data_1I44
# 
_entry.id   1I44 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I44         
RCSB  RCSB012879   
WWPDB D_1000012879 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1IRK '1IRK is the apo form of the insulin receptor tyrosine kinase domain' unspecified 
PDB 1IR3 
'1IR3 is the phosphorylated insulin receptor tyrosine kinase domain in complex with nucleotide analog and peptide substrate' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I44 
_pdbx_database_status.recvd_initial_deposition_date   2001-02-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Till, J.H.'     1 
'Ablooglu, A.J.' 2 
'Frankel, M.'    3 
'Kohanski, R.A.' 4 
'Hubbard, S.R.'  5 
# 
_citation.id                        primary 
_citation.title                     
;Crystallographic and solution studies of an activation loop mutant of the insulin receptor tyrosine kinase: insights into kinase mechanism.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            276 
_citation.page_first                10049 
_citation.page_last                 10055 
_citation.year                      2001 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11124964 
_citation.pdbx_database_id_DOI      10.1074/jbc.M010161200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Till, J.H.'     1 
primary 'Ablooglu, A.J.' 2 
primary 'Frankel, M.'    3 
primary 'Bishop, S.M.'   4 
primary 'Kohanski, R.A.' 5 
primary 'Hubbard, S.R.'  6 
# 
_cell.entry_id           1I44 
_cell.length_a           57.857 
_cell.length_b           69.578 
_cell.length_c           89.260 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I44 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INSULIN RECEPTOR'                             34748.797 1   2.7.1.112 'C981S, Y984PHE, D1161A' 
'TYROSINE KINASE DOMAIN' ? 
2 non-polymer syn 'MAGNESIUM ION'                                24.305    1   ?         ?                        ? ? 
3 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 505.208   1   ?         ?                        ? ? 
4 water       nat water                                          18.015    141 ?         ?                        ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IR 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDIYETAYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDIYETAYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PHE n 
1 3   PRO n 
1 4   SER n 
1 5   SER n 
1 6   VAL n 
1 7   PHE n 
1 8   VAL n 
1 9   PRO n 
1 10  ASP n 
1 11  GLU n 
1 12  TRP n 
1 13  GLU n 
1 14  VAL n 
1 15  SER n 
1 16  ARG n 
1 17  GLU n 
1 18  LYS n 
1 19  ILE n 
1 20  THR n 
1 21  LEU n 
1 22  LEU n 
1 23  ARG n 
1 24  GLU n 
1 25  LEU n 
1 26  GLY n 
1 27  GLN n 
1 28  GLY n 
1 29  SER n 
1 30  PHE n 
1 31  GLY n 
1 32  MET n 
1 33  VAL n 
1 34  TYR n 
1 35  GLU n 
1 36  GLY n 
1 37  ASN n 
1 38  ALA n 
1 39  ARG n 
1 40  ASP n 
1 41  ILE n 
1 42  ILE n 
1 43  LYS n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  THR n 
1 49  ARG n 
1 50  VAL n 
1 51  ALA n 
1 52  VAL n 
1 53  LYS n 
1 54  THR n 
1 55  VAL n 
1 56  ASN n 
1 57  GLU n 
1 58  SER n 
1 59  ALA n 
1 60  SER n 
1 61  LEU n 
1 62  ARG n 
1 63  GLU n 
1 64  ARG n 
1 65  ILE n 
1 66  GLU n 
1 67  PHE n 
1 68  LEU n 
1 69  ASN n 
1 70  GLU n 
1 71  ALA n 
1 72  SER n 
1 73  VAL n 
1 74  MET n 
1 75  LYS n 
1 76  GLY n 
1 77  PHE n 
1 78  THR n 
1 79  CYS n 
1 80  HIS n 
1 81  HIS n 
1 82  VAL n 
1 83  VAL n 
1 84  ARG n 
1 85  LEU n 
1 86  LEU n 
1 87  GLY n 
1 88  VAL n 
1 89  VAL n 
1 90  SER n 
1 91  LYS n 
1 92  GLY n 
1 93  GLN n 
1 94  PRO n 
1 95  THR n 
1 96  LEU n 
1 97  VAL n 
1 98  VAL n 
1 99  MET n 
1 100 GLU n 
1 101 LEU n 
1 102 MET n 
1 103 ALA n 
1 104 HIS n 
1 105 GLY n 
1 106 ASP n 
1 107 LEU n 
1 108 LYS n 
1 109 SER n 
1 110 TYR n 
1 111 LEU n 
1 112 ARG n 
1 113 SER n 
1 114 LEU n 
1 115 ARG n 
1 116 PRO n 
1 117 GLU n 
1 118 ALA n 
1 119 GLU n 
1 120 ASN n 
1 121 ASN n 
1 122 PRO n 
1 123 GLY n 
1 124 ARG n 
1 125 PRO n 
1 126 PRO n 
1 127 PRO n 
1 128 THR n 
1 129 LEU n 
1 130 GLN n 
1 131 GLU n 
1 132 MET n 
1 133 ILE n 
1 134 GLN n 
1 135 MET n 
1 136 ALA n 
1 137 ALA n 
1 138 GLU n 
1 139 ILE n 
1 140 ALA n 
1 141 ASP n 
1 142 GLY n 
1 143 MET n 
1 144 ALA n 
1 145 TYR n 
1 146 LEU n 
1 147 ASN n 
1 148 ALA n 
1 149 LYS n 
1 150 LYS n 
1 151 PHE n 
1 152 VAL n 
1 153 HIS n 
1 154 ARG n 
1 155 ASP n 
1 156 LEU n 
1 157 ALA n 
1 158 ALA n 
1 159 ARG n 
1 160 ASN n 
1 161 CYS n 
1 162 MET n 
1 163 VAL n 
1 164 ALA n 
1 165 HIS n 
1 166 ASP n 
1 167 PHE n 
1 168 THR n 
1 169 VAL n 
1 170 LYS n 
1 171 ILE n 
1 172 GLY n 
1 173 ASP n 
1 174 PHE n 
1 175 GLY n 
1 176 MET n 
1 177 THR n 
1 178 ARG n 
1 179 ASP n 
1 180 ILE n 
1 181 TYR n 
1 182 GLU n 
1 183 THR n 
1 184 ALA n 
1 185 TYR n 
1 186 TYR n 
1 187 ARG n 
1 188 LYS n 
1 189 GLY n 
1 190 GLY n 
1 191 LYS n 
1 192 GLY n 
1 193 LEU n 
1 194 LEU n 
1 195 PRO n 
1 196 VAL n 
1 197 ARG n 
1 198 TRP n 
1 199 MET n 
1 200 ALA n 
1 201 PRO n 
1 202 GLU n 
1 203 SER n 
1 204 LEU n 
1 205 LYS n 
1 206 ASP n 
1 207 GLY n 
1 208 VAL n 
1 209 PHE n 
1 210 THR n 
1 211 THR n 
1 212 SER n 
1 213 SER n 
1 214 ASP n 
1 215 MET n 
1 216 TRP n 
1 217 SER n 
1 218 PHE n 
1 219 GLY n 
1 220 VAL n 
1 221 VAL n 
1 222 LEU n 
1 223 TRP n 
1 224 GLU n 
1 225 ILE n 
1 226 THR n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 GLU n 
1 231 GLN n 
1 232 PRO n 
1 233 TYR n 
1 234 GLN n 
1 235 GLY n 
1 236 LEU n 
1 237 SER n 
1 238 ASN n 
1 239 GLU n 
1 240 GLN n 
1 241 VAL n 
1 242 LEU n 
1 243 LYS n 
1 244 PHE n 
1 245 VAL n 
1 246 MET n 
1 247 ASP n 
1 248 GLY n 
1 249 GLY n 
1 250 TYR n 
1 251 LEU n 
1 252 ASP n 
1 253 GLN n 
1 254 PRO n 
1 255 ASP n 
1 256 ASN n 
1 257 CYS n 
1 258 PRO n 
1 259 GLU n 
1 260 ARG n 
1 261 VAL n 
1 262 THR n 
1 263 ASP n 
1 264 LEU n 
1 265 MET n 
1 266 ARG n 
1 267 MET n 
1 268 CYS n 
1 269 TRP n 
1 270 GLN n 
1 271 PHE n 
1 272 ASN n 
1 273 PRO n 
1 274 LYS n 
1 275 MET n 
1 276 ARG n 
1 277 PRO n 
1 278 THR n 
1 279 PHE n 
1 280 LEU n 
1 281 GLU n 
1 282 ILE n 
1 283 VAL n 
1 284 ASN n 
1 285 LEU n 
1 286 LEU n 
1 287 LYS n 
1 288 ASP n 
1 289 ASP n 
1 290 LEU n 
1 291 HIS n 
1 292 PRO n 
1 293 SER n 
1 294 PHE n 
1 295 PRO n 
1 296 GLU n 
1 297 VAL n 
1 298 SER n 
1 299 PHE n 
1 300 PHE n 
1 301 HIS n 
1 302 SER n 
1 303 GLU n 
1 304 GLU n 
1 305 ASN n 
1 306 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INSR_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCH
HVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARN
CMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQ
VLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
;
_struct_ref.pdbx_align_begin           1005 
_struct_ref.pdbx_db_accession          P06213 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1I44 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 306 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06213 
_struct_ref_seq.db_align_beg                  1005 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1310 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       978 
_struct_ref_seq.pdbx_auth_seq_align_end       1283 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1I44 SER A 4   ? UNP P06213 CYS 1008 ENGINEERED 981  1 
1 1I44 PHE A 7   ? UNP P06213 TYR 1011 ENGINEERED 984  2 
1 1I44 ALA A 184 ? UNP P06213 ASP 1188 ENGINEERED 1161 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 
;ADENOSINE-5'-[BETA, GAMMA-METHYLENE]TRIPHOSPHATE
;
'C11 H18 N5 O12 P3' 505.208 
ALA 'L-peptide linking' y ALANINE                                        ?                                                  
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                                                  
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                                                  
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                                                  
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                                                  
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                                                  
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                                                  
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                                                  
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                                                  
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?                                                  'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                                                  
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                                                  
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                                                  
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                                                  
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ?                                                  'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                                                  
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                                                  
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?                                                  
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ?                                                  
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                                                  
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                                                  
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                                                  
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1I44 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.40 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, Tris-HCl, NaCl, dithiothreitol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   2000-06-29 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1I44 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   14350 
_reflns.number_all                   14350 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0640000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.6 
_reflns.B_iso_Wilson_estimate        17.5 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   93.9 
_reflns_shell.Rmerge_I_obs           0.2230000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I44 
_refine.ls_number_reflns_obs                     13915 
_refine.ls_number_reflns_all                     13915 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               362135.97 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          0.2100000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2100000 
_refine.ls_R_factor_R_free                       0.2680000 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  702 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.9 
_refine.aniso_B[1][1]                            -1.42 
_refine.aniso_B[2][2]                            0.63 
_refine.aniso_B[3][3]                            0.79 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.321 
_refine.solvent_model_param_bsol                 22.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1irk 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER, 1991' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I44 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.39 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2205 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               2378 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.72  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.46  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.37  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.45  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.57  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             1894 
_refine_ls_shell.R_factor_R_work                  0.2380000 
_refine_ls_shell.percent_reflns_obs               83.7 
_refine_ls_shell.R_factor_R_free                  0.3360000 
_refine_ls_shell.R_factor_R_free_error            0.034 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             96 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PAram     ? 'X-RAY DIFFRACTION' 
2 DNA-RNA.PARAM         ? 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAm       ? 'X-RAY DIFFRACTION' 
4 ION.PARAM             ? 'X-RAY DIFFRACTION' 
5 TOPPAR:PARAMCSDX.MISC ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1I44 
_struct.title                     'CRYSTALLOGRAPHIC STUDIES OF AN ACTIVATION LOOP MUTANT OF THE INSULIN RECEPTOR TYROSINE KINASE' 
_struct.pdbx_descriptor           'INSULIN RECEPTOR (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I44 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'protein tyrosine kinase, phosphotransferase, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 15  ? GLU A 17  ? SER A 992  GLU A 994  5 ? 3  
HELX_P HELX_P2  2  SER A 60  ? LYS A 75  ? SER A 1037 LYS A 1052 1 ? 16 
HELX_P HELX_P3  3  ASP A 106 ? LEU A 114 ? ASP A 1083 LEU A 1091 1 ? 9  
HELX_P HELX_P4  4  THR A 128 ? LYS A 149 ? THR A 1105 LYS A 1126 1 ? 22 
HELX_P HELX_P5  5  ALA A 157 ? ARG A 159 ? ALA A 1134 ARG A 1136 5 ? 3  
HELX_P HELX_P6  6  PRO A 195 ? MET A 199 ? PRO A 1172 MET A 1176 5 ? 5  
HELX_P HELX_P7  7  ALA A 200 ? GLY A 207 ? ALA A 1177 GLY A 1184 1 ? 8  
HELX_P HELX_P8  8  THR A 210 ? SER A 227 ? THR A 1187 SER A 1204 1 ? 18 
HELX_P HELX_P9  9  SER A 237 ? ASP A 247 ? SER A 1214 ASP A 1224 1 ? 11 
HELX_P HELX_P10 10 PRO A 258 ? TRP A 269 ? PRO A 1235 TRP A 1246 1 ? 12 
HELX_P HELX_P11 11 ASN A 272 ? ARG A 276 ? ASN A 1249 ARG A 1253 5 ? 5  
HELX_P HELX_P12 12 THR A 278 ? LYS A 287 ? THR A 1255 LYS A 1264 1 ? 10 
HELX_P HELX_P13 13 ASP A 288 ? LEU A 290 ? ASP A 1265 LEU A 1267 5 ? 3  
HELX_P HELX_P14 14 SER A 293 ? SER A 298 ? SER A 1270 SER A 1275 1 ? 6  
HELX_P HELX_P15 15 SER A 302 ? LYS A 306 ? SER A 1279 LYS A 1283 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 173 OD2 ? ? A MG 301 A ASP 1150 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 301 A HOH 121  1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C ACP .   O2B ? ? A MG 301 A ACP 300  1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 173 OD1 ? ? A MG 301 A ASP 1150 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 301 A HOH 116  1_555 ? ? ? ? ? ? ? 2.525 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 301 A HOH 114  1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc7 metalc ? ? B MG . MG ? ? ? 1_555 C ACP .   O1G ? ? A MG 301 A ACP 300  1_555 ? ? ? ? ? ? ? 2.501 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           93 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            1070 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    94 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     1071 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 19  ? GLN A 27  ? ILE A 996  GLN A 1004 
A 2 MET A 32  ? ARG A 39  ? MET A 1009 ARG A 1016 
A 3 GLU A 47  ? THR A 54  ? GLU A 1024 THR A 1031 
A 4 LEU A 96  ? GLU A 100 ? LEU A 1073 GLU A 1077 
A 5 LEU A 85  ? VAL A 89  ? LEU A 1062 VAL A 1066 
B 1 CYS A 161 ? VAL A 163 ? CYS A 1138 VAL A 1140 
B 2 VAL A 169 ? ILE A 171 ? VAL A 1146 ILE A 1148 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 26  ? O GLY A 1003 N VAL A 33  ? N VAL A 1010 
A 2 3 N ALA A 38  ? N ALA A 1015 O THR A 48  ? O THR A 1025 
A 3 4 N LYS A 53  ? N LYS A 1030 O VAL A 97  ? O VAL A 1074 
A 4 5 O VAL A 98  ? O VAL A 1075 N LEU A 86  ? N LEU A 1063 
B 1 2 N MET A 162 ? N MET A 1139 O LYS A 170 ? O LYS A 1147 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 301'  
AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ACP A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HOH D .   ? HOH A 114  . ? 1_555 ? 
2  AC1 5  HOH D .   ? HOH A 116  . ? 1_555 ? 
3  AC1 5  HOH D .   ? HOH A 121  . ? 1_555 ? 
4  AC1 5  ACP C .   ? ACP A 300  . ? 1_555 ? 
5  AC1 5  ASP A 173 ? ASP A 1150 . ? 1_555 ? 
6  AC2 23 HOH D .   ? HOH A 48   . ? 1_555 ? 
7  AC2 23 HOH D .   ? HOH A 65   . ? 1_555 ? 
8  AC2 23 HOH D .   ? HOH A 96   . ? 1_555 ? 
9  AC2 23 HOH D .   ? HOH A 100  . ? 1_555 ? 
10 AC2 23 HOH D .   ? HOH A 111  . ? 1_555 ? 
11 AC2 23 HOH D .   ? HOH A 112  . ? 1_555 ? 
12 AC2 23 HOH D .   ? HOH A 121  . ? 1_555 ? 
13 AC2 23 HOH D .   ? HOH A 124  . ? 1_555 ? 
14 AC2 23 HOH D .   ? HOH A 131  . ? 1_555 ? 
15 AC2 23 HOH D .   ? HOH A 139  . ? 1_555 ? 
16 AC2 23 HOH D .   ? HOH A 141  . ? 1_555 ? 
17 AC2 23 MG  B .   ? MG  A 301  . ? 1_555 ? 
18 AC2 23 LEU A 25  ? LEU A 1002 . ? 1_555 ? 
19 AC2 23 GLN A 27  ? GLN A 1004 . ? 1_555 ? 
20 AC2 23 GLY A 28  ? GLY A 1005 . ? 1_555 ? 
21 AC2 23 SER A 29  ? SER A 1006 . ? 1_555 ? 
22 AC2 23 VAL A 33  ? VAL A 1010 . ? 1_555 ? 
23 AC2 23 ALA A 51  ? ALA A 1028 . ? 1_555 ? 
24 AC2 23 LYS A 53  ? LYS A 1030 . ? 1_555 ? 
25 AC2 23 GLU A 100 ? GLU A 1077 . ? 1_555 ? 
26 AC2 23 MET A 102 ? MET A 1079 . ? 1_555 ? 
27 AC2 23 MET A 162 ? MET A 1139 . ? 1_555 ? 
28 AC2 23 ASP A 173 ? ASP A 1150 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I44 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I44 
_atom_sites.fract_transf_matrix[1][1]   0.017284 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014372 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011203 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 9   ? 11.497  25.829  -4.113 1.00 59.63 ? 986  PRO A N     1 
ATOM   2    C  CA    . PRO A 1 9   ? 11.071  26.768  -3.051 1.00 58.62 ? 986  PRO A CA    1 
ATOM   3    C  C     . PRO A 1 9   ? 9.713   27.393  -3.335 1.00 57.39 ? 986  PRO A C     1 
ATOM   4    O  O     . PRO A 1 9   ? 8.811   27.319  -2.501 1.00 58.23 ? 986  PRO A O     1 
ATOM   5    C  CB    . PRO A 1 9   ? 12.146  27.837  -2.954 1.00 59.88 ? 986  PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 9   ? 13.375  27.045  -3.382 1.00 60.94 ? 986  PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 9   ? 12.874  26.147  -4.531 1.00 59.85 ? 986  PRO A CD    1 
ATOM   8    N  N     . ASP A 1 10  ? 9.567   28.013  -4.504 1.00 52.97 ? 987  ASP A N     1 
ATOM   9    C  CA    . ASP A 1 10  ? 8.297   28.630  -4.865 1.00 49.10 ? 987  ASP A CA    1 
ATOM   10   C  C     . ASP A 1 10  ? 7.214   27.574  -4.692 1.00 46.48 ? 987  ASP A C     1 
ATOM   11   O  O     . ASP A 1 10  ? 6.084   27.880  -4.312 1.00 46.85 ? 987  ASP A O     1 
ATOM   12   C  CB    . ASP A 1 10  ? 8.325   29.119  -6.320 1.00 50.78 ? 987  ASP A CB    1 
ATOM   13   C  CG    . ASP A 1 10  ? 7.048   29.848  -6.724 1.00 48.97 ? 987  ASP A CG    1 
ATOM   14   O  OD1   . ASP A 1 10  ? 6.932   30.229  -7.908 1.00 49.61 ? 987  ASP A OD1   1 
ATOM   15   O  OD2   . ASP A 1 10  ? 6.168   30.040  -5.859 1.00 49.74 ? 987  ASP A OD2   1 
ATOM   16   N  N     . GLU A 1 11  ? 7.572   26.325  -4.971 1.00 42.82 ? 988  GLU A N     1 
ATOM   17   C  CA    . GLU A 1 11  ? 6.636   25.216  -4.840 1.00 38.66 ? 988  GLU A CA    1 
ATOM   18   C  C     . GLU A 1 11  ? 6.219   25.074  -3.378 1.00 35.64 ? 988  GLU A C     1 
ATOM   19   O  O     . GLU A 1 11  ? 5.139   24.571  -3.077 1.00 35.31 ? 988  GLU A O     1 
ATOM   20   C  CB    . GLU A 1 11  ? 7.290   23.915  -5.320 1.00 39.03 ? 988  GLU A CB    1 
ATOM   21   N  N     . TRP A 1 12  ? 7.088   25.523  -2.476 1.00 30.75 ? 989  TRP A N     1 
ATOM   22   C  CA    . TRP A 1 12  ? 6.826   25.449  -1.047 1.00 27.75 ? 989  TRP A CA    1 
ATOM   23   C  C     . TRP A 1 12  ? 6.071   26.656  -0.518 1.00 27.47 ? 989  TRP A C     1 
ATOM   24   O  O     . TRP A 1 12  ? 5.392   26.570  0.501  1.00 29.38 ? 989  TRP A O     1 
ATOM   25   C  CB    . TRP A 1 12  ? 8.138   25.308  -0.271 1.00 25.98 ? 989  TRP A CB    1 
ATOM   26   C  CG    . TRP A 1 12  ? 8.826   24.021  -0.519 1.00 23.74 ? 989  TRP A CG    1 
ATOM   27   C  CD1   . TRP A 1 12  ? 9.805   23.772  -1.437 1.00 22.62 ? 989  TRP A CD1   1 
ATOM   28   C  CD2   . TRP A 1 12  ? 8.546   22.775  0.119  1.00 22.48 ? 989  TRP A CD2   1 
ATOM   29   N  NE1   . TRP A 1 12  ? 10.153  22.445  -1.410 1.00 23.30 ? 989  TRP A NE1   1 
ATOM   30   C  CE2   . TRP A 1 12  ? 9.395   21.807  -0.462 1.00 21.89 ? 989  TRP A CE2   1 
ATOM   31   C  CE3   . TRP A 1 12  ? 7.658   22.380  1.127  1.00 20.39 ? 989  TRP A CE3   1 
ATOM   32   C  CZ2   . TRP A 1 12  ? 9.385   20.468  -0.071 1.00 20.34 ? 989  TRP A CZ2   1 
ATOM   33   C  CZ3   . TRP A 1 12  ? 7.645   21.047  1.518  1.00 22.12 ? 989  TRP A CZ3   1 
ATOM   34   C  CH2   . TRP A 1 12  ? 8.506   20.106  0.919  1.00 19.75 ? 989  TRP A CH2   1 
ATOM   35   N  N     . GLU A 1 13  ? 6.193   27.781  -1.209 1.00 26.77 ? 990  GLU A N     1 
ATOM   36   C  CA    . GLU A 1 13  ? 5.526   29.007  -0.795 1.00 25.52 ? 990  GLU A CA    1 
ATOM   37   C  C     . GLU A 1 13  ? 4.026   28.788  -0.596 1.00 26.34 ? 990  GLU A C     1 
ATOM   38   O  O     . GLU A 1 13  ? 3.343   28.213  -1.448 1.00 26.77 ? 990  GLU A O     1 
ATOM   39   C  CB    . GLU A 1 13  ? 5.758   30.098  -1.839 1.00 24.05 ? 990  GLU A CB    1 
ATOM   40   C  CG    . GLU A 1 13  ? 5.356   31.494  -1.402 1.00 24.64 ? 990  GLU A CG    1 
ATOM   41   C  CD    . GLU A 1 13  ? 6.174   32.001  -0.229 1.00 24.74 ? 990  GLU A CD    1 
ATOM   42   O  OE1   . GLU A 1 13  ? 7.393   31.734  -0.191 1.00 23.39 ? 990  GLU A OE1   1 
ATOM   43   O  OE2   . GLU A 1 13  ? 5.598   32.679  0.651  1.00 25.65 ? 990  GLU A OE2   1 
ATOM   44   N  N     . VAL A 1 14  ? 3.524   29.245  0.542  1.00 25.74 ? 991  VAL A N     1 
ATOM   45   C  CA    . VAL A 1 14  ? 2.110   29.120  0.863  1.00 26.50 ? 991  VAL A CA    1 
ATOM   46   C  C     . VAL A 1 14  ? 1.572   30.518  1.160  1.00 27.66 ? 991  VAL A C     1 
ATOM   47   O  O     . VAL A 1 14  ? 2.235   31.318  1.821  1.00 27.24 ? 991  VAL A O     1 
ATOM   48   C  CB    . VAL A 1 14  ? 1.898   28.214  2.097  1.00 26.25 ? 991  VAL A CB    1 
ATOM   49   C  CG1   . VAL A 1 14  ? 0.416   28.045  2.369  1.00 27.92 ? 991  VAL A CG1   1 
ATOM   50   C  CG2   . VAL A 1 14  ? 2.547   26.859  1.865  1.00 25.29 ? 991  VAL A CG2   1 
ATOM   51   N  N     . SER A 1 15  ? 0.375   30.823  0.673  1.00 28.20 ? 992  SER A N     1 
ATOM   52   C  CA    . SER A 1 15  ? -0.193  32.140  0.921  1.00 29.06 ? 992  SER A CA    1 
ATOM   53   C  C     . SER A 1 15  ? -0.590  32.258  2.385  1.00 28.54 ? 992  SER A C     1 
ATOM   54   O  O     . SER A 1 15  ? -1.135  31.328  2.978  1.00 27.90 ? 992  SER A O     1 
ATOM   55   C  CB    . SER A 1 15  ? -1.411  32.387  0.028  1.00 29.10 ? 992  SER A CB    1 
ATOM   56   O  OG    . SER A 1 15  ? -2.452  31.486  0.334  1.00 32.28 ? 992  SER A OG    1 
ATOM   57   N  N     . ARG A 1 16  ? -0.304  33.419  2.952  1.00 28.95 ? 993  ARG A N     1 
ATOM   58   C  CA    . ARG A 1 16  ? -0.594  33.720  4.343  1.00 29.31 ? 993  ARG A CA    1 
ATOM   59   C  C     . ARG A 1 16  ? -2.059  33.504  4.689  1.00 29.93 ? 993  ARG A C     1 
ATOM   60   O  O     . ARG A 1 16  ? -2.381  33.020  5.776  1.00 29.27 ? 993  ARG A O     1 
ATOM   61   C  CB    . ARG A 1 16  ? -0.209  35.172  4.617  1.00 29.76 ? 993  ARG A CB    1 
ATOM   62   C  CG    . ARG A 1 16  ? -0.291  35.620  6.055  1.00 30.03 ? 993  ARG A CG    1 
ATOM   63   C  CD    . ARG A 1 16  ? 0.024   37.099  6.111  1.00 31.57 ? 993  ARG A CD    1 
ATOM   64   N  NE    . ARG A 1 16  ? 1.279   37.385  5.426  1.00 29.18 ? 993  ARG A NE    1 
ATOM   65   C  CZ    . ARG A 1 16  ? 2.476   37.159  5.953  1.00 29.55 ? 993  ARG A CZ    1 
ATOM   66   N  NH1   . ARG A 1 16  ? 2.572   36.655  7.173  1.00 25.86 ? 993  ARG A NH1   1 
ATOM   67   N  NH2   . ARG A 1 16  ? 3.575   37.421  5.254  1.00 30.87 ? 993  ARG A NH2   1 
ATOM   68   N  N     . GLU A 1 17  ? -2.936  33.867  3.756  1.00 31.39 ? 994  GLU A N     1 
ATOM   69   C  CA    . GLU A 1 17  ? -4.384  33.753  3.938  1.00 33.63 ? 994  GLU A CA    1 
ATOM   70   C  C     . GLU A 1 17  ? -4.865  32.350  4.313  1.00 31.50 ? 994  GLU A C     1 
ATOM   71   O  O     . GLU A 1 17  ? -5.887  32.198  4.979  1.00 28.97 ? 994  GLU A O     1 
ATOM   72   C  CB    . GLU A 1 17  ? -5.117  34.202  2.660  1.00 37.75 ? 994  GLU A CB    1 
ATOM   73   C  CG    . GLU A 1 17  ? -4.890  33.281  1.445  1.00 44.91 ? 994  GLU A CG    1 
ATOM   74   C  CD    . GLU A 1 17  ? -5.967  33.416  0.367  1.00 48.77 ? 994  GLU A CD    1 
ATOM   75   O  OE1   . GLU A 1 17  ? -6.121  34.528  -0.188 1.00 51.65 ? 994  GLU A OE1   1 
ATOM   76   O  OE2   . GLU A 1 17  ? -6.657  32.408  0.074  1.00 49.03 ? 994  GLU A OE2   1 
ATOM   77   N  N     . LYS A 1 18  ? -4.128  31.332  3.880  1.00 31.39 ? 995  LYS A N     1 
ATOM   78   C  CA    . LYS A 1 18  ? -4.496  29.943  4.145  1.00 29.84 ? 995  LYS A CA    1 
ATOM   79   C  C     . LYS A 1 18  ? -4.211  29.466  5.565  1.00 27.55 ? 995  LYS A C     1 
ATOM   80   O  O     . LYS A 1 18  ? -4.742  28.443  5.991  1.00 26.51 ? 995  LYS A O     1 
ATOM   81   C  CB    . LYS A 1 18  ? -3.773  29.013  3.166  1.00 32.45 ? 995  LYS A CB    1 
ATOM   82   C  CG    . LYS A 1 18  ? -4.164  29.167  1.709  1.00 35.90 ? 995  LYS A CG    1 
ATOM   83   C  CD    . LYS A 1 18  ? -3.481  28.091  0.869  1.00 41.43 ? 995  LYS A CD    1 
ATOM   84   C  CE    . LYS A 1 18  ? -4.014  28.057  -0.563 1.00 46.53 ? 995  LYS A CE    1 
ATOM   85   N  NZ    . LYS A 1 18  ? -5.493  27.821  -0.648 1.00 47.27 ? 995  LYS A NZ    1 
ATOM   86   N  N     . ILE A 1 19  ? -3.382  30.203  6.295  1.00 25.54 ? 996  ILE A N     1 
ATOM   87   C  CA    . ILE A 1 19  ? -3.010  29.812  7.648  1.00 25.22 ? 996  ILE A CA    1 
ATOM   88   C  C     . ILE A 1 19  ? -3.826  30.456  8.764  1.00 25.76 ? 996  ILE A C     1 
ATOM   89   O  O     . ILE A 1 19  ? -3.983  31.673  8.814  1.00 26.46 ? 996  ILE A O     1 
ATOM   90   C  CB    . ILE A 1 19  ? -1.524  30.119  7.907  1.00 25.99 ? 996  ILE A CB    1 
ATOM   91   C  CG1   . ILE A 1 19  ? -0.675  29.599  6.744  1.00 26.58 ? 996  ILE A CG1   1 
ATOM   92   C  CG2   . ILE A 1 19  ? -1.080  29.486  9.213  1.00 24.17 ? 996  ILE A CG2   1 
ATOM   93   C  CD1   . ILE A 1 19  ? -0.809  28.112  6.495  1.00 28.00 ? 996  ILE A CD1   1 
ATOM   94   N  N     . THR A 1 20  ? -4.336  29.622  9.663  1.00 25.75 ? 997  THR A N     1 
ATOM   95   C  CA    . THR A 1 20  ? -5.124  30.090  10.798 1.00 25.33 ? 997  THR A CA    1 
ATOM   96   C  C     . THR A 1 20  ? -4.437  29.622  12.072 1.00 24.91 ? 997  THR A C     1 
ATOM   97   O  O     . THR A 1 20  ? -4.257  28.421  12.265 1.00 27.12 ? 997  THR A O     1 
ATOM   98   C  CB    . THR A 1 20  ? -6.550  29.503  10.772 1.00 26.55 ? 997  THR A CB    1 
ATOM   99   O  OG1   . THR A 1 20  ? -7.224  29.931  9.585  1.00 28.34 ? 997  THR A OG1   1 
ATOM   100  C  CG2   . THR A 1 20  ? -7.339  29.974  11.975 1.00 30.17 ? 997  THR A CG2   1 
ATOM   101  N  N     . LEU A 1 21  ? -4.052  30.561  12.934 1.00 23.58 ? 998  LEU A N     1 
ATOM   102  C  CA    . LEU A 1 21  ? -3.388  30.219  14.193 1.00 21.42 ? 998  LEU A CA    1 
ATOM   103  C  C     . LEU A 1 21  ? -4.433  30.011  15.279 1.00 21.90 ? 998  LEU A C     1 
ATOM   104  O  O     . LEU A 1 21  ? -5.390  30.779  15.380 1.00 23.92 ? 998  LEU A O     1 
ATOM   105  C  CB    . LEU A 1 21  ? -2.403  31.323  14.598 1.00 20.42 ? 998  LEU A CB    1 
ATOM   106  C  CG    . LEU A 1 21  ? -1.272  31.630  13.602 1.00 19.08 ? 998  LEU A CG    1 
ATOM   107  C  CD1   . LEU A 1 21  ? -0.320  32.661  14.191 1.00 16.00 ? 998  LEU A CD1   1 
ATOM   108  C  CD2   . LEU A 1 21  ? -0.516  30.354  13.265 1.00 18.45 ? 998  LEU A CD2   1 
ATOM   109  N  N     . LEU A 1 22  ? -4.245  28.975  16.089 1.00 21.29 ? 999  LEU A N     1 
ATOM   110  C  CA    . LEU A 1 22  ? -5.196  28.630  17.142 1.00 23.09 ? 999  LEU A CA    1 
ATOM   111  C  C     . LEU A 1 22  ? -4.742  28.856  18.582 1.00 23.95 ? 999  LEU A C     1 
ATOM   112  O  O     . LEU A 1 22  ? -5.520  29.332  19.407 1.00 24.32 ? 999  LEU A O     1 
ATOM   113  C  CB    . LEU A 1 22  ? -5.604  27.162  16.986 1.00 23.83 ? 999  LEU A CB    1 
ATOM   114  C  CG    . LEU A 1 22  ? -6.294  26.810  15.667 1.00 26.11 ? 999  LEU A CG    1 
ATOM   115  C  CD1   . LEU A 1 22  ? -6.337  25.305  15.476 1.00 25.29 ? 999  LEU A CD1   1 
ATOM   116  C  CD2   . LEU A 1 22  ? -7.695  27.396  15.665 1.00 24.84 ? 999  LEU A CD2   1 
ATOM   117  N  N     . ARG A 1 23  ? -3.496  28.505  18.884 1.00 24.16 ? 1000 ARG A N     1 
ATOM   118  C  CA    . ARG A 1 23  ? -2.965  28.658  20.234 1.00 25.73 ? 1000 ARG A CA    1 
ATOM   119  C  C     . ARG A 1 23  ? -1.459  28.454  20.294 1.00 24.06 ? 1000 ARG A C     1 
ATOM   120  O  O     . ARG A 1 23  ? -0.867  27.874  19.393 1.00 24.84 ? 1000 ARG A O     1 
ATOM   121  C  CB    . ARG A 1 23  ? -3.646  27.664  21.175 1.00 27.99 ? 1000 ARG A CB    1 
ATOM   122  C  CG    . ARG A 1 23  ? -3.669  26.240  20.655 1.00 34.47 ? 1000 ARG A CG    1 
ATOM   123  C  CD    . ARG A 1 23  ? -4.433  25.336  21.598 1.00 39.25 ? 1000 ARG A CD    1 
ATOM   124  N  NE    . ARG A 1 23  ? -3.681  25.097  22.822 1.00 46.73 ? 1000 ARG A NE    1 
ATOM   125  C  CZ    . ARG A 1 23  ? -2.687  24.219  22.925 1.00 50.58 ? 1000 ARG A CZ    1 
ATOM   126  N  NH1   . ARG A 1 23  ? -2.330  23.491  21.875 1.00 50.92 ? 1000 ARG A NH1   1 
ATOM   127  N  NH2   . ARG A 1 23  ? -2.042  24.072  24.077 1.00 51.34 ? 1000 ARG A NH2   1 
ATOM   128  N  N     . GLU A 1 24  ? -0.834  28.934  21.361 1.00 23.29 ? 1001 GLU A N     1 
ATOM   129  C  CA    . GLU A 1 24  ? 0.604   28.772  21.505 1.00 23.12 ? 1001 GLU A CA    1 
ATOM   130  C  C     . GLU A 1 24  ? 0.947   27.327  21.840 1.00 22.24 ? 1001 GLU A C     1 
ATOM   131  O  O     . GLU A 1 24  ? 0.247   26.674  22.617 1.00 21.03 ? 1001 GLU A O     1 
ATOM   132  C  CB    . GLU A 1 24  ? 1.142   29.701  22.594 1.00 24.21 ? 1001 GLU A CB    1 
ATOM   133  C  CG    . GLU A 1 24  ? 1.132   31.173  22.200 1.00 27.70 ? 1001 GLU A CG    1 
ATOM   134  C  CD    . GLU A 1 24  ? 1.724   32.082  23.264 1.00 28.05 ? 1001 GLU A CD    1 
ATOM   135  O  OE1   . GLU A 1 24  ? 1.847   33.298  23.002 1.00 29.99 ? 1001 GLU A OE1   1 
ATOM   136  O  OE2   . GLU A 1 24  ? 2.065   31.584  24.358 1.00 28.86 ? 1001 GLU A OE2   1 
ATOM   137  N  N     . LEU A 1 25  ? 2.024   26.829  21.240 1.00 21.57 ? 1002 LEU A N     1 
ATOM   138  C  CA    . LEU A 1 25  ? 2.472   25.467  21.494 1.00 22.44 ? 1002 LEU A CA    1 
ATOM   139  C  C     . LEU A 1 25  ? 3.768   25.456  22.298 1.00 23.42 ? 1002 LEU A C     1 
ATOM   140  O  O     . LEU A 1 25  ? 3.994   24.555  23.105 1.00 25.19 ? 1002 LEU A O     1 
ATOM   141  C  CB    . LEU A 1 25  ? 2.680   24.709  20.182 1.00 19.78 ? 1002 LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 25  ? 1.423   24.223  19.457 1.00 19.45 ? 1002 LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 25  ? 1.825   23.432  18.218 1.00 18.33 ? 1002 LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 25  ? 0.593   23.358  20.391 1.00 15.58 ? 1002 LEU A CD2   1 
ATOM   145  N  N     . GLY A 1 26  ? 4.615   26.455  22.080 1.00 24.06 ? 1003 GLY A N     1 
ATOM   146  C  CA    . GLY A 1 26  ? 5.874   26.516  22.799 1.00 25.13 ? 1003 GLY A CA    1 
ATOM   147  C  C     . GLY A 1 26  ? 6.867   27.474  22.170 1.00 25.64 ? 1003 GLY A C     1 
ATOM   148  O  O     . GLY A 1 26  ? 6.660   27.966  21.065 1.00 24.09 ? 1003 GLY A O     1 
ATOM   149  N  N     . GLN A 1 27  ? 7.957   27.733  22.879 1.00 27.29 ? 1004 GLN A N     1 
ATOM   150  C  CA    . GLN A 1 27  ? 8.983   28.638  22.393 1.00 28.31 ? 1004 GLN A CA    1 
ATOM   151  C  C     . GLN A 1 27  ? 10.087  27.951  21.604 1.00 29.37 ? 1004 GLN A C     1 
ATOM   152  O  O     . GLN A 1 27  ? 10.696  26.983  22.066 1.00 29.62 ? 1004 GLN A O     1 
ATOM   153  C  CB    . GLN A 1 27  ? 9.604   29.403  23.562 1.00 30.81 ? 1004 GLN A CB    1 
ATOM   154  C  CG    . GLN A 1 27  ? 9.090   30.829  23.696 1.00 34.59 ? 1004 GLN A CG    1 
ATOM   155  C  CD    . GLN A 1 27  ? 9.589   31.724  22.576 1.00 36.31 ? 1004 GLN A CD    1 
ATOM   156  O  OE1   . GLN A 1 27  ? 9.098   32.839  22.382 1.00 37.41 ? 1004 GLN A OE1   1 
ATOM   157  N  NE2   . GLN A 1 27  ? 10.579  31.238  21.836 1.00 36.54 ? 1004 GLN A NE2   1 
ATOM   158  N  N     . GLY A 1 28  ? 10.329  28.463  20.401 1.00 29.20 ? 1005 GLY A N     1 
ATOM   159  C  CA    . GLY A 1 28  ? 11.383  27.938  19.558 1.00 27.45 ? 1005 GLY A CA    1 
ATOM   160  C  C     . GLY A 1 28  ? 12.557  28.872  19.765 1.00 27.93 ? 1005 GLY A C     1 
ATOM   161  O  O     . GLY A 1 28  ? 12.413  29.896  20.435 1.00 24.94 ? 1005 GLY A O     1 
ATOM   162  N  N     . SER A 1 29  ? 13.715  28.548  19.206 1.00 28.06 ? 1006 SER A N     1 
ATOM   163  C  CA    . SER A 1 29  ? 14.875  29.409  19.391 1.00 28.59 ? 1006 SER A CA    1 
ATOM   164  C  C     . SER A 1 29  ? 14.718  30.725  18.639 1.00 27.02 ? 1006 SER A C     1 
ATOM   165  O  O     . SER A 1 29  ? 15.365  31.713  18.968 1.00 27.23 ? 1006 SER A O     1 
ATOM   166  C  CB    . SER A 1 29  ? 16.145  28.700  18.926 1.00 30.34 ? 1006 SER A CB    1 
ATOM   167  O  OG    . SER A 1 29  ? 16.119  28.502  17.527 1.00 35.22 ? 1006 SER A OG    1 
ATOM   168  N  N     . PHE A 1 30  ? 13.855  30.736  17.630 1.00 25.61 ? 1007 PHE A N     1 
ATOM   169  C  CA    . PHE A 1 30  ? 13.630  31.941  16.838 1.00 22.48 ? 1007 PHE A CA    1 
ATOM   170  C  C     . PHE A 1 30  ? 12.365  32.660  17.275 1.00 21.64 ? 1007 PHE A C     1 
ATOM   171  O  O     . PHE A 1 30  ? 12.193  33.853  17.014 1.00 21.83 ? 1007 PHE A O     1 
ATOM   172  C  CB    . PHE A 1 30  ? 13.507  31.587  15.359 1.00 21.11 ? 1007 PHE A CB    1 
ATOM   173  C  CG    . PHE A 1 30  ? 14.807  31.228  14.709 1.00 23.34 ? 1007 PHE A CG    1 
ATOM   174  C  CD1   . PHE A 1 30  ? 15.720  32.217  14.360 1.00 25.61 ? 1007 PHE A CD1   1 
ATOM   175  C  CD2   . PHE A 1 30  ? 15.113  29.901  14.424 1.00 22.94 ? 1007 PHE A CD2   1 
ATOM   176  C  CE1   . PHE A 1 30  ? 16.920  31.891  13.731 1.00 26.34 ? 1007 PHE A CE1   1 
ATOM   177  C  CE2   . PHE A 1 30  ? 16.304  29.564  13.798 1.00 23.67 ? 1007 PHE A CE2   1 
ATOM   178  C  CZ    . PHE A 1 30  ? 17.212  30.560  13.449 1.00 25.53 ? 1007 PHE A CZ    1 
ATOM   179  N  N     . GLY A 1 31  ? 11.474  31.935  17.936 1.00 18.81 ? 1008 GLY A N     1 
ATOM   180  C  CA    . GLY A 1 31  ? 10.239  32.555  18.365 1.00 18.61 ? 1008 GLY A CA    1 
ATOM   181  C  C     . GLY A 1 31  ? 9.166   31.566  18.747 1.00 18.95 ? 1008 GLY A C     1 
ATOM   182  O  O     . GLY A 1 31  ? 9.388   30.355  18.788 1.00 16.73 ? 1008 GLY A O     1 
ATOM   183  N  N     . MET A 1 32  ? 7.987   32.098  19.035 1.00 20.70 ? 1009 MET A N     1 
ATOM   184  C  CA    . MET A 1 32  ? 6.863   31.271  19.437 1.00 21.95 ? 1009 MET A CA    1 
ATOM   185  C  C     . MET A 1 32  ? 6.404   30.344  18.319 1.00 21.17 ? 1009 MET A C     1 
ATOM   186  O  O     . MET A 1 32  ? 6.396   30.712  17.144 1.00 19.42 ? 1009 MET A O     1 
ATOM   187  C  CB    . MET A 1 32  ? 5.695   32.159  19.876 1.00 24.69 ? 1009 MET A CB    1 
ATOM   188  C  CG    . MET A 1 32  ? 4.499   31.402  20.424 1.00 28.49 ? 1009 MET A CG    1 
ATOM   189  S  SD    . MET A 1 32  ? 4.899   30.481  21.924 1.00 35.20 ? 1009 MET A SD    1 
ATOM   190  C  CE    . MET A 1 32  ? 5.034   31.801  23.111 1.00 32.72 ? 1009 MET A CE    1 
ATOM   191  N  N     . VAL A 1 33  ? 6.028   29.134  18.708 1.00 21.26 ? 1010 VAL A N     1 
ATOM   192  C  CA    . VAL A 1 33  ? 5.522   28.139  17.779 1.00 20.28 ? 1010 VAL A CA    1 
ATOM   193  C  C     . VAL A 1 33  ? 4.050   27.978  18.126 1.00 21.47 ? 1010 VAL A C     1 
ATOM   194  O  O     . VAL A 1 33  ? 3.707   27.824  19.302 1.00 19.26 ? 1010 VAL A O     1 
ATOM   195  C  CB    . VAL A 1 33  ? 6.223   26.787  17.965 1.00 19.60 ? 1010 VAL A CB    1 
ATOM   196  C  CG1   . VAL A 1 33  ? 5.593   25.752  17.049 1.00 15.37 ? 1010 VAL A CG1   1 
ATOM   197  C  CG2   . VAL A 1 33  ? 7.713   26.932  17.676 1.00 17.49 ? 1010 VAL A CG2   1 
ATOM   198  N  N     . TYR A 1 34  ? 3.184   28.018  17.114 1.00 21.54 ? 1011 TYR A N     1 
ATOM   199  C  CA    . TYR A 1 34  ? 1.748   27.887  17.350 1.00 21.33 ? 1011 TYR A CA    1 
ATOM   200  C  C     . TYR A 1 34  ? 1.116   26.692  16.664 1.00 21.50 ? 1011 TYR A C     1 
ATOM   201  O  O     . TYR A 1 34  ? 1.659   26.150  15.700 1.00 22.59 ? 1011 TYR A O     1 
ATOM   202  C  CB    . TYR A 1 34  ? 0.987   29.114  16.846 1.00 21.65 ? 1011 TYR A CB    1 
ATOM   203  C  CG    . TYR A 1 34  ? 1.466   30.446  17.358 1.00 23.41 ? 1011 TYR A CG    1 
ATOM   204  C  CD1   . TYR A 1 34  ? 2.605   31.052  16.825 1.00 23.17 ? 1011 TYR A CD1   1 
ATOM   205  C  CD2   . TYR A 1 34  ? 0.768   31.114  18.364 1.00 22.97 ? 1011 TYR A CD2   1 
ATOM   206  C  CE1   . TYR A 1 34  ? 3.036   32.293  17.283 1.00 26.35 ? 1011 TYR A CE1   1 
ATOM   207  C  CE2   . TYR A 1 34  ? 1.189   32.350  18.829 1.00 26.50 ? 1011 TYR A CE2   1 
ATOM   208  C  CZ    . TYR A 1 34  ? 2.322   32.936  18.287 1.00 27.80 ? 1011 TYR A CZ    1 
ATOM   209  O  OH    . TYR A 1 34  ? 2.742   34.157  18.761 1.00 31.13 ? 1011 TYR A OH    1 
ATOM   210  N  N     . GLU A 1 35  ? -0.042  26.289  17.177 1.00 19.46 ? 1012 GLU A N     1 
ATOM   211  C  CA    . GLU A 1 35  ? -0.807  25.224  16.558 1.00 19.51 ? 1012 GLU A CA    1 
ATOM   212  C  C     . GLU A 1 35  ? -1.751  25.983  15.631 1.00 18.12 ? 1012 GLU A C     1 
ATOM   213  O  O     . GLU A 1 35  ? -2.288  27.028  16.006 1.00 14.69 ? 1012 GLU A O     1 
ATOM   214  C  CB    . GLU A 1 35  ? -1.647  24.452  17.575 1.00 22.33 ? 1012 GLU A CB    1 
ATOM   215  C  CG    . GLU A 1 35  ? -2.493  23.372  16.909 1.00 26.11 ? 1012 GLU A CG    1 
ATOM   216  C  CD    . GLU A 1 35  ? -3.388  22.629  17.874 1.00 29.28 ? 1012 GLU A CD    1 
ATOM   217  O  OE1   . GLU A 1 35  ? -3.025  22.525  19.062 1.00 33.88 ? 1012 GLU A OE1   1 
ATOM   218  O  OE2   . GLU A 1 35  ? -4.446  22.128  17.441 1.00 29.78 ? 1012 GLU A OE2   1 
ATOM   219  N  N     . GLY A 1 36  ? -1.959  25.474  14.426 1.00 17.97 ? 1013 GLY A N     1 
ATOM   220  C  CA    . GLY A 1 36  ? -2.857  26.161  13.523 1.00 17.25 ? 1013 GLY A CA    1 
ATOM   221  C  C     . GLY A 1 36  ? -3.487  25.212  12.534 1.00 17.85 ? 1013 GLY A C     1 
ATOM   222  O  O     . GLY A 1 36  ? -3.342  23.994  12.654 1.00 17.05 ? 1013 GLY A O     1 
ATOM   223  N  N     . ASN A 1 37  ? -4.207  25.782  11.571 1.00 18.45 ? 1014 ASN A N     1 
ATOM   224  C  CA    . ASN A 1 37  ? -4.844  25.020  10.507 1.00 19.45 ? 1014 ASN A CA    1 
ATOM   225  C  C     . ASN A 1 37  ? -4.446  25.622  9.161  1.00 18.77 ? 1014 ASN A C     1 
ATOM   226  O  O     . ASN A 1 37  ? -4.370  26.842  9.005  1.00 17.23 ? 1014 ASN A O     1 
ATOM   227  C  CB    . ASN A 1 37  ? -6.366  25.042  10.652 1.00 22.90 ? 1014 ASN A CB    1 
ATOM   228  C  CG    . ASN A 1 37  ? -6.881  23.896  11.487 1.00 28.02 ? 1014 ASN A CG    1 
ATOM   229  O  OD1   . ASN A 1 37  ? -6.643  22.732  11.170 1.00 31.47 ? 1014 ASN A OD1   1 
ATOM   230  N  ND2   . ASN A 1 37  ? -7.592  24.216  12.563 1.00 31.18 ? 1014 ASN A ND2   1 
ATOM   231  N  N     . ALA A 1 38  ? -4.189  24.760  8.190  1.00 18.33 ? 1015 ALA A N     1 
ATOM   232  C  CA    . ALA A 1 38  ? -3.810  25.221  6.867  1.00 19.32 ? 1015 ALA A CA    1 
ATOM   233  C  C     . ALA A 1 38  ? -4.808  24.728  5.818  1.00 19.89 ? 1015 ALA A C     1 
ATOM   234  O  O     . ALA A 1 38  ? -5.105  23.535  5.714  1.00 19.63 ? 1015 ALA A O     1 
ATOM   235  C  CB    . ALA A 1 38  ? -2.400  24.746  6.531  1.00 17.06 ? 1015 ALA A CB    1 
ATOM   236  N  N     . ARG A 1 39  ? -5.324  25.671  5.043  1.00 22.91 ? 1016 ARG A N     1 
ATOM   237  C  CA    . ARG A 1 39  ? -6.290  25.376  3.999  1.00 25.26 ? 1016 ARG A CA    1 
ATOM   238  C  C     . ARG A 1 39  ? -5.583  24.886  2.738  1.00 23.67 ? 1016 ARG A C     1 
ATOM   239  O  O     . ARG A 1 39  ? -4.683  25.548  2.225  1.00 22.78 ? 1016 ARG A O     1 
ATOM   240  C  CB    . ARG A 1 39  ? -7.086  26.642  3.692  1.00 30.55 ? 1016 ARG A CB    1 
ATOM   241  C  CG    . ARG A 1 39  ? -8.248  26.482  2.716  1.00 38.16 ? 1016 ARG A CG    1 
ATOM   242  C  CD    . ARG A 1 39  ? -8.834  27.854  2.402  1.00 42.77 ? 1016 ARG A CD    1 
ATOM   243  N  NE    . ARG A 1 39  ? -8.990  28.634  3.627  1.00 49.27 ? 1016 ARG A NE    1 
ATOM   244  C  CZ    . ARG A 1 39  ? -8.792  29.946  3.716  1.00 52.95 ? 1016 ARG A CZ    1 
ATOM   245  N  NH1   . ARG A 1 39  ? -8.431  30.648  2.643  1.00 52.52 ? 1016 ARG A NH1   1 
ATOM   246  N  NH2   . ARG A 1 39  ? -8.927  30.553  4.891  1.00 53.54 ? 1016 ARG A NH2   1 
ATOM   247  N  N     . ASP A 1 40  ? -5.997  23.719  2.253  1.00 23.28 ? 1017 ASP A N     1 
ATOM   248  C  CA    . ASP A 1 40  ? -5.448  23.122  1.035  1.00 22.50 ? 1017 ASP A CA    1 
ATOM   249  C  C     . ASP A 1 40  ? -3.941  23.218  0.924  1.00 21.78 ? 1017 ASP A C     1 
ATOM   250  O  O     . ASP A 1 40  ? -3.424  23.822  -0.017 1.00 22.43 ? 1017 ASP A O     1 
ATOM   251  C  CB    . ASP A 1 40  ? -6.069  23.777  -0.206 1.00 21.06 ? 1017 ASP A CB    1 
ATOM   252  C  CG    . ASP A 1 40  ? -7.575  23.686  -0.216 1.00 20.17 ? 1017 ASP A CG    1 
ATOM   253  O  OD1   . ASP A 1 40  ? -8.092  22.571  -0.014 1.00 19.48 ? 1017 ASP A OD1   1 
ATOM   254  O  OD2   . ASP A 1 40  ? -8.239  24.721  -0.427 1.00 20.82 ? 1017 ASP A OD2   1 
ATOM   255  N  N     . ILE A 1 41  ? -3.233  22.625  1.875  1.00 22.79 ? 1018 ILE A N     1 
ATOM   256  C  CA    . ILE A 1 41  ? -1.778  22.662  1.839  1.00 23.80 ? 1018 ILE A CA    1 
ATOM   257  C  C     . ILE A 1 41  ? -1.273  21.288  1.377  1.00 22.62 ? 1018 ILE A C     1 
ATOM   258  O  O     . ILE A 1 41  ? -0.201  21.167  0.779  1.00 22.18 ? 1018 ILE A O     1 
ATOM   259  C  CB    . ILE A 1 41  ? -1.207  23.037  3.237  1.00 24.61 ? 1018 ILE A CB    1 
ATOM   260  C  CG1   . ILE A 1 41  ? 0.235   23.513  3.102  1.00 25.66 ? 1018 ILE A CG1   1 
ATOM   261  C  CG2   . ILE A 1 41  ? -1.276  21.848  4.184  1.00 26.32 ? 1018 ILE A CG2   1 
ATOM   262  C  CD1   . ILE A 1 41  ? 0.857   23.917  4.419  1.00 28.61 ? 1018 ILE A CD1   1 
ATOM   263  N  N     . ILE A 1 42  ? -2.069  20.261  1.656  1.00 21.30 ? 1019 ILE A N     1 
ATOM   264  C  CA    . ILE A 1 42  ? -1.744  18.894  1.273  1.00 20.62 ? 1019 ILE A CA    1 
ATOM   265  C  C     . ILE A 1 42  ? -2.826  18.388  0.330  1.00 20.99 ? 1019 ILE A C     1 
ATOM   266  O  O     . ILE A 1 42  ? -4.008  18.376  0.678  1.00 20.69 ? 1019 ILE A O     1 
ATOM   267  C  CB    . ILE A 1 42  ? -1.682  17.965  2.512  1.00 20.25 ? 1019 ILE A CB    1 
ATOM   268  C  CG1   . ILE A 1 42  ? -0.418  18.263  3.328  1.00 19.81 ? 1019 ILE A CG1   1 
ATOM   269  C  CG2   . ILE A 1 42  ? -1.729  16.501  2.080  1.00 19.99 ? 1019 ILE A CG2   1 
ATOM   270  C  CD1   . ILE A 1 42  ? -0.288  17.416  4.593  1.00 17.62 ? 1019 ILE A CD1   1 
ATOM   271  N  N     . LYS A 1 43  ? -2.423  17.974  -0.864 1.00 20.98 ? 1020 LYS A N     1 
ATOM   272  C  CA    . LYS A 1 43  ? -3.376  17.465  -1.835 1.00 21.67 ? 1020 LYS A CA    1 
ATOM   273  C  C     . LYS A 1 43  ? -4.169  16.338  -1.202 1.00 22.34 ? 1020 LYS A C     1 
ATOM   274  O  O     . LYS A 1 43  ? -3.617  15.489  -0.508 1.00 23.59 ? 1020 LYS A O     1 
ATOM   275  C  CB    . LYS A 1 43  ? -2.653  16.948  -3.078 1.00 22.89 ? 1020 LYS A CB    1 
ATOM   276  C  CG    . LYS A 1 43  ? -3.596  16.408  -4.138 1.00 25.49 ? 1020 LYS A CG    1 
ATOM   277  C  CD    . LYS A 1 43  ? -2.865  16.044  -5.420 1.00 26.32 ? 1020 LYS A CD    1 
ATOM   278  C  CE    . LYS A 1 43  ? -3.825  15.456  -6.440 1.00 27.24 ? 1020 LYS A CE    1 
ATOM   279  N  NZ    . LYS A 1 43  ? -3.151  15.136  -7.727 1.00 29.00 ? 1020 LYS A NZ    1 
ATOM   280  N  N     . GLY A 1 44  ? -5.471  16.330  -1.433 1.00 23.43 ? 1021 GLY A N     1 
ATOM   281  C  CA    . GLY A 1 44  ? -6.286  15.278  -0.862 1.00 23.35 ? 1021 GLY A CA    1 
ATOM   282  C  C     . GLY A 1 44  ? -7.009  15.681  0.405  1.00 24.85 ? 1021 GLY A C     1 
ATOM   283  O  O     . GLY A 1 44  ? -7.911  14.976  0.845  1.00 26.47 ? 1021 GLY A O     1 
ATOM   284  N  N     . GLU A 1 45  ? -6.624  16.794  1.017  1.00 25.15 ? 1022 GLU A N     1 
ATOM   285  C  CA    . GLU A 1 45  ? -7.318  17.208  2.225  1.00 26.18 ? 1022 GLU A CA    1 
ATOM   286  C  C     . GLU A 1 45  ? -7.583  18.699  2.294  1.00 25.21 ? 1022 GLU A C     1 
ATOM   287  O  O     . GLU A 1 45  ? -6.708  19.522  2.027  1.00 25.36 ? 1022 GLU A O     1 
ATOM   288  C  CB    . GLU A 1 45  ? -6.585  16.708  3.480  1.00 28.19 ? 1022 GLU A CB    1 
ATOM   289  C  CG    . GLU A 1 45  ? -5.147  17.128  3.640  1.00 33.35 ? 1022 GLU A CG    1 
ATOM   290  C  CD    . GLU A 1 45  ? -4.450  16.345  4.747  1.00 36.68 ? 1022 GLU A CD    1 
ATOM   291  O  OE1   . GLU A 1 45  ? -4.038  15.190  4.496  1.00 36.85 ? 1022 GLU A OE1   1 
ATOM   292  O  OE2   . GLU A 1 45  ? -4.330  16.878  5.873  1.00 35.93 ? 1022 GLU A OE2   1 
ATOM   293  N  N     . ALA A 1 46  ? -8.822  19.020  2.653  1.00 24.66 ? 1023 ALA A N     1 
ATOM   294  C  CA    . ALA A 1 46  ? -9.302  20.388  2.757  1.00 23.12 ? 1023 ALA A CA    1 
ATOM   295  C  C     . ALA A 1 46  ? -8.471  21.228  3.709  1.00 22.49 ? 1023 ALA A C     1 
ATOM   296  O  O     . ALA A 1 46  ? -8.053  22.328  3.371  1.00 21.35 ? 1023 ALA A O     1 
ATOM   297  C  CB    . ALA A 1 46  ? -10.756 20.382  3.196  1.00 23.51 ? 1023 ALA A CB    1 
ATOM   298  N  N     . GLU A 1 47  ? -8.234  20.716  4.905  1.00 24.32 ? 1024 GLU A N     1 
ATOM   299  C  CA    . GLU A 1 47  ? -7.436  21.463  5.857  1.00 26.39 ? 1024 GLU A CA    1 
ATOM   300  C  C     . GLU A 1 47  ? -6.580  20.530  6.700  1.00 24.33 ? 1024 GLU A C     1 
ATOM   301  O  O     . GLU A 1 47  ? -7.027  19.461  7.122  1.00 22.48 ? 1024 GLU A O     1 
ATOM   302  C  CB    . GLU A 1 47  ? -8.337  22.317  6.746  1.00 31.51 ? 1024 GLU A CB    1 
ATOM   303  C  CG    . GLU A 1 47  ? -9.169  21.535  7.736  1.00 39.27 ? 1024 GLU A CG    1 
ATOM   304  C  CD    . GLU A 1 47  ? -9.990  22.445  8.629  1.00 44.13 ? 1024 GLU A CD    1 
ATOM   305  O  OE1   . GLU A 1 47  ? -10.954 23.056  8.116  1.00 46.68 ? 1024 GLU A OE1   1 
ATOM   306  O  OE2   . GLU A 1 47  ? -9.665  22.555  9.835  1.00 44.62 ? 1024 GLU A OE2   1 
ATOM   307  N  N     . THR A 1 48  ? -5.343  20.946  6.940  1.00 21.13 ? 1025 THR A N     1 
ATOM   308  C  CA    . THR A 1 48  ? -4.402  20.153  7.715  1.00 20.67 ? 1025 THR A CA    1 
ATOM   309  C  C     . THR A 1 48  ? -4.040  20.842  9.023  1.00 20.18 ? 1025 THR A C     1 
ATOM   310  O  O     . THR A 1 48  ? -3.825  22.058  9.050  1.00 22.06 ? 1025 THR A O     1 
ATOM   311  C  CB    . THR A 1 48  ? -3.089  19.924  6.921  1.00 21.63 ? 1025 THR A CB    1 
ATOM   312  O  OG1   . THR A 1 48  ? -3.393  19.342  5.646  1.00 21.86 ? 1025 THR A OG1   1 
ATOM   313  C  CG2   . THR A 1 48  ? -2.139  19.012  7.699  1.00 19.50 ? 1025 THR A CG2   1 
ATOM   314  N  N     . ARG A 1 49  ? -3.973  20.070  10.104 1.00 18.70 ? 1026 ARG A N     1 
ATOM   315  C  CA    . ARG A 1 49  ? -3.584  20.622  11.401 1.00 17.93 ? 1026 ARG A CA    1 
ATOM   316  C  C     . ARG A 1 49  ? -2.081  20.846  11.270 1.00 14.80 ? 1026 ARG A C     1 
ATOM   317  O  O     . ARG A 1 49  ? -1.369  19.984  10.767 1.00 14.58 ? 1026 ARG A O     1 
ATOM   318  C  CB    . ARG A 1 49  ? -3.855  19.621  12.522 1.00 18.62 ? 1026 ARG A CB    1 
ATOM   319  C  CG    . ARG A 1 49  ? -5.278  19.088  12.566 1.00 21.11 ? 1026 ARG A CG    1 
ATOM   320  C  CD    . ARG A 1 49  ? -5.438  18.157  13.759 1.00 24.73 ? 1026 ARG A CD    1 
ATOM   321  N  NE    . ARG A 1 49  ? -5.129  18.848  15.012 1.00 27.90 ? 1026 ARG A NE    1 
ATOM   322  C  CZ    . ARG A 1 49  ? -4.905  18.241  16.175 1.00 28.62 ? 1026 ARG A CZ    1 
ATOM   323  N  NH1   . ARG A 1 49  ? -4.949  16.914  16.251 1.00 27.78 ? 1026 ARG A NH1   1 
ATOM   324  N  NH2   . ARG A 1 49  ? -4.637  18.963  17.261 1.00 24.25 ? 1026 ARG A NH2   1 
ATOM   325  N  N     . VAL A 1 50  ? -1.594  21.993  11.713 1.00 12.66 ? 1027 VAL A N     1 
ATOM   326  C  CA    . VAL A 1 50  ? -0.174  22.275  11.575 1.00 11.89 ? 1027 VAL A CA    1 
ATOM   327  C  C     . VAL A 1 50  ? 0.437   23.023  12.751 1.00 11.89 ? 1027 VAL A C     1 
ATOM   328  O  O     . VAL A 1 50  ? -0.269  23.567  13.604 1.00 9.39  ? 1027 VAL A O     1 
ATOM   329  C  CB    . VAL A 1 50  ? 0.100   23.124  10.302 1.00 9.52  ? 1027 VAL A CB    1 
ATOM   330  C  CG1   . VAL A 1 50  ? -0.300  22.368  9.069  1.00 9.86  ? 1027 VAL A CG1   1 
ATOM   331  C  CG2   . VAL A 1 50  ? -0.681  24.424  10.371 1.00 9.69  ? 1027 VAL A CG2   1 
ATOM   332  N  N     . ALA A 1 51  ? 1.768   23.029  12.771 1.00 11.73 ? 1028 ALA A N     1 
ATOM   333  C  CA    . ALA A 1 51  ? 2.550   23.742  13.768 1.00 11.31 ? 1028 ALA A CA    1 
ATOM   334  C  C     . ALA A 1 51  ? 3.105   24.895  12.944 1.00 13.34 ? 1028 ALA A C     1 
ATOM   335  O  O     . ALA A 1 51  ? 3.548   24.693  11.809 1.00 13.85 ? 1028 ALA A O     1 
ATOM   336  C  CB    . ALA A 1 51  ? 3.674   22.882  14.281 1.00 10.82 ? 1028 ALA A CB    1 
ATOM   337  N  N     . VAL A 1 52  ? 3.078   26.099  13.499 1.00 13.16 ? 1029 VAL A N     1 
ATOM   338  C  CA    . VAL A 1 52  ? 3.551   27.258  12.765 1.00 12.77 ? 1029 VAL A CA    1 
ATOM   339  C  C     . VAL A 1 52  ? 4.633   27.993  13.541 1.00 12.92 ? 1029 VAL A C     1 
ATOM   340  O  O     . VAL A 1 52  ? 4.384   28.519  14.624 1.00 14.56 ? 1029 VAL A O     1 
ATOM   341  C  CB    . VAL A 1 52  ? 2.371   28.217  12.449 1.00 12.83 ? 1029 VAL A CB    1 
ATOM   342  C  CG1   . VAL A 1 52  ? 2.841   29.366  11.555 1.00 13.06 ? 1029 VAL A CG1   1 
ATOM   343  C  CG2   . VAL A 1 52  ? 1.248   27.451  11.760 1.00 8.60  ? 1029 VAL A CG2   1 
ATOM   344  N  N     . LYS A 1 53  ? 5.837   28.018  12.977 1.00 14.20 ? 1030 LYS A N     1 
ATOM   345  C  CA    . LYS A 1 53  ? 6.975   28.686  13.600 1.00 15.80 ? 1030 LYS A CA    1 
ATOM   346  C  C     . LYS A 1 53  ? 7.061   30.138  13.166 1.00 17.55 ? 1030 LYS A C     1 
ATOM   347  O  O     . LYS A 1 53  ? 6.809   30.479  12.008 1.00 16.67 ? 1030 LYS A O     1 
ATOM   348  C  CB    . LYS A 1 53  ? 8.286   27.975  13.248 1.00 14.17 ? 1030 LYS A CB    1 
ATOM   349  C  CG    . LYS A 1 53  ? 8.429   26.609  13.904 1.00 16.87 ? 1030 LYS A CG    1 
ATOM   350  C  CD    . LYS A 1 53  ? 9.840   26.045  13.775 1.00 18.10 ? 1030 LYS A CD    1 
ATOM   351  C  CE    . LYS A 1 53  ? 10.012  24.833  14.681 1.00 20.44 ? 1030 LYS A CE    1 
ATOM   352  N  NZ    . LYS A 1 53  ? 11.421  24.376  14.757 1.00 22.49 ? 1030 LYS A NZ    1 
ATOM   353  N  N     . THR A 1 54  ? 7.414   31.000  14.104 1.00 18.56 ? 1031 THR A N     1 
ATOM   354  C  CA    . THR A 1 54  ? 7.531   32.409  13.797 1.00 21.60 ? 1031 THR A CA    1 
ATOM   355  C  C     . THR A 1 54  ? 8.820   32.933  14.393 1.00 24.58 ? 1031 THR A C     1 
ATOM   356  O  O     . THR A 1 54  ? 9.438   32.288  15.245 1.00 24.36 ? 1031 THR A O     1 
ATOM   357  C  CB    . THR A 1 54  ? 6.345   33.217  14.373 1.00 20.52 ? 1031 THR A CB    1 
ATOM   358  O  OG1   . THR A 1 54  ? 6.407   33.218  15.808 1.00 18.07 ? 1031 THR A OG1   1 
ATOM   359  C  CG2   . THR A 1 54  ? 5.026   32.607  13.922 1.00 19.12 ? 1031 THR A CG2   1 
ATOM   360  N  N     . VAL A 1 55  ? 9.227   34.107  13.935 1.00 26.22 ? 1032 VAL A N     1 
ATOM   361  C  CA    . VAL A 1 55  ? 10.433  34.713  14.447 1.00 30.17 ? 1032 VAL A CA    1 
ATOM   362  C  C     . VAL A 1 55  ? 10.040  35.937  15.271 1.00 32.42 ? 1032 VAL A C     1 
ATOM   363  O  O     . VAL A 1 55  ? 9.335   36.829  14.796 1.00 31.43 ? 1032 VAL A O     1 
ATOM   364  C  CB    . VAL A 1 55  ? 11.392  35.098  13.297 1.00 29.81 ? 1032 VAL A CB    1 
ATOM   365  C  CG1   . VAL A 1 55  ? 10.650  35.880  12.234 1.00 31.66 ? 1032 VAL A CG1   1 
ATOM   366  C  CG2   . VAL A 1 55  ? 12.550  35.907  13.841 1.00 30.21 ? 1032 VAL A CG2   1 
ATOM   367  N  N     . ASN A 1 56  ? 10.498  35.950  16.519 1.00 34.68 ? 1033 ASN A N     1 
ATOM   368  C  CA    . ASN A 1 56  ? 10.234  37.031  17.457 1.00 36.76 ? 1033 ASN A CA    1 
ATOM   369  C  C     . ASN A 1 56  ? 10.618  38.387  16.869 1.00 37.74 ? 1033 ASN A C     1 
ATOM   370  O  O     . ASN A 1 56  ? 11.563  38.487  16.088 1.00 36.81 ? 1033 ASN A O     1 
ATOM   371  C  CB    . ASN A 1 56  ? 11.007  36.754  18.751 1.00 40.15 ? 1033 ASN A CB    1 
ATOM   372  C  CG    . ASN A 1 56  ? 11.624  38.002  19.353 1.00 46.83 ? 1033 ASN A CG    1 
ATOM   373  O  OD1   . ASN A 1 56  ? 10.922  38.937  19.745 1.00 50.13 ? 1033 ASN A OD1   1 
ATOM   374  N  ND2   . ASN A 1 56  ? 12.951  38.019  19.434 1.00 48.78 ? 1033 ASN A ND2   1 
ATOM   375  N  N     . GLU A 1 57  ? 9.878   39.427  17.247 1.00 39.34 ? 1034 GLU A N     1 
ATOM   376  C  CA    . GLU A 1 57  ? 10.135  40.786  16.762 1.00 41.18 ? 1034 GLU A CA    1 
ATOM   377  C  C     . GLU A 1 57  ? 11.544  41.277  17.115 1.00 41.35 ? 1034 GLU A C     1 
ATOM   378  O  O     . GLU A 1 57  ? 12.170  42.008  16.348 1.00 41.17 ? 1034 GLU A O     1 
ATOM   379  C  CB    . GLU A 1 57  ? 9.095   41.755  17.340 1.00 41.68 ? 1034 GLU A CB    1 
ATOM   380  N  N     . SER A 1 58  ? 12.031  40.865  18.279 1.00 41.38 ? 1035 SER A N     1 
ATOM   381  C  CA    . SER A 1 58  ? 13.354  41.250  18.760 1.00 41.06 ? 1035 SER A CA    1 
ATOM   382  C  C     . SER A 1 58  ? 14.484  40.624  17.937 1.00 39.67 ? 1035 SER A C     1 
ATOM   383  O  O     . SER A 1 58  ? 15.655  40.750  18.293 1.00 38.98 ? 1035 SER A O     1 
ATOM   384  C  CB    . SER A 1 58  ? 13.520  40.824  20.225 1.00 42.52 ? 1035 SER A CB    1 
ATOM   385  O  OG    . SER A 1 58  ? 12.463  41.307  21.036 1.00 46.77 ? 1035 SER A OG    1 
ATOM   386  N  N     . ALA A 1 59  ? 14.140  39.952  16.844 1.00 36.78 ? 1036 ALA A N     1 
ATOM   387  C  CA    . ALA A 1 59  ? 15.155  39.306  16.020 1.00 33.88 ? 1036 ALA A CA    1 
ATOM   388  C  C     . ALA A 1 59  ? 15.856  40.267  15.067 1.00 33.61 ? 1036 ALA A C     1 
ATOM   389  O  O     . ALA A 1 59  ? 15.254  41.226  14.572 1.00 33.77 ? 1036 ALA A O     1 
ATOM   390  C  CB    . ALA A 1 59  ? 14.535  38.161  15.231 1.00 32.03 ? 1036 ALA A CB    1 
ATOM   391  N  N     . SER A 1 60  ? 17.134  40.000  14.813 1.00 30.27 ? 1037 SER A N     1 
ATOM   392  C  CA    . SER A 1 60  ? 17.913  40.822  13.907 1.00 28.02 ? 1037 SER A CA    1 
ATOM   393  C  C     . SER A 1 60  ? 17.655  40.331  12.490 1.00 27.58 ? 1037 SER A C     1 
ATOM   394  O  O     . SER A 1 60  ? 17.176  39.218  12.280 1.00 26.29 ? 1037 SER A O     1 
ATOM   395  C  CB    . SER A 1 60  ? 19.403  40.709  14.226 1.00 27.20 ? 1037 SER A CB    1 
ATOM   396  O  OG    . SER A 1 60  ? 19.894  39.415  13.932 1.00 25.37 ? 1037 SER A OG    1 
ATOM   397  N  N     . LEU A 1 61  ? 17.977  41.172  11.520 1.00 27.42 ? 1038 LEU A N     1 
ATOM   398  C  CA    . LEU A 1 61  ? 17.784  40.835  10.122 1.00 28.20 ? 1038 LEU A CA    1 
ATOM   399  C  C     . LEU A 1 61  ? 18.426  39.482  9.798  1.00 28.41 ? 1038 LEU A C     1 
ATOM   400  O  O     . LEU A 1 61  ? 17.814  38.628  9.151  1.00 27.03 ? 1038 LEU A O     1 
ATOM   401  C  CB    . LEU A 1 61  ? 18.386  41.948  9.254  1.00 28.25 ? 1038 LEU A CB    1 
ATOM   402  C  CG    . LEU A 1 61  ? 18.229  41.937  7.732  1.00 30.79 ? 1038 LEU A CG    1 
ATOM   403  C  CD1   . LEU A 1 61  ? 19.178  40.931  7.106  1.00 32.53 ? 1038 LEU A CD1   1 
ATOM   404  C  CD2   . LEU A 1 61  ? 16.789  41.624  7.382  1.00 29.94 ? 1038 LEU A CD2   1 
ATOM   405  N  N     . ARG A 1 62  ? 19.658  39.297  10.262 1.00 28.87 ? 1039 ARG A N     1 
ATOM   406  C  CA    . ARG A 1 62  ? 20.406  38.072  10.020 1.00 27.80 ? 1039 ARG A CA    1 
ATOM   407  C  C     . ARG A 1 62  ? 19.695  36.840  10.560 1.00 26.90 ? 1039 ARG A C     1 
ATOM   408  O  O     . ARG A 1 62  ? 19.730  35.775  9.943  1.00 24.17 ? 1039 ARG A O     1 
ATOM   409  C  CB    . ARG A 1 62  ? 21.795  38.170  10.650 1.00 29.93 ? 1039 ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 62  ? 22.768  37.121  10.145 1.00 34.17 ? 1039 ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 62  ? 23.279  36.252  11.268 1.00 37.16 ? 1039 ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 62  ? 23.811  37.052  12.366 1.00 41.31 ? 1039 ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 62  ? 24.428  36.552  13.435 1.00 42.96 ? 1039 ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 62  ? 24.602  35.240  13.559 1.00 39.44 ? 1039 ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 62  ? 24.868  37.371  14.387 1.00 41.84 ? 1039 ARG A NH2   1 
ATOM   416  N  N     . GLU A 1 63  ? 19.052  36.980  11.713 1.00 24.89 ? 1040 GLU A N     1 
ATOM   417  C  CA    . GLU A 1 63  ? 18.349  35.849  12.292 1.00 25.43 ? 1040 GLU A CA    1 
ATOM   418  C  C     . GLU A 1 63  ? 17.084  35.541  11.493 1.00 24.37 ? 1040 GLU A C     1 
ATOM   419  O  O     . GLU A 1 63  ? 16.722  34.379  11.325 1.00 24.19 ? 1040 GLU A O     1 
ATOM   420  C  CB    . GLU A 1 63  ? 18.022  36.131  13.757 1.00 26.69 ? 1040 GLU A CB    1 
ATOM   421  C  CG    . GLU A 1 63  ? 19.268  36.312  14.617 1.00 29.05 ? 1040 GLU A CG    1 
ATOM   422  C  CD    . GLU A 1 63  ? 18.950  36.639  16.066 1.00 31.36 ? 1040 GLU A CD    1 
ATOM   423  O  OE1   . GLU A 1 63  ? 18.096  37.515  16.303 1.00 35.26 ? 1040 GLU A OE1   1 
ATOM   424  O  OE2   . GLU A 1 63  ? 19.560  36.035  16.971 1.00 32.87 ? 1040 GLU A OE2   1 
ATOM   425  N  N     . ARG A 1 64  ? 16.412  36.573  10.996 1.00 23.97 ? 1041 ARG A N     1 
ATOM   426  C  CA    . ARG A 1 64  ? 15.209  36.355  10.201 1.00 23.09 ? 1041 ARG A CA    1 
ATOM   427  C  C     . ARG A 1 64  ? 15.620  35.592  8.953  1.00 21.75 ? 1041 ARG A C     1 
ATOM   428  O  O     . ARG A 1 64  ? 14.864  34.779  8.433  1.00 21.68 ? 1041 ARG A O     1 
ATOM   429  C  CB    . ARG A 1 64  ? 14.558  37.685  9.805  1.00 23.19 ? 1041 ARG A CB    1 
ATOM   430  C  CG    . ARG A 1 64  ? 13.988  38.458  10.974 1.00 27.95 ? 1041 ARG A CG    1 
ATOM   431  C  CD    . ARG A 1 64  ? 13.536  39.854  10.572 1.00 30.58 ? 1041 ARG A CD    1 
ATOM   432  N  NE    . ARG A 1 64  ? 13.210  40.680  11.735 1.00 34.53 ? 1041 ARG A NE    1 
ATOM   433  C  CZ    . ARG A 1 64  ? 12.153  40.500  12.527 1.00 36.06 ? 1041 ARG A CZ    1 
ATOM   434  N  NH1   . ARG A 1 64  ? 11.292  39.514  12.290 1.00 34.77 ? 1041 ARG A NH1   1 
ATOM   435  N  NH2   . ARG A 1 64  ? 11.955  41.309  13.563 1.00 34.92 ? 1041 ARG A NH2   1 
ATOM   436  N  N     . ILE A 1 65  ? 16.830  35.861  8.478  1.00 21.61 ? 1042 ILE A N     1 
ATOM   437  C  CA    . ILE A 1 65  ? 17.343  35.194  7.293  1.00 21.67 ? 1042 ILE A CA    1 
ATOM   438  C  C     . ILE A 1 65  ? 17.713  33.748  7.605  1.00 21.96 ? 1042 ILE A C     1 
ATOM   439  O  O     . ILE A 1 65  ? 17.383  32.847  6.837  1.00 21.75 ? 1042 ILE A O     1 
ATOM   440  C  CB    . ILE A 1 65  ? 18.584  35.933  6.726  1.00 22.00 ? 1042 ILE A CB    1 
ATOM   441  C  CG1   . ILE A 1 65  ? 18.160  37.286  6.155  1.00 21.92 ? 1042 ILE A CG1   1 
ATOM   442  C  CG2   . ILE A 1 65  ? 19.257  35.095  5.644  1.00 18.91 ? 1042 ILE A CG2   1 
ATOM   443  C  CD1   . ILE A 1 65  ? 19.303  38.068  5.529  1.00 23.36 ? 1042 ILE A CD1   1 
ATOM   444  N  N     . GLU A 1 66  ? 18.394  33.535  8.731  1.00 22.52 ? 1043 GLU A N     1 
ATOM   445  C  CA    . GLU A 1 66  ? 18.811  32.198  9.149  1.00 22.43 ? 1043 GLU A CA    1 
ATOM   446  C  C     . GLU A 1 66  ? 17.577  31.345  9.397  1.00 21.62 ? 1043 GLU A C     1 
ATOM   447  O  O     . GLU A 1 66  ? 17.578  30.146  9.140  1.00 20.97 ? 1043 GLU A O     1 
ATOM   448  C  CB    . GLU A 1 66  ? 19.657  32.265  10.429 1.00 23.15 ? 1043 GLU A CB    1 
ATOM   449  C  CG    . GLU A 1 66  ? 20.863  33.191  10.328 1.00 29.32 ? 1043 GLU A CG    1 
ATOM   450  C  CD    . GLU A 1 66  ? 21.710  33.240  11.599 1.00 31.46 ? 1043 GLU A CD    1 
ATOM   451  O  OE1   . GLU A 1 66  ? 21.137  33.357  12.706 1.00 31.86 ? 1043 GLU A OE1   1 
ATOM   452  O  OE2   . GLU A 1 66  ? 22.956  33.182  11.485 1.00 30.07 ? 1043 GLU A OE2   1 
ATOM   453  N  N     . PHE A 1 67  ? 16.524  31.981  9.900  1.00 21.76 ? 1044 PHE A N     1 
ATOM   454  C  CA    . PHE A 1 67  ? 15.258  31.308  10.180 1.00 22.53 ? 1044 PHE A CA    1 
ATOM   455  C  C     . PHE A 1 67  ? 14.739  30.649  8.893  1.00 23.04 ? 1044 PHE A C     1 
ATOM   456  O  O     . PHE A 1 67  ? 14.396  29.469  8.883  1.00 23.02 ? 1044 PHE A O     1 
ATOM   457  C  CB    . PHE A 1 67  ? 14.251  32.337  10.717 1.00 21.14 ? 1044 PHE A CB    1 
ATOM   458  C  CG    . PHE A 1 67  ? 12.872  31.789  10.955 1.00 19.35 ? 1044 PHE A CG    1 
ATOM   459  C  CD1   . PHE A 1 67  ? 12.651  30.803  11.910 1.00 16.92 ? 1044 PHE A CD1   1 
ATOM   460  C  CD2   . PHE A 1 67  ? 11.782  32.289  10.245 1.00 18.86 ? 1044 PHE A CD2   1 
ATOM   461  C  CE1   . PHE A 1 67  ? 11.367  30.325  12.160 1.00 14.83 ? 1044 PHE A CE1   1 
ATOM   462  C  CE2   . PHE A 1 67  ? 10.491  31.816  10.489 1.00 17.46 ? 1044 PHE A CE2   1 
ATOM   463  C  CZ    . PHE A 1 67  ? 10.286  30.832  11.450 1.00 16.52 ? 1044 PHE A CZ    1 
ATOM   464  N  N     . LEU A 1 68  ? 14.693  31.421  7.811  1.00 23.54 ? 1045 LEU A N     1 
ATOM   465  C  CA    . LEU A 1 68  ? 14.234  30.914  6.524  1.00 25.61 ? 1045 LEU A CA    1 
ATOM   466  C  C     . LEU A 1 68  ? 15.192  29.890  5.938  1.00 24.73 ? 1045 LEU A C     1 
ATOM   467  O  O     . LEU A 1 68  ? 14.762  28.865  5.413  1.00 24.70 ? 1045 LEU A O     1 
ATOM   468  C  CB    . LEU A 1 68  ? 14.057  32.058  5.521  1.00 28.75 ? 1045 LEU A CB    1 
ATOM   469  C  CG    . LEU A 1 68  ? 12.745  32.847  5.570  1.00 33.07 ? 1045 LEU A CG    1 
ATOM   470  C  CD1   . LEU A 1 68  ? 11.593  31.918  5.225  1.00 35.16 ? 1045 LEU A CD1   1 
ATOM   471  C  CD2   . LEU A 1 68  ? 12.543  33.458  6.954  1.00 37.61 ? 1045 LEU A CD2   1 
ATOM   472  N  N     . ASN A 1 69  ? 16.488  30.165  6.021  1.00 24.09 ? 1046 ASN A N     1 
ATOM   473  C  CA    . ASN A 1 69  ? 17.471  29.235  5.487  1.00 25.61 ? 1046 ASN A CA    1 
ATOM   474  C  C     . ASN A 1 69  ? 17.295  27.849  6.099  1.00 25.74 ? 1046 ASN A C     1 
ATOM   475  O  O     . ASN A 1 69  ? 17.422  26.837  5.404  1.00 26.77 ? 1046 ASN A O     1 
ATOM   476  C  CB    . ASN A 1 69  ? 18.898  29.738  5.740  1.00 25.89 ? 1046 ASN A CB    1 
ATOM   477  C  CG    . ASN A 1 69  ? 19.239  30.975  4.919  1.00 27.91 ? 1046 ASN A CG    1 
ATOM   478  O  OD1   . ASN A 1 69  ? 18.654  31.214  3.858  1.00 28.37 ? 1046 ASN A OD1   1 
ATOM   479  N  ND2   . ASN A 1 69  ? 20.199  31.758  5.401  1.00 27.57 ? 1046 ASN A ND2   1 
ATOM   480  N  N     . GLU A 1 70  ? 17.004  27.802  7.398  1.00 25.07 ? 1047 GLU A N     1 
ATOM   481  C  CA    . GLU A 1 70  ? 16.801  26.528  8.074  1.00 23.99 ? 1047 GLU A CA    1 
ATOM   482  C  C     . GLU A 1 70  ? 15.642  25.769  7.446  1.00 22.99 ? 1047 GLU A C     1 
ATOM   483  O  O     . GLU A 1 70  ? 15.722  24.560  7.235  1.00 23.13 ? 1047 GLU A O     1 
ATOM   484  C  CB    . GLU A 1 70  ? 16.540  26.740  9.566  1.00 25.26 ? 1047 GLU A CB    1 
ATOM   485  C  CG    . GLU A 1 70  ? 17.793  26.611  10.415 1.00 29.46 ? 1047 GLU A CG    1 
ATOM   486  C  CD    . GLU A 1 70  ? 17.498  26.527  11.896 1.00 32.17 ? 1047 GLU A CD    1 
ATOM   487  O  OE1   . GLU A 1 70  ? 16.592  25.754  12.284 1.00 36.15 ? 1047 GLU A OE1   1 
ATOM   488  O  OE2   . GLU A 1 70  ? 18.181  27.221  12.675 1.00 31.56 ? 1047 GLU A OE2   1 
ATOM   489  N  N     . ALA A 1 71  ? 14.565  26.486  7.144  1.00 22.17 ? 1048 ALA A N     1 
ATOM   490  C  CA    . ALA A 1 71  ? 13.396  25.878  6.521  1.00 22.87 ? 1048 ALA A CA    1 
ATOM   491  C  C     . ALA A 1 71  ? 13.799  25.308  5.169  1.00 22.77 ? 1048 ALA A C     1 
ATOM   492  O  O     . ALA A 1 71  ? 13.351  24.233  4.776  1.00 22.70 ? 1048 ALA A O     1 
ATOM   493  C  CB    . ALA A 1 71  ? 12.300  26.916  6.338  1.00 21.43 ? 1048 ALA A CB    1 
ATOM   494  N  N     . SER A 1 72  ? 14.654  26.044  4.469  1.00 22.98 ? 1049 SER A N     1 
ATOM   495  C  CA    . SER A 1 72  ? 15.140  25.648  3.154  1.00 25.64 ? 1049 SER A CA    1 
ATOM   496  C  C     . SER A 1 72  ? 15.889  24.303  3.211  1.00 24.98 ? 1049 SER A C     1 
ATOM   497  O  O     . SER A 1 72  ? 15.811  23.500  2.284  1.00 25.65 ? 1049 SER A O     1 
ATOM   498  C  CB    . SER A 1 72  ? 16.049  26.754  2.605  1.00 27.41 ? 1049 SER A CB    1 
ATOM   499  O  OG    . SER A 1 72  ? 16.099  26.728  1.194  1.00 33.86 ? 1049 SER A OG    1 
ATOM   500  N  N     . VAL A 1 73  ? 16.612  24.059  4.299  1.00 24.91 ? 1050 VAL A N     1 
ATOM   501  C  CA    . VAL A 1 73  ? 17.337  22.797  4.466  1.00 25.25 ? 1050 VAL A CA    1 
ATOM   502  C  C     . VAL A 1 73  ? 16.335  21.642  4.570  1.00 24.92 ? 1050 VAL A C     1 
ATOM   503  O  O     . VAL A 1 73  ? 16.483  20.601  3.926  1.00 23.82 ? 1050 VAL A O     1 
ATOM   504  C  CB    . VAL A 1 73  ? 18.212  22.821  5.748  1.00 25.91 ? 1050 VAL A CB    1 
ATOM   505  C  CG1   . VAL A 1 73  ? 18.781  21.437  6.024  1.00 24.33 ? 1050 VAL A CG1   1 
ATOM   506  C  CG2   . VAL A 1 73  ? 19.337  23.837  5.588  1.00 23.99 ? 1050 VAL A CG2   1 
ATOM   507  N  N     . MET A 1 74  ? 15.312  21.844  5.389  1.00 24.16 ? 1051 MET A N     1 
ATOM   508  C  CA    . MET A 1 74  ? 14.263  20.851  5.593  1.00 24.27 ? 1051 MET A CA    1 
ATOM   509  C  C     . MET A 1 74  ? 13.517  20.491  4.300  1.00 22.98 ? 1051 MET A C     1 
ATOM   510  O  O     . MET A 1 74  ? 12.931  19.416  4.209  1.00 19.04 ? 1051 MET A O     1 
ATOM   511  C  CB    . MET A 1 74  ? 13.273  21.370  6.639  1.00 25.06 ? 1051 MET A CB    1 
ATOM   512  C  CG    . MET A 1 74  ? 13.911  21.687  7.986  1.00 26.28 ? 1051 MET A CG    1 
ATOM   513  S  SD    . MET A 1 74  ? 13.607  20.420  9.235  1.00 31.87 ? 1051 MET A SD    1 
ATOM   514  C  CE    . MET A 1 74  ? 15.023  19.437  9.145  1.00 28.83 ? 1051 MET A CE    1 
ATOM   515  N  N     . LYS A 1 75  ? 13.534  21.385  3.309  1.00 23.08 ? 1052 LYS A N     1 
ATOM   516  C  CA    . LYS A 1 75  ? 12.860  21.117  2.035  1.00 24.14 ? 1052 LYS A CA    1 
ATOM   517  C  C     . LYS A 1 75  ? 13.416  19.852  1.392  1.00 23.54 ? 1052 LYS A C     1 
ATOM   518  O  O     . LYS A 1 75  ? 12.764  19.233  0.550  1.00 23.28 ? 1052 LYS A O     1 
ATOM   519  C  CB    . LYS A 1 75  ? 13.055  22.269  1.046  1.00 24.75 ? 1052 LYS A CB    1 
ATOM   520  C  CG    . LYS A 1 75  ? 12.326  23.557  1.371  1.00 27.47 ? 1052 LYS A CG    1 
ATOM   521  C  CD    . LYS A 1 75  ? 12.733  24.641  0.380  1.00 29.05 ? 1052 LYS A CD    1 
ATOM   522  C  CE    . LYS A 1 75  ? 12.164  26.004  0.746  1.00 30.10 ? 1052 LYS A CE    1 
ATOM   523  N  NZ    . LYS A 1 75  ? 12.701  27.065  -0.159 1.00 33.66 ? 1052 LYS A NZ    1 
ATOM   524  N  N     . GLY A 1 76  ? 14.627  19.477  1.792  1.00 21.59 ? 1053 GLY A N     1 
ATOM   525  C  CA    . GLY A 1 76  ? 15.252  18.297  1.234  1.00 19.92 ? 1053 GLY A CA    1 
ATOM   526  C  C     . GLY A 1 76  ? 14.997  17.023  2.016  1.00 20.22 ? 1053 GLY A C     1 
ATOM   527  O  O     . GLY A 1 76  ? 15.584  15.982  1.710  1.00 20.89 ? 1053 GLY A O     1 
ATOM   528  N  N     . PHE A 1 77  ? 14.140  17.077  3.030  1.00 18.57 ? 1054 PHE A N     1 
ATOM   529  C  CA    . PHE A 1 77  ? 13.874  15.869  3.799  1.00 18.93 ? 1054 PHE A CA    1 
ATOM   530  C  C     . PHE A 1 77  ? 12.492  15.304  3.548  1.00 19.66 ? 1054 PHE A C     1 
ATOM   531  O  O     . PHE A 1 77  ? 11.498  16.027  3.506  1.00 19.14 ? 1054 PHE A O     1 
ATOM   532  C  CB    . PHE A 1 77  ? 14.050  16.108  5.298  1.00 17.43 ? 1054 PHE A CB    1 
ATOM   533  C  CG    . PHE A 1 77  ? 15.424  16.570  5.686  1.00 17.91 ? 1054 PHE A CG    1 
ATOM   534  C  CD1   . PHE A 1 77  ? 16.520  16.299  4.884  1.00 18.31 ? 1054 PHE A CD1   1 
ATOM   535  C  CD2   . PHE A 1 77  ? 15.618  17.286  6.857  1.00 16.56 ? 1054 PHE A CD2   1 
ATOM   536  C  CE1   . PHE A 1 77  ? 17.791  16.742  5.242  1.00 20.45 ? 1054 PHE A CE1   1 
ATOM   537  C  CE2   . PHE A 1 77  ? 16.878  17.729  7.221  1.00 19.14 ? 1054 PHE A CE2   1 
ATOM   538  C  CZ    . PHE A 1 77  ? 17.969  17.459  6.411  1.00 17.84 ? 1054 PHE A CZ    1 
ATOM   539  N  N     . THR A 1 78  ? 12.444  13.991  3.379  1.00 20.23 ? 1055 THR A N     1 
ATOM   540  C  CA    . THR A 1 78  ? 11.193  13.301  3.144  1.00 22.21 ? 1055 THR A CA    1 
ATOM   541  C  C     . THR A 1 78  ? 11.260  11.982  3.893  1.00 21.89 ? 1055 THR A C     1 
ATOM   542  O  O     . THR A 1 78  ? 11.229  10.908  3.290  1.00 24.62 ? 1055 THR A O     1 
ATOM   543  C  CB    . THR A 1 78  ? 10.976  13.014  1.647  1.00 22.71 ? 1055 THR A CB    1 
ATOM   544  O  OG1   . THR A 1 78  ? 12.020  12.152  1.176  1.00 24.34 ? 1055 THR A OG1   1 
ATOM   545  C  CG2   . THR A 1 78  ? 10.992  14.309  0.844  1.00 23.04 ? 1055 THR A CG2   1 
ATOM   546  N  N     . CYS A 1 79  ? 11.369  12.066  5.212  1.00 20.12 ? 1056 CYS A N     1 
ATOM   547  C  CA    . CYS A 1 79  ? 11.421  10.869  6.030  1.00 19.73 ? 1056 CYS A CA    1 
ATOM   548  C  C     . CYS A 1 79  ? 10.240  10.865  6.987  1.00 18.13 ? 1056 CYS A C     1 
ATOM   549  O  O     . CYS A 1 79  ? 9.918   11.873  7.609  1.00 17.50 ? 1056 CYS A O     1 
ATOM   550  C  CB    . CYS A 1 79  ? 12.738  10.791  6.817  1.00 20.27 ? 1056 CYS A CB    1 
ATOM   551  S  SG    . CYS A 1 79  ? 12.888  9.288   7.838  1.00 21.21 ? 1056 CYS A SG    1 
ATOM   552  N  N     . HIS A 1 80  ? 9.592   9.715   7.094  1.00 18.56 ? 1057 HIS A N     1 
ATOM   553  C  CA    . HIS A 1 80  ? 8.449   9.571   7.976  1.00 16.26 ? 1057 HIS A CA    1 
ATOM   554  C  C     . HIS A 1 80  ? 8.854   9.760   9.438  1.00 14.08 ? 1057 HIS A C     1 
ATOM   555  O  O     . HIS A 1 80  ? 8.024   10.113  10.272 1.00 15.84 ? 1057 HIS A O     1 
ATOM   556  C  CB    . HIS A 1 80  ? 7.831   8.183   7.799  1.00 15.83 ? 1057 HIS A CB    1 
ATOM   557  C  CG    . HIS A 1 80  ? 6.579   7.976   8.591  1.00 16.89 ? 1057 HIS A CG    1 
ATOM   558  N  ND1   . HIS A 1 80  ? 5.426   8.698   8.361  1.00 17.32 ? 1057 HIS A ND1   1 
ATOM   559  C  CD2   . HIS A 1 80  ? 6.300   7.139   9.618  1.00 16.22 ? 1057 HIS A CD2   1 
ATOM   560  C  CE1   . HIS A 1 80  ? 4.492   8.314   9.212  1.00 16.53 ? 1057 HIS A CE1   1 
ATOM   561  N  NE2   . HIS A 1 80  ? 4.996   7.369   9.985  1.00 17.06 ? 1057 HIS A NE2   1 
ATOM   562  N  N     . HIS A 1 81  ? 10.122  9.533   9.754  1.00 10.69 ? 1058 HIS A N     1 
ATOM   563  C  CA    . HIS A 1 81  ? 10.550  9.662   11.136 1.00 11.92 ? 1058 HIS A CA    1 
ATOM   564  C  C     . HIS A 1 81  ? 11.282  10.945  11.512 1.00 13.53 ? 1058 HIS A C     1 
ATOM   565  O  O     . HIS A 1 81  ? 12.000  11.007  12.509 1.00 12.80 ? 1058 HIS A O     1 
ATOM   566  C  CB    . HIS A 1 81  ? 11.330  8.415   11.531 1.00 10.23 ? 1058 HIS A CB    1 
ATOM   567  C  CG    . HIS A 1 81  ? 10.504  7.170   11.454 1.00 13.36 ? 1058 HIS A CG    1 
ATOM   568  N  ND1   . HIS A 1 81  ? 10.928  6.028   10.812 1.00 12.79 ? 1058 HIS A ND1   1 
ATOM   569  C  CD2   . HIS A 1 81  ? 9.242   6.917   11.878 1.00 11.16 ? 1058 HIS A CD2   1 
ATOM   570  C  CE1   . HIS A 1 81  ? 9.961   5.126   10.837 1.00 13.61 ? 1058 HIS A CE1   1 
ATOM   571  N  NE2   . HIS A 1 81  ? 8.928   5.641   11.479 1.00 12.95 ? 1058 HIS A NE2   1 
ATOM   572  N  N     . VAL A 1 82  ? 11.081  11.970  10.692 1.00 13.69 ? 1059 VAL A N     1 
ATOM   573  C  CA    . VAL A 1 82  ? 11.627  13.290  10.944 1.00 11.91 ? 1059 VAL A CA    1 
ATOM   574  C  C     . VAL A 1 82  ? 10.436  14.212  10.697 1.00 13.17 ? 1059 VAL A C     1 
ATOM   575  O  O     . VAL A 1 82  ? 9.702   14.015  9.731  1.00 14.76 ? 1059 VAL A O     1 
ATOM   576  C  CB    . VAL A 1 82  ? 12.761  13.652  9.975  1.00 12.31 ? 1059 VAL A CB    1 
ATOM   577  C  CG1   . VAL A 1 82  ? 13.240  15.072  10.268 1.00 10.11 ? 1059 VAL A CG1   1 
ATOM   578  C  CG2   . VAL A 1 82  ? 13.921  12.658  10.120 1.00 8.99  ? 1059 VAL A CG2   1 
ATOM   579  N  N     . VAL A 1 83  ? 10.235  15.200  11.567 1.00 13.16 ? 1060 VAL A N     1 
ATOM   580  C  CA    . VAL A 1 83  ? 9.121   16.135  11.423 1.00 12.51 ? 1060 VAL A CA    1 
ATOM   581  C  C     . VAL A 1 83  ? 9.263   16.901  10.103 1.00 13.72 ? 1060 VAL A C     1 
ATOM   582  O  O     . VAL A 1 83  ? 10.251  17.591  9.875  1.00 13.33 ? 1060 VAL A O     1 
ATOM   583  C  CB    . VAL A 1 83  ? 9.060   17.109  12.630 1.00 12.14 ? 1060 VAL A CB    1 
ATOM   584  C  CG1   . VAL A 1 83  ? 7.954   18.127  12.431 1.00 9.98  ? 1060 VAL A CG1   1 
ATOM   585  C  CG2   . VAL A 1 83  ? 8.805   16.316  13.912 1.00 7.19  ? 1060 VAL A CG2   1 
ATOM   586  N  N     . ARG A 1 84  ? 8.260   16.767  9.241  1.00 15.05 ? 1061 ARG A N     1 
ATOM   587  C  CA    . ARG A 1 84  ? 8.277   17.382  7.921  1.00 16.44 ? 1061 ARG A CA    1 
ATOM   588  C  C     . ARG A 1 84  ? 7.849   18.828  7.763  1.00 14.18 ? 1061 ARG A C     1 
ATOM   589  O  O     . ARG A 1 84  ? 6.988   19.330  8.473  1.00 13.72 ? 1061 ARG A O     1 
ATOM   590  C  CB    . ARG A 1 84  ? 7.446   16.531  6.955  1.00 20.03 ? 1061 ARG A CB    1 
ATOM   591  C  CG    . ARG A 1 84  ? 8.154   15.267  6.495  1.00 31.66 ? 1061 ARG A CG    1 
ATOM   592  C  CD    . ARG A 1 84  ? 7.193   14.285  5.836  1.00 37.82 ? 1061 ARG A CD    1 
ATOM   593  N  NE    . ARG A 1 84  ? 7.653   13.884  4.511  1.00 40.34 ? 1061 ARG A NE    1 
ATOM   594  C  CZ    . ARG A 1 84  ? 7.790   14.723  3.490  1.00 43.03 ? 1061 ARG A CZ    1 
ATOM   595  N  NH1   . ARG A 1 84  ? 7.502   16.010  3.643  1.00 45.05 ? 1061 ARG A NH1   1 
ATOM   596  N  NH2   . ARG A 1 84  ? 8.213   14.277  2.316  1.00 45.57 ? 1061 ARG A NH2   1 
ATOM   597  N  N     . LEU A 1 85  ? 8.480   19.485  6.801  1.00 14.70 ? 1062 LEU A N     1 
ATOM   598  C  CA    . LEU A 1 85  ? 8.167   20.859  6.446  1.00 14.34 ? 1062 LEU A CA    1 
ATOM   599  C  C     . LEU A 1 85  ? 6.991   20.735  5.477  1.00 14.62 ? 1062 LEU A C     1 
ATOM   600  O  O     . LEU A 1 85  ? 7.020   19.905  4.568  1.00 13.85 ? 1062 LEU A O     1 
ATOM   601  C  CB    . LEU A 1 85  ? 9.361   21.497  5.736  1.00 11.53 ? 1062 LEU A CB    1 
ATOM   602  C  CG    . LEU A 1 85  ? 9.086   22.765  4.917  1.00 13.66 ? 1062 LEU A CG    1 
ATOM   603  C  CD1   . LEU A 1 85  ? 8.711   23.930  5.837  1.00 14.30 ? 1062 LEU A CD1   1 
ATOM   604  C  CD2   . LEU A 1 85  ? 10.319  23.112  4.101  1.00 13.25 ? 1062 LEU A CD2   1 
ATOM   605  N  N     . LEU A 1 86  ? 5.958   21.546  5.669  1.00 15.73 ? 1063 LEU A N     1 
ATOM   606  C  CA    . LEU A 1 86  ? 4.798   21.497  4.787  1.00 15.54 ? 1063 LEU A CA    1 
ATOM   607  C  C     . LEU A 1 86  ? 4.770   22.695  3.854  1.00 17.64 ? 1063 LEU A C     1 
ATOM   608  O  O     . LEU A 1 86  ? 4.267   22.609  2.738  1.00 19.43 ? 1063 LEU A O     1 
ATOM   609  C  CB    . LEU A 1 86  ? 3.511   21.452  5.604  1.00 14.52 ? 1063 LEU A CB    1 
ATOM   610  C  CG    . LEU A 1 86  ? 3.333   20.166  6.408  1.00 14.35 ? 1063 LEU A CG    1 
ATOM   611  C  CD1   . LEU A 1 86  ? 2.017   20.213  7.165  1.00 12.96 ? 1063 LEU A CD1   1 
ATOM   612  C  CD2   . LEU A 1 86  ? 3.360   18.970  5.460  1.00 11.42 ? 1063 LEU A CD2   1 
ATOM   613  N  N     . GLY A 1 87  ? 5.317   23.815  4.315  1.00 18.47 ? 1064 GLY A N     1 
ATOM   614  C  CA    . GLY A 1 87  ? 5.339   25.011  3.500  1.00 17.43 ? 1064 GLY A CA    1 
ATOM   615  C  C     . GLY A 1 87  ? 5.903   26.203  4.239  1.00 17.56 ? 1064 GLY A C     1 
ATOM   616  O  O     . GLY A 1 87  ? 6.180   26.128  5.433  1.00 18.32 ? 1064 GLY A O     1 
ATOM   617  N  N     . VAL A 1 88  ? 6.075   27.311  3.526  1.00 19.21 ? 1065 VAL A N     1 
ATOM   618  C  CA    . VAL A 1 88  ? 6.623   28.524  4.124  1.00 20.91 ? 1065 VAL A CA    1 
ATOM   619  C  C     . VAL A 1 88  ? 6.011   29.797  3.538  1.00 21.32 ? 1065 VAL A C     1 
ATOM   620  O  O     . VAL A 1 88  ? 5.540   29.814  2.402  1.00 20.98 ? 1065 VAL A O     1 
ATOM   621  C  CB    . VAL A 1 88  ? 8.169   28.574  3.953  1.00 19.36 ? 1065 VAL A CB    1 
ATOM   622  C  CG1   . VAL A 1 88  ? 8.541   28.495  2.483  1.00 22.38 ? 1065 VAL A CG1   1 
ATOM   623  C  CG2   . VAL A 1 88  ? 8.721   29.846  4.554  1.00 23.92 ? 1065 VAL A CG2   1 
ATOM   624  N  N     . VAL A 1 89  ? 6.017   30.858  4.336  1.00 24.22 ? 1066 VAL A N     1 
ATOM   625  C  CA    . VAL A 1 89  ? 5.508   32.158  3.921  1.00 23.98 ? 1066 VAL A CA    1 
ATOM   626  C  C     . VAL A 1 89  ? 6.675   33.124  4.089  1.00 24.79 ? 1066 VAL A C     1 
ATOM   627  O  O     . VAL A 1 89  ? 6.971   33.564  5.201  1.00 23.99 ? 1066 VAL A O     1 
ATOM   628  C  CB    . VAL A 1 89  ? 4.345   32.615  4.815  1.00 24.01 ? 1066 VAL A CB    1 
ATOM   629  C  CG1   . VAL A 1 89  ? 3.812   33.960  4.336  1.00 24.69 ? 1066 VAL A CG1   1 
ATOM   630  C  CG2   . VAL A 1 89  ? 3.250   31.569  4.807  1.00 24.68 ? 1066 VAL A CG2   1 
ATOM   631  N  N     . SER A 1 90  ? 7.335   33.445  2.982  1.00 25.14 ? 1067 SER A N     1 
ATOM   632  C  CA    . SER A 1 90  ? 8.484   34.338  3.014  1.00 28.50 ? 1067 SER A CA    1 
ATOM   633  C  C     . SER A 1 90  ? 8.194   35.712  2.419  1.00 31.16 ? 1067 SER A C     1 
ATOM   634  O  O     . SER A 1 90  ? 9.037   36.611  2.468  1.00 33.60 ? 1067 SER A O     1 
ATOM   635  C  CB    . SER A 1 90  ? 9.649   33.685  2.276  1.00 26.18 ? 1067 SER A CB    1 
ATOM   636  O  OG    . SER A 1 90  ? 9.203   33.170  1.037  1.00 29.14 ? 1067 SER A OG    1 
ATOM   637  N  N     . LYS A 1 91  ? 7.001   35.868  1.858  1.00 32.61 ? 1068 LYS A N     1 
ATOM   638  C  CA    . LYS A 1 91  ? 6.588   37.133  1.269  1.00 34.90 ? 1068 LYS A CA    1 
ATOM   639  C  C     . LYS A 1 91  ? 5.965   38.016  2.350  1.00 36.51 ? 1068 LYS A C     1 
ATOM   640  O  O     . LYS A 1 91  ? 4.918   37.691  2.908  1.00 38.07 ? 1068 LYS A O     1 
ATOM   641  C  CB    . LYS A 1 91  ? 5.572   36.890  0.148  1.00 34.13 ? 1068 LYS A CB    1 
ATOM   642  N  N     . GLY A 1 92  ? 6.615   39.132  2.646  1.00 37.37 ? 1069 GLY A N     1 
ATOM   643  C  CA    . GLY A 1 92  ? 6.091   40.028  3.657  1.00 37.49 ? 1069 GLY A CA    1 
ATOM   644  C  C     . GLY A 1 92  ? 6.359   39.546  5.067  1.00 38.64 ? 1069 GLY A C     1 
ATOM   645  O  O     . GLY A 1 92  ? 6.984   38.505  5.275  1.00 38.01 ? 1069 GLY A O     1 
ATOM   646  N  N     . GLN A 1 93  ? 5.881   40.311  6.040  1.00 39.00 ? 1070 GLN A N     1 
ATOM   647  C  CA    . GLN A 1 93  ? 6.061   39.976  7.443  1.00 39.40 ? 1070 GLN A CA    1 
ATOM   648  C  C     . GLN A 1 93  ? 4.700   39.707  8.068  1.00 38.46 ? 1070 GLN A C     1 
ATOM   649  O  O     . GLN A 1 93  ? 3.687   40.259  7.632  1.00 39.39 ? 1070 GLN A O     1 
ATOM   650  C  CB    . GLN A 1 93  ? 6.740   41.134  8.175  1.00 42.72 ? 1070 GLN A CB    1 
ATOM   651  C  CG    . GLN A 1 93  ? 8.108   41.518  7.615  1.00 46.25 ? 1070 GLN A CG    1 
ATOM   652  C  CD    . GLN A 1 93  ? 9.207   40.543  8.010  1.00 48.60 ? 1070 GLN A CD    1 
ATOM   653  O  OE1   . GLN A 1 93  ? 9.440   40.308  9.195  1.00 49.87 ? 1070 GLN A OE1   1 
ATOM   654  N  NE2   . GLN A 1 93  ? 9.894   39.980  7.018  1.00 47.79 ? 1070 GLN A NE2   1 
ATOM   655  N  N     . PRO A 1 94  ? 4.651   38.818  9.074  1.00 36.28 ? 1071 PRO A N     1 
ATOM   656  C  CA    . PRO A 1 94  ? 5.803   38.086  9.607  1.00 33.91 ? 1071 PRO A CA    1 
ATOM   657  C  C     . PRO A 1 94  ? 6.004   36.807  8.786  1.00 32.02 ? 1071 PRO A C     1 
ATOM   658  O  O     . PRO A 1 94  ? 5.058   36.304  8.182  1.00 32.35 ? 1071 PRO A O     1 
ATOM   659  C  CB    . PRO A 1 94  ? 5.369   37.789  11.032 1.00 34.41 ? 1071 PRO A CB    1 
ATOM   660  C  CG    . PRO A 1 94  ? 3.919   37.465  10.843 1.00 34.05 ? 1071 PRO A CG    1 
ATOM   661  C  CD    . PRO A 1 94  ? 3.448   38.552  9.886  1.00 34.90 ? 1071 PRO A CD    1 
ATOM   662  N  N     . THR A 1 95  ? 7.222   36.281  8.753  1.00 28.64 ? 1072 THR A N     1 
ATOM   663  C  CA    . THR A 1 95  ? 7.459   35.059  7.998  1.00 26.84 ? 1072 THR A CA    1 
ATOM   664  C  C     . THR A 1 95  ? 7.009   33.848  8.832  1.00 26.25 ? 1072 THR A C     1 
ATOM   665  O  O     . THR A 1 95  ? 7.093   33.858  10.060 1.00 25.39 ? 1072 THR A O     1 
ATOM   666  C  CB    . THR A 1 95  ? 8.945   34.928  7.593  1.00 26.17 ? 1072 THR A CB    1 
ATOM   667  O  OG1   . THR A 1 95  ? 9.766   34.892  8.760  1.00 28.60 ? 1072 THR A OG1   1 
ATOM   668  C  CG2   . THR A 1 95  ? 9.365   36.113  6.741  1.00 25.79 ? 1072 THR A CG2   1 
ATOM   669  N  N     . LEU A 1 96  ? 6.524   32.808  8.160  1.00 24.47 ? 1073 LEU A N     1 
ATOM   670  C  CA    . LEU A 1 96  ? 6.040   31.621  8.853  1.00 22.57 ? 1073 LEU A CA    1 
ATOM   671  C  C     . LEU A 1 96  ? 6.562   30.328  8.242  1.00 22.02 ? 1073 LEU A C     1 
ATOM   672  O  O     . LEU A 1 96  ? 6.739   30.220  7.027  1.00 22.55 ? 1073 LEU A O     1 
ATOM   673  C  CB    . LEU A 1 96  ? 4.510   31.595  8.831  1.00 21.35 ? 1073 LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 96  ? 3.791   32.884  9.239  1.00 23.61 ? 1073 LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 96  ? 2.321   32.782  8.863  1.00 21.67 ? 1073 LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 96  ? 3.964   33.139  10.731 1.00 20.63 ? 1073 LEU A CD2   1 
ATOM   677  N  N     . VAL A 1 97  ? 6.807   29.348  9.102  1.00 19.62 ? 1074 VAL A N     1 
ATOM   678  C  CA    . VAL A 1 97  ? 7.286   28.051  8.669  1.00 17.42 ? 1074 VAL A CA    1 
ATOM   679  C  C     . VAL A 1 97  ? 6.282   27.034  9.170  1.00 16.77 ? 1074 VAL A C     1 
ATOM   680  O  O     . VAL A 1 97  ? 6.133   26.832  10.372 1.00 14.54 ? 1074 VAL A O     1 
ATOM   681  C  CB    . VAL A 1 97  ? 8.667   27.756  9.248  1.00 18.58 ? 1074 VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 97  ? 9.118   26.367  8.835  1.00 19.59 ? 1074 VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 97  ? 9.657   28.811  8.754  1.00 19.70 ? 1074 VAL A CG2   1 
ATOM   684  N  N     . VAL A 1 98  ? 5.594   26.401  8.226  1.00 15.00 ? 1075 VAL A N     1 
ATOM   685  C  CA    . VAL A 1 98  ? 4.555   25.427  8.525  1.00 13.41 ? 1075 VAL A CA    1 
ATOM   686  C  C     . VAL A 1 98  ? 5.080   24.002  8.516  1.00 13.61 ? 1075 VAL A C     1 
ATOM   687  O  O     . VAL A 1 98  ? 5.543   23.498  7.491  1.00 13.17 ? 1075 VAL A O     1 
ATOM   688  C  CB    . VAL A 1 98  ? 3.398   25.562  7.500  1.00 14.07 ? 1075 VAL A CB    1 
ATOM   689  C  CG1   . VAL A 1 98  ? 2.209   24.687  7.900  1.00 11.87 ? 1075 VAL A CG1   1 
ATOM   690  C  CG2   . VAL A 1 98  ? 2.990   27.025  7.396  1.00 13.22 ? 1075 VAL A CG2   1 
ATOM   691  N  N     . MET A 1 99  ? 4.993   23.363  9.678  1.00 14.62 ? 1076 MET A N     1 
ATOM   692  C  CA    . MET A 1 99  ? 5.450   21.993  9.878  1.00 14.48 ? 1076 MET A CA    1 
ATOM   693  C  C     . MET A 1 99  ? 4.257   21.096  10.180 1.00 15.00 ? 1076 MET A C     1 
ATOM   694  O  O     . MET A 1 99  ? 3.193   21.587  10.566 1.00 16.62 ? 1076 MET A O     1 
ATOM   695  C  CB    . MET A 1 99  ? 6.393   21.937  11.076 1.00 13.39 ? 1076 MET A CB    1 
ATOM   696  C  CG    . MET A 1 99  ? 7.526   22.944  11.048 1.00 16.84 ? 1076 MET A CG    1 
ATOM   697  S  SD    . MET A 1 99  ? 8.745   22.594  9.770  1.00 15.87 ? 1076 MET A SD    1 
ATOM   698  C  CE    . MET A 1 99  ? 9.272   20.928  10.211 1.00 16.51 ? 1076 MET A CE    1 
ATOM   699  N  N     . GLU A 1 100 ? 4.424   19.787  10.013 1.00 13.44 ? 1077 GLU A N     1 
ATOM   700  C  CA    . GLU A 1 100 ? 3.336   18.873  10.331 1.00 13.08 ? 1077 GLU A CA    1 
ATOM   701  C  C     . GLU A 1 100 ? 3.146   18.940  11.851 1.00 11.90 ? 1077 GLU A C     1 
ATOM   702  O  O     . GLU A 1 100 ? 4.115   19.015  12.611 1.00 9.87  ? 1077 GLU A O     1 
ATOM   703  C  CB    . GLU A 1 100 ? 3.667   17.435  9.899  1.00 13.13 ? 1077 GLU A CB    1 
ATOM   704  C  CG    . GLU A 1 100 ? 4.826   16.785  10.634 1.00 13.74 ? 1077 GLU A CG    1 
ATOM   705  C  CD    . GLU A 1 100 ? 4.955   15.296  10.330 1.00 15.54 ? 1077 GLU A CD    1 
ATOM   706  O  OE1   . GLU A 1 100 ? 4.042   14.519  10.687 1.00 16.25 ? 1077 GLU A OE1   1 
ATOM   707  O  OE2   . GLU A 1 100 ? 5.973   14.897  9.734  1.00 14.40 ? 1077 GLU A OE2   1 
ATOM   708  N  N     . LEU A 1 101 ? 1.902   18.919  12.301 1.00 10.32 ? 1078 LEU A N     1 
ATOM   709  C  CA    . LEU A 1 101 ? 1.652   18.986  13.728 1.00 11.55 ? 1078 LEU A CA    1 
ATOM   710  C  C     . LEU A 1 101 ? 1.985   17.679  14.452 1.00 12.47 ? 1078 LEU A C     1 
ATOM   711  O  O     . LEU A 1 101 ? 1.651   16.588  13.985 1.00 12.76 ? 1078 LEU A O     1 
ATOM   712  C  CB    . LEU A 1 101 ? 0.185   19.347  13.998 1.00 8.46  ? 1078 LEU A CB    1 
ATOM   713  C  CG    . LEU A 1 101 ? -0.182  19.448  15.485 1.00 7.34  ? 1078 LEU A CG    1 
ATOM   714  C  CD1   . LEU A 1 101 ? 0.611   20.573  16.149 1.00 5.29  ? 1078 LEU A CD1   1 
ATOM   715  C  CD2   . LEU A 1 101 ? -1.677  19.698  15.624 1.00 7.66  ? 1078 LEU A CD2   1 
ATOM   716  N  N     . MET A 1 102 ? 2.650   17.793  15.593 1.00 12.35 ? 1079 MET A N     1 
ATOM   717  C  CA    . MET A 1 102 ? 2.962   16.621  16.401 1.00 14.78 ? 1079 MET A CA    1 
ATOM   718  C  C     . MET A 1 102 ? 2.063   16.839  17.618 1.00 16.27 ? 1079 MET A C     1 
ATOM   719  O  O     . MET A 1 102 ? 2.455   17.437  18.616 1.00 16.02 ? 1079 MET A O     1 
ATOM   720  C  CB    . MET A 1 102 ? 4.449   16.613  16.763 1.00 16.69 ? 1079 MET A CB    1 
ATOM   721  C  CG    . MET A 1 102 ? 5.366   16.433  15.550 1.00 15.77 ? 1079 MET A CG    1 
ATOM   722  S  SD    . MET A 1 102 ? 5.240   14.767  14.818 1.00 23.14 ? 1079 MET A SD    1 
ATOM   723  C  CE    . MET A 1 102 ? 4.046   15.032  13.588 1.00 23.92 ? 1079 MET A CE    1 
ATOM   724  N  N     . ALA A 1 103 ? 0.834   16.348  17.494 1.00 18.12 ? 1080 ALA A N     1 
ATOM   725  C  CA    . ALA A 1 103 ? -0.212  16.507  18.502 1.00 18.93 ? 1080 ALA A CA    1 
ATOM   726  C  C     . ALA A 1 103 ? 0.124   16.217  19.963 1.00 20.43 ? 1080 ALA A C     1 
ATOM   727  O  O     . ALA A 1 103 ? -0.551  16.724  20.851 1.00 19.81 ? 1080 ALA A O     1 
ATOM   728  C  CB    . ALA A 1 103 ? -1.433  15.700  18.086 1.00 20.29 ? 1080 ALA A CB    1 
ATOM   729  N  N     . HIS A 1 104 ? 1.147   15.414  20.232 1.00 21.07 ? 1081 HIS A N     1 
ATOM   730  C  CA    . HIS A 1 104 ? 1.480   15.131  21.624 1.00 21.15 ? 1081 HIS A CA    1 
ATOM   731  C  C     . HIS A 1 104 ? 2.746   15.820  22.121 1.00 20.16 ? 1081 HIS A C     1 
ATOM   732  O  O     . HIS A 1 104 ? 3.248   15.507  23.202 1.00 21.89 ? 1081 HIS A O     1 
ATOM   733  C  CB    . HIS A 1 104 ? 1.554   13.620  21.845 1.00 23.71 ? 1081 HIS A CB    1 
ATOM   734  C  CG    . HIS A 1 104 ? 0.219   12.946  21.767 1.00 27.17 ? 1081 HIS A CG    1 
ATOM   735  N  ND1   . HIS A 1 104 ? -0.794  13.203  22.666 1.00 26.07 ? 1081 HIS A ND1   1 
ATOM   736  C  CD2   . HIS A 1 104 ? -0.291  12.075  20.864 1.00 27.72 ? 1081 HIS A CD2   1 
ATOM   737  C  CE1   . HIS A 1 104 ? -1.871  12.522  22.318 1.00 27.98 ? 1081 HIS A CE1   1 
ATOM   738  N  NE2   . HIS A 1 104 ? -1.593  11.831  21.227 1.00 28.17 ? 1081 HIS A NE2   1 
ATOM   739  N  N     . GLY A 1 105 ? 3.256   16.756  21.324 1.00 18.43 ? 1082 GLY A N     1 
ATOM   740  C  CA    . GLY A 1 105 ? 4.439   17.516  21.703 1.00 17.50 ? 1082 GLY A CA    1 
ATOM   741  C  C     . GLY A 1 105 ? 5.775   16.794  21.774 1.00 17.94 ? 1082 GLY A C     1 
ATOM   742  O  O     . GLY A 1 105 ? 5.957   15.706  21.212 1.00 16.40 ? 1082 GLY A O     1 
ATOM   743  N  N     . ASP A 1 106 ? 6.723   17.416  22.468 1.00 16.50 ? 1083 ASP A N     1 
ATOM   744  C  CA    . ASP A 1 106 ? 8.044   16.839  22.608 1.00 16.83 ? 1083 ASP A CA    1 
ATOM   745  C  C     . ASP A 1 106 ? 7.955   15.559  23.433 1.00 16.12 ? 1083 ASP A C     1 
ATOM   746  O  O     . ASP A 1 106 ? 7.101   15.428  24.315 1.00 14.08 ? 1083 ASP A O     1 
ATOM   747  C  CB    . ASP A 1 106 ? 8.994   17.829  23.278 1.00 19.91 ? 1083 ASP A CB    1 
ATOM   748  C  CG    . ASP A 1 106 ? 8.673   18.039  24.738 1.00 23.88 ? 1083 ASP A CG    1 
ATOM   749  O  OD1   . ASP A 1 106 ? 7.822   18.903  25.043 1.00 24.83 ? 1083 ASP A OD1   1 
ATOM   750  O  OD2   . ASP A 1 106 ? 9.268   17.326  25.578 1.00 23.75 ? 1083 ASP A OD2   1 
ATOM   751  N  N     . LEU A 1 107 ? 8.847   14.621  23.137 1.00 15.13 ? 1084 LEU A N     1 
ATOM   752  C  CA    . LEU A 1 107 ? 8.876   13.330  23.809 1.00 14.18 ? 1084 LEU A CA    1 
ATOM   753  C  C     . LEU A 1 107 ? 9.036   13.421  25.320 1.00 15.56 ? 1084 LEU A C     1 
ATOM   754  O  O     . LEU A 1 107 ? 8.331   12.732  26.055 1.00 15.17 ? 1084 LEU A O     1 
ATOM   755  C  CB    . LEU A 1 107 ? 9.987   12.462  23.212 1.00 8.73  ? 1084 LEU A CB    1 
ATOM   756  C  CG    . LEU A 1 107 ? 10.194  11.065  23.791 1.00 8.30  ? 1084 LEU A CG    1 
ATOM   757  C  CD1   . LEU A 1 107 ? 8.895   10.278  23.744 1.00 3.24  ? 1084 LEU A CD1   1 
ATOM   758  C  CD2   . LEU A 1 107 ? 11.285  10.351  22.990 1.00 7.67  ? 1084 LEU A CD2   1 
ATOM   759  N  N     . LYS A 1 108 ? 9.957   14.263  25.783 1.00 16.67 ? 1085 LYS A N     1 
ATOM   760  C  CA    . LYS A 1 108 ? 10.183  14.426  27.220 1.00 20.50 ? 1085 LYS A CA    1 
ATOM   761  C  C     . LYS A 1 108 ? 8.876   14.737  27.955 1.00 21.72 ? 1085 LYS A C     1 
ATOM   762  O  O     . LYS A 1 108 ? 8.480   14.018  28.878 1.00 22.50 ? 1085 LYS A O     1 
ATOM   763  C  CB    . LYS A 1 108 ? 11.193  15.549  27.473 1.00 21.36 ? 1085 LYS A CB    1 
ATOM   764  C  CG    . LYS A 1 108 ? 11.350  15.946  28.941 1.00 25.13 ? 1085 LYS A CG    1 
ATOM   765  C  CD    . LYS A 1 108 ? 12.317  17.121  29.081 1.00 28.98 ? 1085 LYS A CD    1 
ATOM   766  C  CE    . LYS A 1 108 ? 12.241  17.779  30.457 1.00 31.72 ? 1085 LYS A CE    1 
ATOM   767  N  NZ    . LYS A 1 108 ? 12.655  16.875  31.558 1.00 31.88 ? 1085 LYS A NZ    1 
ATOM   768  N  N     . SER A 1 109 ? 8.210   15.809  27.539 1.00 21.18 ? 1086 SER A N     1 
ATOM   769  C  CA    . SER A 1 109 ? 6.949   16.206  28.145 1.00 22.94 ? 1086 SER A CA    1 
ATOM   770  C  C     . SER A 1 109 ? 5.937   15.062  28.093 1.00 24.70 ? 1086 SER A C     1 
ATOM   771  O  O     . SER A 1 109 ? 5.216   14.809  29.064 1.00 26.75 ? 1086 SER A O     1 
ATOM   772  C  CB    . SER A 1 109 ? 6.380   17.430  27.420 1.00 23.41 ? 1086 SER A CB    1 
ATOM   773  O  OG    . SER A 1 109 ? 7.245   18.544  27.547 1.00 25.20 ? 1086 SER A OG    1 
ATOM   774  N  N     . TYR A 1 110 ? 5.879   14.369  26.961 1.00 22.96 ? 1087 TYR A N     1 
ATOM   775  C  CA    . TYR A 1 110 ? 4.948   13.262  26.816 1.00 22.88 ? 1087 TYR A CA    1 
ATOM   776  C  C     . TYR A 1 110 ? 5.261   12.167  27.831 1.00 23.53 ? 1087 TYR A C     1 
ATOM   777  O  O     . TYR A 1 110 ? 4.362   11.621  28.469 1.00 23.74 ? 1087 TYR A O     1 
ATOM   778  C  CB    . TYR A 1 110 ? 5.019   12.692  25.403 1.00 21.71 ? 1087 TYR A CB    1 
ATOM   779  C  CG    . TYR A 1 110 ? 4.150   11.479  25.204 1.00 22.98 ? 1087 TYR A CG    1 
ATOM   780  C  CD1   . TYR A 1 110 ? 2.759   11.585  25.196 1.00 24.72 ? 1087 TYR A CD1   1 
ATOM   781  C  CD2   . TYR A 1 110 ? 4.717   10.213  25.053 1.00 24.15 ? 1087 TYR A CD2   1 
ATOM   782  C  CE1   . TYR A 1 110 ? 1.950   10.457  25.045 1.00 24.76 ? 1087 TYR A CE1   1 
ATOM   783  C  CE2   . TYR A 1 110 ? 3.925   9.082   24.901 1.00 25.43 ? 1087 TYR A CE2   1 
ATOM   784  C  CZ    . TYR A 1 110 ? 2.541   9.210   24.899 1.00 27.54 ? 1087 TYR A CZ    1 
ATOM   785  O  OH    . TYR A 1 110 ? 1.755   8.088   24.753 1.00 29.37 ? 1087 TYR A OH    1 
ATOM   786  N  N     . LEU A 1 111 ? 6.541   11.846  27.982 1.00 24.06 ? 1088 LEU A N     1 
ATOM   787  C  CA    . LEU A 1 111 ? 6.952   10.818  28.928 1.00 24.20 ? 1088 LEU A CA    1 
ATOM   788  C  C     . LEU A 1 111 ? 6.575   11.189  30.364 1.00 26.91 ? 1088 LEU A C     1 
ATOM   789  O  O     . LEU A 1 111 ? 6.087   10.345  31.119 1.00 26.87 ? 1088 LEU A O     1 
ATOM   790  C  CB    . LEU A 1 111 ? 8.461   10.575  28.817 1.00 21.33 ? 1088 LEU A CB    1 
ATOM   791  C  CG    . LEU A 1 111 ? 8.911   9.813   27.561 1.00 19.50 ? 1088 LEU A CG    1 
ATOM   792  C  CD1   . LEU A 1 111 ? 10.413  9.920   27.376 1.00 19.25 ? 1088 LEU A CD1   1 
ATOM   793  C  CD2   . LEU A 1 111 ? 8.492   8.351   27.681 1.00 20.34 ? 1088 LEU A CD2   1 
ATOM   794  N  N     . ARG A 1 112 ? 6.787   12.443  30.749 1.00 28.33 ? 1089 ARG A N     1 
ATOM   795  C  CA    . ARG A 1 112 ? 6.451   12.843  32.111 1.00 31.85 ? 1089 ARG A CA    1 
ATOM   796  C  C     . ARG A 1 112 ? 4.960   12.882  32.415 1.00 31.67 ? 1089 ARG A C     1 
ATOM   797  O  O     . ARG A 1 112 ? 4.559   12.878  33.583 1.00 32.55 ? 1089 ARG A O     1 
ATOM   798  C  CB    . ARG A 1 112 ? 7.086   14.188  32.451 1.00 33.14 ? 1089 ARG A CB    1 
ATOM   799  C  CG    . ARG A 1 112 ? 8.465   14.029  33.050 1.00 38.97 ? 1089 ARG A CG    1 
ATOM   800  C  CD    . ARG A 1 112 ? 9.502   14.757  32.239 1.00 43.68 ? 1089 ARG A CD    1 
ATOM   801  N  NE    . ARG A 1 112 ? 9.891   16.017  32.855 1.00 49.57 ? 1089 ARG A NE    1 
ATOM   802  C  CZ    . ARG A 1 112 ? 10.482  16.112  34.040 1.00 53.07 ? 1089 ARG A CZ    1 
ATOM   803  N  NH1   . ARG A 1 112 ? 10.750  15.014  34.740 1.00 54.99 ? 1089 ARG A NH1   1 
ATOM   804  N  NH2   . ARG A 1 112 ? 10.814  17.304  34.522 1.00 54.12 ? 1089 ARG A NH2   1 
ATOM   805  N  N     . SER A 1 113 ? 4.133   12.914  31.378 1.00 29.39 ? 1090 SER A N     1 
ATOM   806  C  CA    . SER A 1 113 ? 2.697   12.945  31.603 1.00 29.03 ? 1090 SER A CA    1 
ATOM   807  C  C     . SER A 1 113 ? 2.187   11.542  31.903 1.00 29.38 ? 1090 SER A C     1 
ATOM   808  O  O     . SER A 1 113 ? 1.062   11.364  32.363 1.00 29.81 ? 1090 SER A O     1 
ATOM   809  C  CB    . SER A 1 113 ? 1.972   13.506  30.384 1.00 27.31 ? 1090 SER A CB    1 
ATOM   810  O  OG    . SER A 1 113 ? 1.992   12.581  29.319 1.00 31.62 ? 1090 SER A OG    1 
ATOM   811  N  N     . LEU A 1 114 ? 3.019   10.542  31.641 1.00 29.65 ? 1091 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 114 ? 2.633   9.163   31.892 1.00 31.15 ? 1091 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 114 ? 3.108   8.671   33.251 1.00 33.64 ? 1091 LEU A C     1 
ATOM   814  O  O     . LEU A 1 114 ? 3.035   7.482   33.546 1.00 32.83 ? 1091 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 114 ? 3.187   8.262   30.797 1.00 30.68 ? 1091 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 114 ? 2.518   8.406   29.435 1.00 29.72 ? 1091 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 114 ? 3.338   7.674   28.387 1.00 27.88 ? 1091 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 114 ? 1.095   7.854   29.509 1.00 29.06 ? 1091 LEU A CD2   1 
ATOM   819  N  N     . ARG A 1 115 ? 3.594   9.591   34.077 1.00 37.51 ? 1092 ARG A N     1 
ATOM   820  C  CA    . ARG A 1 115 ? 4.067   9.239   35.408 1.00 42.28 ? 1092 ARG A CA    1 
ATOM   821  C  C     . ARG A 1 115 ? 2.865   9.184   36.346 1.00 46.04 ? 1092 ARG A C     1 
ATOM   822  O  O     . ARG A 1 115 ? 2.018   10.075  36.339 1.00 46.38 ? 1092 ARG A O     1 
ATOM   823  C  CB    . ARG A 1 115 ? 5.064   10.280  35.913 1.00 42.64 ? 1092 ARG A CB    1 
ATOM   824  C  CG    . ARG A 1 115 ? 6.013   10.766  34.848 1.00 44.59 ? 1092 ARG A CG    1 
ATOM   825  C  CD    . ARG A 1 115 ? 7.124   11.597  35.436 1.00 46.43 ? 1092 ARG A CD    1 
ATOM   826  N  NE    . ARG A 1 115 ? 8.015   10.773  36.240 1.00 48.27 ? 1092 ARG A NE    1 
ATOM   827  C  CZ    . ARG A 1 115 ? 9.252   11.124  36.567 1.00 50.23 ? 1092 ARG A CZ    1 
ATOM   828  N  NH1   . ARG A 1 115 ? 9.738   12.290  36.158 1.00 49.68 ? 1092 ARG A NH1   1 
ATOM   829  N  NH2   . ARG A 1 115 ? 10.005  10.304  37.290 1.00 51.04 ? 1092 ARG A NH2   1 
ATOM   830  N  N     . PRO A 1 116 ? 2.777   8.131   37.168 1.00 49.22 ? 1093 PRO A N     1 
ATOM   831  C  CA    . PRO A 1 116 ? 1.672   7.957   38.115 1.00 51.63 ? 1093 PRO A CA    1 
ATOM   832  C  C     . PRO A 1 116 ? 1.230   9.234   38.838 1.00 53.26 ? 1093 PRO A C     1 
ATOM   833  O  O     . PRO A 1 116 ? 0.033   9.498   38.966 1.00 53.36 ? 1093 PRO A O     1 
ATOM   834  C  CB    . PRO A 1 116 ? 2.219   6.903   39.070 1.00 51.96 ? 1093 PRO A CB    1 
ATOM   835  C  CG    . PRO A 1 116 ? 3.015   6.027   38.144 1.00 50.05 ? 1093 PRO A CG    1 
ATOM   836  C  CD    . PRO A 1 116 ? 3.764   7.045   37.309 1.00 49.62 ? 1093 PRO A CD    1 
ATOM   837  N  N     . GLU A 1 117 ? 2.192   10.024  39.304 1.00 54.27 ? 1094 GLU A N     1 
ATOM   838  C  CA    . GLU A 1 117 ? 1.874   11.254  40.019 1.00 55.27 ? 1094 GLU A CA    1 
ATOM   839  C  C     . GLU A 1 117 ? 1.665   12.442  39.090 1.00 56.00 ? 1094 GLU A C     1 
ATOM   840  O  O     . GLU A 1 117 ? 1.591   13.583  39.546 1.00 56.13 ? 1094 GLU A O     1 
ATOM   841  C  CB    . GLU A 1 117 ? 2.985   11.583  41.020 1.00 55.23 ? 1094 GLU A CB    1 
ATOM   842  N  N     . ALA A 1 118 ? 1.569   12.180  37.791 1.00 56.38 ? 1095 ALA A N     1 
ATOM   843  C  CA    . ALA A 1 118 ? 1.375   13.259  36.828 1.00 57.35 ? 1095 ALA A CA    1 
ATOM   844  C  C     . ALA A 1 118 ? -0.020  13.865  36.942 1.00 57.61 ? 1095 ALA A C     1 
ATOM   845  O  O     . ALA A 1 118 ? -1.029  13.170  36.791 1.00 57.33 ? 1095 ALA A O     1 
ATOM   846  C  CB    . ALA A 1 118 ? 1.610   12.753  35.408 1.00 56.65 ? 1095 ALA A CB    1 
ATOM   847  N  N     . GLU A 1 119 ? -0.066  15.167  37.211 1.00 57.44 ? 1096 GLU A N     1 
ATOM   848  C  CA    . GLU A 1 119 ? -1.328  15.881  37.343 1.00 57.45 ? 1096 GLU A CA    1 
ATOM   849  C  C     . GLU A 1 119 ? -2.057  15.942  35.999 1.00 58.20 ? 1096 GLU A C     1 
ATOM   850  O  O     . GLU A 1 119 ? -3.144  16.511  35.894 1.00 58.98 ? 1096 GLU A O     1 
ATOM   851  C  CB    . GLU A 1 119 ? -1.074  17.297  37.867 1.00 55.87 ? 1096 GLU A CB    1 
ATOM   852  N  N     . ASN A 1 120 ? -1.454  15.354  34.971 1.00 57.88 ? 1097 ASN A N     1 
ATOM   853  C  CA    . ASN A 1 120 ? -2.054  15.341  33.641 1.00 56.73 ? 1097 ASN A CA    1 
ATOM   854  C  C     . ASN A 1 120 ? -1.961  13.960  32.996 1.00 55.26 ? 1097 ASN A C     1 
ATOM   855  O  O     . ASN A 1 120 ? -1.840  13.843  31.775 1.00 54.26 ? 1097 ASN A O     1 
ATOM   856  C  CB    . ASN A 1 120 ? -1.378  16.380  32.740 1.00 57.88 ? 1097 ASN A CB    1 
ATOM   857  C  CG    . ASN A 1 120 ? 0.125   16.165  32.615 1.00 59.78 ? 1097 ASN A CG    1 
ATOM   858  O  OD1   . ASN A 1 120 ? 0.786   16.806  31.796 1.00 59.60 ? 1097 ASN A OD1   1 
ATOM   859  N  ND2   . ASN A 1 120 ? 0.672   15.268  33.431 1.00 59.54 ? 1097 ASN A ND2   1 
ATOM   860  N  N     . ASN A 1 121 ? -2.020  12.919  33.821 1.00 53.09 ? 1098 ASN A N     1 
ATOM   861  C  CA    . ASN A 1 121 ? -1.949  11.549  33.327 1.00 52.43 ? 1098 ASN A CA    1 
ATOM   862  C  C     . ASN A 1 121 ? -3.077  11.335  32.311 1.00 52.38 ? 1098 ASN A C     1 
ATOM   863  O  O     . ASN A 1 121 ? -4.255  11.469  32.642 1.00 51.94 ? 1098 ASN A O     1 
ATOM   864  C  CB    . ASN A 1 121 ? -2.101  10.566  34.492 1.00 52.86 ? 1098 ASN A CB    1 
ATOM   865  C  CG    . ASN A 1 121 ? -1.670  9.157   34.132 1.00 52.50 ? 1098 ASN A CG    1 
ATOM   866  O  OD1   . ASN A 1 121 ? -0.479  8.838   34.136 1.00 52.22 ? 1098 ASN A OD1   1 
ATOM   867  N  ND2   . ASN A 1 121 ? -2.638  8.307   33.808 1.00 52.14 ? 1098 ASN A ND2   1 
ATOM   868  N  N     . PRO A 1 122 ? -2.728  10.999  31.059 1.00 52.60 ? 1099 PRO A N     1 
ATOM   869  C  CA    . PRO A 1 122 ? -3.729  10.775  30.011 1.00 53.09 ? 1099 PRO A CA    1 
ATOM   870  C  C     . PRO A 1 122 ? -4.668  9.604   30.293 1.00 54.34 ? 1099 PRO A C     1 
ATOM   871  O  O     . PRO A 1 122 ? -5.621  9.374   29.547 1.00 54.89 ? 1099 PRO A O     1 
ATOM   872  C  CB    . PRO A 1 122 ? -2.876  10.553  28.768 1.00 52.67 ? 1099 PRO A CB    1 
ATOM   873  C  CG    . PRO A 1 122 ? -1.674  9.875   29.324 1.00 52.57 ? 1099 PRO A CG    1 
ATOM   874  C  CD    . PRO A 1 122 ? -1.377  10.703  30.553 1.00 52.50 ? 1099 PRO A CD    1 
ATOM   875  N  N     . GLY A 1 123 ? -4.396  8.865   31.366 1.00 54.62 ? 1100 GLY A N     1 
ATOM   876  C  CA    . GLY A 1 123 ? -5.247  7.742   31.720 1.00 54.08 ? 1100 GLY A CA    1 
ATOM   877  C  C     . GLY A 1 123 ? -4.781  6.377   31.242 1.00 54.01 ? 1100 GLY A C     1 
ATOM   878  O  O     . GLY A 1 123 ? -5.509  5.393   31.377 1.00 53.90 ? 1100 GLY A O     1 
ATOM   879  N  N     . ARG A 1 124 ? -3.582  6.311   30.672 1.00 53.97 ? 1101 ARG A N     1 
ATOM   880  C  CA    . ARG A 1 124 ? -3.035  5.043   30.199 1.00 52.95 ? 1101 ARG A CA    1 
ATOM   881  C  C     . ARG A 1 124 ? -1.800  4.721   31.020 1.00 50.51 ? 1101 ARG A C     1 
ATOM   882  O  O     . ARG A 1 124 ? -1.221  5.602   31.656 1.00 49.94 ? 1101 ARG A O     1 
ATOM   883  C  CB    . ARG A 1 124 ? -2.642  5.117   28.719 1.00 55.97 ? 1101 ARG A CB    1 
ATOM   884  C  CG    . ARG A 1 124 ? -3.796  5.352   27.753 1.00 60.97 ? 1101 ARG A CG    1 
ATOM   885  C  CD    . ARG A 1 124 ? -4.160  6.828   27.650 1.00 64.59 ? 1101 ARG A CD    1 
ATOM   886  N  NE    . ARG A 1 124 ? -3.029  7.647   27.206 1.00 67.20 ? 1101 ARG A NE    1 
ATOM   887  C  CZ    . ARG A 1 124 ? -2.452  7.557   26.009 1.00 66.68 ? 1101 ARG A CZ    1 
ATOM   888  N  NH1   . ARG A 1 124 ? -2.896  6.679   25.116 1.00 66.79 ? 1101 ARG A NH1   1 
ATOM   889  N  NH2   . ARG A 1 124 ? -1.426  8.344   25.708 1.00 65.79 ? 1101 ARG A NH2   1 
ATOM   890  N  N     . PRO A 1 125 ? -1.379  3.449   31.021 1.00 48.28 ? 1102 PRO A N     1 
ATOM   891  C  CA    . PRO A 1 125 ? -0.193  3.056   31.787 1.00 45.82 ? 1102 PRO A CA    1 
ATOM   892  C  C     . PRO A 1 125 ? 1.075   3.516   31.076 1.00 43.07 ? 1102 PRO A C     1 
ATOM   893  O  O     . PRO A 1 125 ? 1.031   3.914   29.912 1.00 42.26 ? 1102 PRO A O     1 
ATOM   894  C  CB    . PRO A 1 125 ? -0.312  1.537   31.836 1.00 45.64 ? 1102 PRO A CB    1 
ATOM   895  C  CG    . PRO A 1 125 ? -0.897  1.225   30.497 1.00 47.06 ? 1102 PRO A CG    1 
ATOM   896  C  CD    . PRO A 1 125 ? -1.981  2.283   30.349 1.00 47.68 ? 1102 PRO A CD    1 
ATOM   897  N  N     . PRO A 1 126 ? 2.221   3.483   31.773 1.00 40.78 ? 1103 PRO A N     1 
ATOM   898  C  CA    . PRO A 1 126 ? 3.458   3.912   31.119 1.00 38.16 ? 1103 PRO A CA    1 
ATOM   899  C  C     . PRO A 1 126 ? 3.665   3.088   29.845 1.00 36.58 ? 1103 PRO A C     1 
ATOM   900  O  O     . PRO A 1 126 ? 2.978   2.090   29.627 1.00 36.54 ? 1103 PRO A O     1 
ATOM   901  C  CB    . PRO A 1 126 ? 4.520   3.640   32.183 1.00 38.83 ? 1103 PRO A CB    1 
ATOM   902  C  CG    . PRO A 1 126 ? 3.941   2.483   32.960 1.00 38.93 ? 1103 PRO A CG    1 
ATOM   903  C  CD    . PRO A 1 126 ? 2.498   2.900   33.098 1.00 40.62 ? 1103 PRO A CD    1 
ATOM   904  N  N     . PRO A 1 127 ? 4.608   3.495   28.983 1.00 34.45 ? 1104 PRO A N     1 
ATOM   905  C  CA    . PRO A 1 127 ? 4.827   2.732   27.751 1.00 32.15 ? 1104 PRO A CA    1 
ATOM   906  C  C     . PRO A 1 127 ? 5.228   1.280   27.982 1.00 29.20 ? 1104 PRO A C     1 
ATOM   907  O  O     . PRO A 1 127 ? 5.969   0.971   28.913 1.00 29.13 ? 1104 PRO A O     1 
ATOM   908  C  CB    . PRO A 1 127 ? 5.914   3.538   27.035 1.00 33.11 ? 1104 PRO A CB    1 
ATOM   909  C  CG    . PRO A 1 127 ? 6.669   4.165   28.165 1.00 32.48 ? 1104 PRO A CG    1 
ATOM   910  C  CD    . PRO A 1 127 ? 5.556   4.619   29.076 1.00 33.64 ? 1104 PRO A CD    1 
ATOM   911  N  N     . THR A 1 128 ? 4.728   0.396   27.124 1.00 24.97 ? 1105 THR A N     1 
ATOM   912  C  CA    . THR A 1 128 ? 5.035   -1.026  27.214 1.00 21.92 ? 1105 THR A CA    1 
ATOM   913  C  C     . THR A 1 128 ? 6.403   -1.277  26.589 1.00 20.22 ? 1105 THR A C     1 
ATOM   914  O  O     . THR A 1 128 ? 6.950   -0.402  25.916 1.00 18.60 ? 1105 THR A O     1 
ATOM   915  C  CB    . THR A 1 128 ? 4.010   -1.869  26.431 1.00 20.57 ? 1105 THR A CB    1 
ATOM   916  O  OG1   . THR A 1 128 ? 4.290   -1.769  25.030 1.00 18.36 ? 1105 THR A OG1   1 
ATOM   917  C  CG2   . THR A 1 128 ? 2.600   -1.365  26.685 1.00 19.02 ? 1105 THR A CG2   1 
ATOM   918  N  N     . LEU A 1 129 ? 6.950   -2.470  26.810 1.00 18.65 ? 1106 LEU A N     1 
ATOM   919  C  CA    . LEU A 1 129 ? 8.240   -2.824  26.229 1.00 18.51 ? 1106 LEU A CA    1 
ATOM   920  C  C     . LEU A 1 129 ? 8.098   -2.723  24.713 1.00 18.39 ? 1106 LEU A C     1 
ATOM   921  O  O     . LEU A 1 129 ? 8.988   -2.245  24.011 1.00 18.49 ? 1106 LEU A O     1 
ATOM   922  C  CB    . LEU A 1 129 ? 8.642   -4.255  26.616 1.00 16.89 ? 1106 LEU A CB    1 
ATOM   923  C  CG    . LEU A 1 129 ? 9.918   -4.805  25.959 1.00 16.74 ? 1106 LEU A CG    1 
ATOM   924  C  CD1   . LEU A 1 129 ? 11.070  -3.834  26.203 1.00 15.79 ? 1106 LEU A CD1   1 
ATOM   925  C  CD2   . LEU A 1 129 ? 10.258  -6.187  26.512 1.00 13.96 ? 1106 LEU A CD2   1 
ATOM   926  N  N     . GLN A 1 130 ? 6.957   -3.179  24.219 1.00 17.89 ? 1107 GLN A N     1 
ATOM   927  C  CA    . GLN A 1 130 ? 6.663   -3.145  22.800 1.00 17.55 ? 1107 GLN A CA    1 
ATOM   928  C  C     . GLN A 1 130 ? 6.679   -1.703  22.280 1.00 17.94 ? 1107 GLN A C     1 
ATOM   929  O  O     . GLN A 1 130 ? 7.286   -1.417  21.252 1.00 17.21 ? 1107 GLN A O     1 
ATOM   930  C  CB    . GLN A 1 130 ? 5.296   -3.782  22.569 1.00 17.34 ? 1107 GLN A CB    1 
ATOM   931  C  CG    . GLN A 1 130 ? 4.790   -3.748  21.151 1.00 17.41 ? 1107 GLN A CG    1 
ATOM   932  C  CD    . GLN A 1 130 ? 3.449   -4.440  21.032 1.00 20.55 ? 1107 GLN A CD    1 
ATOM   933  O  OE1   . GLN A 1 130 ? 2.489   -4.075  21.713 1.00 21.04 ? 1107 GLN A OE1   1 
ATOM   934  N  NE2   . GLN A 1 130 ? 3.375   -5.450  20.173 1.00 20.56 ? 1107 GLN A NE2   1 
ATOM   935  N  N     . GLU A 1 131 ? 6.014   -0.798  22.992 1.00 17.42 ? 1108 GLU A N     1 
ATOM   936  C  CA    . GLU A 1 131 ? 5.967   0.600   22.571 1.00 18.90 ? 1108 GLU A CA    1 
ATOM   937  C  C     . GLU A 1 131 ? 7.329   1.282   22.664 1.00 18.28 ? 1108 GLU A C     1 
ATOM   938  O  O     . GLU A 1 131 ? 7.640   2.171   21.865 1.00 16.28 ? 1108 GLU A O     1 
ATOM   939  C  CB    . GLU A 1 131 ? 4.944   1.376   23.404 1.00 18.78 ? 1108 GLU A CB    1 
ATOM   940  C  CG    . GLU A 1 131 ? 3.533   0.829   23.302 1.00 21.26 ? 1108 GLU A CG    1 
ATOM   941  C  CD    . GLU A 1 131 ? 2.550   1.578   24.188 1.00 22.12 ? 1108 GLU A CD    1 
ATOM   942  O  OE1   . GLU A 1 131 ? 2.864   1.793   25.374 1.00 21.17 ? 1108 GLU A OE1   1 
ATOM   943  O  OE2   . GLU A 1 131 ? 1.460   1.942   23.701 1.00 24.86 ? 1108 GLU A OE2   1 
ATOM   944  N  N     . MET A 1 132 ? 8.137   0.866   23.637 1.00 18.96 ? 1109 MET A N     1 
ATOM   945  C  CA    . MET A 1 132 ? 9.466   1.435   23.814 1.00 20.67 ? 1109 MET A CA    1 
ATOM   946  C  C     . MET A 1 132 ? 10.385  1.036   22.661 1.00 20.22 ? 1109 MET A C     1 
ATOM   947  O  O     . MET A 1 132 ? 11.205  1.837   22.203 1.00 22.01 ? 1109 MET A O     1 
ATOM   948  C  CB    . MET A 1 132 ? 10.065  0.994   25.155 1.00 23.55 ? 1109 MET A CB    1 
ATOM   949  C  CG    . MET A 1 132 ? 9.358   1.600   26.366 1.00 28.29 ? 1109 MET A CG    1 
ATOM   950  S  SD    . MET A 1 132 ? 10.231  1.348   27.931 1.00 33.18 ? 1109 MET A SD    1 
ATOM   951  C  CE    . MET A 1 132 ? 9.272   0.057   28.681 1.00 33.30 ? 1109 MET A CE    1 
ATOM   952  N  N     . ILE A 1 133 ? 10.242  -0.200  22.190 1.00 18.24 ? 1110 ILE A N     1 
ATOM   953  C  CA    . ILE A 1 133 ? 11.042  -0.695  21.075 1.00 16.82 ? 1110 ILE A CA    1 
ATOM   954  C  C     . ILE A 1 133 ? 10.622  0.050   19.813 1.00 16.45 ? 1110 ILE A C     1 
ATOM   955  O  O     . ILE A 1 133 ? 11.462  0.438   18.987 1.00 17.58 ? 1110 ILE A O     1 
ATOM   956  C  CB    . ILE A 1 133 ? 10.827  -2.215  20.848 1.00 18.22 ? 1110 ILE A CB    1 
ATOM   957  C  CG1   . ILE A 1 133 ? 11.359  -3.008  22.043 1.00 19.27 ? 1110 ILE A CG1   1 
ATOM   958  C  CG2   . ILE A 1 133 ? 11.545  -2.665  19.585 1.00 16.35 ? 1110 ILE A CG2   1 
ATOM   959  C  CD1   . ILE A 1 133 ? 12.861  -2.896  22.243 1.00 21.56 ? 1110 ILE A CD1   1 
ATOM   960  N  N     . GLN A 1 134 ? 9.319   0.251   19.666 1.00 12.23 ? 1111 GLN A N     1 
ATOM   961  C  CA    . GLN A 1 134 ? 8.803   0.956   18.507 1.00 14.35 ? 1111 GLN A CA    1 
ATOM   962  C  C     . GLN A 1 134 ? 9.394   2.364   18.508 1.00 13.97 ? 1111 GLN A C     1 
ATOM   963  O  O     . GLN A 1 134 ? 9.845   2.850   17.476 1.00 15.39 ? 1111 GLN A O     1 
ATOM   964  C  CB    . GLN A 1 134 ? 7.275   1.005   18.552 1.00 11.70 ? 1111 GLN A CB    1 
ATOM   965  C  CG    . GLN A 1 134 ? 6.619   1.711   17.375 1.00 13.42 ? 1111 GLN A CG    1 
ATOM   966  C  CD    . GLN A 1 134 ? 6.802   0.980   16.058 1.00 12.62 ? 1111 GLN A CD    1 
ATOM   967  O  OE1   . GLN A 1 134 ? 6.654   -0.235  15.989 1.00 14.80 ? 1111 GLN A OE1   1 
ATOM   968  N  NE2   . GLN A 1 134 ? 7.106   1.725   14.999 1.00 13.59 ? 1111 GLN A NE2   1 
ATOM   969  N  N     . MET A 1 135 ? 9.396   3.016   19.668 1.00 15.14 ? 1112 MET A N     1 
ATOM   970  C  CA    . MET A 1 135 ? 9.956   4.365   19.775 1.00 14.61 ? 1112 MET A CA    1 
ATOM   971  C  C     . MET A 1 135 ? 11.439  4.364   19.413 1.00 13.07 ? 1112 MET A C     1 
ATOM   972  O  O     . MET A 1 135 ? 11.902  5.194   18.644 1.00 12.68 ? 1112 MET A O     1 
ATOM   973  C  CB    . MET A 1 135 ? 9.813   4.906   21.199 1.00 17.50 ? 1112 MET A CB    1 
ATOM   974  C  CG    . MET A 1 135 ? 8.425   5.349   21.593 1.00 20.95 ? 1112 MET A CG    1 
ATOM   975  S  SD    . MET A 1 135 ? 8.474   6.204   23.181 1.00 21.92 ? 1112 MET A SD    1 
ATOM   976  C  CE    . MET A 1 135 ? 8.326   4.853   24.294 1.00 22.07 ? 1112 MET A CE    1 
ATOM   977  N  N     . ALA A 1 136 ? 12.181  3.426   19.983 1.00 11.49 ? 1113 ALA A N     1 
ATOM   978  C  CA    . ALA A 1 136 ? 13.601  3.334   19.714 1.00 11.68 ? 1113 ALA A CA    1 
ATOM   979  C  C     . ALA A 1 136 ? 13.858  3.256   18.216 1.00 11.82 ? 1113 ALA A C     1 
ATOM   980  O  O     . ALA A 1 136 ? 14.632  4.042   17.674 1.00 12.33 ? 1113 ALA A O     1 
ATOM   981  C  CB    . ALA A 1 136 ? 14.177  2.120   20.409 1.00 12.42 ? 1113 ALA A CB    1 
ATOM   982  N  N     . ALA A 1 137 ? 13.200  2.306   17.555 1.00 12.68 ? 1114 ALA A N     1 
ATOM   983  C  CA    . ALA A 1 137 ? 13.337  2.107   16.113 1.00 11.39 ? 1114 ALA A CA    1 
ATOM   984  C  C     . ALA A 1 137 ? 13.004  3.351   15.288 1.00 12.10 ? 1114 ALA A C     1 
ATOM   985  O  O     . ALA A 1 137 ? 13.731  3.696   14.355 1.00 12.81 ? 1114 ALA A O     1 
ATOM   986  C  CB    . ALA A 1 137 ? 12.455  0.947   15.661 1.00 10.30 ? 1114 ALA A CB    1 
ATOM   987  N  N     . GLU A 1 138 ? 11.907  4.021   15.625 1.00 10.88 ? 1115 GLU A N     1 
ATOM   988  C  CA    . GLU A 1 138 ? 11.516  5.216   14.895 1.00 12.13 ? 1115 GLU A CA    1 
ATOM   989  C  C     . GLU A 1 138 ? 12.557  6.318   15.059 1.00 12.45 ? 1115 GLU A C     1 
ATOM   990  O  O     . GLU A 1 138 ? 12.925  6.987   14.092 1.00 13.24 ? 1115 GLU A O     1 
ATOM   991  C  CB    . GLU A 1 138 ? 10.139  5.681   15.369 1.00 9.83  ? 1115 GLU A CB    1 
ATOM   992  C  CG    . GLU A 1 138 ? 9.103   4.581   15.243 1.00 12.94 ? 1115 GLU A CG    1 
ATOM   993  C  CD    . GLU A 1 138 ? 7.708   5.007   15.643 1.00 14.49 ? 1115 GLU A CD    1 
ATOM   994  O  OE1   . GLU A 1 138 ? 7.573   5.754   16.632 1.00 17.45 ? 1115 GLU A OE1   1 
ATOM   995  O  OE2   . GLU A 1 138 ? 6.745   4.577   14.977 1.00 12.39 ? 1115 GLU A OE2   1 
ATOM   996  N  N     . ILE A 1 139 ? 13.033  6.498   16.285 1.00 13.09 ? 1116 ILE A N     1 
ATOM   997  C  CA    . ILE A 1 139 ? 14.039  7.509   16.576 1.00 10.65 ? 1116 ILE A CA    1 
ATOM   998  C  C     . ILE A 1 139 ? 15.331  7.159   15.847 1.00 12.29 ? 1116 ILE A C     1 
ATOM   999  O  O     . ILE A 1 139 ? 15.983  8.031   15.267 1.00 12.32 ? 1116 ILE A O     1 
ATOM   1000 C  CB    . ILE A 1 139 ? 14.312  7.592   18.097 1.00 8.91  ? 1116 ILE A CB    1 
ATOM   1001 C  CG1   . ILE A 1 139 ? 13.032  8.010   18.830 1.00 9.20  ? 1116 ILE A CG1   1 
ATOM   1002 C  CG2   . ILE A 1 139 ? 15.422  8.588   18.382 1.00 6.10  ? 1116 ILE A CG2   1 
ATOM   1003 C  CD1   . ILE A 1 139 ? 13.139  7.972   20.347 1.00 8.23  ? 1116 ILE A CD1   1 
ATOM   1004 N  N     . ALA A 1 140 ? 15.695  5.879   15.871 1.00 11.27 ? 1117 ALA A N     1 
ATOM   1005 C  CA    . ALA A 1 140 ? 16.920  5.430   15.207 1.00 13.25 ? 1117 ALA A CA    1 
ATOM   1006 C  C     . ALA A 1 140 ? 16.817  5.579   13.696 1.00 13.84 ? 1117 ALA A C     1 
ATOM   1007 O  O     . ALA A 1 140 ? 17.797  5.923   13.021 1.00 13.38 ? 1117 ALA A O     1 
ATOM   1008 C  CB    . ALA A 1 140 ? 17.215  3.971   15.565 1.00 12.07 ? 1117 ALA A CB    1 
ATOM   1009 N  N     . ASP A 1 141 ? 15.623  5.313   13.175 1.00 14.65 ? 1118 ASP A N     1 
ATOM   1010 C  CA    . ASP A 1 141 ? 15.371  5.410   11.745 1.00 14.84 ? 1118 ASP A CA    1 
ATOM   1011 C  C     . ASP A 1 141 ? 15.537  6.854   11.277 1.00 13.88 ? 1118 ASP A C     1 
ATOM   1012 O  O     . ASP A 1 141 ? 16.175  7.108   10.261 1.00 13.59 ? 1118 ASP A O     1 
ATOM   1013 C  CB    . ASP A 1 141 ? 13.960  4.911   11.419 1.00 14.69 ? 1118 ASP A CB    1 
ATOM   1014 C  CG    . ASP A 1 141 ? 13.738  4.727   9.928  1.00 15.54 ? 1118 ASP A CG    1 
ATOM   1015 O  OD1   . ASP A 1 141 ? 12.830  5.381   9.369  1.00 14.66 ? 1118 ASP A OD1   1 
ATOM   1016 O  OD2   . ASP A 1 141 ? 14.476  3.923   9.316  1.00 13.70 ? 1118 ASP A OD2   1 
ATOM   1017 N  N     . GLY A 1 142 ? 14.961  7.793   12.021 1.00 13.31 ? 1119 GLY A N     1 
ATOM   1018 C  CA    . GLY A 1 142 ? 15.083  9.190   11.662 1.00 12.21 ? 1119 GLY A CA    1 
ATOM   1019 C  C     . GLY A 1 142 ? 16.538  9.619   11.722 1.00 13.01 ? 1119 GLY A C     1 
ATOM   1020 O  O     . GLY A 1 142 ? 17.021  10.329  10.843 1.00 13.47 ? 1119 GLY A O     1 
ATOM   1021 N  N     . MET A 1 143 ? 17.252  9.192   12.758 1.00 13.00 ? 1120 MET A N     1 
ATOM   1022 C  CA    . MET A 1 143 ? 18.659  9.555   12.874 1.00 11.33 ? 1120 MET A CA    1 
ATOM   1023 C  C     . MET A 1 143 ? 19.473  8.993   11.705 1.00 11.76 ? 1120 MET A C     1 
ATOM   1024 O  O     . MET A 1 143 ? 20.332  9.683   11.161 1.00 13.17 ? 1120 MET A O     1 
ATOM   1025 C  CB    . MET A 1 143 ? 19.234  9.065   14.204 1.00 9.90  ? 1120 MET A CB    1 
ATOM   1026 C  CG    . MET A 1 143 ? 18.721  9.831   15.424 1.00 10.13 ? 1120 MET A CG    1 
ATOM   1027 S  SD    . MET A 1 143 ? 18.997  11.627  15.339 1.00 11.34 ? 1120 MET A SD    1 
ATOM   1028 C  CE    . MET A 1 143 ? 20.780  11.674  15.246 1.00 5.95  ? 1120 MET A CE    1 
ATOM   1029 N  N     . ALA A 1 144 ? 19.198  7.750   11.317 1.00 11.25 ? 1121 ALA A N     1 
ATOM   1030 C  CA    . ALA A 1 144 ? 19.906  7.119   10.208 1.00 11.57 ? 1121 ALA A CA    1 
ATOM   1031 C  C     . ALA A 1 144 ? 19.692  7.925   8.928  1.00 13.63 ? 1121 ALA A C     1 
ATOM   1032 O  O     . ALA A 1 144 ? 20.609  8.076   8.115  1.00 13.57 ? 1121 ALA A O     1 
ATOM   1033 C  CB    . ALA A 1 144 ? 19.413  5.685   10.012 1.00 12.76 ? 1121 ALA A CB    1 
ATOM   1034 N  N     . TYR A 1 145 ? 18.476  8.438   8.757  1.00 11.86 ? 1122 TYR A N     1 
ATOM   1035 C  CA    . TYR A 1 145 ? 18.150  9.244   7.586  1.00 13.70 ? 1122 TYR A CA    1 
ATOM   1036 C  C     . TYR A 1 145 ? 18.991  10.520  7.567  1.00 12.98 ? 1122 TYR A C     1 
ATOM   1037 O  O     . TYR A 1 145 ? 19.577  10.887  6.539  1.00 11.13 ? 1122 TYR A O     1 
ATOM   1038 C  CB    . TYR A 1 145 ? 16.670  9.628   7.594  1.00 12.89 ? 1122 TYR A CB    1 
ATOM   1039 C  CG    . TYR A 1 145 ? 16.262  10.468  6.404  1.00 14.79 ? 1122 TYR A CG    1 
ATOM   1040 C  CD1   . TYR A 1 145 ? 16.025  9.883   5.152  1.00 15.29 ? 1122 TYR A CD1   1 
ATOM   1041 C  CD2   . TYR A 1 145 ? 16.119  11.852  6.521  1.00 15.01 ? 1122 TYR A CD2   1 
ATOM   1042 C  CE1   . TYR A 1 145 ? 15.649  10.659  4.053  1.00 14.45 ? 1122 TYR A CE1   1 
ATOM   1043 C  CE2   . TYR A 1 145 ? 15.744  12.632  5.430  1.00 13.87 ? 1122 TYR A CE2   1 
ATOM   1044 C  CZ    . TYR A 1 145 ? 15.509  12.032  4.202  1.00 13.85 ? 1122 TYR A CZ    1 
ATOM   1045 O  OH    . TYR A 1 145 ? 15.116  12.810  3.132  1.00 18.55 ? 1122 TYR A OH    1 
ATOM   1046 N  N     . LEU A 1 146 ? 19.040  11.190  8.714  1.00 11.81 ? 1123 LEU A N     1 
ATOM   1047 C  CA    . LEU A 1 146 ? 19.804  12.416  8.855  1.00 13.21 ? 1123 LEU A CA    1 
ATOM   1048 C  C     . LEU A 1 146 ? 21.274  12.180  8.591  1.00 15.90 ? 1123 LEU A C     1 
ATOM   1049 O  O     . LEU A 1 146 ? 21.918  12.959  7.890  1.00 15.58 ? 1123 LEU A O     1 
ATOM   1050 C  CB    . LEU A 1 146 ? 19.645  12.970  10.256 1.00 13.14 ? 1123 LEU A CB    1 
ATOM   1051 C  CG    . LEU A 1 146 ? 18.229  13.414  10.589 1.00 15.78 ? 1123 LEU A CG    1 
ATOM   1052 C  CD1   . LEU A 1 146 ? 18.160  13.781  12.064 1.00 16.08 ? 1123 LEU A CD1   1 
ATOM   1053 C  CD2   . LEU A 1 146 ? 17.844  14.595  9.702  1.00 13.96 ? 1123 LEU A CD2   1 
ATOM   1054 N  N     . ASN A 1 147 ? 21.801  11.102  9.164  1.00 17.67 ? 1124 ASN A N     1 
ATOM   1055 C  CA    . ASN A 1 147 ? 23.204  10.766  8.995  1.00 18.08 ? 1124 ASN A CA    1 
ATOM   1056 C  C     . ASN A 1 147 ? 23.494  10.472  7.527  1.00 17.16 ? 1124 ASN A C     1 
ATOM   1057 O  O     . ASN A 1 147 ? 24.530  10.875  7.000  1.00 16.78 ? 1124 ASN A O     1 
ATOM   1058 C  CB    . ASN A 1 147 ? 23.573  9.565   9.873  1.00 20.73 ? 1124 ASN A CB    1 
ATOM   1059 C  CG    . ASN A 1 147 ? 25.031  9.148   9.714  1.00 24.32 ? 1124 ASN A CG    1 
ATOM   1060 O  OD1   . ASN A 1 147 ? 25.322  8.017   9.324  1.00 24.74 ? 1124 ASN A OD1   1 
ATOM   1061 N  ND2   . ASN A 1 147 ? 25.951  10.065  10.009 1.00 24.98 ? 1124 ASN A ND2   1 
ATOM   1062 N  N     . ALA A 1 148 ? 22.584  9.772   6.862  1.00 15.86 ? 1125 ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 148 ? 22.779  9.477   5.446  1.00 16.87 ? 1125 ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 148 ? 22.799  10.796  4.667  1.00 17.45 ? 1125 ALA A C     1 
ATOM   1065 O  O     . ALA A 1 148 ? 23.423  10.902  3.612  1.00 17.78 ? 1125 ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 148 ? 21.657  8.577   4.930  1.00 14.96 ? 1125 ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 149 ? 22.111  11.799  5.205  1.00 17.59 ? 1126 LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 149 ? 22.038  13.117  4.583  1.00 19.14 ? 1126 LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 149 ? 23.236  13.978  4.956  1.00 19.88 ? 1126 LYS A C     1 
ATOM   1070 O  O     . LYS A 1 149 ? 23.299  15.152  4.597  1.00 20.38 ? 1126 LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 149 ? 20.748  13.835  5.000  1.00 18.80 ? 1126 LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 149 ? 19.487  13.275  4.368  1.00 17.45 ? 1126 LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 149 ? 19.487  13.507  2.875  1.00 16.87 ? 1126 LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 149 ? 18.369  12.744  2.209  1.00 18.33 ? 1126 LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 149 ? 18.370  12.959  0.734  1.00 21.26 ? 1126 LYS A NZ    1 
ATOM   1076 N  N     . LYS A 1 150 ? 24.176  13.388  5.685  1.00 21.00 ? 1127 LYS A N     1 
ATOM   1077 C  CA    . LYS A 1 150 ? 25.387  14.081  6.114  1.00 23.17 ? 1127 LYS A CA    1 
ATOM   1078 C  C     . LYS A 1 150 ? 25.197  15.031  7.285  1.00 23.56 ? 1127 LYS A C     1 
ATOM   1079 O  O     . LYS A 1 150 ? 25.987  15.962  7.475  1.00 24.03 ? 1127 LYS A O     1 
ATOM   1080 C  CB    . LYS A 1 150 ? 26.020  14.852  4.950  1.00 24.38 ? 1127 LYS A CB    1 
ATOM   1081 C  CG    . LYS A 1 150 ? 27.094  14.089  4.210  1.00 28.40 ? 1127 LYS A CG    1 
ATOM   1082 C  CD    . LYS A 1 150 ? 26.525  13.073  3.240  1.00 31.85 ? 1127 LYS A CD    1 
ATOM   1083 C  CE    . LYS A 1 150 ? 27.653  12.271  2.608  1.00 33.32 ? 1127 LYS A CE    1 
ATOM   1084 N  NZ    . LYS A 1 150 ? 28.798  13.149  2.227  1.00 35.13 ? 1127 LYS A NZ    1 
ATOM   1085 N  N     . PHE A 1 151 ? 24.154  14.807  8.074  1.00 23.98 ? 1128 PHE A N     1 
ATOM   1086 C  CA    . PHE A 1 151 ? 23.923  15.663  9.228  1.00 23.45 ? 1128 PHE A CA    1 
ATOM   1087 C  C     . PHE A 1 151 ? 24.210  14.950  10.539 1.00 23.21 ? 1128 PHE A C     1 
ATOM   1088 O  O     . PHE A 1 151 ? 23.761  13.826  10.761 1.00 23.91 ? 1128 PHE A O     1 
ATOM   1089 C  CB    . PHE A 1 151 ? 22.482  16.178  9.261  1.00 22.01 ? 1128 PHE A CB    1 
ATOM   1090 C  CG    . PHE A 1 151 ? 22.150  17.119  8.152  1.00 21.49 ? 1128 PHE A CG    1 
ATOM   1091 C  CD1   . PHE A 1 151 ? 21.834  16.637  6.885  1.00 22.04 ? 1128 PHE A CD1   1 
ATOM   1092 C  CD2   . PHE A 1 151 ? 22.168  18.494  8.365  1.00 21.57 ? 1128 PHE A CD2   1 
ATOM   1093 C  CE1   . PHE A 1 151 ? 21.539  17.516  5.843  1.00 20.37 ? 1128 PHE A CE1   1 
ATOM   1094 C  CE2   . PHE A 1 151 ? 21.876  19.383  7.332  1.00 20.17 ? 1128 PHE A CE2   1 
ATOM   1095 C  CZ    . PHE A 1 151 ? 21.560  18.894  6.069  1.00 20.54 ? 1128 PHE A CZ    1 
ATOM   1096 N  N     . VAL A 1 152 ? 24.971  15.613  11.397 1.00 20.87 ? 1129 VAL A N     1 
ATOM   1097 C  CA    . VAL A 1 152 ? 25.273  15.092  12.718 1.00 20.79 ? 1129 VAL A CA    1 
ATOM   1098 C  C     . VAL A 1 152 ? 24.387  15.997  13.586 1.00 19.10 ? 1129 VAL A C     1 
ATOM   1099 O  O     . VAL A 1 152 ? 24.530  17.219  13.557 1.00 19.29 ? 1129 VAL A O     1 
ATOM   1100 C  CB    . VAL A 1 152 ? 26.777  15.281  13.067 1.00 23.27 ? 1129 VAL A CB    1 
ATOM   1101 C  CG1   . VAL A 1 152 ? 27.129  14.513  14.327 1.00 25.12 ? 1129 VAL A CG1   1 
ATOM   1102 C  CG2   . VAL A 1 152 ? 27.646  14.781  11.920 1.00 22.90 ? 1129 VAL A CG2   1 
ATOM   1103 N  N     . HIS A 1 153 ? 23.471  15.409  14.347 1.00 17.34 ? 1130 HIS A N     1 
ATOM   1104 C  CA    . HIS A 1 153 ? 22.538  16.190  15.165 1.00 16.72 ? 1130 HIS A CA    1 
ATOM   1105 C  C     . HIS A 1 153 ? 23.131  17.082  16.264 1.00 16.50 ? 1130 HIS A C     1 
ATOM   1106 O  O     . HIS A 1 153 ? 22.830  18.270  16.324 1.00 14.44 ? 1130 HIS A O     1 
ATOM   1107 C  CB    . HIS A 1 153 ? 21.482  15.257  15.762 1.00 16.23 ? 1130 HIS A CB    1 
ATOM   1108 C  CG    . HIS A 1 153 ? 20.256  15.963  16.249 1.00 17.07 ? 1130 HIS A CG    1 
ATOM   1109 N  ND1   . HIS A 1 153 ? 20.246  16.740  17.388 1.00 17.43 ? 1130 HIS A ND1   1 
ATOM   1110 C  CD2   . HIS A 1 153 ? 19.001  16.017  15.744 1.00 16.88 ? 1130 HIS A CD2   1 
ATOM   1111 C  CE1   . HIS A 1 153 ? 19.036  17.240  17.565 1.00 16.48 ? 1130 HIS A CE1   1 
ATOM   1112 N  NE2   . HIS A 1 153 ? 18.261  16.816  16.581 1.00 17.29 ? 1130 HIS A NE2   1 
ATOM   1113 N  N     . ARG A 1 154 ? 23.960  16.507  17.130 1.00 19.76 ? 1131 ARG A N     1 
ATOM   1114 C  CA    . ARG A 1 154 ? 24.609  17.236  18.226 1.00 20.17 ? 1131 ARG A CA    1 
ATOM   1115 C  C     . ARG A 1 154 ? 23.734  17.539  19.426 1.00 19.70 ? 1131 ARG A C     1 
ATOM   1116 O  O     . ARG A 1 154 ? 24.243  17.986  20.458 1.00 20.88 ? 1131 ARG A O     1 
ATOM   1117 C  CB    . ARG A 1 154 ? 25.205  18.564  17.746 1.00 22.69 ? 1131 ARG A CB    1 
ATOM   1118 C  CG    . ARG A 1 154 ? 26.419  18.442  16.867 1.00 26.80 ? 1131 ARG A CG    1 
ATOM   1119 C  CD    . ARG A 1 154 ? 27.022  19.793  16.552 1.00 33.08 ? 1131 ARG A CD    1 
ATOM   1120 N  NE    . ARG A 1 154 ? 27.699  19.745  15.262 1.00 41.74 ? 1131 ARG A NE    1 
ATOM   1121 C  CZ    . ARG A 1 154 ? 27.065  19.661  14.095 1.00 45.51 ? 1131 ARG A CZ    1 
ATOM   1122 N  NH1   . ARG A 1 154 ? 25.741  19.625  14.057 1.00 46.88 ? 1131 ARG A NH1   1 
ATOM   1123 N  NH2   . ARG A 1 154 ? 27.754  19.590  12.966 1.00 49.00 ? 1131 ARG A NH2   1 
ATOM   1124 N  N     . ASP A 1 155 ? 22.430  17.308  19.315 1.00 18.16 ? 1132 ASP A N     1 
ATOM   1125 C  CA    . ASP A 1 155 ? 21.548  17.615  20.434 1.00 17.57 ? 1132 ASP A CA    1 
ATOM   1126 C  C     . ASP A 1 155 ? 20.378  16.642  20.551 1.00 15.77 ? 1132 ASP A C     1 
ATOM   1127 O  O     . ASP A 1 155 ? 19.254  17.025  20.873 1.00 13.15 ? 1132 ASP A O     1 
ATOM   1128 C  CB    . ASP A 1 155 ? 21.050  19.063  20.298 1.00 21.19 ? 1132 ASP A CB    1 
ATOM   1129 C  CG    . ASP A 1 155 ? 20.486  19.622  21.600 1.00 26.52 ? 1132 ASP A CG    1 
ATOM   1130 O  OD1   . ASP A 1 155 ? 20.627  18.975  22.665 1.00 24.81 ? 1132 ASP A OD1   1 
ATOM   1131 O  OD2   . ASP A 1 155 ? 19.906  20.728  21.558 1.00 29.87 ? 1132 ASP A OD2   1 
ATOM   1132 N  N     . LEU A 1 156 ? 20.646  15.371  20.290 1.00 15.86 ? 1133 LEU A N     1 
ATOM   1133 C  CA    . LEU A 1 156 ? 19.603  14.369  20.395 1.00 14.22 ? 1133 LEU A CA    1 
ATOM   1134 C  C     . LEU A 1 156 ? 19.252  14.169  21.867 1.00 15.37 ? 1133 LEU A C     1 
ATOM   1135 O  O     . LEU A 1 156 ? 20.121  13.913  22.699 1.00 15.51 ? 1133 LEU A O     1 
ATOM   1136 C  CB    . LEU A 1 156 ? 20.063  13.051  19.787 1.00 11.35 ? 1133 LEU A CB    1 
ATOM   1137 C  CG    . LEU A 1 156 ? 19.017  11.936  19.866 1.00 9.86  ? 1133 LEU A CG    1 
ATOM   1138 C  CD1   . LEU A 1 156 ? 17.717  12.395  19.212 1.00 8.46  ? 1133 LEU A CD1   1 
ATOM   1139 C  CD2   . LEU A 1 156 ? 19.561  10.687  19.187 1.00 10.29 ? 1133 LEU A CD2   1 
ATOM   1140 N  N     . ALA A 1 157 ? 17.968  14.298  22.176 1.00 15.68 ? 1134 ALA A N     1 
ATOM   1141 C  CA    . ALA A 1 157 ? 17.460  14.146  23.531 1.00 13.68 ? 1134 ALA A CA    1 
ATOM   1142 C  C     . ALA A 1 157 ? 15.948  14.031  23.393 1.00 14.19 ? 1134 ALA A C     1 
ATOM   1143 O  O     . ALA A 1 157 ? 15.397  14.358  22.343 1.00 14.17 ? 1134 ALA A O     1 
ATOM   1144 C  CB    . ALA A 1 157 ? 17.828  15.359  24.373 1.00 7.91  ? 1134 ALA A CB    1 
ATOM   1145 N  N     . ALA A 1 158 ? 15.274  13.566  24.439 1.00 14.85 ? 1135 ALA A N     1 
ATOM   1146 C  CA    . ALA A 1 158 ? 13.832  13.406  24.361 1.00 14.84 ? 1135 ALA A CA    1 
ATOM   1147 C  C     . ALA A 1 158 ? 13.143  14.731  24.048 1.00 16.62 ? 1135 ALA A C     1 
ATOM   1148 O  O     . ALA A 1 158 ? 12.175  14.764  23.290 1.00 15.48 ? 1135 ALA A O     1 
ATOM   1149 C  CB    . ALA A 1 158 ? 13.303  12.824  25.647 1.00 14.41 ? 1135 ALA A CB    1 
ATOM   1150 N  N     . ARG A 1 159 ? 13.645  15.823  24.624 1.00 17.48 ? 1136 ARG A N     1 
ATOM   1151 C  CA    . ARG A 1 159 ? 13.050  17.136  24.379 1.00 19.71 ? 1136 ARG A CA    1 
ATOM   1152 C  C     . ARG A 1 159 ? 13.089  17.474  22.890 1.00 18.10 ? 1136 ARG A C     1 
ATOM   1153 O  O     . ARG A 1 159 ? 12.247  18.217  22.392 1.00 19.60 ? 1136 ARG A O     1 
ATOM   1154 C  CB    . ARG A 1 159 ? 13.783  18.231  25.168 1.00 21.23 ? 1136 ARG A CB    1 
ATOM   1155 C  CG    . ARG A 1 159 ? 15.253  18.391  24.793 1.00 26.50 ? 1136 ARG A CG    1 
ATOM   1156 C  CD    . ARG A 1 159 ? 15.909  19.624  25.440 1.00 28.97 ? 1136 ARG A CD    1 
ATOM   1157 N  NE    . ARG A 1 159 ? 17.349  19.658  25.161 1.00 33.66 ? 1136 ARG A NE    1 
ATOM   1158 C  CZ    . ARG A 1 159 ? 18.255  18.866  25.740 1.00 33.39 ? 1136 ARG A CZ    1 
ATOM   1159 N  NH1   . ARG A 1 159 ? 17.887  17.974  26.654 1.00 31.00 ? 1136 ARG A NH1   1 
ATOM   1160 N  NH2   . ARG A 1 159 ? 19.532  18.938  25.380 1.00 30.84 ? 1136 ARG A NH2   1 
ATOM   1161 N  N     . ASN A 1 160 ? 14.064  16.930  22.174 1.00 16.42 ? 1137 ASN A N     1 
ATOM   1162 C  CA    . ASN A 1 160 ? 14.156  17.229  20.759 1.00 16.82 ? 1137 ASN A CA    1 
ATOM   1163 C  C     . ASN A 1 160 ? 13.526  16.186  19.841 1.00 17.33 ? 1137 ASN A C     1 
ATOM   1164 O  O     . ASN A 1 160 ? 13.799  16.145  18.645 1.00 18.96 ? 1137 ASN A O     1 
ATOM   1165 C  CB    . ASN A 1 160 ? 15.609  17.529  20.377 1.00 14.03 ? 1137 ASN A CB    1 
ATOM   1166 C  CG    . ASN A 1 160 ? 16.087  18.861  20.947 1.00 15.07 ? 1137 ASN A CG    1 
ATOM   1167 O  OD1   . ASN A 1 160 ? 15.327  19.832  20.983 1.00 17.96 ? 1137 ASN A OD1   1 
ATOM   1168 N  ND2   . ASN A 1 160 ? 17.341  18.916  21.386 1.00 11.04 ? 1137 ASN A ND2   1 
ATOM   1169 N  N     . CYS A 1 161 ? 12.674  15.347  20.421 1.00 18.00 ? 1138 CYS A N     1 
ATOM   1170 C  CA    . CYS A 1 161 ? 11.931  14.337  19.673 1.00 17.02 ? 1138 CYS A CA    1 
ATOM   1171 C  C     . CYS A 1 161 ? 10.464  14.686  19.884 1.00 16.80 ? 1138 CYS A C     1 
ATOM   1172 O  O     . CYS A 1 161 ? 10.101  15.248  20.919 1.00 14.39 ? 1138 CYS A O     1 
ATOM   1173 C  CB    . CYS A 1 161 ? 12.214  12.932  20.198 1.00 15.86 ? 1138 CYS A CB    1 
ATOM   1174 S  SG    . CYS A 1 161 ? 13.867  12.356  19.821 1.00 14.02 ? 1138 CYS A SG    1 
ATOM   1175 N  N     . MET A 1 162 ? 9.624   14.354  18.910 1.00 15.69 ? 1139 MET A N     1 
ATOM   1176 C  CA    . MET A 1 162 ? 8.216   14.683  19.001 1.00 15.72 ? 1139 MET A CA    1 
ATOM   1177 C  C     . MET A 1 162 ? 7.314   13.483  18.814 1.00 14.93 ? 1139 MET A C     1 
ATOM   1178 O  O     . MET A 1 162 ? 7.724   12.465  18.259 1.00 15.96 ? 1139 MET A O     1 
ATOM   1179 C  CB    . MET A 1 162 ? 7.887   15.753  17.973 1.00 18.26 ? 1139 MET A CB    1 
ATOM   1180 C  CG    . MET A 1 162 ? 8.958   16.804  17.887 1.00 21.54 ? 1139 MET A CG    1 
ATOM   1181 S  SD    . MET A 1 162 ? 8.279   18.436  17.762 1.00 30.55 ? 1139 MET A SD    1 
ATOM   1182 C  CE    . MET A 1 162 ? 7.904   18.686  19.535 1.00 28.37 ? 1139 MET A CE    1 
ATOM   1183 N  N     . VAL A 1 163 ? 6.078   13.622  19.279 1.00 13.53 ? 1140 VAL A N     1 
ATOM   1184 C  CA    . VAL A 1 163 ? 5.097   12.553  19.215 1.00 11.86 ? 1140 VAL A CA    1 
ATOM   1185 C  C     . VAL A 1 163 ? 3.850   12.974  18.457 1.00 12.66 ? 1140 VAL A C     1 
ATOM   1186 O  O     . VAL A 1 163 ? 3.190   13.943  18.823 1.00 13.56 ? 1140 VAL A O     1 
ATOM   1187 C  CB    . VAL A 1 163 ? 4.667   12.130  20.635 1.00 11.91 ? 1140 VAL A CB    1 
ATOM   1188 C  CG1   . VAL A 1 163 ? 3.790   10.880  20.561 1.00 9.98  ? 1140 VAL A CG1   1 
ATOM   1189 C  CG2   . VAL A 1 163 ? 5.904   11.904  21.513 1.00 7.54  ? 1140 VAL A CG2   1 
ATOM   1190 N  N     . ALA A 1 164 ? 3.531   12.230  17.405 1.00 13.60 ? 1141 ALA A N     1 
ATOM   1191 C  CA    . ALA A 1 164 ? 2.364   12.515  16.583 1.00 15.00 ? 1141 ALA A CA    1 
ATOM   1192 C  C     . ALA A 1 164 ? 1.049   12.031  17.210 1.00 16.34 ? 1141 ALA A C     1 
ATOM   1193 O  O     . ALA A 1 164 ? 1.029   11.413  18.282 1.00 14.42 ? 1141 ALA A O     1 
ATOM   1194 C  CB    . ALA A 1 164 ? 2.550   11.883  15.211 1.00 13.95 ? 1141 ALA A CB    1 
ATOM   1195 N  N     . HIS A 1 165 ? -0.051  12.315  16.525 1.00 19.66 ? 1142 HIS A N     1 
ATOM   1196 C  CA    . HIS A 1 165 ? -1.379  11.922  16.995 1.00 22.96 ? 1142 HIS A CA    1 
ATOM   1197 C  C     . HIS A 1 165 ? -1.508  10.411  17.187 1.00 21.28 ? 1142 HIS A C     1 
ATOM   1198 O  O     . HIS A 1 165 ? -2.220  9.950   18.082 1.00 20.82 ? 1142 HIS A O     1 
ATOM   1199 C  CB    . HIS A 1 165 ? -2.447  12.415  16.010 1.00 26.27 ? 1142 HIS A CB    1 
ATOM   1200 C  CG    . HIS A 1 165 ? -2.324  11.827  14.636 1.00 32.63 ? 1142 HIS A CG    1 
ATOM   1201 N  ND1   . HIS A 1 165 ? -2.909  10.629  14.282 1.00 34.86 ? 1142 HIS A ND1   1 
ATOM   1202 C  CD2   . HIS A 1 165 ? -1.672  12.266  13.534 1.00 34.82 ? 1142 HIS A CD2   1 
ATOM   1203 C  CE1   . HIS A 1 165 ? -2.624  10.357  13.021 1.00 35.35 ? 1142 HIS A CE1   1 
ATOM   1204 N  NE2   . HIS A 1 165 ? -1.873  11.335  12.544 1.00 36.67 ? 1142 HIS A NE2   1 
ATOM   1205 N  N     . ASP A 1 166 ? -0.818  9.644   16.348 1.00 19.51 ? 1143 ASP A N     1 
ATOM   1206 C  CA    . ASP A 1 166 ? -0.876  8.191   16.435 1.00 19.82 ? 1143 ASP A CA    1 
ATOM   1207 C  C     . ASP A 1 166 ? 0.286   7.643   17.254 1.00 19.96 ? 1143 ASP A C     1 
ATOM   1208 O  O     . ASP A 1 166 ? 0.583   6.449   17.210 1.00 22.00 ? 1143 ASP A O     1 
ATOM   1209 C  CB    . ASP A 1 166 ? -0.869  7.577   15.031 1.00 19.09 ? 1143 ASP A CB    1 
ATOM   1210 C  CG    . ASP A 1 166 ? 0.456   7.767   14.304 1.00 18.54 ? 1143 ASP A CG    1 
ATOM   1211 O  OD1   . ASP A 1 166 ? 1.305   8.565   14.760 1.00 16.39 ? 1143 ASP A OD1   1 
ATOM   1212 O  OD2   . ASP A 1 166 ? 0.642   7.112   13.257 1.00 18.84 ? 1143 ASP A OD2   1 
ATOM   1213 N  N     . PHE A 1 167 ? 0.938   8.536   17.994 1.00 18.55 ? 1144 PHE A N     1 
ATOM   1214 C  CA    . PHE A 1 167 ? 2.066   8.197   18.855 1.00 18.12 ? 1144 PHE A CA    1 
ATOM   1215 C  C     . PHE A 1 167 ? 3.372   7.845   18.162 1.00 18.11 ? 1144 PHE A C     1 
ATOM   1216 O  O     . PHE A 1 167 ? 4.297   7.325   18.789 1.00 17.87 ? 1144 PHE A O     1 
ATOM   1217 C  CB    . PHE A 1 167 ? 1.666   7.085   19.820 1.00 17.80 ? 1144 PHE A CB    1 
ATOM   1218 C  CG    . PHE A 1 167 ? 0.471   7.435   20.637 1.00 19.62 ? 1144 PHE A CG    1 
ATOM   1219 C  CD1   . PHE A 1 167 ? -0.793  6.981   20.273 1.00 18.16 ? 1144 PHE A CD1   1 
ATOM   1220 C  CD2   . PHE A 1 167 ? 0.590   8.311   21.716 1.00 18.42 ? 1144 PHE A CD2   1 
ATOM   1221 C  CE1   . PHE A 1 167 ? -1.923  7.400   20.965 1.00 20.62 ? 1144 PHE A CE1   1 
ATOM   1222 C  CE2   . PHE A 1 167 ? -0.534  8.737   22.415 1.00 18.54 ? 1144 PHE A CE2   1 
ATOM   1223 C  CZ    . PHE A 1 167 ? -1.794  8.282   22.037 1.00 19.69 ? 1144 PHE A CZ    1 
ATOM   1224 N  N     . THR A 1 168 ? 3.455   8.128   16.870 1.00 16.90 ? 1145 THR A N     1 
ATOM   1225 C  CA    . THR A 1 168 ? 4.683   7.869   16.147 1.00 14.92 ? 1145 THR A CA    1 
ATOM   1226 C  C     . THR A 1 168 ? 5.688   8.913   16.626 1.00 15.47 ? 1145 THR A C     1 
ATOM   1227 O  O     . THR A 1 168 ? 5.381   10.107  16.683 1.00 16.13 ? 1145 THR A O     1 
ATOM   1228 C  CB    . THR A 1 168 ? 4.490   8.039   14.645 1.00 15.23 ? 1145 THR A CB    1 
ATOM   1229 O  OG1   . THR A 1 168 ? 3.400   7.221   14.212 1.00 18.02 ? 1145 THR A OG1   1 
ATOM   1230 C  CG2   . THR A 1 168 ? 5.755   7.628   13.903 1.00 15.12 ? 1145 THR A CG2   1 
ATOM   1231 N  N     . VAL A 1 169 ? 6.888   8.474   16.975 1.00 15.09 ? 1146 VAL A N     1 
ATOM   1232 C  CA    . VAL A 1 169 ? 7.906   9.407   17.437 1.00 14.46 ? 1146 VAL A CA    1 
ATOM   1233 C  C     . VAL A 1 169 ? 8.809   9.812   16.271 1.00 14.53 ? 1146 VAL A C     1 
ATOM   1234 O  O     . VAL A 1 169 ? 9.204   8.972   15.469 1.00 14.87 ? 1146 VAL A O     1 
ATOM   1235 C  CB    . VAL A 1 169 ? 8.736   8.771   18.578 1.00 12.50 ? 1146 VAL A CB    1 
ATOM   1236 C  CG1   . VAL A 1 169 ? 9.780   9.757   19.107 1.00 9.66  ? 1146 VAL A CG1   1 
ATOM   1237 C  CG2   . VAL A 1 169 ? 7.800   8.358   19.694 1.00 13.35 ? 1146 VAL A CG2   1 
ATOM   1238 N  N     . LYS A 1 170 ? 9.128   11.101  16.176 1.00 15.05 ? 1147 LYS A N     1 
ATOM   1239 C  CA    . LYS A 1 170 ? 9.982   11.596  15.095 1.00 13.71 ? 1147 LYS A CA    1 
ATOM   1240 C  C     . LYS A 1 170 ? 11.025  12.580  15.617 1.00 13.04 ? 1147 LYS A C     1 
ATOM   1241 O  O     . LYS A 1 170 ? 10.824  13.229  16.646 1.00 11.27 ? 1147 LYS A O     1 
ATOM   1242 C  CB    . LYS A 1 170 ? 9.130   12.294  14.024 1.00 13.41 ? 1147 LYS A CB    1 
ATOM   1243 C  CG    . LYS A 1 170 ? 7.904   11.498  13.574 1.00 12.60 ? 1147 LYS A CG    1 
ATOM   1244 C  CD    . LYS A 1 170 ? 7.164   12.204  12.456 1.00 8.22  ? 1147 LYS A CD    1 
ATOM   1245 C  CE    . LYS A 1 170 ? 5.914   11.441  12.054 1.00 12.75 ? 1147 LYS A CE    1 
ATOM   1246 N  NZ    . LYS A 1 170 ? 5.336   11.989  10.797 1.00 15.84 ? 1147 LYS A NZ    1 
ATOM   1247 N  N     . ILE A 1 171 ? 12.142  12.684  14.903 1.00 13.32 ? 1148 ILE A N     1 
ATOM   1248 C  CA    . ILE A 1 171 ? 13.203  13.612  15.276 1.00 11.76 ? 1148 ILE A CA    1 
ATOM   1249 C  C     . ILE A 1 171 ? 12.670  14.994  14.909 1.00 12.91 ? 1148 ILE A C     1 
ATOM   1250 O  O     . ILE A 1 171 ? 12.148  15.177  13.811 1.00 12.07 ? 1148 ILE A O     1 
ATOM   1251 C  CB    . ILE A 1 171 ? 14.503  13.362  14.467 1.00 9.76  ? 1148 ILE A CB    1 
ATOM   1252 C  CG1   . ILE A 1 171 ? 14.899  11.881  14.534 1.00 7.72  ? 1148 ILE A CG1   1 
ATOM   1253 C  CG2   . ILE A 1 171 ? 15.617  14.273  14.989 1.00 5.48  ? 1148 ILE A CG2   1 
ATOM   1254 C  CD1   . ILE A 1 171 ? 15.246  11.387  15.918 1.00 7.39  ? 1148 ILE A CD1   1 
ATOM   1255 N  N     . GLY A 1 172 ? 12.798  15.956  15.820 1.00 14.56 ? 1149 GLY A N     1 
ATOM   1256 C  CA    . GLY A 1 172 ? 12.307  17.298  15.559 1.00 17.02 ? 1149 GLY A CA    1 
ATOM   1257 C  C     . GLY A 1 172 ? 12.910  17.956  14.331 1.00 20.50 ? 1149 GLY A C     1 
ATOM   1258 O  O     . GLY A 1 172 ? 12.186  18.348  13.409 1.00 22.99 ? 1149 GLY A O     1 
ATOM   1259 N  N     . ASP A 1 173 ? 14.233  18.082  14.302 1.00 22.28 ? 1150 ASP A N     1 
ATOM   1260 C  CA    . ASP A 1 173 ? 14.901  18.707  13.161 1.00 24.15 ? 1150 ASP A CA    1 
ATOM   1261 C  C     . ASP A 1 173 ? 16.258  18.078  12.848 1.00 24.16 ? 1150 ASP A C     1 
ATOM   1262 O  O     . ASP A 1 173 ? 16.607  17.044  13.403 1.00 25.96 ? 1150 ASP A O     1 
ATOM   1263 C  CB    . ASP A 1 173 ? 15.051  20.211  13.407 1.00 24.37 ? 1150 ASP A CB    1 
ATOM   1264 C  CG    . ASP A 1 173 ? 15.473  20.525  14.824 1.00 26.28 ? 1150 ASP A CG    1 
ATOM   1265 O  OD1   . ASP A 1 173 ? 16.566  20.082  15.237 1.00 27.64 ? 1150 ASP A OD1   1 
ATOM   1266 O  OD2   . ASP A 1 173 ? 14.705  21.211  15.526 1.00 26.09 ? 1150 ASP A OD2   1 
ATOM   1267 N  N     . PHE A 1 174 ? 17.021  18.705  11.958 1.00 26.37 ? 1151 PHE A N     1 
ATOM   1268 C  CA    . PHE A 1 174 ? 18.317  18.168  11.564 1.00 28.03 ? 1151 PHE A CA    1 
ATOM   1269 C  C     . PHE A 1 174 ? 19.453  18.414  12.560 1.00 30.38 ? 1151 PHE A C     1 
ATOM   1270 O  O     . PHE A 1 174 ? 20.614  18.114  12.279 1.00 28.12 ? 1151 PHE A O     1 
ATOM   1271 C  CB    . PHE A 1 174 ? 18.696  18.689  10.168 1.00 27.18 ? 1151 PHE A CB    1 
ATOM   1272 C  CG    . PHE A 1 174 ? 18.763  20.189  10.066 1.00 27.57 ? 1151 PHE A CG    1 
ATOM   1273 C  CD1   . PHE A 1 174 ? 19.851  20.890  10.577 1.00 27.38 ? 1151 PHE A CD1   1 
ATOM   1274 C  CD2   . PHE A 1 174 ? 17.735  20.900  9.457  1.00 25.97 ? 1151 PHE A CD2   1 
ATOM   1275 C  CE1   . PHE A 1 174 ? 19.914  22.279  10.480 1.00 26.41 ? 1151 PHE A CE1   1 
ATOM   1276 C  CE2   . PHE A 1 174 ? 17.785  22.282  9.356  1.00 27.15 ? 1151 PHE A CE2   1 
ATOM   1277 C  CZ    . PHE A 1 174 ? 18.879  22.976  9.869  1.00 27.48 ? 1151 PHE A CZ    1 
ATOM   1278 N  N     . GLY A 1 175 ? 19.122  18.956  13.727 1.00 33.08 ? 1152 GLY A N     1 
ATOM   1279 C  CA    . GLY A 1 175 ? 20.153  19.187  14.720 1.00 38.23 ? 1152 GLY A CA    1 
ATOM   1280 C  C     . GLY A 1 175 ? 20.287  20.612  15.208 1.00 42.47 ? 1152 GLY A C     1 
ATOM   1281 O  O     . GLY A 1 175 ? 19.601  21.519  14.735 1.00 42.69 ? 1152 GLY A O     1 
ATOM   1282 N  N     . MET A 1 176 ? 21.185  20.802  16.168 1.00 47.55 ? 1153 MET A N     1 
ATOM   1283 C  CA    . MET A 1 176 ? 21.429  22.114  16.743 1.00 52.43 ? 1153 MET A CA    1 
ATOM   1284 C  C     . MET A 1 176 ? 22.330  22.947  15.846 1.00 54.08 ? 1153 MET A C     1 
ATOM   1285 O  O     . MET A 1 176 ? 23.453  22.556  15.524 1.00 54.49 ? 1153 MET A O     1 
ATOM   1286 C  CB    . MET A 1 176 ? 22.063  21.987  18.127 1.00 55.73 ? 1153 MET A CB    1 
ATOM   1287 C  CG    . MET A 1 176 ? 22.332  23.327  18.793 1.00 60.03 ? 1153 MET A CG    1 
ATOM   1288 S  SD    . MET A 1 176 ? 22.983  23.147  20.458 1.00 65.47 ? 1153 MET A SD    1 
ATOM   1289 C  CE    . MET A 1 176 ? 21.467  23.306  21.442 1.00 65.48 ? 1153 MET A CE    1 
ATOM   1290 N  N     . THR A 1 177 ? 21.815  24.103  15.452 1.00 54.88 ? 1154 THR A N     1 
ATOM   1291 C  CA    . THR A 1 177 ? 22.527  25.024  14.586 1.00 54.61 ? 1154 THR A CA    1 
ATOM   1292 C  C     . THR A 1 177 ? 23.480  25.906  15.389 1.00 54.07 ? 1154 THR A C     1 
ATOM   1293 O  O     . THR A 1 177 ? 23.623  27.097  15.118 1.00 53.18 ? 1154 THR A O     1 
ATOM   1294 C  CB    . THR A 1 177 ? 21.516  25.895  13.827 1.00 55.18 ? 1154 THR A CB    1 
ATOM   1295 O  OG1   . THR A 1 177 ? 20.492  26.327  14.732 1.00 53.72 ? 1154 THR A OG1   1 
ATOM   1296 C  CG2   . THR A 1 177 ? 20.871  25.100  12.703 1.00 54.85 ? 1154 THR A CG2   1 
ATOM   1297 N  N     . LEU A 1 194 ? 26.894  22.521  25.797 1.00 33.12 ? 1171 LEU A N     1 
ATOM   1298 C  CA    . LEU A 1 194 ? 25.550  22.787  26.312 1.00 32.61 ? 1171 LEU A CA    1 
ATOM   1299 C  C     . LEU A 1 194 ? 24.846  21.545  26.877 1.00 31.42 ? 1171 LEU A C     1 
ATOM   1300 O  O     . LEU A 1 194 ? 24.733  21.388  28.090 1.00 32.49 ? 1171 LEU A O     1 
ATOM   1301 N  N     . PRO A 1 195 ? 24.363  20.646  25.997 1.00 29.93 ? 1172 PRO A N     1 
ATOM   1302 C  CA    . PRO A 1 195 ? 23.667  19.418  26.410 1.00 28.68 ? 1172 PRO A CA    1 
ATOM   1303 C  C     . PRO A 1 195 ? 24.598  18.410  27.107 1.00 29.04 ? 1172 PRO A C     1 
ATOM   1304 O  O     . PRO A 1 195 ? 24.609  17.210  26.790 1.00 27.67 ? 1172 PRO A O     1 
ATOM   1305 C  CB    . PRO A 1 195 ? 23.103  18.893  25.094 1.00 27.34 ? 1172 PRO A CB    1 
ATOM   1306 C  CG    . PRO A 1 195 ? 24.167  19.289  24.109 1.00 27.11 ? 1172 PRO A CG    1 
ATOM   1307 C  CD    . PRO A 1 195 ? 24.489  20.710  24.529 1.00 28.27 ? 1172 PRO A CD    1 
ATOM   1308 N  N     . VAL A 1 196 ? 25.365  18.925  28.064 1.00 26.73 ? 1173 VAL A N     1 
ATOM   1309 C  CA    . VAL A 1 196 ? 26.334  18.157  28.840 1.00 24.95 ? 1173 VAL A CA    1 
ATOM   1310 C  C     . VAL A 1 196 ? 25.903  16.751  29.256 1.00 23.25 ? 1173 VAL A C     1 
ATOM   1311 O  O     . VAL A 1 196 ? 26.630  15.780  29.030 1.00 21.47 ? 1173 VAL A O     1 
ATOM   1312 C  CB    . VAL A 1 196 ? 26.749  18.965  30.102 1.00 25.55 ? 1173 VAL A CB    1 
ATOM   1313 C  CG1   . VAL A 1 196 ? 27.471  18.085  31.095 1.00 25.37 ? 1173 VAL A CG1   1 
ATOM   1314 C  CG2   . VAL A 1 196 ? 27.646  20.128  29.684 1.00 24.90 ? 1173 VAL A CG2   1 
ATOM   1315 N  N     . ARG A 1 197 ? 24.726  16.644  29.861 1.00 21.05 ? 1174 ARG A N     1 
ATOM   1316 C  CA    . ARG A 1 197 ? 24.221  15.360  30.323 1.00 18.94 ? 1174 ARG A CA    1 
ATOM   1317 C  C     . ARG A 1 197 ? 23.882  14.380  29.199 1.00 18.05 ? 1174 ARG A C     1 
ATOM   1318 O  O     . ARG A 1 197 ? 23.581  13.220  29.460 1.00 18.79 ? 1174 ARG A O     1 
ATOM   1319 C  CB    . ARG A 1 197 ? 22.999  15.584  31.219 1.00 19.72 ? 1174 ARG A CB    1 
ATOM   1320 C  CG    . ARG A 1 197 ? 23.330  16.312  32.513 1.00 22.49 ? 1174 ARG A CG    1 
ATOM   1321 C  CD    . ARG A 1 197 ? 22.111  16.958  33.158 1.00 22.83 ? 1174 ARG A CD    1 
ATOM   1322 N  NE    . ARG A 1 197 ? 22.514  17.888  34.209 1.00 25.73 ? 1174 ARG A NE    1 
ATOM   1323 C  CZ    . ARG A 1 197 ? 22.853  17.534  35.447 1.00 28.30 ? 1174 ARG A CZ    1 
ATOM   1324 N  NH1   . ARG A 1 197 ? 22.830  16.257  35.820 1.00 27.64 ? 1174 ARG A NH1   1 
ATOM   1325 N  NH2   . ARG A 1 197 ? 23.243  18.461  36.313 1.00 28.91 ? 1174 ARG A NH2   1 
ATOM   1326 N  N     . TRP A 1 198 ? 23.942  14.846  27.955 1.00 17.13 ? 1175 TRP A N     1 
ATOM   1327 C  CA    . TRP A 1 198 ? 23.631  14.016  26.787 1.00 16.50 ? 1175 TRP A CA    1 
ATOM   1328 C  C     . TRP A 1 198 ? 24.839  13.806  25.864 1.00 17.24 ? 1175 TRP A C     1 
ATOM   1329 O  O     . TRP A 1 198 ? 24.764  13.062  24.886 1.00 16.07 ? 1175 TRP A O     1 
ATOM   1330 C  CB    . TRP A 1 198 ? 22.505  14.670  25.972 1.00 16.29 ? 1175 TRP A CB    1 
ATOM   1331 C  CG    . TRP A 1 198 ? 21.108  14.451  26.513 1.00 14.74 ? 1175 TRP A CG    1 
ATOM   1332 C  CD1   . TRP A 1 198 ? 20.186  13.549  26.060 1.00 13.10 ? 1175 TRP A CD1   1 
ATOM   1333 C  CD2   . TRP A 1 198 ? 20.495  15.130  27.613 1.00 13.93 ? 1175 TRP A CD2   1 
ATOM   1334 N  NE1   . TRP A 1 198 ? 19.036  13.624  26.810 1.00 14.74 ? 1175 TRP A NE1   1 
ATOM   1335 C  CE2   . TRP A 1 198 ? 19.198  14.586  27.772 1.00 15.18 ? 1175 TRP A CE2   1 
ATOM   1336 C  CE3   . TRP A 1 198 ? 20.912  16.145  28.483 1.00 15.36 ? 1175 TRP A CE3   1 
ATOM   1337 C  CZ2   . TRP A 1 198 ? 18.317  15.022  28.767 1.00 13.69 ? 1175 TRP A CZ2   1 
ATOM   1338 C  CZ3   . TRP A 1 198 ? 20.032  16.580  29.477 1.00 15.75 ? 1175 TRP A CZ3   1 
ATOM   1339 C  CH2   . TRP A 1 198 ? 18.751  16.016  29.608 1.00 13.23 ? 1175 TRP A CH2   1 
ATOM   1340 N  N     . MET A 1 199 ? 25.948  14.464  26.181 1.00 16.26 ? 1176 MET A N     1 
ATOM   1341 C  CA    . MET A 1 199 ? 27.141  14.378  25.358 1.00 17.21 ? 1176 MET A CA    1 
ATOM   1342 C  C     . MET A 1 199 ? 28.061  13.199  25.638 1.00 17.96 ? 1176 MET A C     1 
ATOM   1343 O  O     . MET A 1 199 ? 28.195  12.753  26.777 1.00 19.32 ? 1176 MET A O     1 
ATOM   1344 C  CB    . MET A 1 199 ? 27.928  15.678  25.483 1.00 16.65 ? 1176 MET A CB    1 
ATOM   1345 C  CG    . MET A 1 199 ? 27.196  16.870  24.915 1.00 17.72 ? 1176 MET A CG    1 
ATOM   1346 S  SD    . MET A 1 199 ? 27.920  18.400  25.439 1.00 23.11 ? 1176 MET A SD    1 
ATOM   1347 C  CE    . MET A 1 199 ? 29.460  18.374  24.493 1.00 18.73 ? 1176 MET A CE    1 
ATOM   1348 N  N     . ALA A 1 200 ? 28.691  12.705  24.575 1.00 17.36 ? 1177 ALA A N     1 
ATOM   1349 C  CA    . ALA A 1 200 ? 29.625  11.592  24.667 1.00 18.59 ? 1177 ALA A CA    1 
ATOM   1350 C  C     . ALA A 1 200 ? 30.919  12.113  25.279 1.00 20.13 ? 1177 ALA A C     1 
ATOM   1351 O  O     . ALA A 1 200 ? 31.241  13.297  25.155 1.00 19.30 ? 1177 ALA A O     1 
ATOM   1352 C  CB    . ALA A 1 200 ? 29.896  11.023  23.284 1.00 17.39 ? 1177 ALA A CB    1 
ATOM   1353 N  N     . PRO A 1 201 ? 31.682  11.234  25.942 1.00 21.11 ? 1178 PRO A N     1 
ATOM   1354 C  CA    . PRO A 1 201 ? 32.948  11.620  26.575 1.00 20.59 ? 1178 PRO A CA    1 
ATOM   1355 C  C     . PRO A 1 201 ? 33.921  12.369  25.662 1.00 18.62 ? 1178 PRO A C     1 
ATOM   1356 O  O     . PRO A 1 201 ? 34.504  13.371  26.075 1.00 17.82 ? 1178 PRO A O     1 
ATOM   1357 C  CB    . PRO A 1 201 ? 33.511  10.283  27.066 1.00 21.17 ? 1178 PRO A CB    1 
ATOM   1358 C  CG    . PRO A 1 201 ? 32.915  9.284   26.098 1.00 20.86 ? 1178 PRO A CG    1 
ATOM   1359 C  CD    . PRO A 1 201 ? 31.495  9.773   26.001 1.00 20.48 ? 1178 PRO A CD    1 
ATOM   1360 N  N     . GLU A 1 202 ? 34.095  11.888  24.432 1.00 19.63 ? 1179 GLU A N     1 
ATOM   1361 C  CA    . GLU A 1 202 ? 35.006  12.531  23.477 1.00 21.14 ? 1179 GLU A CA    1 
ATOM   1362 C  C     . GLU A 1 202 ? 34.502  13.910  23.056 1.00 22.64 ? 1179 GLU A C     1 
ATOM   1363 O  O     . GLU A 1 202 ? 35.290  14.776  22.677 1.00 25.63 ? 1179 GLU A O     1 
ATOM   1364 C  CB    . GLU A 1 202 ? 35.190  11.672  22.223 1.00 21.87 ? 1179 GLU A CB    1 
ATOM   1365 C  CG    . GLU A 1 202 ? 33.967  11.615  21.323 1.00 23.78 ? 1179 GLU A CG    1 
ATOM   1366 C  CD    . GLU A 1 202 ? 33.070  10.422  21.604 1.00 24.38 ? 1179 GLU A CD    1 
ATOM   1367 O  OE1   . GLU A 1 202 ? 33.153  9.842   22.710 1.00 23.86 ? 1179 GLU A OE1   1 
ATOM   1368 O  OE2   . GLU A 1 202 ? 32.270  10.071  20.713 1.00 25.53 ? 1179 GLU A OE2   1 
ATOM   1369 N  N     . SER A 1 203 ? 33.188  14.109  23.113 1.00 22.40 ? 1180 SER A N     1 
ATOM   1370 C  CA    . SER A 1 203 ? 32.609  15.400  22.762 1.00 22.39 ? 1180 SER A CA    1 
ATOM   1371 C  C     . SER A 1 203 ? 32.910  16.338  23.920 1.00 21.97 ? 1180 SER A C     1 
ATOM   1372 O  O     . SER A 1 203 ? 33.283  17.488  23.722 1.00 19.19 ? 1180 SER A O     1 
ATOM   1373 C  CB    . SER A 1 203 ? 31.091  15.286  22.569 1.00 23.85 ? 1180 SER A CB    1 
ATOM   1374 O  OG    . SER A 1 203 ? 30.768  14.503  21.430 1.00 22.76 ? 1180 SER A OG    1 
ATOM   1375 N  N     . LEU A 1 204 ? 32.744  15.831  25.136 1.00 21.90 ? 1181 LEU A N     1 
ATOM   1376 C  CA    . LEU A 1 204 ? 33.021  16.620  26.323 1.00 23.69 ? 1181 LEU A CA    1 
ATOM   1377 C  C     . LEU A 1 204 ? 34.509  16.956  26.361 1.00 26.51 ? 1181 LEU A C     1 
ATOM   1378 O  O     . LEU A 1 204 ? 34.898  18.065  26.729 1.00 27.28 ? 1181 LEU A O     1 
ATOM   1379 C  CB    . LEU A 1 204 ? 32.650  15.842  27.587 1.00 20.23 ? 1181 LEU A CB    1 
ATOM   1380 C  CG    . LEU A 1 204 ? 31.168  15.591  27.875 1.00 19.64 ? 1181 LEU A CG    1 
ATOM   1381 C  CD1   . LEU A 1 204 ? 31.015  14.606  29.021 1.00 17.42 ? 1181 LEU A CD1   1 
ATOM   1382 C  CD2   . LEU A 1 204 ? 30.492  16.900  28.206 1.00 19.43 ? 1181 LEU A CD2   1 
ATOM   1383 N  N     . LYS A 1 205 ? 35.336  15.992  25.970 1.00 28.27 ? 1182 LYS A N     1 
ATOM   1384 C  CA    . LYS A 1 205 ? 36.779  16.172  25.994 1.00 31.53 ? 1182 LYS A CA    1 
ATOM   1385 C  C     . LYS A 1 205 ? 37.344  17.015  24.863 1.00 32.97 ? 1182 LYS A C     1 
ATOM   1386 O  O     . LYS A 1 205 ? 37.804  18.132  25.079 1.00 33.77 ? 1182 LYS A O     1 
ATOM   1387 C  CB    . LYS A 1 205 ? 37.485  14.808  25.994 1.00 33.17 ? 1182 LYS A CB    1 
ATOM   1388 C  CG    . LYS A 1 205 ? 38.999  14.895  26.179 1.00 33.41 ? 1182 LYS A CG    1 
ATOM   1389 C  CD    . LYS A 1 205 ? 39.663  13.530  26.166 1.00 33.30 ? 1182 LYS A CD    1 
ATOM   1390 C  CE    . LYS A 1 205 ? 41.150  13.657  26.444 1.00 31.74 ? 1182 LYS A CE    1 
ATOM   1391 N  NZ    . LYS A 1 205 ? 41.859  12.369  26.257 1.00 31.48 ? 1182 LYS A NZ    1 
ATOM   1392 N  N     . ASP A 1 206 ? 37.311  16.468  23.657 1.00 35.04 ? 1183 ASP A N     1 
ATOM   1393 C  CA    . ASP A 1 206 ? 37.861  17.147  22.499 1.00 36.91 ? 1183 ASP A CA    1 
ATOM   1394 C  C     . ASP A 1 206 ? 36.857  18.028  21.777 1.00 37.30 ? 1183 ASP A C     1 
ATOM   1395 O  O     . ASP A 1 206 ? 37.209  18.728  20.830 1.00 37.54 ? 1183 ASP A O     1 
ATOM   1396 C  CB    . ASP A 1 206 ? 38.432  16.112  21.527 1.00 39.46 ? 1183 ASP A CB    1 
ATOM   1397 C  CG    . ASP A 1 206 ? 39.367  15.119  22.211 1.00 42.73 ? 1183 ASP A CG    1 
ATOM   1398 O  OD1   . ASP A 1 206 ? 40.315  15.567  22.897 1.00 44.83 ? 1183 ASP A OD1   1 
ATOM   1399 O  OD2   . ASP A 1 206 ? 39.157  13.892  22.058 1.00 41.66 ? 1183 ASP A OD2   1 
ATOM   1400 N  N     . GLY A 1 207 ? 35.606  17.999  22.219 1.00 36.79 ? 1184 GLY A N     1 
ATOM   1401 C  CA    . GLY A 1 207 ? 34.596  18.806  21.564 1.00 34.74 ? 1184 GLY A CA    1 
ATOM   1402 C  C     . GLY A 1 207 ? 34.321  18.317  20.154 1.00 34.68 ? 1184 GLY A C     1 
ATOM   1403 O  O     . GLY A 1 207 ? 33.931  19.098  19.294 1.00 36.57 ? 1184 GLY A O     1 
ATOM   1404 N  N     . VAL A 1 208 ? 34.528  17.025  19.910 1.00 34.33 ? 1185 VAL A N     1 
ATOM   1405 C  CA    . VAL A 1 208 ? 34.284  16.452  18.587 1.00 32.60 ? 1185 VAL A CA    1 
ATOM   1406 C  C     . VAL A 1 208 ? 32.886  15.823  18.527 1.00 30.68 ? 1185 VAL A C     1 
ATOM   1407 O  O     . VAL A 1 208 ? 32.488  15.090  19.436 1.00 29.21 ? 1185 VAL A O     1 
ATOM   1408 C  CB    . VAL A 1 208 ? 35.335  15.350  18.228 1.00 34.28 ? 1185 VAL A CB    1 
ATOM   1409 C  CG1   . VAL A 1 208 ? 36.727  15.809  18.620 1.00 34.82 ? 1185 VAL A CG1   1 
ATOM   1410 C  CG2   . VAL A 1 208 ? 34.993  14.032  18.914 1.00 34.57 ? 1185 VAL A CG2   1 
ATOM   1411 N  N     . PHE A 1 209 ? 32.146  16.113  17.459 1.00 27.71 ? 1186 PHE A N     1 
ATOM   1412 C  CA    . PHE A 1 209 ? 30.808  15.555  17.287 1.00 24.88 ? 1186 PHE A CA    1 
ATOM   1413 C  C     . PHE A 1 209 ? 30.702  14.709  16.023 1.00 23.34 ? 1186 PHE A C     1 
ATOM   1414 O  O     . PHE A 1 209 ? 31.055  15.149  14.928 1.00 23.75 ? 1186 PHE A O     1 
ATOM   1415 C  CB    . PHE A 1 209 ? 29.756  16.666  17.250 1.00 24.40 ? 1186 PHE A CB    1 
ATOM   1416 C  CG    . PHE A 1 209 ? 29.634  17.427  18.536 1.00 24.16 ? 1186 PHE A CG    1 
ATOM   1417 C  CD1   . PHE A 1 209 ? 30.552  18.415  18.868 1.00 27.38 ? 1186 PHE A CD1   1 
ATOM   1418 C  CD2   . PHE A 1 209 ? 28.600  17.155  19.421 1.00 24.93 ? 1186 PHE A CD2   1 
ATOM   1419 C  CE1   . PHE A 1 209 ? 30.439  19.128  20.071 1.00 27.33 ? 1186 PHE A CE1   1 
ATOM   1420 C  CE2   . PHE A 1 209 ? 28.476  17.861  20.627 1.00 24.91 ? 1186 PHE A CE2   1 
ATOM   1421 C  CZ    . PHE A 1 209 ? 29.396  18.848  20.950 1.00 25.03 ? 1186 PHE A CZ    1 
ATOM   1422 N  N     . THR A 1 210 ? 30.211  13.486  16.188 1.00 21.54 ? 1187 THR A N     1 
ATOM   1423 C  CA    . THR A 1 210 ? 30.046  12.559  15.076 1.00 19.44 ? 1187 THR A CA    1 
ATOM   1424 C  C     . THR A 1 210 ? 28.709  11.863  15.217 1.00 18.71 ? 1187 THR A C     1 
ATOM   1425 O  O     . THR A 1 210 ? 27.974  12.091  16.178 1.00 17.70 ? 1187 THR A O     1 
ATOM   1426 C  CB    . THR A 1 210 ? 31.116  11.460  15.093 1.00 20.65 ? 1187 THR A CB    1 
ATOM   1427 O  OG1   . THR A 1 210 ? 30.869  10.580  16.201 1.00 21.20 ? 1187 THR A OG1   1 
ATOM   1428 C  CG2   . THR A 1 210 ? 32.512  12.066  15.234 1.00 21.27 ? 1187 THR A CG2   1 
ATOM   1429 N  N     . THR A 1 211 ? 28.392  11.008  14.256 1.00 18.84 ? 1188 THR A N     1 
ATOM   1430 C  CA    . THR A 1 211 ? 27.150  10.271  14.327 1.00 17.67 ? 1188 THR A CA    1 
ATOM   1431 C  C     . THR A 1 211 ? 27.285  9.327   15.522 1.00 18.86 ? 1188 THR A C     1 
ATOM   1432 O  O     . THR A 1 211 ? 26.292  8.913   16.119 1.00 19.40 ? 1188 THR A O     1 
ATOM   1433 C  CB    . THR A 1 211 ? 26.901  9.472   13.045 1.00 16.79 ? 1188 THR A CB    1 
ATOM   1434 O  OG1   . THR A 1 211 ? 25.612  8.854   13.126 1.00 19.19 ? 1188 THR A OG1   1 
ATOM   1435 C  CG2   . THR A 1 211 ? 27.976  8.404   12.850 1.00 13.54 ? 1188 THR A CG2   1 
ATOM   1436 N  N     . SER A 1 212 ? 28.526  8.997   15.873 1.00 19.05 ? 1189 SER A N     1 
ATOM   1437 C  CA    . SER A 1 212 ? 28.790  8.123   17.016 1.00 22.56 ? 1189 SER A CA    1 
ATOM   1438 C  C     . SER A 1 212 ? 28.468  8.841   18.331 1.00 20.17 ? 1189 SER A C     1 
ATOM   1439 O  O     . SER A 1 212 ? 27.995  8.214   19.281 1.00 20.04 ? 1189 SER A O     1 
ATOM   1440 C  CB    . SER A 1 212 ? 30.251  7.671   17.021 1.00 23.70 ? 1189 SER A CB    1 
ATOM   1441 O  OG    . SER A 1 212 ? 30.585  7.099   15.769 1.00 34.69 ? 1189 SER A OG    1 
ATOM   1442 N  N     . SER A 1 213 ? 28.729  10.145  18.396 1.00 16.34 ? 1190 SER A N     1 
ATOM   1443 C  CA    . SER A 1 213 ? 28.401  10.873  19.613 1.00 16.32 ? 1190 SER A CA    1 
ATOM   1444 C  C     . SER A 1 213 ? 26.874  11.026  19.661 1.00 15.72 ? 1190 SER A C     1 
ATOM   1445 O  O     . SER A 1 213 ? 26.282  11.215  20.728 1.00 15.63 ? 1190 SER A O     1 
ATOM   1446 C  CB    . SER A 1 213 ? 29.109  12.238  19.661 1.00 15.02 ? 1190 SER A CB    1 
ATOM   1447 O  OG    . SER A 1 213 ? 29.014  12.944  18.440 1.00 15.85 ? 1190 SER A OG    1 
ATOM   1448 N  N     . ASP A 1 214 ? 26.242  10.937  18.494 1.00 14.20 ? 1191 ASP A N     1 
ATOM   1449 C  CA    . ASP A 1 214 ? 24.790  11.015  18.415 1.00 13.46 ? 1191 ASP A CA    1 
ATOM   1450 C  C     . ASP A 1 214 ? 24.224  9.698   18.950 1.00 12.02 ? 1191 ASP A C     1 
ATOM   1451 O  O     . ASP A 1 214 ? 23.128  9.671   19.497 1.00 13.63 ? 1191 ASP A O     1 
ATOM   1452 C  CB    . ASP A 1 214 ? 24.332  11.242  16.965 1.00 11.41 ? 1191 ASP A CB    1 
ATOM   1453 C  CG    . ASP A 1 214 ? 24.326  12.720  16.570 1.00 12.64 ? 1191 ASP A CG    1 
ATOM   1454 O  OD1   . ASP A 1 214 ? 24.227  13.005  15.362 1.00 12.94 ? 1191 ASP A OD1   1 
ATOM   1455 O  OD2   . ASP A 1 214 ? 24.409  13.599  17.460 1.00 10.87 ? 1191 ASP A OD2   1 
ATOM   1456 N  N     . MET A 1 215 ? 24.978  8.611   18.794 1.00 12.19 ? 1192 MET A N     1 
ATOM   1457 C  CA    . MET A 1 215 ? 24.545  7.294   19.272 1.00 11.81 ? 1192 MET A CA    1 
ATOM   1458 C  C     . MET A 1 215 ? 24.549  7.297   20.796 1.00 11.21 ? 1192 MET A C     1 
ATOM   1459 O  O     . MET A 1 215 ? 23.655  6.743   21.443 1.00 11.56 ? 1192 MET A O     1 
ATOM   1460 C  CB    . MET A 1 215 ? 25.475  6.197   18.748 1.00 11.19 ? 1192 MET A CB    1 
ATOM   1461 C  CG    . MET A 1 215 ? 25.054  4.793   19.137 1.00 12.00 ? 1192 MET A CG    1 
ATOM   1462 S  SD    . MET A 1 215 ? 23.365  4.409   18.637 1.00 15.02 ? 1192 MET A SD    1 
ATOM   1463 C  CE    . MET A 1 215 ? 23.484  4.502   16.847 1.00 13.40 ? 1192 MET A CE    1 
ATOM   1464 N  N     . TRP A 1 216 ? 25.566  7.926   21.366 1.00 10.47 ? 1193 TRP A N     1 
ATOM   1465 C  CA    . TRP A 1 216 ? 25.659  8.032   22.812 1.00 10.59 ? 1193 TRP A CA    1 
ATOM   1466 C  C     . TRP A 1 216 ? 24.378  8.725   23.301 1.00 12.21 ? 1193 TRP A C     1 
ATOM   1467 O  O     . TRP A 1 216 ? 23.683  8.215   24.176 1.00 12.85 ? 1193 TRP A O     1 
ATOM   1468 C  CB    . TRP A 1 216 ? 26.898  8.852   23.194 1.00 9.50  ? 1193 TRP A CB    1 
ATOM   1469 C  CG    . TRP A 1 216 ? 27.009  9.131   24.661 1.00 9.81  ? 1193 TRP A CG    1 
ATOM   1470 C  CD1   . TRP A 1 216 ? 26.257  10.014  25.390 1.00 9.83  ? 1193 TRP A CD1   1 
ATOM   1471 C  CD2   . TRP A 1 216 ? 27.876  8.478   25.593 1.00 9.62  ? 1193 TRP A CD2   1 
ATOM   1472 N  NE1   . TRP A 1 216 ? 26.599  9.943   26.718 1.00 10.22 ? 1193 TRP A NE1   1 
ATOM   1473 C  CE2   . TRP A 1 216 ? 27.590  9.008   26.871 1.00 11.77 ? 1193 TRP A CE2   1 
ATOM   1474 C  CE3   . TRP A 1 216 ? 28.864  7.495   25.473 1.00 11.18 ? 1193 TRP A CE3   1 
ATOM   1475 C  CZ2   . TRP A 1 216 ? 28.258  8.584   28.024 1.00 12.87 ? 1193 TRP A CZ2   1 
ATOM   1476 C  CZ3   . TRP A 1 216 ? 29.530  7.073   26.621 1.00 12.62 ? 1193 TRP A CZ3   1 
ATOM   1477 C  CH2   . TRP A 1 216 ? 29.222  7.619   27.879 1.00 12.54 ? 1193 TRP A CH2   1 
ATOM   1478 N  N     . SER A 1 217 ? 24.069  9.886   22.726 1.00 12.50 ? 1194 SER A N     1 
ATOM   1479 C  CA    . SER A 1 217 ? 22.870  10.632  23.106 1.00 13.48 ? 1194 SER A CA    1 
ATOM   1480 C  C     . SER A 1 217 ? 21.634  9.755   22.952 1.00 14.43 ? 1194 SER A C     1 
ATOM   1481 O  O     . SER A 1 217 ? 20.741  9.757   23.798 1.00 16.74 ? 1194 SER A O     1 
ATOM   1482 C  CB    . SER A 1 217 ? 22.714  11.876  22.227 1.00 12.84 ? 1194 SER A CB    1 
ATOM   1483 O  OG    . SER A 1 217 ? 23.864  12.700  22.305 1.00 13.38 ? 1194 SER A OG    1 
ATOM   1484 N  N     . PHE A 1 218 ? 21.591  9.009   21.858 1.00 14.19 ? 1195 PHE A N     1 
ATOM   1485 C  CA    . PHE A 1 218 ? 20.478  8.117   21.584 1.00 11.92 ? 1195 PHE A CA    1 
ATOM   1486 C  C     . PHE A 1 218 ? 20.273  7.212   22.797 1.00 12.89 ? 1195 PHE A C     1 
ATOM   1487 O  O     . PHE A 1 218 ? 19.145  6.975   23.228 1.00 11.37 ? 1195 PHE A O     1 
ATOM   1488 C  CB    . PHE A 1 218 ? 20.793  7.288   20.340 1.00 11.32 ? 1195 PHE A CB    1 
ATOM   1489 C  CG    . PHE A 1 218 ? 19.785  6.225   20.050 1.00 10.49 ? 1195 PHE A CG    1 
ATOM   1490 C  CD1   . PHE A 1 218 ? 18.478  6.561   19.714 1.00 8.79  ? 1195 PHE A CD1   1 
ATOM   1491 C  CD2   . PHE A 1 218 ? 20.139  4.883   20.119 1.00 8.47  ? 1195 PHE A CD2   1 
ATOM   1492 C  CE1   . PHE A 1 218 ? 17.536  5.574   19.449 1.00 8.91  ? 1195 PHE A CE1   1 
ATOM   1493 C  CE2   . PHE A 1 218 ? 19.203  3.888   19.855 1.00 10.95 ? 1195 PHE A CE2   1 
ATOM   1494 C  CZ    . PHE A 1 218 ? 17.897  4.236   19.519 1.00 7.02  ? 1195 PHE A CZ    1 
ATOM   1495 N  N     . GLY A 1 219 ? 21.376  6.711   23.346 1.00 13.73 ? 1196 GLY A N     1 
ATOM   1496 C  CA    . GLY A 1 219 ? 21.290  5.854   24.517 1.00 13.73 ? 1196 GLY A CA    1 
ATOM   1497 C  C     . GLY A 1 219 ? 20.633  6.559   25.692 1.00 14.97 ? 1196 GLY A C     1 
ATOM   1498 O  O     . GLY A 1 219 ? 19.836  5.968   26.424 1.00 13.64 ? 1196 GLY A O     1 
ATOM   1499 N  N     . VAL A 1 220 ? 20.966  7.832   25.878 1.00 14.96 ? 1197 VAL A N     1 
ATOM   1500 C  CA    . VAL A 1 220 ? 20.390  8.609   26.966 1.00 15.74 ? 1197 VAL A CA    1 
ATOM   1501 C  C     . VAL A 1 220 ? 18.892  8.824   26.724 1.00 16.37 ? 1197 VAL A C     1 
ATOM   1502 O  O     . VAL A 1 220 ? 18.110  8.960   27.674 1.00 17.34 ? 1197 VAL A O     1 
ATOM   1503 C  CB    . VAL A 1 220 ? 21.098  9.968   27.102 1.00 16.01 ? 1197 VAL A CB    1 
ATOM   1504 C  CG1   . VAL A 1 220 ? 20.498  10.764  28.267 1.00 12.59 ? 1197 VAL A CG1   1 
ATOM   1505 C  CG2   . VAL A 1 220 ? 22.588  9.744   27.300 1.00 12.43 ? 1197 VAL A CG2   1 
ATOM   1506 N  N     . VAL A 1 221 ? 18.495  8.853   25.454 1.00 14.92 ? 1198 VAL A N     1 
ATOM   1507 C  CA    . VAL A 1 221 ? 17.084  9.018   25.114 1.00 14.70 ? 1198 VAL A CA    1 
ATOM   1508 C  C     . VAL A 1 221 ? 16.355  7.755   25.570 1.00 14.68 ? 1198 VAL A C     1 
ATOM   1509 O  O     . VAL A 1 221 ? 15.255  7.823   26.120 1.00 15.68 ? 1198 VAL A O     1 
ATOM   1510 C  CB    . VAL A 1 221 ? 16.870  9.206   23.585 1.00 15.12 ? 1198 VAL A CB    1 
ATOM   1511 C  CG1   . VAL A 1 221 ? 15.391  9.260   23.279 1.00 11.13 ? 1198 VAL A CG1   1 
ATOM   1512 C  CG2   . VAL A 1 221 ? 17.544  10.487  23.102 1.00 11.60 ? 1198 VAL A CG2   1 
ATOM   1513 N  N     . LEU A 1 222 ? 16.975  6.601   25.339 1.00 16.53 ? 1199 LEU A N     1 
ATOM   1514 C  CA    . LEU A 1 222 ? 16.389  5.330   25.758 1.00 16.13 ? 1199 LEU A CA    1 
ATOM   1515 C  C     . LEU A 1 222 ? 16.287  5.353   27.271 1.00 15.89 ? 1199 LEU A C     1 
ATOM   1516 O  O     . LEU A 1 222 ? 15.286  4.954   27.855 1.00 17.13 ? 1199 LEU A O     1 
ATOM   1517 C  CB    . LEU A 1 222 ? 17.264  4.151   25.328 1.00 16.58 ? 1199 LEU A CB    1 
ATOM   1518 C  CG    . LEU A 1 222 ? 17.457  3.917   23.825 1.00 17.20 ? 1199 LEU A CG    1 
ATOM   1519 C  CD1   . LEU A 1 222 ? 18.303  2.660   23.604 1.00 17.13 ? 1199 LEU A CD1   1 
ATOM   1520 C  CD2   . LEU A 1 222 ? 16.110  3.779   23.150 1.00 14.55 ? 1199 LEU A CD2   1 
ATOM   1521 N  N     . TRP A 1 223 ? 17.339  5.831   27.912 1.00 17.87 ? 1200 TRP A N     1 
ATOM   1522 C  CA    . TRP A 1 223 ? 17.335  5.913   29.358 1.00 18.40 ? 1200 TRP A CA    1 
ATOM   1523 C  C     . TRP A 1 223 ? 16.167  6.819   29.770 1.00 19.39 ? 1200 TRP A C     1 
ATOM   1524 O  O     . TRP A 1 223 ? 15.392  6.486   30.667 1.00 20.75 ? 1200 TRP A O     1 
ATOM   1525 C  CB    . TRP A 1 223 ? 18.660  6.488   29.845 1.00 18.50 ? 1200 TRP A CB    1 
ATOM   1526 C  CG    . TRP A 1 223 ? 18.732  6.578   31.317 1.00 20.39 ? 1200 TRP A CG    1 
ATOM   1527 C  CD1   . TRP A 1 223 ? 19.172  5.617   32.181 1.00 18.88 ? 1200 TRP A CD1   1 
ATOM   1528 C  CD2   . TRP A 1 223 ? 18.317  7.684   32.120 1.00 19.87 ? 1200 TRP A CD2   1 
ATOM   1529 N  NE1   . TRP A 1 223 ? 19.058  6.060   33.475 1.00 20.21 ? 1200 TRP A NE1   1 
ATOM   1530 C  CE2   . TRP A 1 223 ? 18.533  7.326   33.467 1.00 20.00 ? 1200 TRP A CE2   1 
ATOM   1531 C  CE3   . TRP A 1 223 ? 17.778  8.946   31.829 1.00 19.97 ? 1200 TRP A CE3   1 
ATOM   1532 C  CZ2   . TRP A 1 223 ? 18.230  8.188   34.528 1.00 19.04 ? 1200 TRP A CZ2   1 
ATOM   1533 C  CZ3   . TRP A 1 223 ? 17.475  9.803   32.883 1.00 17.83 ? 1200 TRP A CZ3   1 
ATOM   1534 C  CH2   . TRP A 1 223 ? 17.703  9.419   34.216 1.00 18.36 ? 1200 TRP A CH2   1 
ATOM   1535 N  N     . GLU A 1 224 ? 16.043  7.964   29.105 1.00 18.15 ? 1201 GLU A N     1 
ATOM   1536 C  CA    . GLU A 1 224 ? 14.961  8.889   29.399 1.00 18.22 ? 1201 GLU A CA    1 
ATOM   1537 C  C     . GLU A 1 224 ? 13.613  8.184   29.264 1.00 19.90 ? 1201 GLU A C     1 
ATOM   1538 O  O     . GLU A 1 224 ? 12.728  8.333   30.104 1.00 21.56 ? 1201 GLU A O     1 
ATOM   1539 C  CB    . GLU A 1 224 ? 15.007  10.082  28.443 1.00 17.32 ? 1201 GLU A CB    1 
ATOM   1540 C  CG    . GLU A 1 224 ? 16.049  11.128  28.788 1.00 16.30 ? 1201 GLU A CG    1 
ATOM   1541 C  CD    . GLU A 1 224 ? 15.997  12.324  27.855 1.00 18.20 ? 1201 GLU A CD    1 
ATOM   1542 O  OE1   . GLU A 1 224 ? 16.484  12.208  26.713 1.00 16.75 ? 1201 GLU A OE1   1 
ATOM   1543 O  OE2   . GLU A 1 224 ? 15.455  13.378  28.256 1.00 19.87 ? 1201 GLU A OE2   1 
ATOM   1544 N  N     . ILE A 1 225 ? 13.461  7.411   28.199 1.00 19.93 ? 1202 ILE A N     1 
ATOM   1545 C  CA    . ILE A 1 225 ? 12.218  6.699   27.958 1.00 20.03 ? 1202 ILE A CA    1 
ATOM   1546 C  C     . ILE A 1 225 ? 11.871  5.687   29.044 1.00 21.01 ? 1202 ILE A C     1 
ATOM   1547 O  O     . ILE A 1 225 ? 10.713  5.549   29.434 1.00 22.61 ? 1202 ILE A O     1 
ATOM   1548 C  CB    . ILE A 1 225 ? 12.273  5.984   26.611 1.00 20.27 ? 1202 ILE A CB    1 
ATOM   1549 C  CG1   . ILE A 1 225 ? 12.372  7.027   25.494 1.00 19.01 ? 1202 ILE A CG1   1 
ATOM   1550 C  CG2   . ILE A 1 225 ? 11.052  5.093   26.444 1.00 20.01 ? 1202 ILE A CG2   1 
ATOM   1551 C  CD1   . ILE A 1 225 ? 12.671  6.452   24.144 1.00 15.85 ? 1202 ILE A CD1   1 
ATOM   1552 N  N     . THR A 1 226 ? 12.872  4.974   29.536 1.00 19.90 ? 1203 THR A N     1 
ATOM   1553 C  CA    . THR A 1 226 ? 12.626  3.980   30.564 1.00 19.74 ? 1203 THR A CA    1 
ATOM   1554 C  C     . THR A 1 226 ? 12.481  4.602   31.958 1.00 20.45 ? 1203 THR A C     1 
ATOM   1555 O  O     . THR A 1 226 ? 11.961  3.971   32.876 1.00 21.84 ? 1203 THR A O     1 
ATOM   1556 C  CB    . THR A 1 226 ? 13.755  2.935   30.571 1.00 18.92 ? 1203 THR A CB    1 
ATOM   1557 O  OG1   . THR A 1 226 ? 15.012  3.590   30.765 1.00 18.02 ? 1203 THR A OG1   1 
ATOM   1558 C  CG2   . THR A 1 226 ? 13.789  2.190   29.247 1.00 15.53 ? 1203 THR A CG2   1 
ATOM   1559 N  N     . SER A 1 227 ? 12.934  5.840   32.114 1.00 19.31 ? 1204 SER A N     1 
ATOM   1560 C  CA    . SER A 1 227 ? 12.851  6.517   33.402 1.00 19.30 ? 1204 SER A CA    1 
ATOM   1561 C  C     . SER A 1 227 ? 11.745  7.552   33.383 1.00 20.45 ? 1204 SER A C     1 
ATOM   1562 O  O     . SER A 1 227 ? 11.642  8.379   34.288 1.00 22.63 ? 1204 SER A O     1 
ATOM   1563 C  CB    . SER A 1 227 ? 14.172  7.214   33.715 1.00 17.60 ? 1204 SER A CB    1 
ATOM   1564 O  OG    . SER A 1 227 ? 14.496  8.145   32.696 1.00 19.95 ? 1204 SER A OG    1 
ATOM   1565 N  N     . LEU A 1 228 ? 10.920  7.494   32.345 1.00 20.41 ? 1205 LEU A N     1 
ATOM   1566 C  CA    . LEU A 1 228 ? 9.829   8.435   32.160 1.00 19.91 ? 1205 LEU A CA    1 
ATOM   1567 C  C     . LEU A 1 228 ? 10.315  9.871   32.282 1.00 21.45 ? 1205 LEU A C     1 
ATOM   1568 O  O     . LEU A 1 228 ? 9.744   10.684  33.010 1.00 21.29 ? 1205 LEU A O     1 
ATOM   1569 C  CB    . LEU A 1 228 ? 8.697   8.162   33.144 1.00 19.47 ? 1205 LEU A CB    1 
ATOM   1570 C  CG    . LEU A 1 228 ? 8.032   6.792   32.974 1.00 20.11 ? 1205 LEU A CG    1 
ATOM   1571 C  CD1   . LEU A 1 228 ? 6.827   6.732   33.882 1.00 19.50 ? 1205 LEU A CD1   1 
ATOM   1572 C  CD2   . LEU A 1 228 ? 7.602   6.559   31.523 1.00 18.15 ? 1205 LEU A CD2   1 
ATOM   1573 N  N     . ALA A 1 229 ? 11.392  10.152  31.551 1.00 22.76 ? 1206 ALA A N     1 
ATOM   1574 C  CA    . ALA A 1 229 ? 12.017  11.468  31.456 1.00 24.17 ? 1206 ALA A CA    1 
ATOM   1575 C  C     . ALA A 1 229 ? 12.604  12.090  32.712 1.00 26.22 ? 1206 ALA A C     1 
ATOM   1576 O  O     . ALA A 1 229 ? 12.492  13.301  32.924 1.00 25.26 ? 1206 ALA A O     1 
ATOM   1577 C  CB    . ALA A 1 229 ? 11.054  12.443  30.806 1.00 23.71 ? 1206 ALA A CB    1 
ATOM   1578 N  N     . GLU A 1 230 ? 13.230  11.272  33.548 1.00 27.90 ? 1207 GLU A N     1 
ATOM   1579 C  CA    . GLU A 1 230 ? 13.868  11.799  34.741 1.00 29.58 ? 1207 GLU A CA    1 
ATOM   1580 C  C     . GLU A 1 230 ? 15.083  12.571  34.262 1.00 28.84 ? 1207 GLU A C     1 
ATOM   1581 O  O     . GLU A 1 230 ? 15.492  12.440  33.110 1.00 27.46 ? 1207 GLU A O     1 
ATOM   1582 C  CB    . GLU A 1 230 ? 14.329  10.675  35.663 1.00 33.13 ? 1207 GLU A CB    1 
ATOM   1583 C  CG    . GLU A 1 230 ? 13.228  10.067  36.497 1.00 41.31 ? 1207 GLU A CG    1 
ATOM   1584 C  CD    . GLU A 1 230 ? 13.776  9.205   37.608 1.00 45.38 ? 1207 GLU A CD    1 
ATOM   1585 O  OE1   . GLU A 1 230 ? 14.630  9.707   38.371 1.00 48.61 ? 1207 GLU A OE1   1 
ATOM   1586 O  OE2   . GLU A 1 230 ? 13.355  8.032   37.721 1.00 48.17 ? 1207 GLU A OE2   1 
ATOM   1587 N  N     . GLN A 1 231 ? 15.655  13.378  35.143 1.00 29.04 ? 1208 GLN A N     1 
ATOM   1588 C  CA    . GLN A 1 231 ? 16.840  14.151  34.808 1.00 29.92 ? 1208 GLN A CA    1 
ATOM   1589 C  C     . GLN A 1 231 ? 18.065  13.242  34.896 1.00 30.27 ? 1208 GLN A C     1 
ATOM   1590 O  O     . GLN A 1 231 ? 18.339  12.658  35.943 1.00 30.01 ? 1208 GLN A O     1 
ATOM   1591 C  CB    . GLN A 1 231 ? 16.982  15.323  35.782 1.00 31.12 ? 1208 GLN A CB    1 
ATOM   1592 C  CG    . GLN A 1 231 ? 18.413  15.727  36.097 1.00 34.93 ? 1208 GLN A CG    1 
ATOM   1593 C  CD    . GLN A 1 231 ? 18.809  17.042  35.465 1.00 37.25 ? 1208 GLN A CD    1 
ATOM   1594 O  OE1   . GLN A 1 231 ? 18.762  17.195  34.242 1.00 40.46 ? 1208 GLN A OE1   1 
ATOM   1595 N  NE2   . GLN A 1 231 ? 19.208  18.003  36.296 1.00 36.42 ? 1208 GLN A NE2   1 
ATOM   1596 N  N     . PRO A 1 232 ? 18.811  13.097  33.789 1.00 30.54 ? 1209 PRO A N     1 
ATOM   1597 C  CA    . PRO A 1 232 ? 19.999  12.239  33.823 1.00 29.67 ? 1209 PRO A CA    1 
ATOM   1598 C  C     . PRO A 1 232 ? 21.042  12.779  34.805 1.00 28.71 ? 1209 PRO A C     1 
ATOM   1599 O  O     . PRO A 1 232 ? 21.354  13.968  34.798 1.00 27.33 ? 1209 PRO A O     1 
ATOM   1600 C  CB    . PRO A 1 232 ? 20.481  12.259  32.371 1.00 29.20 ? 1209 PRO A CB    1 
ATOM   1601 C  CG    . PRO A 1 232 ? 20.029  13.600  31.879 1.00 30.68 ? 1209 PRO A CG    1 
ATOM   1602 C  CD    . PRO A 1 232 ? 18.639  13.705  32.458 1.00 30.56 ? 1209 PRO A CD    1 
ATOM   1603 N  N     . TYR A 1 233 ? 21.568  11.893  35.647 1.00 29.49 ? 1210 TYR A N     1 
ATOM   1604 C  CA    . TYR A 1 233 ? 22.570  12.252  36.645 1.00 32.20 ? 1210 TYR A CA    1 
ATOM   1605 C  C     . TYR A 1 233 ? 22.023  13.207  37.706 1.00 35.39 ? 1210 TYR A C     1 
ATOM   1606 O  O     . TYR A 1 233 ? 22.742  14.077  38.199 1.00 34.31 ? 1210 TYR A O     1 
ATOM   1607 C  CB    . TYR A 1 233 ? 23.793  12.881  35.970 1.00 31.28 ? 1210 TYR A CB    1 
ATOM   1608 C  CG    . TYR A 1 233 ? 24.342  12.067  34.820 1.00 31.64 ? 1210 TYR A CG    1 
ATOM   1609 C  CD1   . TYR A 1 233 ? 24.088  12.433  33.495 1.00 29.99 ? 1210 TYR A CD1   1 
ATOM   1610 C  CD2   . TYR A 1 233 ? 25.095  10.912  35.053 1.00 32.18 ? 1210 TYR A CD2   1 
ATOM   1611 C  CE1   . TYR A 1 233 ? 24.567  11.672  32.433 1.00 29.75 ? 1210 TYR A CE1   1 
ATOM   1612 C  CE2   . TYR A 1 233 ? 25.581  10.137  33.993 1.00 31.38 ? 1210 TYR A CE2   1 
ATOM   1613 C  CZ    . TYR A 1 233 ? 25.314  10.525  32.688 1.00 31.54 ? 1210 TYR A CZ    1 
ATOM   1614 O  OH    . TYR A 1 233 ? 25.793  9.769   31.642 1.00 30.92 ? 1210 TYR A OH    1 
ATOM   1615 N  N     . GLN A 1 234 ? 20.749  13.042  38.055 1.00 39.55 ? 1211 GLN A N     1 
ATOM   1616 C  CA    . GLN A 1 234 ? 20.115  13.889  39.061 1.00 42.87 ? 1211 GLN A CA    1 
ATOM   1617 C  C     . GLN A 1 234 ? 20.926  13.806  40.342 1.00 44.04 ? 1211 GLN A C     1 
ATOM   1618 O  O     . GLN A 1 234 ? 21.173  12.713  40.860 1.00 43.41 ? 1211 GLN A O     1 
ATOM   1619 C  CB    . GLN A 1 234 ? 18.688  13.416  39.347 1.00 45.57 ? 1211 GLN A CB    1 
ATOM   1620 C  CG    . GLN A 1 234 ? 17.916  14.311  40.310 1.00 51.47 ? 1211 GLN A CG    1 
ATOM   1621 C  CD    . GLN A 1 234 ? 17.429  15.597  39.655 1.00 55.70 ? 1211 GLN A CD    1 
ATOM   1622 O  OE1   . GLN A 1 234 ? 17.837  16.701  40.030 1.00 58.56 ? 1211 GLN A OE1   1 
ATOM   1623 N  NE2   . GLN A 1 234 ? 16.548  15.458  38.670 1.00 57.58 ? 1211 GLN A NE2   1 
ATOM   1624 N  N     . GLY A 1 235 ? 21.338  14.961  40.852 1.00 44.44 ? 1212 GLY A N     1 
ATOM   1625 C  CA    . GLY A 1 235 ? 22.123  14.979  42.070 1.00 44.22 ? 1212 GLY A CA    1 
ATOM   1626 C  C     . GLY A 1 235 ? 23.512  15.501  41.784 1.00 43.83 ? 1212 GLY A C     1 
ATOM   1627 O  O     . GLY A 1 235 ? 24.127  16.151  42.631 1.00 44.95 ? 1212 GLY A O     1 
ATOM   1628 N  N     . LEU A 1 236 ? 24.002  15.215  40.581 1.00 42.39 ? 1213 LEU A N     1 
ATOM   1629 C  CA    . LEU A 1 236 ? 25.322  15.671  40.166 1.00 40.33 ? 1213 LEU A CA    1 
ATOM   1630 C  C     . LEU A 1 236 ? 25.203  17.002  39.442 1.00 39.65 ? 1213 LEU A C     1 
ATOM   1631 O  O     . LEU A 1 236 ? 24.199  17.283  38.789 1.00 39.74 ? 1213 LEU A O     1 
ATOM   1632 C  CB    . LEU A 1 236 ? 25.991  14.651  39.237 1.00 38.84 ? 1213 LEU A CB    1 
ATOM   1633 C  CG    . LEU A 1 236 ? 26.140  13.202  39.712 1.00 39.19 ? 1213 LEU A CG    1 
ATOM   1634 C  CD1   . LEU A 1 236 ? 27.174  12.503  38.847 1.00 38.53 ? 1213 LEU A CD1   1 
ATOM   1635 C  CD2   . LEU A 1 236 ? 26.579  13.162  41.166 1.00 39.95 ? 1213 LEU A CD2   1 
ATOM   1636 N  N     . SER A 1 237 ? 26.237  17.819  39.568 1.00 39.61 ? 1214 SER A N     1 
ATOM   1637 C  CA    . SER A 1 237 ? 26.272  19.114  38.915 1.00 40.28 ? 1214 SER A CA    1 
ATOM   1638 C  C     . SER A 1 237 ? 26.864  18.896  37.532 1.00 41.43 ? 1214 SER A C     1 
ATOM   1639 O  O     . SER A 1 237 ? 27.564  17.911  37.303 1.00 40.96 ? 1214 SER A O     1 
ATOM   1640 C  CB    . SER A 1 237 ? 27.168  20.063  39.700 1.00 40.06 ? 1214 SER A CB    1 
ATOM   1641 O  OG    . SER A 1 237 ? 28.492  19.556  39.751 1.00 40.85 ? 1214 SER A OG    1 
ATOM   1642 N  N     . ASN A 1 238 ? 26.591  19.813  36.612 1.00 42.73 ? 1215 ASN A N     1 
ATOM   1643 C  CA    . ASN A 1 238 ? 27.123  19.692  35.262 1.00 46.09 ? 1215 ASN A CA    1 
ATOM   1644 C  C     . ASN A 1 238 ? 28.649  19.591  35.339 1.00 47.29 ? 1215 ASN A C     1 
ATOM   1645 O  O     . ASN A 1 238 ? 29.308  19.086  34.428 1.00 46.07 ? 1215 ASN A O     1 
ATOM   1646 C  CB    . ASN A 1 238 ? 26.705  20.904  34.422 1.00 46.61 ? 1215 ASN A CB    1 
ATOM   1647 C  CG    . ASN A 1 238 ? 25.200  21.142  34.451 1.00 48.62 ? 1215 ASN A CG    1 
ATOM   1648 O  OD1   . ASN A 1 238 ? 24.401  20.216  34.278 1.00 47.57 ? 1215 ASN A OD1   1 
ATOM   1649 N  ND2   . ASN A 1 238 ? 24.808  22.392  34.666 1.00 49.31 ? 1215 ASN A ND2   1 
ATOM   1650 N  N     . GLU A 1 239 ? 29.194  20.082  36.445 1.00 49.40 ? 1216 GLU A N     1 
ATOM   1651 C  CA    . GLU A 1 239 ? 30.628  20.066  36.698 1.00 50.81 ? 1216 GLU A CA    1 
ATOM   1652 C  C     . GLU A 1 239 ? 31.074  18.632  36.965 1.00 49.32 ? 1216 GLU A C     1 
ATOM   1653 O  O     . GLU A 1 239 ? 32.094  18.176  36.447 1.00 48.69 ? 1216 GLU A O     1 
ATOM   1654 C  CB    . GLU A 1 239 ? 30.937  20.934  37.924 1.00 56.35 ? 1216 GLU A CB    1 
ATOM   1655 C  CG    . GLU A 1 239 ? 32.400  20.960  38.363 1.00 62.49 ? 1216 GLU A CG    1 
ATOM   1656 C  CD    . GLU A 1 239 ? 33.172  22.120  37.762 1.00 66.75 ? 1216 GLU A CD    1 
ATOM   1657 O  OE1   . GLU A 1 239 ? 32.749  23.280  37.969 1.00 69.17 ? 1216 GLU A OE1   1 
ATOM   1658 O  OE2   . GLU A 1 239 ? 34.201  21.875  37.091 1.00 68.64 ? 1216 GLU A OE2   1 
ATOM   1659 N  N     . GLN A 1 240 ? 30.297  17.926  37.778 1.00 46.89 ? 1217 GLN A N     1 
ATOM   1660 C  CA    . GLN A 1 240 ? 30.611  16.550  38.137 1.00 45.12 ? 1217 GLN A CA    1 
ATOM   1661 C  C     . GLN A 1 240 ? 30.284  15.562  37.012 1.00 43.36 ? 1217 GLN A C     1 
ATOM   1662 O  O     . GLN A 1 240 ? 31.019  14.595  36.792 1.00 42.34 ? 1217 GLN A O     1 
ATOM   1663 C  CB    . GLN A 1 240 ? 29.865  16.186  39.425 1.00 46.35 ? 1217 GLN A CB    1 
ATOM   1664 C  CG    . GLN A 1 240 ? 30.158  17.153  40.574 1.00 47.42 ? 1217 GLN A CG    1 
ATOM   1665 C  CD    . GLN A 1 240 ? 29.360  16.855  41.831 1.00 49.89 ? 1217 GLN A CD    1 
ATOM   1666 O  OE1   . GLN A 1 240 ? 28.128  16.902  41.828 1.00 50.80 ? 1217 GLN A OE1   1 
ATOM   1667 N  NE2   . GLN A 1 240 ? 30.063  16.551  42.917 1.00 50.87 ? 1217 GLN A NE2   1 
ATOM   1668 N  N     . VAL A 1 241 ? 29.186  15.803  36.300 1.00 40.26 ? 1218 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 241 ? 28.802  14.931  35.197 1.00 37.11 ? 1218 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 241 ? 29.940  14.947  34.186 1.00 36.07 ? 1218 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 241 ? 30.338  13.911  33.662 1.00 35.16 ? 1218 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 241 ? 27.513  15.428  34.495 1.00 36.58 ? 1218 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 241 ? 27.237  14.588  33.261 1.00 35.11 ? 1218 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 241 ? 26.328  15.357  35.449 1.00 34.83 ? 1218 VAL A CG2   1 
ATOM   1675 N  N     . LEU A 1 242 ? 30.459  16.142  33.930 1.00 34.97 ? 1219 LEU A N     1 
ATOM   1676 C  CA    . LEU A 1 242 ? 31.546  16.344  32.982 1.00 35.29 ? 1219 LEU A CA    1 
ATOM   1677 C  C     . LEU A 1 242 ? 32.738  15.444  33.285 1.00 34.11 ? 1219 LEU A C     1 
ATOM   1678 O  O     . LEU A 1 242 ? 33.289  14.811  32.385 1.00 33.15 ? 1219 LEU A O     1 
ATOM   1679 C  CB    . LEU A 1 242 ? 31.992  17.812  33.003 1.00 37.55 ? 1219 LEU A CB    1 
ATOM   1680 C  CG    . LEU A 1 242 ? 32.972  18.294  31.925 1.00 40.29 ? 1219 LEU A CG    1 
ATOM   1681 C  CD1   . LEU A 1 242 ? 32.269  18.377  30.583 1.00 40.54 ? 1219 LEU A CD1   1 
ATOM   1682 C  CD2   . LEU A 1 242 ? 33.508  19.669  32.300 1.00 44.27 ? 1219 LEU A CD2   1 
ATOM   1683 N  N     . LYS A 1 243 ? 33.136  15.390  34.552 1.00 33.61 ? 1220 LYS A N     1 
ATOM   1684 C  CA    . LYS A 1 243 ? 34.269  14.569  34.944 1.00 33.30 ? 1220 LYS A CA    1 
ATOM   1685 C  C     . LYS A 1 243 ? 33.883  13.100  34.969 1.00 30.88 ? 1220 LYS A C     1 
ATOM   1686 O  O     . LYS A 1 243 ? 34.621  12.249  34.477 1.00 32.11 ? 1220 LYS A O     1 
ATOM   1687 C  CB    . LYS A 1 243 ? 34.784  14.977  36.324 1.00 37.96 ? 1220 LYS A CB    1 
ATOM   1688 C  CG    . LYS A 1 243 ? 36.039  14.220  36.727 1.00 42.80 ? 1220 LYS A CG    1 
ATOM   1689 C  CD    . LYS A 1 243 ? 36.417  14.442  38.176 1.00 44.84 ? 1220 LYS A CD    1 
ATOM   1690 C  CE    . LYS A 1 243 ? 37.699  13.689  38.502 1.00 49.01 ? 1220 LYS A CE    1 
ATOM   1691 N  NZ    . LYS A 1 243 ? 38.068  13.787  39.940 1.00 53.22 ? 1220 LYS A NZ    1 
ATOM   1692 N  N     . PHE A 1 244 ? 32.720  12.811  35.546 1.00 27.63 ? 1221 PHE A N     1 
ATOM   1693 C  CA    . PHE A 1 244 ? 32.211  11.444  35.655 1.00 23.45 ? 1221 PHE A CA    1 
ATOM   1694 C  C     . PHE A 1 244 ? 32.197  10.734  34.308 1.00 23.05 ? 1221 PHE A C     1 
ATOM   1695 O  O     . PHE A 1 244 ? 32.740  9.640   34.160 1.00 21.74 ? 1221 PHE A O     1 
ATOM   1696 C  CB    . PHE A 1 244 ? 30.798  11.468  36.231 1.00 20.64 ? 1221 PHE A CB    1 
ATOM   1697 C  CG    . PHE A 1 244 ? 30.211  10.107  36.473 1.00 19.91 ? 1221 PHE A CG    1 
ATOM   1698 C  CD1   . PHE A 1 244 ? 30.718  9.282   37.473 1.00 18.20 ? 1221 PHE A CD1   1 
ATOM   1699 C  CD2   . PHE A 1 244 ? 29.138  9.654   35.711 1.00 16.53 ? 1221 PHE A CD2   1 
ATOM   1700 C  CE1   . PHE A 1 244 ? 30.163  8.023   37.715 1.00 17.71 ? 1221 PHE A CE1   1 
ATOM   1701 C  CE2   . PHE A 1 244 ? 28.579  8.404   35.943 1.00 19.74 ? 1221 PHE A CE2   1 
ATOM   1702 C  CZ    . PHE A 1 244 ? 29.095  7.582   36.952 1.00 18.34 ? 1221 PHE A CZ    1 
ATOM   1703 N  N     . VAL A 1 245 ? 31.570  11.367  33.324 1.00 23.69 ? 1222 VAL A N     1 
ATOM   1704 C  CA    . VAL A 1 245 ? 31.479  10.791  31.992 1.00 23.47 ? 1222 VAL A CA    1 
ATOM   1705 C  C     . VAL A 1 245 ? 32.849  10.679  31.353 1.00 23.32 ? 1222 VAL A C     1 
ATOM   1706 O  O     . VAL A 1 245 ? 33.164  9.665   30.728 1.00 23.40 ? 1222 VAL A O     1 
ATOM   1707 C  CB    . VAL A 1 245 ? 30.551  11.628  31.072 1.00 23.85 ? 1222 VAL A CB    1 
ATOM   1708 C  CG1   . VAL A 1 245 ? 30.564  11.065  29.656 1.00 22.08 ? 1222 VAL A CG1   1 
ATOM   1709 C  CG2   . VAL A 1 245 ? 29.128  11.611  31.623 1.00 24.21 ? 1222 VAL A CG2   1 
ATOM   1710 N  N     . MET A 1 246 ? 33.669  11.712  31.509 1.00 22.00 ? 1223 MET A N     1 
ATOM   1711 C  CA    . MET A 1 246 ? 34.996  11.674  30.919 1.00 24.31 ? 1223 MET A CA    1 
ATOM   1712 C  C     . MET A 1 246 ? 35.905  10.632  31.550 1.00 24.70 ? 1223 MET A C     1 
ATOM   1713 O  O     . MET A 1 246 ? 36.886  10.213  30.934 1.00 25.50 ? 1223 MET A O     1 
ATOM   1714 C  CB    . MET A 1 246 ? 35.654  13.047  30.976 1.00 26.01 ? 1223 MET A CB    1 
ATOM   1715 C  CG    . MET A 1 246 ? 35.141  13.994  29.909 1.00 26.71 ? 1223 MET A CG    1 
ATOM   1716 S  SD    . MET A 1 246 ? 36.251  15.379  29.654 1.00 30.32 ? 1223 MET A SD    1 
ATOM   1717 C  CE    . MET A 1 246 ? 35.529  16.585  30.709 1.00 28.11 ? 1223 MET A CE    1 
ATOM   1718 N  N     . ASP A 1 247 ? 35.579  10.211  32.770 1.00 24.88 ? 1224 ASP A N     1 
ATOM   1719 C  CA    . ASP A 1 247 ? 36.370  9.192   33.457 1.00 25.09 ? 1224 ASP A CA    1 
ATOM   1720 C  C     . ASP A 1 247 ? 35.920  7.801   33.047 1.00 25.43 ? 1224 ASP A C     1 
ATOM   1721 O  O     . ASP A 1 247 ? 36.536  6.802   33.430 1.00 24.70 ? 1224 ASP A O     1 
ATOM   1722 C  CB    . ASP A 1 247 ? 36.251  9.330   34.973 1.00 25.20 ? 1224 ASP A CB    1 
ATOM   1723 C  CG    . ASP A 1 247 ? 37.080  10.468  35.514 1.00 26.99 ? 1224 ASP A CG    1 
ATOM   1724 O  OD1   . ASP A 1 247 ? 38.028  10.889  34.809 1.00 28.43 ? 1224 ASP A OD1   1 
ATOM   1725 O  OD2   . ASP A 1 247 ? 36.793  10.930  36.640 1.00 24.21 ? 1224 ASP A OD2   1 
ATOM   1726 N  N     . GLY A 1 248 ? 34.840  7.743   32.271 1.00 24.10 ? 1225 GLY A N     1 
ATOM   1727 C  CA    . GLY A 1 248 ? 34.329  6.470   31.810 1.00 21.57 ? 1225 GLY A CA    1 
ATOM   1728 C  C     . GLY A 1 248 ? 33.025  6.043   32.452 1.00 21.92 ? 1225 GLY A C     1 
ATOM   1729 O  O     . GLY A 1 248 ? 32.540  4.946   32.179 1.00 23.86 ? 1225 GLY A O     1 
ATOM   1730 N  N     . GLY A 1 249 ? 32.452  6.895   33.298 1.00 21.70 ? 1226 GLY A N     1 
ATOM   1731 C  CA    . GLY A 1 249 ? 31.198  6.555   33.947 1.00 21.87 ? 1226 GLY A CA    1 
ATOM   1732 C  C     . GLY A 1 249 ? 29.979  6.775   33.061 1.00 24.15 ? 1226 GLY A C     1 
ATOM   1733 O  O     . GLY A 1 249 ? 30.049  7.491   32.061 1.00 23.11 ? 1226 GLY A O     1 
ATOM   1734 N  N     . TYR A 1 250 ? 28.865  6.137   33.407 1.00 24.43 ? 1227 TYR A N     1 
ATOM   1735 C  CA    . TYR A 1 250 ? 27.624  6.297   32.661 1.00 27.90 ? 1227 TYR A CA    1 
ATOM   1736 C  C     . TYR A 1 250 ? 26.412  6.069   33.561 1.00 28.82 ? 1227 TYR A C     1 
ATOM   1737 O  O     . TYR A 1 250 ? 26.552  5.701   34.724 1.00 30.84 ? 1227 TYR A O     1 
ATOM   1738 C  CB    . TYR A 1 250 ? 27.572  5.362   31.447 1.00 29.20 ? 1227 TYR A CB    1 
ATOM   1739 C  CG    . TYR A 1 250 ? 27.941  3.926   31.726 1.00 31.27 ? 1227 TYR A CG    1 
ATOM   1740 C  CD1   . TYR A 1 250 ? 29.271  3.506   31.675 1.00 32.14 ? 1227 TYR A CD1   1 
ATOM   1741 C  CD2   . TYR A 1 250 ? 26.963  2.988   32.048 1.00 32.20 ? 1227 TYR A CD2   1 
ATOM   1742 C  CE1   . TYR A 1 250 ? 29.619  2.182   31.941 1.00 34.21 ? 1227 TYR A CE1   1 
ATOM   1743 C  CE2   . TYR A 1 250 ? 27.296  1.662   32.318 1.00 34.70 ? 1227 TYR A CE2   1 
ATOM   1744 C  CZ    . TYR A 1 250 ? 28.626  1.266   32.262 1.00 36.75 ? 1227 TYR A CZ    1 
ATOM   1745 O  OH    . TYR A 1 250 ? 28.958  -0.043  32.531 1.00 39.02 ? 1227 TYR A OH    1 
ATOM   1746 N  N     . LEU A 1 251 ? 25.223  6.293   33.015 1.00 28.55 ? 1228 LEU A N     1 
ATOM   1747 C  CA    . LEU A 1 251 ? 23.977  6.152   33.758 1.00 29.35 ? 1228 LEU A CA    1 
ATOM   1748 C  C     . LEU A 1 251 ? 23.646  4.749   34.267 1.00 30.82 ? 1228 LEU A C     1 
ATOM   1749 O  O     . LEU A 1 251 ? 23.952  3.747   33.622 1.00 31.52 ? 1228 LEU A O     1 
ATOM   1750 C  CB    . LEU A 1 251 ? 22.819  6.664   32.895 1.00 26.54 ? 1228 LEU A CB    1 
ATOM   1751 C  CG    . LEU A 1 251 ? 22.858  8.162   32.591 1.00 25.29 ? 1228 LEU A CG    1 
ATOM   1752 C  CD1   . LEU A 1 251 ? 22.036  8.469   31.357 1.00 22.04 ? 1228 LEU A CD1   1 
ATOM   1753 C  CD2   . LEU A 1 251 ? 22.345  8.932   33.802 1.00 22.61 ? 1228 LEU A CD2   1 
ATOM   1754 N  N     . ASP A 1 252 ? 23.014  4.701   35.437 1.00 32.60 ? 1229 ASP A N     1 
ATOM   1755 C  CA    . ASP A 1 252 ? 22.589  3.455   36.058 1.00 34.07 ? 1229 ASP A CA    1 
ATOM   1756 C  C     . ASP A 1 252 ? 21.268  3.092   35.419 1.00 35.40 ? 1229 ASP A C     1 
ATOM   1757 O  O     . ASP A 1 252 ? 20.496  3.975   35.057 1.00 35.14 ? 1229 ASP A O     1 
ATOM   1758 C  CB    . ASP A 1 252 ? 22.362  3.653   37.556 1.00 37.09 ? 1229 ASP A CB    1 
ATOM   1759 C  CG    . ASP A 1 252 ? 23.651  3.763   38.335 1.00 39.45 ? 1229 ASP A CG    1 
ATOM   1760 O  OD1   . ASP A 1 252 ? 23.584  4.103   39.536 1.00 41.66 ? 1229 ASP A OD1   1 
ATOM   1761 O  OD2   . ASP A 1 252 ? 24.725  3.504   37.754 1.00 40.48 ? 1229 ASP A OD2   1 
ATOM   1762 N  N     . GLN A 1 253 ? 20.996  1.804   35.278 1.00 37.67 ? 1230 GLN A N     1 
ATOM   1763 C  CA    . GLN A 1 253 ? 19.735  1.395   34.684 1.00 40.79 ? 1230 GLN A CA    1 
ATOM   1764 C  C     . GLN A 1 253 ? 18.565  1.818   35.548 1.00 41.29 ? 1230 GLN A C     1 
ATOM   1765 O  O     . GLN A 1 253 ? 18.631  1.747   36.775 1.00 42.02 ? 1230 GLN A O     1 
ATOM   1766 C  CB    . GLN A 1 253 ? 19.701  -0.117  34.495 1.00 42.09 ? 1230 GLN A CB    1 
ATOM   1767 C  CG    . GLN A 1 253 ? 20.643  -0.572  33.419 1.00 47.20 ? 1230 GLN A CG    1 
ATOM   1768 C  CD    . GLN A 1 253 ? 20.510  0.285   32.176 1.00 49.01 ? 1230 GLN A CD    1 
ATOM   1769 O  OE1   . GLN A 1 253 ? 19.400  0.548   31.705 1.00 49.85 ? 1230 GLN A OE1   1 
ATOM   1770 N  NE2   . GLN A 1 253 ? 21.642  0.727   31.638 1.00 48.76 ? 1230 GLN A NE2   1 
ATOM   1771 N  N     . PRO A 1 254 ? 17.484  2.298   34.920 1.00 42.13 ? 1231 PRO A N     1 
ATOM   1772 C  CA    . PRO A 1 254 ? 16.325  2.709   35.716 1.00 42.26 ? 1231 PRO A CA    1 
ATOM   1773 C  C     . PRO A 1 254 ? 15.793  1.466   36.411 1.00 42.47 ? 1231 PRO A C     1 
ATOM   1774 O  O     . PRO A 1 254 ? 16.116  0.349   36.010 1.00 40.91 ? 1231 PRO A O     1 
ATOM   1775 C  CB    . PRO A 1 254 ? 15.355  3.248   34.665 1.00 42.16 ? 1231 PRO A CB    1 
ATOM   1776 C  CG    . PRO A 1 254 ? 16.281  3.794   33.605 1.00 42.34 ? 1231 PRO A CG    1 
ATOM   1777 C  CD    . PRO A 1 254 ? 17.332  2.704   33.511 1.00 42.44 ? 1231 PRO A CD    1 
ATOM   1778 N  N     . ASP A 1 255 ? 14.984  1.657   37.448 1.00 44.68 ? 1232 ASP A N     1 
ATOM   1779 C  CA    . ASP A 1 255 ? 14.424  0.526   38.178 1.00 45.76 ? 1232 ASP A CA    1 
ATOM   1780 C  C     . ASP A 1 255 ? 13.574  -0.356  37.270 1.00 45.77 ? 1232 ASP A C     1 
ATOM   1781 O  O     . ASP A 1 255 ? 12.786  0.138   36.458 1.00 45.60 ? 1232 ASP A O     1 
ATOM   1782 C  CB    . ASP A 1 255 ? 13.592  1.017   39.368 1.00 46.82 ? 1232 ASP A CB    1 
ATOM   1783 C  CG    . ASP A 1 255 ? 14.453  1.442   40.548 1.00 49.31 ? 1232 ASP A CG    1 
ATOM   1784 O  OD1   . ASP A 1 255 ? 13.884  1.903   41.558 1.00 50.94 ? 1232 ASP A OD1   1 
ATOM   1785 O  OD2   . ASP A 1 255 ? 15.696  1.311   40.470 1.00 50.69 ? 1232 ASP A OD2   1 
ATOM   1786 N  N     . ASN A 1 256 ? 13.752  -1.667  37.415 1.00 45.52 ? 1233 ASN A N     1 
ATOM   1787 C  CA    . ASN A 1 256 ? 13.020  -2.656  36.628 1.00 45.72 ? 1233 ASN A CA    1 
ATOM   1788 C  C     . ASN A 1 256 ? 13.008  -2.335  35.136 1.00 44.17 ? 1233 ASN A C     1 
ATOM   1789 O  O     . ASN A 1 256 ? 12.004  -2.521  34.449 1.00 44.30 ? 1233 ASN A O     1 
ATOM   1790 C  CB    . ASN A 1 256 ? 11.585  -2.783  37.147 1.00 46.88 ? 1233 ASN A CB    1 
ATOM   1791 C  CG    . ASN A 1 256 ? 11.528  -3.036  38.639 1.00 46.74 ? 1233 ASN A CG    1 
ATOM   1792 O  OD1   . ASN A 1 256 ? 11.529  -2.099  39.443 1.00 46.24 ? 1233 ASN A OD1   1 
ATOM   1793 N  ND2   . ASN A 1 256 ? 11.500  -4.307  39.020 1.00 45.99 ? 1233 ASN A ND2   1 
ATOM   1794 N  N     . CYS A 1 257 ? 14.134  -1.847  34.639 1.00 43.37 ? 1234 CYS A N     1 
ATOM   1795 C  CA    . CYS A 1 257 ? 14.249  -1.519  33.230 1.00 42.05 ? 1234 CYS A CA    1 
ATOM   1796 C  C     . CYS A 1 257 ? 14.315  -2.832  32.444 1.00 40.06 ? 1234 CYS A C     1 
ATOM   1797 O  O     . CYS A 1 257 ? 14.978  -3.783  32.863 1.00 38.48 ? 1234 CYS A O     1 
ATOM   1798 C  CB    . CYS A 1 257 ? 15.515  -0.686  32.997 1.00 41.92 ? 1234 CYS A CB    1 
ATOM   1799 S  SG    . CYS A 1 257 ? 15.820  -0.248  31.281 1.00 40.14 ? 1234 CYS A SG    1 
ATOM   1800 N  N     . PRO A 1 258 ? 13.608  -2.911  31.308 1.00 39.30 ? 1235 PRO A N     1 
ATOM   1801 C  CA    . PRO A 1 258 ? 13.636  -4.145  30.514 1.00 38.58 ? 1235 PRO A CA    1 
ATOM   1802 C  C     . PRO A 1 258 ? 15.054  -4.442  30.030 1.00 37.52 ? 1235 PRO A C     1 
ATOM   1803 O  O     . PRO A 1 258 ? 15.717  -3.580  29.457 1.00 35.69 ? 1235 PRO A O     1 
ATOM   1804 C  CB    . PRO A 1 258 ? 12.654  -3.853  29.377 1.00 38.05 ? 1235 PRO A CB    1 
ATOM   1805 C  CG    . PRO A 1 258 ? 12.700  -2.355  29.254 1.00 39.41 ? 1235 PRO A CG    1 
ATOM   1806 C  CD    . PRO A 1 258 ? 12.752  -1.887  30.681 1.00 38.95 ? 1235 PRO A CD    1 
ATOM   1807 N  N     . GLU A 1 259 ? 15.511  -5.666  30.270 1.00 37.66 ? 1236 GLU A N     1 
ATOM   1808 C  CA    . GLU A 1 259 ? 16.863  -6.070  29.897 1.00 38.91 ? 1236 GLU A CA    1 
ATOM   1809 C  C     . GLU A 1 259 ? 17.271  -5.685  28.484 1.00 37.64 ? 1236 GLU A C     1 
ATOM   1810 O  O     . GLU A 1 259 ? 18.385  -5.203  28.257 1.00 37.32 ? 1236 GLU A O     1 
ATOM   1811 C  CB    . GLU A 1 259 ? 17.041  -7.583  30.048 1.00 41.00 ? 1236 GLU A CB    1 
ATOM   1812 C  CG    . GLU A 1 259 ? 18.482  -8.024  29.822 1.00 47.90 ? 1236 GLU A CG    1 
ATOM   1813 C  CD    . GLU A 1 259 ? 18.598  -9.346  29.091 1.00 52.07 ? 1236 GLU A CD    1 
ATOM   1814 O  OE1   . GLU A 1 259 ? 18.083  -9.444  27.955 1.00 54.30 ? 1236 GLU A OE1   1 
ATOM   1815 O  OE2   . GLU A 1 259 ? 19.210  -10.284 29.648 1.00 53.61 ? 1236 GLU A OE2   1 
ATOM   1816 N  N     . ARG A 1 260 ? 16.371  -5.903  27.534 1.00 34.74 ? 1237 ARG A N     1 
ATOM   1817 C  CA    . ARG A 1 260 ? 16.669  -5.610  26.147 1.00 32.86 ? 1237 ARG A CA    1 
ATOM   1818 C  C     . ARG A 1 260 ? 17.058  -4.155  25.921 1.00 32.43 ? 1237 ARG A C     1 
ATOM   1819 O  O     . ARG A 1 260 ? 17.972  -3.865  25.143 1.00 33.15 ? 1237 ARG A O     1 
ATOM   1820 C  CB    . ARG A 1 260 ? 15.478  -5.978  25.269 1.00 34.13 ? 1237 ARG A CB    1 
ATOM   1821 C  CG    . ARG A 1 260 ? 15.850  -6.076  23.810 1.00 37.61 ? 1237 ARG A CG    1 
ATOM   1822 C  CD    . ARG A 1 260 ? 14.746  -6.685  22.989 1.00 38.32 ? 1237 ARG A CD    1 
ATOM   1823 N  NE    . ARG A 1 260 ? 15.110  -6.709  21.579 1.00 37.64 ? 1237 ARG A NE    1 
ATOM   1824 C  CZ    . ARG A 1 260 ? 14.269  -7.025  20.604 1.00 37.61 ? 1237 ARG A CZ    1 
ATOM   1825 N  NH1   . ARG A 1 260 ? 13.011  -7.345  20.893 1.00 34.35 ? 1237 ARG A NH1   1 
ATOM   1826 N  NH2   . ARG A 1 260 ? 14.687  -7.016  19.344 1.00 37.92 ? 1237 ARG A NH2   1 
ATOM   1827 N  N     . VAL A 1 261 ? 16.373  -3.237  26.597 1.00 28.82 ? 1238 VAL A N     1 
ATOM   1828 C  CA    . VAL A 1 261 ? 16.692  -1.828  26.440 1.00 28.78 ? 1238 VAL A CA    1 
ATOM   1829 C  C     . VAL A 1 261 ? 18.023  -1.510  27.109 1.00 28.70 ? 1238 VAL A C     1 
ATOM   1830 O  O     . VAL A 1 261 ? 18.776  -0.655  26.638 1.00 28.43 ? 1238 VAL A O     1 
ATOM   1831 C  CB    . VAL A 1 261 ? 15.612  -0.913  27.055 1.00 28.19 ? 1238 VAL A CB    1 
ATOM   1832 C  CG1   . VAL A 1 261 ? 15.964  0.548   26.786 1.00 27.57 ? 1238 VAL A CG1   1 
ATOM   1833 C  CG2   . VAL A 1 261 ? 14.253  -1.241  26.468 1.00 27.71 ? 1238 VAL A CG2   1 
ATOM   1834 N  N     . THR A 1 262 ? 18.306  -2.198  28.208 1.00 26.90 ? 1239 THR A N     1 
ATOM   1835 C  CA    . THR A 1 262 ? 19.546  -1.985  28.938 1.00 26.81 ? 1239 THR A CA    1 
ATOM   1836 C  C     . THR A 1 262 ? 20.741  -2.304  28.048 1.00 26.37 ? 1239 THR A C     1 
ATOM   1837 O  O     . THR A 1 262 ? 21.743  -1.591  28.056 1.00 24.77 ? 1239 THR A O     1 
ATOM   1838 C  CB    . THR A 1 262 ? 19.606  -2.874  30.195 1.00 27.42 ? 1239 THR A CB    1 
ATOM   1839 O  OG1   . THR A 1 262 ? 18.655  -2.404  31.156 1.00 26.93 ? 1239 THR A OG1   1 
ATOM   1840 C  CG2   . THR A 1 262 ? 21.004  -2.849  30.800 1.00 28.22 ? 1239 THR A CG2   1 
ATOM   1841 N  N     . ASP A 1 263 ? 20.624  -3.379  27.277 1.00 26.20 ? 1240 ASP A N     1 
ATOM   1842 C  CA    . ASP A 1 263 ? 21.697  -3.785  26.389 1.00 25.80 ? 1240 ASP A CA    1 
ATOM   1843 C  C     . ASP A 1 263 ? 21.939  -2.744  25.298 1.00 25.21 ? 1240 ASP A C     1 
ATOM   1844 O  O     . ASP A 1 263 ? 23.086  -2.473  24.944 1.00 22.94 ? 1240 ASP A O     1 
ATOM   1845 C  CB    . ASP A 1 263 ? 21.379  -5.146  25.770 1.00 28.16 ? 1240 ASP A CB    1 
ATOM   1846 C  CG    . ASP A 1 263 ? 21.313  -6.263  26.809 1.00 32.05 ? 1240 ASP A CG    1 
ATOM   1847 O  OD1   . ASP A 1 263 ? 21.791  -6.055  27.949 1.00 33.19 ? 1240 ASP A OD1   1 
ATOM   1848 O  OD2   . ASP A 1 263 ? 20.794  -7.356  26.479 1.00 33.57 ? 1240 ASP A OD2   1 
ATOM   1849 N  N     . LEU A 1 264 ? 20.862  -2.164  24.765 1.00 24.39 ? 1241 LEU A N     1 
ATOM   1850 C  CA    . LEU A 1 264 ? 20.993  -1.136  23.733 1.00 23.22 ? 1241 LEU A CA    1 
ATOM   1851 C  C     . LEU A 1 264 ? 21.723  0.058   24.331 1.00 22.13 ? 1241 LEU A C     1 
ATOM   1852 O  O     . LEU A 1 264 ? 22.638  0.605   23.717 1.00 20.43 ? 1241 LEU A O     1 
ATOM   1853 C  CB    . LEU A 1 264 ? 19.621  -0.692  23.222 1.00 25.10 ? 1241 LEU A CB    1 
ATOM   1854 C  CG    . LEU A 1 264 ? 18.827  -1.662  22.342 1.00 25.95 ? 1241 LEU A CG    1 
ATOM   1855 C  CD1   . LEU A 1 264 ? 17.423  -1.114  22.100 1.00 25.08 ? 1241 LEU A CD1   1 
ATOM   1856 C  CD2   . LEU A 1 264 ? 19.557  -1.861  21.024 1.00 24.52 ? 1241 LEU A CD2   1 
ATOM   1857 N  N     . MET A 1 265 ? 21.313  0.454   25.535 1.00 19.85 ? 1242 MET A N     1 
ATOM   1858 C  CA    . MET A 1 265 ? 21.942  1.570   26.233 1.00 20.38 ? 1242 MET A CA    1 
ATOM   1859 C  C     . MET A 1 265 ? 23.431  1.328   26.417 1.00 19.66 ? 1242 MET A C     1 
ATOM   1860 O  O     . MET A 1 265 ? 24.250  2.193   26.139 1.00 19.21 ? 1242 MET A O     1 
ATOM   1861 C  CB    . MET A 1 265 ? 21.315  1.766   27.610 1.00 19.97 ? 1242 MET A CB    1 
ATOM   1862 C  CG    . MET A 1 265 ? 19.954  2.412   27.593 1.00 23.37 ? 1242 MET A CG    1 
ATOM   1863 S  SD    . MET A 1 265 ? 19.388  2.764   29.262 1.00 22.14 ? 1242 MET A SD    1 
ATOM   1864 C  CE    . MET A 1 265 ? 17.739  2.138   29.201 1.00 19.01 ? 1242 MET A CE    1 
ATOM   1865 N  N     . ARG A 1 266 ? 23.773  0.142   26.897 1.00 20.13 ? 1243 ARG A N     1 
ATOM   1866 C  CA    . ARG A 1 266 ? 25.163  -0.210  27.123 1.00 20.90 ? 1243 ARG A CA    1 
ATOM   1867 C  C     . ARG A 1 266 ? 25.992  -0.102  25.840 1.00 21.24 ? 1243 ARG A C     1 
ATOM   1868 O  O     . ARG A 1 266 ? 27.096  0.443   25.851 1.00 22.23 ? 1243 ARG A O     1 
ATOM   1869 C  CB    . ARG A 1 266 ? 25.250  -1.624  27.714 1.00 19.78 ? 1243 ARG A CB    1 
ATOM   1870 N  N     . MET A 1 267 ? 25.471  -0.613  24.731 1.00 21.46 ? 1244 MET A N     1 
ATOM   1871 C  CA    . MET A 1 267 ? 26.203  -0.533  23.471 1.00 21.52 ? 1244 MET A CA    1 
ATOM   1872 C  C     . MET A 1 267 ? 26.514  0.927   23.142 1.00 20.28 ? 1244 MET A C     1 
ATOM   1873 O  O     . MET A 1 267 ? 27.631  1.254   22.754 1.00 20.67 ? 1244 MET A O     1 
ATOM   1874 C  CB    . MET A 1 267 ? 25.378  -1.131  22.332 1.00 24.12 ? 1244 MET A CB    1 
ATOM   1875 C  CG    . MET A 1 267 ? 25.082  -2.611  22.461 1.00 31.17 ? 1244 MET A CG    1 
ATOM   1876 S  SD    . MET A 1 267 ? 23.937  -3.170  21.167 1.00 37.72 ? 1244 MET A SD    1 
ATOM   1877 C  CE    . MET A 1 267 ? 25.103  -3.479  19.800 1.00 38.42 ? 1244 MET A CE    1 
ATOM   1878 N  N     . CYS A 1 268 ? 25.511  1.791   23.300 1.00 18.18 ? 1245 CYS A N     1 
ATOM   1879 C  CA    . CYS A 1 268 ? 25.633  3.219   23.020 1.00 17.60 ? 1245 CYS A CA    1 
ATOM   1880 C  C     . CYS A 1 268 ? 26.658  3.933   23.895 1.00 18.22 ? 1245 CYS A C     1 
ATOM   1881 O  O     . CYS A 1 268 ? 27.200  4.971   23.504 1.00 15.86 ? 1245 CYS A O     1 
ATOM   1882 C  CB    . CYS A 1 268 ? 24.286  3.924   23.231 1.00 17.53 ? 1245 CYS A CB    1 
ATOM   1883 S  SG    . CYS A 1 268 ? 22.938  3.417   22.149 1.00 18.49 ? 1245 CYS A SG    1 
ATOM   1884 N  N     . TRP A 1 269 ? 26.922  3.383   25.077 1.00 18.01 ? 1246 TRP A N     1 
ATOM   1885 C  CA    . TRP A 1 269 ? 27.833  4.031   25.997 1.00 18.36 ? 1246 TRP A CA    1 
ATOM   1886 C  C     . TRP A 1 269 ? 29.252  3.489   26.089 1.00 20.87 ? 1246 TRP A C     1 
ATOM   1887 O  O     . TRP A 1 269 ? 29.958  3.739   27.073 1.00 20.18 ? 1246 TRP A O     1 
ATOM   1888 C  CB    . TRP A 1 269 ? 27.190  4.091   27.386 1.00 16.88 ? 1246 TRP A CB    1 
ATOM   1889 C  CG    . TRP A 1 269 ? 25.890  4.870   27.398 1.00 16.39 ? 1246 TRP A CG    1 
ATOM   1890 C  CD1   . TRP A 1 269 ? 25.514  5.854   26.522 1.00 14.64 ? 1246 TRP A CD1   1 
ATOM   1891 C  CD2   . TRP A 1 269 ? 24.794  4.709   28.309 1.00 16.05 ? 1246 TRP A CD2   1 
ATOM   1892 N  NE1   . TRP A 1 269 ? 24.252  6.305   26.824 1.00 14.83 ? 1246 TRP A NE1   1 
ATOM   1893 C  CE2   . TRP A 1 269 ? 23.785  5.622   27.917 1.00 16.83 ? 1246 TRP A CE2   1 
ATOM   1894 C  CE3   . TRP A 1 269 ? 24.564  3.882   29.418 1.00 16.14 ? 1246 TRP A CE3   1 
ATOM   1895 C  CZ2   . TRP A 1 269 ? 22.563  5.731   28.593 1.00 16.71 ? 1246 TRP A CZ2   1 
ATOM   1896 C  CZ3   . TRP A 1 269 ? 23.346  3.990   30.093 1.00 15.98 ? 1246 TRP A CZ3   1 
ATOM   1897 C  CH2   . TRP A 1 269 ? 22.363  4.908   29.675 1.00 18.07 ? 1246 TRP A CH2   1 
ATOM   1898 N  N     . GLN A 1 270 ? 29.684  2.750   25.073 1.00 21.31 ? 1247 GLN A N     1 
ATOM   1899 C  CA    . GLN A 1 270 ? 31.047  2.237   25.087 1.00 23.77 ? 1247 GLN A CA    1 
ATOM   1900 C  C     . GLN A 1 270 ? 31.967  3.453   24.975 1.00 23.86 ? 1247 GLN A C     1 
ATOM   1901 O  O     . GLN A 1 270 ? 31.745  4.338   24.140 1.00 22.90 ? 1247 GLN A O     1 
ATOM   1902 C  CB    . GLN A 1 270 ? 31.263  1.295   23.915 1.00 25.49 ? 1247 GLN A CB    1 
ATOM   1903 C  CG    . GLN A 1 270 ? 30.250  0.185   23.862 1.00 32.26 ? 1247 GLN A CG    1 
ATOM   1904 C  CD    . GLN A 1 270 ? 30.513  -0.758  22.720 1.00 37.59 ? 1247 GLN A CD    1 
ATOM   1905 O  OE1   . GLN A 1 270 ? 31.493  -1.505  22.736 1.00 43.84 ? 1247 GLN A OE1   1 
ATOM   1906 N  NE2   . GLN A 1 270 ? 29.650  -0.724  21.708 1.00 37.86 ? 1247 GLN A NE2   1 
ATOM   1907 N  N     . PHE A 1 271 ? 32.995  3.503   25.814 1.00 23.48 ? 1248 PHE A N     1 
ATOM   1908 C  CA    . PHE A 1 271 ? 33.904  4.643   25.816 1.00 22.82 ? 1248 PHE A CA    1 
ATOM   1909 C  C     . PHE A 1 271 ? 34.488  4.955   24.440 1.00 22.35 ? 1248 PHE A C     1 
ATOM   1910 O  O     . PHE A 1 271 ? 34.580  6.120   24.049 1.00 21.00 ? 1248 PHE A O     1 
ATOM   1911 C  CB    . PHE A 1 271 ? 35.020  4.416   26.839 1.00 22.05 ? 1248 PHE A CB    1 
ATOM   1912 C  CG    . PHE A 1 271 ? 35.795  5.658   27.168 1.00 21.58 ? 1248 PHE A CG    1 
ATOM   1913 C  CD1   . PHE A 1 271 ? 36.982  5.956   26.502 1.00 19.81 ? 1248 PHE A CD1   1 
ATOM   1914 C  CD2   . PHE A 1 271 ? 35.325  6.549   28.132 1.00 19.85 ? 1248 PHE A CD2   1 
ATOM   1915 C  CE1   . PHE A 1 271 ? 37.692  7.124   26.795 1.00 18.29 ? 1248 PHE A CE1   1 
ATOM   1916 C  CE2   . PHE A 1 271 ? 36.028  7.718   28.431 1.00 16.94 ? 1248 PHE A CE2   1 
ATOM   1917 C  CZ    . PHE A 1 271 ? 37.214  8.003   27.759 1.00 15.19 ? 1248 PHE A CZ    1 
ATOM   1918 N  N     . ASN A 1 272 ? 34.875  3.914   23.709 1.00 21.34 ? 1249 ASN A N     1 
ATOM   1919 C  CA    . ASN A 1 272 ? 35.435  4.070   22.368 1.00 21.34 ? 1249 ASN A CA    1 
ATOM   1920 C  C     . ASN A 1 272 ? 34.308  4.265   21.350 1.00 20.06 ? 1249 ASN A C     1 
ATOM   1921 O  O     . ASN A 1 272 ? 33.532  3.351   21.098 1.00 19.84 ? 1249 ASN A O     1 
ATOM   1922 C  CB    . ASN A 1 272 ? 36.229  2.822   21.991 1.00 23.48 ? 1249 ASN A CB    1 
ATOM   1923 C  CG    . ASN A 1 272 ? 36.978  2.984   20.686 1.00 26.20 ? 1249 ASN A CG    1 
ATOM   1924 O  OD1   . ASN A 1 272 ? 36.507  3.656   19.765 1.00 28.65 ? 1249 ASN A OD1   1 
ATOM   1925 N  ND2   . ASN A 1 272 ? 38.144  2.358   20.593 1.00 25.51 ? 1249 ASN A ND2   1 
ATOM   1926 N  N     . PRO A 1 273 ? 34.216  5.454   20.738 1.00 20.91 ? 1250 PRO A N     1 
ATOM   1927 C  CA    . PRO A 1 273 ? 33.149  5.692   19.755 1.00 21.40 ? 1250 PRO A CA    1 
ATOM   1928 C  C     . PRO A 1 273 ? 33.092  4.678   18.610 1.00 24.04 ? 1250 PRO A C     1 
ATOM   1929 O  O     . PRO A 1 273 ? 32.012  4.364   18.104 1.00 24.06 ? 1250 PRO A O     1 
ATOM   1930 C  CB    . PRO A 1 273 ? 33.424  7.121   19.279 1.00 20.71 ? 1250 PRO A CB    1 
ATOM   1931 C  CG    . PRO A 1 273 ? 34.908  7.295   19.520 1.00 19.75 ? 1250 PRO A CG    1 
ATOM   1932 C  CD    . PRO A 1 273 ? 35.100  6.626   20.857 1.00 19.41 ? 1250 PRO A CD    1 
ATOM   1933 N  N     . LYS A 1 274 ? 34.247  4.161   18.204 1.00 24.96 ? 1251 LYS A N     1 
ATOM   1934 C  CA    . LYS A 1 274 ? 34.289  3.180   17.124 1.00 26.63 ? 1251 LYS A CA    1 
ATOM   1935 C  C     . LYS A 1 274 ? 33.547  1.904   17.500 1.00 26.44 ? 1251 LYS A C     1 
ATOM   1936 O  O     . LYS A 1 274 ? 33.177  1.115   16.631 1.00 27.84 ? 1251 LYS A O     1 
ATOM   1937 C  CB    . LYS A 1 274 ? 35.741  2.843   16.769 1.00 28.78 ? 1251 LYS A CB    1 
ATOM   1938 C  CG    . LYS A 1 274 ? 36.406  3.788   15.758 1.00 32.47 ? 1251 LYS A CG    1 
ATOM   1939 C  CD    . LYS A 1 274 ? 36.281  5.260   16.137 1.00 36.14 ? 1251 LYS A CD    1 
ATOM   1940 C  CE    . LYS A 1 274 ? 34.945  5.849   15.682 1.00 38.47 ? 1251 LYS A CE    1 
ATOM   1941 N  NZ    . LYS A 1 274 ? 34.711  7.228   16.210 1.00 39.16 ? 1251 LYS A NZ    1 
ATOM   1942 N  N     . MET A 1 275 ? 33.328  1.710   18.797 1.00 24.51 ? 1252 MET A N     1 
ATOM   1943 C  CA    . MET A 1 275 ? 32.652  0.520   19.297 1.00 22.91 ? 1252 MET A CA    1 
ATOM   1944 C  C     . MET A 1 275 ? 31.130  0.600   19.318 1.00 21.44 ? 1252 MET A C     1 
ATOM   1945 O  O     . MET A 1 275 ? 30.453  -0.425  19.324 1.00 21.71 ? 1252 MET A O     1 
ATOM   1946 C  CB    . MET A 1 275 ? 33.160  0.201   20.702 1.00 26.87 ? 1252 MET A CB    1 
ATOM   1947 C  CG    . MET A 1 275 ? 34.620  -0.227  20.738 1.00 32.68 ? 1252 MET A CG    1 
ATOM   1948 S  SD    . MET A 1 275 ? 34.912  -1.652  19.665 1.00 40.48 ? 1252 MET A SD    1 
ATOM   1949 C  CE    . MET A 1 275 ? 34.275  -3.024  20.706 1.00 34.82 ? 1252 MET A CE    1 
ATOM   1950 N  N     . ARG A 1 276 ? 30.589  1.812   19.331 1.00 18.98 ? 1253 ARG A N     1 
ATOM   1951 C  CA    . ARG A 1 276 ? 29.141  1.992   19.352 1.00 16.93 ? 1253 ARG A CA    1 
ATOM   1952 C  C     . ARG A 1 276 ? 28.533  1.611   18.005 1.00 16.21 ? 1253 ARG A C     1 
ATOM   1953 O  O     . ARG A 1 276 ? 29.199  1.656   16.973 1.00 18.18 ? 1253 ARG A O     1 
ATOM   1954 C  CB    . ARG A 1 276 ? 28.799  3.448   19.682 1.00 14.47 ? 1253 ARG A CB    1 
ATOM   1955 C  CG    . ARG A 1 276 ? 29.441  3.941   20.974 1.00 13.22 ? 1253 ARG A CG    1 
ATOM   1956 C  CD    . ARG A 1 276 ? 29.379  5.455   21.112 1.00 14.21 ? 1253 ARG A CD    1 
ATOM   1957 N  NE    . ARG A 1 276 ? 30.329  5.916   22.124 1.00 18.23 ? 1253 ARG A NE    1 
ATOM   1958 C  CZ    . ARG A 1 276 ? 30.826  7.149   22.190 1.00 17.59 ? 1253 ARG A CZ    1 
ATOM   1959 N  NH1   . ARG A 1 276 ? 30.459  8.073   21.306 1.00 14.97 ? 1253 ARG A NH1   1 
ATOM   1960 N  NH2   . ARG A 1 276 ? 31.730  7.446   23.115 1.00 14.07 ? 1253 ARG A NH2   1 
ATOM   1961 N  N     . PRO A 1 277 ? 27.258  1.205   18.003 1.00 16.56 ? 1254 PRO A N     1 
ATOM   1962 C  CA    . PRO A 1 277 ? 26.606  0.827   16.748 1.00 16.32 ? 1254 PRO A CA    1 
ATOM   1963 C  C     . PRO A 1 277 ? 26.172  2.045   15.936 1.00 18.31 ? 1254 PRO A C     1 
ATOM   1964 O  O     . PRO A 1 277 ? 26.309  3.190   16.389 1.00 17.39 ? 1254 PRO A O     1 
ATOM   1965 C  CB    . PRO A 1 277 ? 25.412  0.002   17.221 1.00 15.14 ? 1254 PRO A CB    1 
ATOM   1966 C  CG    . PRO A 1 277 ? 25.054  0.650   18.519 1.00 13.54 ? 1254 PRO A CG    1 
ATOM   1967 C  CD    . PRO A 1 277 ? 26.404  0.882   19.162 1.00 15.31 ? 1254 PRO A CD    1 
ATOM   1968 N  N     . THR A 1 278 ? 25.660  1.787   14.733 1.00 17.89 ? 1255 THR A N     1 
ATOM   1969 C  CA    . THR A 1 278 ? 25.160  2.841   13.867 1.00 17.58 ? 1255 THR A CA    1 
ATOM   1970 C  C     . THR A 1 278 ? 23.651  2.789   14.010 1.00 17.32 ? 1255 THR A C     1 
ATOM   1971 O  O     . THR A 1 278 ? 23.093  1.785   14.450 1.00 17.18 ? 1255 THR A O     1 
ATOM   1972 C  CB    . THR A 1 278 ? 25.510  2.600   12.388 1.00 18.83 ? 1255 THR A CB    1 
ATOM   1973 O  OG1   . THR A 1 278 ? 24.806  1.446   11.913 1.00 20.17 ? 1255 THR A OG1   1 
ATOM   1974 C  CG2   . THR A 1 278 ? 27.016  2.385   12.218 1.00 19.30 ? 1255 THR A CG2   1 
ATOM   1975 N  N     . PHE A 1 279 ? 22.982  3.867   13.641 1.00 18.29 ? 1256 PHE A N     1 
ATOM   1976 C  CA    . PHE A 1 279 ? 21.534  3.896   13.734 1.00 17.43 ? 1256 PHE A CA    1 
ATOM   1977 C  C     . PHE A 1 279 ? 20.924  2.819   12.848 1.00 16.21 ? 1256 PHE A C     1 
ATOM   1978 O  O     . PHE A 1 279 ? 19.925  2.205   13.213 1.00 17.80 ? 1256 PHE A O     1 
ATOM   1979 C  CB    . PHE A 1 279 ? 21.032  5.288   13.366 1.00 14.66 ? 1256 PHE A CB    1 
ATOM   1980 C  CG    . PHE A 1 279 ? 21.338  6.307   14.410 1.00 13.34 ? 1256 PHE A CG    1 
ATOM   1981 C  CD1   . PHE A 1 279 ? 20.598  6.348   15.594 1.00 12.95 ? 1256 PHE A CD1   1 
ATOM   1982 C  CD2   . PHE A 1 279 ? 22.410  7.176   14.260 1.00 12.78 ? 1256 PHE A CD2   1 
ATOM   1983 C  CE1   . PHE A 1 279 ? 20.925  7.235   16.612 1.00 10.70 ? 1256 PHE A CE1   1 
ATOM   1984 C  CE2   . PHE A 1 279 ? 22.748  8.073   15.276 1.00 12.03 ? 1256 PHE A CE2   1 
ATOM   1985 C  CZ    . PHE A 1 279 ? 22.004  8.101   16.454 1.00 11.42 ? 1256 PHE A CZ    1 
ATOM   1986 N  N     . LEU A 1 280 ? 21.532  2.585   11.691 1.00 15.12 ? 1257 LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 280 ? 21.047  1.549   10.789 1.00 17.42 ? 1257 LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 280 ? 21.123  0.187   11.474 1.00 18.46 ? 1257 LEU A C     1 
ATOM   1989 O  O     . LEU A 1 280 ? 20.240  -0.654  11.305 1.00 20.29 ? 1257 LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 280 ? 21.869  1.520   9.495  1.00 17.28 ? 1257 LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 280 ? 21.593  2.642   8.491  1.00 17.28 ? 1257 LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 280 ? 22.486  2.472   7.267  1.00 15.39 ? 1257 LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 280 ? 20.127  2.607   8.085  1.00 16.35 ? 1257 LEU A CD2   1 
ATOM   1994 N  N     . GLU A 1 281 ? 22.181  -0.029  12.249 1.00 19.39 ? 1258 GLU A N     1 
ATOM   1995 C  CA    . GLU A 1 281 ? 22.340  -1.292  12.962 1.00 18.33 ? 1258 GLU A CA    1 
ATOM   1996 C  C     . GLU A 1 281 ? 21.326  -1.385  14.091 1.00 16.41 ? 1258 GLU A C     1 
ATOM   1997 O  O     . GLU A 1 281 ? 20.869  -2.474  14.421 1.00 16.60 ? 1258 GLU A O     1 
ATOM   1998 C  CB    . GLU A 1 281 ? 23.759  -1.424  13.519 1.00 17.55 ? 1258 GLU A CB    1 
ATOM   1999 C  CG    . GLU A 1 281 ? 24.811  -1.488  12.438 1.00 19.12 ? 1258 GLU A CG    1 
ATOM   2000 C  CD    . GLU A 1 281 ? 26.206  -1.643  12.990 1.00 21.18 ? 1258 GLU A CD    1 
ATOM   2001 O  OE1   . GLU A 1 281 ? 26.487  -1.076  14.065 1.00 22.84 ? 1258 GLU A OE1   1 
ATOM   2002 O  OE2   . GLU A 1 281 ? 27.028  -2.319  12.340 1.00 23.81 ? 1258 GLU A OE2   1 
ATOM   2003 N  N     . ILE A 1 282 ? 20.974  -0.247  14.685 1.00 15.02 ? 1259 ILE A N     1 
ATOM   2004 C  CA    . ILE A 1 282 ? 19.991  -0.254  15.760 1.00 13.13 ? 1259 ILE A CA    1 
ATOM   2005 C  C     . ILE A 1 282 ? 18.673  -0.760  15.171 1.00 14.91 ? 1259 ILE A C     1 
ATOM   2006 O  O     . ILE A 1 282 ? 18.047  -1.671  15.716 1.00 15.14 ? 1259 ILE A O     1 
ATOM   2007 C  CB    . ILE A 1 282 ? 19.762  1.164   16.356 1.00 13.23 ? 1259 ILE A CB    1 
ATOM   2008 C  CG1   . ILE A 1 282 ? 21.014  1.645   17.097 1.00 11.99 ? 1259 ILE A CG1   1 
ATOM   2009 C  CG2   . ILE A 1 282 ? 18.560  1.146   17.308 1.00 12.02 ? 1259 ILE A CG2   1 
ATOM   2010 C  CD1   . ILE A 1 282 ? 21.388  0.827   18.336 1.00 9.66  ? 1259 ILE A CD1   1 
ATOM   2011 N  N     . VAL A 1 283 ? 18.262  -0.167  14.053 1.00 12.75 ? 1260 VAL A N     1 
ATOM   2012 C  CA    . VAL A 1 283 ? 17.021  -0.559  13.403 1.00 14.37 ? 1260 VAL A CA    1 
ATOM   2013 C  C     . VAL A 1 283 ? 17.050  -2.030  13.002 1.00 16.75 ? 1260 VAL A C     1 
ATOM   2014 O  O     . VAL A 1 283 ? 16.079  -2.759  13.196 1.00 15.53 ? 1260 VAL A O     1 
ATOM   2015 C  CB    . VAL A 1 283 ? 16.748  0.312   12.158 1.00 12.42 ? 1260 VAL A CB    1 
ATOM   2016 C  CG1   . VAL A 1 283 ? 15.523  -0.202  11.414 1.00 11.97 ? 1260 VAL A CG1   1 
ATOM   2017 C  CG2   . VAL A 1 283 ? 16.534  1.762   12.582 1.00 7.81  ? 1260 VAL A CG2   1 
ATOM   2018 N  N     . ASN A 1 284 ? 18.169  -2.472  12.446 1.00 19.52 ? 1261 ASN A N     1 
ATOM   2019 C  CA    . ASN A 1 284 ? 18.275  -3.861  12.046 1.00 21.66 ? 1261 ASN A CA    1 
ATOM   2020 C  C     . ASN A 1 284 ? 18.073  -4.805  13.234 1.00 22.32 ? 1261 ASN A C     1 
ATOM   2021 O  O     . ASN A 1 284 ? 17.444  -5.849  13.097 1.00 23.37 ? 1261 ASN A O     1 
ATOM   2022 C  CB    . ASN A 1 284 ? 19.628  -4.127  11.399 1.00 22.16 ? 1261 ASN A CB    1 
ATOM   2023 C  CG    . ASN A 1 284 ? 19.699  -5.509  10.783 1.00 26.25 ? 1261 ASN A CG    1 
ATOM   2024 O  OD1   . ASN A 1 284 ? 18.933  -5.834  9.870  1.00 22.23 ? 1261 ASN A OD1   1 
ATOM   2025 N  ND2   . ASN A 1 284 ? 20.611  -6.338  11.288 1.00 26.87 ? 1261 ASN A ND2   1 
ATOM   2026 N  N     . LEU A 1 285 ? 18.605  -4.432  14.395 1.00 22.70 ? 1262 LEU A N     1 
ATOM   2027 C  CA    . LEU A 1 285 ? 18.475  -5.243  15.607 1.00 22.98 ? 1262 LEU A CA    1 
ATOM   2028 C  C     . LEU A 1 285 ? 17.047  -5.381  16.098 1.00 23.53 ? 1262 LEU A C     1 
ATOM   2029 O  O     . LEU A 1 285 ? 16.712  -6.354  16.772 1.00 25.03 ? 1262 LEU A O     1 
ATOM   2030 C  CB    . LEU A 1 285 ? 19.291  -4.635  16.747 1.00 23.49 ? 1262 LEU A CB    1 
ATOM   2031 C  CG    . LEU A 1 285 ? 20.809  -4.805  16.719 1.00 26.59 ? 1262 LEU A CG    1 
ATOM   2032 C  CD1   . LEU A 1 285 ? 21.450  -3.914  17.776 1.00 25.63 ? 1262 LEU A CD1   1 
ATOM   2033 C  CD2   . LEU A 1 285 ? 21.155  -6.264  16.963 1.00 26.99 ? 1262 LEU A CD2   1 
ATOM   2034 N  N     . LEU A 1 286 ? 16.207  -4.408  15.762 1.00 22.79 ? 1263 LEU A N     1 
ATOM   2035 C  CA    . LEU A 1 286 ? 14.823  -4.403  16.224 1.00 22.56 ? 1263 LEU A CA    1 
ATOM   2036 C  C     . LEU A 1 286 ? 13.761  -4.620  15.152 1.00 22.86 ? 1263 LEU A C     1 
ATOM   2037 O  O     . LEU A 1 286 ? 12.577  -4.666  15.468 1.00 23.75 ? 1263 LEU A O     1 
ATOM   2038 C  CB    . LEU A 1 286 ? 14.530  -3.066  16.913 1.00 20.66 ? 1263 LEU A CB    1 
ATOM   2039 C  CG    . LEU A 1 286 ? 15.624  -2.476  17.806 1.00 18.02 ? 1263 LEU A CG    1 
ATOM   2040 C  CD1   . LEU A 1 286 ? 15.257  -1.040  18.193 1.00 11.50 ? 1263 LEU A CD1   1 
ATOM   2041 C  CD2   . LEU A 1 286 ? 15.809  -3.360  19.045 1.00 18.93 ? 1263 LEU A CD2   1 
ATOM   2042 N  N     . LYS A 1 287 ? 14.171  -4.756  13.896 1.00 23.22 ? 1264 LYS A N     1 
ATOM   2043 C  CA    . LYS A 1 287 ? 13.220  -4.899  12.792 1.00 23.81 ? 1264 LYS A CA    1 
ATOM   2044 C  C     . LYS A 1 287 ? 12.150  -5.990  12.875 1.00 25.32 ? 1264 LYS A C     1 
ATOM   2045 O  O     . LYS A 1 287 ? 11.045  -5.809  12.363 1.00 25.69 ? 1264 LYS A O     1 
ATOM   2046 C  CB    . LYS A 1 287 ? 13.978  -5.052  11.474 1.00 22.44 ? 1264 LYS A CB    1 
ATOM   2047 C  CG    . LYS A 1 287 ? 14.788  -6.319  11.381 1.00 22.74 ? 1264 LYS A CG    1 
ATOM   2048 C  CD    . LYS A 1 287 ? 15.523  -6.404  10.061 1.00 23.11 ? 1264 LYS A CD    1 
ATOM   2049 C  CE    . LYS A 1 287 ? 16.398  -7.635  10.028 1.00 23.96 ? 1264 LYS A CE    1 
ATOM   2050 N  NZ    . LYS A 1 287 ? 17.095  -7.754  8.727  1.00 28.72 ? 1264 LYS A NZ    1 
ATOM   2051 N  N     . ASP A 1 288 ? 12.457  -7.114  13.508 1.00 26.57 ? 1265 ASP A N     1 
ATOM   2052 C  CA    . ASP A 1 288 ? 11.475  -8.189  13.591 1.00 30.75 ? 1265 ASP A CA    1 
ATOM   2053 C  C     . ASP A 1 288 ? 10.441  -8.024  14.704 1.00 31.72 ? 1265 ASP A C     1 
ATOM   2054 O  O     . ASP A 1 288 ? 9.578   -8.882  14.884 1.00 33.32 ? 1265 ASP A O     1 
ATOM   2055 C  CB    . ASP A 1 288 ? 12.182  -9.542  13.744 1.00 31.44 ? 1265 ASP A CB    1 
ATOM   2056 C  CG    . ASP A 1 288 ? 13.127  -9.837  12.596 1.00 33.92 ? 1265 ASP A CG    1 
ATOM   2057 O  OD1   . ASP A 1 288 ? 12.763  -9.550  11.436 1.00 34.72 ? 1265 ASP A OD1   1 
ATOM   2058 O  OD2   . ASP A 1 288 ? 14.231  -10.363 12.847 1.00 39.66 ? 1265 ASP A OD2   1 
ATOM   2059 N  N     . ASP A 1 289 ? 10.519  -6.926  15.448 1.00 31.69 ? 1266 ASP A N     1 
ATOM   2060 C  CA    . ASP A 1 289 ? 9.581   -6.698  16.540 1.00 31.18 ? 1266 ASP A CA    1 
ATOM   2061 C  C     . ASP A 1 289 ? 8.879   -5.355  16.422 1.00 28.87 ? 1266 ASP A C     1 
ATOM   2062 O  O     . ASP A 1 289 ? 8.662   -4.679  17.425 1.00 28.70 ? 1266 ASP A O     1 
ATOM   2063 C  CB    . ASP A 1 289 ? 10.317  -6.754  17.880 1.00 35.81 ? 1266 ASP A CB    1 
ATOM   2064 C  CG    . ASP A 1 289 ? 11.067  -8.059  18.083 1.00 41.62 ? 1266 ASP A CG    1 
ATOM   2065 O  OD1   . ASP A 1 289 ? 10.418  -9.130  18.096 1.00 43.92 ? 1266 ASP A OD1   1 
ATOM   2066 O  OD2   . ASP A 1 289 ? 12.308  -8.011  18.231 1.00 42.28 ? 1266 ASP A OD2   1 
ATOM   2067 N  N     . LEU A 1 290 ? 8.516   -4.965  15.208 1.00 24.98 ? 1267 LEU A N     1 
ATOM   2068 C  CA    . LEU A 1 290 ? 7.870   -3.675  15.026 1.00 22.53 ? 1267 LEU A CA    1 
ATOM   2069 C  C     . LEU A 1 290 ? 6.480   -3.757  14.428 1.00 21.06 ? 1267 LEU A C     1 
ATOM   2070 O  O     . LEU A 1 290 ? 6.065   -4.793  13.919 1.00 21.62 ? 1267 LEU A O     1 
ATOM   2071 C  CB    . LEU A 1 290 ? 8.751   -2.774  14.155 1.00 19.23 ? 1267 LEU A CB    1 
ATOM   2072 C  CG    . LEU A 1 290 ? 10.161  -2.551  14.717 1.00 19.00 ? 1267 LEU A CG    1 
ATOM   2073 C  CD1   . LEU A 1 290 ? 10.981  -1.689  13.771 1.00 13.90 ? 1267 LEU A CD1   1 
ATOM   2074 C  CD2   . LEU A 1 290 ? 10.064  -1.900  16.095 1.00 17.40 ? 1267 LEU A CD2   1 
ATOM   2075 N  N     . HIS A 1 291 ? 5.765   -2.642  14.503 1.00 20.37 ? 1268 HIS A N     1 
ATOM   2076 C  CA    . HIS A 1 291 ? 4.427   -2.551  13.951 1.00 20.63 ? 1268 HIS A CA    1 
ATOM   2077 C  C     . HIS A 1 291 ? 4.528   -2.876  12.460 1.00 21.77 ? 1268 HIS A C     1 
ATOM   2078 O  O     . HIS A 1 291 ? 5.511   -2.522  11.809 1.00 22.96 ? 1268 HIS A O     1 
ATOM   2079 C  CB    . HIS A 1 291 ? 3.876   -1.138  14.167 1.00 18.53 ? 1268 HIS A CB    1 
ATOM   2080 C  CG    . HIS A 1 291 ? 2.456   -0.971  13.733 1.00 19.13 ? 1268 HIS A CG    1 
ATOM   2081 N  ND1   . HIS A 1 291 ? 2.086   -0.917  12.407 1.00 20.30 ? 1268 HIS A ND1   1 
ATOM   2082 C  CD2   . HIS A 1 291 ? 1.311   -0.882  14.449 1.00 18.99 ? 1268 HIS A CD2   1 
ATOM   2083 C  CE1   . HIS A 1 291 ? 0.772   -0.802  12.324 1.00 19.35 ? 1268 HIS A CE1   1 
ATOM   2084 N  NE2   . HIS A 1 291 ? 0.279   -0.779  13.550 1.00 21.21 ? 1268 HIS A NE2   1 
ATOM   2085 N  N     . PRO A 1 292 ? 3.521   -3.568  11.905 1.00 22.18 ? 1269 PRO A N     1 
ATOM   2086 C  CA    . PRO A 1 292 ? 3.490   -3.954  10.489 1.00 23.66 ? 1269 PRO A CA    1 
ATOM   2087 C  C     . PRO A 1 292 ? 3.728   -2.820  9.489  1.00 24.11 ? 1269 PRO A C     1 
ATOM   2088 O  O     . PRO A 1 292 ? 4.343   -3.024  8.439  1.00 24.23 ? 1269 PRO A O     1 
ATOM   2089 C  CB    . PRO A 1 292 ? 2.101   -4.566  10.333 1.00 24.26 ? 1269 PRO A CB    1 
ATOM   2090 C  CG    . PRO A 1 292 ? 1.855   -5.168  11.670 1.00 23.25 ? 1269 PRO A CG    1 
ATOM   2091 C  CD    . PRO A 1 292 ? 2.332   -4.083  12.606 1.00 22.62 ? 1269 PRO A CD    1 
ATOM   2092 N  N     . SER A 1 293 ? 3.240   -1.630  9.821  1.00 23.51 ? 1270 SER A N     1 
ATOM   2093 C  CA    . SER A 1 293 ? 3.380   -0.475  8.946  1.00 23.35 ? 1270 SER A CA    1 
ATOM   2094 C  C     . SER A 1 293 ? 4.814   0.025   8.758  1.00 23.34 ? 1270 SER A C     1 
ATOM   2095 O  O     . SER A 1 293 ? 5.114   0.674   7.754  1.00 23.73 ? 1270 SER A O     1 
ATOM   2096 C  CB    . SER A 1 293 ? 2.527   0.679   9.477  1.00 23.20 ? 1270 SER A CB    1 
ATOM   2097 O  OG    . SER A 1 293 ? 3.029   1.155   10.716 1.00 23.30 ? 1270 SER A OG    1 
ATOM   2098 N  N     . PHE A 1 294 ? 5.689   -0.283  9.714  1.00 21.83 ? 1271 PHE A N     1 
ATOM   2099 C  CA    . PHE A 1 294 ? 7.076   0.185   9.692  1.00 20.91 ? 1271 PHE A CA    1 
ATOM   2100 C  C     . PHE A 1 294 ? 7.838   0.107   8.366  1.00 21.71 ? 1271 PHE A C     1 
ATOM   2101 O  O     . PHE A 1 294 ? 8.371   1.116   7.896  1.00 22.53 ? 1271 PHE A O     1 
ATOM   2102 C  CB    . PHE A 1 294 ? 7.893   -0.525  10.778 1.00 19.31 ? 1271 PHE A CB    1 
ATOM   2103 C  CG    . PHE A 1 294 ? 9.209   0.139   11.074 1.00 18.32 ? 1271 PHE A CG    1 
ATOM   2104 C  CD1   . PHE A 1 294 ? 9.264   1.279   11.872 1.00 17.02 ? 1271 PHE A CD1   1 
ATOM   2105 C  CD2   . PHE A 1 294 ? 10.391  -0.353  10.528 1.00 17.44 ? 1271 PHE A CD2   1 
ATOM   2106 C  CE1   . PHE A 1 294 ? 10.475  1.917   12.121 1.00 16.43 ? 1271 PHE A CE1   1 
ATOM   2107 C  CE2   . PHE A 1 294 ? 11.606  0.277   10.771 1.00 15.62 ? 1271 PHE A CE2   1 
ATOM   2108 C  CZ    . PHE A 1 294 ? 11.651  1.414   11.567 1.00 15.79 ? 1271 PHE A CZ    1 
ATOM   2109 N  N     . PRO A 1 295 ? 7.909   -1.085  7.749  1.00 20.91 ? 1272 PRO A N     1 
ATOM   2110 C  CA    . PRO A 1 295 ? 8.627   -1.237  6.476  1.00 21.68 ? 1272 PRO A CA    1 
ATOM   2111 C  C     . PRO A 1 295 ? 8.076   -0.367  5.343  1.00 22.85 ? 1272 PRO A C     1 
ATOM   2112 O  O     . PRO A 1 295 ? 8.783   -0.046  4.388  1.00 22.00 ? 1272 PRO A O     1 
ATOM   2113 C  CB    . PRO A 1 295 ? 8.480   -2.731  6.170  1.00 20.46 ? 1272 PRO A CB    1 
ATOM   2114 C  CG    . PRO A 1 295 ? 8.322   -3.354  7.532  1.00 19.67 ? 1272 PRO A CG    1 
ATOM   2115 C  CD    . PRO A 1 295 ? 7.381   -2.384  8.205  1.00 21.95 ? 1272 PRO A CD    1 
ATOM   2116 N  N     . GLU A 1 296 ? 6.812   0.014   5.458  1.00 22.32 ? 1273 GLU A N     1 
ATOM   2117 C  CA    . GLU A 1 296 ? 6.174   0.820   4.432  1.00 23.56 ? 1273 GLU A CA    1 
ATOM   2118 C  C     . GLU A 1 296 ? 6.558   2.287   4.545  1.00 21.00 ? 1273 GLU A C     1 
ATOM   2119 O  O     . GLU A 1 296 ? 6.468   3.032   3.569  1.00 18.85 ? 1273 GLU A O     1 
ATOM   2120 C  CB    . GLU A 1 296 ? 4.653   0.676   4.542  1.00 28.03 ? 1273 GLU A CB    1 
ATOM   2121 C  CG    . GLU A 1 296 ? 4.210   -0.750  4.848  1.00 37.61 ? 1273 GLU A CG    1 
ATOM   2122 C  CD    . GLU A 1 296 ? 2.706   -0.894  5.008  1.00 43.23 ? 1273 GLU A CD    1 
ATOM   2123 O  OE1   . GLU A 1 296 ? 2.093   -0.084  5.743  1.00 44.87 ? 1273 GLU A OE1   1 
ATOM   2124 O  OE2   . GLU A 1 296 ? 2.140   -1.830  4.405  1.00 45.17 ? 1273 GLU A OE2   1 
ATOM   2125 N  N     . VAL A 1 297 ? 6.991   2.703   5.731  1.00 17.22 ? 1274 VAL A N     1 
ATOM   2126 C  CA    . VAL A 1 297 ? 7.342   4.101   5.938  1.00 16.22 ? 1274 VAL A CA    1 
ATOM   2127 C  C     . VAL A 1 297 ? 8.769   4.388   6.371  1.00 16.68 ? 1274 VAL A C     1 
ATOM   2128 O  O     . VAL A 1 297 ? 9.197   5.538   6.347  1.00 19.27 ? 1274 VAL A O     1 
ATOM   2129 C  CB    . VAL A 1 297 ? 6.422   4.738   6.984  1.00 14.72 ? 1274 VAL A CB    1 
ATOM   2130 C  CG1   . VAL A 1 297 ? 4.964   4.587   6.558  1.00 12.20 ? 1274 VAL A CG1   1 
ATOM   2131 C  CG2   . VAL A 1 297 ? 6.663   4.084   8.339  1.00 10.14 ? 1274 VAL A CG2   1 
ATOM   2132 N  N     . SER A 1 298 ? 9.511   3.363   6.764  1.00 15.53 ? 1275 SER A N     1 
ATOM   2133 C  CA    . SER A 1 298 ? 10.866  3.595   7.237  1.00 17.21 ? 1275 SER A CA    1 
ATOM   2134 C  C     . SER A 1 298 ? 11.887  3.901   6.152  1.00 18.18 ? 1275 SER A C     1 
ATOM   2135 O  O     . SER A 1 298 ? 11.734  3.513   4.991  1.00 19.23 ? 1275 SER A O     1 
ATOM   2136 C  CB    . SER A 1 298 ? 11.357  2.397   8.043  1.00 18.20 ? 1275 SER A CB    1 
ATOM   2137 O  OG    . SER A 1 298 ? 11.701  1.329   7.183  1.00 19.24 ? 1275 SER A OG    1 
ATOM   2138 N  N     . PHE A 1 299 ? 12.933  4.611   6.551  1.00 16.47 ? 1276 PHE A N     1 
ATOM   2139 C  CA    . PHE A 1 299 ? 14.010  4.948   5.647  1.00 15.80 ? 1276 PHE A CA    1 
ATOM   2140 C  C     . PHE A 1 299 ? 14.810  3.659   5.487  1.00 17.23 ? 1276 PHE A C     1 
ATOM   2141 O  O     . PHE A 1 299 ? 15.324  3.363   4.411  1.00 18.68 ? 1276 PHE A O     1 
ATOM   2142 C  CB    . PHE A 1 299 ? 14.881  6.047   6.264  1.00 14.85 ? 1276 PHE A CB    1 
ATOM   2143 C  CG    . PHE A 1 299 ? 16.292  6.088   5.724  1.00 16.96 ? 1276 PHE A CG    1 
ATOM   2144 C  CD1   . PHE A 1 299 ? 16.546  6.462   4.403  1.00 17.46 ? 1276 PHE A CD1   1 
ATOM   2145 C  CD2   . PHE A 1 299 ? 17.369  5.722   6.532  1.00 16.28 ? 1276 PHE A CD2   1 
ATOM   2146 C  CE1   . PHE A 1 299 ? 17.855  6.469   3.891  1.00 13.71 ? 1276 PHE A CE1   1 
ATOM   2147 C  CE2   . PHE A 1 299 ? 18.683  5.726   6.028  1.00 15.15 ? 1276 PHE A CE2   1 
ATOM   2148 C  CZ    . PHE A 1 299 ? 18.921  6.100   4.706  1.00 15.88 ? 1276 PHE A CZ    1 
ATOM   2149 N  N     . PHE A 1 300 ? 14.899  2.895   6.573  1.00 17.31 ? 1277 PHE A N     1 
ATOM   2150 C  CA    . PHE A 1 300 ? 15.643  1.637   6.594  1.00 19.87 ? 1277 PHE A CA    1 
ATOM   2151 C  C     . PHE A 1 300 ? 15.182  0.672   5.505  1.00 21.08 ? 1277 PHE A C     1 
ATOM   2152 O  O     . PHE A 1 300 ? 15.995  0.024   4.850  1.00 20.41 ? 1277 PHE A O     1 
ATOM   2153 C  CB    . PHE A 1 300 ? 15.484  0.962   7.961  1.00 20.26 ? 1277 PHE A CB    1 
ATOM   2154 C  CG    . PHE A 1 300 ? 16.235  -0.333  8.095  1.00 18.02 ? 1277 PHE A CG    1 
ATOM   2155 C  CD1   . PHE A 1 300 ? 17.602  -0.343  8.353  1.00 18.00 ? 1277 PHE A CD1   1 
ATOM   2156 C  CD2   . PHE A 1 300 ? 15.575  -1.549  7.965  1.00 17.87 ? 1277 PHE A CD2   1 
ATOM   2157 C  CE1   . PHE A 1 300 ? 18.300  -1.550  8.480  1.00 18.28 ? 1277 PHE A CE1   1 
ATOM   2158 C  CE2   . PHE A 1 300 ? 16.264  -2.757  8.090  1.00 17.44 ? 1277 PHE A CE2   1 
ATOM   2159 C  CZ    . PHE A 1 300 ? 17.627  -2.758  8.349  1.00 16.64 ? 1277 PHE A CZ    1 
ATOM   2160 N  N     . HIS A 1 301 ? 13.871  0.585   5.319  1.00 22.77 ? 1278 HIS A N     1 
ATOM   2161 C  CA    . HIS A 1 301 ? 13.293  -0.305  4.323  1.00 23.54 ? 1278 HIS A CA    1 
ATOM   2162 C  C     . HIS A 1 301 ? 13.083  0.365   2.964  1.00 24.73 ? 1278 HIS A C     1 
ATOM   2163 O  O     . HIS A 1 301 ? 12.695  -0.293  2.003  1.00 25.49 ? 1278 HIS A O     1 
ATOM   2164 C  CB    . HIS A 1 301 ? 11.955  -0.843  4.837  1.00 23.84 ? 1278 HIS A CB    1 
ATOM   2165 C  CG    . HIS A 1 301 ? 12.067  -1.681  6.075  1.00 24.81 ? 1278 HIS A CG    1 
ATOM   2166 N  ND1   . HIS A 1 301 ? 12.455  -3.005  6.047  1.00 25.14 ? 1278 HIS A ND1   1 
ATOM   2167 C  CD2   . HIS A 1 301 ? 11.821  -1.390  7.375  1.00 24.28 ? 1278 HIS A CD2   1 
ATOM   2168 C  CE1   . HIS A 1 301 ? 12.437  -3.493  7.275  1.00 25.31 ? 1278 HIS A CE1   1 
ATOM   2169 N  NE2   . HIS A 1 301 ? 12.056  -2.534  8.101  1.00 23.70 ? 1278 HIS A NE2   1 
ATOM   2170 N  N     . SER A 1 302 ? 13.336  1.666   2.880  1.00 26.09 ? 1279 SER A N     1 
ATOM   2171 C  CA    . SER A 1 302 ? 13.139  2.394   1.627  1.00 26.33 ? 1279 SER A CA    1 
ATOM   2172 C  C     . SER A 1 302 ? 14.253  2.122   0.627  1.00 29.71 ? 1279 SER A C     1 
ATOM   2173 O  O     . SER A 1 302 ? 15.305  1.589   0.980  1.00 29.77 ? 1279 SER A O     1 
ATOM   2174 C  CB    . SER A 1 302 ? 13.076  3.893   1.889  1.00 23.86 ? 1279 SER A CB    1 
ATOM   2175 O  OG    . SER A 1 302 ? 14.371  4.405   2.132  1.00 23.08 ? 1279 SER A OG    1 
ATOM   2176 N  N     . GLU A 1 303 ? 14.021  2.494   -0.627 1.00 32.75 ? 1280 GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 303 ? 15.022  2.286   -1.659 1.00 36.09 ? 1280 GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 303 ? 16.141  3.318   -1.578 1.00 35.95 ? 1280 GLU A C     1 
ATOM   2179 O  O     . GLU A 1 303 ? 17.123  3.226   -2.308 1.00 37.01 ? 1280 GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 303 ? 14.382  2.308   -3.050 1.00 38.66 ? 1280 GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 303 ? 13.566  3.538   -3.381 1.00 42.57 ? 1280 GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 303 ? 13.021  3.478   -4.798 1.00 46.06 ? 1280 GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 303 ? 12.487  2.415   -5.185 1.00 47.47 ? 1280 GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 303 ? 13.121  4.488   -5.525 1.00 47.98 ? 1280 GLU A OE2   1 
ATOM   2185 N  N     . GLU A 1 304 ? 15.993  4.300   -0.694 1.00 35.27 ? 1281 GLU A N     1 
ATOM   2186 C  CA    . GLU A 1 304 ? 17.024  5.312   -0.522 1.00 35.63 ? 1281 GLU A CA    1 
ATOM   2187 C  C     . GLU A 1 304 ? 18.122  4.770   0.380  1.00 35.55 ? 1281 GLU A C     1 
ATOM   2188 O  O     . GLU A 1 304 ? 19.059  5.485   0.718  1.00 35.94 ? 1281 GLU A O     1 
ATOM   2189 C  CB    . GLU A 1 304 ? 16.449  6.579   0.104  1.00 37.25 ? 1281 GLU A CB    1 
ATOM   2190 C  CG    . GLU A 1 304 ? 15.475  7.326   -0.786 1.00 40.72 ? 1281 GLU A CG    1 
ATOM   2191 C  CD    . GLU A 1 304 ? 15.169  8.717   -0.266 1.00 42.18 ? 1281 GLU A CD    1 
ATOM   2192 O  OE1   . GLU A 1 304 ? 14.385  9.431   -0.923 1.00 45.49 ? 1281 GLU A OE1   1 
ATOM   2193 O  OE2   . GLU A 1 304 ? 15.711  9.100   0.794  1.00 41.11 ? 1281 GLU A OE2   1 
ATOM   2194 N  N     . ASN A 1 305 ? 17.994  3.503   0.764  1.00 35.30 ? 1282 ASN A N     1 
ATOM   2195 C  CA    . ASN A 1 305 ? 18.965  2.842   1.629  1.00 35.89 ? 1282 ASN A CA    1 
ATOM   2196 C  C     . ASN A 1 305 ? 19.262  1.408   1.176  1.00 37.02 ? 1282 ASN A C     1 
ATOM   2197 O  O     . ASN A 1 305 ? 19.472  0.521   2.000  1.00 36.98 ? 1282 ASN A O     1 
ATOM   2198 C  CB    . ASN A 1 305 ? 18.443  2.830   3.070  1.00 33.75 ? 1282 ASN A CB    1 
ATOM   2199 C  CG    . ASN A 1 305 ? 19.339  2.049   4.009  1.00 30.28 ? 1282 ASN A CG    1 
ATOM   2200 O  OD1   . ASN A 1 305 ? 20.549  2.260   4.042  1.00 29.55 ? 1282 ASN A OD1   1 
ATOM   2201 N  ND2   . ASN A 1 305 ? 18.748  1.143   4.779  1.00 27.89 ? 1282 ASN A ND2   1 
ATOM   2202 N  N     . LYS A 1 306 ? 19.278  1.180   -0.135 1.00 40.07 ? 1283 LYS A N     1 
ATOM   2203 C  CA    . LYS A 1 306 ? 19.546  -0.154  -0.678 1.00 40.41 ? 1283 LYS A CA    1 
ATOM   2204 C  C     . LYS A 1 306 ? 19.781  -0.137  -2.189 1.00 39.92 ? 1283 LYS A C     1 
ATOM   2205 O  O     . LYS A 1 306 ? 19.936  0.976   -2.735 1.00 39.01 ? 1283 LYS A O     1 
HETATM 2206 MG MG    . MG  B 2 .   ? 15.687  21.832  17.625 1.00 39.70 ? 301  MG  A MG    1 
HETATM 2207 P  PG    . ACP C 3 .   ? 16.448  24.266  19.934 1.00 41.70 ? 300  ACP A PG    1 
HETATM 2208 O  O1G   . ACP C 3 .   ? 16.931  22.954  19.482 1.00 40.95 ? 300  ACP A O1G   1 
HETATM 2209 O  O2G   . ACP C 3 .   ? 16.975  25.420  19.147 1.00 41.96 ? 300  ACP A O2G   1 
HETATM 2210 O  O3G   . ACP C 3 .   ? 16.550  24.450  21.409 1.00 42.49 ? 300  ACP A O3G   1 
HETATM 2211 P  PB    . ACP C 3 .   ? 13.909  24.730  18.179 1.00 36.01 ? 300  ACP A PB    1 
HETATM 2212 O  O1B   . ACP C 3 .   ? 14.126  26.189  18.046 1.00 35.49 ? 300  ACP A O1B   1 
HETATM 2213 O  O2B   . ACP C 3 .   ? 14.290  23.919  17.006 1.00 37.08 ? 300  ACP A O2B   1 
HETATM 2214 C  C3B   . ACP C 3 .   ? 14.761  24.218  19.575 1.00 38.80 ? 300  ACP A C3B   1 
HETATM 2215 P  PA    . ACP C 3 .   ? 11.548  23.242  18.570 1.00 33.01 ? 300  ACP A PA    1 
HETATM 2216 O  O1A   . ACP C 3 .   ? 11.290  22.726  17.204 1.00 30.20 ? 300  ACP A O1A   1 
HETATM 2217 O  O2A   . ACP C 3 .   ? 12.124  22.337  19.595 1.00 31.95 ? 300  ACP A O2A   1 
HETATM 2218 O  O3A   . ACP C 3 .   ? 12.423  24.492  18.474 1.00 34.51 ? 300  ACP A O3A   1 
HETATM 2219 O  "O5'" . ACP C 3 .   ? 10.170  23.859  19.157 1.00 30.65 ? 300  ACP A "O5'" 1 
HETATM 2220 C  "C5'" . ACP C 3 .   ? 9.942   24.271  20.532 1.00 26.60 ? 300  ACP A "C5'" 1 
HETATM 2221 C  "C4'" . ACP C 3 .   ? 8.649   23.694  21.064 1.00 26.18 ? 300  ACP A "C4'" 1 
HETATM 2222 O  "O4'" . ACP C 3 .   ? 7.561   24.068  20.172 1.00 26.14 ? 300  ACP A "O4'" 1 
HETATM 2223 C  "C3'" . ACP C 3 .   ? 8.580   22.172  21.130 1.00 25.59 ? 300  ACP A "C3'" 1 
HETATM 2224 O  "O3'" . ACP C 3 .   ? 9.124   21.677  22.351 1.00 25.96 ? 300  ACP A "O3'" 1 
HETATM 2225 C  "C2'" . ACP C 3 .   ? 7.081   21.924  21.059 1.00 24.96 ? 300  ACP A "C2'" 1 
HETATM 2226 O  "O2'" . ACP C 3 .   ? 6.443   22.167  22.297 1.00 27.12 ? 300  ACP A "O2'" 1 
HETATM 2227 C  "C1'" . ACP C 3 .   ? 6.651   22.984  20.041 1.00 25.37 ? 300  ACP A "C1'" 1 
HETATM 2228 N  N9    . ACP C 3 .   ? 6.695   22.501  18.655 1.00 24.59 ? 300  ACP A N9    1 
HETATM 2229 C  C8    . ACP C 3 .   ? 7.646   22.775  17.695 1.00 23.59 ? 300  ACP A C8    1 
HETATM 2230 N  N7    . ACP C 3 .   ? 7.434   22.170  16.551 1.00 22.15 ? 300  ACP A N7    1 
HETATM 2231 C  C5    . ACP C 3 .   ? 6.264   21.451  16.764 1.00 22.87 ? 300  ACP A C5    1 
HETATM 2232 C  C6    . ACP C 3 .   ? 5.510   20.596  15.929 1.00 21.19 ? 300  ACP A C6    1 
HETATM 2233 N  N6    . ACP C 3 .   ? 5.855   20.295  14.674 1.00 19.76 ? 300  ACP A N6    1 
HETATM 2234 N  N1    . ACP C 3 .   ? 4.379   20.051  16.438 1.00 19.28 ? 300  ACP A N1    1 
HETATM 2235 C  C2    . ACP C 3 .   ? 4.042   20.345  17.701 1.00 22.98 ? 300  ACP A C2    1 
HETATM 2236 N  N3    . ACP C 3 .   ? 4.673   21.125  18.588 1.00 24.55 ? 300  ACP A N3    1 
HETATM 2237 C  C4    . ACP C 3 .   ? 5.789   21.655  18.051 1.00 24.35 ? 300  ACP A C4    1 
HETATM 2238 O  O     . HOH D 4 .   ? -4.536  20.753  3.484  1.00 11.81 ? 1    HOH A O     1 
HETATM 2239 O  O     . HOH D 4 .   ? 23.028  14.315  19.855 1.00 8.97  ? 2    HOH A O     1 
HETATM 2240 O  O     . HOH D 4 .   ? 15.487  17.622  16.909 1.00 8.54  ? 3    HOH A O     1 
HETATM 2241 O  O     . HOH D 4 .   ? 7.173   13.060  8.768  1.00 6.26  ? 4    HOH A O     1 
HETATM 2242 O  O     . HOH D 4 .   ? 26.830  14.400  18.750 1.00 8.40  ? 5    HOH A O     1 
HETATM 2243 O  O     . HOH D 4 .   ? 10.319  -3.983  10.113 1.00 25.19 ? 6    HOH A O     1 
HETATM 2244 O  O     . HOH D 4 .   ? 13.529  -6.866  28.425 1.00 25.53 ? 7    HOH A O     1 
HETATM 2245 O  O     . HOH D 4 .   ? 0.070   14.755  15.119 1.00 12.80 ? 8    HOH A O     1 
HETATM 2246 O  O     . HOH D 4 .   ? 2.847   1.012   16.391 1.00 20.14 ? 9    HOH A O     1 
HETATM 2247 O  O     . HOH D 4 .   ? 4.061   4.775   15.416 1.00 26.74 ? 10   HOH A O     1 
HETATM 2248 O  O     . HOH D 4 .   ? 5.539   3.414   20.844 1.00 16.25 ? 11   HOH A O     1 
HETATM 2249 O  O     . HOH D 4 .   ? 4.067   5.588   11.874 1.00 7.74  ? 12   HOH A O     1 
HETATM 2250 O  O     . HOH D 4 .   ? 2.062   8.080   11.143 1.00 16.39 ? 13   HOH A O     1 
HETATM 2251 O  O     . HOH D 4 .   ? 3.677   5.678   25.247 1.00 21.42 ? 14   HOH A O     1 
HETATM 2252 O  O     . HOH D 4 .   ? 25.479  11.191  29.235 1.00 15.31 ? 15   HOH A O     1 
HETATM 2253 O  O     . HOH D 4 .   ? -4.956  22.161  14.681 1.00 26.27 ? 16   HOH A O     1 
HETATM 2254 O  O     . HOH D 4 .   ? 25.485  0.801   9.323  1.00 22.39 ? 17   HOH A O     1 
HETATM 2255 O  O     . HOH D 4 .   ? 6.006   5.005   18.648 1.00 17.92 ? 18   HOH A O     1 
HETATM 2256 O  O     . HOH D 4 .   ? 10.665  18.245  5.489  1.00 24.04 ? 19   HOH A O     1 
HETATM 2257 O  O     . HOH D 4 .   ? -4.202  16.858  10.049 1.00 25.51 ? 20   HOH A O     1 
HETATM 2258 O  O     . HOH D 4 .   ? -7.672  22.121  14.582 1.00 28.93 ? 21   HOH A O     1 
HETATM 2259 O  O     . HOH D 4 .   ? 29.708  11.553  11.391 1.00 21.68 ? 22   HOH A O     1 
HETATM 2260 O  O     . HOH D 4 .   ? 2.203   -2.490  23.656 1.00 16.99 ? 23   HOH A O     1 
HETATM 2261 O  O     . HOH D 4 .   ? 0.423   9.719   42.165 1.00 38.74 ? 24   HOH A O     1 
HETATM 2262 O  O     . HOH D 4 .   ? -1.542  20.319  19.776 1.00 23.90 ? 25   HOH A O     1 
HETATM 2263 O  O     . HOH D 4 .   ? 2.456   22.767  23.991 1.00 31.82 ? 26   HOH A O     1 
HETATM 2264 O  O     . HOH D 4 .   ? 21.386  16.545  23.623 1.00 12.81 ? 27   HOH A O     1 
HETATM 2265 O  O     . HOH D 4 .   ? 33.766  8.713   38.856 1.00 32.50 ? 28   HOH A O     1 
HETATM 2266 O  O     . HOH D 4 .   ? 28.971  0.379   28.189 1.00 24.68 ? 29   HOH A O     1 
HETATM 2267 O  O     . HOH D 4 .   ? 11.116  14.265  6.632  1.00 19.47 ? 30   HOH A O     1 
HETATM 2268 O  O     . HOH D 4 .   ? 1.620   14.248  11.832 1.00 20.47 ? 31   HOH A O     1 
HETATM 2269 O  O     . HOH D 4 .   ? 20.035  -0.990  5.823  1.00 27.09 ? 32   HOH A O     1 
HETATM 2270 O  O     . HOH D 4 .   ? 2.722   3.891   10.553 1.00 27.86 ? 33   HOH A O     1 
HETATM 2271 O  O     . HOH D 4 .   ? 22.677  0.695   4.078  1.00 26.16 ? 34   HOH A O     1 
HETATM 2272 O  O     . HOH D 4 .   ? 5.529   1.877   12.119 1.00 25.04 ? 35   HOH A O     1 
HETATM 2273 O  O     . HOH D 4 .   ? 25.161  -4.419  16.840 1.00 37.58 ? 36   HOH A O     1 
HETATM 2274 O  O     . HOH D 4 .   ? 27.020  5.506   15.180 1.00 29.40 ? 37   HOH A O     1 
HETATM 2275 O  O     . HOH D 4 .   ? 21.929  4.743   3.385  1.00 30.84 ? 38   HOH A O     1 
HETATM 2276 O  O     . HOH D 4 .   ? 8.532   -6.376  12.804 1.00 27.84 ? 39   HOH A O     1 
HETATM 2277 O  O     . HOH D 4 .   ? 0.272   17.860  10.388 1.00 21.74 ? 40   HOH A O     1 
HETATM 2278 O  O     . HOH D 4 .   ? 27.374  13.143  29.325 1.00 18.00 ? 41   HOH A O     1 
HETATM 2279 O  O     . HOH D 4 .   ? 4.150   16.753  30.916 1.00 28.81 ? 42   HOH A O     1 
HETATM 2280 O  O     . HOH D 4 .   ? 11.867  16.702  7.440  1.00 15.44 ? 43   HOH A O     1 
HETATM 2281 O  O     . HOH D 4 .   ? 2.375   10.727  11.362 1.00 25.94 ? 44   HOH A O     1 
HETATM 2282 O  O     . HOH D 4 .   ? 0.062   16.436  7.710  1.00 26.06 ? 45   HOH A O     1 
HETATM 2283 O  O     . HOH D 4 .   ? 30.670  3.766   15.518 1.00 30.23 ? 46   HOH A O     1 
HETATM 2284 O  O     . HOH D 4 .   ? 11.444  3.098   -1.153 1.00 23.56 ? 47   HOH A O     1 
HETATM 2285 O  O     . HOH D 4 .   ? 8.321   22.645  24.997 1.00 41.05 ? 48   HOH A O     1 
HETATM 2286 O  O     . HOH D 4 .   ? 15.577  17.867  28.719 1.00 17.31 ? 49   HOH A O     1 
HETATM 2287 O  O     . HOH D 4 .   ? 11.641  -6.264  8.804  1.00 27.81 ? 50   HOH A O     1 
HETATM 2288 O  O     . HOH D 4 .   ? 10.643  7.467   5.531  1.00 25.17 ? 51   HOH A O     1 
HETATM 2289 O  O     . HOH D 4 .   ? 4.726   9.215   5.399  1.00 29.35 ? 52   HOH A O     1 
HETATM 2290 O  O     . HOH D 4 .   ? 28.290  14.307  22.301 1.00 25.98 ? 53   HOH A O     1 
HETATM 2291 O  O     . HOH D 4 .   ? 11.861  28.896  16.561 1.00 22.94 ? 54   HOH A O     1 
HETATM 2292 O  O     . HOH D 4 .   ? 18.188  16.030  0.553  1.00 26.33 ? 55   HOH A O     1 
HETATM 2293 O  O     . HOH D 4 .   ? 16.763  -8.994  13.564 1.00 46.09 ? 56   HOH A O     1 
HETATM 2294 O  O     . HOH D 4 .   ? 18.991  30.493  16.645 1.00 29.19 ? 57   HOH A O     1 
HETATM 2295 O  O     . HOH D 4 .   ? -4.149  10.605  20.250 1.00 26.39 ? 58   HOH A O     1 
HETATM 2296 O  O     . HOH D 4 .   ? 35.350  8.645   23.765 1.00 26.57 ? 59   HOH A O     1 
HETATM 2297 O  O     . HOH D 4 .   ? 23.743  25.330  26.944 1.00 40.86 ? 60   HOH A O     1 
HETATM 2298 O  O     . HOH D 4 .   ? 14.724  -7.787  15.308 1.00 20.78 ? 61   HOH A O     1 
HETATM 2299 O  O     . HOH D 4 .   ? -0.353  13.027  27.584 1.00 30.69 ? 62   HOH A O     1 
HETATM 2300 O  O     . HOH D 4 .   ? 14.287  13.772  30.728 1.00 18.38 ? 63   HOH A O     1 
HETATM 2301 O  O     . HOH D 4 .   ? 1.319   -7.152  19.576 1.00 22.46 ? 64   HOH A O     1 
HETATM 2302 O  O     . HOH D 4 .   ? 3.731   20.955  21.310 1.00 24.97 ? 65   HOH A O     1 
HETATM 2303 O  O     . HOH D 4 .   ? 35.025  1.205   24.311 1.00 22.39 ? 66   HOH A O     1 
HETATM 2304 O  O     . HOH D 4 .   ? 25.372  7.475   30.197 1.00 19.72 ? 67   HOH A O     1 
HETATM 2305 O  O     . HOH D 4 .   ? -4.670  8.663   15.625 1.00 35.77 ? 68   HOH A O     1 
HETATM 2306 O  O     . HOH D 4 .   ? 5.146   -1.848  17.574 1.00 28.51 ? 69   HOH A O     1 
HETATM 2307 O  O     . HOH D 4 .   ? 18.620  19.735  2.569  1.00 25.96 ? 70   HOH A O     1 
HETATM 2308 O  O     . HOH D 4 .   ? 38.661  19.080  27.959 1.00 40.70 ? 71   HOH A O     1 
HETATM 2309 O  O     . HOH D 4 .   ? 0.504   6.219   33.523 1.00 29.19 ? 72   HOH A O     1 
HETATM 2310 O  O     . HOH D 4 .   ? -0.521  5.150   23.636 1.00 32.35 ? 73   HOH A O     1 
HETATM 2311 O  O     . HOH D 4 .   ? 18.278  -9.919  9.601  1.00 33.91 ? 74   HOH A O     1 
HETATM 2312 O  O     . HOH D 4 .   ? 30.294  -0.512  15.111 1.00 27.08 ? 75   HOH A O     1 
HETATM 2313 O  O     . HOH D 4 .   ? -1.420  -4.765  13.153 1.00 44.89 ? 76   HOH A O     1 
HETATM 2314 O  O     . HOH D 4 .   ? 8.911   31.349  26.934 1.00 50.53 ? 77   HOH A O     1 
HETATM 2315 O  O     . HOH D 4 .   ? -11.823 23.833  11.630 1.00 30.44 ? 78   HOH A O     1 
HETATM 2316 O  O     . HOH D 4 .   ? 3.909   43.083  5.426  1.00 33.96 ? 79   HOH A O     1 
HETATM 2317 O  O     . HOH D 4 .   ? 22.673  -4.942  13.388 1.00 30.43 ? 80   HOH A O     1 
HETATM 2318 O  O     . HOH D 4 .   ? 22.257  -9.024  29.149 1.00 22.32 ? 81   HOH A O     1 
HETATM 2319 O  O     . HOH D 4 .   ? 7.421   -3.104  19.119 1.00 32.55 ? 82   HOH A O     1 
HETATM 2320 O  O     . HOH D 4 .   ? 11.187  20.835  13.568 1.00 42.45 ? 83   HOH A O     1 
HETATM 2321 O  O     . HOH D 4 .   ? 5.123   10.374  39.406 1.00 39.90 ? 84   HOH A O     1 
HETATM 2322 O  O     . HOH D 4 .   ? 15.448  12.466  38.122 1.00 37.02 ? 85   HOH A O     1 
HETATM 2323 O  O     . HOH D 4 .   ? 21.063  18.376  39.271 1.00 35.49 ? 86   HOH A O     1 
HETATM 2324 O  O     . HOH D 4 .   ? 28.642  9.688   1.122  1.00 53.24 ? 87   HOH A O     1 
HETATM 2325 O  O     . HOH D 4 .   ? 13.803  26.896  12.947 1.00 36.70 ? 88   HOH A O     1 
HETATM 2326 O  O     . HOH D 4 .   ? 4.022   15.711  4.656  1.00 32.45 ? 89   HOH A O     1 
HETATM 2327 O  O     . HOH D 4 .   ? 27.131  -3.105  16.220 1.00 26.41 ? 90   HOH A O     1 
HETATM 2328 O  O     . HOH D 4 .   ? 5.430   -5.831  7.783  1.00 38.28 ? 91   HOH A O     1 
HETATM 2329 O  O     . HOH D 4 .   ? 31.849  7.309   30.132 1.00 12.87 ? 92   HOH A O     1 
HETATM 2330 O  O     . HOH D 4 .   ? 9.327   29.939  -1.170 1.00 32.81 ? 93   HOH A O     1 
HETATM 2331 O  O     . HOH D 4 .   ? 23.073  19.305  11.957 1.00 24.44 ? 94   HOH A O     1 
HETATM 2332 O  O     . HOH D 4 .   ? 10.865  7.531   36.794 1.00 58.10 ? 95   HOH A O     1 
HETATM 2333 O  O     . HOH D 4 .   ? 19.146  21.637  19.243 1.00 39.13 ? 96   HOH A O     1 
HETATM 2334 O  O     . HOH D 4 .   ? 7.149   -4.842  11.176 1.00 21.60 ? 97   HOH A O     1 
HETATM 2335 O  O     . HOH D 4 .   ? 23.384  4.955   10.286 1.00 5.99  ? 98   HOH A O     1 
HETATM 2336 O  O     . HOH D 4 .   ? 7.668   -8.918  13.411 1.00 18.27 ? 99   HOH A O     1 
HETATM 2337 O  O     . HOH D 4 .   ? 12.521  20.409  16.230 1.00 21.78 ? 100  HOH A O     1 
HETATM 2338 O  O     . HOH D 4 .   ? 23.495  20.529  14.218 1.00 40.99 ? 101  HOH A O     1 
HETATM 2339 O  O     . HOH D 4 .   ? 2.305   23.502  -0.409 1.00 24.94 ? 102  HOH A O     1 
HETATM 2340 O  O     . HOH D 4 .   ? 19.231  -5.848  22.033 1.00 32.16 ? 103  HOH A O     1 
HETATM 2341 O  O     . HOH D 4 .   ? 25.659  14.161  21.135 1.00 18.18 ? 104  HOH A O     1 
HETATM 2342 O  O     . HOH D 4 .   ? 32.334  11.265  18.196 1.00 30.39 ? 105  HOH A O     1 
HETATM 2343 O  O     . HOH D 4 .   ? 22.234  16.346  2.679  1.00 19.44 ? 106  HOH A O     1 
HETATM 2344 O  O     . HOH D 4 .   ? 12.558  7.978   3.932  1.00 26.58 ? 107  HOH A O     1 
HETATM 2345 O  O     . HOH D 4 .   ? -2.434  15.789  14.153 1.00 19.68 ? 108  HOH A O     1 
HETATM 2346 O  O     . HOH D 4 .   ? -7.238  25.822  20.525 1.00 45.94 ? 109  HOH A O     1 
HETATM 2347 O  O     . HOH D 4 .   ? 9.425   29.728  15.948 1.00 21.77 ? 110  HOH A O     1 
HETATM 2348 O  O     . HOH D 4 .   ? 15.547  22.002  22.826 1.00 29.83 ? 111  HOH A O     1 
HETATM 2349 O  O     . HOH D 4 .   ? 19.230  25.354  21.728 1.00 38.25 ? 112  HOH A O     1 
HETATM 2350 O  O     . HOH D 4 .   ? 25.912  16.245  15.741 1.00 63.01 ? 113  HOH A O     1 
HETATM 2351 O  O     . HOH D 4 .   ? 17.485  23.521  16.173 1.00 25.80 ? 114  HOH A O     1 
HETATM 2352 O  O     . HOH D 4 .   ? 17.705  22.466  12.979 1.00 27.03 ? 115  HOH A O     1 
HETATM 2353 O  O     . HOH D 4 .   ? 17.586  20.171  17.511 1.00 20.35 ? 116  HOH A O     1 
HETATM 2354 O  O     . HOH D 4 .   ? 0.111   17.738  -1.499 1.00 19.98 ? 117  HOH A O     1 
HETATM 2355 O  O     . HOH D 4 .   ? -6.509  20.533  -0.704 1.00 18.64 ? 118  HOH A O     1 
HETATM 2356 O  O     . HOH D 4 .   ? -10.006 18.431  5.506  1.00 35.18 ? 119  HOH A O     1 
HETATM 2357 O  O     . HOH D 4 .   ? -6.935  28.310  7.356  1.00 35.67 ? 120  HOH A O     1 
HETATM 2358 O  O     . HOH D 4 .   ? 13.791  20.668  18.641 1.00 30.49 ? 121  HOH A O     1 
HETATM 2359 O  O     . HOH D 4 .   ? 15.287  15.663  26.932 1.00 12.65 ? 122  HOH A O     1 
HETATM 2360 O  O     . HOH D 4 .   ? 22.826  18.997  30.701 1.00 27.82 ? 123  HOH A O     1 
HETATM 2361 O  O     . HOH D 4 .   ? 11.851  20.920  21.800 1.00 40.31 ? 124  HOH A O     1 
HETATM 2362 O  O     . HOH D 4 .   ? 6.403   4.426   12.560 1.00 17.70 ? 125  HOH A O     1 
HETATM 2363 O  O     . HOH D 4 .   ? 0.626   3.201   13.530 1.00 29.52 ? 126  HOH A O     1 
HETATM 2364 O  O     . HOH D 4 .   ? 23.637  5.371   5.357  1.00 25.30 ? 127  HOH A O     1 
HETATM 2365 O  O     . HOH D 4 .   ? 3.012   2.309   14.191 1.00 40.88 ? 128  HOH A O     1 
HETATM 2366 O  O     . HOH D 4 .   ? 3.335   4.810   22.764 1.00 26.82 ? 129  HOH A O     1 
HETATM 2367 O  O     . HOH D 4 .   ? 24.924  7.951   37.745 1.00 36.31 ? 130  HOH A O     1 
HETATM 2368 O  O     . HOH D 4 .   ? 5.912   20.106  23.683 1.00 25.57 ? 131  HOH A O     1 
HETATM 2369 O  O     . HOH D 4 .   ? 34.884  10.723  38.211 1.00 36.80 ? 132  HOH A O     1 
HETATM 2370 O  O     . HOH D 4 .   ? 9.115   14.739  36.568 1.00 29.04 ? 133  HOH A O     1 
HETATM 2371 O  O     . HOH D 4 .   ? 13.196  16.096  34.539 1.00 39.20 ? 134  HOH A O     1 
HETATM 2372 O  O     . HOH D 4 .   ? 34.543  18.819  35.666 1.00 28.41 ? 135  HOH A O     1 
HETATM 2373 O  O     . HOH D 4 .   ? 0.993   3.825   21.811 1.00 25.65 ? 136  HOH A O     1 
HETATM 2374 O  O     . HOH D 4 .   ? 3.309   33.641  0.695  1.00 24.77 ? 137  HOH A O     1 
HETATM 2375 O  O     . HOH D 4 .   ? 12.284  23.341  22.795 1.00 42.09 ? 138  HOH A O     1 
HETATM 2376 O  O     . HOH D 4 .   ? 13.088  26.356  15.345 1.00 37.10 ? 139  HOH A O     1 
HETATM 2377 O  O     . HOH D 4 .   ? 12.763  27.441  10.628 1.00 33.11 ? 140  HOH A O     1 
HETATM 2378 O  O     . HOH D 4 .   ? 16.203  25.831  15.709 1.00 43.51 ? 141  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   978  ?    ?   ?   A . n 
A 1 2   PHE 2   979  ?    ?   ?   A . n 
A 1 3   PRO 3   980  ?    ?   ?   A . n 
A 1 4   SER 4   981  ?    ?   ?   A . n 
A 1 5   SER 5   982  ?    ?   ?   A . n 
A 1 6   VAL 6   983  ?    ?   ?   A . n 
A 1 7   PHE 7   984  ?    ?   ?   A . n 
A 1 8   VAL 8   985  ?    ?   ?   A . n 
A 1 9   PRO 9   986  986  PRO PRO A . n 
A 1 10  ASP 10  987  987  ASP ASP A . n 
A 1 11  GLU 11  988  988  GLU GLU A . n 
A 1 12  TRP 12  989  989  TRP TRP A . n 
A 1 13  GLU 13  990  990  GLU GLU A . n 
A 1 14  VAL 14  991  991  VAL VAL A . n 
A 1 15  SER 15  992  992  SER SER A . n 
A 1 16  ARG 16  993  993  ARG ARG A . n 
A 1 17  GLU 17  994  994  GLU GLU A . n 
A 1 18  LYS 18  995  995  LYS LYS A . n 
A 1 19  ILE 19  996  996  ILE ILE A . n 
A 1 20  THR 20  997  997  THR THR A . n 
A 1 21  LEU 21  998  998  LEU LEU A . n 
A 1 22  LEU 22  999  999  LEU LEU A . n 
A 1 23  ARG 23  1000 1000 ARG ARG A . n 
A 1 24  GLU 24  1001 1001 GLU GLU A . n 
A 1 25  LEU 25  1002 1002 LEU LEU A . n 
A 1 26  GLY 26  1003 1003 GLY GLY A . n 
A 1 27  GLN 27  1004 1004 GLN GLN A . n 
A 1 28  GLY 28  1005 1005 GLY GLY A . n 
A 1 29  SER 29  1006 1006 SER SER A . n 
A 1 30  PHE 30  1007 1007 PHE PHE A . n 
A 1 31  GLY 31  1008 1008 GLY GLY A . n 
A 1 32  MET 32  1009 1009 MET MET A . n 
A 1 33  VAL 33  1010 1010 VAL VAL A . n 
A 1 34  TYR 34  1011 1011 TYR TYR A . n 
A 1 35  GLU 35  1012 1012 GLU GLU A . n 
A 1 36  GLY 36  1013 1013 GLY GLY A . n 
A 1 37  ASN 37  1014 1014 ASN ASN A . n 
A 1 38  ALA 38  1015 1015 ALA ALA A . n 
A 1 39  ARG 39  1016 1016 ARG ARG A . n 
A 1 40  ASP 40  1017 1017 ASP ASP A . n 
A 1 41  ILE 41  1018 1018 ILE ILE A . n 
A 1 42  ILE 42  1019 1019 ILE ILE A . n 
A 1 43  LYS 43  1020 1020 LYS LYS A . n 
A 1 44  GLY 44  1021 1021 GLY GLY A . n 
A 1 45  GLU 45  1022 1022 GLU GLU A . n 
A 1 46  ALA 46  1023 1023 ALA ALA A . n 
A 1 47  GLU 47  1024 1024 GLU GLU A . n 
A 1 48  THR 48  1025 1025 THR THR A . n 
A 1 49  ARG 49  1026 1026 ARG ARG A . n 
A 1 50  VAL 50  1027 1027 VAL VAL A . n 
A 1 51  ALA 51  1028 1028 ALA ALA A . n 
A 1 52  VAL 52  1029 1029 VAL VAL A . n 
A 1 53  LYS 53  1030 1030 LYS LYS A . n 
A 1 54  THR 54  1031 1031 THR THR A . n 
A 1 55  VAL 55  1032 1032 VAL VAL A . n 
A 1 56  ASN 56  1033 1033 ASN ASN A . n 
A 1 57  GLU 57  1034 1034 GLU GLU A . n 
A 1 58  SER 58  1035 1035 SER SER A . n 
A 1 59  ALA 59  1036 1036 ALA ALA A . n 
A 1 60  SER 60  1037 1037 SER SER A . n 
A 1 61  LEU 61  1038 1038 LEU LEU A . n 
A 1 62  ARG 62  1039 1039 ARG ARG A . n 
A 1 63  GLU 63  1040 1040 GLU GLU A . n 
A 1 64  ARG 64  1041 1041 ARG ARG A . n 
A 1 65  ILE 65  1042 1042 ILE ILE A . n 
A 1 66  GLU 66  1043 1043 GLU GLU A . n 
A 1 67  PHE 67  1044 1044 PHE PHE A . n 
A 1 68  LEU 68  1045 1045 LEU LEU A . n 
A 1 69  ASN 69  1046 1046 ASN ASN A . n 
A 1 70  GLU 70  1047 1047 GLU GLU A . n 
A 1 71  ALA 71  1048 1048 ALA ALA A . n 
A 1 72  SER 72  1049 1049 SER SER A . n 
A 1 73  VAL 73  1050 1050 VAL VAL A . n 
A 1 74  MET 74  1051 1051 MET MET A . n 
A 1 75  LYS 75  1052 1052 LYS LYS A . n 
A 1 76  GLY 76  1053 1053 GLY GLY A . n 
A 1 77  PHE 77  1054 1054 PHE PHE A . n 
A 1 78  THR 78  1055 1055 THR THR A . n 
A 1 79  CYS 79  1056 1056 CYS CYS A . n 
A 1 80  HIS 80  1057 1057 HIS HIS A . n 
A 1 81  HIS 81  1058 1058 HIS HIS A . n 
A 1 82  VAL 82  1059 1059 VAL VAL A . n 
A 1 83  VAL 83  1060 1060 VAL VAL A . n 
A 1 84  ARG 84  1061 1061 ARG ARG A . n 
A 1 85  LEU 85  1062 1062 LEU LEU A . n 
A 1 86  LEU 86  1063 1063 LEU LEU A . n 
A 1 87  GLY 87  1064 1064 GLY GLY A . n 
A 1 88  VAL 88  1065 1065 VAL VAL A . n 
A 1 89  VAL 89  1066 1066 VAL VAL A . n 
A 1 90  SER 90  1067 1067 SER SER A . n 
A 1 91  LYS 91  1068 1068 LYS LYS A . n 
A 1 92  GLY 92  1069 1069 GLY GLY A . n 
A 1 93  GLN 93  1070 1070 GLN GLN A . n 
A 1 94  PRO 94  1071 1071 PRO PRO A . n 
A 1 95  THR 95  1072 1072 THR THR A . n 
A 1 96  LEU 96  1073 1073 LEU LEU A . n 
A 1 97  VAL 97  1074 1074 VAL VAL A . n 
A 1 98  VAL 98  1075 1075 VAL VAL A . n 
A 1 99  MET 99  1076 1076 MET MET A . n 
A 1 100 GLU 100 1077 1077 GLU GLU A . n 
A 1 101 LEU 101 1078 1078 LEU LEU A . n 
A 1 102 MET 102 1079 1079 MET MET A . n 
A 1 103 ALA 103 1080 1080 ALA ALA A . n 
A 1 104 HIS 104 1081 1081 HIS HIS A . n 
A 1 105 GLY 105 1082 1082 GLY GLY A . n 
A 1 106 ASP 106 1083 1083 ASP ASP A . n 
A 1 107 LEU 107 1084 1084 LEU LEU A . n 
A 1 108 LYS 108 1085 1085 LYS LYS A . n 
A 1 109 SER 109 1086 1086 SER SER A . n 
A 1 110 TYR 110 1087 1087 TYR TYR A . n 
A 1 111 LEU 111 1088 1088 LEU LEU A . n 
A 1 112 ARG 112 1089 1089 ARG ARG A . n 
A 1 113 SER 113 1090 1090 SER SER A . n 
A 1 114 LEU 114 1091 1091 LEU LEU A . n 
A 1 115 ARG 115 1092 1092 ARG ARG A . n 
A 1 116 PRO 116 1093 1093 PRO PRO A . n 
A 1 117 GLU 117 1094 1094 GLU GLU A . n 
A 1 118 ALA 118 1095 1095 ALA ALA A . n 
A 1 119 GLU 119 1096 1096 GLU GLU A . n 
A 1 120 ASN 120 1097 1097 ASN ASN A . n 
A 1 121 ASN 121 1098 1098 ASN ASN A . n 
A 1 122 PRO 122 1099 1099 PRO PRO A . n 
A 1 123 GLY 123 1100 1100 GLY GLY A . n 
A 1 124 ARG 124 1101 1101 ARG ARG A . n 
A 1 125 PRO 125 1102 1102 PRO PRO A . n 
A 1 126 PRO 126 1103 1103 PRO PRO A . n 
A 1 127 PRO 127 1104 1104 PRO PRO A . n 
A 1 128 THR 128 1105 1105 THR THR A . n 
A 1 129 LEU 129 1106 1106 LEU LEU A . n 
A 1 130 GLN 130 1107 1107 GLN GLN A . n 
A 1 131 GLU 131 1108 1108 GLU GLU A . n 
A 1 132 MET 132 1109 1109 MET MET A . n 
A 1 133 ILE 133 1110 1110 ILE ILE A . n 
A 1 134 GLN 134 1111 1111 GLN GLN A . n 
A 1 135 MET 135 1112 1112 MET MET A . n 
A 1 136 ALA 136 1113 1113 ALA ALA A . n 
A 1 137 ALA 137 1114 1114 ALA ALA A . n 
A 1 138 GLU 138 1115 1115 GLU GLU A . n 
A 1 139 ILE 139 1116 1116 ILE ILE A . n 
A 1 140 ALA 140 1117 1117 ALA ALA A . n 
A 1 141 ASP 141 1118 1118 ASP ASP A . n 
A 1 142 GLY 142 1119 1119 GLY GLY A . n 
A 1 143 MET 143 1120 1120 MET MET A . n 
A 1 144 ALA 144 1121 1121 ALA ALA A . n 
A 1 145 TYR 145 1122 1122 TYR TYR A . n 
A 1 146 LEU 146 1123 1123 LEU LEU A . n 
A 1 147 ASN 147 1124 1124 ASN ASN A . n 
A 1 148 ALA 148 1125 1125 ALA ALA A . n 
A 1 149 LYS 149 1126 1126 LYS LYS A . n 
A 1 150 LYS 150 1127 1127 LYS LYS A . n 
A 1 151 PHE 151 1128 1128 PHE PHE A . n 
A 1 152 VAL 152 1129 1129 VAL VAL A . n 
A 1 153 HIS 153 1130 1130 HIS HIS A . n 
A 1 154 ARG 154 1131 1131 ARG ARG A . n 
A 1 155 ASP 155 1132 1132 ASP ASP A . n 
A 1 156 LEU 156 1133 1133 LEU LEU A . n 
A 1 157 ALA 157 1134 1134 ALA ALA A . n 
A 1 158 ALA 158 1135 1135 ALA ALA A . n 
A 1 159 ARG 159 1136 1136 ARG ARG A . n 
A 1 160 ASN 160 1137 1137 ASN ASN A . n 
A 1 161 CYS 161 1138 1138 CYS CYS A . n 
A 1 162 MET 162 1139 1139 MET MET A . n 
A 1 163 VAL 163 1140 1140 VAL VAL A . n 
A 1 164 ALA 164 1141 1141 ALA ALA A . n 
A 1 165 HIS 165 1142 1142 HIS HIS A . n 
A 1 166 ASP 166 1143 1143 ASP ASP A . n 
A 1 167 PHE 167 1144 1144 PHE PHE A . n 
A 1 168 THR 168 1145 1145 THR THR A . n 
A 1 169 VAL 169 1146 1146 VAL VAL A . n 
A 1 170 LYS 170 1147 1147 LYS LYS A . n 
A 1 171 ILE 171 1148 1148 ILE ILE A . n 
A 1 172 GLY 172 1149 1149 GLY GLY A . n 
A 1 173 ASP 173 1150 1150 ASP ASP A . n 
A 1 174 PHE 174 1151 1151 PHE PHE A . n 
A 1 175 GLY 175 1152 1152 GLY GLY A . n 
A 1 176 MET 176 1153 1153 MET MET A . n 
A 1 177 THR 177 1154 1154 THR THR A . n 
A 1 178 ARG 178 1155 ?    ?   ?   A . n 
A 1 179 ASP 179 1156 ?    ?   ?   A . n 
A 1 180 ILE 180 1157 ?    ?   ?   A . n 
A 1 181 TYR 181 1158 ?    ?   ?   A . n 
A 1 182 GLU 182 1159 ?    ?   ?   A . n 
A 1 183 THR 183 1160 ?    ?   ?   A . n 
A 1 184 ALA 184 1161 ?    ?   ?   A . n 
A 1 185 TYR 185 1162 ?    ?   ?   A . n 
A 1 186 TYR 186 1163 ?    ?   ?   A . n 
A 1 187 ARG 187 1164 ?    ?   ?   A . n 
A 1 188 LYS 188 1165 ?    ?   ?   A . n 
A 1 189 GLY 189 1166 ?    ?   ?   A . n 
A 1 190 GLY 190 1167 ?    ?   ?   A . n 
A 1 191 LYS 191 1168 ?    ?   ?   A . n 
A 1 192 GLY 192 1169 ?    ?   ?   A . n 
A 1 193 LEU 193 1170 ?    ?   ?   A . n 
A 1 194 LEU 194 1171 1171 LEU LEU A . n 
A 1 195 PRO 195 1172 1172 PRO PRO A . n 
A 1 196 VAL 196 1173 1173 VAL VAL A . n 
A 1 197 ARG 197 1174 1174 ARG ARG A . n 
A 1 198 TRP 198 1175 1175 TRP TRP A . n 
A 1 199 MET 199 1176 1176 MET MET A . n 
A 1 200 ALA 200 1177 1177 ALA ALA A . n 
A 1 201 PRO 201 1178 1178 PRO PRO A . n 
A 1 202 GLU 202 1179 1179 GLU GLU A . n 
A 1 203 SER 203 1180 1180 SER SER A . n 
A 1 204 LEU 204 1181 1181 LEU LEU A . n 
A 1 205 LYS 205 1182 1182 LYS LYS A . n 
A 1 206 ASP 206 1183 1183 ASP ASP A . n 
A 1 207 GLY 207 1184 1184 GLY GLY A . n 
A 1 208 VAL 208 1185 1185 VAL VAL A . n 
A 1 209 PHE 209 1186 1186 PHE PHE A . n 
A 1 210 THR 210 1187 1187 THR THR A . n 
A 1 211 THR 211 1188 1188 THR THR A . n 
A 1 212 SER 212 1189 1189 SER SER A . n 
A 1 213 SER 213 1190 1190 SER SER A . n 
A 1 214 ASP 214 1191 1191 ASP ASP A . n 
A 1 215 MET 215 1192 1192 MET MET A . n 
A 1 216 TRP 216 1193 1193 TRP TRP A . n 
A 1 217 SER 217 1194 1194 SER SER A . n 
A 1 218 PHE 218 1195 1195 PHE PHE A . n 
A 1 219 GLY 219 1196 1196 GLY GLY A . n 
A 1 220 VAL 220 1197 1197 VAL VAL A . n 
A 1 221 VAL 221 1198 1198 VAL VAL A . n 
A 1 222 LEU 222 1199 1199 LEU LEU A . n 
A 1 223 TRP 223 1200 1200 TRP TRP A . n 
A 1 224 GLU 224 1201 1201 GLU GLU A . n 
A 1 225 ILE 225 1202 1202 ILE ILE A . n 
A 1 226 THR 226 1203 1203 THR THR A . n 
A 1 227 SER 227 1204 1204 SER SER A . n 
A 1 228 LEU 228 1205 1205 LEU LEU A . n 
A 1 229 ALA 229 1206 1206 ALA ALA A . n 
A 1 230 GLU 230 1207 1207 GLU GLU A . n 
A 1 231 GLN 231 1208 1208 GLN GLN A . n 
A 1 232 PRO 232 1209 1209 PRO PRO A . n 
A 1 233 TYR 233 1210 1210 TYR TYR A . n 
A 1 234 GLN 234 1211 1211 GLN GLN A . n 
A 1 235 GLY 235 1212 1212 GLY GLY A . n 
A 1 236 LEU 236 1213 1213 LEU LEU A . n 
A 1 237 SER 237 1214 1214 SER SER A . n 
A 1 238 ASN 238 1215 1215 ASN ASN A . n 
A 1 239 GLU 239 1216 1216 GLU GLU A . n 
A 1 240 GLN 240 1217 1217 GLN GLN A . n 
A 1 241 VAL 241 1218 1218 VAL VAL A . n 
A 1 242 LEU 242 1219 1219 LEU LEU A . n 
A 1 243 LYS 243 1220 1220 LYS LYS A . n 
A 1 244 PHE 244 1221 1221 PHE PHE A . n 
A 1 245 VAL 245 1222 1222 VAL VAL A . n 
A 1 246 MET 246 1223 1223 MET MET A . n 
A 1 247 ASP 247 1224 1224 ASP ASP A . n 
A 1 248 GLY 248 1225 1225 GLY GLY A . n 
A 1 249 GLY 249 1226 1226 GLY GLY A . n 
A 1 250 TYR 250 1227 1227 TYR TYR A . n 
A 1 251 LEU 251 1228 1228 LEU LEU A . n 
A 1 252 ASP 252 1229 1229 ASP ASP A . n 
A 1 253 GLN 253 1230 1230 GLN GLN A . n 
A 1 254 PRO 254 1231 1231 PRO PRO A . n 
A 1 255 ASP 255 1232 1232 ASP ASP A . n 
A 1 256 ASN 256 1233 1233 ASN ASN A . n 
A 1 257 CYS 257 1234 1234 CYS CYS A . n 
A 1 258 PRO 258 1235 1235 PRO PRO A . n 
A 1 259 GLU 259 1236 1236 GLU GLU A . n 
A 1 260 ARG 260 1237 1237 ARG ARG A . n 
A 1 261 VAL 261 1238 1238 VAL VAL A . n 
A 1 262 THR 262 1239 1239 THR THR A . n 
A 1 263 ASP 263 1240 1240 ASP ASP A . n 
A 1 264 LEU 264 1241 1241 LEU LEU A . n 
A 1 265 MET 265 1242 1242 MET MET A . n 
A 1 266 ARG 266 1243 1243 ARG ARG A . n 
A 1 267 MET 267 1244 1244 MET MET A . n 
A 1 268 CYS 268 1245 1245 CYS CYS A . n 
A 1 269 TRP 269 1246 1246 TRP TRP A . n 
A 1 270 GLN 270 1247 1247 GLN GLN A . n 
A 1 271 PHE 271 1248 1248 PHE PHE A . n 
A 1 272 ASN 272 1249 1249 ASN ASN A . n 
A 1 273 PRO 273 1250 1250 PRO PRO A . n 
A 1 274 LYS 274 1251 1251 LYS LYS A . n 
A 1 275 MET 275 1252 1252 MET MET A . n 
A 1 276 ARG 276 1253 1253 ARG ARG A . n 
A 1 277 PRO 277 1254 1254 PRO PRO A . n 
A 1 278 THR 278 1255 1255 THR THR A . n 
A 1 279 PHE 279 1256 1256 PHE PHE A . n 
A 1 280 LEU 280 1257 1257 LEU LEU A . n 
A 1 281 GLU 281 1258 1258 GLU GLU A . n 
A 1 282 ILE 282 1259 1259 ILE ILE A . n 
A 1 283 VAL 283 1260 1260 VAL VAL A . n 
A 1 284 ASN 284 1261 1261 ASN ASN A . n 
A 1 285 LEU 285 1262 1262 LEU LEU A . n 
A 1 286 LEU 286 1263 1263 LEU LEU A . n 
A 1 287 LYS 287 1264 1264 LYS LYS A . n 
A 1 288 ASP 288 1265 1265 ASP ASP A . n 
A 1 289 ASP 289 1266 1266 ASP ASP A . n 
A 1 290 LEU 290 1267 1267 LEU LEU A . n 
A 1 291 HIS 291 1268 1268 HIS HIS A . n 
A 1 292 PRO 292 1269 1269 PRO PRO A . n 
A 1 293 SER 293 1270 1270 SER SER A . n 
A 1 294 PHE 294 1271 1271 PHE PHE A . n 
A 1 295 PRO 295 1272 1272 PRO PRO A . n 
A 1 296 GLU 296 1273 1273 GLU GLU A . n 
A 1 297 VAL 297 1274 1274 VAL VAL A . n 
A 1 298 SER 298 1275 1275 SER SER A . n 
A 1 299 PHE 299 1276 1276 PHE PHE A . n 
A 1 300 PHE 300 1277 1277 PHE PHE A . n 
A 1 301 HIS 301 1278 1278 HIS HIS A . n 
A 1 302 SER 302 1279 1279 SER SER A . n 
A 1 303 GLU 303 1280 1280 GLU GLU A . n 
A 1 304 GLU 304 1281 1281 GLU GLU A . n 
A 1 305 ASN 305 1282 1282 ASN ASN A . n 
A 1 306 LYS 306 1283 1283 LYS LYS A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 121  ? 1_555 85.6  ? 
2  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2B ? C ACP .   ? A ACP 300  ? 1_555 77.2  ? 
3  O   ? D HOH .   ? A HOH 121  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2B ? C ACP .   ? A ACP 300  ? 1_555 93.7  ? 
4  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 45.0  ? 
5  O   ? D HOH .   ? A HOH 121  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 105.8 ? 
6  O2B ? C ACP .   ? A ACP 300  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 115.2 ? 
7  OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 116  ? 1_555 95.6  ? 
8  O   ? D HOH .   ? A HOH 121  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 116  ? 1_555 106.8 ? 
9  O2B ? C ACP .   ? A ACP 300  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 116  ? 1_555 157.8 ? 
10 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 116  ? 1_555 51.6  ? 
11 OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 114  ? 1_555 88.1  ? 
12 O   ? D HOH .   ? A HOH 121  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 114  ? 1_555 168.1 ? 
13 O2B ? C ACP .   ? A ACP 300  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 114  ? 1_555 75.0  ? 
14 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 114  ? 1_555 76.3  ? 
15 O   ? D HOH .   ? A HOH 116  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O   ? D HOH .   ? A HOH 114  ? 1_555 83.8  ? 
16 OD2 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 165.8 ? 
17 O   ? D HOH .   ? A HOH 121  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 106.9 ? 
18 O2B ? C ACP .   ? A ACP 300  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 94.8  ? 
19 OD1 ? A ASP 173 ? A ASP 1150 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 133.4 ? 
20 O   ? D HOH .   ? A HOH 116  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 87.4  ? 
21 O   ? D HOH .   ? A HOH 114  ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1G ? C ACP .   ? A ACP 300  ? 1_555 78.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-03-07 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.5 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 1035 ? ? -68.82  6.81   
2 1 GLU A 1096 ? ? -67.15  0.33   
3 1 ARG A 1131 ? ? 77.04   -9.75  
4 1 ASP A 1132 ? ? -146.06 38.49  
5 1 PRO A 1172 ? ? -68.29  48.19  
6 1 LYS A 1182 ? ? -76.94  -70.03 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 988  ? CG  ? A GLU 11  CG  
2  1 Y 1 A GLU 988  ? CD  ? A GLU 11  CD  
3  1 Y 1 A GLU 988  ? OE1 ? A GLU 11  OE1 
4  1 Y 1 A GLU 988  ? OE2 ? A GLU 11  OE2 
5  1 Y 1 A GLU 1034 ? CG  ? A GLU 57  CG  
6  1 Y 1 A GLU 1034 ? CD  ? A GLU 57  CD  
7  1 Y 1 A GLU 1034 ? OE1 ? A GLU 57  OE1 
8  1 Y 1 A GLU 1034 ? OE2 ? A GLU 57  OE2 
9  1 Y 1 A LYS 1068 ? CG  ? A LYS 91  CG  
10 1 Y 1 A LYS 1068 ? CD  ? A LYS 91  CD  
11 1 Y 1 A LYS 1068 ? CE  ? A LYS 91  CE  
12 1 Y 1 A LYS 1068 ? NZ  ? A LYS 91  NZ  
13 1 Y 1 A GLU 1094 ? CG  ? A GLU 117 CG  
14 1 Y 1 A GLU 1094 ? CD  ? A GLU 117 CD  
15 1 Y 1 A GLU 1094 ? OE1 ? A GLU 117 OE1 
16 1 Y 1 A GLU 1094 ? OE2 ? A GLU 117 OE2 
17 1 Y 1 A GLU 1096 ? CG  ? A GLU 119 CG  
18 1 Y 1 A GLU 1096 ? CD  ? A GLU 119 CD  
19 1 Y 1 A GLU 1096 ? OE1 ? A GLU 119 OE1 
20 1 Y 1 A GLU 1096 ? OE2 ? A GLU 119 OE2 
21 1 Y 1 A LEU 1171 ? CB  ? A LEU 194 CB  
22 1 Y 1 A LEU 1171 ? CG  ? A LEU 194 CG  
23 1 Y 1 A LEU 1171 ? CD1 ? A LEU 194 CD1 
24 1 Y 1 A LEU 1171 ? CD2 ? A LEU 194 CD2 
25 1 Y 1 A ARG 1243 ? CG  ? A ARG 266 CG  
26 1 Y 1 A ARG 1243 ? CD  ? A ARG 266 CD  
27 1 Y 1 A ARG 1243 ? NE  ? A ARG 266 NE  
28 1 Y 1 A ARG 1243 ? CZ  ? A ARG 266 CZ  
29 1 Y 1 A ARG 1243 ? NH1 ? A ARG 266 NH1 
30 1 Y 1 A ARG 1243 ? NH2 ? A ARG 266 NH2 
31 1 Y 1 A LYS 1283 ? CB  ? A LYS 306 CB  
32 1 Y 1 A LYS 1283 ? CG  ? A LYS 306 CG  
33 1 Y 1 A LYS 1283 ? CD  ? A LYS 306 CD  
34 1 Y 1 A LYS 1283 ? CE  ? A LYS 306 CE  
35 1 Y 1 A LYS 1283 ? NZ  ? A LYS 306 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 978  ? A VAL 1   
2  1 Y 1 A PHE 979  ? A PHE 2   
3  1 Y 1 A PRO 980  ? A PRO 3   
4  1 Y 1 A SER 981  ? A SER 4   
5  1 Y 1 A SER 982  ? A SER 5   
6  1 Y 1 A VAL 983  ? A VAL 6   
7  1 Y 1 A PHE 984  ? A PHE 7   
8  1 Y 1 A VAL 985  ? A VAL 8   
9  1 Y 1 A ARG 1155 ? A ARG 178 
10 1 Y 1 A ASP 1156 ? A ASP 179 
11 1 Y 1 A ILE 1157 ? A ILE 180 
12 1 Y 1 A TYR 1158 ? A TYR 181 
13 1 Y 1 A GLU 1159 ? A GLU 182 
14 1 Y 1 A THR 1160 ? A THR 183 
15 1 Y 1 A ALA 1161 ? A ALA 184 
16 1 Y 1 A TYR 1162 ? A TYR 185 
17 1 Y 1 A TYR 1163 ? A TYR 186 
18 1 Y 1 A ARG 1164 ? A ARG 187 
19 1 Y 1 A LYS 1165 ? A LYS 188 
20 1 Y 1 A GLY 1166 ? A GLY 189 
21 1 Y 1 A GLY 1167 ? A GLY 190 
22 1 Y 1 A LYS 1168 ? A LYS 191 
23 1 Y 1 A GLY 1169 ? A GLY 192 
24 1 Y 1 A LEU 1170 ? A LEU 193 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                MG  
3 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' ACP 
4 water                                          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   301 301 MG  MG  A . 
C 3 ACP 1   300 300 ACP ACP A . 
D 4 HOH 1   1   1   HOH HOH A . 
D 4 HOH 2   2   2   HOH HOH A . 
D 4 HOH 3   3   3   HOH HOH A . 
D 4 HOH 4   4   4   HOH HOH A . 
D 4 HOH 5   5   5   HOH HOH A . 
D 4 HOH 6   6   6   HOH HOH A . 
D 4 HOH 7   7   7   HOH HOH A . 
D 4 HOH 8   8   8   HOH HOH A . 
D 4 HOH 9   9   9   HOH HOH A . 
D 4 HOH 10  10  10  HOH HOH A . 
D 4 HOH 11  11  11  HOH HOH A . 
D 4 HOH 12  12  12  HOH HOH A . 
D 4 HOH 13  13  13  HOH HOH A . 
D 4 HOH 14  14  14  HOH HOH A . 
D 4 HOH 15  15  15  HOH HOH A . 
D 4 HOH 16  16  16  HOH HOH A . 
D 4 HOH 17  17  17  HOH HOH A . 
D 4 HOH 18  18  18  HOH HOH A . 
D 4 HOH 19  19  19  HOH HOH A . 
D 4 HOH 20  20  20  HOH HOH A . 
D 4 HOH 21  21  21  HOH HOH A . 
D 4 HOH 22  22  22  HOH HOH A . 
D 4 HOH 23  23  23  HOH HOH A . 
D 4 HOH 24  24  24  HOH HOH A . 
D 4 HOH 25  25  25  HOH HOH A . 
D 4 HOH 26  26  26  HOH HOH A . 
D 4 HOH 27  27  27  HOH HOH A . 
D 4 HOH 28  28  28  HOH HOH A . 
D 4 HOH 29  29  29  HOH HOH A . 
D 4 HOH 30  30  30  HOH HOH A . 
D 4 HOH 31  31  31  HOH HOH A . 
D 4 HOH 32  32  32  HOH HOH A . 
D 4 HOH 33  33  33  HOH HOH A . 
D 4 HOH 34  34  34  HOH HOH A . 
D 4 HOH 35  35  35  HOH HOH A . 
D 4 HOH 36  36  36  HOH HOH A . 
D 4 HOH 37  37  37  HOH HOH A . 
D 4 HOH 38  38  38  HOH HOH A . 
D 4 HOH 39  39  39  HOH HOH A . 
D 4 HOH 40  40  40  HOH HOH A . 
D 4 HOH 41  41  41  HOH HOH A . 
D 4 HOH 42  42  42  HOH HOH A . 
D 4 HOH 43  43  43  HOH HOH A . 
D 4 HOH 44  44  44  HOH HOH A . 
D 4 HOH 45  45  45  HOH HOH A . 
D 4 HOH 46  46  46  HOH HOH A . 
D 4 HOH 47  47  47  HOH HOH A . 
D 4 HOH 48  48  48  HOH HOH A . 
D 4 HOH 49  49  49  HOH HOH A . 
D 4 HOH 50  50  50  HOH HOH A . 
D 4 HOH 51  51  51  HOH HOH A . 
D 4 HOH 52  52  52  HOH HOH A . 
D 4 HOH 53  53  53  HOH HOH A . 
D 4 HOH 54  54  54  HOH HOH A . 
D 4 HOH 55  55  55  HOH HOH A . 
D 4 HOH 56  56  56  HOH HOH A . 
D 4 HOH 57  57  57  HOH HOH A . 
D 4 HOH 58  58  58  HOH HOH A . 
D 4 HOH 59  59  59  HOH HOH A . 
D 4 HOH 60  60  60  HOH HOH A . 
D 4 HOH 61  61  61  HOH HOH A . 
D 4 HOH 62  62  62  HOH HOH A . 
D 4 HOH 63  63  63  HOH HOH A . 
D 4 HOH 64  64  64  HOH HOH A . 
D 4 HOH 65  65  65  HOH HOH A . 
D 4 HOH 66  66  66  HOH HOH A . 
D 4 HOH 67  67  67  HOH HOH A . 
D 4 HOH 68  68  68  HOH HOH A . 
D 4 HOH 69  69  69  HOH HOH A . 
D 4 HOH 70  70  70  HOH HOH A . 
D 4 HOH 71  71  71  HOH HOH A . 
D 4 HOH 72  72  72  HOH HOH A . 
D 4 HOH 73  73  73  HOH HOH A . 
D 4 HOH 74  74  74  HOH HOH A . 
D 4 HOH 75  75  75  HOH HOH A . 
D 4 HOH 76  76  76  HOH HOH A . 
D 4 HOH 77  77  77  HOH HOH A . 
D 4 HOH 78  78  78  HOH HOH A . 
D 4 HOH 79  79  79  HOH HOH A . 
D 4 HOH 80  80  80  HOH HOH A . 
D 4 HOH 81  81  81  HOH HOH A . 
D 4 HOH 82  82  82  HOH HOH A . 
D 4 HOH 83  83  83  HOH HOH A . 
D 4 HOH 84  84  84  HOH HOH A . 
D 4 HOH 85  85  85  HOH HOH A . 
D 4 HOH 86  86  86  HOH HOH A . 
D 4 HOH 87  87  87  HOH HOH A . 
D 4 HOH 88  88  88  HOH HOH A . 
D 4 HOH 89  89  89  HOH HOH A . 
D 4 HOH 90  90  90  HOH HOH A . 
D 4 HOH 91  91  91  HOH HOH A . 
D 4 HOH 92  92  92  HOH HOH A . 
D 4 HOH 93  93  93  HOH HOH A . 
D 4 HOH 94  94  94  HOH HOH A . 
D 4 HOH 95  95  95  HOH HOH A . 
D 4 HOH 96  96  96  HOH HOH A . 
D 4 HOH 97  97  97  HOH HOH A . 
D 4 HOH 98  98  98  HOH HOH A . 
D 4 HOH 99  99  99  HOH HOH A . 
D 4 HOH 100 100 100 HOH HOH A . 
D 4 HOH 101 101 101 HOH HOH A . 
D 4 HOH 102 102 102 HOH HOH A . 
D 4 HOH 103 103 103 HOH HOH A . 
D 4 HOH 104 104 104 HOH HOH A . 
D 4 HOH 105 105 105 HOH HOH A . 
D 4 HOH 106 106 106 HOH HOH A . 
D 4 HOH 107 107 107 HOH HOH A . 
D 4 HOH 108 108 108 HOH HOH A . 
D 4 HOH 109 109 109 HOH HOH A . 
D 4 HOH 110 110 110 HOH HOH A . 
D 4 HOH 111 111 111 HOH HOH A . 
D 4 HOH 112 112 112 HOH HOH A . 
D 4 HOH 113 113 113 HOH HOH A . 
D 4 HOH 114 114 114 HOH HOH A . 
D 4 HOH 115 115 115 HOH HOH A . 
D 4 HOH 116 116 116 HOH HOH A . 
D 4 HOH 117 117 117 HOH HOH A . 
D 4 HOH 118 118 118 HOH HOH A . 
D 4 HOH 119 119 119 HOH HOH A . 
D 4 HOH 120 120 120 HOH HOH A . 
D 4 HOH 121 121 121 HOH HOH A . 
D 4 HOH 122 122 122 HOH HOH A . 
D 4 HOH 123 123 123 HOH HOH A . 
D 4 HOH 124 124 124 HOH HOH A . 
D 4 HOH 125 125 125 HOH HOH A . 
D 4 HOH 126 126 126 HOH HOH A . 
D 4 HOH 127 127 127 HOH HOH A . 
D 4 HOH 128 128 128 HOH HOH A . 
D 4 HOH 129 129 129 HOH HOH A . 
D 4 HOH 130 130 130 HOH HOH A . 
D 4 HOH 131 131 131 HOH HOH A . 
D 4 HOH 132 132 132 HOH HOH A . 
D 4 HOH 133 133 133 HOH HOH A . 
D 4 HOH 134 134 134 HOH HOH A . 
D 4 HOH 135 135 135 HOH HOH A . 
D 4 HOH 136 136 136 HOH HOH A . 
D 4 HOH 137 137 137 HOH HOH A . 
D 4 HOH 138 138 138 HOH HOH A . 
D 4 HOH 139 139 139 HOH HOH A . 
D 4 HOH 140 140 140 HOH HOH A . 
D 4 HOH 141 141 141 HOH HOH A . 
#