1.00 73.37  ? 195 GLU F O   1 
ATOM   9418  C CB  . GLU F  2 199 ? 62.947  22.707  -10.479 1.00 76.60  ? 195 GLU F CB  1 
ATOM   9419  C CG  . GLU F  2 199 ? 64.191  22.464  -11.314 1.00 76.95  ? 195 GLU F CG  1 
ATOM   9420  C CD  . GLU F  2 199 ? 63.985  21.369  -12.344 1.00 77.08  ? 195 GLU F CD  1 
ATOM   9421  O OE1 . GLU F  2 199 ? 63.707  20.219  -11.939 1.00 76.59  ? 195 GLU F OE1 1 
ATOM   9422  O OE2 . GLU F  2 199 ? 64.096  21.657  -13.555 1.00 76.77  ? 195 GLU F OE2 1 
ATOM   9423  N N   . VAL F  2 200 ? 61.158  25.228  -9.800  1.00 73.29  ? 196 VAL F N   1 
ATOM   9424  C CA  . VAL F  2 200 ? 59.820  25.752  -9.561  1.00 73.43  ? 196 VAL F CA  1 
ATOM   9425  C C   . VAL F  2 200 ? 59.030  25.728  -10.869 1.00 72.00  ? 196 VAL F C   1 
ATOM   9426  O O   . VAL F  2 200 ? 59.413  26.365  -11.856 1.00 70.72  ? 196 VAL F O   1 
ATOM   9427  C CB  . VAL F  2 200 ? 59.874  27.197  -9.010  1.00 72.88  ? 196 VAL F CB  1 
ATOM   9428  C CG1 . VAL F  2 200 ? 58.478  27.787  -8.934  1.00 71.52  ? 196 VAL F CG1 1 
ATOM   9429  C CG2 . VAL F  2 200 ? 60.506  27.194  -7.632  1.00 72.02  ? 196 VAL F CG2 1 
ATOM   9430  N N   . TYR F  2 201 ? 57.931  24.976  -10.867 1.00 70.88  ? 197 TYR F N   1 
ATOM   9431  C CA  . TYR F  2 201 ? 57.077  24.846  -12.044 1.00 70.39  ? 197 TYR F CA  1 
ATOM   9432  C C   . TYR F  2 201 ? 55.783  25.653  -11.910 1.00 69.20  ? 197 TYR F C   1 
ATOM   9433  O O   . TYR F  2 201 ? 55.265  25.837  -10.808 1.00 68.67  ? 197 TYR F O   1 
ATOM   9434  C CB  . TYR F  2 201 ? 56.737  23.373  -12.293 1.00 68.50  ? 197 TYR F CB  1 
ATOM   9435  C CG  . TYR F  2 201 ? 57.927  22.497  -12.611 1.00 67.08  ? 197 TYR F CG  1 
ATOM   9436  C CD1 . TYR F  2 201 ? 58.748  22.005  -11.601 1.00 66.22  ? 197 TYR F CD1 1 
ATOM   9437  C CD2 . TYR F  2 201 ? 58.230  22.158  -13.928 1.00 66.52  ? 197 TYR F CD2 1 
ATOM   9438  C CE1 . TYR F  2 201 ? 59.837  21.197  -11.894 1.00 66.38  ? 197 TYR F CE1 1 
ATOM   9439  C CE2 . TYR F  2 201 ? 59.316  21.353  -14.230 1.00 66.25  ? 197 TYR F CE2 1 
ATOM   9440  C CZ  . TYR F  2 201 ? 60.114  20.876  -13.211 1.00 66.61  ? 197 TYR F CZ  1 
ATOM   9441  O OH  . TYR F  2 201 ? 61.193  20.081  -13.511 1.00 67.83  ? 197 TYR F OH  1 
ATOM   9442  N N   . THR F  2 202 ? 55.260  26.117  -13.041 1.00 68.10  ? 198 THR F N   1 
ATOM   9443  C CA  . THR F  2 202 ? 54.038  26.908  -13.051 1.00 67.87  ? 198 THR F CA  1 
ATOM   9444  C C   . THR F  2 202 ? 53.044  26.500  -14.135 1.00 66.26  ? 198 THR F C   1 
ATOM   9445  O O   . THR F  2 202 ? 53.393  26.430  -15.316 1.00 66.03  ? 198 THR F O   1 
ATOM   9446  C CB  . THR F  2 202 ? 54.351  28.403  -13.264 1.00 69.17  ? 198 THR F CB  1 
ATOM   9447  O OG1 . THR F  2 202 ? 55.131  28.892  -12.167 1.00 71.51  ? 198 THR F OG1 1 
ATOM   9448  C CG2 . THR F  2 202 ? 53.058  29.212  -13.370 1.00 69.60  ? 198 THR F CG2 1 
ATOM   9449  N N   . CYS F  2 203 ? 51.803  26.237  -13.737 1.00 63.86  ? 199 CYS F N   1 
ATOM   9450  C CA  . CYS F  2 203 ? 50.786  25.896  -14.718 1.00 61.41  ? 199 CYS F CA  1 
ATOM   9451  C C   . CYS F  2 203 ? 49.897  27.113  -14.891 1.00 59.53  ? 199 CYS F C   1 
ATOM   9452  O O   . CYS F  2 203 ? 49.263  27.558  -13.942 1.00 59.17  ? 199 CYS F O   1 
ATOM   9453  C CB  . CYS F  2 203 ? 49.923  24.705  -14.282 1.00 60.04  ? 199 CYS F CB  1 
ATOM   9454  S SG  . CYS F  2 203 ? 48.792  24.227  -15.636 1.00 62.49  ? 199 CYS F SG  1 
ATOM   9455  N N   . GLN F  2 204 ? 49.866  27.658  -16.100 1.00 58.44  ? 200 GLN F N   1 
ATOM   9456  C CA  . GLN F  2 204 ? 49.040  28.821  -16.388 1.00 58.70  ? 200 GLN F CA  1 
ATOM   9457  C C   . GLN F  2 204 ? 47.827  28.405  -17.232 1.00 59.13  ? 200 GLN F C   1 
ATOM   9458  O O   . GLN F  2 204 ? 47.975  27.800  -18.295 1.00 59.35  ? 200 GLN F O   1 
ATOM   9459  C CB  . GLN F  2 204 ? 49.868  29.872  -17.120 1.00 57.47  ? 200 GLN F CB  1 
ATOM   9460  C CG  . GLN F  2 204 ? 49.082  31.078  -17.569 1.00 59.23  ? 200 GLN F CG  1 
ATOM   9461  C CD  . GLN F  2 204 ? 49.978  32.199  -18.024 1.00 59.83  ? 200 GLN F CD  1 
ATOM   9462  O OE1 . GLN F  2 204 ? 50.693  32.794  -17.216 1.00 60.14  ? 200 GLN F OE1 1 
ATOM   9463  N NE2 . GLN F  2 204 ? 49.960  32.492  -19.324 1.00 60.12  ? 200 GLN F NE2 1 
ATOM   9464  N N   . VAL F  2 205 ? 46.631  28.732  -16.751 1.00 59.09  ? 201 VAL F N   1 
ATOM   9465  C CA  . VAL F  2 205 ? 45.401  28.374  -17.443 1.00 59.03  ? 201 VAL F CA  1 
ATOM   9466  C C   . VAL F  2 205 ? 44.580  29.595  -17.848 1.00 59.60  ? 201 VAL F C   1 
ATOM   9467  O O   . VAL F  2 205 ? 44.205  30.405  -17.007 1.00 61.05  ? 201 VAL F O   1 
ATOM   9468  C CB  . VAL F  2 205 ? 44.532  27.460  -16.554 1.00 58.51  ? 201 VAL F CB  1 
ATOM   9469  C CG1 . VAL F  2 205 ? 43.228  27.131  -17.253 1.00 59.10  ? 201 VAL F CG1 1 
ATOM   9470  C CG2 . VAL F  2 205 ? 45.287  26.188  -16.234 1.00 58.04  ? 201 VAL F CG2 1 
ATOM   9471  N N   . GLU F  2 206 ? 44.300  29.719  -19.141 1.00 59.43  ? 202 GLU F N   1 
ATOM   9472  C CA  . GLU F  2 206 ? 43.514  30.836  -19.656 1.00 60.91  ? 202 GLU F CA  1 
ATOM   9473  C C   . GLU F  2 206 ? 42.122  30.365  -20.086 1.00 60.82  ? 202 GLU F C   1 
ATOM   9474  O O   . GLU F  2 206 ? 41.981  29.443  -20.884 1.00 59.82  ? 202 GLU F O   1 
ATOM   9475  C CB  . GLU F  2 206 ? 44.258  31.496  -20.821 1.00 62.13  ? 202 GLU F CB  1 
ATOM   9476  C CG  . GLU F  2 206 ? 45.359  32.440  -20.353 1.00 66.29  ? 202 GLU F CG  1 
ATOM   9477  C CD  . GLU F  2 206 ? 46.518  32.556  -21.330 1.00 68.94  ? 202 GLU F CD  1 
ATOM   9478  O OE1 . GLU F  2 206 ? 47.309  31.592  -21.439 1.00 70.61  ? 202 GLU F OE1 1 
ATOM   9479  O OE2 . GLU F  2 206 ? 46.640  33.609  -21.989 1.00 71.33  ? 202 GLU F OE2 1 
ATOM   9480  N N   . HIS F  2 207 ? 41.095  31.009  -19.544 1.00 61.47  ? 203 HIS F N   1 
ATOM   9481  C CA  . HIS F  2 207 ? 39.717  30.638  -19.829 1.00 61.42  ? 203 HIS F CA  1 
ATOM   9482  C C   . HIS F  2 207 ? 38.854  31.895  -19.816 1.00 61.77  ? 203 HIS F C   1 
ATOM   9483  O O   . HIS F  2 207 ? 39.049  32.776  -18.982 1.00 62.51  ? 203 HIS F O   1 
ATOM   9484  C CB  . HIS F  2 207 ? 39.250  29.648  -18.756 1.00 61.99  ? 203 HIS F CB  1 
ATOM   9485  C CG  . HIS F  2 207 ? 37.889  29.075  -18.993 1.00 62.32  ? 203 HIS F CG  1 
ATOM   9486  N ND1 . HIS F  2 207 ? 36.740  29.831  -18.924 1.00 62.35  ? 203 HIS F ND1 1 
ATOM   9487  C CD2 . HIS F  2 207 ? 37.492  27.812  -19.275 1.00 62.04  ? 203 HIS F CD2 1 
ATOM   9488  C CE1 . HIS F  2 207 ? 35.693  29.057  -19.151 1.00 61.87  ? 203 HIS F CE1 1 
ATOM   9489  N NE2 . HIS F  2 207 ? 36.122  27.828  -19.367 1.00 60.93  ? 203 HIS F NE2 1 
ATOM   9490  N N   . PRO F  2 208 ? 37.885  31.992  -20.741 1.00 62.20  ? 204 PRO F N   1 
ATOM   9491  C CA  . PRO F  2 208 ? 37.000  33.161  -20.822 1.00 61.56  ? 204 PRO F CA  1 
ATOM   9492  C C   . PRO F  2 208 ? 36.264  33.519  -19.532 1.00 61.21  ? 204 PRO F C   1 
ATOM   9493  O O   . PRO F  2 208 ? 35.801  34.646  -19.378 1.00 60.68  ? 204 PRO F O   1 
ATOM   9494  C CB  . PRO F  2 208 ? 36.052  32.799  -21.969 1.00 61.44  ? 204 PRO F CB  1 
ATOM   9495  C CG  . PRO F  2 208 ? 36.047  31.293  -21.953 1.00 61.50  ? 204 PRO F CG  1 
ATOM   9496  C CD  . PRO F  2 208 ? 37.498  30.974  -21.735 1.00 61.42  ? 204 PRO F CD  1 
ATOM   9497  N N   . SER F  2 209 ? 36.165  32.569  -18.607 1.00 62.35  ? 205 SER F N   1 
ATOM   9498  C CA  . SER F  2 209 ? 35.487  32.812  -17.331 1.00 64.29  ? 205 SER F CA  1 
ATOM   9499  C C   . SER F  2 209 ? 36.430  33.490  -16.341 1.00 67.13  ? 205 SER F C   1 
ATOM   9500  O O   . SER F  2 209 ? 36.050  33.789  -15.206 1.00 67.63  ? 205 SER F O   1 
ATOM   9501  C CB  . SER F  2 209 ? 35.000  31.497  -16.713 1.00 62.26  ? 205 SER F CB  1 
ATOM   9502  O OG  . SER F  2 209 ? 36.074  30.777  -16.126 1.00 60.89  ? 205 SER F OG  1 
ATOM   9503  N N   . LEU F  2 210 ? 37.663  33.733  -16.773 1.00 70.34  ? 206 LEU F N   1 
ATOM   9504  C CA  . LEU F  2 210 ? 38.656  34.359  -15.905 1.00 72.78  ? 206 LEU F CA  1 
ATOM   9505  C C   . LEU F  2 210 ? 39.114  35.721  -16.404 1.00 74.35  ? 206 LEU F C   1 
ATOM   9506  O O   . LEU F  2 210 ? 39.594  35.857  -17.534 1.00 73.99  ? 206 LEU F O   1 
ATOM   9507  C CB  . LEU F  2 210 ? 39.877  33.445  -15.755 1.00 72.11  ? 206 LEU F CB  1 
ATOM   9508  C CG  . LEU F  2 210 ? 39.659  32.062  -15.135 1.00 72.76  ? 206 LEU F CG  1 
ATOM   9509  C CD1 . LEU F  2 210 ? 40.948  31.263  -15.249 1.00 71.80  ? 206 LEU F CD1 1 
ATOM   9510  C CD2 . LEU F  2 210 ? 39.220  32.187  -13.676 1.00 71.79  ? 206 LEU F CD2 1 
ATOM   9511  N N   . THR F  2 211 ? 38.964  36.726  -15.545 1.00 76.46  ? 207 THR F N   1 
ATOM   9512  C CA  . THR F  2 211 ? 39.373  38.088  -15.871 1.00 77.70  ? 207 THR F CA  1 
ATOM   9513  C C   . THR F  2 211 ? 40.797  38.035  -16.416 1.00 77.75  ? 207 THR F C   1 
ATOM   9514  O O   . THR F  2 211 ? 41.069  38.465  -17.537 1.00 77.98  ? 207 THR F O   1 
ATOM   9515  C CB  . THR F  2 211 ? 39.349  38.977  -14.617 1.00 78.47  ? 207 THR F CB  1 
ATOM   9516  O OG1 . THR F  2 211 ? 40.241  38.434  -13.634 1.00 79.63  ? 207 THR F OG1 1 
ATOM   9517  C CG2 . THR F  2 211 ? 37.941  39.036  -14.033 1.00 78.12  ? 207 THR F CG2 1 
ATOM   9518  N N   . ASP F  2 212 ? 41.696  37.491  -15.606 1.00 77.93  ? 208 ASP F N   1 
ATOM   9519  C CA  . ASP F  2 212 ? 43.095  37.347  -15.980 1.00 78.57  ? 208 ASP F CA  1 
ATOM   9520  C C   . ASP F  2 212 ? 43.522  35.898  -15.723 1.00 78.17  ? 208 ASP F C   1 
ATOM   9521  O O   . ASP F  2 212 ? 42.915  35.199  -14.907 1.00 78.31  ? 208 ASP F O   1 
ATOM   9522  C CB  . ASP F  2 212 ? 43.960  38.313  -15.164 1.00 79.71  ? 208 ASP F CB  1 
ATOM   9523  C CG  . ASP F  2 212 ? 43.570  39.769  -15.379 1.00 81.30  ? 208 ASP F CG  1 
ATOM   9524  O OD1 . ASP F  2 212 ? 43.622  40.238  -16.537 1.00 81.04  ? 208 ASP F OD1 1 
ATOM   9525  O OD2 . ASP F  2 212 ? 43.212  40.445  -14.390 1.00 82.10  ? 208 ASP F OD2 1 
ATOM   9526  N N   . PRO F  2 213 ? 44.570  35.430  -16.422 1.00 77.14  ? 209 PRO F N   1 
ATOM   9527  C CA  . PRO F  2 213 ? 45.097  34.067  -16.295 1.00 75.03  ? 209 PRO F CA  1 
ATOM   9528  C C   . PRO F  2 213 ? 45.312  33.583  -14.864 1.00 73.75  ? 209 PRO F C   1 
ATOM   9529  O O   . PRO F  2 213 ? 45.711  34.353  -13.993 1.00 74.52  ? 209 PRO F O   1 
ATOM   9530  C CB  . PRO F  2 213 ? 46.408  34.137  -17.070 1.00 74.84  ? 209 PRO F CB  1 
ATOM   9531  C CG  . PRO F  2 213 ? 46.090  35.107  -18.153 1.00 75.90  ? 209 PRO F CG  1 
ATOM   9532  C CD  . PRO F  2 213 ? 45.355  36.198  -17.408 1.00 77.03  ? 209 PRO F CD  1 
ATOM   9533  N N   . VAL F  2 214 ? 45.033  32.303  -14.634 1.00 71.03  ? 210 VAL F N   1 
ATOM   9534  C CA  . VAL F  2 214 ? 45.226  31.686  -13.329 1.00 69.56  ? 210 VAL F CA  1 
ATOM   9535  C C   . VAL F  2 214 ? 46.578  30.979  -13.381 1.00 68.78  ? 210 VAL F C   1 
ATOM   9536  O O   . VAL F  2 214 ? 47.035  30.583  -14.455 1.00 69.19  ? 210 VAL F O   1 
ATOM   9537  C CB  . VAL F  2 214 ? 44.117  30.654  -13.024 1.00 69.02  ? 210 VAL F CB  1 
ATOM   9538  C CG1 . VAL F  2 214 ? 44.536  29.731  -11.886 1.00 68.74  ? 210 VAL F CG1 1 
ATOM   9539  C CG2 . VAL F  2 214 ? 42.852  31.374  -12.637 1.00 70.78  ? 210 VAL F CG2 1 
ATOM   9540  N N   . THR F  2 215 ? 47.227  30.833  -12.232 1.00 66.64  ? 211 THR F N   1 
ATOM   9541  C CA  . THR F  2 215 ? 48.522  30.178  -12.196 1.00 65.23  ? 211 THR F CA  1 
ATOM   9542  C C   . THR F  2 215 ? 48.736  29.453  -10.879 1.00 64.23  ? 211 THR F C   1 
ATOM   9543  O O   . THR F  2 215 ? 48.507  30.008  -9.809  1.00 62.96  ? 211 THR F O   1 
ATOM   9544  C CB  . THR F  2 215 ? 49.677  31.190  -12.376 1.00 65.29  ? 211 THR F CB  1 
ATOM   9545  O OG1 . THR F  2 215 ? 49.692  32.087  -11.263 1.00 66.87  ? 211 THR F OG1 1 
ATOM   9546  C CG2 . THR F  2 215 ? 49.515  31.991  -13.662 1.00 63.02  ? 211 THR F CG2 1 
ATOM   9547  N N   . VAL F  2 216 ? 49.159  28.198  -10.972 1.00 64.05  ? 212 VAL F N   1 
ATOM   9548  C CA  . VAL F  2 216 ? 49.442  27.390  -9.800  1.00 64.59  ? 212 VAL F CA  1 
ATOM   9549  C C   . VAL F  2 216 ? 50.913  27.022  -9.865  1.00 65.97  ? 212 VAL F C   1 
ATOM   9550  O O   . VAL F  2 216 ? 51.422  26.589  -10.905 1.00 65.51  ? 212 VAL F O   1 
ATOM   9551  C CB  . VAL F  2 216 ? 48.614  26.108  -9.757  1.00 62.98  ? 212 VAL F CB  1 
ATOM   9552  C CG1 . VAL F  2 216 ? 49.086  25.242  -8.606  1.00 61.81  ? 212 VAL F CG1 1 
ATOM   9553  C CG2 . VAL F  2 216 ? 47.138  26.449  -9.591  1.00 62.50  ? 212 VAL F CG2 1 
ATOM   9554  N N   . GLU F  2 217 ? 51.589  27.204  -8.742  1.00 66.81  ? 213 GLU F N   1 
ATOM   9555  C CA  . GLU F  2 217 ? 53.010  26.944  -8.654  1.00 68.57  ? 213 GLU F CA  1 
ATOM   9556  C C   . GLU F  2 217 ? 53.256  25.617  -7.951  1.00 67.65  ? 213 GLU F C   1 
ATOM   9557  O O   . GLU F  2 217 ? 52.477  25.202  -7.093  1.00 66.77  ? 213 GLU F O   1 
ATOM   9558  C CB  . GLU F  2 217 ? 53.679  28.100  -7.894  1.00 70.18  ? 213 GLU F CB  1 
ATOM   9559  C CG  . GLU F  2 217 ? 55.147  28.340  -8.228  1.00 73.41  ? 213 GLU F CG  1 
ATOM   9560  C CD  . GLU F  2 217 ? 55.660  29.686  -7.715  1.00 74.33  ? 213 GLU F CD  1 
ATOM   9561  O OE1 . GLU F  2 217 ? 55.572  29.937  -6.494  1.00 74.89  ? 213 GLU F OE1 1 
ATOM   9562  O OE2 . GLU F  2 217 ? 56.154  30.492  -8.535  1.00 74.20  ? 213 GLU F OE2 1 
ATOM   9563  N N   . TRP F  2 218 ? 54.331  24.943  -8.341  1.00 66.98  ? 214 TRP F N   1 
ATOM   9564  C CA  . TRP F  2 218 ? 54.687  23.676  -7.730  1.00 67.57  ? 214 TRP F CA  1 
ATOM   9565  C C   . TRP F  2 218 ? 56.206  23.536  -7.633  1.00 69.07  ? 214 TRP F C   1 
ATOM   9566  O O   . TRP F  2 218 ? 56.938  23.890  -8.560  1.00 68.14  ? 214 TRP F O   1 
ATOM   9567  C CB  . TRP F  2 218 ? 54.113  22.509  -8.530  1.00 61.84  ? 214 TRP F CB  1 
ATOM   9568  C CG  . TRP F  2 218 ? 54.297  21.205  -7.834  1.00 56.57  ? 214 TRP F CG  1 
ATOM   9569  C CD1 . TRP F  2 218 ? 53.491  20.667  -6.872  1.00 54.82  ? 214 TRP F CD1 1 
ATOM   9570  C CD2 . TRP F  2 218 ? 55.395  20.298  -7.993  1.00 53.91  ? 214 TRP F CD2 1 
ATOM   9571  N NE1 . TRP F  2 218 ? 54.019  19.479  -6.418  1.00 54.75  ? 214 TRP F NE1 1 
ATOM   9572  C CE2 . TRP F  2 218 ? 55.188  19.228  -7.089  1.00 53.83  ? 214 TRP F CE2 1 
ATOM   9573  C CE3 . TRP F  2 218 ? 56.535  20.284  -8.810  1.00 50.86  ? 214 TRP F CE3 1 
ATOM   9574  C CZ2 . TRP F  2 218 ? 56.083  18.152  -6.979  1.00 53.28  ? 214 TRP F CZ2 1 
ATOM   9575  C CZ3 . TRP F  2 218 ? 57.427  19.216  -8.701  1.00 50.49  ? 214 TRP F CZ3 1 
ATOM   9576  C CH2 . TRP F  2 218 ? 57.193  18.163  -7.791  1.00 51.57  ? 214 TRP F CH2 1 
ATOM   9577  N N   . LYS F  2 219 ? 56.664  23.021  -6.496  1.00 72.74  ? 215 LYS F N   1 
ATOM   9578  C CA  . LYS F  2 219 ? 58.088  22.821  -6.241  1.00 76.79  ? 215 LYS F CA  1 
ATOM   9579  C C   . LYS F  2 219 ? 58.276  21.445  -5.623  1.00 77.17  ? 215 LYS F C   1 
ATOM   9580  O O   . LYS F  2 219 ? 57.345  20.883  -5.042  1.00 75.91  ? 215 LYS F O   1 
ATOM   9581  C CB  . LYS F  2 219 ? 58.613  23.871  -5.260  1.00 78.45  ? 215 LYS F CB  1 
ATOM   9582  C CG  . LYS F  2 219 ? 58.379  25.314  -5.674  1.00 81.43  ? 215 LYS F CG  1 
ATOM   9583  C CD  . LYS F  2 219 ? 58.201  26.198  -4.442  1.00 83.69  ? 215 LYS F CD  1 
ATOM   9584  C CE  . LYS F  2 219 ? 56.980  25.757  -3.633  1.00 84.04  ? 215 LYS F CE  1 
ATOM   9585  N NZ  . LYS F  2 219 ? 56.819  26.536  -2.375  1.00 84.79  ? 215 LYS F NZ  1 
ATOM   9586  N N   . ALA F  2 220 ? 59.482  20.906  -5.743  1.00 79.08  ? 216 ALA F N   1 
ATOM   9587  C CA  . ALA F  2 220 ? 59.779  19.599  -5.176  1.00 81.54  ? 216 ALA F CA  1 
ATOM   9588  C C   . ALA F  2 220 ? 60.481  19.761  -3.822  1.00 82.37  ? 216 ALA F C   1 
ATOM   9589  O O   . ALA F  2 220 ? 60.796  20.918  -3.459  1.00 82.72  ? 216 ALA F O   1 
ATOM   9590  C CB  . ALA F  2 220 ? 60.653  18.804  -6.142  1.00 81.82  ? 216 ALA F CB  1 
ATOM   9591  N N   . ILE G  1 1   ? 17.828  22.940  -65.437 1.00 86.75  ? 1   ILE G N   1 
ATOM   9592  C CA  . ILE G  1 1   ? 17.581  23.961  -64.374 1.00 87.19  ? 1   ILE G CA  1 
ATOM   9593  C C   . ILE G  1 1   ? 18.267  23.572  -63.062 1.00 86.02  ? 1   ILE G C   1 
ATOM   9594  O O   . ILE G  1 1   ? 18.624  24.437  -62.253 1.00 86.10  ? 1   ILE G O   1 
ATOM   9595  C CB  . ILE G  1 1   ? 16.053  24.153  -64.124 1.00 88.63  ? 1   ILE G CB  1 
ATOM   9596  C CG1 . ILE G  1 1   ? 15.412  24.845  -65.336 1.00 89.64  ? 1   ILE G CG1 1 
ATOM   9597  C CG2 . ILE G  1 1   ? 15.818  24.964  -62.846 1.00 89.22  ? 1   ILE G CG2 1 
ATOM   9598  C CD1 . ILE G  1 1   ? 13.926  25.135  -65.184 1.00 89.61  ? 1   ILE G CD1 1 
ATOM   9599  N N   . LYS G  1 2   ? 18.453  22.268  -62.865 1.00 83.74  ? 2   LYS G N   1 
ATOM   9600  C CA  . LYS G  1 2   ? 19.095  21.742  -61.659 1.00 80.32  ? 2   LYS G CA  1 
ATOM   9601  C C   . LYS G  1 2   ? 20.412  21.049  -61.999 1.00 76.86  ? 2   LYS G C   1 
ATOM   9602  O O   . LYS G  1 2   ? 20.454  19.828  -62.157 1.00 78.21  ? 2   LYS G O   1 
ATOM   9603  C CB  . LYS G  1 2   ? 18.165  20.742  -60.958 1.00 80.17  ? 2   LYS G CB  1 
ATOM   9604  C CG  . LYS G  1 2   ? 18.787  20.049  -59.749 1.00 80.52  ? 2   LYS G CG  1 
ATOM   9605  C CD  . LYS G  1 2   ? 17.995  18.814  -59.334 1.00 81.17  ? 2   LYS G CD  1 
ATOM   9606  C CE  . LYS G  1 2   ? 18.002  17.759  -60.432 1.00 80.34  ? 2   LYS G CE  1 
ATOM   9607  N NZ  . LYS G  1 2   ? 19.388  17.356  -60.796 1.00 79.74  ? 2   LYS G NZ  1 
ATOM   9608  N N   . GLU G  1 3   ? 21.484  21.822  -62.124 1.00 72.08  ? 3   GLU G N   1 
ATOM   9609  C CA  . GLU G  1 3   ? 22.782  21.235  -62.435 1.00 67.59  ? 3   GLU G CA  1 
ATOM   9610  C C   . GLU G  1 3   ? 23.613  21.120  -61.168 1.00 62.98  ? 3   GLU G C   1 
ATOM   9611  O O   . GLU G  1 3   ? 24.484  21.946  -60.908 1.00 60.77  ? 3   GLU G O   1 
ATOM   9612  C CB  . GLU G  1 3   ? 23.534  22.072  -63.476 1.00 67.90  ? 3   GLU G CB  1 
ATOM   9613  C CG  . GLU G  1 3   ? 23.064  21.870  -64.911 1.00 69.89  ? 3   GLU G CG  1 
ATOM   9614  C CD  . GLU G  1 3   ? 23.297  20.451  -65.420 1.00 70.83  ? 3   GLU G CD  1 
ATOM   9615  O OE1 . GLU G  1 3   ? 24.457  19.992  -65.395 1.00 70.13  ? 3   GLU G OE1 1 
ATOM   9616  O OE2 . GLU G  1 3   ? 22.318  19.795  -65.845 1.00 73.03  ? 3   GLU G OE2 1 
ATOM   9617  N N   . GLU G  1 4   ? 23.326  20.094  -60.373 1.00 59.29  ? 4   GLU G N   1 
ATOM   9618  C CA  . GLU G  1 4   ? 24.058  19.871  -59.132 1.00 54.90  ? 4   GLU G CA  1 
ATOM   9619  C C   . GLU G  1 4   ? 25.055  18.750  -59.362 1.00 50.51  ? 4   GLU G C   1 
ATOM   9620  O O   . GLU G  1 4   ? 24.701  17.693  -59.875 1.00 50.26  ? 4   GLU G O   1 
ATOM   9621  C CB  . GLU G  1 4   ? 23.093  19.506  -58.001 1.00 55.50  ? 4   GLU G CB  1 
ATOM   9622  C CG  . GLU G  1 4   ? 21.858  20.391  -57.970 1.00 58.48  ? 4   GLU G CG  1 
ATOM   9623  C CD  . GLU G  1 4   ? 20.998  20.202  -56.735 1.00 59.57  ? 4   GLU G CD  1 
ATOM   9624  O OE1 . GLU G  1 4   ? 20.946  19.075  -56.197 1.00 60.62  ? 4   GLU G OE1 1 
ATOM   9625  O OE2 . GLU G  1 4   ? 20.356  21.186  -56.313 1.00 60.49  ? 4   GLU G OE2 1 
ATOM   9626  N N   . HIS G  1 5   ? 26.306  18.997  -58.996 1.00 45.65  ? 5   HIS G N   1 
ATOM   9627  C CA  . HIS G  1 5   ? 27.365  18.014  -59.167 1.00 42.59  ? 5   HIS G CA  1 
ATOM   9628  C C   . HIS G  1 5   ? 28.365  18.108  -58.015 1.00 40.86  ? 5   HIS G C   1 
ATOM   9629  O O   . HIS G  1 5   ? 28.393  19.096  -57.274 1.00 35.34  ? 5   HIS G O   1 
ATOM   9630  C CB  . HIS G  1 5   ? 28.108  18.251  -60.495 1.00 42.63  ? 5   HIS G CB  1 
ATOM   9631  C CG  . HIS G  1 5   ? 27.273  18.002  -61.711 1.00 42.56  ? 5   HIS G CG  1 
ATOM   9632  N ND1 . HIS G  1 5   ? 26.898  16.737  -62.113 1.00 43.53  ? 5   HIS G ND1 1 
ATOM   9633  C CD2 . HIS G  1 5   ? 26.702  18.859  -62.589 1.00 42.18  ? 5   HIS G CD2 1 
ATOM   9634  C CE1 . HIS G  1 5   ? 26.130  16.827  -63.184 1.00 43.90  ? 5   HIS G CE1 1 
ATOM   9635  N NE2 . HIS G  1 5   ? 25.995  18.104  -63.492 1.00 44.49  ? 5   HIS G NE2 1 
ATOM   9636  N N   . THR G  1 6   ? 29.176  17.063  -57.872 1.00 38.72  ? 6   THR G N   1 
ATOM   9637  C CA  . THR G  1 6   ? 30.201  17.032  -56.852 1.00 41.13  ? 6   THR G CA  1 
ATOM   9638  C C   . THR G  1 6   ? 31.513  16.561  -57.456 1.00 40.70  ? 6   THR G C   1 
ATOM   9639  O O   . THR G  1 6   ? 31.554  15.602  -58.230 1.00 43.52  ? 6   THR G O   1 
ATOM   9640  C CB  . THR G  1 6   ? 29.831  16.097  -55.679 1.00 41.68  ? 6   THR G CB  1 
ATOM   9641  O OG1 . THR G  1 6   ? 28.744  16.665  -54.940 1.00 45.52  ? 6   THR G OG1 1 
ATOM   9642  C CG2 . THR G  1 6   ? 31.012  15.935  -54.730 1.00 42.30  ? 6   THR G CG2 1 
ATOM   9643  N N   . ILE G  1 7   ? 32.584  17.261  -57.119 1.00 38.25  ? 7   ILE G N   1 
ATOM   9644  C CA  . ILE G  1 7   ? 33.898  16.888  -57.589 1.00 36.70  ? 7   ILE G CA  1 
ATOM   9645  C C   . ILE G  1 7   ? 34.714  16.698  -56.337 1.00 34.57  ? 7   ILE G C   1 
ATOM   9646  O O   . ILE G  1 7   ? 34.656  17.528  -55.428 1.00 33.12  ? 7   ILE G O   1 
ATOM   9647  C CB  . ILE G  1 7   ? 34.533  17.995  -58.431 1.00 38.97  ? 7   ILE G CB  1 
ATOM   9648  C CG1 . ILE G  1 7   ? 33.773  18.138  -59.749 1.00 39.07  ? 7   ILE G CG1 1 
ATOM   9649  C CG2 . ILE G  1 7   ? 36.013  17.693  -58.645 1.00 38.26  ? 7   ILE G CG2 1 
ATOM   9650  C CD1 . ILE G  1 7   ? 34.371  19.168  -60.683 1.00 42.32  ? 7   ILE G CD1 1 
ATOM   9651  N N   . ILE G  1 8   ? 35.458  15.603  -56.264 1.00 32.62  ? 8   ILE G N   1 
ATOM   9652  C CA  . ILE G  1 8   ? 36.266  15.369  -55.077 1.00 31.92  ? 8   ILE G CA  1 
ATOM   9653  C C   . ILE G  1 8   ? 37.715  15.006  -55.364 1.00 30.49  ? 8   ILE G C   1 
ATOM   9654  O O   . ILE G  1 8   ? 38.004  14.208  -56.258 1.00 33.17  ? 8   ILE G O   1 
ATOM   9655  C CB  . ILE G  1 8   ? 35.698  14.224  -54.205 1.00 31.23  ? 8   ILE G CB  1 
ATOM   9656  C CG1 . ILE G  1 8   ? 34.237  14.476  -53.869 1.00 31.58  ? 8   ILE G CG1 1 
ATOM   9657  C CG2 . ILE G  1 8   ? 36.501  14.125  -52.906 1.00 32.92  ? 8   ILE G CG2 1 
ATOM   9658  C CD1 . ILE G  1 8   ? 33.663  13.408  -52.973 1.00 28.64  ? 8   ILE G CD1 1 
ATOM   9659  N N   . GLN G  1 9   ? 38.626  15.601  -54.608 1.00 28.83  ? 9   GLN G N   1 
ATOM   9660  C CA  . GLN G  1 9   ? 40.034  15.259  -54.733 1.00 29.24  ? 9   GLN G CA  1 
ATOM   9661  C C   . GLN G  1 9   ? 40.288  14.444  -53.466 1.00 27.85  ? 9   GLN G C   1 
ATOM   9662  O O   . GLN G  1 9   ? 40.161  14.963  -52.358 1.00 28.31  ? 9   GLN G O   1 
ATOM   9663  C CB  . GLN G  1 9   ? 40.930  16.498  -54.736 1.00 29.73  ? 9   GLN G CB  1 
ATOM   9664  C CG  . GLN G  1 9   ? 42.415  16.142  -54.721 1.00 34.71  ? 9   GLN G CG  1 
ATOM   9665  C CD  . GLN G  1 9   ? 43.323  17.353  -54.750 1.00 37.69  ? 9   GLN G CD  1 
ATOM   9666  O OE1 . GLN G  1 9   ? 43.287  18.147  -55.696 1.00 39.40  ? 9   GLN G OE1 1 
ATOM   9667  N NE2 . GLN G  1 9   ? 44.156  17.495  -53.718 1.00 34.16  ? 9   GLN G NE2 1 
ATOM   9668  N N   . ALA G  1 10  ? 40.612  13.169  -53.631 1.00 25.80  ? 10  ALA G N   1 
ATOM   9669  C CA  . ALA G  1 10  ? 40.859  12.299  -52.486 1.00 27.36  ? 10  ALA G CA  1 
ATOM   9670  C C   . ALA G  1 10  ? 42.289  11.785  -52.503 1.00 27.63  ? 10  ALA G C   1 
ATOM   9671  O O   . ALA G  1 10  ? 42.765  11.279  -53.527 1.00 26.86  ? 10  ALA G O   1 
ATOM   9672  C CB  . ALA G  1 10  ? 39.878  11.118  -52.500 1.00 28.97  ? 10  ALA G CB  1 
ATOM   9673  N N   . GLN G  1 11  ? 42.968  11.901  -51.365 1.00 27.19  ? 11  GLN G N   1 
ATOM   9674  C CA  . GLN G  1 11  ? 44.356  11.459  -51.283 1.00 30.38  ? 11  GLN G CA  1 
ATOM   9675  C C   . GLN G  1 11  ? 44.702  10.935  -49.906 1.00 30.36  ? 11  GLN G C   1 
ATOM   9676  O O   . GLN G  1 11  ? 44.148  11.377  -48.897 1.00 30.65  ? 11  GLN G O   1 
ATOM   9677  C CB  . GLN G  1 11  ? 45.293  12.616  -51.631 1.00 31.32  ? 11  GLN G CB  1 
ATOM   9678  C CG  . GLN G  1 11  ? 45.246  13.755  -50.616 1.00 37.95  ? 11  GLN G CG  1 
ATOM   9679  C CD  . GLN G  1 11  ? 45.860  15.031  -51.151 1.00 43.10  ? 11  GLN G CD  1 
ATOM   9680  O OE1 . GLN G  1 11  ? 45.301  15.675  -52.041 1.00 49.24  ? 11  GLN G OE1 1 
ATOM   9681  N NE2 . GLN G  1 11  ? 47.021  15.395  -50.628 1.00 43.60  ? 11  GLN G NE2 1 
ATOM   9682  N N   . PHE G  1 12  ? 45.636  9.995   -49.872 1.00 29.84  ? 12  PHE G N   1 
ATOM   9683  C CA  . PHE G  1 12  ? 46.055  9.412   -48.612 1.00 28.87  ? 12  PHE G CA  1 
ATOM   9684  C C   . PHE G  1 12  ? 47.454  8.835   -48.656 1.00 29.17  ? 12  PHE G C   1 
ATOM   9685  O O   . PHE G  1 12  ? 48.022  8.602   -49.720 1.00 27.96  ? 12  PHE G O   1 
ATOM   9686  C CB  . PHE G  1 12  ? 45.082  8.301   -48.207 1.00 29.99  ? 12  PHE G CB  1 
ATOM   9687  C CG  . PHE G  1 12  ? 45.239  7.018   -48.997 1.00 29.04  ? 12  PHE G CG  1 
ATOM   9688  C CD1 . PHE G  1 12  ? 46.346  6.185   -48.808 1.00 27.95  ? 12  PHE G CD1 1 
ATOM   9689  C CD2 . PHE G  1 12  ? 44.256  6.624   -49.899 1.00 30.48  ? 12  PHE G CD2 1 
ATOM   9690  C CE1 . PHE G  1 12  ? 46.464  4.982   -49.499 1.00 30.79  ? 12  PHE G CE1 1 
ATOM   9691  C CE2 . PHE G  1 12  ? 44.363  5.419   -50.600 1.00 31.18  ? 12  PHE G CE2 1 
ATOM   9692  C CZ  . PHE G  1 12  ? 45.467  4.595   -50.402 1.00 31.24  ? 12  PHE G CZ  1 
ATOM   9693  N N   . TYR G  1 13  ? 47.998  8.610   -47.469 1.00 30.34  ? 13  TYR G N   1 
ATOM   9694  C CA  . TYR G  1 13  ? 49.290  7.979   -47.329 1.00 31.15  ? 13  TYR G CA  1 
ATOM   9695  C C   . TYR G  1 13  ? 49.047  7.023   -46.179 1.00 29.78  ? 13  TYR G C   1 
ATOM   9696  O O   . TYR G  1 13  ? 48.460  7.407   -45.184 1.00 32.53  ? 13  TYR G O   1 
ATOM   9697  C CB  . TYR G  1 13  ? 50.399  8.966   -46.966 1.00 32.16  ? 13  TYR G CB  1 
ATOM   9698  C CG  . TYR G  1 13  ? 51.746  8.297   -47.058 1.00 34.63  ? 13  TYR G CG  1 
ATOM   9699  C CD1 . TYR G  1 13  ? 52.236  7.868   -48.285 1.00 36.44  ? 13  TYR G CD1 1 
ATOM   9700  C CD2 . TYR G  1 13  ? 52.489  8.006   -45.914 1.00 37.60  ? 13  TYR G CD2 1 
ATOM   9701  C CE1 . TYR G  1 13  ? 53.438  7.155   -48.381 1.00 40.05  ? 13  TYR G CE1 1 
ATOM   9702  C CE2 . TYR G  1 13  ? 53.701  7.285   -45.996 1.00 39.50  ? 13  TYR G CE2 1 
ATOM   9703  C CZ  . TYR G  1 13  ? 54.160  6.865   -47.236 1.00 40.60  ? 13  TYR G CZ  1 
ATOM   9704  O OH  . TYR G  1 13  ? 55.323  6.138   -47.348 1.00 44.07  ? 13  TYR G OH  1 
ATOM   9705  N N   . LEU G  1 14  ? 49.500  5.785   -46.314 1.00 32.12  ? 14  LEU G N   1 
ATOM   9706  C CA  . LEU G  1 14  ? 49.280  4.758   -45.297 1.00 31.49  ? 14  LEU G CA  1 
ATOM   9707  C C   . LEU G  1 14  ? 50.538  4.035   -44.813 1.00 34.06  ? 14  LEU G C   1 
ATOM   9708  O O   . LEU G  1 14  ? 51.407  3.685   -45.614 1.00 33.71  ? 14  LEU G O   1 
ATOM   9709  C CB  . LEU G  1 14  ? 48.318  3.717   -45.864 1.00 28.56  ? 14  LEU G CB  1 
ATOM   9710  C CG  . LEU G  1 14  ? 48.158  2.394   -45.129 1.00 29.40  ? 14  LEU G CG  1 
ATOM   9711  C CD1 . LEU G  1 14  ? 47.298  2.566   -43.887 1.00 23.82  ? 14  LEU G CD1 1 
ATOM   9712  C CD2 . LEU G  1 14  ? 47.505  1.403   -46.084 1.00 29.44  ? 14  LEU G CD2 1 
ATOM   9713  N N   . LEU G  1 15  ? 50.612  3.802   -43.503 1.00 34.24  ? 15  LEU G N   1 
ATOM   9714  C CA  . LEU G  1 15  ? 51.724  3.083   -42.896 1.00 35.80  ? 15  LEU G CA  1 
ATOM   9715  C C   . LEU G  1 15  ? 51.166  1.889   -42.128 1.00 36.40  ? 15  LEU G C   1 
ATOM   9716  O O   . LEU G  1 15  ? 50.046  1.935   -41.632 1.00 38.91  ? 15  LEU G O   1 
ATOM   9717  C CB  . LEU G  1 15  ? 52.515  3.982   -41.955 1.00 36.00  ? 15  LEU G CB  1 
ATOM   9718  C CG  . LEU G  1 15  ? 53.609  4.854   -42.580 1.00 37.76  ? 15  LEU G CG  1 
ATOM   9719  C CD1 . LEU G  1 15  ? 54.291  5.674   -41.476 1.00 35.84  ? 15  LEU G CD1 1 
ATOM   9720  C CD2 . LEU G  1 15  ? 54.639  3.975   -43.295 1.00 36.68  ? 15  LEU G CD2 1 
ATOM   9721  N N   . PRO G  1 16  ? 51.965  0.823   -41.970 1.00 37.77  ? 16  PRO G N   1 
ATOM   9722  C CA  . PRO G  1 16  ? 53.351  0.669   -42.447 1.00 39.50  ? 16  PRO G CA  1 
ATOM   9723  C C   . PRO G  1 16  ? 53.566  0.285   -43.914 1.00 40.36  ? 16  PRO G C   1 
ATOM   9724  O O   . PRO G  1 16  ? 54.709  0.198   -44.364 1.00 43.34  ? 16  PRO G O   1 
ATOM   9725  C CB  . PRO G  1 16  ? 53.906  -0.390  -41.502 1.00 35.77  ? 16  PRO G CB  1 
ATOM   9726  C CG  . PRO G  1 16  ? 52.736  -1.326  -41.386 1.00 35.25  ? 16  PRO G CG  1 
ATOM   9727  C CD  . PRO G  1 16  ? 51.527  -0.387  -41.245 1.00 36.08  ? 16  PRO G CD  1 
ATOM   9728  N N   . ASP G  1 17  ? 52.487  0.066   -44.659 1.00 41.69  ? 17  ASP G N   1 
ATOM   9729  C CA  . ASP G  1 17  ? 52.582  -0.338  -46.071 1.00 42.43  ? 17  ASP G CA  1 
ATOM   9730  C C   . ASP G  1 17  ? 53.260  0.658   -47.018 1.00 42.31  ? 17  ASP G C   1 
ATOM   9731  O O   . ASP G  1 17  ? 53.661  0.290   -48.119 1.00 42.91  ? 17  ASP G O   1 
ATOM   9732  C CB  . ASP G  1 17  ? 51.183  -0.650  -46.609 1.00 43.48  ? 17  ASP G CB  1 
ATOM   9733  C CG  . ASP G  1 17  ? 50.339  -1.414  -45.609 1.00 45.88  ? 17  ASP G CG  1 
ATOM   9734  O OD1 . ASP G  1 17  ? 50.112  -0.882  -44.502 1.00 48.08  ? 17  ASP G OD1 1 
ATOM   9735  O OD2 . ASP G  1 17  ? 49.909  -2.545  -45.922 1.00 48.52  ? 17  ASP G OD2 1 
ATOM   9736  N N   . LYS G  1 18  ? 53.381  1.911   -46.596 1.00 42.61  ? 18  LYS G N   1 
ATOM   9737  C CA  . LYS G  1 18  ? 53.981  2.949   -47.429 1.00 43.74  ? 18  LYS G CA  1 
ATOM   9738  C C   . LYS G  1 18  ? 53.258  3.094   -48.760 1.00 43.18  ? 18  LYS G C   1 
ATOM   9739  O O   . LYS G  1 18  ? 53.882  3.271   -49.799 1.00 44.16  ? 18  LYS G O   1 
ATOM   9740  C CB  . LYS G  1 18  ? 55.461  2.662   -47.658 1.00 46.36  ? 18  LYS G CB  1 
ATOM   9741  C CG  . LYS G  1 18  ? 56.257  2.772   -46.375 1.00 51.57  ? 18  LYS G CG  1 
ATOM   9742  C CD  . LYS G  1 18  ? 57.754  2.724   -46.596 1.00 52.19  ? 18  LYS G CD  1 
ATOM   9743  C CE  . LYS G  1 18  ? 58.473  2.909   -45.266 1.00 55.78  ? 18  LYS G CE  1 
ATOM   9744  N NZ  . LYS G  1 18  ? 59.941  2.642   -45.361 1.00 59.97  ? 18  LYS G NZ  1 
ATOM   9745  N N   . ARG G  1 19  ? 51.932  3.021   -48.711 1.00 42.86  ? 19  ARG G N   1 
ATOM   9746  C CA  . ARG G  1 19  ? 51.102  3.150   -49.898 1.00 43.46  ? 19  ARG G CA  1 
ATOM   9747  C C   . ARG G  1 19  ? 50.501  4.560   -49.964 1.00 42.04  ? 19  ARG G C   1 
ATOM   9748  O O   . ARG G  1 19  ? 50.212  5.177   -48.939 1.00 41.71  ? 19  ARG G O   1 
ATOM   9749  C CB  . ARG G  1 19  ? 49.980  2.105   -49.872 1.00 46.66  ? 19  ARG G CB  1 
ATOM   9750  C CG  . ARG G  1 19  ? 50.412  0.657   -50.097 1.00 50.82  ? 19  ARG G CG  1 
ATOM   9751  C CD  . ARG G  1 19  ? 50.978  0.446   -51.499 1.00 56.91  ? 19  ARG G CD  1 
ATOM   9752  N NE  . ARG G  1 19  ? 52.398  0.792   -51.584 1.00 62.68  ? 19  ARG G NE  1 
ATOM   9753  C CZ  . ARG G  1 19  ? 53.038  1.089   -52.715 1.00 65.21  ? 19  ARG G CZ  1 
ATOM   9754  N NH1 . ARG G  1 19  ? 52.390  1.091   -53.877 1.00 66.79  ? 19  ARG G NH1 1 
ATOM   9755  N NH2 . ARG G  1 19  ? 54.335  1.384   -52.687 1.00 66.10  ? 19  ARG G NH2 1 
ATOM   9756  N N   . GLY G  1 20  ? 50.320  5.068   -51.175 1.00 40.68  ? 20  GLY G N   1 
ATOM   9757  C CA  . GLY G  1 20  ? 49.759  6.395   -51.336 1.00 37.93  ? 20  GLY G CA  1 
ATOM   9758  C C   . GLY G  1 20  ? 48.975  6.500   -52.623 1.00 36.31  ? 20  GLY G C   1 
ATOM   9759  O O   . GLY G  1 20  ? 49.367  5.936   -53.636 1.00 37.92  ? 20  GLY G O   1 
ATOM   9760  N N   . GLU G  1 21  ? 47.852  7.201   -52.594 1.00 35.43  ? 21  GLU G N   1 
ATOM   9761  C CA  . GLU G  1 21  ? 47.059  7.362   -53.804 1.00 35.10  ? 21  GLU G CA  1 
ATOM   9762  C C   . GLU G  1 21  ? 46.470  8.766   -53.890 1.00 32.96  ? 21  GLU G C   1 
ATOM   9763  O O   . GLU G  1 21  ? 46.298  9.440   -52.876 1.00 33.08  ? 21  GLU G O   1 
ATOM   9764  C CB  . GLU G  1 21  ? 45.937  6.309   -53.872 1.00 36.92  ? 21  GLU G CB  1 
ATOM   9765  C CG  . GLU G  1 21  ? 46.452  4.879   -54.029 1.00 39.09  ? 21  GLU G CG  1 
ATOM   9766  C CD  . GLU G  1 21  ? 45.363  3.842   -54.303 1.00 41.03  ? 21  GLU G CD  1 
ATOM   9767  O OE1 . GLU G  1 21  ? 45.736  2.690   -54.627 1.00 42.14  ? 21  GLU G OE1 1 
ATOM   9768  O OE2 . GLU G  1 21  ? 44.153  4.160   -54.198 1.00 38.98  ? 21  GLU G OE2 1 
ATOM   9769  N N   . PHE G  1 22  ? 46.182  9.193   -55.116 1.00 30.08  ? 22  PHE G N   1 
ATOM   9770  C CA  . PHE G  1 22  ? 45.602  10.496  -55.385 1.00 30.17  ? 22  PHE G CA  1 
ATOM   9771  C C   . PHE G  1 22  ? 44.582  10.328  -56.508 1.00 31.26  ? 22  PHE G C   1 
ATOM   9772  O O   . PHE G  1 22  ? 44.894  9.731   -57.532 1.00 32.68  ? 22  PHE G O   1 
ATOM   9773  C CB  . PHE G  1 22  ? 46.692  11.463  -55.834 1.00 27.29  ? 22  PHE G CB  1 
ATOM   9774  C CG  . PHE G  1 22  ? 46.194  12.844  -56.157 1.00 25.77  ? 22  PHE G CG  1 
ATOM   9775  C CD1 . PHE G  1 22  ? 46.356  13.880  -55.247 1.00 27.58  ? 22  PHE G CD1 1 
ATOM   9776  C CD2 . PHE G  1 22  ? 45.616  13.120  -57.390 1.00 24.68  ? 22  PHE G CD2 1 
ATOM   9777  C CE1 . PHE G  1 22  ? 45.954  15.188  -55.564 1.00 29.04  ? 22  PHE G CE1 1 
ATOM   9778  C CE2 . PHE G  1 22  ? 45.210  14.407  -57.721 1.00 28.33  ? 22  PHE G CE2 1 
ATOM   9779  C CZ  . PHE G  1 22  ? 45.381  15.454  -56.802 1.00 29.10  ? 22  PHE G CZ  1 
ATOM   9780  N N   . MET G  1 23  ? 43.372  10.848  -56.334 1.00 30.25  ? 23  MET G N   1 
ATOM   9781  C CA  . MET G  1 23  ? 42.368  10.725  -57.390 1.00 31.05  ? 23  MET G CA  1 
ATOM   9782  C C   . MET G  1 23  ? 41.302  11.804  -57.367 1.00 31.99  ? 23  MET G C   1 
ATOM   9783  O O   . MET G  1 23  ? 41.075  12.483  -56.352 1.00 30.83  ? 23  MET G O   1 
ATOM   9784  C CB  . MET G  1 23  ? 41.681  9.348   -57.345 1.00 29.34  ? 23  MET G CB  1 
ATOM   9785  C CG  . MET G  1 23  ? 40.848  9.058   -56.086 1.00 33.20  ? 23  MET G CG  1 
ATOM   9786  S SD  . MET G  1 23  ? 39.139  9.729   -56.053 1.00 37.21  ? 23  MET G SD  1 
ATOM   9787  C CE  . MET G  1 23  ? 38.328  8.606   -57.221 1.00 38.59  ? 23  MET G CE  1 
ATOM   9788  N N   . PHE G  1 24  ? 40.659  11.957  -58.517 1.00 32.03  ? 24  PHE G N   1 
ATOM   9789  C CA  . PHE G  1 24  ? 39.577  12.904  -58.677 1.00 33.57  ? 24  PHE G CA  1 
ATOM   9790  C C   . PHE G  1 24  ? 38.314  12.102  -58.887 1.00 34.11  ? 24  PHE G C   1 
ATOM   9791  O O   . PHE G  1 24  ? 38.323  11.054  -59.538 1.00 33.81  ? 24  PHE G O   1 
ATOM   9792  C CB  . PHE G  1 24  ? 39.822  13.820  -59.875 1.00 33.75  ? 24  PHE G CB  1 
ATOM   9793  C CG  . PHE G  1 24  ? 40.382  15.172  -59.500 1.00 37.47  ? 24  PHE G CG  1 
ATOM   9794  C CD1 . PHE G  1 24  ? 41.554  15.274  -58.763 1.00 36.19  ? 24  PHE G CD1 1 
ATOM   9795  C CD2 . PHE G  1 24  ? 39.734  16.342  -59.890 1.00 36.49  ? 24  PHE G CD2 1 
ATOM   9796  C CE1 . PHE G  1 24  ? 42.069  16.523  -58.424 1.00 39.21  ? 24  PHE G CE1 1 
ATOM   9797  C CE2 . PHE G  1 24  ? 40.245  17.585  -59.553 1.00 37.48  ? 24  PHE G CE2 1 
ATOM   9798  C CZ  . PHE G  1 24  ? 41.412  17.680  -58.819 1.00 35.46  ? 24  PHE G CZ  1 
ATOM   9799  N N   . ASP G  1 25  ? 37.225  12.598  -58.327 1.00 34.67  ? 25  ASP G N   1 
ATOM   9800  C CA  . ASP G  1 25  ? 35.957  11.918  -58.447 1.00 36.42  ? 25  ASP G CA  1 
ATOM   9801  C C   . ASP G  1 25  ? 34.913  12.894  -58.964 1.00 36.21  ? 25  ASP G C   1 
ATOM   9802  O O   . ASP G  1 25  ? 34.934  14.080  -58.635 1.00 36.50  ? 25  ASP G O   1 
ATOM   9803  C CB  . ASP G  1 25  ? 35.556  11.350  -57.082 1.00 38.91  ? 25  ASP G CB  1 
ATOM   9804  C CG  . ASP G  1 25  ? 34.176  10.722  -57.086 1.00 44.95  ? 25  ASP G CG  1 
ATOM   9805  O OD1 . ASP G  1 25  ? 33.178  11.476  -57.196 1.00 48.07  ? 25  ASP G OD1 1 
ATOM   9806  O OD2 . ASP G  1 25  ? 34.088  9.475   -56.977 1.00 47.22  ? 25  ASP G OD2 1 
ATOM   9807  N N   . PHE G  1 26  ? 34.018  12.385  -59.800 1.00 34.71  ? 26  PHE G N   1 
ATOM   9808  C CA  . PHE G  1 26  ? 32.944  13.189  -60.362 1.00 34.12  ? 26  PHE G CA  1 
ATOM   9809  C C   . PHE G  1 26  ? 31.641  12.442  -60.147 1.00 32.79  ? 26  PHE G C   1 
ATOM   9810  O O   . PHE G  1 26  ? 31.416  11.400  -60.748 1.00 32.50  ? 26  PHE G O   1 
ATOM   9811  C CB  . PHE G  1 26  ? 33.152  13.414  -61.862 1.00 34.10  ? 26  PHE G CB  1 
ATOM   9812  C CG  . PHE G  1 26  ? 32.123  14.301  -62.474 1.00 32.68  ? 26  PHE G CG  1 
ATOM   9813  C CD1 . PHE G  1 26  ? 32.175  15.671  -62.279 1.00 34.77  ? 26  PHE G CD1 1 
ATOM   9814  C CD2 . PHE G  1 26  ? 31.058  13.762  -63.188 1.00 34.33  ? 26  PHE G CD2 1 
ATOM   9815  C CE1 . PHE G  1 26  ? 31.181  16.504  -62.781 1.00 34.49  ? 26  PHE G CE1 1 
ATOM   9816  C CE2 . PHE G  1 26  ? 30.060  14.571  -63.694 1.00 35.76  ? 26  PHE G CE2 1 
ATOM   9817  C CZ  . PHE G  1 26  ? 30.118  15.957  -63.490 1.00 37.99  ? 26  PHE G CZ  1 
ATOM   9818  N N   . ASP G  1 27  ? 30.797  12.987  -59.281 1.00 34.72  ? 27  ASP G N   1 
ATOM   9819  C CA  . ASP G  1 27  ? 29.506  12.399  -58.943 1.00 36.42  ? 27  ASP G CA  1 
ATOM   9820  C C   . ASP G  1 27  ? 29.584  10.938  -58.485 1.00 36.65  ? 27  ASP G C   1 
ATOM   9821  O O   . ASP G  1 27  ? 28.657  10.167  -58.708 1.00 36.86  ? 27  ASP G O   1 
ATOM   9822  C CB  . ASP G  1 27  ? 28.543  12.515  -60.127 1.00 38.87  ? 27  ASP G CB  1 
ATOM   9823  C CG  . ASP G  1 27  ? 28.189  13.963  -60.460 1.00 43.03  ? 27  ASP G CG  1 
ATOM   9824  O OD1 . ASP G  1 27  ? 28.103  14.796  -59.536 1.00 42.79  ? 27  ASP G OD1 1 
ATOM   9825  O OD2 . ASP G  1 27  ? 27.971  14.269  -61.652 1.00 46.69  ? 27  ASP G OD2 1 
ATOM   9826  N N   . GLY G  1 28  ? 30.689  10.554  -57.850 1.00 35.39  ? 28  GLY G N   1 
ATOM   9827  C CA  . GLY G  1 28  ? 30.812  9.185   -57.385 1.00 33.58  ? 28  GLY G CA  1 
ATOM   9828  C C   . GLY G  1 28  ? 31.615  8.278   -58.304 1.00 35.44  ? 28  GLY G C   1 
ATOM   9829  O O   . GLY G  1 28  ? 31.855  7.105   -57.983 1.00 33.59  ? 28  GLY G O   1 
ATOM   9830  N N   . ASP G  1 29  ? 32.016  8.795   -59.460 1.00 33.73  ? 29  ASP G N   1 
ATOM   9831  C CA  . ASP G  1 29  ? 32.818  7.994   -60.371 1.00 34.60  ? 29  ASP G CA  1 
ATOM   9832  C C   . ASP G  1 29  ? 34.199  8.613   -60.496 1.00 34.40  ? 29  ASP G C   1 
ATOM   9833  O O   . ASP G  1 29  ? 34.349  9.831   -60.408 1.00 35.50  ? 29  ASP G O   1 
ATOM   9834  C CB  . ASP G  1 29  ? 32.139  7.880   -61.736 1.00 34.40  ? 29  ASP G CB  1 
ATOM   9835  C CG  . ASP G  1 29  ? 30.874  7.045   -61.678 1.00 37.30  ? 29  ASP G CG  1 
ATOM   9836  O OD1 . ASP G  1 29  ? 30.916  5.967   -61.037 1.00 39.93  ? 29  ASP G OD1 1 
ATOM   9837  O OD2 . ASP G  1 29  ? 29.846  7.453   -62.268 1.00 33.44  ? 29  ASP G OD2 1 
ATOM   9838  N N   . GLU G  1 30  ? 35.203  7.765   -60.682 1.00 32.94  ? 30  GLU G N   1 
ATOM   9839  C CA  . GLU G  1 30  ? 36.580  8.214   -60.803 1.00 34.78  ? 30  GLU G CA  1 
ATOM   9840  C C   . GLU G  1 30  ? 36.939  8.772   -62.187 1.00 34.95  ? 30  GLU G C   1 
ATOM   9841  O O   . GLU G  1 30  ? 36.664  8.142   -63.205 1.00 35.87  ? 30  GLU G O   1 
ATOM   9842  C CB  . GLU G  1 30  ? 37.535  7.061   -60.475 1.00 35.54  ? 30  GLU G CB  1 
ATOM   9843  C CG  . GLU G  1 30  ? 38.968  7.307   -60.966 1.00 40.69  ? 30  GLU G CG  1 
ATOM   9844  C CD  . GLU G  1 30  ? 39.863  6.085   -60.848 1.00 44.64  ? 30  GLU G CD  1 
ATOM   9845  O OE1 . GLU G  1 30  ? 39.327  4.949   -60.834 1.00 46.81  ? 30  GLU G OE1 1 
ATOM   9846  O OE2 . GLU G  1 30  ? 41.103  6.256   -60.790 1.00 45.02  ? 30  GLU G OE2 1 
ATOM   9847  N N   . ILE G  1 31  ? 37.567  9.948   -62.208 1.00 35.10  ? 31  ILE G N   1 
ATOM   9848  C CA  . ILE G  1 31  ? 38.001  10.582  -63.457 1.00 34.92  ? 31  ILE G CA  1 
ATOM   9849  C C   . ILE G  1 31  ? 39.409  10.053  -63.736 1.00 34.96  ? 31  ILE G C   1 
ATOM   9850  O O   . ILE G  1 31  ? 39.703  9.563   -64.819 1.00 36.52  ? 31  ILE G O   1 
ATOM   9851  C CB  . ILE G  1 31  ? 38.072  12.129  -63.328 1.00 34.25  ? 31  ILE G CB  1 
ATOM   9852  C CG1 . ILE G  1 31  ? 36.758  12.684  -62.777 1.00 33.74  ? 31  ILE G CG1 1 
ATOM   9853  C CG2 . ILE G  1 31  ? 38.336  12.755  -64.693 1.00 35.80  ? 31  ILE G CG2 1 
ATOM   9854  C CD1 . ILE G  1 31  ? 36.742  14.206  -62.670 1.00 32.35  ? 31  ILE G CD1 1 
ATOM   9855  N N   . PHE G  1 32  ? 40.283  10.158  -62.746 1.00 34.34  ? 32  PHE G N   1 
ATOM   9856  C CA  . PHE G  1 32  ? 41.645  9.658   -62.890 1.00 34.21  ? 32  PHE G CA  1 
ATOM   9857  C C   . PHE G  1 32  ? 42.282  9.543   -61.512 1.00 33.86  ? 32  PHE G C   1 
ATOM   9858  O O   . PHE G  1 32  ? 41.741  10.022  -60.514 1.00 33.67  ? 32  PHE G O   1 
ATOM   9859  C CB  . PHE G  1 32  ? 42.500  10.615  -63.732 1.00 34.57  ? 32  PHE G CB  1 
ATOM   9860  C CG  . PHE G  1 32  ? 42.861  11.899  -63.011 1.00 33.67  ? 32  PHE G CG  1 
ATOM   9861  C CD1 . PHE G  1 32  ? 42.018  13.007  -63.059 1.00 33.67  ? 32  PHE G CD1 1 
ATOM   9862  C CD2 . PHE G  1 32  ? 44.023  11.980  -62.250 1.00 30.34  ? 32  PHE G CD2 1 
ATOM   9863  C CE1 . PHE G  1 32  ? 42.332  14.168  -62.366 1.00 30.96  ? 32  PHE G CE1 1 
ATOM   9864  C CE2 . PHE G  1 32  ? 44.339  13.128  -61.563 1.00 29.54  ? 32  PHE G CE2 1 
ATOM   9865  C CZ  . PHE G  1 32  ? 43.491  14.231  -61.618 1.00 30.96  ? 32  PHE G CZ  1 
ATOM   9866  N N   . HIS G  1 33  ? 43.442  8.908   -61.471 1.00 33.41  ? 33  HIS G N   1 
ATOM   9867  C CA  . HIS G  1 33  ? 44.187  8.773   -60.235 1.00 35.51  ? 33  HIS G CA  1 
ATOM   9868  C C   . HIS G  1 33  ? 45.655  8.824   -60.622 1.00 38.26  ? 33  HIS G C   1 
ATOM   9869  O O   . HIS G  1 33  ? 45.996  8.772   -61.807 1.00 39.81  ? 33  HIS G O   1 
ATOM   9870  C CB  . HIS G  1 33  ? 43.875  7.449   -59.530 1.00 33.64  ? 33  HIS G CB  1 
ATOM   9871  C CG  . HIS G  1 33  ? 44.370  6.238   -60.258 1.00 32.79  ? 33  HIS G CG  1 
ATOM   9872  N ND1 . HIS G  1 33  ? 43.547  5.447   -61.030 1.00 31.60  ? 33  HIS G ND1 1 
ATOM   9873  C CD2 . HIS G  1 33  ? 45.604  5.686   -60.334 1.00 31.32  ? 33  HIS G CD2 1 
ATOM   9874  C CE1 . HIS G  1 33  ? 44.252  4.458   -61.549 1.00 32.02  ? 33  HIS G CE1 1 
ATOM   9875  N NE2 . HIS G  1 33  ? 45.502  4.580   -61.142 1.00 36.36  ? 33  HIS G NE2 1 
ATOM   9876  N N   . VAL G  1 34  ? 46.526  8.928   -59.635 1.00 39.80  ? 34  VAL G N   1 
ATOM   9877  C CA  . VAL G  1 34  ? 47.941  8.978   -59.924 1.00 45.81  ? 34  VAL G CA  1 
ATOM   9878  C C   . VAL G  1 34  ? 48.677  7.867   -59.203 1.00 51.29  ? 34  VAL G C   1 
ATOM   9879  O O   . VAL G  1 34  ? 48.514  7.676   -57.997 1.00 50.49  ? 34  VAL G O   1 
ATOM   9880  C CB  . VAL G  1 34  ? 48.554  10.340  -59.519 1.00 45.08  ? 34  VAL G CB  1 
ATOM   9881  C CG1 . VAL G  1 34  ? 50.069  10.286  -59.619 1.00 43.95  ? 34  VAL G CG1 1 
ATOM   9882  C CG2 . VAL G  1 34  ? 48.023  11.434  -60.429 1.00 43.16  ? 34  VAL G CG2 1 
ATOM   9883  N N   . ASP G  1 35  ? 49.474  7.127   -59.966 1.00 58.03  ? 35  ASP G N   1 
ATOM   9884  C CA  . ASP G  1 35  ? 50.285  6.033   -59.436 1.00 63.96  ? 35  ASP G CA  1 
ATOM   9885  C C   . ASP G  1 35  ? 51.451  6.672   -58.668 1.00 65.50  ? 35  ASP G C   1 
ATOM   9886  O O   . ASP G  1 35  ? 52.377  7.211   -59.287 1.00 66.20  ? 35  ASP G O   1 
ATOM   9887  C CB  . ASP G  1 35  ? 50.854  5.200   -60.601 1.00 68.43  ? 35  ASP G CB  1 
ATOM   9888  C CG  . ASP G  1 35  ? 50.384  3.750   -60.587 1.00 73.00  ? 35  ASP G CG  1 
ATOM   9889  O OD1 . ASP G  1 35  ? 49.210  3.494   -60.959 1.00 74.32  ? 35  ASP G OD1 1 
ATOM   9890  O OD2 . ASP G  1 35  ? 51.196  2.871   -60.199 1.00 73.48  ? 35  ASP G OD2 1 
ATOM   9891  N N   . ILE G  1 36  ? 51.416  6.634   -57.339 1.00 65.29  ? 36  ILE G N   1 
ATOM   9892  C CA  . ILE G  1 36  ? 52.518  7.214   -56.572 1.00 67.35  ? 36  ILE G CA  1 
ATOM   9893  C C   . ILE G  1 36  ? 53.807  6.488   -56.929 1.00 67.70  ? 36  ILE G C   1 
ATOM   9894  O O   . ILE G  1 36  ? 54.902  6.961   -56.641 1.00 66.26  ? 36  ILE G O   1 
ATOM   9895  C CB  . ILE G  1 36  ? 52.322  7.061   -55.070 1.00 67.48  ? 36  ILE G CB  1 
ATOM   9896  C CG1 . ILE G  1 36  ? 52.211  5.574   -54.723 1.00 68.33  ? 36  ILE G CG1 1 
ATOM   9897  C CG2 . ILE G  1 36  ? 51.111  7.855   -54.632 1.00 69.67  ? 36  ILE G CG2 1 
ATOM   9898  C CD1 . ILE G  1 36  ? 52.567  5.241   -53.289 1.00 68.27  ? 36  ILE G CD1 1 
ATOM   9899  N N   . GLU G  1 37  ? 53.650  5.326   -57.552 1.00 69.08  ? 37  GLU G N   1 
ATOM   9900  C CA  . GLU G  1 37  ? 54.772  4.502   -57.971 1.00 69.60  ? 37  GLU G CA  1 
ATOM   9901  C C   . GLU G  1 37  ? 55.288  4.876   -59.358 1.00 68.67  ? 37  GLU G C   1 
ATOM   9902  O O   . GLU G  1 37  ? 56.492  5.041   -59.534 1.00 68.86  ? 37  GLU G O   1 
ATOM   9903  C CB  . GLU G  1 37  ? 54.362  3.027   -57.963 1.00 70.96  ? 37  GLU G CB  1 
ATOM   9904  C CG  . GLU G  1 37  ? 54.103  2.463   -56.580 1.00 73.29  ? 37  GLU G CG  1 
ATOM   9905  C CD  . GLU G  1 37  ? 55.383  2.091   -55.856 1.00 74.85  ? 37  GLU G CD  1 
ATOM   9906  O OE1 . GLU G  1 37  ? 56.082  1.173   -56.335 1.00 77.17  ? 37  GLU G OE1 1 
ATOM   9907  O OE2 . GLU G  1 37  ? 55.696  2.711   -54.815 1.00 75.32  ? 37  GLU G OE2 1 
ATOM   9908  N N   . LYS G  1 38  ? 54.386  5.012   -60.335 1.00 67.61  ? 38  LYS G N   1 
ATOM   9909  C CA  . LYS G  1 38  ? 54.790  5.342   -61.706 1.00 65.98  ? 38  LYS G CA  1 
ATOM   9910  C C   . LYS G  1 38  ? 54.757  6.822   -62.097 1.00 64.81  ? 38  LYS G C   1 
ATOM   9911  O O   . LYS G  1 38  ? 55.246  7.185   -63.168 1.00 66.27  ? 38  LYS G O   1 
ATOM   9912  C CB  . LYS G  1 38  ? 53.964  4.537   -62.725 1.00 66.69  ? 38  LYS G CB  1 
ATOM   9913  C CG  . LYS G  1 38  ? 54.444  4.729   -64.178 1.00 68.95  ? 38  LYS G CG  1 
ATOM   9914  C CD  . LYS G  1 38  ? 53.871  3.710   -65.167 1.00 69.54  ? 38  LYS G CD  1 
ATOM   9915  C CE  . LYS G  1 38  ? 54.522  3.872   -66.550 1.00 70.51  ? 38  LYS G CE  1 
ATOM   9916  N NZ  . LYS G  1 38  ? 54.082  2.859   -67.566 1.00 70.15  ? 38  LYS G NZ  1 
ATOM   9917  N N   . SER G  1 39  ? 54.193  7.678   -61.250 1.00 61.40  ? 39  SER G N   1 
ATOM   9918  C CA  . SER G  1 39  ? 54.138  9.103   -61.568 1.00 58.45  ? 39  SER G CA  1 
ATOM   9919  C C   . SER G  1 39  ? 53.483  9.318   -62.924 1.00 56.80  ? 39  SER G C   1 
ATOM   9920  O O   . SER G  1 39  ? 53.963  10.098  -63.746 1.00 55.92  ? 39  SER G O   1 
ATOM   9921  C CB  . SER G  1 39  ? 55.547  9.696   -61.596 1.00 58.60  ? 39  SER G CB  1 
ATOM   9922  O OG  . SER G  1 39  ? 55.521  11.052  -62.017 1.00 58.98  ? 39  SER G OG  1 
ATOM   9923  N N   . GLU G  1 40  ? 52.379  8.621   -63.151 1.00 55.38  ? 40  GLU G N   1 
ATOM   9924  C CA  . GLU G  1 40  ? 51.658  8.711   -64.412 1.00 52.34  ? 40  GLU G CA  1 
ATOM   9925  C C   . GLU G  1 40  ? 50.170  8.887   -64.156 1.00 49.32  ? 40  GLU G C   1 
ATOM   9926  O O   . GLU G  1 40  ? 49.579  8.163   -63.355 1.00 50.81  ? 40  GLU G O   1 
ATOM   9927  C CB  . GLU G  1 40  ? 51.896  7.434   -65.224 1.00 54.22  ? 40  GLU G CB  1 
ATOM   9928  C CG  . GLU G  1 40  ? 51.125  7.341   -66.544 1.00 56.94  ? 40  GLU G CG  1 
ATOM   9929  C CD  . GLU G  1 40  ? 51.201  5.947   -67.174 1.00 58.18  ? 40  GLU G CD  1 
ATOM   9930  O OE1 . GLU G  1 40  ? 50.535  5.721   -68.208 1.00 58.43  ? 40  GLU G OE1 1 
ATOM   9931  O OE2 . GLU G  1 40  ? 51.924  5.077   -66.635 1.00 57.28  ? 40  GLU G OE2 1 
ATOM   9932  N N   . THR G  1 41  ? 49.568  9.857   -64.830 1.00 44.86  ? 41  THR G N   1 
ATOM   9933  C CA  . THR G  1 41  ? 48.148  10.096  -64.679 1.00 40.07  ? 41  THR G CA  1 
ATOM   9934  C C   . THR G  1 41  ? 47.458  8.966   -65.427 1.00 39.32  ? 41  THR G C   1 
ATOM   9935  O O   . THR G  1 41  ? 47.769  8.715   -66.586 1.00 40.00  ? 41  THR G O   1 
ATOM   9936  C CB  . THR G  1 41  ? 47.722  11.445  -65.305 1.00 37.78  ? 41  THR G CB  1 
ATOM   9937  O OG1 . THR G  1 41  ? 48.480  12.515  -64.733 1.00 35.75  ? 41  THR G OG1 1 
ATOM   9938  C CG2 . THR G  1 41  ? 46.261  11.708  -65.032 1.00 35.67  ? 41  THR G CG2 1 
ATOM   9939  N N   . ILE G  1 42  ? 46.531  8.283   -64.761 1.00 38.38  ? 42  ILE G N   1 
ATOM   9940  C CA  . ILE G  1 42  ? 45.802  7.179   -65.366 1.00 38.13  ? 42  ILE G CA  1 
ATOM   9941  C C   . ILE G  1 42  ? 44.316  7.526   -65.435 1.00 38.94  ? 42  ILE G C   1 
ATOM   9942  O O   . ILE G  1 42  ? 43.650  7.635   -64.406 1.00 38.69  ? 42  ILE G O   1 
ATOM   9943  C CB  . ILE G  1 42  ? 45.948  5.874   -64.534 1.00 39.74  ? 42  ILE G CB  1 
ATOM   9944  C CG1 . ILE G  1 42  ? 47.418  5.627   -64.175 1.00 39.62  ? 42  ILE G CG1 1 
ATOM   9945  C CG2 . ILE G  1 42  ? 45.360  4.693   -65.302 1.00 36.56  ? 42  ILE G CG2 1 
ATOM   9946  C CD1 . ILE G  1 42  ? 48.353  5.574   -65.355 1.00 41.52  ? 42  ILE G CD1 1 
ATOM   9947  N N   . TRP G  1 43  ? 43.798  7.693   -66.646 1.00 38.61  ? 43  TRP G N   1 
ATOM   9948  C CA  . TRP G  1 43  ? 42.394  8.019   -66.827 1.00 40.77  ? 43  TRP G CA  1 
ATOM   9949  C C   . TRP G  1 43  ? 41.493  6.792   -66.685 1.00 41.01  ? 43  TRP G C   1 
ATOM   9950  O O   . TRP G  1 43  ? 41.776  5.729   -67.232 1.00 42.61  ? 43  TRP G O   1 
ATOM   9951  C CB  . TRP G  1 43  ? 42.192  8.687   -68.191 1.00 40.79  ? 43  TRP G CB  1 
ATOM   9952  C CG  . TRP G  1 43  ? 43.052  9.891   -68.331 1.00 41.69  ? 43  TRP G CG  1 
ATOM   9953  C CD1 . TRP G  1 43  ? 44.345  9.930   -68.770 1.00 43.62  ? 43  TRP G CD1 1 
ATOM   9954  C CD2 . TRP G  1 43  ? 42.738  11.217  -67.897 1.00 42.32  ? 43  TRP G CD2 1 
ATOM   9955  N NE1 . TRP G  1 43  ? 44.860  11.200  -68.626 1.00 41.78  ? 43  TRP G NE1 1 
ATOM   9956  C CE2 . TRP G  1 43  ? 43.893  12.008  -68.092 1.00 42.56  ? 43  TRP G CE2 1 
ATOM   9957  C CE3 . TRP G  1 43  ? 41.593  11.815  -67.358 1.00 43.86  ? 43  TRP G CE3 1 
ATOM   9958  C CZ2 . TRP G  1 43  ? 43.934  13.363  -67.766 1.00 42.93  ? 43  TRP G CZ2 1 
ATOM   9959  C CZ3 . TRP G  1 43  ? 41.635  13.164  -67.033 1.00 45.14  ? 43  TRP G CZ3 1 
ATOM   9960  C CH2 . TRP G  1 43  ? 42.800  13.922  -67.238 1.00 44.92  ? 43  TRP G CH2 1 
ATOM   9961  N N   . ARG G  1 44  ? 40.406  6.949   -65.937 1.00 39.37  ? 44  ARG G N   1 
ATOM   9962  C CA  . ARG G  1 44  ? 39.472  5.861   -65.720 1.00 38.81  ? 44  ARG G CA  1 
ATOM   9963  C C   . ARG G  1 44  ? 38.941  5.323   -67.047 1.00 40.77  ? 44  ARG G C   1 
ATOM   9964  O O   . ARG G  1 44  ? 38.764  4.113   -67.215 1.00 39.03  ? 44  ARG G O   1 
ATOM   9965  C CB  . ARG G  1 44  ? 38.312  6.335   -64.845 1.00 36.54  ? 44  ARG G CB  1 
ATOM   9966  C CG  . ARG G  1 44  ? 37.379  5.211   -64.452 1.00 38.66  ? 44  ARG G CG  1 
ATOM   9967  C CD  . ARG G  1 44  ? 38.138  4.165   -63.631 1.00 36.33  ? 44  ARG G CD  1 
ATOM   9968  N NE  . ARG G  1 44  ? 37.323  2.991   -63.339 1.00 35.92  ? 44  ARG G NE  1 
ATOM   9969  C CZ  . ARG G  1 44  ? 36.971  2.077   -64.238 1.00 32.64  ? 44  ARG G CZ  1 
ATOM   9970  N NH1 . ARG G  1 44  ? 37.362  2.202   -65.497 1.00 33.16  ? 44  ARG G NH1 1 
ATOM   9971  N NH2 . ARG G  1 44  ? 36.245  1.033   -63.873 1.00 28.45  ? 44  ARG G NH2 1 
ATOM   9972  N N   . LEU G  1 45  ? 38.669  6.241   -67.975 1.00 42.63  ? 45  LEU G N   1 
ATOM   9973  C CA  . LEU G  1 45  ? 38.182  5.910   -69.313 1.00 43.74  ? 45  LEU G CA  1 
ATOM   9974  C C   . LEU G  1 45  ? 39.091  6.616   -70.301 1.00 44.64  ? 45  LEU G C   1 
ATOM   9975  O O   . LEU G  1 45  ? 39.239  7.835   -70.249 1.00 43.15  ? 45  LEU G O   1 
ATOM   9976  C CB  . LEU G  1 45  ? 36.751  6.394   -69.508 1.00 44.65  ? 45  LEU G CB  1 
ATOM   9977  C CG  . LEU G  1 45  ? 35.692  5.695   -68.668 1.00 45.00  ? 45  LEU G CG  1 
ATOM   9978  C CD1 . LEU G  1 45  ? 34.344  6.326   -68.953 1.00 46.44  ? 45  LEU G CD1 1 
ATOM   9979  C CD2 . LEU G  1 45  ? 35.675  4.204   -68.984 1.00 42.80  ? 45  LEU G CD2 1 
ATOM   9980  N N   . GLU G  1 46  ? 39.702  5.836   -71.189 1.00 47.45  ? 46  GLU G N   1 
ATOM   9981  C CA  . GLU G  1 46  ? 40.630  6.333   -72.206 1.00 49.81  ? 46  GLU G CA  1 
ATOM   9982  C C   . GLU G  1 46  ? 40.238  7.667   -72.853 1.00 49.12  ? 46  GLU G C   1 
ATOM   9983  O O   . GLU G  1 46  ? 41.040  8.600   -72.915 1.00 47.09  ? 46  GLU G O   1 
ATOM   9984  C CB  . GLU G  1 46  ? 40.782  5.276   -73.293 1.00 53.76  ? 46  GLU G CB  1 
ATOM   9985  C CG  . GLU G  1 46  ? 41.623  5.708   -74.481 1.00 60.59  ? 46  GLU G CG  1 
ATOM   9986  C CD  . GLU G  1 46  ? 41.141  5.083   -75.783 1.00 65.27  ? 46  GLU G CD  1 
ATOM   9987  O OE1 . GLU G  1 46  ? 41.869  5.180   -76.800 1.00 64.71  ? 46  GLU G OE1 1 
ATOM   9988  O OE2 . GLU G  1 46  ? 40.024  4.505   -75.781 1.00 68.02  ? 46  GLU G OE2 1 
ATOM   9989  N N   . GLU G  1 47  ? 39.005  7.732   -73.343 1.00 48.62  ? 47  GLU G N   1 
ATOM   9990  C CA  . GLU G  1 47  ? 38.468  8.916   -74.000 1.00 49.68  ? 47  GLU G CA  1 
ATOM   9991  C C   . GLU G  1 47  ? 38.660  10.225  -73.221 1.00 48.94  ? 47  GLU G C   1 
ATOM   9992  O O   . GLU G  1 47  ? 38.779  11.299  -73.811 1.00 47.94  ? 47  GLU G O   1 
ATOM   9993  C CB  . GLU G  1 47  ? 36.975  8.706   -74.271 1.00 52.52  ? 47  GLU G CB  1 
ATOM   9994  C CG  . GLU G  1 47  ? 36.119  8.712   -73.009 1.00 57.49  ? 47  GLU G CG  1 
ATOM   9995  C CD  . GLU G  1 47  ? 34.750  8.082   -73.216 1.00 61.31  ? 47  GLU G CD  1 
ATOM   9996  O OE1 . GLU G  1 47  ? 34.697  6.915   -73.664 1.00 63.92  ? 47  GLU G OE1 1 
ATOM   9997  O OE2 . GLU G  1 47  ? 33.728  8.743   -72.924 1.00 63.56  ? 47  GLU G OE2 1 
ATOM   9998  N N   . PHE G  1 48  ? 38.680  10.136  -71.895 1.00 47.58  ? 48  PHE G N   1 
ATOM   9999  C CA  . PHE G  1 48  ? 38.835  11.324  -71.065 1.00 45.35  ? 48  PHE G CA  1 
ATOM   10000 C C   . PHE G  1 48  ? 40.090  12.146  -71.370 1.00 45.85  ? 48  PHE G C   1 
ATOM   10001 O O   . PHE G  1 48  ? 40.068  13.380  -71.288 1.00 42.62  ? 48  PHE G O   1 
ATOM   10002 C CB  . PHE G  1 48  ? 38.840  10.943  -69.577 1.00 43.43  ? 48  PHE G CB  1 
ATOM   10003 C CG  . PHE G  1 48  ? 37.502  10.484  -69.045 1.00 42.25  ? 48  PHE G CG  1 
ATOM   10004 C CD1 . PHE G  1 48  ? 36.328  10.682  -69.771 1.00 41.89  ? 48  PHE G CD1 1 
ATOM   10005 C CD2 . PHE G  1 48  ? 37.417  9.871   -67.796 1.00 40.41  ? 48  PHE G CD2 1 
ATOM   10006 C CE1 . PHE G  1 48  ? 35.090  10.275  -69.258 1.00 41.00  ? 48  PHE G CE1 1 
ATOM   10007 C CE2 . PHE G  1 48  ? 36.187  9.464   -67.278 1.00 40.77  ? 48  PHE G CE2 1 
ATOM   10008 C CZ  . PHE G  1 48  ? 35.023  9.667   -68.008 1.00 39.75  ? 48  PHE G CZ  1 
ATOM   10009 N N   . ALA G  1 49  ? 41.180  11.466  -71.719 1.00 46.43  ? 49  ALA G N   1 
ATOM   10010 C CA  . ALA G  1 49  ? 42.449  12.141  -71.996 1.00 48.86  ? 49  ALA G CA  1 
ATOM   10011 C C   . ALA G  1 49  ? 42.450  13.132  -73.158 1.00 49.78  ? 49  ALA G C   1 
ATOM   10012 O O   . ALA G  1 49  ? 43.361  13.951  -73.260 1.00 51.68  ? 49  ALA G O   1 
ATOM   10013 C CB  . ALA G  1 49  ? 43.557  11.110  -72.203 1.00 44.00  ? 49  ALA G CB  1 
ATOM   10014 N N   . LYS G  1 50  ? 41.447  13.069  -74.029 1.00 50.26  ? 50  LYS G N   1 
ATOM   10015 C CA  . LYS G  1 50  ? 41.397  13.980  -75.171 1.00 51.49  ? 50  LYS G CA  1 
ATOM   10016 C C   . LYS G  1 50  ? 40.808  15.317  -74.766 1.00 51.08  ? 50  LYS G C   1 
ATOM   10017 O O   . LYS G  1 50  ? 40.976  16.311  -75.464 1.00 53.46  ? 50  LYS G O   1 
ATOM   10018 C CB  . LYS G  1 50  ? 40.543  13.391  -76.301 1.00 52.26  ? 50  LYS G CB  1 
ATOM   10019 C CG  . LYS G  1 50  ? 40.881  11.960  -76.667 1.00 57.45  ? 50  LYS G CG  1 
ATOM   10020 C CD  . LYS G  1 50  ? 42.292  11.822  -77.228 1.00 60.53  ? 50  LYS G CD  1 
ATOM   10021 C CE  . LYS G  1 50  ? 42.400  12.448  -78.617 1.00 63.64  ? 50  LYS G CE  1 
ATOM   10022 N NZ  . LYS G  1 50  ? 43.716  12.175  -79.268 1.00 64.67  ? 50  LYS G NZ  1 
ATOM   10023 N N   . PHE G  1 51  ? 40.116  15.341  -73.635 1.00 48.91  ? 51  PHE G N   1 
ATOM   10024 C CA  . PHE G  1 51  ? 39.468  16.556  -73.170 1.00 47.68  ? 51  PHE G CA  1 
ATOM   10025 C C   . PHE G  1 51  ? 40.159  17.239  -72.009 1.00 45.91  ? 51  PHE G C   1 
ATOM   10026 O O   . PHE G  1 51  ? 39.726  18.300  -71.574 1.00 46.41  ? 51  PHE G O   1 
ATOM   10027 C CB  . PHE G  1 51  ? 38.030  16.243  -72.769 1.00 47.55  ? 51  PHE G CB  1 
ATOM   10028 C CG  . PHE G  1 51  ? 37.186  15.740  -73.897 1.00 48.15  ? 51  PHE G CG  1 
ATOM   10029 C CD1 . PHE G  1 51  ? 36.590  16.632  -74.787 1.00 48.13  ? 51  PHE G CD1 1 
ATOM   10030 C CD2 . PHE G  1 51  ? 36.982  14.374  -74.072 1.00 47.19  ? 51  PHE G CD2 1 
ATOM   10031 C CE1 . PHE G  1 51  ? 35.802  16.170  -75.835 1.00 47.43  ? 51  PHE G CE1 1 
ATOM   10032 C CE2 . PHE G  1 51  ? 36.194  13.900  -75.120 1.00 48.42  ? 51  PHE G CE2 1 
ATOM   10033 C CZ  . PHE G  1 51  ? 35.602  14.798  -76.001 1.00 47.56  ? 51  PHE G CZ  1 
ATOM   10034 N N   . ALA G  1 52  ? 41.225  16.641  -71.497 1.00 44.45  ? 52  ALA G N   1 
ATOM   10035 C CA  . ALA G  1 52  ? 41.910  17.243  -70.368 1.00 44.06  ? 52  ALA G CA  1 
ATOM   10036 C C   . ALA G  1 52  ? 43.259  16.626  -70.062 1.00 42.61  ? 52  ALA G C   1 
ATOM   10037 O O   . ALA G  1 52  ? 43.612  15.568  -70.574 1.00 40.96  ? 52  ALA G O   1 
ATOM   10038 C CB  . ALA G  1 52  ? 41.031  17.162  -69.131 1.00 43.78  ? 52  ALA G CB  1 
ATOM   10039 N N   . SER G  1 53  ? 44.007  17.312  -69.206 1.00 41.65  ? 53  SER G N   1 
ATOM   10040 C CA  . SER G  1 53  ? 45.307  16.841  -68.793 1.00 42.05  ? 53  SER G CA  1 
ATOM   10041 C C   . SER G  1 53  ? 45.516  17.190  -67.322 1.00 40.83  ? 53  SER G C   1 
ATOM   10042 O O   . SER G  1 53  ? 44.821  18.044  -66.756 1.00 39.44  ? 53  SER G O   1 
ATOM   10043 C CB  . SER G  1 53  ? 46.406  17.495  -69.633 1.00 41.45  ? 53  SER G CB  1 
ATOM   10044 O OG  . SER G  1 53  ? 46.759  18.754  -69.093 1.00 45.56  ? 53  SER G OG  1 
ATOM   10045 N N   . PHE G  1 54  ? 46.474  16.510  -66.707 1.00 38.95  ? 54  PHE G N   1 
ATOM   10046 C CA  . PHE G  1 54  ? 46.807  16.752  -65.321 1.00 38.89  ? 54  PHE G CA  1 
ATOM   10047 C C   . PHE G  1 54  ? 48.255  16.351  -65.115 1.00 40.37  ? 54  PHE G C   1 
ATOM   10048 O O   . PHE G  1 54  ? 48.661  15.242  -65.484 1.00 39.01  ? 54  PHE G O   1 
ATOM   10049 C CB  . PHE G  1 54  ? 45.919  15.937  -64.379 1.00 37.21  ? 54  PHE G CB  1 
ATOM   10050 C CG  . PHE G  1 54  ? 46.307  16.076  -62.937 1.00 36.26  ? 54  PHE G CG  1 
ATOM   10051 C CD1 . PHE G  1 54  ? 45.960  17.211  -62.217 1.00 34.63  ? 54  PHE G CD1 1 
ATOM   10052 C CD2 . PHE G  1 54  ? 47.071  15.094  -62.315 1.00 36.16  ? 54  PHE G CD2 1 
ATOM   10053 C CE1 . PHE G  1 54  ? 46.369  17.373  -60.882 1.00 37.67  ? 54  PHE G CE1 1 
ATOM   10054 C CE2 . PHE G  1 54  ? 47.487  15.242  -60.988 1.00 36.43  ? 54  PHE G CE2 1 
ATOM   10055 C CZ  . PHE G  1 54  ? 47.136  16.386  -60.268 1.00 35.39  ? 54  PHE G CZ  1 
ATOM   10056 N N   . GLU G  1 55  ? 49.031  17.252  -64.521 1.00 42.92  ? 55  GLU G N   1 
ATOM   10057 C CA  . GLU G  1 55  ? 50.437  16.986  -64.269 1.00 45.92  ? 55  GLU G CA  1 
ATOM   10058 C C   . GLU G  1 55  ? 50.552  16.106  -63.040 1.00 44.08  ? 55  GLU G C   1 
ATOM   10059 O O   . GLU G  1 55  ? 50.281  16.552  -61.927 1.00 42.34  ? 55  GLU G O   1 
ATOM   10060 C CB  . GLU G  1 55  ? 51.192  18.301  -64.063 1.00 51.48  ? 55  GLU G CB  1 
ATOM   10061 C CG  . GLU G  1 55  ? 52.384  18.469  -65.000 1.00 61.65  ? 55  GLU G CG  1 
ATOM   10062 C CD  . GLU G  1 55  ? 52.325  19.761  -65.818 1.00 66.09  ? 55  GLU G CD  1 
ATOM   10063 O OE1 . GLU G  1 55  ? 53.229  19.973  -66.662 1.00 67.60  ? 55  GLU G OE1 1 
ATOM   10064 O OE2 . GLU G  1 55  ? 51.378  20.562  -65.618 1.00 69.22  ? 55  GLU G OE2 1 
ATOM   10065 N N   . ALA G  1 56  ? 50.949  14.852  -63.261 1.00 44.25  ? 56  ALA G N   1 
ATOM   10066 C CA  . ALA G  1 56  ? 51.093  13.861  -62.194 1.00 44.00  ? 56  ALA G CA  1 
ATOM   10067 C C   . ALA G  1 56  ? 52.028  14.284  -61.053 1.00 44.32  ? 56  ALA G C   1 
ATOM   10068 O O   . ALA G  1 56  ? 51.900  13.810  -59.920 1.00 44.61  ? 56  ALA G O   1 
ATOM   10069 C CB  . ALA G  1 56  ? 51.555  12.520  -62.791 1.00 44.27  ? 56  ALA G CB  1 
ATOM   10070 N N   . GLN G  1 57  ? 52.967  15.174  -61.344 1.00 43.62  ? 57  GLN G N   1 
ATOM   10071 C CA  . GLN G  1 57  ? 53.889  15.633  -60.316 1.00 44.65  ? 57  GLN G CA  1 
ATOM   10072 C C   . GLN G  1 57  ? 53.146  16.373  -59.197 1.00 43.78  ? 57  GLN G C   1 
ATOM   10073 O O   . GLN G  1 57  ? 53.623  16.458  -58.059 1.00 41.75  ? 57  GLN G O   1 
ATOM   10074 C CB  . GLN G  1 57  ? 54.960  16.529  -60.947 1.00 45.68  ? 57  GLN G CB  1 
ATOM   10075 C CG  . GLN G  1 57  ? 55.880  15.772  -61.893 1.00 49.72  ? 57  GLN G CG  1 
ATOM   10076 C CD  . GLN G  1 57  ? 56.739  14.739  -61.165 1.00 51.83  ? 57  GLN G CD  1 
ATOM   10077 O OE1 . GLN G  1 57  ? 57.066  13.679  -61.710 1.00 55.26  ? 57  GLN G OE1 1 
ATOM   10078 N NE2 . GLN G  1 57  ? 57.118  15.051  -59.937 1.00 54.31  ? 57  GLN G NE2 1 
ATOM   10079 N N   . GLY G  1 58  ? 51.974  16.908  -59.522 1.00 42.99  ? 58  GLY G N   1 
ATOM   10080 C CA  . GLY G  1 58  ? 51.198  17.616  -58.522 1.00 43.71  ? 58  GLY G CA  1 
ATOM   10081 C C   . GLY G  1 58  ? 50.690  16.621  -57.498 1.00 45.39  ? 58  GLY G C   1 
ATOM   10082 O O   . GLY G  1 58  ? 50.758  16.843  -56.282 1.00 46.71  ? 58  GLY G O   1 
ATOM   10083 N N   . ALA G  1 59  ? 50.186  15.503  -58.000 1.00 43.79  ? 59  ALA G N   1 
ATOM   10084 C CA  . ALA G  1 59  ? 49.682  14.457  -57.132 1.00 42.84  ? 59  ALA G CA  1 
ATOM   10085 C C   . ALA G  1 59  ? 50.810  13.963  -56.227 1.00 41.56  ? 59  ALA G C   1 
ATOM   10086 O O   . ALA G  1 59  ? 50.630  13.836  -55.018 1.00 41.96  ? 59  ALA G O   1 
ATOM   10087 C CB  . ALA G  1 59  ? 49.132  13.316  -57.968 1.00 42.22  ? 59  ALA G CB  1 
ATOM   10088 N N   . LEU G  1 60  ? 51.977  13.706  -56.810 1.00 40.41  ? 60  LEU G N   1 
ATOM   10089 C CA  . LEU G  1 60  ? 53.115  13.212  -56.039 1.00 39.95  ? 60  LEU G CA  1 
ATOM   10090 C C   . LEU G  1 60  ? 53.598  14.186  -54.981 1.00 39.87  ? 60  LEU G C   1 
ATOM   10091 O O   . LEU G  1 60  ? 54.019  13.777  -53.899 1.00 41.57  ? 60  LEU G O   1 
ATOM   10092 C CB  . LEU G  1 60  ? 54.264  12.852  -56.971 1.00 40.89  ? 60  LEU G CB  1 
ATOM   10093 C CG  . LEU G  1 60  ? 53.939  11.718  -57.939 1.00 41.04  ? 60  LEU G CG  1 
ATOM   10094 C CD1 . LEU G  1 60  ? 55.168  11.413  -58.767 1.00 43.35  ? 60  LEU G CD1 1 
ATOM   10095 C CD2 . LEU G  1 60  ? 53.496  10.488  -57.178 1.00 42.91  ? 60  LEU G CD2 1 
ATOM   10096 N N   . ALA G  1 61  ? 53.543  15.473  -55.300 1.00 38.98  ? 61  ALA G N   1 
ATOM   10097 C CA  . ALA G  1 61  ? 53.947  16.514  -54.373 1.00 38.26  ? 61  ALA G CA  1 
ATOM   10098 C C   . ALA G  1 61  ? 52.978  16.487  -53.197 1.00 39.43  ? 61  ALA G C   1 
ATOM   10099 O O   . ALA G  1 61  ? 53.382  16.554  -52.029 1.00 41.60  ? 61  ALA G O   1 
ATOM   10100 C CB  . ALA G  1 61  ? 53.891  17.865  -55.070 1.00 37.75  ? 61  ALA G CB  1 
ATOM   10101 N N   . ASN G  1 62  ? 51.691  16.380  -53.516 1.00 39.64  ? 62  ASN G N   1 
ATOM   10102 C CA  . ASN G  1 62  ? 50.641  16.332  -52.505 1.00 40.24  ? 62  ASN G CA  1 
ATOM   10103 C C   . ASN G  1 62  ? 50.769  15.108  -51.593 1.00 40.59  ? 62  ASN G C   1 
ATOM   10104 O O   . ASN G  1 62  ? 50.648  15.217  -50.370 1.00 42.25  ? 62  ASN G O   1 
ATOM   10105 C CB  . ASN G  1 62  ? 49.267  16.354  -53.176 1.00 42.84  ? 62  ASN G CB  1 
ATOM   10106 C CG  . ASN G  1 62  ? 48.724  17.769  -53.357 1.00 45.13  ? 62  ASN G CG  1 
ATOM   10107 O OD1 . ASN G  1 62  ? 49.333  18.613  -54.015 1.00 47.02  ? 62  ASN G OD1 1 
ATOM   10108 N ND2 . ASN G  1 62  ? 47.572  18.030  -52.767 1.00 45.47  ? 62  ASN G ND2 1 
ATOM   10109 N N   . ILE G  1 63  ? 51.010  13.940  -52.178 1.00 40.36  ? 63  ILE G N   1 
ATOM   10110 C CA  . ILE G  1 63  ? 51.164  12.735  -51.372 1.00 39.64  ? 63  ILE G CA  1 
ATOM   10111 C C   . ILE G  1 63  ? 52.299  12.960  -50.389 1.00 38.38  ? 63  ILE G C   1 
ATOM   10112 O O   . ILE G  1 63  ? 52.166  12.668  -49.204 1.00 38.34  ? 63  ILE G O   1 
ATOM   10113 C CB  . ILE G  1 63  ? 51.512  11.492  -52.234 1.00 41.16  ? 63  ILE G CB  1 
ATOM   10114 C CG1 . ILE G  1 63  ? 50.322  11.116  -53.112 1.00 41.82  ? 63  ILE G CG1 1 
ATOM   10115 C CG2 . ILE G  1 63  ? 51.889  10.319  -51.343 1.00 38.81  ? 63  ILE G CG2 1 
ATOM   10116 C CD1 . ILE G  1 63  ? 49.077  10.801  -52.320 1.00 45.74  ? 63  ILE G CD1 1 
ATOM   10117 N N   . ALA G  1 64  ? 53.417  13.480  -50.887 1.00 36.76  ? 64  ALA G N   1 
ATOM   10118 C CA  . ALA G  1 64  ? 54.568  13.734  -50.030 1.00 36.78  ? 64  ALA G CA  1 
ATOM   10119 C C   . ALA G  1 64  ? 54.125  14.561  -48.816 1.00 37.36  ? 64  ALA G C   1 
ATOM   10120 O O   . ALA G  1 64  ? 54.547  14.299  -47.691 1.00 38.01  ? 64  ALA G O   1 
ATOM   10121 C CB  . ALA G  1 64  ? 55.642  14.459  -50.809 1.00 35.46  ? 64  ALA G CB  1 
ATOM   10122 N N   . VAL G  1 65  ? 53.255  15.545  -49.031 1.00 37.24  ? 65  VAL G N   1 
ATOM   10123 C CA  . VAL G  1 65  ? 52.784  16.349  -47.907 1.00 38.46  ? 65  VAL G CA  1 
ATOM   10124 C C   . VAL G  1 65  ? 52.004  15.472  -46.929 1.00 37.93  ? 65  VAL G C   1 
ATOM   10125 O O   . VAL G  1 65  ? 52.149  15.612  -45.711 1.00 36.84  ? 65  VAL G O   1 
ATOM   10126 C CB  . VAL G  1 65  ? 51.896  17.551  -48.375 1.00 39.85  ? 65  VAL G CB  1 
ATOM   10127 C CG1 . VAL G  1 65  ? 51.279  18.270  -47.156 1.00 36.86  ? 65  VAL G CG1 1 
ATOM   10128 C CG2 . VAL G  1 65  ? 52.747  18.535  -49.184 1.00 35.30  ? 65  VAL G CG2 1 
ATOM   10129 N N   . ASN G  1 66  ? 51.201  14.554  -47.462 1.00 38.10  ? 66  ASN G N   1 
ATOM   10130 C CA  . ASN G  1 66  ? 50.423  13.653  -46.617 1.00 38.20  ? 66  ASN G CA  1 
ATOM   10131 C C   . ASN G  1 66  ? 51.351  12.730  -45.844 1.00 36.82  ? 66  ASN G C   1 
ATOM   10132 O O   . ASN G  1 66  ? 51.079  12.363  -44.705 1.00 37.72  ? 66  ASN G O   1 
ATOM   10133 C CB  . ASN G  1 66  ? 49.469  12.807  -47.462 1.00 41.78  ? 66  ASN G CB  1 
ATOM   10134 C CG  . ASN G  1 66  ? 48.399  13.636  -48.144 1.00 44.72  ? 66  ASN G CG  1 
ATOM   10135 O OD1 . ASN G  1 66  ? 48.053  13.379  -49.296 1.00 47.01  ? 66  ASN G OD1 1 
ATOM   10136 N ND2 . ASN G  1 66  ? 47.863  14.627  -47.437 1.00 44.60  ? 66  ASN G ND2 1 
ATOM   10137 N N   . LYS G  1 67  ? 52.447  12.348  -46.477 1.00 36.93  ? 67  LYS G N   1 
ATOM   10138 C CA  . LYS G  1 67  ? 53.424  11.473  -45.851 1.00 37.24  ? 67  LYS G CA  1 
ATOM   10139 C C   . LYS G  1 67  ? 54.074  12.194  -44.659 1.00 36.45  ? 67  LYS G C   1 
ATOM   10140 O O   . LYS G  1 67  ? 54.236  11.621  -43.586 1.00 36.30  ? 67  LYS G O   1 
ATOM   10141 C CB  . LYS G  1 67  ? 54.464  11.084  -46.895 1.00 40.01  ? 67  LYS G CB  1 
ATOM   10142 C CG  . LYS G  1 67  ? 55.464  10.040  -46.470 1.00 44.37  ? 67  LYS G CG  1 
ATOM   10143 C CD  . LYS G  1 67  ? 56.350  9.680   -47.667 1.00 48.28  ? 67  LYS G CD  1 
ATOM   10144 C CE  . LYS G  1 67  ? 57.536  8.841   -47.260 1.00 49.11  ? 67  LYS G CE  1 
ATOM   10145 N NZ  . LYS G  1 67  ? 58.360  9.629   -46.320 1.00 51.36  ? 67  LYS G NZ  1 
ATOM   10146 N N   . ALA G  1 68  ? 54.435  13.460  -44.840 1.00 35.74  ? 68  ALA G N   1 
ATOM   10147 C CA  . ALA G  1 68  ? 55.045  14.214  -43.750 1.00 36.15  ? 68  ALA G CA  1 
ATOM   10148 C C   . ALA G  1 68  ? 54.026  14.396  -42.625 1.00 36.74  ? 68  ALA G C   1 
ATOM   10149 O O   . ALA G  1 68  ? 54.332  14.158  -41.444 1.00 37.35  ? 68  ALA G O   1 
ATOM   10150 C CB  . ALA G  1 68  ? 55.536  15.581  -44.255 1.00 36.24  ? 68  ALA G CB  1 
ATOM   10151 N N   . ASN G  1 69  ? 52.813  14.811  -43.002 1.00 35.71  ? 69  ASN G N   1 
ATOM   10152 C CA  . ASN G  1 69  ? 51.737  15.022  -42.042 1.00 33.74  ? 69  ASN G CA  1 
ATOM   10153 C C   . ASN G  1 69  ? 51.403  13.747  -41.272 1.00 33.31  ? 69  ASN G C   1 
ATOM   10154 O O   . ASN G  1 69  ? 51.041  13.805  -40.097 1.00 34.97  ? 69  ASN G O   1 
ATOM   10155 C CB  . ASN G  1 69  ? 50.480  15.550  -42.748 1.00 33.37  ? 69  ASN G CB  1 
ATOM   10156 C CG  . ASN G  1 69  ? 50.636  16.986  -43.221 1.00 33.80  ? 69  ASN G CG  1 
ATOM   10157 O OD1 . ASN G  1 69  ? 51.516  17.715  -42.759 1.00 33.89  ? 69  ASN G OD1 1 
ATOM   10158 N ND2 . ASN G  1 69  ? 49.772  17.404  -44.133 1.00 31.88  ? 69  ASN G ND2 1 
ATOM   10159 N N   . LEU G  1 70  ? 51.526  12.590  -41.915 1.00 32.55  ? 70  LEU G N   1 
ATOM   10160 C CA  . LEU G  1 70  ? 51.227  11.350  -41.214 1.00 32.59  ? 70  LEU G CA  1 
ATOM   10161 C C   . LEU G  1 70  ? 52.144  11.172  -40.007 1.00 34.75  ? 70  LEU G C   1 
ATOM   10162 O O   . LEU G  1 70  ? 51.688  10.805  -38.930 1.00 36.23  ? 70  LEU G O   1 
ATOM   10163 C CB  . LEU G  1 70  ? 51.367  10.139  -42.143 1.00 30.36  ? 70  LEU G CB  1 
ATOM   10164 C CG  . LEU G  1 70  ? 51.147  8.807   -41.413 1.00 29.97  ? 70  LEU G CG  1 
ATOM   10165 C CD1 . LEU G  1 70  ? 49.758  8.784   -40.768 1.00 28.31  ? 70  LEU G CD1 1 
ATOM   10166 C CD2 . LEU G  1 70  ? 51.296  7.658   -42.376 1.00 30.15  ? 70  LEU G CD2 1 
ATOM   10167 N N   . ASP G  1 71  ? 53.438  11.420  -40.183 1.00 35.80  ? 71  ASP G N   1 
ATOM   10168 C CA  . ASP G  1 71  ? 54.367  11.276  -39.074 1.00 37.29  ? 71  ASP G CA  1 
ATOM   10169 C C   . ASP G  1 71  ? 54.004  12.211  -37.928 1.00 36.86  ? 71  ASP G C   1 
ATOM   10170 O O   . ASP G  1 71  ? 54.142  11.861  -36.760 1.00 35.53  ? 71  ASP G O   1 
ATOM   10171 C CB  . ASP G  1 71  ? 55.800  11.556  -39.527 1.00 39.19  ? 71  ASP G CB  1 
ATOM   10172 C CG  . ASP G  1 71  ? 56.374  10.427  -40.338 1.00 41.44  ? 71  ASP G CG  1 
ATOM   10173 O OD1 . ASP G  1 71  ? 56.155  9.253   -39.957 1.00 43.39  ? 71  ASP G OD1 1 
ATOM   10174 O OD2 . ASP G  1 71  ? 57.054  10.710  -41.345 1.00 44.51  ? 71  ASP G OD2 1 
ATOM   10175 N N   . VAL G  1 72  ? 53.546  13.409  -38.266 1.00 37.95  ? 72  VAL G N   1 
ATOM   10176 C CA  . VAL G  1 72  ? 53.159  14.367  -37.235 1.00 39.25  ? 72  VAL G CA  1 
ATOM   10177 C C   . VAL G  1 72  ? 51.943  13.828  -36.496 1.00 40.58  ? 72  VAL G C   1 
ATOM   10178 O O   . VAL G  1 72  ? 51.876  13.890  -35.262 1.00 41.03  ? 72  VAL G O   1 
ATOM   10179 C CB  . VAL G  1 72  ? 52.790  15.742  -37.834 1.00 39.22  ? 72  VAL G CB  1 
ATOM   10180 C CG1 . VAL G  1 72  ? 52.304  16.689  -36.718 1.00 36.14  ? 72  VAL G CG1 1 
ATOM   10181 C CG2 . VAL G  1 72  ? 53.997  16.328  -38.573 1.00 35.89  ? 72  VAL G CG2 1 
ATOM   10182 N N   . MET G  1 73  ? 50.988  13.293  -37.258 1.00 39.17  ? 73  MET G N   1 
ATOM   10183 C CA  . MET G  1 73  ? 49.770  12.750  -36.670 1.00 39.66  ? 73  MET G CA  1 
ATOM   10184 C C   . MET G  1 73  ? 50.055  11.548  -35.790 1.00 39.43  ? 73  MET G C   1 
ATOM   10185 O O   . MET G  1 73  ? 49.415  11.379  -34.752 1.00 39.27  ? 73  MET G O   1 
ATOM   10186 C CB  . MET G  1 73  ? 48.765  12.371  -37.762 1.00 38.93  ? 73  MET G CB  1 
ATOM   10187 C CG  . MET G  1 73  ? 48.252  13.556  -38.559 1.00 38.26  ? 73  MET G CG  1 
ATOM   10188 S SD  . MET G  1 73  ? 47.491  14.800  -37.512 1.00 39.61  ? 73  MET G SD  1 
ATOM   10189 C CE  . MET G  1 73  ? 45.906  14.089  -37.279 1.00 38.49  ? 73  MET G CE  1 
ATOM   10190 N N   . LYS G  1 74  ? 51.007  10.710  -36.198 1.00 40.81  ? 74  LYS G N   1 
ATOM   10191 C CA  . LYS G  1 74  ? 51.351  9.537   -35.393 1.00 43.60  ? 74  LYS G CA  1 
ATOM   10192 C C   . LYS G  1 74  ? 51.949  9.980   -34.056 1.00 44.43  ? 74  LYS G C   1 
ATOM   10193 O O   . LYS G  1 74  ? 51.747  9.333   -33.027 1.00 45.52  ? 74  LYS G O   1 
ATOM   10194 C CB  . LYS G  1 74  ? 52.337  8.629   -36.132 1.00 44.97  ? 74  LYS G CB  1 
ATOM   10195 C CG  . LYS G  1 74  ? 51.716  7.787   -37.248 1.00 46.47  ? 74  LYS G CG  1 
ATOM   10196 C CD  . LYS G  1 74  ? 52.680  6.695   -37.709 1.00 48.21  ? 74  LYS G CD  1 
ATOM   10197 C CE  . LYS G  1 74  ? 52.985  5.743   -36.556 1.00 50.82  ? 74  LYS G CE  1 
ATOM   10198 N NZ  . LYS G  1 74  ? 54.021  4.732   -36.870 1.00 55.02  ? 74  LYS G NZ  1 
ATOM   10199 N N   . GLU G  1 75  ? 52.686  11.086  -34.070 1.00 44.21  ? 75  GLU G N   1 
ATOM   10200 C CA  . GLU G  1 75  ? 53.268  11.610  -32.838 1.00 46.14  ? 75  GLU G CA  1 
ATOM   10201 C C   . GLU G  1 75  ? 52.192  12.284  -31.984 1.00 43.70  ? 75  GLU G C   1 
ATOM   10202 O O   . GLU G  1 75  ? 52.122  12.080  -30.774 1.00 41.89  ? 75  GLU G O   1 
ATOM   10203 C CB  . GLU G  1 75  ? 54.369  12.629  -33.154 1.00 50.02  ? 75  GLU G CB  1 
ATOM   10204 C CG  . GLU G  1 75  ? 55.727  12.026  -33.467 1.00 56.78  ? 75  GLU G CG  1 
ATOM   10205 C CD  . GLU G  1 75  ? 56.522  11.682  -32.216 1.00 62.36  ? 75  GLU G CD  1 
ATOM   10206 O OE1 . GLU G  1 75  ? 56.892  12.620  -31.469 1.00 65.48  ? 75  GLU G OE1 1 
ATOM   10207 O OE2 . GLU G  1 75  ? 56.777  10.478  -31.979 1.00 63.66  ? 75  GLU G OE2 1 
ATOM   10208 N N   . ARG G  1 76  ? 51.347  13.079  -32.628 1.00 42.26  ? 76  ARG G N   1 
ATOM   10209 C CA  . ARG G  1 76  ? 50.295  13.803  -31.924 1.00 41.38  ? 76  ARG G CA  1 
ATOM   10210 C C   . ARG G  1 76  ? 49.272  12.919  -31.220 1.00 41.35  ? 76  ARG G C   1 
ATOM   10211 O O   . ARG G  1 76  ? 48.555  13.393  -30.341 1.00 43.15  ? 76  ARG G O   1 
ATOM   10212 C CB  . ARG G  1 76  ? 49.580  14.745  -32.890 1.00 40.14  ? 76  ARG G CB  1 
ATOM   10213 C CG  . ARG G  1 76  ? 48.583  15.667  -32.237 1.00 37.97  ? 76  ARG G CG  1 
ATOM   10214 C CD  . ARG G  1 76  ? 47.724  16.310  -33.295 1.00 35.05  ? 76  ARG G CD  1 
ATOM   10215 N NE  . ARG G  1 76  ? 48.517  17.184  -34.137 1.00 34.86  ? 76  ARG G NE  1 
ATOM   10216 C CZ  . ARG G  1 76  ? 48.086  17.724  -35.271 1.00 37.36  ? 76  ARG G CZ  1 
ATOM   10217 N NH1 . ARG G  1 76  ? 46.855  17.477  -35.709 1.00 38.38  ? 76  ARG G NH1 1 
ATOM   10218 N NH2 . ARG G  1 76  ? 48.886  18.516  -35.967 1.00 35.64  ? 76  ARG G NH2 1 
ATOM   10219 N N   . SER G  1 77  ? 49.205  11.643  -31.588 1.00 41.14  ? 77  SER G N   1 
ATOM   10220 C CA  . SER G  1 77  ? 48.252  10.731  -30.955 1.00 42.08  ? 77  SER G CA  1 
ATOM   10221 C C   . SER G  1 77  ? 48.951  9.535   -30.320 1.00 42.32  ? 77  SER G C   1 
ATOM   10222 O O   . SER G  1 77  ? 48.345  8.483   -30.115 1.00 41.11  ? 77  SER G O   1 
ATOM   10223 C CB  . SER G  1 77  ? 47.234  10.245  -31.983 1.00 41.48  ? 77  SER G CB  1 
ATOM   10224 O OG  . SER G  1 77  ? 47.891  9.568   -33.039 1.00 43.74  ? 77  SER G OG  1 
ATOM   10225 N N   . ASN G  1 78  ? 50.233  9.711   -30.017 1.00 45.29  ? 78  ASN G N   1 
ATOM   10226 C CA  . ASN G  1 78  ? 51.070  8.685   -29.395 1.00 48.74  ? 78  ASN G CA  1 
ATOM   10227 C C   . ASN G  1 78  ? 50.951  7.287   -30.021 1.00 48.92  ? 78  ASN G C   1 
ATOM   10228 O O   . ASN G  1 78  ? 50.816  6.280   -29.314 1.00 47.74  ? 78  ASN G O   1 
ATOM   10229 C CB  . ASN G  1 78  ? 50.783  8.624   -27.883 1.00 51.03  ? 78  ASN G CB  1 
ATOM   10230 C CG  . ASN G  1 78  ? 51.791  7.757   -27.122 1.00 55.89  ? 78  ASN G CG  1 
ATOM   10231 O OD1 . ASN G  1 78  ? 52.996  7.806   -27.383 1.00 55.87  ? 78  ASN G OD1 1 
ATOM   10232 N ND2 . ASN G  1 78  ? 51.291  6.978   -26.168 1.00 61.07  ? 78  ASN G ND2 1 
ATOM   10233 N N   . ASN G  1 79  ? 51.016  7.237   -31.350 1.00 49.08  ? 79  ASN G N   1 
ATOM   10234 C CA  . ASN G  1 79  ? 50.940  5.981   -32.097 1.00 51.80  ? 79  ASN G CA  1 
ATOM   10235 C C   . ASN G  1 79  ? 49.800  5.064   -31.656 1.00 51.72  ? 79  ASN G C   1 
ATOM   10236 O O   . ASN G  1 79  ? 49.937  3.845   -31.680 1.00 52.06  ? 79  ASN G O   1 
ATOM   10237 C CB  . ASN G  1 79  ? 52.262  5.208   -31.975 1.00 52.56  ? 79  ASN G CB  1 
ATOM   10238 C CG  . ASN G  1 79  ? 53.475  6.073   -32.250 1.00 54.02  ? 79  ASN G CG  1 
ATOM   10239 O OD1 . ASN G  1 79  ? 53.660  6.576   -33.359 1.00 54.01  ? 79  ASN G OD1 1 
ATOM   10240 N ND2 . ASN G  1 79  ? 54.311  6.254   -31.229 1.00 55.98  ? 79  ASN G ND2 1 
ATOM   10241 N N   . THR G  1 80  ? 48.677  5.635   -31.246 1.00 52.55  ? 80  THR G N   1 
ATOM   10242 C CA  . THR G  1 80  ? 47.556  4.813   -30.826 1.00 52.87  ? 80  THR G CA  1 
ATOM   10243 C C   . THR G  1 80  ? 46.856  4.323   -32.091 1.00 52.97  ? 80  THR G C   1 
ATOM   10244 O O   . THR G  1 80  ? 46.648  5.092   -33.028 1.00 51.79  ? 80  THR G O   1 
ATOM   10245 C CB  . THR G  1 80  ? 46.572  5.625   -29.989 1.00 53.28  ? 80  THR G CB  1 
ATOM   10246 O OG1 . THR G  1 80  ? 47.304  6.472   -29.098 1.00 55.88  ? 80  THR G OG1 1 
ATOM   10247 C CG2 . THR G  1 80  ? 45.684  4.704   -29.181 1.00 53.78  ? 80  THR G CG2 1 
ATOM   10248 N N   . PRO G  1 81  ? 46.497  3.032   -32.143 1.00 53.48  ? 81  PRO G N   1 
ATOM   10249 C CA  . PRO G  1 81  ? 45.826  2.553   -33.350 1.00 54.21  ? 81  PRO G CA  1 
ATOM   10250 C C   . PRO G  1 81  ? 44.333  2.290   -33.156 1.00 52.39  ? 81  PRO G C   1 
ATOM   10251 O O   . PRO G  1 81  ? 43.868  2.065   -32.034 1.00 51.39  ? 81  PRO G O   1 
ATOM   10252 C CB  . PRO G  1 81  ? 46.588  1.274   -33.657 1.00 53.48  ? 81  PRO G CB  1 
ATOM   10253 C CG  . PRO G  1 81  ? 46.722  0.681   -32.287 1.00 53.70  ? 81  PRO G CG  1 
ATOM   10254 C CD  . PRO G  1 81  ? 47.059  1.895   -31.388 1.00 55.09  ? 81  PRO G CD  1 
ATOM   10255 N N   . ASP G  1 82  ? 43.594  2.336   -34.263 1.00 51.64  ? 82  ASP G N   1 
ATOM   10256 C CA  . ASP G  1 82  ? 42.160  2.058   -34.264 1.00 51.23  ? 82  ASP G CA  1 
ATOM   10257 C C   . ASP G  1 82  ? 41.990  0.656   -34.856 1.00 48.50  ? 82  ASP G C   1 
ATOM   10258 O O   . ASP G  1 82  ? 42.891  0.149   -35.527 1.00 46.22  ? 82  ASP G O   1 
ATOM   10259 C CB  . ASP G  1 82  ? 41.393  3.070   -35.129 1.00 52.72  ? 82  ASP G CB  1 
ATOM   10260 C CG  . ASP G  1 82  ? 41.440  4.489   -34.576 1.00 54.99  ? 82  ASP G CG  1 
ATOM   10261 O OD1 . ASP G  1 82  ? 41.401  4.652   -33.336 1.00 57.46  ? 82  ASP G OD1 1 
ATOM   10262 O OD2 . ASP G  1 82  ? 41.486  5.444   -35.387 1.00 54.24  ? 82  ASP G OD2 1 
ATOM   10263 N N   . ALA G  1 83  ? 40.836  0.037   -34.626 1.00 46.24  ? 83  ALA G N   1 
ATOM   10264 C CA  . ALA G  1 83  ? 40.598  -1.304  -35.152 1.00 44.06  ? 83  ALA G CA  1 
ATOM   10265 C C   . ALA G  1 83  ? 40.502  -1.284  -36.667 1.00 42.32  ? 83  ALA G C   1 
ATOM   10266 O O   . ALA G  1 83  ? 40.322  -0.234  -37.275 1.00 42.97  ? 83  ALA G O   1 
ATOM   10267 C CB  . ALA G  1 83  ? 39.317  -1.883  -34.568 1.00 40.13  ? 83  ALA G CB  1 
ATOM   10268 N N   . ASN G  1 84  ? 40.635  -2.460  -37.265 1.00 40.89  ? 84  ASN G N   1 
ATOM   10269 C CA  . ASN G  1 84  ? 40.533  -2.623  -38.702 1.00 39.90  ? 84  ASN G CA  1 
ATOM   10270 C C   . ASN G  1 84  ? 39.046  -2.774  -38.963 1.00 39.35  ? 84  ASN G C   1 
ATOM   10271 O O   . ASN G  1 84  ? 38.360  -3.450  -38.196 1.00 40.96  ? 84  ASN G O   1 
ATOM   10272 C CB  . ASN G  1 84  ? 41.256  -3.901  -39.141 1.00 39.73  ? 84  ASN G CB  1 
ATOM   10273 C CG  . ASN G  1 84  ? 42.764  -3.776  -39.056 1.00 40.74  ? 84  ASN G CG  1 
ATOM   10274 O OD1 . ASN G  1 84  ? 43.443  -3.528  -40.061 1.00 42.20  ? 84  ASN G OD1 1 
ATOM   10275 N ND2 . ASN G  1 84  ? 43.300  -3.926  -37.852 1.00 40.42  ? 84  ASN G ND2 1 
ATOM   10276 N N   . VAL G  1 85  ? 38.542  -2.143  -40.020 1.00 37.94  ? 85  VAL G N   1 
ATOM   10277 C CA  . VAL G  1 85  ? 37.122  -2.253  -40.360 1.00 37.70  ? 85  VAL G CA  1 
ATOM   10278 C C   . VAL G  1 85  ? 36.977  -3.123  -41.612 1.00 37.35  ? 85  VAL G C   1 
ATOM   10279 O O   . VAL G  1 85  ? 37.444  -2.766  -42.699 1.00 35.86  ? 85  VAL G O   1 
ATOM   10280 C CB  . VAL G  1 85  ? 36.516  -0.882  -40.615 1.00 36.86  ? 85  VAL G CB  1 
ATOM   10281 C CG1 . VAL G  1 85  ? 35.027  -1.008  -40.812 1.00 34.45  ? 85  VAL G CG1 1 
ATOM   10282 C CG2 . VAL G  1 85  ? 36.844  0.045   -39.450 1.00 38.93  ? 85  VAL G CG2 1 
ATOM   10283 N N   . ALA G  1 86  ? 36.330  -4.270  -41.443 1.00 36.74  ? 86  ALA G N   1 
ATOM   10284 C CA  . ALA G  1 86  ? 36.152  -5.232  -42.527 1.00 37.78  ? 86  ALA G CA  1 
ATOM   10285 C C   . ALA G  1 86  ? 35.176  -4.800  -43.612 1.00 35.75  ? 86  ALA G C   1 
ATOM   10286 O O   . ALA G  1 86  ? 34.172  -4.152  -43.338 1.00 36.03  ? 86  ALA G O   1 
ATOM   10287 C CB  . ALA G  1 86  ? 35.720  -6.592  -41.949 1.00 37.26  ? 86  ALA G CB  1 
ATOM   10288 N N   . PRO G  1 87  ? 35.460  -5.176  -44.868 1.00 35.78  ? 87  PRO G N   1 
ATOM   10289 C CA  . PRO G  1 87  ? 34.622  -4.846  -46.024 1.00 35.86  ? 87  PRO G CA  1 
ATOM   10290 C C   . PRO G  1 87  ? 33.396  -5.733  -46.194 1.00 36.22  ? 87  PRO G C   1 
ATOM   10291 O O   . PRO G  1 87  ? 33.354  -6.851  -45.698 1.00 35.87  ? 87  PRO G O   1 
ATOM   10292 C CB  . PRO G  1 87  ? 35.575  -5.021  -47.190 1.00 35.16  ? 87  PRO G CB  1 
ATOM   10293 C CG  . PRO G  1 87  ? 36.399  -6.186  -46.745 1.00 34.18  ? 87  PRO G CG  1 
ATOM   10294 C CD  . PRO G  1 87  ? 36.702  -5.842  -45.300 1.00 34.97  ? 87  PRO G CD  1 
ATOM   10295 N N   . GLU G  1 88  ? 32.396  -5.189  -46.883 1.00 40.32  ? 88  GLU G N   1 
ATOM   10296 C CA  . GLU G  1 88  ? 31.165  -5.895  -47.242 1.00 41.53  ? 88  GLU G CA  1 
ATOM   10297 C C   . GLU G  1 88  ? 31.494  -6.272  -48.675 1.00 40.80  ? 88  GLU G C   1 
ATOM   10298 O O   . GLU G  1 88  ? 32.138  -5.497  -49.387 1.00 40.86  ? 88  GLU G O   1 
ATOM   10299 C CB  . GLU G  1 88  ? 29.963  -4.953  -47.282 1.00 44.49  ? 88  GLU G CB  1 
ATOM   10300 C CG  . GLU G  1 88  ? 29.194  -4.797  -45.991 1.00 50.37  ? 88  GLU G CG  1 
ATOM   10301 C CD  . GLU G  1 88  ? 28.080  -3.762  -46.121 1.00 53.81  ? 88  GLU G CD  1 
ATOM   10302 O OE1 . GLU G  1 88  ? 27.274  -3.852  -47.083 1.00 54.60  ? 88  GLU G OE1 1 
ATOM   10303 O OE2 . GLU G  1 88  ? 28.011  -2.860  -45.256 1.00 55.80  ? 88  GLU G OE2 1 
ATOM   10304 N N   . VAL G  1 89  ? 31.063  -7.443  -49.112 1.00 40.58  ? 89  VAL G N   1 
ATOM   10305 C CA  . VAL G  1 89  ? 31.358  -7.850  -50.472 1.00 39.49  ? 89  VAL G CA  1 
ATOM   10306 C C   . VAL G  1 89  ? 30.127  -8.346  -51.214 1.00 39.40  ? 89  VAL G C   1 
ATOM   10307 O O   . VAL G  1 89  ? 29.348  -9.148  -50.705 1.00 39.43  ? 89  VAL G O   1 
ATOM   10308 C CB  . VAL G  1 89  ? 32.434  -8.940  -50.497 1.00 37.74  ? 89  VAL G CB  1 
ATOM   10309 C CG1 . VAL G  1 89  ? 32.738  -9.323  -51.929 1.00 40.06  ? 89  VAL G CG1 1 
ATOM   10310 C CG2 . VAL G  1 89  ? 33.691  -8.440  -49.821 1.00 38.19  ? 89  VAL G CG2 1 
ATOM   10311 N N   . THR G  1 90  ? 29.973  -7.858  -52.436 1.00 38.24  ? 90  THR G N   1 
ATOM   10312 C CA  . THR G  1 90  ? 28.863  -8.231  -53.274 1.00 38.33  ? 90  THR G CA  1 
ATOM   10313 C C   . THR G  1 90  ? 29.379  -8.482  -54.682 1.00 39.42  ? 90  THR G C   1 
ATOM   10314 O O   . THR G  1 90  ? 30.151  -7.678  -55.232 1.00 37.41  ? 90  THR G O   1 
ATOM   10315 C CB  . THR G  1 90  ? 27.818  -7.112  -53.310 1.00 39.62  ? 90  THR G CB  1 
ATOM   10316 O OG1 . THR G  1 90  ? 27.305  -6.912  -51.986 1.00 43.17  ? 90  THR G OG1 1 
ATOM   10317 C CG2 . THR G  1 90  ? 26.675  -7.467  -54.256 1.00 35.35  ? 90  THR G CG2 1 
ATOM   10318 N N   . VAL G  1 91  ? 28.966  -9.614  -55.250 1.00 38.24  ? 91  VAL G N   1 
ATOM   10319 C CA  . VAL G  1 91  ? 29.347  -9.981  -56.609 1.00 37.87  ? 91  VAL G CA  1 
ATOM   10320 C C   . VAL G  1 91  ? 28.113  -9.869  -57.486 1.00 37.85  ? 91  VAL G C   1 
ATOM   10321 O O   . VAL G  1 91  ? 27.041  -10.343 -57.111 1.00 39.66  ? 91  VAL G O   1 
ATOM   10322 C CB  . VAL G  1 91  ? 29.827  -11.434 -56.708 1.00 36.39  ? 91  VAL G CB  1 
ATOM   10323 C CG1 . VAL G  1 91  ? 30.332  -11.702 -58.116 1.00 34.95  ? 91  VAL G CG1 1 
ATOM   10324 C CG2 . VAL G  1 91  ? 30.897  -11.715 -55.676 1.00 37.50  ? 91  VAL G CG2 1 
ATOM   10325 N N   . LEU G  1 92  ? 28.253  -9.241  -58.647 1.00 37.14  ? 92  LEU G N   1 
ATOM   10326 C CA  . LEU G  1 92  ? 27.135  -9.113  -59.570 1.00 36.90  ? 92  LEU G CA  1 
ATOM   10327 C C   . LEU G  1 92  ? 27.637  -8.932  -60.993 1.00 38.70  ? 92  LEU G C   1 
ATOM   10328 O O   . LEU G  1 92  ? 28.813  -8.603  -61.214 1.00 38.12  ? 92  LEU G O   1 
ATOM   10329 C CB  . LEU G  1 92  ? 26.248  -7.930  -59.193 1.00 37.79  ? 92  LEU G CB  1 
ATOM   10330 C CG  . LEU G  1 92  ? 26.872  -6.530  -59.236 1.00 38.96  ? 92  LEU G CG  1 
ATOM   10331 C CD1 . LEU G  1 92  ? 25.780  -5.503  -59.007 1.00 39.45  ? 92  LEU G CD1 1 
ATOM   10332 C CD2 . LEU G  1 92  ? 27.952  -6.396  -58.170 1.00 37.56  ? 92  LEU G CD2 1 
ATOM   10333 N N   . SER G  1 93  ? 26.740  -9.143  -61.956 1.00 39.11  ? 93  SER G N   1 
ATOM   10334 C CA  . SER G  1 93  ? 27.079  -9.004  -63.366 1.00 40.90  ? 93  SER G CA  1 
ATOM   10335 C C   . SER G  1 93  ? 26.925  -7.558  -63.802 1.00 40.44  ? 93  SER G C   1 
ATOM   10336 O O   . SER G  1 93  ? 26.019  -6.863  -63.358 1.00 39.77  ? 93  SER G O   1 
ATOM   10337 C CB  . SER G  1 93  ? 26.180  -9.900  -64.218 1.00 41.12  ? 93  SER G CB  1 
ATOM   10338 O OG  . SER G  1 93  ? 24.818  -9.562  -64.036 1.00 44.41  ? 93  SER G OG  1 
ATOM   10339 N N   . ARG G  1 94  ? 27.820  -7.112  -64.675 1.00 41.60  ? 94  ARG G N   1 
ATOM   10340 C CA  . ARG G  1 94  ? 27.796  -5.742  -65.167 1.00 43.70  ? 94  ARG G CA  1 
ATOM   10341 C C   . ARG G  1 94  ? 26.527  -5.431  -65.958 1.00 43.64  ? 94  ARG G C   1 
ATOM   10342 O O   . ARG G  1 94  ? 26.080  -4.291  -65.997 1.00 43.27  ? 94  ARG G O   1 
ATOM   10343 C CB  . ARG G  1 94  ? 29.044  -5.470  -66.012 1.00 43.12  ? 94  ARG G CB  1 
ATOM   10344 C CG  . ARG G  1 94  ? 29.048  -4.121  -66.686 1.00 45.27  ? 94  ARG G CG  1 
ATOM   10345 C CD  . ARG G  1 94  ? 30.409  -3.805  -67.255 1.00 49.23  ? 94  ARG G CD  1 
ATOM   10346 N NE  . ARG G  1 94  ? 30.397  -2.542  -67.981 1.00 52.02  ? 94  ARG G NE  1 
ATOM   10347 C CZ  . ARG G  1 94  ? 29.774  -2.363  -69.138 1.00 54.16  ? 94  ARG G CZ  1 
ATOM   10348 N NH1 . ARG G  1 94  ? 29.118  -3.373  -69.695 1.00 54.44  ? 94  ARG G NH1 1 
ATOM   10349 N NH2 . ARG G  1 94  ? 29.807  -1.177  -69.736 1.00 55.24  ? 94  ARG G NH2 1 
ATOM   10350 N N   . SER G  1 95  ? 25.951  -6.444  -66.589 1.00 45.11  ? 95  SER G N   1 
ATOM   10351 C CA  . SER G  1 95  ? 24.716  -6.270  -67.350 1.00 46.65  ? 95  SER G CA  1 
ATOM   10352 C C   . SER G  1 95  ? 23.999  -7.618  -67.455 1.00 48.11  ? 95  SER G C   1 
ATOM   10353 O O   . SER G  1 95  ? 24.593  -8.666  -67.169 1.00 45.34  ? 95  SER G O   1 
ATOM   10354 C CB  . SER G  1 95  ? 25.009  -5.688  -68.746 1.00 48.18  ? 95  SER G CB  1 
ATOM   10355 O OG  . SER G  1 95  ? 25.983  -6.427  -69.466 1.00 48.29  ? 95  SER G OG  1 
ATOM   10356 N N   . PRO G  1 96  ? 22.707  -7.609  -67.838 1.00 48.77  ? 96  PRO G N   1 
ATOM   10357 C CA  . PRO G  1 96  ? 21.931  -8.845  -67.965 1.00 48.36  ? 96  PRO G CA  1 
ATOM   10358 C C   . PRO G  1 96  ? 22.754  -9.979  -68.569 1.00 48.56  ? 96  PRO G C   1 
ATOM   10359 O O   . PRO G  1 96  ? 23.411  -9.812  -69.599 1.00 48.23  ? 96  PRO G O   1 
ATOM   10360 C CB  . PRO G  1 96  ? 20.768  -8.419  -68.849 1.00 50.00  ? 96  PRO G CB  1 
ATOM   10361 C CG  . PRO G  1 96  ? 20.513  -7.023  -68.374 1.00 49.24  ? 96  PRO G CG  1 
ATOM   10362 C CD  . PRO G  1 96  ? 21.908  -6.445  -68.263 1.00 48.96  ? 96  PRO G CD  1 
ATOM   10363 N N   . VAL G  1 97  ? 22.717  -11.130 -67.915 1.00 48.04  ? 97  VAL G N   1 
ATOM   10364 C CA  . VAL G  1 97  ? 23.469  -12.285 -68.363 1.00 48.78  ? 97  VAL G CA  1 
ATOM   10365 C C   . VAL G  1 97  ? 22.743  -13.137 -69.396 1.00 49.90  ? 97  VAL G C   1 
ATOM   10366 O O   . VAL G  1 97  ? 21.587  -13.514 -69.210 1.00 50.02  ? 97  VAL G O   1 
ATOM   10367 C CB  . VAL G  1 97  ? 23.837  -13.181 -67.175 1.00 48.82  ? 97  VAL G CB  1 
ATOM   10368 C CG1 . VAL G  1 97  ? 24.630  -14.384 -67.658 1.00 49.83  ? 97  VAL G CG1 1 
ATOM   10369 C CG2 . VAL G  1 97  ? 24.630  -12.384 -66.167 1.00 47.79  ? 97  VAL G CG2 1 
ATOM   10370 N N   . ASN G  1 98  ? 23.445  -13.431 -70.488 1.00 50.68  ? 98  ASN G N   1 
ATOM   10371 C CA  . ASN G  1 98  ? 22.925  -14.259 -71.573 1.00 50.24  ? 98  ASN G CA  1 
ATOM   10372 C C   . ASN G  1 98  ? 23.989  -15.282 -71.951 1.00 49.42  ? 98  ASN G C   1 
ATOM   10373 O O   . ASN G  1 98  ? 25.128  -14.930 -72.237 1.00 48.77  ? 98  ASN G O   1 
ATOM   10374 C CB  . ASN G  1 98  ? 22.576  -13.400 -72.790 1.00 50.38  ? 98  ASN G CB  1 
ATOM   10375 C CG  . ASN G  1 98  ? 21.395  -12.495 -72.535 1.00 52.21  ? 98  ASN G CG  1 
ATOM   10376 O OD1 . ASN G  1 98  ? 20.308  -12.963 -72.197 1.00 54.29  ? 98  ASN G OD1 1 
ATOM   10377 N ND2 . ASN G  1 98  ? 21.597  -11.194 -72.691 1.00 51.43  ? 98  ASN G ND2 1 
ATOM   10378 N N   . LEU G  1 99  ? 23.614  -16.552 -71.933 1.00 49.10  ? 99  LEU G N   1 
ATOM   10379 C CA  . LEU G  1 99  ? 24.535  -17.624 -72.274 1.00 50.38  ? 99  LEU G CA  1 
ATOM   10380 C C   . LEU G  1 99  ? 25.245  -17.395 -73.615 1.00 49.41  ? 99  LEU G C   1 
ATOM   10381 O O   . LEU G  1 99  ? 24.595  -17.135 -74.631 1.00 49.28  ? 99  LEU G O   1 
ATOM   10382 C CB  . LEU G  1 99  ? 23.767  -18.947 -72.312 1.00 50.17  ? 99  LEU G CB  1 
ATOM   10383 C CG  . LEU G  1 99  ? 23.190  -19.349 -70.958 1.00 50.62  ? 99  LEU G CG  1 
ATOM   10384 C CD1 . LEU G  1 99  ? 22.066  -20.369 -71.123 1.00 49.77  ? 99  LEU G CD1 1 
ATOM   10385 C CD2 . LEU G  1 99  ? 24.328  -19.892 -70.105 1.00 49.78  ? 99  LEU G CD2 1 
ATOM   10386 N N   . GLY G  1 100 ? 26.576  -17.484 -73.604 1.00 47.76  ? 100 GLY G N   1 
ATOM   10387 C CA  . GLY G  1 100 ? 27.350  -17.313 -74.823 1.00 47.51  ? 100 GLY G CA  1 
ATOM   10388 C C   . GLY G  1 100 ? 27.655  -15.885 -75.235 1.00 46.22  ? 100 GLY G C   1 
ATOM   10389 O O   . GLY G  1 100 ? 28.290  -15.659 -76.262 1.00 45.26  ? 100 GLY G O   1 
ATOM   10390 N N   . GLU G  1 101 ? 27.211  -14.922 -74.433 1.00 45.89  ? 101 GLU G N   1 
ATOM   10391 C CA  . GLU G  1 101 ? 27.434  -13.507 -74.717 1.00 45.63  ? 101 GLU G CA  1 
ATOM   10392 C C   . GLU G  1 101 ? 28.442  -12.916 -73.725 1.00 44.94  ? 101 GLU G C   1 
ATOM   10393 O O   . GLU G  1 101 ? 28.203  -12.910 -72.512 1.00 45.56  ? 101 GLU G O   1 
ATOM   10394 C CB  . GLU G  1 101 ? 26.104  -12.769 -74.620 1.00 46.25  ? 101 GLU G CB  1 
ATOM   10395 C CG  . GLU G  1 101 ? 26.183  -11.267 -74.796 1.00 51.24  ? 101 GLU G CG  1 
ATOM   10396 C CD  . GLU G  1 101 ? 24.907  -10.582 -74.332 1.00 54.02  ? 101 GLU G CD  1 
ATOM   10397 O OE1 . GLU G  1 101 ? 24.639  -10.614 -73.110 1.00 51.65  ? 101 GLU G OE1 1 
ATOM   10398 O OE2 . GLU G  1 101 ? 24.172  -10.025 -75.184 1.00 55.39  ? 101 GLU G OE2 1 
ATOM   10399 N N   . PRO G  1 102 ? 29.577  -12.394 -74.227 1.00 43.48  ? 102 PRO G N   1 
ATOM   10400 C CA  . PRO G  1 102 ? 30.619  -11.807 -73.375 1.00 41.38  ? 102 PRO G CA  1 
ATOM   10401 C C   . PRO G  1 102 ? 30.039  -10.845 -72.341 1.00 39.84  ? 102 PRO G C   1 
ATOM   10402 O O   . PRO G  1 102 ? 29.192  -10.010 -72.660 1.00 37.25  ? 102 PRO G O   1 
ATOM   10403 C CB  . PRO G  1 102 ? 31.530  -11.103 -74.376 1.00 39.12  ? 102 PRO G CB  1 
ATOM   10404 C CG  . PRO G  1 102 ? 31.368  -11.907 -75.600 1.00 42.62  ? 102 PRO G CG  1 
ATOM   10405 C CD  . PRO G  1 102 ? 29.882  -12.153 -75.645 1.00 43.18  ? 102 PRO G CD  1 
ATOM   10406 N N   . ASN G  1 103 ? 30.504  -10.973 -71.104 1.00 38.72  ? 103 ASN G N   1 
ATOM   10407 C CA  . ASN G  1 103 ? 30.027  -10.128 -70.023 1.00 39.27  ? 103 ASN G CA  1 
ATOM   10408 C C   . ASN G  1 103 ? 31.174  -9.823  -69.064 1.00 38.76  ? 103 ASN G C   1 
ATOM   10409 O O   . ASN G  1 103 ? 32.331  -10.167 -69.320 1.00 40.16  ? 103 ASN G O   1 
ATOM   10410 C CB  . ASN G  1 103 ? 28.890  -10.829 -69.271 1.00 37.16  ? 103 ASN G CB  1 
ATOM   10411 C CG  . ASN G  1 103 ? 27.870  -9.846  -68.698 1.00 40.33  ? 103 ASN G CG  1 
ATOM   10412 O OD1 . ASN G  1 103 ? 28.230  -8.901  -67.987 1.00 38.31  ? 103 ASN G OD1 1 
ATOM   10413 N ND2 . ASN G  1 103 ? 26.586  -10.072 -69.003 1.00 39.08  ? 103 ASN G ND2 1 
ATOM   10414 N N   . ILE G  1 104 ? 30.839  -9.182  -67.952 1.00 38.88  ? 104 ILE G N   1 
ATOM   10415 C CA  . ILE G  1 104 ? 31.816  -8.801  -66.945 1.00 35.62  ? 104 ILE G CA  1 
ATOM   10416 C C   . ILE G  1 104 ? 31.246  -9.037  -65.557 1.00 34.06  ? 104 ILE G C   1 
ATOM   10417 O O   . ILE G  1 104 ? 30.121  -8.665  -65.287 1.00 33.97  ? 104 ILE G O   1 
ATOM   10418 C CB  . ILE G  1 104 ? 32.168  -7.307  -67.105 1.00 35.71  ? 104 ILE G CB  1 
ATOM   10419 C CG1 . ILE G  1 104 ? 33.004  -7.128  -68.376 1.00 33.25  ? 104 ILE G CG1 1 
ATOM   10420 C CG2 . ILE G  1 104 ? 32.860  -6.769  -65.847 1.00 32.54  ? 104 ILE G CG2 1 
ATOM   10421 C CD1 . ILE G  1 104 ? 33.370  -5.697  -68.683 1.00 32.25  ? 104 ILE G CD1 1 
ATOM   10422 N N   . LEU G  1 105 ? 32.011  -9.681  -64.687 1.00 34.03  ? 105 LEU G N   1 
ATOM   10423 C CA  . LEU G  1 105 ? 31.555  -9.903  -63.320 1.00 35.31  ? 105 LEU G CA  1 
ATOM   10424 C C   . LEU G  1 105 ? 32.137  -8.799  -62.448 1.00 34.35  ? 105 LEU G C   1 
ATOM   10425 O O   . LEU G  1 105 ? 33.307  -8.426  -62.594 1.00 33.06  ? 105 LEU G O   1 
ATOM   10426 C CB  . LEU G  1 105 ? 32.017  -11.259 -62.778 1.00 34.04  ? 105 LEU G CB  1 
ATOM   10427 C CG  . LEU G  1 105 ? 31.021  -12.396 -62.938 1.00 37.43  ? 105 LEU G CG  1 
ATOM   10428 C CD1 . LEU G  1 105 ? 31.504  -13.634 -62.180 1.00 35.12  ? 105 LEU G CD1 1 
ATOM   10429 C CD2 . LEU G  1 105 ? 29.672  -11.938 -62.419 1.00 36.41  ? 105 LEU G CD2 1 
ATOM   10430 N N   . ILE G  1 106 ? 31.328  -8.302  -61.523 1.00 33.90  ? 106 ILE G N   1 
ATOM   10431 C CA  . ILE G  1 106 ? 31.764  -7.229  -60.652 1.00 34.65  ? 106 ILE G CA  1 
ATOM   10432 C C   . ILE G  1 106 ? 31.875  -7.643  -59.197 1.00 34.81  ? 106 ILE G C   1 
ATOM   10433 O O   . ILE G  1 106 ? 30.941  -8.202  -58.635 1.00 34.72  ? 106 ILE G O   1 
ATOM   10434 C CB  . ILE G  1 106 ? 30.786  -6.037  -60.742 1.00 36.00  ? 106 ILE G CB  1 
ATOM   10435 C CG1 . ILE G  1 106 ? 30.684  -5.572  -62.194 1.00 31.84  ? 106 ILE G CG1 1 
ATOM   10436 C CG2 . ILE G  1 106 ? 31.248  -4.890  -59.836 1.00 33.45  ? 106 ILE G CG2 1 
ATOM   10437 C CD1 . ILE G  1 106 ? 29.603  -4.557  -62.406 1.00 39.50  ? 106 ILE G CD1 1 
ATOM   10438 N N   . CYS G  1 107 ? 33.031  -7.375  -58.595 1.00 34.85  ? 107 CYS G N   1 
ATOM   10439 C CA  . CYS G  1 107 ? 33.231  -7.663  -57.179 1.00 34.46  ? 107 CYS G CA  1 
ATOM   10440 C C   . CYS G  1 107 ? 33.338  -6.310  -56.473 1.00 33.56  ? 107 CYS G C   1 
ATOM   10441 O O   . CYS G  1 107 ? 34.386  -5.655  -56.521 1.00 33.06  ? 107 CYS G O   1 
ATOM   10442 C CB  . CYS G  1 107 ? 34.506  -8.464  -56.940 1.00 32.66  ? 107 CYS G CB  1 
ATOM   10443 S SG  . CYS G  1 107 ? 34.634  -8.999  -55.207 1.00 34.81  ? 107 CYS G SG  1 
ATOM   10444 N N   . PHE G  1 108 ? 32.245  -5.896  -55.834 1.00 33.42  ? 108 PHE G N   1 
ATOM   10445 C CA  . PHE G  1 108 ? 32.177  -4.619  -55.127 1.00 31.95  ? 108 PHE G CA  1 
ATOM   10446 C C   . PHE G  1 108 ? 32.531  -4.771  -53.645 1.00 33.52  ? 108 PHE G C   1 
ATOM   10447 O O   . PHE G  1 108 ? 31.839  -5.456  -52.876 1.00 30.43  ? 108 PHE G O   1 
ATOM   10448 C CB  . PHE G  1 108 ? 30.778  -4.030  -55.298 1.00 33.05  ? 108 PHE G CB  1 
ATOM   10449 C CG  . PHE G  1 108 ? 30.588  -2.666  -54.670 1.00 34.57  ? 108 PHE G CG  1 
ATOM   10450 C CD1 . PHE G  1 108 ? 31.518  -1.647  -54.873 1.00 32.92  ? 108 PHE G CD1 1 
ATOM   10451 C CD2 . PHE G  1 108 ? 29.433  -2.384  -53.943 1.00 33.12  ? 108 PHE G CD2 1 
ATOM   10452 C CE1 . PHE G  1 108 ? 31.302  -0.366  -54.365 1.00 35.20  ? 108 PHE G CE1 1 
ATOM   10453 C CE2 . PHE G  1 108 ? 29.201  -1.104  -53.430 1.00 35.55  ? 108 PHE G CE2 1 
ATOM   10454 C CZ  . PHE G  1 108 ? 30.142  -0.089  -53.642 1.00 34.85  ? 108 PHE G CZ  1 
ATOM   10455 N N   . ILE G  1 109 ? 33.634  -4.130  -53.267 1.00 32.26  ? 109 ILE G N   1 
ATOM   10456 C CA  . ILE G  1 109 ? 34.143  -4.145  -51.902 1.00 30.96  ? 109 ILE G CA  1 
ATOM   10457 C C   . ILE G  1 109 ? 33.817  -2.781  -51.278 1.00 30.63  ? 109 ILE G C   1 
ATOM   10458 O O   . ILE G  1 109 ? 34.328  -1.749  -51.707 1.00 28.95  ? 109 ILE G O   1 
ATOM   10459 C CB  . ILE G  1 109 ? 35.642  -4.400  -51.933 1.00 29.46  ? 109 ILE G CB  1 
ATOM   10460 C CG1 . ILE G  1 109 ? 35.903  -5.610  -52.840 1.00 28.32  ? 109 ILE G CG1 1 
ATOM   10461 C CG2 . ILE G  1 109 ? 36.167  -4.616  -50.530 1.00 26.44  ? 109 ILE G CG2 1 
ATOM   10462 C CD1 . ILE G  1 109 ? 37.357  -5.891  -53.122 1.00 27.36  ? 109 ILE G CD1 1 
ATOM   10463 N N   . ASP G  1 110 ? 32.988  -2.792  -50.243 1.00 29.89  ? 110 ASP G N   1 
ATOM   10464 C CA  . ASP G  1 110 ? 32.527  -1.557  -49.630 1.00 31.11  ? 110 ASP G CA  1 
ATOM   10465 C C   . ASP G  1 110 ? 32.747  -1.413  -48.114 1.00 30.44  ? 110 ASP G C   1 
ATOM   10466 O O   . ASP G  1 110 ? 32.914  -2.401  -47.399 1.00 28.37  ? 110 ASP G O   1 
ATOM   10467 C CB  . ASP G  1 110 ? 31.027  -1.457  -49.958 1.00 34.35  ? 110 ASP G CB  1 
ATOM   10468 C CG  . ASP G  1 110 ? 30.473  -0.067  -49.830 1.00 36.49  ? 110 ASP G CG  1 
ATOM   10469 O OD1 . ASP G  1 110 ? 31.242  0.915   -49.751 1.00 39.08  ? 110 ASP G OD1 1 
ATOM   10470 O OD2 . ASP G  1 110 ? 29.234  0.039   -49.834 1.00 42.27  ? 110 ASP G OD2 1 
ATOM   10471 N N   . LYS G  1 111 ? 32.725  -0.164  -47.644 1.00 28.92  ? 111 LYS G N   1 
ATOM   10472 C CA  . LYS G  1 111 ? 32.845  0.180   -46.225 1.00 29.12  ? 111 LYS G CA  1 
ATOM   10473 C C   . LYS G  1 111 ? 33.975  -0.465  -45.451 1.00 28.57  ? 111 LYS G C   1 
ATOM   10474 O O   . LYS G  1 111 ? 33.741  -1.161  -44.466 1.00 29.56  ? 111 LYS G O   1 
ATOM   10475 C CB  . LYS G  1 111 ? 31.547  -0.143  -45.487 1.00 31.79  ? 111 LYS G CB  1 
ATOM   10476 C CG  . LYS G  1 111 ? 30.289  0.444   -46.090 1.00 39.15  ? 111 LYS G CG  1 
ATOM   10477 C CD  . LYS G  1 111 ? 29.070  -0.062  -45.321 1.00 44.86  ? 111 LYS G CD  1 
ATOM   10478 C CE  . LYS G  1 111 ? 27.759  0.173   -46.085 1.00 49.56  ? 111 LYS G CE  1 
ATOM   10479 N NZ  . LYS G  1 111 ? 26.577  -0.518  -45.458 1.00 49.46  ? 111 LYS G NZ  1 
ATOM   10480 N N   . PHE G  1 112 ? 35.206  -0.233  -45.867 1.00 26.18  ? 112 PHE G N   1 
ATOM   10481 C CA  . PHE G  1 112 ? 36.305  -0.827  -45.146 1.00 25.46  ? 112 PHE G CA  1 
ATOM   10482 C C   . PHE G  1 112 ? 37.445  0.161   -45.059 1.00 24.65  ? 112 PHE G C   1 
ATOM   10483 O O   . PHE G  1 112 ? 37.526  1.109   -45.841 1.00 24.30  ? 112 PHE G O   1 
ATOM   10484 C CB  . PHE G  1 112 ? 36.797  -2.078  -45.874 1.00 24.90  ? 112 PHE G CB  1 
ATOM   10485 C CG  . PHE G  1 112 ? 37.332  -1.800  -47.256 1.00 24.32  ? 112 PHE G CG  1 
ATOM   10486 C CD1 . PHE G  1 112 ? 36.464  -1.713  -48.355 1.00 23.84  ? 112 PHE G CD1 1 
ATOM   10487 C CD2 . PHE G  1 112 ? 38.699  -1.583  -47.453 1.00 19.92  ? 112 PHE G CD2 1 
ATOM   10488 C CE1 . PHE G  1 112 ? 36.957  -1.412  -49.640 1.00 22.89  ? 112 PHE G CE1 1 
ATOM   10489 C CE2 . PHE G  1 112 ? 39.206  -1.283  -48.722 1.00 20.99  ? 112 PHE G CE2 1 
ATOM   10490 C CZ  . PHE G  1 112 ? 38.335  -1.199  -49.821 1.00 23.38  ? 112 PHE G CZ  1 
ATOM   10491 N N   . SER G  1 113 ? 38.326  -0.082  -44.101 1.00 23.76  ? 113 SER G N   1 
ATOM   10492 C CA  . SER G  1 113 ? 39.520  0.723   -43.910 1.00 23.53  ? 113 SER G CA  1 
ATOM   10493 C C   . SER G  1 113 ? 40.353  -0.136  -42.985 1.00 23.96  ? 113 SER G C   1 
ATOM   10494 O O   . SER G  1 113 ? 39.790  -0.873  -42.178 1.00 25.07  ? 113 SER G O   1 
ATOM   10495 C CB  . SER G  1 113 ? 39.184  2.053   -43.233 1.00 20.86  ? 113 SER G CB  1 
ATOM   10496 O OG  . SER G  1 113 ? 40.345  2.856   -43.177 1.00 23.27  ? 113 SER G OG  1 
ATOM   10497 N N   . PRO G  1 114 ? 41.690  -0.092  -43.101 1.00 23.47  ? 114 PRO G N   1 
ATOM   10498 C CA  . PRO G  1 114 ? 42.516  0.693   -44.017 1.00 25.90  ? 114 PRO G CA  1 
ATOM   10499 C C   . PRO G  1 114 ? 42.347  0.295   -45.467 1.00 28.38  ? 114 PRO G C   1 
ATOM   10500 O O   . PRO G  1 114 ? 41.888  -0.813  -45.776 1.00 28.64  ? 114 PRO G O   1 
ATOM   10501 C CB  . PRO G  1 114 ? 43.933  0.411   -43.535 1.00 25.38  ? 114 PRO G CB  1 
ATOM   10502 C CG  . PRO G  1 114 ? 43.834  -0.971  -43.016 1.00 24.14  ? 114 PRO G CG  1 
ATOM   10503 C CD  . PRO G  1 114 ? 42.540  -0.929  -42.242 1.00 24.24  ? 114 PRO G CD  1 
ATOM   10504 N N   . PRO G  1 115 ? 42.733  1.196   -46.379 1.00 28.06  ? 115 PRO G N   1 
ATOM   10505 C CA  . PRO G  1 115 ? 42.630  0.948   -47.814 1.00 29.52  ? 115 PRO G CA  1 
ATOM   10506 C C   . PRO G  1 115 ? 43.703  -0.012  -48.329 1.00 30.01  ? 115 PRO G C   1 
ATOM   10507 O O   . PRO G  1 115 ? 44.639  0.390   -49.012 1.00 31.28  ? 115 PRO G O   1 
ATOM   10508 C CB  . PRO G  1 115 ? 42.749  2.349   -48.409 1.00 29.82  ? 115 PRO G CB  1 
ATOM   10509 C CG  . PRO G  1 115 ? 43.715  3.011   -47.470 1.00 28.45  ? 115 PRO G CG  1 
ATOM   10510 C CD  . PRO G  1 115 ? 43.241  2.551   -46.106 1.00 25.92  ? 115 PRO G CD  1 
ATOM   10511 N N   . VAL G  1 116 ? 43.561  -1.279  -47.967 1.00 32.22  ? 116 VAL G N   1 
ATOM   10512 C CA  . VAL G  1 116 ? 44.455  -2.354  -48.394 1.00 33.47  ? 116 VAL G CA  1 
ATOM   10513 C C   . VAL G  1 116 ? 43.622  -3.617  -48.377 1.00 32.73  ? 116 VAL G C   1 
ATOM   10514 O O   . VAL G  1 116 ? 42.988  -3.924  -47.382 1.00 32.37  ? 116 VAL G O   1 
ATOM   10515 C CB  . VAL G  1 116 ? 45.650  -2.545  -47.437 1.00 35.62  ? 116 VAL G CB  1 
ATOM   10516 C CG1 . VAL G  1 116 ? 46.775  -1.596  -47.815 1.00 37.69  ? 116 VAL G CG1 1 
ATOM   10517 C CG2 . VAL G  1 116 ? 45.207  -2.307  -46.007 1.00 34.74  ? 116 VAL G CG2 1 
ATOM   10518 N N   . VAL G  1 117 ? 43.603  -4.344  -49.484 1.00 35.26  ? 117 VAL G N   1 
ATOM   10519 C CA  . VAL G  1 117 ? 42.819  -5.573  -49.560 1.00 36.33  ? 117 VAL G CA  1 
ATOM   10520 C C   . VAL G  1 117 ? 43.429  -6.474  -50.596 1.00 37.38  ? 117 VAL G C   1 
ATOM   10521 O O   . VAL G  1 117 ? 44.076  -6.007  -51.521 1.00 38.84  ? 117 VAL G O   1 
ATOM   10522 C CB  . VAL G  1 117 ? 41.333  -5.320  -49.991 1.00 36.40  ? 117 VAL G CB  1 
ATOM   10523 C CG1 . VAL G  1 117 ? 40.505  -4.804  -48.813 1.00 37.48  ? 117 VAL G CG1 1 
ATOM   10524 C CG2 . VAL G  1 117 ? 41.291  -4.323  -51.155 1.00 34.44  ? 117 VAL G CG2 1 
ATOM   10525 N N   . ASN G  1 118 ? 43.245  -7.772  -50.423 1.00 38.88  ? 118 ASN G N   1 
ATOM   10526 C CA  . ASN G  1 118 ? 43.745  -8.728  -51.395 1.00 40.04  ? 118 ASN G CA  1 
ATOM   10527 C C   . ASN G  1 118 ? 42.517  -9.355  -51.987 1.00 38.13  ? 118 ASN G C   1 
ATOM   10528 O O   . ASN G  1 118 ? 41.631  -9.811  -51.265 1.00 36.62  ? 118 ASN G O   1 
ATOM   10529 C CB  . ASN G  1 118 ? 44.609  -9.793  -50.743 1.00 41.40  ? 118 ASN G CB  1 
ATOM   10530 C CG  . ASN G  1 118 ? 45.945  -9.265  -50.340 1.00 45.20  ? 118 ASN G CG  1 
ATOM   10531 O OD1 . ASN G  1 118 ? 46.505  -8.406  -51.027 1.00 44.51  ? 118 ASN G OD1 1 
ATOM   10532 N ND2 . ASN G  1 118 ? 46.467  -9.780  -49.233 1.00 48.27  ? 118 ASN G ND2 1 
ATOM   10533 N N   . VAL G  1 119 ? 42.463  -9.356  -53.309 1.00 37.78  ? 119 VAL G N   1 
ATOM   10534 C CA  . VAL G  1 119 ? 41.325  -9.900  -54.014 1.00 37.59  ? 119 VAL G CA  1 
ATOM   10535 C C   . VAL G  1 119 ? 41.778  -10.962 -54.998 1.00 38.27  ? 119 VAL G C   1 
ATOM   10536 O O   . VAL G  1 119 ? 42.737  -10.761 -55.753 1.00 37.60  ? 119 VAL G O   1 
ATOM   10537 C CB  . VAL G  1 119 ? 40.593  -8.780  -54.769 1.00 37.28  ? 119 VAL G CB  1 
ATOM   10538 C CG1 . VAL G  1 119 ? 39.349  -9.318  -55.463 1.00 35.42  ? 119 VAL G CG1 1 
ATOM   10539 C CG2 . VAL G  1 119 ? 40.238  -7.672  -53.791 1.00 36.76  ? 119 VAL G CG2 1 
ATOM   10540 N N   . THR G  1 120 ? 41.102  -12.106 -54.959 1.00 37.54  ? 120 THR G N   1 
ATOM   10541 C CA  . THR G  1 120 ? 41.391  -13.203 -55.865 1.00 36.95  ? 120 THR G CA  1 
ATOM   10542 C C   . THR G  1 120 ? 40.088  -13.568 -56.562 1.00 36.44  ? 120 THR G C   1 
ATOM   10543 O O   . THR G  1 120 ? 39.038  -13.696 -55.929 1.00 37.28  ? 120 THR G O   1 
ATOM   10544 C CB  . THR G  1 120 ? 41.918  -14.459 -55.125 1.00 38.37  ? 120 THR G CB  1 
ATOM   10545 O OG1 . THR G  1 120 ? 43.197  -14.187 -54.536 1.00 41.62  ? 120 THR G OG1 1 
ATOM   10546 C CG2 . THR G  1 120 ? 42.071  -15.619 -56.100 1.00 39.65  ? 120 THR G CG2 1 
ATOM   10547 N N   . TRP G  1 121 ? 40.144  -13.706 -57.877 1.00 36.24  ? 121 TRP G N   1 
ATOM   10548 C CA  . TRP G  1 121 ? 38.965  -14.103 -58.622 1.00 36.03  ? 121 TRP G CA  1 
ATOM   10549 C C   . TRP G  1 121 ? 39.096  -15.606 -58.818 1.00 36.60  ? 121 TRP G C   1 
ATOM   10550 O O   . TRP G  1 121 ? 40.189  -16.111 -59.042 1.00 35.83  ? 121 TRP G O   1 
ATOM   10551 C CB  . TRP G  1 121 ? 38.936  -13.425 -59.978 1.00 31.06  ? 121 TRP G CB  1 
ATOM   10552 C CG  . TRP G  1 121 ? 38.281  -12.102 -60.000 1.00 29.40  ? 121 TRP G CG  1 
ATOM   10553 C CD1 . TRP G  1 121 ? 38.876  -10.908 -60.261 1.00 26.68  ? 121 TRP G CD1 1 
ATOM   10554 C CD2 . TRP G  1 121 ? 36.876  -11.840 -59.897 1.00 27.37  ? 121 TRP G CD2 1 
ATOM   10555 N NE1 . TRP G  1 121 ? 37.931  -9.912  -60.347 1.00 29.50  ? 121 TRP G NE1 1 
ATOM   10556 C CE2 . TRP G  1 121 ? 36.693  -10.454 -60.130 1.00 27.71  ? 121 TRP G CE2 1 
ATOM   10557 C CE3 . TRP G  1 121 ? 35.758  -12.638 -59.641 1.00 24.82  ? 121 TRP G CE3 1 
ATOM   10558 C CZ2 . TRP G  1 121 ? 35.434  -9.847  -60.117 1.00 27.13  ? 121 TRP G CZ2 1 
ATOM   10559 C CZ3 . TRP G  1 121 ? 34.492  -12.038 -59.628 1.00 26.14  ? 121 TRP G CZ3 1 
ATOM   10560 C CH2 . TRP G  1 121 ? 34.342  -10.653 -59.866 1.00 29.70  ? 121 TRP G CH2 1 
ATOM   10561 N N   . LEU G  1 122 ? 37.992  -16.324 -58.723 1.00 38.75  ? 122 LEU G N   1 
ATOM   10562 C CA  . LEU G  1 122 ? 38.041  -17.756 -58.910 1.00 42.87  ? 122 LEU G CA  1 
ATOM   10563 C C   . LEU G  1 122 ? 36.950  -18.216 -59.863 1.00 42.88  ? 122 LEU G C   1 
ATOM   10564 O O   . LEU G  1 122 ? 35.769  -17.927 -59.663 1.00 42.16  ? 122 LEU G O   1 
ATOM   10565 C CB  . LEU G  1 122 ? 37.872  -18.468 -57.570 1.00 44.11  ? 122 LEU G CB  1 
ATOM   10566 C CG  . LEU G  1 122 ? 38.910  -18.177 -56.487 1.00 45.78  ? 122 LEU G CG  1 
ATOM   10567 C CD1 . LEU G  1 122 ? 38.186  -17.948 -55.171 1.00 44.62  ? 122 LEU G CD1 1 
ATOM   10568 C CD2 . LEU G  1 122 ? 39.902  -19.329 -56.379 1.00 44.25  ? 122 LEU G CD2 1 
ATOM   10569 N N   . ARG G  1 123 ? 37.368  -18.920 -60.910 1.00 44.83  ? 123 ARG G N   1 
ATOM   10570 C CA  . ARG G  1 123 ? 36.454  -19.486 -61.899 1.00 46.88  ? 123 ARG G CA  1 
ATOM   10571 C C   . ARG G  1 123 ? 36.573  -20.985 -61.674 1.00 45.96  ? 123 ARG G C   1 
ATOM   10572 O O   . ARG G  1 123 ? 37.672  -21.537 -61.734 1.00 44.66  ? 123 ARG G O   1 
ATOM   10573 C CB  . ARG G  1 123 ? 36.893  -19.135 -63.326 1.00 46.04  ? 123 ARG G CB  1 
ATOM   10574 C CG  . ARG G  1 123 ? 36.215  -19.994 -64.392 1.00 49.36  ? 123 ARG G CG  1 
ATOM   10575 C CD  . ARG G  1 123 ? 36.730  -19.665 -65.784 1.00 52.95  ? 123 ARG G CD  1 
ATOM   10576 N NE  . ARG G  1 123 ? 36.296  -18.337 -66.216 1.00 57.87  ? 123 ARG G NE  1 
ATOM   10577 C CZ  . ARG G  1 123 ? 37.099  -17.421 -66.758 1.00 59.06  ? 123 ARG G CZ  1 
ATOM   10578 N NH1 . ARG G  1 123 ? 38.393  -17.694 -66.936 1.00 57.51  ? 123 ARG G NH1 1 
ATOM   10579 N NH2 . ARG G  1 123 ? 36.607  -16.233 -67.116 1.00 55.97  ? 123 ARG G NH2 1 
ATOM   10580 N N   . ASN G  1 124 ? 35.453  -21.635 -61.393 1.00 47.17  ? 124 ASN G N   1 
ATOM   10581 C CA  . ASN G  1 124 ? 35.459  -23.070 -61.134 1.00 51.17  ? 124 ASN G CA  1 
ATOM   10582 C C   . ASN G  1 124 ? 36.529  -23.452 -60.096 1.00 52.29  ? 124 ASN G C   1 
ATOM   10583 O O   . ASN G  1 124 ? 37.302  -24.402 -60.286 1.00 53.30  ? 124 ASN G O   1 
ATOM   10584 C CB  . ASN G  1 124 ? 35.689  -23.849 -62.434 1.00 48.29  ? 124 ASN G CB  1 
ATOM   10585 C CG  . ASN G  1 124 ? 34.627  -23.573 -63.473 1.00 47.62  ? 124 ASN G CG  1 
ATOM   10586 O OD1 . ASN G  1 124 ? 33.432  -23.554 -63.172 1.00 46.18  ? 124 ASN G OD1 1 
ATOM   10587 N ND2 . ASN G  1 124 ? 35.056  -23.366 -64.714 1.00 45.98  ? 124 ASN G ND2 1 
ATOM   10588 N N   . GLY G  1 125 ? 36.579  -22.688 -59.010 1.00 53.20  ? 125 GLY G N   1 
ATOM   10589 C CA  . GLY G  1 125 ? 37.523  -22.966 -57.947 1.00 54.75  ? 125 GLY G CA  1 
ATOM   10590 C C   . GLY G  1 125 ? 38.994  -22.728 -58.216 1.00 54.61  ? 125 GLY G C   1 
ATOM   10591 O O   . GLY G  1 125 ? 39.815  -22.973 -57.336 1.00 54.93  ? 125 GLY G O   1 
ATOM   10592 N N   . ARG G  1 126 ? 39.346  -22.257 -59.406 1.00 56.07  ? 126 ARG G N   1 
ATOM   10593 C CA  . ARG G  1 126 ? 40.754  -22.003 -59.715 1.00 58.63  ? 126 ARG G CA  1 
ATOM   10594 C C   . ARG G  1 126 ? 41.033  -20.511 -59.870 1.00 57.19  ? 126 ARG G C   1 
ATOM   10595 O O   . ARG G  1 126 ? 40.236  -19.770 -60.446 1.00 56.82  ? 126 ARG G O   1 
ATOM   10596 C CB  . ARG G  1 126 ? 41.169  -22.728 -61.001 1.00 62.04  ? 126 ARG G CB  1 
ATOM   10597 C CG  . ARG G  1 126 ? 41.209  -24.254 -60.908 1.00 64.54  ? 126 ARG G CG  1 
ATOM   10598 C CD  . ARG G  1 126 ? 41.506  -24.863 -62.285 1.00 67.51  ? 126 ARG G CD  1 
ATOM   10599 N NE  . ARG G  1 126 ? 41.532  -26.326 -62.270 1.00 70.13  ? 126 ARG G NE  1 
ATOM   10600 C CZ  . ARG G  1 126 ? 42.505  -27.059 -61.736 1.00 70.35  ? 126 ARG G CZ  1 
ATOM   10601 N NH1 . ARG G  1 126 ? 43.551  -26.471 -61.165 1.00 70.58  ? 126 ARG G NH1 1 
ATOM   10602 N NH2 . ARG G  1 126 ? 42.431  -28.384 -61.775 1.00 69.75  ? 126 ARG G NH2 1 
ATOM   10603 N N   . PRO G  1 127 ? 42.175  -20.050 -59.352 1.00 56.23  ? 127 PRO G N   1 
ATOM   10604 C CA  . PRO G  1 127 ? 42.529  -18.633 -59.451 1.00 55.35  ? 127 PRO G CA  1 
ATOM   10605 C C   . PRO G  1 127 ? 42.582  -18.182 -60.906 1.00 53.84  ? 127 PRO G C   1 
ATOM   10606 O O   . PRO G  1 127 ? 42.974  -18.947 -61.781 1.00 53.92  ? 127 PRO G O   1 
ATOM   10607 C CB  . PRO G  1 127 ? 43.902  -18.574 -58.785 1.00 54.26  ? 127 PRO G CB  1 
ATOM   10608 C CG  . PRO G  1 127 ? 43.832  -19.671 -57.784 1.00 55.56  ? 127 PRO G CG  1 
ATOM   10609 C CD  . PRO G  1 127 ? 43.182  -20.785 -58.571 1.00 55.66  ? 127 PRO G CD  1 
ATOM   10610 N N   . VAL G  1 128 ? 42.190  -16.939 -61.159 1.00 52.30  ? 128 VAL G N   1 
ATOM   10611 C CA  . VAL G  1 128 ? 42.214  -16.388 -62.507 1.00 51.01  ? 128 VAL G CA  1 
ATOM   10612 C C   . VAL G  1 128 ? 42.902  -15.023 -62.514 1.00 50.35  ? 128 VAL G C   1 
ATOM   10613 O O   . VAL G  1 128 ? 42.545  -14.135 -61.730 1.00 48.95  ? 128 VAL G O   1 
ATOM   10614 C CB  . VAL G  1 128 ? 40.794  -16.211 -63.062 1.00 50.25  ? 128 VAL G CB  1 
ATOM   10615 C CG1 . VAL G  1 128 ? 40.853  -15.525 -64.419 1.00 49.06  ? 128 VAL G CG1 1 
ATOM   10616 C CG2 . VAL G  1 128 ? 40.102  -17.561 -63.168 1.00 49.62  ? 128 VAL G CG2 1 
ATOM   10617 N N   . THR G  1 129 ? 43.895  -14.863 -63.383 1.00 47.72  ? 129 THR G N   1 
ATOM   10618 C CA  . THR G  1 129 ? 44.605  -13.593 -63.495 1.00 48.45  ? 129 THR G CA  1 
ATOM   10619 C C   . THR G  1 129 ? 44.524  -13.062 -64.919 1.00 46.34  ? 129 THR G C   1 
ATOM   10620 O O   . THR G  1 129 ? 45.272  -12.166 -65.297 1.00 45.04  ? 129 THR G O   1 
ATOM   10621 C CB  . THR G  1 129 ? 46.100  -13.728 -63.138 1.00 49.24  ? 129 THR G CB  1 
ATOM   10622 O OG1 . THR G  1 129 ? 46.725  -14.640 -64.048 1.00 49.87  ? 129 THR G OG1 1 
ATOM   10623 C CG2 . THR G  1 129 ? 46.273  -14.219 -61.708 1.00 49.89  ? 129 THR G CG2 1 
ATOM   10624 N N   . GLU G  1 130 ? 43.621  -13.622 -65.716 1.00 45.65  ? 130 GLU G N   1 
ATOM   10625 C CA  . GLU G  1 130 ? 43.476  -13.186 -67.099 1.00 43.51  ? 130 GLU G CA  1 
ATOM   10626 C C   . GLU G  1 130 ? 42.120  -12.527 -67.257 1.00 38.31  ? 130 GLU G C   1 
ATOM   10627 O O   . GLU G  1 130 ? 41.105  -13.094 -66.864 1.00 36.12  ? 130 GLU G O   1 
ATOM   10628 C CB  . GLU G  1 130 ? 43.599  -14.385 -68.036 1.00 46.28  ? 130 GLU G CB  1 
ATOM   10629 C CG  . GLU G  1 130 ? 44.626  -15.421 -67.563 1.00 54.51  ? 130 GLU G CG  1 
ATOM   10630 C CD  . GLU G  1 130 ? 46.034  -15.193 -68.103 1.00 57.01  ? 130 GLU G CD  1 
ATOM   10631 O OE1 . GLU G  1 130 ? 46.484  -14.022 -68.153 1.00 57.92  ? 130 GLU G OE1 1 
ATOM   10632 O OE2 . GLU G  1 130 ? 46.690  -16.201 -68.463 1.00 56.23  ? 130 GLU G OE2 1 
ATOM   10633 N N   . GLY G  1 131 ? 42.110  -11.323 -67.821 1.00 35.97  ? 131 GLY G N   1 
ATOM   10634 C CA  . GLY G  1 131 ? 40.861  -10.609 -68.005 1.00 34.78  ? 131 GLY G CA  1 
ATOM   10635 C C   . GLY G  1 131 ? 40.356  -9.984  -66.714 1.00 34.41  ? 131 GLY G C   1 
ATOM   10636 O O   . GLY G  1 131 ? 39.159  -9.737  -66.556 1.00 32.85  ? 131 GLY G O   1 
ATOM   10637 N N   . VAL G  1 132 ? 41.266  -9.752  -65.773 1.00 33.89  ? 132 VAL G N   1 
ATOM   10638 C CA  . VAL G  1 132 ? 40.896  -9.124  -64.514 1.00 35.43  ? 132 VAL G CA  1 
ATOM   10639 C C   . VAL G  1 132 ? 41.430  -7.698  -64.466 1.00 35.12  ? 132 VAL G C   1 
ATOM   10640 O O   . VAL G  1 132 ? 42.461  -7.384  -65.062 1.00 34.16  ? 132 VAL G O   1 
ATOM   10641 C CB  . VAL G  1 132 ? 41.447  -9.890  -63.296 1.00 34.51  ? 132 VAL G CB  1 
ATOM   10642 C CG1 . VAL G  1 132 ? 40.863  -11.280 -63.258 1.00 32.45  ? 132 VAL G CG1 1 
ATOM   10643 C CG2 . VAL G  1 132 ? 42.959  -9.933  -63.343 1.00 32.72  ? 132 VAL G CG2 1 
ATOM   10644 N N   . SER G  1 133 ? 40.703  -6.833  -63.771 1.00 35.47  ? 133 SER G N   1 
ATOM   10645 C CA  . SER G  1 133 ? 41.102  -5.438  -63.615 1.00 33.36  ? 133 SER G CA  1 
ATOM   10646 C C   . SER G  1 133 ? 40.529  -4.925  -62.311 1.00 32.50  ? 133 SER G C   1 
ATOM   10647 O O   . SER G  1 133 ? 39.702  -5.584  -61.690 1.00 30.25  ? 133 SER G O   1 
ATOM   10648 C CB  . SER G  1 133 ? 40.600  -4.587  -64.786 1.00 32.21  ? 133 SER G CB  1 
ATOM   10649 O OG  . SER G  1 133 ? 39.245  -4.861  -65.085 1.00 30.90  ? 133 SER G OG  1 
ATOM   10650 N N   . GLU G  1 134 ? 40.969  -3.750  -61.892 1.00 32.67  ? 134 GLU G N   1 
ATOM   10651 C CA  . GLU G  1 134 ? 40.497  -3.196  -60.641 1.00 33.46  ? 134 GLU G CA  1 
ATOM   10652 C C   . GLU G  1 134 ? 40.621  -1.678  -60.636 1.00 33.09  ? 134 GLU G C   1 
ATOM   10653 O O   . GLU G  1 134 ? 41.384  -1.087  -61.404 1.00 34.53  ? 134 GLU G O   1 
ATOM   10654 C CB  . GLU G  1 134 ? 41.319  -3.771  -59.484 1.00 32.25  ? 134 GLU G CB  1 
ATOM   10655 C CG  . GLU G  1 134 ? 42.765  -3.300  -59.475 1.00 32.69  ? 134 GLU G CG  1 
ATOM   10656 C CD  . GLU G  1 134 ? 43.615  -4.020  -58.438 1.00 38.30  ? 134 GLU G CD  1 
ATOM   10657 O OE1 . GLU G  1 134 ? 43.877  -5.228  -58.616 1.00 40.68  ? 134 GLU G OE1 1 
ATOM   10658 O OE2 . GLU G  1 134 ? 44.030  -3.387  -57.441 1.00 38.75  ? 134 GLU G OE2 1 
ATOM   10659 N N   . THR G  1 135 ? 39.854  -1.060  -59.758 1.00 30.63  ? 135 THR G N   1 
ATOM   10660 C CA  . THR G  1 135 ? 39.883  0.370   -59.588 1.00 30.83  ? 135 THR G CA  1 
ATOM   10661 C C   . THR G  1 135 ? 40.819  0.612   -58.409 1.00 31.17  ? 135 THR G C   1 
ATOM   10662 O O   . THR G  1 135 ? 41.311  -0.344  -57.798 1.00 29.92  ? 135 THR G O   1 
ATOM   10663 C CB  . THR G  1 135 ? 38.488  0.870   -59.243 1.00 33.27  ? 135 THR G CB  1 
ATOM   10664 O OG1 . THR G  1 135 ? 38.126  0.437   -57.923 1.00 35.70  ? 135 THR G OG1 1 
ATOM   10665 C CG2 . THR G  1 135 ? 37.486  0.288   -60.231 1.00 34.67  ? 135 THR G CG2 1 
ATOM   10666 N N   . VAL G  1 136 ? 41.100  1.874   -58.104 1.00 30.17  ? 136 VAL G N   1 
ATOM   10667 C CA  . VAL G  1 136 ? 41.944  2.175   -56.951 1.00 30.30  ? 136 VAL G CA  1 
ATOM   10668 C C   . VAL G  1 136 ? 40.958  2.327   -55.788 1.00 29.08  ? 136 VAL G C   1 
ATOM   10669 O O   . VAL G  1 136 ? 39.770  2.052   -55.953 1.00 27.28  ? 136 VAL G O   1 
ATOM   10670 C CB  . VAL G  1 136 ? 42.794  3.489   -57.145 1.00 33.44  ? 136 VAL G CB  1 
ATOM   10671 C CG1 . VAL G  1 136 ? 43.861  3.271   -58.228 1.00 30.65  ? 136 VAL G CG1 1 
ATOM   10672 C CG2 . VAL G  1 136 ? 41.896  4.664   -57.519 1.00 31.16  ? 136 VAL G CG2 1 
ATOM   10673 N N   . PHE G  1 137 ? 41.430  2.745   -54.621 1.00 29.10  ? 137 PHE G N   1 
ATOM   10674 C CA  . PHE G  1 137 ? 40.541  2.894   -53.472 1.00 28.40  ? 137 PHE G CA  1 
ATOM   10675 C C   . PHE G  1 137 ? 39.691  4.168   -53.593 1.00 30.75  ? 137 PHE G C   1 
ATOM   10676 O O   . PHE G  1 137 ? 40.187  5.296   -53.501 1.00 29.01  ? 137 PHE G O   1 
ATOM   10677 C CB  . PHE G  1 137 ? 41.378  2.865   -52.206 1.00 27.84  ? 137 PHE G CB  1 
ATOM   10678 C CG  . PHE G  1 137 ? 42.035  1.518   -51.958 1.00 27.87  ? 137 PHE G CG  1 
ATOM   10679 C CD1 . PHE G  1 137 ? 41.320  0.473   -51.380 1.00 28.28  ? 137 PHE G CD1 1 
ATOM   10680 C CD2 . PHE G  1 137 ? 43.345  1.286   -52.348 1.00 26.43  ? 137 PHE G CD2 1 
ATOM   10681 C CE1 . PHE G  1 137 ? 41.906  -0.786  -51.193 1.00 31.83  ? 137 PHE G CE1 1 
ATOM   10682 C CE2 . PHE G  1 137 ? 43.943  0.038   -52.171 1.00 28.74  ? 137 PHE G CE2 1 
ATOM   10683 C CZ  . PHE G  1 137 ? 43.223  -1.003  -51.592 1.00 29.64  ? 137 PHE G CZ  1 
ATOM   10684 N N   . LEU G  1 138 ? 38.397  3.967   -53.831 1.00 29.80  ? 138 LEU G N   1 
ATOM   10685 C CA  . LEU G  1 138 ? 37.479  5.072   -54.020 1.00 27.55  ? 138 LEU G CA  1 
ATOM   10686 C C   . LEU G  1 138 ? 36.912  5.596   -52.731 1.00 29.02  ? 138 LEU G C   1 
ATOM   10687 O O   . LEU G  1 138 ? 36.880  4.908   -51.712 1.00 29.87  ? 138 LEU G O   1 
ATOM   10688 C CB  . LEU G  1 138 ? 36.330  4.666   -54.935 1.00 24.77  ? 138 LEU G CB  1 
ATOM   10689 C CG  . LEU G  1 138 ? 36.693  3.974   -56.249 1.00 23.98  ? 138 LEU G CG  1 
ATOM   10690 C CD1 . LEU G  1 138 ? 35.423  3.544   -56.956 1.00 22.88  ? 138 LEU G CD1 1 
ATOM   10691 C CD2 . LEU G  1 138 ? 37.500  4.908   -57.104 1.00 24.94  ? 138 LEU G CD2 1 
ATOM   10692 N N   . PRO G  1 139 ? 36.466  6.853   -52.755 1.00 30.86  ? 139 PRO G N   1 
ATOM   10693 C CA  . PRO G  1 139 ? 35.891  7.466   -51.560 1.00 31.91  ? 139 PRO G CA  1 
ATOM   10694 C C   . PRO G  1 139 ? 34.384  7.233   -51.428 1.00 32.67  ? 139 PRO G C   1 
ATOM   10695 O O   . PRO G  1 139 ? 33.678  7.028   -52.414 1.00 34.00  ? 139 PRO G O   1 
ATOM   10696 C CB  . PRO G  1 139 ? 36.230  8.937   -51.748 1.00 31.64  ? 139 PRO G CB  1 
ATOM   10697 C CG  . PRO G  1 139 ? 36.047  9.103   -53.227 1.00 30.56  ? 139 PRO G CG  1 
ATOM   10698 C CD  . PRO G  1 139 ? 36.723  7.863   -53.799 1.00 27.93  ? 139 PRO G CD  1 
ATOM   10699 N N   . ARG G  1 140 ? 33.914  7.248   -50.188 1.00 34.06  ? 140 ARG G N   1 
ATOM   10700 C CA  . ARG G  1 140 ? 32.504  7.101   -49.864 1.00 32.85  ? 140 ARG G CA  1 
ATOM   10701 C C   . ARG G  1 140 ? 32.187  8.421   -49.184 1.00 36.04  ? 140 ARG G C   1 
ATOM   10702 O O   . ARG G  1 140 ? 33.048  9.304   -49.133 1.00 38.97  ? 140 ARG G O   1 
ATOM   10703 C CB  . ARG G  1 140 ? 32.294  5.948   -48.885 1.00 33.07  ? 140 ARG G CB  1 
ATOM   10704 C CG  . ARG G  1 140 ? 32.385  4.564   -49.496 1.00 28.11  ? 140 ARG G CG  1 
ATOM   10705 C CD  . ARG G  1 140 ? 32.528  3.520   -48.412 1.00 29.37  ? 140 ARG G CD  1 
ATOM   10706 N NE  . ARG G  1 140 ? 31.688  3.809   -47.257 1.00 30.64  ? 140 ARG G NE  1 
ATOM   10707 C CZ  . ARG G  1 140 ? 30.366  3.675   -47.228 1.00 33.27  ? 140 ARG G CZ  1 
ATOM   10708 N NH1 . ARG G  1 140 ? 29.715  3.242   -48.297 1.00 33.93  ? 140 ARG G NH1 1 
ATOM   10709 N NH2 . ARG G  1 140 ? 29.691  3.990   -46.130 1.00 32.89  ? 140 ARG G NH2 1 
ATOM   10710 N N   . ASP G  1 141 ? 30.978  8.576   -48.657 1.00 36.26  ? 141 ASP G N   1 
ATOM   10711 C CA  . ASP G  1 141 ? 30.640  9.829   -47.978 1.00 36.11  ? 141 ASP G CA  1 
ATOM   10712 C C   . ASP G  1 141 ? 31.380  9.956   -46.648 1.00 35.43  ? 141 ASP G C   1 
ATOM   10713 O O   . ASP G  1 141 ? 31.785  11.049  -46.277 1.00 37.52  ? 141 ASP G O   1 
ATOM   10714 C CB  . ASP G  1 141 ? 29.134  9.938   -47.700 1.00 34.61  ? 141 ASP G CB  1 
ATOM   10715 C CG  . ASP G  1 141 ? 28.316  10.109  -48.956 1.00 36.82  ? 141 ASP G CG  1 
ATOM   10716 O OD1 . ASP G  1 141 ? 28.883  10.499  -49.997 1.00 41.92  ? 141 ASP G OD1 1 
ATOM   10717 O OD2 . ASP G  1 141 ? 27.093  9.861   -48.907 1.00 41.62  ? 141 ASP G OD2 1 
ATOM   10718 N N   . ASP G  1 142 ? 31.549  8.842   -45.937 1.00 32.61  ? 142 ASP G N   1 
ATOM   10719 C CA  . ASP G  1 142 ? 32.213  8.839   -44.636 1.00 32.50  ? 142 ASP G CA  1 
ATOM   10720 C C   . ASP G  1 142 ? 33.731  8.719   -44.714 1.00 31.88  ? 142 ASP G C   1 
ATOM   10721 O O   . ASP G  1 142 ? 34.357  9.219   -45.644 1.00 33.74  ? 142 ASP G O   1 
ATOM   10722 C CB  . ASP G  1 142 ? 31.649  7.707   -43.758 1.00 30.00  ? 142 ASP G CB  1 
ATOM   10723 C CG  . ASP G  1 142 ? 31.618  6.361   -44.482 1.00 34.29  ? 142 ASP G CG  1 
ATOM   10724 O OD1 . ASP G  1 142 ? 32.465  6.127   -45.379 1.00 30.57  ? 142 ASP G OD1 1 
ATOM   10725 O OD2 . ASP G  1 142 ? 30.758  5.516   -44.149 1.00 36.71  ? 142 ASP G OD2 1 
ATOM   10726 N N   . HIS G  1 143 ? 34.317  8.042   -43.731 1.00 30.67  ? 143 HIS G N   1 
ATOM   10727 C CA  . HIS G  1 143 ? 35.769  7.854   -43.658 1.00 30.74  ? 143 HIS G CA  1 
ATOM   10728 C C   . HIS G  1 143 ? 36.274  6.526   -44.255 1.00 30.33  ? 143 HIS G C   1 
ATOM   10729 O O   . HIS G  1 143 ? 37.481  6.281   -44.287 1.00 30.29  ? 143 HIS G O   1 
ATOM   10730 C CB  . HIS G  1 143 ? 36.190  7.890   -42.197 1.00 30.37  ? 143 HIS G CB  1 
ATOM   10731 C CG  . HIS G  1 143 ? 35.450  6.891   -41.356 1.00 30.80  ? 143 HIS G CG  1 
ATOM   10732 N ND1 . HIS G  1 143 ? 34.130  7.055   -40.990 1.00 30.14  ? 143 HIS G ND1 1 
ATOM   10733 C CD2 . HIS G  1 143 ? 35.830  5.689   -40.861 1.00 30.53  ? 143 HIS G CD2 1 
ATOM   10734 C CE1 . HIS G  1 143 ? 33.730  5.996   -40.302 1.00 27.60  ? 143 HIS G CE1 1 
ATOM   10735 N NE2 . HIS G  1 143 ? 34.742  5.155   -40.211 1.00 29.01  ? 143 HIS G NE2 1 
ATOM   10736 N N   . LEU G  1 144 ? 35.366  5.681   -44.726 1.00 30.02  ? 144 LEU G N   1 
ATOM   10737 C CA  . LEU G  1 144 ? 35.748  4.383   -45.289 1.00 29.36  ? 144 LEU G CA  1 
ATOM   10738 C C   . LEU G  1 144 ? 35.948  4.408   -46.810 1.00 28.37  ? 144 LEU G C   1 
ATOM   10739 O O   . LEU G  1 144 ? 35.696  5.420   -47.445 1.00 27.88  ? 144 LEU G O   1 
ATOM   10740 C CB  . LEU G  1 144 ? 34.685  3.352   -44.899 1.00 27.65  ? 144 LEU G CB  1 
ATOM   10741 C CG  . LEU G  1 144 ? 34.489  3.321   -43.382 1.00 26.21  ? 144 LEU G CG  1 
ATOM   10742 C CD1 . LEU G  1 144 ? 33.224  2.595   -43.030 1.00 29.38  ? 144 LEU G CD1 1 
ATOM   10743 C CD2 . LEU G  1 144 ? 35.687  2.666   -42.727 1.00 28.32  ? 144 LEU G CD2 1 
ATOM   10744 N N   . PHE G  1 145 ? 36.381  3.287   -47.382 1.00 28.45  ? 145 PHE G N   1 
ATOM   10745 C CA  . PHE G  1 145 ? 36.630  3.185   -48.828 1.00 29.85  ? 145 PHE G CA  1 
ATOM   10746 C C   . PHE G  1 145 ? 35.782  2.136   -49.544 1.00 30.94  ? 145 PHE G C   1 
ATOM   10747 O O   . PHE G  1 145 ? 35.164  1.278   -48.915 1.00 33.14  ? 145 PHE G O   1 
ATOM   10748 C CB  . PHE G  1 145 ? 38.101  2.822   -49.099 1.00 26.36  ? 145 PHE G CB  1 
ATOM   10749 C CG  . PHE G  1 145 ? 39.085  3.803   -48.547 1.00 26.33  ? 145 PHE G CG  1 
ATOM   10750 C CD1 . PHE G  1 145 ? 39.397  3.806   -47.198 1.00 23.22  ? 145 PHE G CD1 1 
ATOM   10751 C CD2 . PHE G  1 145 ? 39.675  4.754   -49.380 1.00 24.75  ? 145 PHE G CD2 1 
ATOM   10752 C CE1 . PHE G  1 145 ? 40.283  4.747   -46.677 1.00 25.75  ? 145 PHE G CE1 1 
ATOM   10753 C CE2 . PHE G  1 145 ? 40.553  5.698   -48.876 1.00 25.53  ? 145 PHE G CE2 1 
ATOM   10754 C CZ  . PHE G  1 145 ? 40.860  5.698   -47.516 1.00 25.86  ? 145 PHE G CZ  1 
ATOM   10755 N N   . ARG G  1 146 ? 35.751  2.223   -50.869 1.00 31.23  ? 146 ARG G N   1 
ATOM   10756 C CA  . ARG G  1 146 ? 35.066  1.220   -51.663 1.00 33.20  ? 146 ARG G CA  1 
ATOM   10757 C C   . ARG G  1 146 ? 35.951  0.935   -52.838 1.00 33.40  ? 146 ARG G C   1 
ATOM   10758 O O   . ARG G  1 146 ? 36.837  1.726   -53.160 1.00 33.15  ? 146 ARG G O   1 
ATOM   10759 C CB  . ARG G  1 146 ? 33.654  1.629   -52.095 1.00 34.12  ? 146 ARG G CB  1 
ATOM   10760 C CG  . ARG G  1 146 ? 33.473  2.979   -52.725 1.00 37.79  ? 146 ARG G CG  1 
ATOM   10761 C CD  . ARG G  1 146 ? 31.983  3.181   -52.966 1.00 37.41  ? 146 ARG G CD  1 
ATOM   10762 N NE  . ARG G  1 146 ? 31.655  4.549   -53.342 1.00 43.95  ? 146 ARG G NE  1 
ATOM   10763 C CZ  . ARG G  1 146 ? 32.032  5.129   -54.478 1.00 50.12  ? 146 ARG G CZ  1 
ATOM   10764 N NH1 . ARG G  1 146 ? 32.759  4.459   -55.368 1.00 50.64  ? 146 ARG G NH1 1 
ATOM   10765 N NH2 . ARG G  1 146 ? 31.678  6.386   -54.729 1.00 53.28  ? 146 ARG G NH2 1 
ATOM   10766 N N   . LYS G  1 147 ? 35.737  -0.212  -53.464 1.00 33.85  ? 147 LYS G N   1 
ATOM   10767 C CA  . LYS G  1 147 ? 36.580  -0.599  -54.570 1.00 32.71  ? 147 LYS G CA  1 
ATOM   10768 C C   . LYS G  1 147 ? 35.924  -1.628  -55.469 1.00 34.62  ? 147 LYS G C   1 
ATOM   10769 O O   . LYS G  1 147 ? 35.122  -2.455  -55.010 1.00 33.18  ? 147 LYS G O   1 
ATOM   10770 C CB  . LYS G  1 147 ? 37.878  -1.165  -54.010 1.00 31.65  ? 147 LYS G CB  1 
ATOM   10771 C CG  . LYS G  1 147 ? 38.868  -1.598  -55.048 1.00 33.35  ? 147 LYS G CG  1 
ATOM   10772 C CD  . LYS G  1 147 ? 40.219  -1.901  -54.429 1.00 32.07  ? 147 LYS G CD  1 
ATOM   10773 C CE  . LYS G  1 147 ? 41.194  -2.344  -55.507 1.00 31.90  ? 147 LYS G CE  1 
ATOM   10774 N NZ  . LYS G  1 147 ? 42.546  -2.526  -54.958 1.00 34.81  ? 147 LYS G NZ  1 
ATOM   10775 N N   . PHE G  1 148 ? 36.267  -1.571  -56.757 1.00 34.01  ? 148 PHE G N   1 
ATOM   10776 C CA  . PHE G  1 148 ? 35.730  -2.525  -57.711 1.00 31.51  ? 148 PHE G CA  1 
ATOM   10777 C C   . PHE G  1 148 ? 36.814  -3.358  -58.353 1.00 30.83  ? 148 PHE G C   1 
ATOM   10778 O O   . PHE G  1 148 ? 37.898  -2.861  -58.675 1.00 28.72  ? 148 PHE G O   1 
ATOM   10779 C CB  . PHE G  1 148 ? 34.956  -1.839  -58.837 1.00 29.27  ? 148 PHE G CB  1 
ATOM   10780 C CG  . PHE G  1 148 ? 33.818  -1.001  -58.375 1.00 25.38  ? 148 PHE G CG  1 
ATOM   10781 C CD1 . PHE G  1 148 ? 34.044  0.250   -57.811 1.00 25.71  ? 148 PHE G CD1 1 
ATOM   10782 C CD2 . PHE G  1 148 ? 32.513  -1.427  -58.560 1.00 24.43  ? 148 PHE G CD2 1 
ATOM   10783 C CE1 . PHE G  1 148 ? 32.970  1.074   -57.442 1.00 25.25  ? 148 PHE G CE1 1 
ATOM   10784 C CE2 . PHE G  1 148 ? 31.428  -0.612  -58.200 1.00 26.75  ? 148 PHE G CE2 1 
ATOM   10785 C CZ  . PHE G  1 148 ? 31.655  0.639   -57.642 1.00 22.72  ? 148 PHE G CZ  1 
ATOM   10786 N N   . HIS G  1 149 ? 36.499  -4.639  -58.526 1.00 30.49  ? 149 HIS G N   1 
ATOM   10787 C CA  . HIS G  1 149 ? 37.382  -5.588  -59.190 1.00 29.77  ? 149 HIS G CA  1 
ATOM   10788 C C   . HIS G  1 149 ? 36.520  -6.164  -60.317 1.00 29.41  ? 149 HIS G C   1 
ATOM   10789 O O   . HIS G  1 149 ? 35.320  -6.390  -60.135 1.00 28.23  ? 149 HIS G O   1 
ATOM   10790 C CB  . HIS G  1 149 ? 37.848  -6.686  -58.228 1.00 27.27  ? 149 HIS G CB  1 
ATOM   10791 C CG  . HIS G  1 149 ? 39.202  -6.434  -57.641 1.00 28.20  ? 149 HIS G CG  1 
ATOM   10792 N ND1 . HIS G  1 149 ? 39.425  -5.511  -56.637 1.00 28.19  ? 149 HIS G ND1 1 
ATOM   10793 C CD2 . HIS G  1 149 ? 40.414  -6.956  -57.946 1.00 26.51  ? 149 HIS G CD2 1 
ATOM   10794 C CE1 . HIS G  1 149 ? 40.714  -5.476  -56.351 1.00 27.14  ? 149 HIS G CE1 1 
ATOM   10795 N NE2 . HIS G  1 149 ? 41.336  -6.344  -57.131 1.00 27.44  ? 149 HIS G NE2 1 
ATOM   10796 N N   . TYR G  1 150 ? 37.122  -6.386  -61.482 1.00 28.73  ? 150 TYR G N   1 
ATOM   10797 C CA  . TYR G  1 150 ? 36.365  -6.885  -62.625 1.00 29.45  ? 150 TYR G CA  1 
ATOM   10798 C C   . TYR G  1 150 ? 36.923  -8.151  -63.274 1.00 30.14  ? 150 TYR G C   1 
ATOM   10799 O O   . TYR G  1 150 ? 38.133  -8.379  -63.298 1.00 28.58  ? 150 TYR G O   1 
ATOM   10800 C CB  . TYR G  1 150 ? 36.282  -5.791  -63.681 1.00 27.74  ? 150 TYR G CB  1 
ATOM   10801 C CG  . TYR G  1 150 ? 35.687  -4.490  -63.195 1.00 26.97  ? 150 TYR G CG  1 
ATOM   10802 C CD1 . TYR G  1 150 ? 34.309  -4.330  -63.089 1.00 25.00  ? 150 TYR G CD1 1 
ATOM   10803 C CD2 . TYR G  1 150 ? 36.510  -3.401  -62.876 1.00 26.29  ? 150 TYR G CD2 1 
ATOM   10804 C CE1 . TYR G  1 150 ? 33.756  -3.116  -62.684 1.00 27.70  ? 150 TYR G CE1 1 
ATOM   10805 C CE2 . TYR G  1 150 ? 35.969  -2.178  -62.472 1.00 24.84  ? 150 TYR G CE2 1 
ATOM   10806 C CZ  . TYR G  1 150 ? 34.598  -2.041  -62.381 1.00 26.61  ? 150 TYR G CZ  1 
ATOM   10807 O OH  . TYR G  1 150 ? 34.063  -0.837  -62.023 1.00 21.92  ? 150 TYR G OH  1 
ATOM   10808 N N   . LEU G  1 151 ? 36.022  -8.957  -63.821 1.00 31.16  ? 151 LEU G N   1 
ATOM   10809 C CA  . LEU G  1 151 ? 36.398  -10.193 -64.497 1.00 32.07  ? 151 LEU G CA  1 
ATOM   10810 C C   . LEU G  1 151 ? 35.612  -10.391 -65.789 1.00 31.44  ? 151 LEU G C   1 
ATOM   10811 O O   . LEU G  1 151 ? 34.377  -10.440 -65.779 1.00 30.61  ? 151 LEU G O   1 
ATOM   10812 C CB  . LEU G  1 151 ? 36.155  -11.407 -63.586 1.00 32.07  ? 151 LEU G CB  1 
ATOM   10813 C CG  . LEU G  1 151 ? 36.404  -12.762 -64.267 1.00 30.52  ? 151 LEU G CG  1 
ATOM   10814 C CD1 . LEU G  1 151 ? 37.892  -12.887 -64.575 1.00 28.48  ? 151 LEU G CD1 1 
ATOM   10815 C CD2 . LEU G  1 151 ? 35.949  -13.903 -63.374 1.00 32.45  ? 151 LEU G CD2 1 
ATOM   10816 N N   . THR G  1 152 ? 36.325  -10.494 -66.903 1.00 32.65  ? 152 THR G N   1 
ATOM   10817 C CA  . THR G  1 152 ? 35.669  -10.729 -68.188 1.00 35.47  ? 152 THR G CA  1 
ATOM   10818 C C   . THR G  1 152 ? 35.346  -12.213 -68.198 1.00 35.34  ? 152 THR G C   1 
ATOM   10819 O O   . THR G  1 152 ? 36.210  -13.036 -67.883 1.00 33.87  ? 152 THR G O   1 
ATOM   10820 C CB  . THR G  1 152 ? 36.598  -10.453 -69.364 1.00 35.37  ? 152 THR G CB  1 
ATOM   10821 O OG1 . THR G  1 152 ? 37.792  -11.230 -69.201 1.00 37.64  ? 152 THR G OG1 1 
ATOM   10822 C CG2 . THR G  1 152 ? 36.943  -8.973  -69.443 1.00 33.85  ? 152 THR G CG2 1 
ATOM   10823 N N   . PHE G  1 153 ? 34.105  -12.557 -68.528 1.00 35.27  ? 153 PHE G N   1 
ATOM   10824 C CA  . PHE G  1 153 ? 33.720  -13.956 -68.563 1.00 35.48  ? 153 PHE G CA  1 
ATOM   10825 C C   . PHE G  1 153 ? 32.680  -14.261 -69.618 1.00 37.67  ? 153 PHE G C   1 
ATOM   10826 O O   . PHE G  1 153 ? 31.941  -13.382 -70.067 1.00 37.95  ? 153 PHE G O   1 
ATOM   10827 C CB  . PHE G  1 153 ? 33.199  -14.414 -67.199 1.00 31.80  ? 153 PHE G CB  1 
ATOM   10828 C CG  . PHE G  1 153 ? 31.765  -14.035 -66.922 1.00 30.50  ? 153 PHE G CG  1 
ATOM   10829 C CD1 . PHE G  1 153 ? 31.396  -12.696 -66.767 1.00 29.44  ? 153 PHE G CD1 1 
ATOM   10830 C CD2 . PHE G  1 153 ? 30.805  -15.022 -66.747 1.00 26.72  ? 153 PHE G CD2 1 
ATOM   10831 C CE1 . PHE G  1 153 ? 30.099  -12.347 -66.432 1.00 27.81  ? 153 PHE G CE1 1 
ATOM   10832 C CE2 . PHE G  1 153 ? 29.510  -14.698 -66.416 1.00 29.34  ? 153 PHE G CE2 1 
ATOM   10833 C CZ  . PHE G  1 153 ? 29.143  -13.350 -66.252 1.00 31.88  ? 153 PHE G CZ  1 
ATOM   10834 N N   . LEU G  1 154 ? 32.627  -15.529 -70.004 1.00 40.51  ? 154 LEU G N   1 
ATOM   10835 C CA  . LEU G  1 154 ? 31.675  -15.986 -70.995 1.00 44.53  ? 154 LEU G CA  1 
ATOM   10836 C C   . LEU G  1 154 ? 30.661  -16.867 -70.269 1.00 45.69  ? 154 LEU G C   1 
ATOM   10837 O O   . LEU G  1 154 ? 30.962  -17.993 -69.885 1.00 47.63  ? 154 LEU G O   1 
ATOM   10838 C CB  . LEU G  1 154 ? 32.406  -16.768 -72.090 1.00 44.09  ? 154 LEU G CB  1 
ATOM   10839 C CG  . LEU G  1 154 ? 31.664  -16.996 -73.407 1.00 44.12  ? 154 LEU G CG  1 
ATOM   10840 C CD1 . LEU G  1 154 ? 31.144  -15.674 -73.933 1.00 44.31  ? 154 LEU G CD1 1 
ATOM   10841 C CD2 . LEU G  1 154 ? 32.609  -17.640 -74.420 1.00 43.73  ? 154 LEU G CD2 1 
ATOM   10842 N N   . PRO G  1 155 ? 29.444  -16.349 -70.063 1.00 47.82  ? 155 PRO G N   1 
ATOM   10843 C CA  . PRO G  1 155 ? 28.363  -17.063 -69.378 1.00 50.21  ? 155 PRO G CA  1 
ATOM   10844 C C   . PRO G  1 155 ? 28.125  -18.492 -69.865 1.00 52.69  ? 155 PRO G C   1 
ATOM   10845 O O   . PRO G  1 155 ? 28.121  -18.767 -71.065 1.00 53.38  ? 155 PRO G O   1 
ATOM   10846 C CB  . PRO G  1 155 ? 27.158  -16.158 -69.613 1.00 48.77  ? 155 PRO G CB  1 
ATOM   10847 C CG  . PRO G  1 155 ? 27.773  -14.803 -69.611 1.00 48.50  ? 155 PRO G CG  1 
ATOM   10848 C CD  . PRO G  1 155 ? 28.997  -15.005 -70.469 1.00 48.48  ? 155 PRO G CD  1 
ATOM   10849 N N   . SER G  1 156 ? 27.906  -19.391 -68.913 1.00 54.18  ? 156 SER G N   1 
ATOM   10850 C CA  . SER G  1 156 ? 27.665  -20.796 -69.206 1.00 56.20  ? 156 SER G CA  1 
ATOM   10851 C C   . SER G  1 156 ? 27.104  -21.487 -67.978 1.00 56.26  ? 156 SER G C   1 
ATOM   10852 O O   . SER G  1 156 ? 27.526  -21.205 -66.859 1.00 56.14  ? 156 SER G O   1 
ATOM   10853 C CB  . SER G  1 156 ? 28.971  -21.478 -69.608 1.00 57.20  ? 156 SER G CB  1 
ATOM   10854 O OG  . SER G  1 156 ? 28.815  -22.882 -69.575 1.00 59.37  ? 156 SER G OG  1 
ATOM   10855 N N   . THR G  1 157 ? 26.160  -22.396 -68.180 1.00 57.73  ? 157 THR G N   1 
ATOM   10856 C CA  . THR G  1 157 ? 25.576  -23.115 -67.054 1.00 59.54  ? 157 THR G CA  1 
ATOM   10857 C C   . THR G  1 157 ? 26.598  -24.096 -66.492 1.00 59.82  ? 157 THR G C   1 
ATOM   10858 O O   . THR G  1 157 ? 26.392  -24.677 -65.433 1.00 60.31  ? 157 THR G O   1 
ATOM   10859 C CB  . THR G  1 157 ? 24.305  -23.901 -67.463 1.00 58.67  ? 157 THR G CB  1 
ATOM   10860 O OG1 . THR G  1 157 ? 24.645  -24.881 -68.452 1.00 60.29  ? 157 THR G OG1 1 
ATOM   10861 C CG2 . THR G  1 157 ? 23.247  -22.960 -68.018 1.00 56.76  ? 157 THR G CG2 1 
ATOM   10862 N N   . ASP G  1