data_1I4S
# 
_entry.id   1I4S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I4S         
RCSB  RCSB012903   
WWPDB D_1000012903 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1STU 'NMR SOLUTION STRUCTURE OF A DOUBLE-STRANDED RNA-BINDING DOMAIN FROM DROSOPHILA STAUFEN PROTEIN'                   
unspecified 
PDB 1DI2 'CRYSTAL STRUCTURE OF A DOUBLE-STRANDED RNA-BINDING DOMAIN FROM XENOPUS LAEVIS COMPLEXED WITH DOUBLE-STRANDED RNA' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I4S 
_pdbx_database_status.recvd_initial_deposition_date   2001-02-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blaszczyk, J.' 1 
'Ji, X.'        2 
# 
_citation.id                        primary 
_citation.title                     
'Crystallographic and modeling studies of RNase III suggest a mechanism for double-stranded RNA cleavage.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1225 
_citation.page_last                 1236 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11738048 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00685-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blaszczyk, J.'  1 
primary 'Tropea, J.E.'   2 
primary 'Bubunenko, M.'  3 
primary 'Routzahn, K.M.' 4 
primary 'Waugh, D.S.'    5 
primary 'Court, D.L.'    6 
primary 'Ji, X.'         7 
# 
_cell.entry_id           1I4S 
_cell.length_a           46.157 
_cell.length_b           51.188 
_cell.length_c           123.468 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I4S 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RIBONUCLEASE III' 17277.078 2   3.1.26.3 ? 'N-TERMINAL ENDONUCLEASE DOMAIN' ? 
2 water   nat water              18.015    252 ?        ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNASE III' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   MET n 
1 4   LEU n 
1 5   GLU n 
1 6   GLN n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  LYS n 
1 11  LEU n 
1 12  GLY n 
1 13  TYR n 
1 14  THR n 
1 15  PHE n 
1 16  LYS n 
1 17  ASP n 
1 18  LYS n 
1 19  SER n 
1 20  LEU n 
1 21  LEU n 
1 22  GLU n 
1 23  LYS n 
1 24  ALA n 
1 25  LEU n 
1 26  THR n 
1 27  HIS n 
1 28  VAL n 
1 29  SER n 
1 30  TYR n 
1 31  SER n 
1 32  LYS n 
1 33  LYS n 
1 34  GLU n 
1 35  HIS n 
1 36  TYR n 
1 37  GLU n 
1 38  THR n 
1 39  LEU n 
1 40  GLU n 
1 41  PHE n 
1 42  LEU n 
1 43  GLY n 
1 44  ASP n 
1 45  ALA n 
1 46  LEU n 
1 47  VAL n 
1 48  ASN n 
1 49  PHE n 
1 50  PHE n 
1 51  ILE n 
1 52  VAL n 
1 53  ASP n 
1 54  LEU n 
1 55  LEU n 
1 56  VAL n 
1 57  GLN n 
1 58  TYR n 
1 59  SER n 
1 60  PRO n 
1 61  ASN n 
1 62  LYS n 
1 63  ARG n 
1 64  GLU n 
1 65  GLY n 
1 66  PHE n 
1 67  LEU n 
1 68  SER n 
1 69  PRO n 
1 70  LEU n 
1 71  LYS n 
1 72  ALA n 
1 73  TYR n 
1 74  LEU n 
1 75  ILE n 
1 76  SER n 
1 77  GLU n 
1 78  GLU n 
1 79  PHE n 
1 80  PHE n 
1 81  ASN n 
1 82  LEU n 
1 83  LEU n 
1 84  ALA n 
1 85  GLN n 
1 86  LYS n 
1 87  LEU n 
1 88  GLU n 
1 89  LEU n 
1 90  HIS n 
1 91  LYS n 
1 92  PHE n 
1 93  ILE n 
1 94  ARG n 
1 95  ILE n 
1 96  LYS n 
1 97  ARG n 
1 98  GLY n 
1 99  LYS n 
1 100 ILE n 
1 101 ASN n 
1 102 GLU n 
1 103 THR n 
1 104 ILE n 
1 105 ILE n 
1 106 GLY n 
1 107 ASP n 
1 108 VAL n 
1 109 PHE n 
1 110 GLU n 
1 111 ALA n 
1 112 LEU n 
1 113 TRP n 
1 114 ALA n 
1 115 ALA n 
1 116 VAL n 
1 117 TYR n 
1 118 ILE n 
1 119 ASP n 
1 120 SER n 
1 121 GLY n 
1 122 ARG n 
1 123 ASP n 
1 124 ALA n 
1 125 ASN n 
1 126 PHE n 
1 127 THR n 
1 128 ARG n 
1 129 GLU n 
1 130 LEU n 
1 131 PHE n 
1 132 TYR n 
1 133 LYS n 
1 134 LEU n 
1 135 PHE n 
1 136 LYS n 
1 137 GLU n 
1 138 ASP n 
1 139 ILE n 
1 140 LEU n 
1 141 SER n 
1 142 ALA n 
1 143 ILE n 
1 144 LYS n 
1 145 GLU n 
1 146 GLY n 
1 147 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PKM803 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNC_AQUAE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O67082 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I4S A 1 ? 147 ? O67082 1 ? 147 ? 1   147 
2 1 1I4S B 1 ? 147 ? O67082 1 ? 147 ? 201 347 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I4S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.011 
_exptl_crystal.density_percent_sol   36.34 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG4000, TRIS-HCL, ACETATE, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-06-03 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON 111' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.98789 1.0 
2 1.01000 1.0 
3 1.03473 1.0 
4 1.04008 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.98789, 1.01000, 1.03473, 1.04008' 
# 
_reflns.entry_id                     1I4S 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   16542 
_reflns.number_all                   16542 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.0380000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.3760 
_reflns.B_iso_Wilson_estimate        48.0 
_reflns.pdbx_redundancy              4.161 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.3700000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.258 
_reflns_shell.pdbx_redundancy        4.025 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1621 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I4S 
_refine.ls_number_reflns_obs                     13894 
_refine.ls_number_reflns_all                     15686 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          4.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_obs                          0.2075000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2119000 
_refine.ls_R_factor_R_free                       0.2750000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     9323 
_refine.ls_number_restraints                     10091 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               54.404 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1975) 201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
'LEAST-SQUARES REFINEMENT USING THE KONNERT-HENDRICKSON CONJUGATE-GRADIENT ALGORITHM' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I4S 
_refine_analyze.Luzzati_coordinate_error_obs    0.263 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      2696.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2444 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               2696 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.018 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.041 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.051 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.019 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.083 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
. 2.15 2.25 . 0.2920000 . . . . . 1712 . . 'X-RAY DIFFRACTION' . 
. 2.25 2.35 . 0.2780000 . . . . . 1439 . . 'X-RAY DIFFRACTION' . 
. 2.35 2.48 . 0.2570000 . . . . . 1640 . . 'X-RAY DIFFRACTION' . 
. 2.48 2.66 . 0.2170000 . . . . . 1520 . . 'X-RAY DIFFRACTION' . 
. 2.66 2.86 . 0.2000000 . . . . . 1619 . . 'X-RAY DIFFRACTION' . 
. 2.86 3.11 . 0.1910000 . . . . . 1488 . . 'X-RAY DIFFRACTION' . 
. 3.11 3.50 . 0.1970000 . . . . . 1618 . . 'X-RAY DIFFRACTION' . 
. 3.50 4.13 . 0.1800000 . . . . . 1559 . . 'X-RAY DIFFRACTION' . 
. 4.13 6.58 . 0.1880000 . . . . . 1529 . . 'X-RAY DIFFRACTION' . 
. 6.58 30.0 . 0.2880000 . . . . . 563  . . 'X-RAY DIFFRACTION' . 
# 
_pdbx_refine.entry_id                                    1I4S 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2220000 
_pdbx_refine.free_R_factor_no_cutoff                     0.2750000 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     4.9917 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            783 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.2075000 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2625000 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.1677 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          718 
_pdbx_refine.number_reflns_obs_4sig_cutoff               13894 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1I4S 
_struct.title                     
'CRYSTAL STRUCTURE OF RNASE III ENDONUCLEASE DOMAIN FROM AQUIFEX AEOLICUS AT 2.15 ANGSTROM RESOLUTION' 
_struct.pdbx_descriptor           'RIBONUCLEASE III (E.C.3.1.26.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I4S 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'RIBONUCLEASE, RNASE III, DOUBLE-STRANDED RNA, CATALYTIC DOMAIN, ENDONUCLEASE DOMAIN, ENDONUCLEOLYTIC CLEAVAGE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 6   ? GLY A 12  ? GLN A 6   GLY A 12  1 ? 7  
HELX_P HELX_P2  2  ASP A 17  ? THR A 26  ? ASP A 17  THR A 26  1 ? 10 
HELX_P HELX_P3  3  TYR A 36  ? SER A 59  ? TYR A 36  SER A 59  1 ? 24 
HELX_P HELX_P4  4  ARG A 63  ? ILE A 75  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER A 76  ? GLU A 88  ? SER A 76  GLU A 88  1 ? 13 
HELX_P HELX_P6  6  LEU A 89  ? PHE A 92  ? LEU A 89  PHE A 92  5 ? 4  
HELX_P HELX_P7  7  ASN A 101 ? SER A 120 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP A 123 ? LYS A 136 ? ASP A 123 LYS A 136 1 ? 14 
HELX_P HELX_P9  9  PHE A 135 ? GLY A 146 ? PHE A 135 GLY A 146 1 ? 12 
HELX_P HELX_P10 10 GLN B 6   ? GLY B 12  ? GLN B 206 GLY B 212 1 ? 7  
HELX_P HELX_P11 11 ASP B 17  ? THR B 26  ? ASP B 217 THR B 226 1 ? 10 
HELX_P HELX_P12 12 HIS B 27  ? SER B 31  ? HIS B 227 SER B 231 5 ? 5  
HELX_P HELX_P13 13 TYR B 36  ? SER B 59  ? TYR B 236 SER B 259 1 ? 24 
HELX_P HELX_P14 14 ARG B 63  ? ILE B 75  ? ARG B 263 ILE B 275 1 ? 13 
HELX_P HELX_P15 15 SER B 76  ? GLN B 85  ? SER B 276 GLN B 285 1 ? 10 
HELX_P HELX_P16 16 LYS B 86  ? PHE B 92  ? LYS B 286 PHE B 292 5 ? 7  
HELX_P HELX_P17 17 ASN B 101 ? SER B 120 ? ASN B 301 SER B 320 1 ? 20 
HELX_P HELX_P18 18 ASP B 123 ? LYS B 136 ? ASP B 323 LYS B 336 1 ? 14 
HELX_P HELX_P19 19 PHE B 135 ? GLU B 145 ? PHE B 335 GLU B 345 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1I4S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1I4S 
_atom_sites.fract_transf_matrix[1][1]   0.021665 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019536 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008099 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 35.420  -29.014 -11.460 1.00 92.63  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 34.779  -29.818 -10.428 1.00 92.79  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 33.423  -30.319 -10.908 1.00 80.12  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 33.223  -30.605 -12.087 1.00 86.70  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 34.609  -29.012 -9.140  1.00 85.95  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 34.526  -29.830 -7.868  1.00 83.14  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 34.396  -28.808 -6.388  1.00 98.24  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 35.477  -29.692 -5.260  1.00 62.26  ? 1   MET A CE  1 
ATOM   9    N N   . LYS A 1 2   ? 32.487  -30.414 -9.972  1.00 100.21 ? 2   LYS A N   1 
ATOM   10   C CA  . LYS A 1 2   ? 31.111  -30.720 -10.346 1.00 99.26  ? 2   LYS A CA  1 
ATOM   11   C C   . LYS A 1 2   ? 30.548  -29.579 -11.198 1.00 103.32 ? 2   LYS A C   1 
ATOM   12   O O   . LYS A 1 2   ? 29.813  -29.806 -12.158 1.00 105.40 ? 2   LYS A O   1 
ATOM   13   C CB  . LYS A 1 2   ? 30.252  -30.927 -9.113  1.00 96.56  ? 2   LYS A CB  1 
ATOM   14   C CG  . LYS A 1 2   ? 28.990  -31.762 -9.372  1.00 94.89  ? 2   LYS A CG  1 
ATOM   15   C CD  . LYS A 1 2   ? 28.356  -32.207 -8.061  1.00 94.24  ? 2   LYS A CD  1 
ATOM   16   C CE  . LYS A 1 2   ? 28.969  -33.508 -7.566  1.00 95.57  ? 2   LYS A CE  1 
ATOM   17   N NZ  . LYS A 1 2   ? 30.351  -33.702 -8.117  1.00 93.96  ? 2   LYS A NZ  1 
ATOM   18   N N   . MET A 1 3   ? 30.928  -28.369 -10.814 1.00 103.07 ? 3   MET A N   1 
ATOM   19   C CA  . MET A 1 3   ? 30.495  -27.121 -11.414 1.00 104.38 ? 3   MET A CA  1 
ATOM   20   C C   . MET A 1 3   ? 30.901  -26.991 -12.880 1.00 106.88 ? 3   MET A C   1 
ATOM   21   O O   . MET A 1 3   ? 30.065  -27.114 -13.776 1.00 95.97  ? 3   MET A O   1 
ATOM   22   C CB  . MET A 1 3   ? 31.079  -25.946 -10.612 1.00 104.38 ? 3   MET A CB  1 
ATOM   23   C CG  . MET A 1 3   ? 32.259  -26.337 -9.730  1.00 104.07 ? 3   MET A CG  1 
ATOM   24   S SD  . MET A 1 3   ? 33.846  -26.143 -10.569 1.00 105.13 ? 3   MET A SD  1 
ATOM   25   C CE  . MET A 1 3   ? 34.781  -25.285 -9.310  1.00 108.04 ? 3   MET A CE  1 
ATOM   26   N N   . LEU A 1 4   ? 32.173  -26.721 -13.111 1.00 111.52 ? 4   LEU A N   1 
ATOM   27   C CA  . LEU A 1 4   ? 32.883  -26.548 -14.373 1.00 111.12 ? 4   LEU A CA  1 
ATOM   28   C C   . LEU A 1 4   ? 32.330  -25.402 -15.233 1.00 108.15 ? 4   LEU A C   1 
ATOM   29   O O   . LEU A 1 4   ? 33.049  -24.968 -16.149 1.00 110.25 ? 4   LEU A O   1 
ATOM   30   C CB  . LEU A 1 4   ? 32.693  -27.809 -15.235 1.00 111.79 ? 4   LEU A CB  1 
ATOM   31   C CG  . LEU A 1 4   ? 33.572  -27.849 -16.504 1.00 111.82 ? 4   LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 4   ? 35.014  -27.534 -16.141 1.00 115.34 ? 4   LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 4   ? 33.467  -29.193 -17.226 1.00 109.98 ? 4   LEU A CD2 1 
ATOM   34   N N   . GLU A 1 5   ? 31.202  -24.794 -14.887 1.00 99.08  ? 5   GLU A N   1 
ATOM   35   C CA  . GLU A 1 5   ? 30.654  -23.676 -15.646 1.00 94.42  ? 5   GLU A CA  1 
ATOM   36   C C   . GLU A 1 5   ? 30.191  -24.155 -17.022 1.00 89.77  ? 5   GLU A C   1 
ATOM   37   O O   . GLU A 1 5   ? 30.287  -23.431 -18.008 1.00 93.21  ? 5   GLU A O   1 
ATOM   38   C CB  . GLU A 1 5   ? 31.663  -22.544 -15.817 1.00 98.20  ? 5   GLU A CB  1 
ATOM   39   C CG  . GLU A 1 5   ? 32.628  -22.322 -14.670 1.00 99.42  ? 5   GLU A CG  1 
ATOM   40   C CD  . GLU A 1 5   ? 32.007  -21.639 -13.469 1.00 97.82  ? 5   GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 5   ? 30.758  -21.627 -13.366 1.00 87.22  ? 5   GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 5   ? 32.770  -21.106 -12.632 1.00 91.76  ? 5   GLU A OE2 1 
ATOM   43   N N   . GLN A 1 6   ? 29.683  -25.381 -17.064 1.00 86.37  ? 6   GLN A N   1 
ATOM   44   C CA  . GLN A 1 6   ? 29.085  -25.937 -18.274 1.00 78.05  ? 6   GLN A CA  1 
ATOM   45   C C   . GLN A 1 6   ? 27.605  -25.548 -18.324 1.00 70.18  ? 6   GLN A C   1 
ATOM   46   O O   . GLN A 1 6   ? 26.831  -26.032 -19.142 1.00 68.36  ? 6   GLN A O   1 
ATOM   47   C CB  . GLN A 1 6   ? 29.245  -27.451 -18.334 1.00 81.28  ? 6   GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 28.556  -28.193 -17.195 1.00 87.36  ? 6   GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 28.912  -29.668 -17.180 1.00 95.36  ? 6   GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 28.132  -30.505 -17.664 1.00 98.30  ? 6   GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 30.072  -29.991 -16.617 1.00 95.79  ? 6   GLN A NE2 1 
ATOM   52   N N   . LEU A 1 7   ? 27.260  -24.646 -17.417 1.00 62.77  ? 7   LEU A N   1 
ATOM   53   C CA  . LEU A 1 7   ? 25.967  -23.996 -17.336 1.00 59.74  ? 7   LEU A CA  1 
ATOM   54   C C   . LEU A 1 7   ? 25.777  -23.040 -18.509 1.00 54.44  ? 7   LEU A C   1 
ATOM   55   O O   . LEU A 1 7   ? 24.688  -22.767 -19.001 1.00 56.75  ? 7   LEU A O   1 
ATOM   56   C CB  . LEU A 1 7   ? 25.854  -23.212 -16.023 1.00 54.84  ? 7   LEU A CB  1 
ATOM   57   C CG  . LEU A 1 7   ? 24.681  -22.227 -15.941 1.00 47.23  ? 7   LEU A CG  1 
ATOM   58   C CD1 . LEU A 1 7   ? 23.375  -23.006 -15.879 1.00 30.08  ? 7   LEU A CD1 1 
ATOM   59   C CD2 . LEU A 1 7   ? 24.847  -21.289 -14.760 1.00 46.74  ? 7   LEU A CD2 1 
ATOM   60   N N   . GLU A 1 8   ? 26.918  -22.516 -18.946 1.00 55.11  ? 8   GLU A N   1 
ATOM   61   C CA  . GLU A 1 8   ? 26.921  -21.554 -20.041 1.00 58.90  ? 8   GLU A CA  1 
ATOM   62   C C   . GLU A 1 8   ? 26.500  -22.220 -21.341 1.00 57.74  ? 8   GLU A C   1 
ATOM   63   O O   . GLU A 1 8   ? 26.039  -21.586 -22.287 1.00 67.09  ? 8   GLU A O   1 
ATOM   64   C CB  . GLU A 1 8   ? 28.318  -20.950 -20.156 1.00 61.95  ? 8   GLU A CB  1 
ATOM   65   C CG  . GLU A 1 8   ? 28.836  -20.353 -18.853 1.00 61.89  ? 8   GLU A CG  1 
ATOM   66   C CD  . GLU A 1 8   ? 30.328  -20.078 -18.966 1.00 61.50  ? 8   GLU A CD  1 
ATOM   67   O OE1 . GLU A 1 8   ? 31.077  -21.073 -18.913 1.00 58.51  ? 8   GLU A OE1 1 
ATOM   68   O OE2 . GLU A 1 8   ? 30.720  -18.905 -19.120 1.00 48.08  ? 8   GLU A OE2 1 
ATOM   69   N N   . LYS A 1 9   ? 26.672  -23.544 -21.393 1.00 54.57  ? 9   LYS A N   1 
ATOM   70   C CA  . LYS A 1 9   ? 26.257  -24.241 -22.613 1.00 56.78  ? 9   LYS A CA  1 
ATOM   71   C C   . LYS A 1 9   ? 24.763  -24.518 -22.520 1.00 48.68  ? 9   LYS A C   1 
ATOM   72   O O   . LYS A 1 9   ? 24.044  -24.499 -23.511 1.00 45.99  ? 9   LYS A O   1 
ATOM   73   C CB  . LYS A 1 9   ? 27.060  -25.517 -22.822 1.00 61.35  ? 9   LYS A CB  1 
ATOM   74   C CG  . LYS A 1 9   ? 26.304  -26.647 -23.501 1.00 59.49  ? 9   LYS A CG  1 
ATOM   75   C CD  . LYS A 1 9   ? 26.807  -26.875 -24.923 1.00 55.42  ? 9   LYS A CD  1 
ATOM   76   C CE  . LYS A 1 9   ? 26.460  -25.688 -25.806 1.00 51.91  ? 9   LYS A CE  1 
ATOM   77   N NZ  . LYS A 1 9   ? 25.137  -25.878 -26.474 1.00 62.37  ? 9   LYS A NZ  1 
ATOM   78   N N   . LYS A 1 10  ? 24.305  -24.769 -21.294 1.00 53.45  ? 10  LYS A N   1 
ATOM   79   C CA  . LYS A 1 10  ? 22.867  -24.925 -21.077 1.00 56.00  ? 10  LYS A CA  1 
ATOM   80   C C   . LYS A 1 10  ? 22.195  -23.567 -21.253 1.00 54.19  ? 10  LYS A C   1 
ATOM   81   O O   . LYS A 1 10  ? 21.067  -23.449 -21.718 1.00 58.25  ? 10  LYS A O   1 
ATOM   82   C CB  . LYS A 1 10  ? 22.594  -25.511 -19.698 1.00 58.90  ? 10  LYS A CB  1 
ATOM   83   C CG  . LYS A 1 10  ? 23.174  -26.900 -19.489 1.00 55.73  ? 10  LYS A CG  1 
ATOM   84   C CD  . LYS A 1 10  ? 22.633  -27.573 -18.237 1.00 57.30  ? 10  LYS A CD  1 
ATOM   85   C CE  . LYS A 1 10  ? 22.780  -29.087 -18.329 1.00 59.94  ? 10  LYS A CE  1 
ATOM   86   N NZ  . LYS A 1 10  ? 21.460  -29.784 -18.428 1.00 43.23  ? 10  LYS A NZ  1 
ATOM   87   N N   . LEU A 1 11  ? 22.945  -22.540 -20.878 1.00 50.05  ? 11  LEU A N   1 
ATOM   88   C CA  . LEU A 1 11  ? 22.498  -21.163 -20.890 1.00 52.08  ? 11  LEU A CA  1 
ATOM   89   C C   . LEU A 1 11  ? 22.544  -20.509 -22.265 1.00 53.35  ? 11  LEU A C   1 
ATOM   90   O O   . LEU A 1 11  ? 21.807  -19.551 -22.518 1.00 59.06  ? 11  LEU A O   1 
ATOM   91   C CB  . LEU A 1 11  ? 23.373  -20.362 -19.906 1.00 43.02  ? 11  LEU A CB  1 
ATOM   92   C CG  . LEU A 1 11  ? 22.921  -18.919 -19.676 1.00 33.03  ? 11  LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 11  ? 21.536  -18.907 -19.049 1.00 41.47  ? 11  LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 11  ? 23.912  -18.166 -18.808 1.00 41.26  ? 11  LEU A CD2 1 
ATOM   95   N N   . GLY A 1 12  ? 23.399  -20.993 -23.155 1.00 48.68  ? 12  GLY A N   1 
ATOM   96   C CA  . GLY A 1 12  ? 23.588  -20.430 -24.477 1.00 40.64  ? 12  GLY A CA  1 
ATOM   97   C C   . GLY A 1 12  ? 24.448  -19.178 -24.477 1.00 47.37  ? 12  GLY A C   1 
ATOM   98   O O   . GLY A 1 12  ? 24.462  -18.442 -25.470 1.00 57.31  ? 12  GLY A O   1 
ATOM   99   N N   . TYR A 1 13  ? 25.164  -18.923 -23.389 1.00 46.81  ? 13  TYR A N   1 
ATOM   100  C CA  . TYR A 1 13  ? 25.969  -17.721 -23.205 1.00 44.68  ? 13  TYR A CA  1 
ATOM   101  C C   . TYR A 1 13  ? 27.238  -18.000 -22.397 1.00 42.19  ? 13  TYR A C   1 
ATOM   102  O O   . TYR A 1 13  ? 27.171  -18.731 -21.412 1.00 41.25  ? 13  TYR A O   1 
ATOM   103  C CB  . TYR A 1 13  ? 25.157  -16.643 -22.495 1.00 44.67  ? 13  TYR A CB  1 
ATOM   104  C CG  . TYR A 1 13  ? 25.880  -15.378 -22.115 1.00 41.29  ? 13  TYR A CG  1 
ATOM   105  C CD1 . TYR A 1 13  ? 26.004  -14.340 -23.024 1.00 30.39  ? 13  TYR A CD1 1 
ATOM   106  C CD2 . TYR A 1 13  ? 26.427  -15.211 -20.846 1.00 43.47  ? 13  TYR A CD2 1 
ATOM   107  C CE1 . TYR A 1 13  ? 26.657  -13.172 -22.695 1.00 37.09  ? 13  TYR A CE1 1 
ATOM   108  C CE2 . TYR A 1 13  ? 27.086  -14.043 -20.509 1.00 37.94  ? 13  TYR A CE2 1 
ATOM   109  C CZ  . TYR A 1 13  ? 27.201  -13.032 -21.434 1.00 35.45  ? 13  TYR A CZ  1 
ATOM   110  O OH  . TYR A 1 13  ? 27.852  -11.863 -21.102 1.00 52.63  ? 13  TYR A OH  1 
ATOM   111  N N   . THR A 1 14  ? 28.337  -17.406 -22.832 1.00 41.36  ? 14  THR A N   1 
ATOM   112  C CA  . THR A 1 14  ? 29.651  -17.540 -22.228 1.00 45.53  ? 14  THR A CA  1 
ATOM   113  C C   . THR A 1 14  ? 30.076  -16.252 -21.531 1.00 43.66  ? 14  THR A C   1 
ATOM   114  O O   . THR A 1 14  ? 30.181  -15.199 -22.165 1.00 44.92  ? 14  THR A O   1 
ATOM   115  C CB  . THR A 1 14  ? 30.705  -17.921 -23.289 1.00 47.08  ? 14  THR A CB  1 
ATOM   116  O OG1 . THR A 1 14  ? 30.535  -19.290 -23.678 1.00 41.04  ? 14  THR A OG1 1 
ATOM   117  C CG2 . THR A 1 14  ? 32.107  -17.798 -22.710 1.00 40.27  ? 14  THR A CG2 1 
ATOM   118  N N   . PHE A 1 15  ? 30.313  -16.318 -20.226 1.00 41.37  ? 15  PHE A N   1 
ATOM   119  C CA  . PHE A 1 15  ? 30.641  -15.146 -19.423 1.00 40.73  ? 15  PHE A CA  1 
ATOM   120  C C   . PHE A 1 15  ? 32.021  -14.570 -19.714 1.00 50.74  ? 15  PHE A C   1 
ATOM   121  O O   . PHE A 1 15  ? 33.008  -15.287 -19.886 1.00 52.50  ? 15  PHE A O   1 
ATOM   122  C CB  . PHE A 1 15  ? 30.563  -15.504 -17.929 1.00 41.37  ? 15  PHE A CB  1 
ATOM   123  C CG  . PHE A 1 15  ? 29.180  -15.282 -17.330 1.00 45.33  ? 15  PHE A CG  1 
ATOM   124  C CD1 . PHE A 1 15  ? 28.100  -16.033 -17.758 1.00 43.21  ? 15  PHE A CD1 1 
ATOM   125  C CD2 . PHE A 1 15  ? 28.985  -14.318 -16.352 1.00 44.60  ? 15  PHE A CD2 1 
ATOM   126  C CE1 . PHE A 1 15  ? 26.845  -15.816 -17.218 1.00 47.18  ? 15  PHE A CE1 1 
ATOM   127  C CE2 . PHE A 1 15  ? 27.733  -14.101 -15.806 1.00 39.00  ? 15  PHE A CE2 1 
ATOM   128  C CZ  . PHE A 1 15  ? 26.661  -14.849 -16.245 1.00 39.21  ? 15  PHE A CZ  1 
ATOM   129  N N   . LYS A 1 16  ? 32.100  -13.241 -19.757 1.00 52.90  ? 16  LYS A N   1 
ATOM   130  C CA  . LYS A 1 16  ? 33.358  -12.533 -19.819 1.00 50.25  ? 16  LYS A CA  1 
ATOM   131  C C   . LYS A 1 16  ? 34.151  -12.641 -18.541 1.00 57.89  ? 16  LYS A C   1 
ATOM   132  O O   . LYS A 1 16  ? 35.124  -13.383 -18.401 1.00 61.24  ? 16  LYS A O   1 
ATOM   133  C CB  . LYS A 1 16  ? 33.177  -11.089 -20.221 1.00 50.78  ? 16  LYS A CB  1 
ATOM   134  C CG  . LYS A 1 16  ? 33.284  -10.752 -21.693 1.00 50.37  ? 16  LYS A CG  1 
ATOM   135  C CD  . LYS A 1 16  ? 32.064  -11.180 -22.482 1.00 46.51  ? 16  LYS A CD  1 
ATOM   136  C CE  . LYS A 1 16  ? 32.417  -11.532 -23.918 1.00 48.67  ? 16  LYS A CE  1 
ATOM   137  N NZ  . LYS A 1 16  ? 32.917  -10.352 -24.678 1.00 57.21  ? 16  LYS A NZ  1 
ATOM   138  N N   . ASP A 1 17  ? 33.613  -11.991 -17.507 1.00 54.30  ? 17  ASP A N   1 
ATOM   139  C CA  . ASP A 1 17  ? 34.137  -12.136 -16.154 1.00 49.94  ? 17  ASP A CA  1 
ATOM   140  C C   . ASP A 1 17  ? 33.455  -13.303 -15.443 1.00 54.64  ? 17  ASP A C   1 
ATOM   141  O O   . ASP A 1 17  ? 32.278  -13.219 -15.095 1.00 55.55  ? 17  ASP A O   1 
ATOM   142  C CB  . ASP A 1 17  ? 33.941  -10.858 -15.347 1.00 56.08  ? 17  ASP A CB  1 
ATOM   143  C CG  . ASP A 1 17  ? 34.130  -11.023 -13.856 1.00 55.94  ? 17  ASP A CG  1 
ATOM   144  O OD1 . ASP A 1 17  ? 34.802  -11.973 -13.400 1.00 60.69  ? 17  ASP A OD1 1 
ATOM   145  O OD2 . ASP A 1 17  ? 33.605  -10.174 -13.101 1.00 50.09  ? 17  ASP A OD2 1 
ATOM   146  N N   . LYS A 1 18  ? 34.220  -14.363 -15.215 1.00 61.49  ? 18  LYS A N   1 
ATOM   147  C CA  . LYS A 1 18  ? 33.690  -15.571 -14.597 1.00 63.39  ? 18  LYS A CA  1 
ATOM   148  C C   . LYS A 1 18  ? 33.428  -15.406 -13.105 1.00 61.58  ? 18  LYS A C   1 
ATOM   149  O O   . LYS A 1 18  ? 32.870  -16.329 -12.497 1.00 66.12  ? 18  LYS A O   1 
ATOM   150  C CB  . LYS A 1 18  ? 34.645  -16.747 -14.822 1.00 65.07  ? 18  LYS A CB  1 
ATOM   151  C CG  . LYS A 1 18  ? 33.964  -17.985 -15.390 1.00 64.01  ? 18  LYS A CG  1 
ATOM   152  C CD  . LYS A 1 18  ? 33.849  -17.896 -16.903 1.00 57.74  ? 18  LYS A CD  1 
ATOM   153  C CE  . LYS A 1 18  ? 34.461  -19.115 -17.573 1.00 54.62  ? 18  LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 18  ? 34.188  -19.141 -19.039 1.00 52.40  ? 18  LYS A NZ  1 
ATOM   155  N N   . SER A 1 19  ? 33.798  -14.276 -12.512 1.00 60.63  ? 19  SER A N   1 
ATOM   156  C CA  . SER A 1 19  ? 33.524  -14.083 -11.081 1.00 57.28  ? 19  SER A CA  1 
ATOM   157  C C   . SER A 1 19  ? 32.042  -13.771 -10.870 1.00 54.16  ? 19  SER A C   1 
ATOM   158  O O   . SER A 1 19  ? 31.466  -14.227 -9.880  1.00 57.62  ? 19  SER A O   1 
ATOM   159  C CB  . SER A 1 19  ? 34.424  -13.012 -10.473 1.00 59.39  ? 19  SER A CB  1 
ATOM   160  O OG  . SER A 1 19  ? 33.914  -11.702 -10.620 1.00 78.24  ? 19  SER A OG  1 
ATOM   161  N N   . LEU A 1 20  ? 31.444  -13.033 -11.794 1.00 53.69  ? 20  LEU A N   1 
ATOM   162  C CA  . LEU A 1 20  ? 30.021  -12.752 -11.863 1.00 54.87  ? 20  LEU A CA  1 
ATOM   163  C C   . LEU A 1 20  ? 29.153  -13.993 -11.682 1.00 45.41  ? 20  LEU A C   1 
ATOM   164  O O   . LEU A 1 20  ? 28.436  -14.155 -10.694 1.00 45.54  ? 20  LEU A O   1 
ATOM   165  C CB  . LEU A 1 20  ? 29.684  -12.123 -13.223 1.00 61.50  ? 20  LEU A CB  1 
ATOM   166  C CG  . LEU A 1 20  ? 29.836  -10.600 -13.290 1.00 62.04  ? 20  LEU A CG  1 
ATOM   167  C CD1 . LEU A 1 20  ? 29.081  -10.042 -14.484 1.00 60.54  ? 20  LEU A CD1 1 
ATOM   168  C CD2 . LEU A 1 20  ? 29.367  -9.981  -11.983 1.00 44.31  ? 20  LEU A CD2 1 
ATOM   169  N N   . LEU A 1 21  ? 29.222  -14.872 -12.670 1.00 41.97  ? 21  LEU A N   1 
ATOM   170  C CA  . LEU A 1 21  ? 28.559  -16.167 -12.667 1.00 42.68  ? 21  LEU A CA  1 
ATOM   171  C C   . LEU A 1 21  ? 28.700  -16.875 -11.326 1.00 45.21  ? 21  LEU A C   1 
ATOM   172  O O   . LEU A 1 21  ? 27.751  -17.450 -10.797 1.00 41.99  ? 21  LEU A O   1 
ATOM   173  C CB  . LEU A 1 21  ? 29.157  -17.024 -13.782 1.00 39.61  ? 21  LEU A CB  1 
ATOM   174  C CG  . LEU A 1 21  ? 28.213  -17.946 -14.546 1.00 42.17  ? 21  LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 21  ? 28.796  -19.349 -14.619 1.00 59.96  ? 21  LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 21  ? 26.833  -17.949 -13.908 1.00 43.77  ? 21  LEU A CD2 1 
ATOM   177  N N   . GLU A 1 22  ? 29.901  -16.841 -10.753 1.00 47.11  ? 22  GLU A N   1 
ATOM   178  C CA  . GLU A 1 22  ? 30.124  -17.503 -9.471  1.00 48.96  ? 22  GLU A CA  1 
ATOM   179  C C   . GLU A 1 22  ? 29.411  -16.775 -8.346  1.00 47.85  ? 22  GLU A C   1 
ATOM   180  O O   . GLU A 1 22  ? 28.879  -17.359 -7.409  1.00 45.63  ? 22  GLU A O   1 
ATOM   181  C CB  . GLU A 1 22  ? 31.626  -17.588 -9.178  1.00 48.91  ? 22  GLU A CB  1 
ATOM   182  C CG  . GLU A 1 22  ? 32.296  -18.770 -9.868  1.00 56.18  ? 22  GLU A CG  1 
ATOM   183  C CD  . GLU A 1 22  ? 33.676  -19.092 -9.343  1.00 57.91  ? 22  GLU A CD  1 
ATOM   184  O OE1 . GLU A 1 22  ? 34.483  -18.160 -9.127  1.00 42.41  ? 22  GLU A OE1 1 
ATOM   185  O OE2 . GLU A 1 22  ? 33.952  -20.298 -9.153  1.00 68.26  ? 22  GLU A OE2 1 
ATOM   186  N N   . LYS A 1 23  ? 29.399  -15.443 -8.420  1.00 48.99  ? 23  LYS A N   1 
ATOM   187  C CA  . LYS A 1 23  ? 28.734  -14.700 -7.353  1.00 35.13  ? 23  LYS A CA  1 
ATOM   188  C C   . LYS A 1 23  ? 27.230  -14.945 -7.374  1.00 31.05  ? 23  LYS A C   1 
ATOM   189  O O   . LYS A 1 23  ? 26.605  -14.928 -6.317  1.00 33.37  ? 23  LYS A O   1 
ATOM   190  C CB  . LYS A 1 23  ? 29.033  -13.211 -7.465  1.00 33.64  ? 23  LYS A CB  1 
ATOM   191  C CG  . LYS A 1 23  ? 28.422  -12.385 -6.342  1.00 32.83  ? 23  LYS A CG  1 
ATOM   192  C CD  . LYS A 1 23  ? 29.031  -10.989 -6.328  1.00 42.15  ? 23  LYS A CD  1 
ATOM   193  C CE  . LYS A 1 23  ? 28.606  -10.229 -5.084  1.00 50.84  ? 23  LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 23  ? 28.710  -8.756  -5.269  1.00 73.62  ? 23  LYS A NZ  1 
ATOM   195  N N   . ALA A 1 24  ? 26.671  -15.176 -8.556  1.00 35.95  ? 24  ALA A N   1 
ATOM   196  C CA  . ALA A 1 24  ? 25.243  -15.445 -8.685  1.00 41.46  ? 24  ALA A CA  1 
ATOM   197  C C   . ALA A 1 24  ? 24.868  -16.818 -8.127  1.00 38.13  ? 24  ALA A C   1 
ATOM   198  O O   . ALA A 1 24  ? 23.764  -17.028 -7.627  1.00 42.18  ? 24  ALA A O   1 
ATOM   199  C CB  . ALA A 1 24  ? 24.805  -15.363 -10.138 1.00 38.25  ? 24  ALA A CB  1 
ATOM   200  N N   . LEU A 1 25  ? 25.799  -17.753 -8.230  1.00 30.64  ? 25  LEU A N   1 
ATOM   201  C CA  . LEU A 1 25  ? 25.584  -19.140 -7.861  1.00 29.17  ? 25  LEU A CA  1 
ATOM   202  C C   . LEU A 1 25  ? 25.961  -19.400 -6.410  1.00 41.03  ? 25  LEU A C   1 
ATOM   203  O O   . LEU A 1 25  ? 25.746  -20.496 -5.890  1.00 54.82  ? 25  LEU A O   1 
ATOM   204  C CB  . LEU A 1 25  ? 26.426  -20.066 -8.735  1.00 30.56  ? 25  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 25  ? 26.083  -20.138 -10.222 1.00 38.78  ? 25  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 25  ? 27.193  -20.894 -10.944 1.00 38.72  ? 25  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 25  ? 24.723  -20.782 -10.450 1.00 28.33  ? 25  LEU A CD2 1 
ATOM   208  N N   . THR A 1 26  ? 26.531  -18.379 -5.768  1.00 37.67  ? 26  THR A N   1 
ATOM   209  C CA  . THR A 1 26  ? 27.059  -18.638 -4.432  1.00 32.58  ? 26  THR A CA  1 
ATOM   210  C C   . THR A 1 26  ? 26.156  -18.134 -3.323  1.00 31.54  ? 26  THR A C   1 
ATOM   211  O O   . THR A 1 26  ? 25.806  -16.966 -3.231  1.00 37.70  ? 26  THR A O   1 
ATOM   212  C CB  . THR A 1 26  ? 28.461  -18.014 -4.297  1.00 32.83  ? 26  THR A CB  1 
ATOM   213  O OG1 . THR A 1 26  ? 29.240  -18.443 -5.417  1.00 34.69  ? 26  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 26  ? 29.163  -18.514 -3.045  1.00 37.31  ? 26  THR A CG2 1 
ATOM   215  N N   . HIS A 1 27  ? 25.776  -19.073 -2.450  1.00 42.68  ? 27  HIS A N   1 
ATOM   216  C CA  . HIS A 1 27  ? 24.943  -18.698 -1.314  1.00 42.77  ? 27  HIS A CA  1 
ATOM   217  C C   . HIS A 1 27  ? 25.813  -18.069 -0.227  1.00 38.01  ? 27  HIS A C   1 
ATOM   218  O O   . HIS A 1 27  ? 27.013  -18.328 -0.187  1.00 33.98  ? 27  HIS A O   1 
ATOM   219  C CB  . HIS A 1 27  ? 24.171  -19.900 -0.768  1.00 39.27  ? 27  HIS A CB  1 
ATOM   220  C CG  . HIS A 1 27  ? 23.049  -19.492 0.138   1.00 38.02  ? 27  HIS A CG  1 
ATOM   221  N ND1 . HIS A 1 27  ? 23.036  -19.750 1.489   1.00 43.36  ? 27  HIS A ND1 1 
ATOM   222  C CD2 . HIS A 1 27  ? 21.898  -18.835 -0.123  1.00 31.48  ? 27  HIS A CD2 1 
ATOM   223  C CE1 . HIS A 1 27  ? 21.921  -19.273 2.020   1.00 43.81  ? 27  HIS A CE1 1 
ATOM   224  N NE2 . HIS A 1 27  ? 21.215  -18.707 1.056   1.00 37.54  ? 27  HIS A NE2 1 
ATOM   225  N N   . VAL A 1 28  ? 25.193  -17.258 0.617   1.00 42.67  ? 28  VAL A N   1 
ATOM   226  C CA  . VAL A 1 28  ? 25.873  -16.581 1.707   1.00 46.78  ? 28  VAL A CA  1 
ATOM   227  C C   . VAL A 1 28  ? 26.445  -17.567 2.724   1.00 49.75  ? 28  VAL A C   1 
ATOM   228  O O   . VAL A 1 28  ? 27.396  -17.216 3.429   1.00 51.68  ? 28  VAL A O   1 
ATOM   229  C CB  . VAL A 1 28  ? 24.940  -15.602 2.448   1.00 46.74  ? 28  VAL A CB  1 
ATOM   230  C CG1 . VAL A 1 28  ? 23.640  -16.272 2.859   1.00 34.98  ? 28  VAL A CG1 1 
ATOM   231  C CG2 . VAL A 1 28  ? 25.660  -15.034 3.662   1.00 43.47  ? 28  VAL A CG2 1 
ATOM   232  N N   . SER A 1 29  ? 25.885  -18.768 2.804   1.00 48.78  ? 29  SER A N   1 
ATOM   233  C CA  . SER A 1 29  ? 26.346  -19.774 3.762   1.00 44.04  ? 29  SER A CA  1 
ATOM   234  C C   . SER A 1 29  ? 27.663  -20.380 3.291   1.00 46.87  ? 29  SER A C   1 
ATOM   235  O O   . SER A 1 29  ? 28.481  -20.852 4.081   1.00 67.16  ? 29  SER A O   1 
ATOM   236  C CB  . SER A 1 29  ? 25.289  -20.853 3.984   1.00 47.76  ? 29  SER A CB  1 
ATOM   237  O OG  . SER A 1 29  ? 24.983  -21.574 2.811   1.00 48.57  ? 29  SER A OG  1 
ATOM   238  N N   . TYR A 1 30  ? 27.865  -20.352 1.979   1.00 40.87  ? 30  TYR A N   1 
ATOM   239  C CA  . TYR A 1 30  ? 29.160  -20.712 1.414   1.00 44.77  ? 30  TYR A CA  1 
ATOM   240  C C   . TYR A 1 30  ? 30.131  -19.549 1.626   1.00 52.64  ? 30  TYR A C   1 
ATOM   241  O O   . TYR A 1 30  ? 31.222  -19.729 2.160   1.00 50.43  ? 30  TYR A O   1 
ATOM   242  C CB  . TYR A 1 30  ? 29.018  -21.044 -0.068  1.00 43.65  ? 30  TYR A CB  1 
ATOM   243  C CG  . TYR A 1 30  ? 30.254  -21.612 -0.722  1.00 37.37  ? 30  TYR A CG  1 
ATOM   244  C CD1 . TYR A 1 30  ? 31.267  -20.794 -1.200  1.00 38.80  ? 30  TYR A CD1 1 
ATOM   245  C CD2 . TYR A 1 30  ? 30.412  -22.987 -0.869  1.00 38.74  ? 30  TYR A CD2 1 
ATOM   246  C CE1 . TYR A 1 30  ? 32.395  -21.314 -1.796  1.00 40.20  ? 30  TYR A CE1 1 
ATOM   247  C CE2 . TYR A 1 30  ? 31.538  -23.521 -1.463  1.00 45.05  ? 30  TYR A CE2 1 
ATOM   248  C CZ  . TYR A 1 30  ? 32.529  -22.680 -1.925  1.00 48.89  ? 30  TYR A CZ  1 
ATOM   249  O OH  . TYR A 1 30  ? 33.657  -23.199 -2.523  1.00 70.07  ? 30  TYR A OH  1 
ATOM   250  N N   . SER A 1 31  ? 29.714  -18.358 1.190   1.00 52.66  ? 31  SER A N   1 
ATOM   251  C CA  . SER A 1 31  ? 30.526  -17.160 1.280   1.00 40.46  ? 31  SER A CA  1 
ATOM   252  C C   . SER A 1 31  ? 29.756  -15.929 1.740   1.00 43.66  ? 31  SER A C   1 
ATOM   253  O O   . SER A 1 31  ? 28.834  -15.445 1.086   1.00 44.49  ? 31  SER A O   1 
ATOM   254  C CB  . SER A 1 31  ? 31.167  -16.818 -0.078  1.00 32.61  ? 31  SER A CB  1 
ATOM   255  O OG  . SER A 1 31  ? 32.031  -15.713 0.137   1.00 38.37  ? 31  SER A OG  1 
ATOM   256  N N   . LYS A 1 32  ? 30.160  -15.410 2.897   1.00 38.36  ? 32  LYS A N   1 
ATOM   257  C CA  . LYS A 1 32  ? 29.490  -14.237 3.439   1.00 35.45  ? 32  LYS A CA  1 
ATOM   258  C C   . LYS A 1 32  ? 29.975  -12.975 2.746   1.00 29.99  ? 32  LYS A C   1 
ATOM   259  O O   . LYS A 1 32  ? 29.342  -11.926 2.824   1.00 41.25  ? 32  LYS A O   1 
ATOM   260  C CB  . LYS A 1 32  ? 29.743  -14.131 4.948   1.00 35.21  ? 32  LYS A CB  1 
ATOM   261  C CG  . LYS A 1 32  ? 31.203  -13.915 5.293   1.00 29.32  ? 32  LYS A CG  1 
ATOM   262  C CD  . LYS A 1 32  ? 31.416  -13.364 6.696   1.00 23.23  ? 32  LYS A CD  1 
ATOM   263  C CE  . LYS A 1 32  ? 32.915  -13.203 6.946   1.00 25.20  ? 32  LYS A CE  1 
ATOM   264  N NZ  . LYS A 1 32  ? 33.252  -12.399 8.142   1.00 30.60  ? 32  LYS A NZ  1 
ATOM   265  N N   . LYS A 1 33  ? 31.119  -13.067 2.075   1.00 29.99  ? 33  LYS A N   1 
ATOM   266  C CA  . LYS A 1 33  ? 31.667  -11.850 1.473   1.00 36.55  ? 33  LYS A CA  1 
ATOM   267  C C   . LYS A 1 33  ? 31.308  -11.723 -0.001  1.00 41.90  ? 33  LYS A C   1 
ATOM   268  O O   . LYS A 1 33  ? 31.239  -10.613 -0.527  1.00 50.34  ? 33  LYS A O   1 
ATOM   269  C CB  . LYS A 1 33  ? 33.186  -11.813 1.635   1.00 37.89  ? 33  LYS A CB  1 
ATOM   270  C CG  . LYS A 1 33  ? 33.643  -11.446 3.042   1.00 38.27  ? 33  LYS A CG  1 
ATOM   271  C CD  . LYS A 1 33  ? 35.078  -11.899 3.260   1.00 35.07  ? 33  LYS A CD  1 
ATOM   272  C CE  . LYS A 1 33  ? 35.677  -11.286 4.513   1.00 34.64  ? 33  LYS A CE  1 
ATOM   273  N NZ  . LYS A 1 33  ? 37.159  -11.175 4.446   1.00 40.36  ? 33  LYS A NZ  1 
ATOM   274  N N   . GLU A 1 34  ? 31.078  -12.841 -0.681  1.00 41.90  ? 34  GLU A N   1 
ATOM   275  C CA  . GLU A 1 34  ? 30.699  -12.755 -2.091  1.00 46.91  ? 34  GLU A CA  1 
ATOM   276  C C   . GLU A 1 34  ? 29.575  -13.724 -2.436  1.00 41.88  ? 34  GLU A C   1 
ATOM   277  O O   . GLU A 1 34  ? 29.834  -14.825 -2.930  1.00 36.22  ? 34  GLU A O   1 
ATOM   278  C CB  . GLU A 1 34  ? 31.909  -13.026 -2.987  1.00 53.57  ? 34  GLU A CB  1 
ATOM   279  C CG  . GLU A 1 34  ? 32.858  -11.840 -3.103  1.00 60.29  ? 34  GLU A CG  1 
ATOM   280  C CD  . GLU A 1 34  ? 32.173  -10.601 -3.638  1.00 67.44  ? 34  GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 34  ? 31.170  -10.172 -3.036  1.00 90.41  ? 34  GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 34  ? 32.624  -10.049 -4.661  1.00 76.41  ? 34  GLU A OE2 1 
ATOM   283  N N   . HIS A 1 35  ? 28.332  -13.319 -2.179  1.00 34.70  ? 35  HIS A N   1 
ATOM   284  C CA  . HIS A 1 35  ? 27.208  -14.177 -2.550  1.00 38.45  ? 35  HIS A CA  1 
ATOM   285  C C   . HIS A 1 35  ? 26.195  -13.413 -3.398  1.00 40.13  ? 35  HIS A C   1 
ATOM   286  O O   . HIS A 1 35  ? 26.380  -12.218 -3.639  1.00 46.13  ? 35  HIS A O   1 
ATOM   287  C CB  . HIS A 1 35  ? 26.545  -14.756 -1.300  1.00 34.00  ? 35  HIS A CB  1 
ATOM   288  C CG  . HIS A 1 35  ? 26.169  -13.690 -0.320  1.00 32.65  ? 35  HIS A CG  1 
ATOM   289  N ND1 . HIS A 1 35  ? 24.884  -13.206 -0.207  1.00 36.17  ? 35  HIS A ND1 1 
ATOM   290  C CD2 . HIS A 1 35  ? 26.915  -13.021 0.590   1.00 28.38  ? 35  HIS A CD2 1 
ATOM   291  C CE1 . HIS A 1 35  ? 24.851  -12.280 0.736   1.00 31.51  ? 35  HIS A CE1 1 
ATOM   292  N NE2 . HIS A 1 35  ? 26.071  -12.153 1.228   1.00 31.89  ? 35  HIS A NE2 1 
ATOM   293  N N   . TYR A 1 36  ? 25.150  -14.101 -3.830  1.00 38.96  ? 36  TYR A N   1 
ATOM   294  C CA  . TYR A 1 36  ? 24.193  -13.658 -4.826  1.00 38.64  ? 36  TYR A CA  1 
ATOM   295  C C   . TYR A 1 36  ? 23.253  -12.535 -4.403  1.00 36.01  ? 36  TYR A C   1 
ATOM   296  O O   . TYR A 1 36  ? 22.453  -12.064 -5.224  1.00 38.47  ? 36  TYR A O   1 
ATOM   297  C CB  . TYR A 1 36  ? 23.364  -14.862 -5.289  1.00 37.70  ? 36  TYR A CB  1 
ATOM   298  C CG  . TYR A 1 36  ? 22.449  -15.618 -4.371  1.00 31.98  ? 36  TYR A CG  1 
ATOM   299  C CD1 . TYR A 1 36  ? 21.309  -15.090 -3.782  1.00 34.38  ? 36  TYR A CD1 1 
ATOM   300  C CD2 . TYR A 1 36  ? 22.713  -16.959 -4.081  1.00 29.39  ? 36  TYR A CD2 1 
ATOM   301  C CE1 . TYR A 1 36  ? 20.464  -15.779 -2.946  1.00 38.08  ? 36  TYR A CE1 1 
ATOM   302  C CE2 . TYR A 1 36  ? 21.883  -17.681 -3.245  1.00 37.65  ? 36  TYR A CE2 1 
ATOM   303  C CZ  . TYR A 1 36  ? 20.766  -17.101 -2.685  1.00 37.27  ? 36  TYR A CZ  1 
ATOM   304  O OH  . TYR A 1 36  ? 19.939  -17.815 -1.851  1.00 42.61  ? 36  TYR A OH  1 
ATOM   305  N N   . GLU A 1 37  ? 23.250  -12.138 -3.146  1.00 30.24  ? 37  GLU A N   1 
ATOM   306  C CA  . GLU A 1 37  ? 22.186  -11.280 -2.625  1.00 33.43  ? 37  GLU A CA  1 
ATOM   307  C C   . GLU A 1 37  ? 21.906  -10.012 -3.415  1.00 34.91  ? 37  GLU A C   1 
ATOM   308  O O   . GLU A 1 37  ? 20.740  -9.653  -3.616  1.00 37.32  ? 37  GLU A O   1 
ATOM   309  C CB  . GLU A 1 37  ? 22.571  -10.915 -1.187  1.00 32.91  ? 37  GLU A CB  1 
ATOM   310  C CG  . GLU A 1 37  ? 21.500  -10.183 -0.400  1.00 39.37  ? 37  GLU A CG  1 
ATOM   311  C CD  . GLU A 1 37  ? 22.086  -9.705  0.922   1.00 46.87  ? 37  GLU A CD  1 
ATOM   312  O OE1 . GLU A 1 37  ? 22.965  -8.821  0.862   1.00 62.28  ? 37  GLU A OE1 1 
ATOM   313  O OE2 . GLU A 1 37  ? 21.675  -10.212 1.981   1.00 82.08  ? 37  GLU A OE2 1 
ATOM   314  N N   . THR A 1 38  ? 22.926  -9.291  -3.883  1.00 41.88  ? 38  THR A N   1 
ATOM   315  C CA  . THR A 1 38  ? 22.643  -8.051  -4.610  1.00 45.80  ? 38  THR A CA  1 
ATOM   316  C C   . THR A 1 38  ? 22.322  -8.319  -6.076  1.00 36.26  ? 38  THR A C   1 
ATOM   317  O O   . THR A 1 38  ? 21.552  -7.599  -6.714  1.00 35.17  ? 38  THR A O   1 
ATOM   318  C CB  . THR A 1 38  ? 23.804  -7.049  -4.513  1.00 50.83  ? 38  THR A CB  1 
ATOM   319  O OG1 . THR A 1 38  ? 24.215  -6.907  -3.148  1.00 52.65  ? 38  THR A OG1 1 
ATOM   320  C CG2 . THR A 1 38  ? 23.321  -5.681  -4.985  1.00 35.38  ? 38  THR A CG2 1 
ATOM   321  N N   . LEU A 1 39  ? 22.918  -9.375  -6.624  1.00 32.63  ? 39  LEU A N   1 
ATOM   322  C CA  . LEU A 1 39  ? 22.518  -9.814  -7.961  1.00 34.00  ? 39  LEU A CA  1 
ATOM   323  C C   . LEU A 1 39  ? 21.047  -10.217 -7.976  1.00 36.82  ? 39  LEU A C   1 
ATOM   324  O O   . LEU A 1 39  ? 20.301  -9.810  -8.861  1.00 32.71  ? 39  LEU A O   1 
ATOM   325  C CB  . LEU A 1 39  ? 23.420  -10.956 -8.419  1.00 25.46  ? 39  LEU A CB  1 
ATOM   326  C CG  . LEU A 1 39  ? 24.824  -10.473 -8.813  1.00 33.96  ? 39  LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 39  ? 25.775  -11.647 -8.979  1.00 24.71  ? 39  LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 39  ? 24.734  -9.621  -10.070 1.00 32.61  ? 39  LEU A CD2 1 
ATOM   329  N N   . GLU A 1 40  ? 20.638  -10.999 -6.979  1.00 32.67  ? 40  GLU A N   1 
ATOM   330  C CA  . GLU A 1 40  ? 19.250  -11.388 -6.835  1.00 24.24  ? 40  GLU A CA  1 
ATOM   331  C C   . GLU A 1 40  ? 18.315  -10.182 -6.900  1.00 32.37  ? 40  GLU A C   1 
ATOM   332  O O   . GLU A 1 40  ? 17.273  -10.236 -7.549  1.00 34.00  ? 40  GLU A O   1 
ATOM   333  C CB  . GLU A 1 40  ? 19.028  -12.116 -5.509  1.00 26.37  ? 40  GLU A CB  1 
ATOM   334  C CG  . GLU A 1 40  ? 17.618  -12.630 -5.274  1.00 33.47  ? 40  GLU A CG  1 
ATOM   335  C CD  . GLU A 1 40  ? 17.389  -13.049 -3.830  1.00 40.08  ? 40  GLU A CD  1 
ATOM   336  O OE1 . GLU A 1 40  ? 18.395  -13.239 -3.117  1.00 37.85  ? 40  GLU A OE1 1 
ATOM   337  O OE2 . GLU A 1 40  ? 16.220  -13.184 -3.414  1.00 37.59  ? 40  GLU A OE2 1 
ATOM   338  N N   . PHE A 1 41  ? 18.681  -9.111  -6.207  1.00 35.44  ? 41  PHE A N   1 
ATOM   339  C CA  . PHE A 1 41  ? 17.828  -7.934  -6.078  1.00 29.79  ? 41  PHE A CA  1 
ATOM   340  C C   . PHE A 1 41  ? 17.626  -7.281  -7.444  1.00 23.00  ? 41  PHE A C   1 
ATOM   341  O O   . PHE A 1 41  ? 16.496  -6.936  -7.770  1.00 27.75  ? 41  PHE A O   1 
ATOM   342  C CB  . PHE A 1 41  ? 18.424  -6.963  -5.065  1.00 40.34  ? 41  PHE A CB  1 
ATOM   343  C CG  . PHE A 1 41  ? 17.538  -5.823  -4.596  1.00 45.11  ? 41  PHE A CG  1 
ATOM   344  C CD1 . PHE A 1 41  ? 16.508  -6.023  -3.696  1.00 40.79  ? 41  PHE A CD1 1 
ATOM   345  C CD2 . PHE A 1 41  ? 17.752  -4.534  -5.065  1.00 47.45  ? 41  PHE A CD2 1 
ATOM   346  C CE1 . PHE A 1 41  ? 15.703  -4.978  -3.273  1.00 39.82  ? 41  PHE A CE1 1 
ATOM   347  C CE2 . PHE A 1 41  ? 16.959  -3.483  -4.645  1.00 47.44  ? 41  PHE A CE2 1 
ATOM   348  C CZ  . PHE A 1 41  ? 15.933  -3.703  -3.745  1.00 43.51  ? 41  PHE A CZ  1 
ATOM   349  N N   . LEU A 1 42  ? 18.695  -7.122  -8.207  1.00 28.11  ? 42  LEU A N   1 
ATOM   350  C CA  . LEU A 1 42  ? 18.631  -6.660  -9.584  1.00 38.22  ? 42  LEU A CA  1 
ATOM   351  C C   . LEU A 1 42  ? 17.848  -7.641  -10.462 1.00 35.15  ? 42  LEU A C   1 
ATOM   352  O O   . LEU A 1 42  ? 16.979  -7.225  -11.225 1.00 28.52  ? 42  LEU A O   1 
ATOM   353  C CB  . LEU A 1 42  ? 20.032  -6.497  -10.172 1.00 38.20  ? 42  LEU A CB  1 
ATOM   354  C CG  . LEU A 1 42  ? 20.325  -5.363  -11.149 1.00 43.56  ? 42  LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 42  ? 21.425  -5.743  -12.136 1.00 30.87  ? 42  LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 42  ? 19.087  -4.933  -11.921 1.00 38.90  ? 42  LEU A CD2 1 
ATOM   357  N N   . GLY A 1 43  ? 18.178  -8.927  -10.359 1.00 27.87  ? 43  GLY A N   1 
ATOM   358  C CA  . GLY A 1 43  ? 17.571  -9.991  -11.126 1.00 30.31  ? 43  GLY A CA  1 
ATOM   359  C C   . GLY A 1 43  ? 16.076  -10.153 -10.936 1.00 32.94  ? 43  GLY A C   1 
ATOM   360  O O   . GLY A 1 43  ? 15.374  -10.643 -11.828 1.00 35.21  ? 43  GLY A O   1 
ATOM   361  N N   . ASP A 1 44  ? 15.527  -9.758  -9.791  1.00 32.87  ? 44  ASP A N   1 
ATOM   362  C CA  . ASP A 1 44  ? 14.088  -9.825  -9.565  1.00 32.23  ? 44  ASP A CA  1 
ATOM   363  C C   . ASP A 1 44  ? 13.350  -8.817  -10.438 1.00 32.81  ? 44  ASP A C   1 
ATOM   364  O O   . ASP A 1 44  ? 12.310  -9.096  -11.034 1.00 26.04  ? 44  ASP A O   1 
ATOM   365  C CB  . ASP A 1 44  ? 13.766  -9.536  -8.093  1.00 34.94  ? 44  ASP A CB  1 
ATOM   366  C CG  . ASP A 1 44  ? 12.285  -9.473  -7.780  1.00 44.73  ? 44  ASP A CG  1 
ATOM   367  O OD1 . ASP A 1 44  ? 11.443  -9.797  -8.650  1.00 57.49  ? 44  ASP A OD1 1 
ATOM   368  O OD2 . ASP A 1 44  ? 11.920  -9.090  -6.646  1.00 49.55  ? 44  ASP A OD2 1 
ATOM   369  N N   . ALA A 1 45  ? 13.916  -7.607  -10.475 1.00 24.17  ? 45  ALA A N   1 
ATOM   370  C CA  . ALA A 1 45  ? 13.300  -6.531  -11.245 1.00 29.90  ? 45  ALA A CA  1 
ATOM   371  C C   . ALA A 1 45  ? 13.486  -6.729  -12.751 1.00 24.82  ? 45  ALA A C   1 
ATOM   372  O O   . ALA A 1 45  ? 12.583  -6.519  -13.555 1.00 26.96  ? 45  ALA A O   1 
ATOM   373  C CB  . ALA A 1 45  ? 13.880  -5.201  -10.786 1.00 22.58  ? 45  ALA A CB  1 
ATOM   374  N N   . LEU A 1 46  ? 14.672  -7.129  -13.144 1.00 21.41  ? 46  LEU A N   1 
ATOM   375  C CA  . LEU A 1 46  ? 15.046  -7.458  -14.515 1.00 31.53  ? 46  LEU A CA  1 
ATOM   376  C C   . LEU A 1 46  ? 14.105  -8.504  -15.101 1.00 31.69  ? 46  LEU A C   1 
ATOM   377  O O   . LEU A 1 46  ? 13.424  -8.340  -16.117 1.00 29.40  ? 46  LEU A O   1 
ATOM   378  C CB  . LEU A 1 46  ? 16.482  -7.967  -14.489 1.00 31.78  ? 46  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 46  ? 17.464  -7.762  -15.626 1.00 37.54  ? 46  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 46  ? 17.909  -9.116  -16.171 1.00 32.85  ? 46  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 46  ? 16.915  -6.916  -16.766 1.00 25.26  ? 46  LEU A CD2 1 
ATOM   382  N N   . VAL A 1 47  ? 14.076  -9.652  -14.425 1.00 18.62  ? 47  VAL A N   1 
ATOM   383  C CA  . VAL A 1 47  ? 13.290  -10.789 -14.905 1.00 27.16  ? 47  VAL A CA  1 
ATOM   384  C C   . VAL A 1 47  ? 11.814  -10.418 -14.930 1.00 30.04  ? 47  VAL A C   1 
ATOM   385  O O   . VAL A 1 47  ? 11.078  -10.739 -15.862 1.00 27.40  ? 47  VAL A O   1 
ATOM   386  C CB  . VAL A 1 47  ? 13.582  -12.025 -14.038 1.00 32.20  ? 47  VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 47  ? 12.539  -13.119 -14.216 1.00 28.48  ? 47  VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 47  ? 14.963  -12.587 -14.376 1.00 38.61  ? 47  VAL A CG2 1 
ATOM   389  N N   . ASN A 1 48  ? 11.377  -9.722  -13.889 1.00 24.51  ? 48  ASN A N   1 
ATOM   390  C CA  . ASN A 1 48  ? 10.003  -9.226  -13.805 1.00 26.31  ? 48  ASN A CA  1 
ATOM   391  C C   . ASN A 1 48  ? 9.676   -8.451  -15.071 1.00 24.09  ? 48  ASN A C   1 
ATOM   392  O O   . ASN A 1 48  ? 8.628   -8.607  -15.693 1.00 28.26  ? 48  ASN A O   1 
ATOM   393  C CB  . ASN A 1 48  ? 9.850   -8.363  -12.549 1.00 28.36  ? 48  ASN A CB  1 
ATOM   394  C CG  . ASN A 1 48  ? 8.517   -7.655  -12.439 1.00 31.44  ? 48  ASN A CG  1 
ATOM   395  O OD1 . ASN A 1 48  ? 7.464   -8.294  -12.429 1.00 35.95  ? 48  ASN A OD1 1 
ATOM   396  N ND2 . ASN A 1 48  ? 8.545   -6.327  -12.359 1.00 32.37  ? 48  ASN A ND2 1 
ATOM   397  N N   . PHE A 1 49  ? 10.607  -7.583  -15.475 1.00 29.82  ? 49  PHE A N   1 
ATOM   398  C CA  . PHE A 1 49  ? 10.415  -6.835  -16.719 1.00 29.38  ? 49  PHE A CA  1 
ATOM   399  C C   . PHE A 1 49  ? 10.315  -7.795  -17.905 1.00 24.64  ? 49  PHE A C   1 
ATOM   400  O O   . PHE A 1 49  ? 9.369   -7.692  -18.689 1.00 28.76  ? 49  PHE A O   1 
ATOM   401  C CB  . PHE A 1 49  ? 11.536  -5.821  -16.905 1.00 26.71  ? 49  PHE A CB  1 
ATOM   402  C CG  . PHE A 1 49  ? 11.712  -5.316  -18.331 1.00 29.33  ? 49  PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 49  ? 10.677  -4.700  -19.005 1.00 29.55  ? 49  PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 49  ? 12.924  -5.456  -18.987 1.00 36.45  ? 49  PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 49  ? 10.819  -4.239  -20.301 1.00 28.21  ? 49  PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 49  ? 13.076  -4.998  -20.285 1.00 38.44  ? 49  PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 49  ? 12.031  -4.376  -20.947 1.00 25.77  ? 49  PHE A CZ  1 
ATOM   408  N N   . PHE A 1 50  ? 11.254  -8.726  -18.039 1.00 23.78  ? 50  PHE A N   1 
ATOM   409  C CA  . PHE A 1 50  ? 11.227  -9.662  -19.158 1.00 27.21  ? 50  PHE A CA  1 
ATOM   410  C C   . PHE A 1 50  ? 9.885   -10.374 -19.270 1.00 34.58  ? 50  PHE A C   1 
ATOM   411  O O   . PHE A 1 50  ? 9.304   -10.523 -20.353 1.00 31.72  ? 50  PHE A O   1 
ATOM   412  C CB  . PHE A 1 50  ? 12.371  -10.670 -19.035 1.00 21.32  ? 50  PHE A CB  1 
ATOM   413  C CG  . PHE A 1 50  ? 13.750  -10.032 -19.142 1.00 22.27  ? 50  PHE A CG  1 
ATOM   414  C CD1 . PHE A 1 50  ? 13.902  -8.720  -19.556 1.00 28.48  ? 50  PHE A CD1 1 
ATOM   415  C CD2 . PHE A 1 50  ? 14.891  -10.745 -18.831 1.00 27.28  ? 50  PHE A CD2 1 
ATOM   416  C CE1 . PHE A 1 50  ? 15.157  -8.144  -19.658 1.00 34.14  ? 50  PHE A CE1 1 
ATOM   417  C CE2 . PHE A 1 50  ? 16.149  -10.183 -18.929 1.00 33.30  ? 50  PHE A CE2 1 
ATOM   418  C CZ  . PHE A 1 50  ? 16.291  -8.870  -19.350 1.00 33.56  ? 50  PHE A CZ  1 
ATOM   419  N N   . ILE A 1 51  ? 9.363   -10.803 -18.129 1.00 34.22  ? 51  ILE A N   1 
ATOM   420  C CA  . ILE A 1 51  ? 8.094   -11.532 -18.118 1.00 32.94  ? 51  ILE A CA  1 
ATOM   421  C C   . ILE A 1 51  ? 6.891   -10.620 -18.334 1.00 32.50  ? 51  ILE A C   1 
ATOM   422  O O   . ILE A 1 51  ? 5.990   -10.996 -19.098 1.00 42.44  ? 51  ILE A O   1 
ATOM   423  C CB  . ILE A 1 51  ? 7.949   -12.328 -16.807 1.00 30.10  ? 51  ILE A CB  1 
ATOM   424  C CG1 . ILE A 1 51  ? 8.641   -13.689 -16.877 1.00 31.54  ? 51  ILE A CG1 1 
ATOM   425  C CG2 . ILE A 1 51  ? 6.486   -12.472 -16.419 1.00 31.09  ? 51  ILE A CG2 1 
ATOM   426  C CD1 . ILE A 1 51  ? 9.807   -13.819 -15.921 1.00 50.58  ? 51  ILE A CD1 1 
ATOM   427  N N   . VAL A 1 52  ? 6.840   -9.444  -17.711 1.00 29.69  ? 52  VAL A N   1 
ATOM   428  C CA  . VAL A 1 52  ? 5.722   -8.531  -17.948 1.00 33.72  ? 52  VAL A CA  1 
ATOM   429  C C   . VAL A 1 52  ? 5.674   -8.086  -19.410 1.00 33.08  ? 52  VAL A C   1 
ATOM   430  O O   . VAL A 1 52  ? 4.605   -7.878  -19.977 1.00 31.46  ? 52  VAL A O   1 
ATOM   431  C CB  . VAL A 1 52  ? 5.778   -7.281  -17.050 1.00 29.82  ? 52  VAL A CB  1 
ATOM   432  C CG1 . VAL A 1 52  ? 4.860   -6.198  -17.592 1.00 11.45  ? 52  VAL A CG1 1 
ATOM   433  C CG2 . VAL A 1 52  ? 5.396   -7.619  -15.614 1.00 17.96  ? 52  VAL A CG2 1 
ATOM   434  N N   . ASP A 1 53  ? 6.828   -7.941  -20.047 1.00 28.72  ? 53  ASP A N   1 
ATOM   435  C CA  . ASP A 1 53  ? 6.906   -7.517  -21.439 1.00 24.58  ? 53  ASP A CA  1 
ATOM   436  C C   . ASP A 1 53  ? 6.308   -8.580  -22.346 1.00 28.20  ? 53  ASP A C   1 
ATOM   437  O O   . ASP A 1 53  ? 5.532   -8.336  -23.268 1.00 31.22  ? 53  ASP A O   1 
ATOM   438  C CB  . ASP A 1 53  ? 8.365   -7.228  -21.823 1.00 28.99  ? 53  ASP A CB  1 
ATOM   439  C CG  . ASP A 1 53  ? 8.456   -6.423  -23.107 1.00 30.74  ? 53  ASP A CG  1 
ATOM   440  O OD1 . ASP A 1 53  ? 7.464   -5.741  -23.446 1.00 36.85  ? 53  ASP A OD1 1 
ATOM   441  O OD2 . ASP A 1 53  ? 9.502   -6.465  -23.780 1.00 42.26  ? 53  ASP A OD2 1 
ATOM   442  N N   . LEU A 1 54  ? 6.682   -9.821  -22.054 1.00 26.77  ? 54  LEU A N   1 
ATOM   443  C CA  . LEU A 1 54  ? 6.186   -10.932 -22.855 1.00 30.68  ? 54  LEU A CA  1 
ATOM   444  C C   . LEU A 1 54  ? 4.684   -11.124 -22.670 1.00 39.57  ? 54  LEU A C   1 
ATOM   445  O O   . LEU A 1 54  ? 3.929   -11.268 -23.633 1.00 33.21  ? 54  LEU A O   1 
ATOM   446  C CB  . LEU A 1 54  ? 6.941   -12.211 -22.480 1.00 33.20  ? 54  LEU A CB  1 
ATOM   447  C CG  . LEU A 1 54  ? 6.912   -13.312 -23.550 1.00 45.38  ? 54  LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 54  ? 7.689   -12.878 -24.787 1.00 34.21  ? 54  LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 54  ? 7.441   -14.623 -22.988 1.00 51.69  ? 54  LEU A CD2 1 
ATOM   450  N N   . LEU A 1 55  ? 4.281   -11.114 -21.403 1.00 40.90  ? 55  LEU A N   1 
ATOM   451  C CA  . LEU A 1 55  ? 2.901   -11.326 -20.990 1.00 38.61  ? 55  LEU A CA  1 
ATOM   452  C C   . LEU A 1 55  ? 1.956   -10.341 -21.667 1.00 42.29  ? 55  LEU A C   1 
ATOM   453  O O   . LEU A 1 55  ? 0.860   -10.708 -22.102 1.00 46.85  ? 55  LEU A O   1 
ATOM   454  C CB  . LEU A 1 55  ? 2.788   -11.219 -19.473 1.00 39.20  ? 55  LEU A CB  1 
ATOM   455  C CG  . LEU A 1 55  ? 1.613   -11.841 -18.732 1.00 45.33  ? 55  LEU A CG  1 
ATOM   456  C CD1 . LEU A 1 55  ? 0.752   -10.751 -18.105 1.00 44.92  ? 55  LEU A CD1 1 
ATOM   457  C CD2 . LEU A 1 55  ? 0.766   -12.732 -19.625 1.00 36.12  ? 55  LEU A CD2 1 
ATOM   458  N N   . VAL A 1 56  ? 2.366   -9.080  -21.763 1.00 40.96  ? 56  VAL A N   1 
ATOM   459  C CA  . VAL A 1 56  ? 1.469   -8.057  -22.309 1.00 41.50  ? 56  VAL A CA  1 
ATOM   460  C C   . VAL A 1 56  ? 1.337   -8.208  -23.822 1.00 43.02  ? 56  VAL A C   1 
ATOM   461  O O   . VAL A 1 56  ? 0.396   -7.696  -24.432 1.00 41.59  ? 56  VAL A O   1 
ATOM   462  C CB  . VAL A 1 56  ? 1.964   -6.657  -21.905 1.00 42.43  ? 56  VAL A CB  1 
ATOM   463  C CG1 . VAL A 1 56  ? 1.488   -5.577  -22.866 1.00 38.23  ? 56  VAL A CG1 1 
ATOM   464  C CG2 . VAL A 1 56  ? 1.509   -6.322  -20.488 1.00 32.04  ? 56  VAL A CG2 1 
ATOM   465  N N   . GLN A 1 57  ? 2.270   -8.922  -24.444 1.00 41.28  ? 57  GLN A N   1 
ATOM   466  C CA  . GLN A 1 57  ? 2.277   -9.151  -25.877 1.00 43.54  ? 57  GLN A CA  1 
ATOM   467  C C   . GLN A 1 57  ? 1.546   -10.419 -26.297 1.00 39.45  ? 57  GLN A C   1 
ATOM   468  O O   . GLN A 1 57  ? 1.041   -10.454 -27.423 1.00 34.90  ? 57  GLN A O   1 
ATOM   469  C CB  . GLN A 1 57  ? 3.720   -9.254  -26.401 1.00 42.92  ? 57  GLN A CB  1 
ATOM   470  C CG  . GLN A 1 57  ? 4.424   -7.904  -26.461 1.00 37.82  ? 57  GLN A CG  1 
ATOM   471  C CD  . GLN A 1 57  ? 5.852   -8.048  -26.932 1.00 35.43  ? 57  GLN A CD  1 
ATOM   472  O OE1 . GLN A 1 57  ? 6.106   -8.061  -28.133 1.00 45.75  ? 57  GLN A OE1 1 
ATOM   473  N NE2 . GLN A 1 57  ? 6.782   -8.158  -25.995 1.00 39.41  ? 57  GLN A NE2 1 
ATOM   474  N N   . TYR A 1 58  ? 1.505   -11.429 -25.430 1.00 33.30  ? 58  TYR A N   1 
ATOM   475  C CA  . TYR A 1 58  ? 0.973   -12.720 -25.844 1.00 34.13  ? 58  TYR A CA  1 
ATOM   476  C C   . TYR A 1 58  ? -0.287  -13.145 -25.108 1.00 42.17  ? 58  TYR A C   1 
ATOM   477  O O   . TYR A 1 58  ? -0.843  -14.204 -25.430 1.00 43.79  ? 58  TYR A O   1 
ATOM   478  C CB  . TYR A 1 58  ? 2.067   -13.799 -25.678 1.00 31.53  ? 58  TYR A CB  1 
ATOM   479  C CG  . TYR A 1 58  ? 3.058   -13.673 -26.822 1.00 30.89  ? 58  TYR A CG  1 
ATOM   480  C CD1 . TYR A 1 58  ? 2.752   -14.196 -28.070 1.00 43.36  ? 58  TYR A CD1 1 
ATOM   481  C CD2 . TYR A 1 58  ? 4.276   -13.028 -26.654 1.00 32.32  ? 58  TYR A CD2 1 
ATOM   482  C CE1 . TYR A 1 58  ? 3.638   -14.091 -29.131 1.00 46.33  ? 58  TYR A CE1 1 
ATOM   483  C CE2 . TYR A 1 58  ? 5.167   -12.916 -27.706 1.00 38.66  ? 58  TYR A CE2 1 
ATOM   484  C CZ  . TYR A 1 58  ? 4.844   -13.448 -28.940 1.00 48.15  ? 58  TYR A CZ  1 
ATOM   485  O OH  . TYR A 1 58  ? 5.728   -13.341 -29.993 1.00 45.82  ? 58  TYR A OH  1 
ATOM   486  N N   . SER A 1 59  ? -0.739  -12.344 -24.152 1.00 36.70  ? 59  SER A N   1 
ATOM   487  C CA  . SER A 1 59  ? -1.920  -12.651 -23.364 1.00 35.06  ? 59  SER A CA  1 
ATOM   488  C C   . SER A 1 59  ? -3.201  -12.452 -24.171 1.00 41.21  ? 59  SER A C   1 
ATOM   489  O O   . SER A 1 59  ? -3.376  -11.424 -24.830 1.00 36.25  ? 59  SER A O   1 
ATOM   490  C CB  . SER A 1 59  ? -1.982  -11.785 -22.098 1.00 43.42  ? 59  SER A CB  1 
ATOM   491  O OG  . SER A 1 59  ? -3.257  -11.923 -21.484 1.00 43.63  ? 59  SER A OG  1 
ATOM   492  N N   . PRO A 1 60  ? -4.077  -13.448 -24.091 1.00 45.48  ? 60  PRO A N   1 
ATOM   493  C CA  . PRO A 1 60  ? -5.329  -13.430 -24.850 1.00 45.24  ? 60  PRO A CA  1 
ATOM   494  C C   . PRO A 1 60  ? -6.121  -12.165 -24.530 1.00 47.91  ? 60  PRO A C   1 
ATOM   495  O O   . PRO A 1 60  ? -6.819  -11.625 -25.384 1.00 51.66  ? 60  PRO A O   1 
ATOM   496  C CB  . PRO A 1 60  ? -6.080  -14.667 -24.367 1.00 47.85  ? 60  PRO A CB  1 
ATOM   497  C CG  . PRO A 1 60  ? -5.342  -15.197 -23.195 1.00 46.60  ? 60  PRO A CG  1 
ATOM   498  C CD  . PRO A 1 60  ? -3.941  -14.661 -23.267 1.00 43.31  ? 60  PRO A CD  1 
ATOM   499  N N   . ASN A 1 61  ? -5.971  -11.714 -23.287 1.00 46.66  ? 61  ASN A N   1 
ATOM   500  C CA  . ASN A 1 61  ? -6.696  -10.515 -22.852 1.00 43.62  ? 61  ASN A CA  1 
ATOM   501  C C   . ASN A 1 61  ? -5.766  -9.605  -22.049 1.00 44.57  ? 61  ASN A C   1 
ATOM   502  O O   . ASN A 1 61  ? -4.995  -10.094 -21.230 1.00 39.26  ? 61  ASN A O   1 
ATOM   503  C CB  . ASN A 1 61  ? -7.939  -10.940 -22.109 1.00 48.10  ? 61  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 61  ? -8.178  -10.540 -20.684 1.00 50.33  ? 61  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 61  ? -7.861  -9.456  -20.204 1.00 59.03  ? 61  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 61  ? -8.802  -11.468 -19.951 1.00 58.69  ? 61  ASN A ND2 1 
ATOM   507  N N   . LYS A 1 62  ? -5.874  -8.323  -22.333 1.00 44.07  ? 62  LYS A N   1 
ATOM   508  C CA  . LYS A 1 62  ? -5.014  -7.218  -21.939 1.00 49.87  ? 62  LYS A CA  1 
ATOM   509  C C   . LYS A 1 62  ? -5.585  -6.424  -20.758 1.00 49.03  ? 62  LYS A C   1 
ATOM   510  O O   . LYS A 1 62  ? -5.263  -5.247  -20.572 1.00 48.05  ? 62  LYS A O   1 
ATOM   511  C CB  . LYS A 1 62  ? -4.959  -6.244  -23.121 1.00 58.53  ? 62  LYS A CB  1 
ATOM   512  C CG  . LYS A 1 62  ? -3.814  -6.524  -24.095 1.00 62.57  ? 62  LYS A CG  1 
ATOM   513  C CD  . LYS A 1 62  ? -4.000  -7.853  -24.813 1.00 55.81  ? 62  LYS A CD  1 
ATOM   514  C CE  . LYS A 1 62  ? -2.914  -8.071  -25.850 1.00 51.42  ? 62  LYS A CE  1 
ATOM   515  N NZ  . LYS A 1 62  ? -2.221  -9.373  -25.669 1.00 46.89  ? 62  LYS A NZ  1 
ATOM   516  N N   . ARG A 1 63  ? -6.404  -7.065  -19.931 1.00 47.48  ? 63  ARG A N   1 
ATOM   517  C CA  . ARG A 1 63  ? -6.930  -6.342  -18.769 1.00 47.53  ? 63  ARG A CA  1 
ATOM   518  C C   . ARG A 1 63  ? -6.050  -6.615  -17.567 1.00 51.23  ? 63  ARG A C   1 
ATOM   519  O O   . ARG A 1 63  ? -5.573  -7.738  -17.402 1.00 66.80  ? 63  ARG A O   1 
ATOM   520  C CB  . ARG A 1 63  ? -8.391  -6.741  -18.515 1.00 43.05  ? 63  ARG A CB  1 
ATOM   521  C CG  . ARG A 1 63  ? -9.319  -6.102  -19.539 1.00 54.45  ? 63  ARG A CG  1 
ATOM   522  C CD  . ARG A 1 63  ? -10.479 -7.008  -19.938 1.00 68.06  ? 63  ARG A CD  1 
ATOM   523  N NE  . ARG A 1 63  ? -11.388 -6.297  -20.838 1.00 67.67  ? 63  ARG A NE  1 
ATOM   524  C CZ  . ARG A 1 63  ? -12.675 -6.533  -21.015 1.00 69.68  ? 63  ARG A CZ  1 
ATOM   525  N NH1 . ARG A 1 63  ? -13.283 -7.498  -20.339 1.00 71.89  ? 63  ARG A NH1 1 
ATOM   526  N NH2 . ARG A 1 63  ? -13.367 -5.794  -21.881 1.00 84.35  ? 63  ARG A NH2 1 
ATOM   527  N N   . GLU A 1 64  ? -5.824  -5.599  -16.743 1.00 57.34  ? 64  GLU A N   1 
ATOM   528  C CA  . GLU A 1 64  ? -5.027  -5.802  -15.540 1.00 63.25  ? 64  GLU A CA  1 
ATOM   529  C C   . GLU A 1 64  ? -5.607  -6.952  -14.719 1.00 58.33  ? 64  GLU A C   1 
ATOM   530  O O   . GLU A 1 64  ? -4.860  -7.707  -14.096 1.00 56.24  ? 64  GLU A O   1 
ATOM   531  C CB  . GLU A 1 64  ? -4.959  -4.533  -14.692 1.00 74.13  ? 64  GLU A CB  1 
ATOM   532  C CG  . GLU A 1 64  ? -5.692  -4.622  -13.364 1.00 80.69  ? 64  GLU A CG  1 
ATOM   533  C CD  . GLU A 1 64  ? -4.814  -5.000  -12.190 1.00 80.61  ? 64  GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 64  ? -3.749  -4.376  -12.001 1.00 84.47  ? 64  GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 64  ? -5.191  -5.934  -11.451 1.00 75.07  ? 64  GLU A OE2 1 
ATOM   536  N N   . GLY A 1 65  ? -6.931  -7.075  -14.720 1.00 52.09  ? 65  GLY A N   1 
ATOM   537  C CA  . GLY A 1 65  ? -7.574  -8.130  -13.957 1.00 44.42  ? 65  GLY A CA  1 
ATOM   538  C C   . GLY A 1 65  ? -7.190  -9.524  -14.411 1.00 53.20  ? 65  GLY A C   1 
ATOM   539  O O   . GLY A 1 65  ? -7.171  -10.457 -13.606 1.00 55.50  ? 65  GLY A O   1 
ATOM   540  N N   . PHE A 1 66  ? -6.886  -9.711  -15.696 1.00 58.61  ? 66  PHE A N   1 
ATOM   541  C CA  . PHE A 1 66  ? -6.466  -11.009 -16.209 1.00 49.88  ? 66  PHE A CA  1 
ATOM   542  C C   . PHE A 1 66  ? -4.948  -11.172 -16.100 1.00 45.74  ? 66  PHE A C   1 
ATOM   543  O O   . PHE A 1 66  ? -4.454  -12.284 -15.905 1.00 42.45  ? 66  PHE A O   1 
ATOM   544  C CB  . PHE A 1 66  ? -6.885  -11.177 -17.666 1.00 51.01  ? 66  PHE A CB  1 
ATOM   545  C CG  . PHE A 1 66  ? -6.534  -12.515 -18.295 1.00 55.60  ? 66  PHE A CG  1 
ATOM   546  C CD1 . PHE A 1 66  ? -7.426  -13.572 -18.207 1.00 52.57  ? 66  PHE A CD1 1 
ATOM   547  C CD2 . PHE A 1 66  ? -5.343  -12.724 -18.973 1.00 50.76  ? 66  PHE A CD2 1 
ATOM   548  C CE1 . PHE A 1 66  ? -7.142  -14.799 -18.772 1.00 45.30  ? 66  PHE A CE1 1 
ATOM   549  C CE2 . PHE A 1 66  ? -5.042  -13.952 -19.526 1.00 44.51  ? 66  PHE A CE2 1 
ATOM   550  C CZ  . PHE A 1 66  ? -5.939  -14.996 -19.424 1.00 41.60  ? 66  PHE A CZ  1 
ATOM   551  N N   . LEU A 1 67  ? -4.235  -10.068 -16.261 1.00 45.89  ? 67  LEU A N   1 
ATOM   552  C CA  . LEU A 1 67  ? -2.783  -10.045 -16.295 1.00 52.39  ? 67  LEU A CA  1 
ATOM   553  C C   . LEU A 1 67  ? -2.135  -10.286 -14.933 1.00 55.14  ? 67  LEU A C   1 
ATOM   554  O O   . LEU A 1 67  ? -1.254  -11.149 -14.830 1.00 48.63  ? 67  LEU A O   1 
ATOM   555  C CB  . LEU A 1 67  ? -2.293  -8.697  -16.840 1.00 47.15  ? 67  LEU A CB  1 
ATOM   556  C CG  . LEU A 1 67  ? -2.808  -8.313  -18.227 1.00 50.27  ? 67  LEU A CG  1 
ATOM   557  C CD1 . LEU A 1 67  ? -2.446  -6.867  -18.535 1.00 61.44  ? 67  LEU A CD1 1 
ATOM   558  C CD2 . LEU A 1 67  ? -2.254  -9.251  -19.287 1.00 39.14  ? 67  LEU A CD2 1 
ATOM   559  N N   . SER A 1 68  ? -2.559  -9.527  -13.928 1.00 46.25  ? 68  SER A N   1 
ATOM   560  C CA  . SER A 1 68  ? -1.923  -9.542  -12.613 1.00 51.65  ? 68  SER A CA  1 
ATOM   561  C C   . SER A 1 68  ? -1.839  -10.915 -11.961 1.00 45.73  ? 68  SER A C   1 
ATOM   562  O O   . SER A 1 68  ? -0.771  -11.316 -11.485 1.00 37.89  ? 68  SER A O   1 
ATOM   563  C CB  . SER A 1 68  ? -2.673  -8.548  -11.709 1.00 55.37  ? 68  SER A CB  1 
ATOM   564  O OG  . SER A 1 68  ? -2.266  -7.222  -12.014 1.00 58.82  ? 68  SER A OG  1 
ATOM   565  N N   . PRO A 1 69  ? -2.915  -11.691 -11.883 1.00 40.75  ? 69  PRO A N   1 
ATOM   566  C CA  . PRO A 1 69  ? -2.812  -13.035 -11.302 1.00 43.96  ? 69  PRO A CA  1 
ATOM   567  C C   . PRO A 1 69  ? -1.905  -13.959 -12.113 1.00 49.16  ? 69  PRO A C   1 
ATOM   568  O O   . PRO A 1 69  ? -1.144  -14.753 -11.551 1.00 42.97  ? 69  PRO A O   1 
ATOM   569  C CB  . PRO A 1 69  ? -4.250  -13.555 -11.335 1.00 43.21  ? 69  PRO A CB  1 
ATOM   570  C CG  . PRO A 1 69  ? -5.002  -12.669 -12.260 1.00 44.03  ? 69  PRO A CG  1 
ATOM   571  C CD  . PRO A 1 69  ? -4.282  -11.356 -12.304 1.00 43.24  ? 69  PRO A CD  1 
ATOM   572  N N   . LEU A 1 70  ? -2.000  -13.847 -13.434 1.00 44.80  ? 70  LEU A N   1 
ATOM   573  C CA  . LEU A 1 70  ? -1.123  -14.564 -14.347 1.00 40.94  ? 70  LEU A CA  1 
ATOM   574  C C   . LEU A 1 70  ? 0.313   -14.091 -14.131 1.00 36.85  ? 70  LEU A C   1 
ATOM   575  O O   . LEU A 1 70  ? 1.210   -14.922 -14.017 1.00 47.13  ? 70  LEU A O   1 
ATOM   576  C CB  . LEU A 1 70  ? -1.523  -14.370 -15.809 1.00 44.69  ? 70  LEU A CB  1 
ATOM   577  C CG  . LEU A 1 70  ? -1.601  -15.645 -16.653 1.00 48.01  ? 70  LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 70  ? -2.199  -15.356 -18.020 1.00 55.81  ? 70  LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 70  ? -0.223  -16.279 -16.789 1.00 43.93  ? 70  LEU A CD2 1 
ATOM   580  N N   . LYS A 1 71  ? 0.499   -12.775 -14.067 1.00 30.92  ? 71  LYS A N   1 
ATOM   581  C CA  . LYS A 1 71  ? 1.810   -12.231 -13.732 1.00 38.14  ? 71  LYS A CA  1 
ATOM   582  C C   . LYS A 1 71  ? 2.337   -12.858 -12.438 1.00 42.12  ? 71  LYS A C   1 
ATOM   583  O O   . LYS A 1 71  ? 3.487   -13.292 -12.386 1.00 32.29  ? 71  LYS A O   1 
ATOM   584  C CB  . LYS A 1 71  ? 1.793   -10.714 -13.555 1.00 39.95  ? 71  LYS A CB  1 
ATOM   585  C CG  . LYS A 1 71  ? 3.170   -10.098 -13.328 1.00 45.38  ? 71  LYS A CG  1 
ATOM   586  C CD  . LYS A 1 71  ? 3.071   -8.630  -12.939 1.00 44.94  ? 71  LYS A CD  1 
ATOM   587  C CE  . LYS A 1 71  ? 4.098   -8.247  -11.888 1.00 41.01  ? 71  LYS A CE  1 
ATOM   588  N NZ  . LYS A 1 71  ? 3.972   -9.095  -10.664 1.00 71.61  ? 71  LYS A NZ  1 
ATOM   589  N N   . ALA A 1 72  ? 1.467   -12.860 -11.437 1.00 42.62  ? 72  ALA A N   1 
ATOM   590  C CA  . ALA A 1 72  ? 1.718   -13.426 -10.120 1.00 39.65  ? 72  ALA A CA  1 
ATOM   591  C C   . ALA A 1 72  ? 2.264   -14.841 -10.229 1.00 36.73  ? 72  ALA A C   1 
ATOM   592  O O   . ALA A 1 72  ? 3.231   -15.217 -9.560  1.00 43.15  ? 72  ALA A O   1 
ATOM   593  C CB  . ALA A 1 72  ? 0.445   -13.400 -9.285  1.00 42.09  ? 72  ALA A CB  1 
ATOM   594  N N   . TYR A 1 73  ? 1.672   -15.666 -11.090 1.00 34.21  ? 73  TYR A N   1 
ATOM   595  C CA  . TYR A 1 73  ? 2.206   -17.020 -11.233 1.00 33.53  ? 73  TYR A CA  1 
ATOM   596  C C   . TYR A 1 73  ? 3.532   -17.034 -11.985 1.00 36.96  ? 73  TYR A C   1 
ATOM   597  O O   . TYR A 1 73  ? 4.469   -17.758 -11.638 1.00 35.28  ? 73  TYR A O   1 
ATOM   598  C CB  . TYR A 1 73  ? 1.176   -17.925 -11.937 1.00 31.93  ? 73  TYR A CB  1 
ATOM   599  C CG  . TYR A 1 73  ? 1.829   -19.217 -12.395 1.00 36.62  ? 73  TYR A CG  1 
ATOM   600  C CD1 . TYR A 1 73  ? 2.147   -20.197 -11.459 1.00 40.05  ? 73  TYR A CD1 1 
ATOM   601  C CD2 . TYR A 1 73  ? 2.136   -19.453 -13.728 1.00 37.14  ? 73  TYR A CD2 1 
ATOM   602  C CE1 . TYR A 1 73  ? 2.748   -21.381 -11.855 1.00 42.57  ? 73  TYR A CE1 1 
ATOM   603  C CE2 . TYR A 1 73  ? 2.739   -20.632 -14.136 1.00 32.86  ? 73  TYR A CE2 1 
ATOM   604  C CZ  . TYR A 1 73  ? 3.041   -21.587 -13.189 1.00 40.14  ? 73  TYR A CZ  1 
ATOM   605  O OH  . TYR A 1 73  ? 3.637   -22.767 -13.577 1.00 37.71  ? 73  TYR A OH  1 
ATOM   606  N N   . LEU A 1 74  ? 3.656   -16.251 -13.056 1.00 33.20  ? 74  LEU A N   1 
ATOM   607  C CA  . LEU A 1 74  ? 4.824   -16.315 -13.923 1.00 29.29  ? 74  LEU A CA  1 
ATOM   608  C C   . LEU A 1 74  ? 6.089   -15.756 -13.286 1.00 34.37  ? 74  LEU A C   1 
ATOM   609  O O   . LEU A 1 74  ? 7.179   -15.865 -13.870 1.00 31.49  ? 74  LEU A O   1 
ATOM   610  C CB  . LEU A 1 74  ? 4.537   -15.584 -15.243 1.00 31.13  ? 74  LEU A CB  1 
ATOM   611  C CG  . LEU A 1 74  ? 3.565   -16.255 -16.216 1.00 31.41  ? 74  LEU A CG  1 
ATOM   612  C CD1 . LEU A 1 74  ? 3.115   -15.257 -17.276 1.00 38.75  ? 74  LEU A CD1 1 
ATOM   613  C CD2 . LEU A 1 74  ? 4.177   -17.487 -16.872 1.00 29.36  ? 74  LEU A CD2 1 
ATOM   614  N N   . ILE A 1 75  ? 5.997   -15.153 -12.104 1.00 37.26  ? 75  ILE A N   1 
ATOM   615  C CA  . ILE A 1 75  ? 7.212   -14.680 -11.437 1.00 38.44  ? 75  ILE A CA  1 
ATOM   616  C C   . ILE A 1 75  ? 7.394   -15.415 -10.109 1.00 40.27  ? 75  ILE A C   1 
ATOM   617  O O   . ILE A 1 75  ? 8.242   -15.091 -9.278  1.00 35.99  ? 75  ILE A O   1 
ATOM   618  C CB  . ILE A 1 75  ? 7.224   -13.161 -11.191 1.00 34.03  ? 75  ILE A CB  1 
ATOM   619  C CG1 . ILE A 1 75  ? 6.138   -12.651 -10.247 1.00 33.22  ? 75  ILE A CG1 1 
ATOM   620  C CG2 . ILE A 1 75  ? 7.182   -12.437 -12.531 1.00 34.54  ? 75  ILE A CG2 1 
ATOM   621  C CD1 . ILE A 1 75  ? 6.247   -11.190 -9.867  1.00 17.23  ? 75  ILE A CD1 1 
ATOM   622  N N   . SER A 1 76  ? 6.566   -16.442 -9.931  1.00 28.05  ? 76  SER A N   1 
ATOM   623  C CA  . SER A 1 76  ? 6.624   -17.204 -8.687  1.00 38.47  ? 76  SER A CA  1 
ATOM   624  C C   . SER A 1 76  ? 7.838   -18.121 -8.600  1.00 35.80  ? 76  SER A C   1 
ATOM   625  O O   . SER A 1 76  ? 8.519   -18.400 -9.581  1.00 34.08  ? 76  SER A O   1 
ATOM   626  C CB  . SER A 1 76  ? 5.346   -18.047 -8.548  1.00 39.64  ? 76  SER A CB  1 
ATOM   627  O OG  . SER A 1 76  ? 5.467   -19.199 -9.374  1.00 42.22  ? 76  SER A OG  1 
ATOM   628  N N   . GLU A 1 77  ? 8.096   -18.612 -7.394  1.00 38.70  ? 77  GLU A N   1 
ATOM   629  C CA  . GLU A 1 77  ? 9.145   -19.568 -7.090  1.00 40.18  ? 77  GLU A CA  1 
ATOM   630  C C   . GLU A 1 77  ? 8.948   -20.886 -7.826  1.00 38.76  ? 77  GLU A C   1 
ATOM   631  O O   . GLU A 1 77  ? 9.889   -21.523 -8.293  1.00 36.33  ? 77  GLU A O   1 
ATOM   632  C CB  . GLU A 1 77  ? 9.166   -19.836 -5.581  1.00 40.77  ? 77  GLU A CB  1 
ATOM   633  C CG  . GLU A 1 77  ? 10.277  -20.779 -5.138  1.00 50.41  ? 77  GLU A CG  1 
ATOM   634  C CD  . GLU A 1 77  ? 10.198  -21.046 -3.643  1.00 55.72  ? 77  GLU A CD  1 
ATOM   635  O OE1 . GLU A 1 77  ? 10.312  -20.076 -2.861  1.00 48.87  ? 77  GLU A OE1 1 
ATOM   636  O OE2 . GLU A 1 77  ? 10.027  -22.224 -3.271  1.00 49.79  ? 77  GLU A OE2 1 
ATOM   637  N N   . GLU A 1 78  ? 7.683   -21.293 -7.917  1.00 32.69  ? 78  GLU A N   1 
ATOM   638  C CA  . GLU A 1 78  ? 7.352   -22.552 -8.564  1.00 31.74  ? 78  GLU A CA  1 
ATOM   639  C C   . GLU A 1 78  ? 7.658   -22.473 -10.055 1.00 34.92  ? 78  GLU A C   1 
ATOM   640  O O   . GLU A 1 78  ? 8.211   -23.410 -10.626 1.00 41.38  ? 78  GLU A O   1 
ATOM   641  C CB  . GLU A 1 78  ? 5.878   -22.911 -8.343  1.00 41.56  ? 78  GLU A CB  1 
ATOM   642  C CG  . GLU A 1 78  ? 5.476   -23.097 -6.891  1.00 51.32  ? 78  GLU A CG  1 
ATOM   643  C CD  . GLU A 1 78  ? 5.339   -21.798 -6.123  1.00 59.95  ? 78  GLU A CD  1 
ATOM   644  O OE1 . GLU A 1 78  ? 5.556   -20.729 -6.738  1.00 62.12  ? 78  GLU A OE1 1 
ATOM   645  O OE2 . GLU A 1 78  ? 5.015   -21.827 -4.913  1.00 66.65  ? 78  GLU A OE2 1 
ATOM   646  N N   . PHE A 1 79  ? 7.280   -21.357 -10.680 1.00 34.16  ? 79  PHE A N   1 
ATOM   647  C CA  . PHE A 1 79  ? 7.538   -21.192 -12.104 1.00 23.20  ? 79  PHE A CA  1 
ATOM   648  C C   . PHE A 1 79  ? 9.039   -21.054 -12.340 1.00 33.89  ? 79  PHE A C   1 
ATOM   649  O O   . PHE A 1 79  ? 9.616   -21.725 -13.197 1.00 41.60  ? 79  PHE A O   1 
ATOM   650  C CB  . PHE A 1 79  ? 6.792   -19.990 -12.693 1.00 24.15  ? 79  PHE A CB  1 
ATOM   651  C CG  . PHE A 1 79  ? 6.901   -19.964 -14.213 1.00 38.35  ? 79  PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 79  ? 6.386   -21.015 -14.959 1.00 41.51  ? 79  PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 79  ? 7.508   -18.917 -14.880 1.00 40.41  ? 79  PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 79  ? 6.475   -21.025 -16.337 1.00 41.26  ? 79  PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 79  ? 7.602   -18.927 -16.262 1.00 41.12  ? 79  PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 79  ? 7.098   -19.983 -16.998 1.00 36.21  ? 79  PHE A CZ  1 
ATOM   657  N N   . PHE A 1 80  ? 9.696   -20.184 -11.565 1.00 37.93  ? 80  PHE A N   1 
ATOM   658  C CA  . PHE A 1 80  ? 11.132  -20.008 -11.739 1.00 35.53  ? 80  PHE A CA  1 
ATOM   659  C C   . PHE A 1 80  ? 11.875  -21.332 -11.598 1.00 34.12  ? 80  PHE A C   1 
ATOM   660  O O   . PHE A 1 80  ? 12.909  -21.546 -12.234 1.00 26.74  ? 80  PHE A O   1 
ATOM   661  C CB  . PHE A 1 80  ? 11.698  -19.019 -10.721 1.00 34.60  ? 80  PHE A CB  1 
ATOM   662  C CG  . PHE A 1 80  ? 11.501  -17.568 -11.136 1.00 30.23  ? 80  PHE A CG  1 
ATOM   663  C CD1 . PHE A 1 80  ? 10.880  -17.273 -12.336 1.00 22.48  ? 80  PHE A CD1 1 
ATOM   664  C CD2 . PHE A 1 80  ? 11.929  -16.546 -10.314 1.00 29.19  ? 80  PHE A CD2 1 
ATOM   665  C CE1 . PHE A 1 80  ? 10.669  -15.966 -12.714 1.00 24.82  ? 80  PHE A CE1 1 
ATOM   666  C CE2 . PHE A 1 80  ? 11.733  -15.227 -10.686 1.00 29.73  ? 80  PHE A CE2 1 
ATOM   667  C CZ  . PHE A 1 80  ? 11.102  -14.950 -11.881 1.00 31.49  ? 80  PHE A CZ  1 
ATOM   668  N N   . ASN A 1 81  ? 11.314  -22.181 -10.740 1.00 32.99  ? 81  ASN A N   1 
ATOM   669  C CA  . ASN A 1 81  ? 11.934  -23.482 -10.497 1.00 43.80  ? 81  ASN A CA  1 
ATOM   670  C C   . ASN A 1 81  ? 11.778  -24.390 -11.714 1.00 48.50  ? 81  ASN A C   1 
ATOM   671  O O   . ASN A 1 81  ? 12.689  -25.158 -12.021 1.00 32.06  ? 81  ASN A O   1 
ATOM   672  C CB  . ASN A 1 81  ? 11.339  -24.135 -9.247  1.00 47.16  ? 81  ASN A CB  1 
ATOM   673  C CG  . ASN A 1 81  ? 12.163  -23.807 -8.015  1.00 39.19  ? 81  ASN A CG  1 
ATOM   674  O OD1 . ASN A 1 81  ? 13.218  -24.400 -7.811  1.00 43.94  ? 81  ASN A OD1 1 
ATOM   675  N ND2 . ASN A 1 81  ? 11.695  -22.867 -7.212  1.00 39.58  ? 81  ASN A ND2 1 
ATOM   676  N N   . LEU A 1 82  ? 10.634  -24.263 -12.373 1.00 54.25  ? 82  LEU A N   1 
ATOM   677  C CA  . LEU A 1 82  ? 10.300  -24.958 -13.614 1.00 57.41  ? 82  LEU A CA  1 
ATOM   678  C C   . LEU A 1 82  ? 11.262  -24.524 -14.717 1.00 56.10  ? 82  LEU A C   1 
ATOM   679  O O   . LEU A 1 82  ? 11.749  -25.345 -15.498 1.00 57.91  ? 82  LEU A O   1 
ATOM   680  C CB  . LEU A 1 82  ? 8.851   -24.681 -13.981 1.00 59.01  ? 82  LEU A CB  1 
ATOM   681  C CG  . LEU A 1 82  ? 8.033   -25.604 -14.871 1.00 58.59  ? 82  LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 82  ? 8.256   -25.269 -16.343 1.00 56.29  ? 82  LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 82  ? 8.342   -27.069 -14.618 1.00 55.37  ? 82  LEU A CD2 1 
ATOM   684  N N   . LEU A 1 83  ? 11.550  -23.224 -14.775 1.00 49.41  ? 83  LEU A N   1 
ATOM   685  C CA  . LEU A 1 83  ? 12.475  -22.711 -15.788 1.00 45.60  ? 83  LEU A CA  1 
ATOM   686  C C   . LEU A 1 83  ? 13.919  -23.039 -15.457 1.00 35.55  ? 83  LEU A C   1 
ATOM   687  O O   . LEU A 1 83  ? 14.754  -23.343 -16.313 1.00 31.36  ? 83  LEU A O   1 
ATOM   688  C CB  . LEU A 1 83  ? 12.288  -21.198 -15.939 1.00 42.70  ? 83  LEU A CB  1 
ATOM   689  C CG  . LEU A 1 83  ? 10.917  -20.733 -16.429 1.00 32.21  ? 83  LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 83  ? 10.874  -19.215 -16.497 1.00 37.87  ? 83  LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 83  ? 10.596  -21.336 -17.788 1.00 26.63  ? 83  LEU A CD2 1 
ATOM   692  N N   . ALA A 1 84  ? 14.269  -22.999 -14.171 1.00 40.36  ? 84  ALA A N   1 
ATOM   693  C CA  . ALA A 1 84  ? 15.641  -23.330 -13.790 1.00 36.16  ? 84  ALA A CA  1 
ATOM   694  C C   . ALA A 1 84  ? 16.023  -24.773 -14.107 1.00 37.48  ? 84  ALA A C   1 
ATOM   695  O O   . ALA A 1 84  ? 17.196  -25.036 -14.393 1.00 52.42  ? 84  ALA A O   1 
ATOM   696  C CB  . ALA A 1 84  ? 15.830  -23.023 -12.311 1.00 32.97  ? 84  ALA A CB  1 
ATOM   697  N N   . GLN A 1 85  ? 15.101  -25.715 -14.080 1.00 48.70  ? 85  GLN A N   1 
ATOM   698  C CA  . GLN A 1 85  ? 15.322  -27.121 -14.393 1.00 53.03  ? 85  GLN A CA  1 
ATOM   699  C C   . GLN A 1 85  ? 16.154  -27.304 -15.658 1.00 46.01  ? 85  GLN A C   1 
ATOM   700  O O   . GLN A 1 85  ? 17.168  -27.994 -15.695 1.00 58.38  ? 85  GLN A O   1 
ATOM   701  C CB  . GLN A 1 85  ? 13.992  -27.855 -14.604 1.00 51.70  ? 85  GLN A CB  1 
ATOM   702  C CG  . GLN A 1 85  ? 13.243  -28.212 -13.336 1.00 53.53  ? 85  GLN A CG  1 
ATOM   703  C CD  . GLN A 1 85  ? 11.931  -28.918 -13.650 1.00 63.20  ? 85  GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 85  ? 11.701  -30.030 -13.186 1.00 80.33  ? 85  GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 85  ? 11.081  -28.276 -14.440 1.00 61.26  ? 85  GLN A NE2 1 
ATOM   706  N N   . LYS A 1 86  ? 15.677  -26.646 -16.701 1.00 51.60  ? 86  LYS A N   1 
ATOM   707  C CA  . LYS A 1 86  ? 16.285  -26.624 -18.023 1.00 57.00  ? 86  LYS A CA  1 
ATOM   708  C C   . LYS A 1 86  ? 17.767  -26.286 -17.945 1.00 59.49  ? 86  LYS A C   1 
ATOM   709  O O   . LYS A 1 86  ? 18.561  -26.762 -18.756 1.00 78.73  ? 86  LYS A O   1 
ATOM   710  C CB  . LYS A 1 86  ? 15.526  -25.623 -18.897 1.00 61.05  ? 86  LYS A CB  1 
ATOM   711  C CG  . LYS A 1 86  ? 14.074  -25.422 -18.477 1.00 62.74  ? 86  LYS A CG  1 
ATOM   712  C CD  . LYS A 1 86  ? 13.270  -26.705 -18.485 1.00 65.26  ? 86  LYS A CD  1 
ATOM   713  C CE  . LYS A 1 86  ? 11.834  -26.497 -18.039 1.00 66.63  ? 86  LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 86  ? 11.134  -27.784 -17.760 1.00 59.93  ? 86  LYS A NZ  1 
ATOM   715  N N   . LEU A 1 87  ? 18.136  -25.475 -16.960 1.00 56.39  ? 87  LEU A N   1 
ATOM   716  C CA  . LEU A 1 87  ? 19.517  -25.128 -16.679 1.00 54.96  ? 87  LEU A CA  1 
ATOM   717  C C   . LEU A 1 87  ? 20.091  -26.058 -15.606 1.00 54.60  ? 87  LEU A C   1 
ATOM   718  O O   . LEU A 1 87  ? 21.293  -26.304 -15.594 1.00 51.44  ? 87  LEU A O   1 
ATOM   719  C CB  . LEU A 1 87  ? 19.644  -23.678 -16.216 1.00 53.75  ? 87  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 87  ? 19.007  -22.586 -17.071 1.00 45.83  ? 87  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 87  ? 18.793  -21.323 -16.242 1.00 49.49  ? 87  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 87  ? 19.860  -22.272 -18.288 1.00 40.68  ? 87  LEU A CD2 1 
ATOM   723  N N   . GLU A 1 88  ? 19.227  -26.542 -14.740 1.00 61.11  ? 88  GLU A N   1 
ATOM   724  C CA  . GLU A 1 88  ? 19.502  -27.383 -13.589 1.00 68.54  ? 88  GLU A CA  1 
ATOM   725  C C   . GLU A 1 88  ? 20.479  -26.717 -12.617 1.00 65.75  ? 88  GLU A C   1 
ATOM   726  O O   . GLU A 1 88  ? 21.448  -27.348 -12.196 1.00 52.39  ? 88  GLU A O   1 
ATOM   727  C CB  . GLU A 1 88  ? 19.964  -28.765 -13.969 1.00 77.02  ? 88  GLU A CB  1 
ATOM   728  C CG  . GLU A 1 88  ? 21.368  -28.898 -14.524 1.00 77.29  ? 88  GLU A CG  1 
ATOM   729  C CD  . GLU A 1 88  ? 21.704  -30.328 -14.913 1.00 79.34  ? 88  GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 88  ? 20.824  -31.005 -15.485 1.00 83.16  ? 88  GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 88  ? 22.841  -30.762 -14.638 1.00 78.25  ? 88  GLU A OE2 1 
ATOM   732  N N   . LEU A 1 89  ? 20.218  -25.466 -12.273 1.00 68.01  ? 89  LEU A N   1 
ATOM   733  C CA  . LEU A 1 89  ? 21.022  -24.641 -11.392 1.00 69.10  ? 89  LEU A CA  1 
ATOM   734  C C   . LEU A 1 89  ? 21.481  -25.351 -10.130 1.00 62.57  ? 89  LEU A C   1 
ATOM   735  O O   . LEU A 1 89  ? 22.527  -25.022 -9.563  1.00 76.53  ? 89  LEU A O   1 
ATOM   736  C CB  . LEU A 1 89  ? 20.223  -23.408 -10.941 1.00 75.50  ? 89  LEU A CB  1 
ATOM   737  C CG  . LEU A 1 89  ? 20.155  -22.231 -11.909 1.00 79.11  ? 89  LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 89  ? 19.302  -21.119 -11.313 1.00 79.34  ? 89  LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 89  ? 21.553  -21.744 -12.256 1.00 77.36  ? 89  LEU A CD2 1 
ATOM   740  N N   . HIS A 1 90  ? 20.720  -26.336 -9.655  1.00 57.59  ? 90  HIS A N   1 
ATOM   741  C CA  . HIS A 1 90  ? 21.060  -26.991 -8.395  1.00 63.94  ? 90  HIS A CA  1 
ATOM   742  C C   . HIS A 1 90  ? 22.395  -27.725 -8.444  1.00 59.87  ? 90  HIS A C   1 
ATOM   743  O O   . HIS A 1 90  ? 22.911  -28.157 -7.410  1.00 74.93  ? 90  HIS A O   1 
ATOM   744  C CB  . HIS A 1 90  ? 19.941  -27.952 -7.984  1.00 73.69  ? 90  HIS A CB  1 
ATOM   745  C CG  . HIS A 1 90  ? 19.701  -29.108 -8.897  1.00 83.38  ? 90  HIS A CG  1 
ATOM   746  N ND1 . HIS A 1 90  ? 19.623  -28.988 -10.266 1.00 90.56  ? 90  HIS A ND1 1 
ATOM   747  C CD2 . HIS A 1 90  ? 19.515  -30.426 -8.637  1.00 86.12  ? 90  HIS A CD2 1 
ATOM   748  C CE1 . HIS A 1 90  ? 19.400  -30.173 -10.812 1.00 89.28  ? 90  HIS A CE1 1 
ATOM   749  N NE2 . HIS A 1 90  ? 19.332  -31.065 -9.839  1.00 87.89  ? 90  HIS A NE2 1 
ATOM   750  N N   . LYS A 1 91  ? 22.977  -27.885 -9.618  1.00 58.29  ? 91  LYS A N   1 
ATOM   751  C CA  . LYS A 1 91  ? 24.252  -28.542 -9.826  1.00 59.05  ? 91  LYS A CA  1 
ATOM   752  C C   . LYS A 1 91  ? 25.402  -27.554 -9.734  1.00 64.56  ? 91  LYS A C   1 
ATOM   753  O O   . LYS A 1 91  ? 26.568  -27.908 -9.566  1.00 66.83  ? 91  LYS A O   1 
ATOM   754  C CB  . LYS A 1 91  ? 24.254  -29.204 -11.208 1.00 55.38  ? 91  LYS A CB  1 
ATOM   755  C CG  . LYS A 1 91  ? 24.360  -30.718 -11.165 1.00 61.31  ? 91  LYS A CG  1 
ATOM   756  C CD  . LYS A 1 91  ? 23.039  -31.373 -11.537 1.00 61.34  ? 91  LYS A CD  1 
ATOM   757  C CE  . LYS A 1 91  ? 22.224  -31.701 -10.296 1.00 61.00  ? 91  LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 91  ? 22.203  -33.165 -10.027 1.00 61.34  ? 91  LYS A NZ  1 
ATOM   759  N N   . PHE A 1 92  ? 25.078  -26.263 -9.864  1.00 61.75  ? 92  PHE A N   1 
ATOM   760  C CA  . PHE A 1 92  ? 26.172  -25.299 -9.920  1.00 52.69  ? 92  PHE A CA  1 
ATOM   761  C C   . PHE A 1 92  ? 26.152  -24.334 -8.744  1.00 54.12  ? 92  PHE A C   1 
ATOM   762  O O   . PHE A 1 92  ? 27.092  -23.542 -8.629  1.00 48.04  ? 92  PHE A O   1 
ATOM   763  C CB  . PHE A 1 92  ? 26.113  -24.519 -11.230 1.00 52.63  ? 92  PHE A CB  1 
ATOM   764  C CG  . PHE A 1 92  ? 26.005  -25.379 -12.477 1.00 59.94  ? 92  PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 92  ? 24.798  -25.965 -12.826 1.00 67.52  ? 92  PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 92  ? 27.119  -25.578 -13.279 1.00 52.13  ? 92  PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 92  ? 24.687  -26.744 -13.964 1.00 61.26  ? 92  PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 92  ? 27.016  -26.361 -14.415 1.00 58.00  ? 92  PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 92  ? 25.807  -26.941 -14.754 1.00 61.41  ? 92  PHE A CZ  1 
ATOM   770  N N   . ILE A 1 93  ? 25.119  -24.391 -7.905  1.00 47.25  ? 93  ILE A N   1 
ATOM   771  C CA  . ILE A 1 93  ? 25.058  -23.472 -6.767  1.00 43.85  ? 93  ILE A CA  1 
ATOM   772  C C   . ILE A 1 93  ? 26.016  -23.931 -5.676  1.00 51.35  ? 93  ILE A C   1 
ATOM   773  O O   . ILE A 1 93  ? 26.177  -25.133 -5.446  1.00 54.77  ? 93  ILE A O   1 
ATOM   774  C CB  . ILE A 1 93  ? 23.639  -23.360 -6.188  1.00 43.27  ? 93  ILE A CB  1 
ATOM   775  C CG1 . ILE A 1 93  ? 22.697  -22.437 -6.975  1.00 42.15  ? 93  ILE A CG1 1 
ATOM   776  C CG2 . ILE A 1 93  ? 23.677  -22.938 -4.725  1.00 32.20  ? 93  ILE A CG2 1 
ATOM   777  C CD1 . ILE A 1 93  ? 21.347  -23.076 -7.248  1.00 30.61  ? 93  ILE A CD1 1 
ATOM   778  N N   . ARG A 1 94  ? 26.659  -22.992 -4.990  1.00 51.86  ? 94  ARG A N   1 
ATOM   779  C CA  . ARG A 1 94  ? 27.527  -23.356 -3.871  1.00 44.87  ? 94  ARG A CA  1 
ATOM   780  C C   . ARG A 1 94  ? 26.907  -22.941 -2.547  1.00 45.80  ? 94  ARG A C   1 
ATOM   781  O O   . ARG A 1 94  ? 26.713  -21.764 -2.242  1.00 43.51  ? 94  ARG A O   1 
ATOM   782  C CB  . ARG A 1 94  ? 28.900  -22.722 -4.086  1.00 44.50  ? 94  ARG A CB  1 
ATOM   783  C CG  . ARG A 1 94  ? 29.211  -22.521 -5.563  1.00 47.76  ? 94  ARG A CG  1 
ATOM   784  C CD  . ARG A 1 94  ? 30.678  -22.219 -5.798  1.00 51.48  ? 94  ARG A CD  1 
ATOM   785  N NE  . ARG A 1 94  ? 30.899  -20.781 -5.922  1.00 63.65  ? 94  ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 94  ? 32.082  -20.184 -5.953  1.00 65.52  ? 94  ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 94  ? 33.199  -20.898 -5.870  1.00 57.58  ? 94  ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 94  ? 32.146  -18.864 -6.070  1.00 67.48  ? 94  ARG A NH2 1 
ATOM   789  N N   . ILE A 1 95  ? 26.560  -23.921 -1.705  1.00 44.67  ? 95  ILE A N   1 
ATOM   790  C CA  . ILE A 1 95  ? 25.966  -23.502 -0.423  1.00 52.61  ? 95  ILE A CA  1 
ATOM   791  C C   . ILE A 1 95  ? 26.516  -24.346 0.714   1.00 56.47  ? 95  ILE A C   1 
ATOM   792  O O   . ILE A 1 95  ? 27.111  -25.410 0.493   1.00 61.06  ? 95  ILE A O   1 
ATOM   793  C CB  . ILE A 1 95  ? 24.433  -23.537 -0.551  1.00 45.45  ? 95  ILE A CB  1 
ATOM   794  C CG1 . ILE A 1 95  ? 23.666  -23.464 0.771   1.00 48.74  ? 95  ILE A CG1 1 
ATOM   795  C CG2 . ILE A 1 95  ? 24.000  -24.757 -1.347  1.00 48.60  ? 95  ILE A CG2 1 
ATOM   796  C CD1 . ILE A 1 95  ? 22.207  -23.091 0.645   1.00 38.72  ? 95  ILE A CD1 1 
ATOM   797  N N   . LYS A 1 96  ? 26.376  -23.919 1.967   1.00 60.09  ? 96  LYS A N   1 
ATOM   798  C CA  . LYS A 1 96  ? 26.978  -24.655 3.077   1.00 71.52  ? 96  LYS A CA  1 
ATOM   799  C C   . LYS A 1 96  ? 25.975  -25.541 3.811   1.00 78.50  ? 96  LYS A C   1 
ATOM   800  O O   . LYS A 1 96  ? 25.705  -26.667 3.397   1.00 86.32  ? 96  LYS A O   1 
ATOM   801  C CB  . LYS A 1 96  ? 27.618  -23.690 4.083   1.00 75.93  ? 96  LYS A CB  1 
ATOM   802  C CG  . LYS A 1 96  ? 28.368  -24.376 5.218   1.00 78.85  ? 96  LYS A CG  1 
ATOM   803  C CD  . LYS A 1 96  ? 28.691  -23.421 6.352   1.00 83.00  ? 96  LYS A CD  1 
ATOM   804  C CE  . LYS A 1 96  ? 30.106  -22.867 6.240   1.00 82.76  ? 96  LYS A CE  1 
ATOM   805  N NZ  . LYS A 1 96  ? 30.788  -22.758 7.557   1.00 63.64  ? 96  LYS A NZ  1 
ATOM   806  N N   . ARG A 1 97  ? 25.381  -24.973 4.850   1.00 84.89  ? 97  ARG A N   1 
ATOM   807  C CA  . ARG A 1 97  ? 24.512  -25.637 5.805   1.00 87.33  ? 97  ARG A CA  1 
ATOM   808  C C   . ARG A 1 97  ? 23.309  -26.169 5.011   1.00 89.68  ? 97  ARG A C   1 
ATOM   809  O O   . ARG A 1 97  ? 22.511  -25.384 4.529   1.00 89.69  ? 97  ARG A O   1 
ATOM   810  C CB  . ARG A 1 97  ? 24.065  -24.640 6.888   1.00 86.75  ? 97  ARG A CB  1 
ATOM   811  C CG  . ARG A 1 97  ? 25.219  -24.017 7.653   1.00 86.28  ? 97  ARG A CG  1 
ATOM   812  C CD  . ARG A 1 97  ? 25.474  -22.563 7.240   1.00 82.76  ? 97  ARG A CD  1 
ATOM   813  N NE  . ARG A 1 97  ? 26.379  -21.891 8.166   1.00 82.36  ? 97  ARG A NE  1 
ATOM   814  C CZ  . ARG A 1 97  ? 26.478  -20.588 8.371   1.00 83.86  ? 97  ARG A CZ  1 
ATOM   815  N NH1 . ARG A 1 97  ? 25.713  -19.725 7.707   1.00 84.80  ? 97  ARG A NH1 1 
ATOM   816  N NH2 . ARG A 1 97  ? 27.355  -20.121 9.251   1.00 86.23  ? 97  ARG A NH2 1 
ATOM   817  N N   . GLY A 1 98  ? 23.170  -27.498 5.036   1.00 88.57  ? 98  GLY A N   1 
ATOM   818  C CA  . GLY A 1 98  ? 22.159  -28.276 4.371   1.00 92.64  ? 98  GLY A CA  1 
ATOM   819  C C   . GLY A 1 98  ? 20.775  -27.657 4.336   1.00 99.30  ? 98  GLY A C   1 
ATOM   820  O O   . GLY A 1 98  ? 19.872  -28.113 5.042   1.00 101.58 ? 98  GLY A O   1 
ATOM   821  N N   . LYS A 1 99  ? 20.602  -26.634 3.522   1.00 102.18 ? 99  LYS A N   1 
ATOM   822  C CA  . LYS A 1 99  ? 19.350  -25.914 3.334   1.00 103.83 ? 99  LYS A CA  1 
ATOM   823  C C   . LYS A 1 99  ? 19.307  -25.311 1.928   1.00 95.82  ? 99  LYS A C   1 
ATOM   824  O O   . LYS A 1 99  ? 19.273  -24.094 1.752   1.00 93.23  ? 99  LYS A O   1 
ATOM   825  C CB  . LYS A 1 99  ? 19.176  -24.823 4.385   1.00 107.09 ? 99  LYS A CB  1 
ATOM   826  C CG  . LYS A 1 99  ? 17.995  -23.890 4.156   1.00 109.34 ? 99  LYS A CG  1 
ATOM   827  C CD  . LYS A 1 99  ? 17.351  -23.465 5.470   1.00 112.21 ? 99  LYS A CD  1 
ATOM   828  C CE  . LYS A 1 99  ? 18.132  -22.345 6.146   1.00 115.73 ? 99  LYS A CE  1 
ATOM   829  N NZ  . LYS A 1 99  ? 17.818  -22.207 7.600   1.00 117.68 ? 99  LYS A NZ  1 
ATOM   830  N N   . ILE A 1 100 ? 19.319  -26.195 0.933   1.00 85.46  ? 100 ILE A N   1 
ATOM   831  C CA  . ILE A 1 100 ? 19.346  -25.746 -0.463  1.00 73.27  ? 100 ILE A CA  1 
ATOM   832  C C   . ILE A 1 100 ? 17.990  -25.181 -0.857  1.00 74.59  ? 100 ILE A C   1 
ATOM   833  O O   . ILE A 1 100 ? 17.943  -24.062 -1.386  1.00 86.79  ? 100 ILE A O   1 
ATOM   834  C CB  . ILE A 1 100 ? 19.839  -26.879 -1.382  1.00 59.84  ? 100 ILE A CB  1 
ATOM   835  C CG1 . ILE A 1 100 ? 20.442  -26.384 -2.702  1.00 62.32  ? 100 ILE A CG1 1 
ATOM   836  C CG2 . ILE A 1 100 ? 18.762  -27.913 -1.658  1.00 58.03  ? 100 ILE A CG2 1 
ATOM   837  C CD1 . ILE A 1 100 ? 19.414  -25.961 -3.728  1.00 64.14  ? 100 ILE A CD1 1 
ATOM   838  N N   . ASN A 1 101 ? 16.819  -25.759 -0.492  1.00 66.64  ? 101 ASN A N   1 
ATOM   839  C CA  . ASN A 1 101 ? 15.477  -25.254 -0.805  1.00 61.98  ? 101 ASN A CA  1 
ATOM   840  C C   . ASN A 1 101 ? 15.222  -24.974 -2.300  1.00 65.43  ? 101 ASN A C   1 
ATOM   841  O O   . ASN A 1 101 ? 16.092  -24.750 -3.143  1.00 72.19  ? 101 ASN A O   1 
ATOM   842  C CB  . ASN A 1 101 ? 15.459  -23.922 -0.037  1.00 62.31  ? 101 ASN A CB  1 
ATOM   843  C CG  . ASN A 1 101 ? 15.526  -24.154 1.478   1.00 68.42  ? 101 ASN A CG  1 
ATOM   844  O OD1 . ASN A 1 101 ? 15.050  -23.322 2.250   1.00 84.83  ? 101 ASN A OD1 1 
ATOM   845  N ND2 . ASN A 1 101 ? 16.071  -25.292 1.898   1.00 68.31  ? 101 ASN A ND2 1 
ATOM   846  N N   . GLU A 1 102 ? 13.934  -24.718 -2.540  1.00 61.55  ? 102 GLU A N   1 
ATOM   847  C CA  . GLU A 1 102 ? 13.457  -24.340 -3.868  1.00 50.65  ? 102 GLU A CA  1 
ATOM   848  C C   . GLU A 1 102 ? 13.443  -22.820 -3.983  1.00 41.80  ? 102 GLU A C   1 
ATOM   849  O O   . GLU A 1 102 ? 13.568  -22.244 -5.062  1.00 41.02  ? 102 GLU A O   1 
ATOM   850  C CB  . GLU A 1 102 ? 12.071  -24.912 -4.164  1.00 57.75  ? 102 GLU A CB  1 
ATOM   851  C CG  . GLU A 1 102 ? 11.920  -26.404 -3.918  1.00 65.65  ? 102 GLU A CG  1 
ATOM   852  C CD  . GLU A 1 102 ? 10.530  -26.933 -4.213  1.00 74.11  ? 102 GLU A CD  1 
ATOM   853  O OE1 . GLU A 1 102 ? 9.571   -26.569 -3.505  1.00 77.28  ? 102 GLU A OE1 1 
ATOM   854  O OE2 . GLU A 1 102 ? 10.376  -27.737 -5.163  1.00 94.36  ? 102 GLU A OE2 1 
ATOM   855  N N   . THR A 1 103 ? 13.283  -22.153 -2.840  1.00 44.60  ? 103 THR A N   1 
ATOM   856  C CA  . THR A 1 103 ? 13.382  -20.690 -2.870  1.00 51.40  ? 103 THR A CA  1 
ATOM   857  C C   . THR A 1 103 ? 14.809  -20.248 -3.167  1.00 52.40  ? 103 THR A C   1 
ATOM   858  O O   . THR A 1 103 ? 15.048  -19.206 -3.793  1.00 43.30  ? 103 THR A O   1 
ATOM   859  C CB  . THR A 1 103 ? 12.838  -20.089 -1.560  1.00 55.16  ? 103 THR A CB  1 
ATOM   860  O OG1 . THR A 1 103 ? 13.793  -19.191 -0.983  1.00 57.73  ? 103 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 103 ? 12.577  -21.197 -0.551  1.00 56.06  ? 103 THR A CG2 1 
ATOM   862  N N   . ILE A 1 104 ? 15.820  -21.022 -2.765  1.00 47.60  ? 104 ILE A N   1 
ATOM   863  C CA  . ILE A 1 104 ? 17.192  -20.621 -3.114  1.00 44.75  ? 104 ILE A CA  1 
ATOM   864  C C   . ILE A 1 104 ? 17.403  -20.719 -4.621  1.00 39.04  ? 104 ILE A C   1 
ATOM   865  O O   . ILE A 1 104 ? 17.886  -19.775 -5.255  1.00 40.08  ? 104 ILE A O   1 
ATOM   866  C CB  . ILE A 1 104 ? 18.219  -21.439 -2.316  1.00 42.90  ? 104 ILE A CB  1 
ATOM   867  C CG1 . ILE A 1 104 ? 18.552  -20.824 -0.948  1.00 48.09  ? 104 ILE A CG1 1 
ATOM   868  C CG2 . ILE A 1 104 ? 19.502  -21.676 -3.087  1.00 33.10  ? 104 ILE A CG2 1 
ATOM   869  C CD1 . ILE A 1 104 ? 18.822  -21.870 0.115   1.00 60.98  ? 104 ILE A CD1 1 
ATOM   870  N N   . ILE A 1 105 ? 17.040  -21.829 -5.248  1.00 40.87  ? 105 ILE A N   1 
ATOM   871  C CA  . ILE A 1 105 ? 17.126  -21.972 -6.698  1.00 38.90  ? 105 ILE A CA  1 
ATOM   872  C C   . ILE A 1 105 ? 16.491  -20.807 -7.449  1.00 34.04  ? 105 ILE A C   1 
ATOM   873  O O   . ILE A 1 105 ? 17.009  -20.370 -8.479  1.00 33.21  ? 105 ILE A O   1 
ATOM   874  C CB  . ILE A 1 105 ? 16.436  -23.277 -7.153  1.00 40.88  ? 105 ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 105 ? 17.160  -24.533 -6.671  1.00 42.71  ? 105 ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 105 ? 16.253  -23.299 -8.660  1.00 36.72  ? 105 ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 105 ? 16.403  -25.817 -6.883  1.00 36.66  ? 105 ILE A CD1 1 
ATOM   878  N N   . GLY A 1 106 ? 15.367  -20.310 -6.947  1.00 29.40  ? 106 GLY A N   1 
ATOM   879  C CA  . GLY A 1 106 ? 14.740  -19.123 -7.497  1.00 33.76  ? 106 GLY A CA  1 
ATOM   880  C C   . GLY A 1 106 ? 15.591  -17.879 -7.275  1.00 32.06  ? 106 GLY A C   1 
ATOM   881  O O   . GLY A 1 106 ? 15.665  -17.002 -8.138  1.00 37.00  ? 106 GLY A O   1 
ATOM   882  N N   . ASP A 1 107 ? 16.239  -17.781 -6.118  1.00 24.61  ? 107 ASP A N   1 
ATOM   883  C CA  . ASP A 1 107 ? 17.088  -16.652 -5.793  1.00 26.68  ? 107 ASP A CA  1 
ATOM   884  C C   . ASP A 1 107 ? 18.207  -16.539 -6.833  1.00 35.37  ? 107 ASP A C   1 
ATOM   885  O O   . ASP A 1 107 ? 18.423  -15.488 -7.429  1.00 26.76  ? 107 ASP A O   1 
ATOM   886  C CB  . ASP A 1 107 ? 17.698  -16.816 -4.409  1.00 35.05  ? 107 ASP A CB  1 
ATOM   887  C CG  . ASP A 1 107 ? 16.758  -16.676 -3.233  1.00 46.53  ? 107 ASP A CG  1 
ATOM   888  O OD1 . ASP A 1 107 ? 15.693  -16.028 -3.312  1.00 36.76  ? 107 ASP A OD1 1 
ATOM   889  O OD2 . ASP A 1 107 ? 17.110  -17.246 -2.168  1.00 52.02  ? 107 ASP A OD2 1 
ATOM   890  N N   . VAL A 1 108 ? 18.875  -17.672 -7.000  1.00 37.05  ? 108 VAL A N   1 
ATOM   891  C CA  . VAL A 1 108 ? 19.997  -17.905 -7.882  1.00 28.96  ? 108 VAL A CA  1 
ATOM   892  C C   . VAL A 1 108 ? 19.618  -17.715 -9.341  1.00 31.00  ? 108 VAL A C   1 
ATOM   893  O O   . VAL A 1 108 ? 20.367  -17.145 -10.134 1.00 34.49  ? 108 VAL A O   1 
ATOM   894  C CB  . VAL A 1 108 ? 20.557  -19.336 -7.728  1.00 36.89  ? 108 VAL A CB  1 
ATOM   895  C CG1 . VAL A 1 108 ? 21.468  -19.639 -8.910  1.00 44.89  ? 108 VAL A CG1 1 
ATOM   896  C CG2 . VAL A 1 108 ? 21.277  -19.502 -6.397  1.00 28.39  ? 108 VAL A CG2 1 
ATOM   897  N N   . PHE A 1 109 ? 18.431  -18.221 -9.672  1.00 28.30  ? 109 PHE A N   1 
ATOM   898  C CA  . PHE A 1 109 ? 17.914  -18.022 -11.021 1.00 28.77  ? 109 PHE A CA  1 
ATOM   899  C C   . PHE A 1 109 ? 17.768  -16.534 -11.311 1.00 30.06  ? 109 PHE A C   1 
ATOM   900  O O   . PHE A 1 109 ? 18.117  -16.033 -12.376 1.00 29.72  ? 109 PHE A O   1 
ATOM   901  C CB  . PHE A 1 109 ? 16.573  -18.728 -11.173 1.00 25.86  ? 109 PHE A CB  1 
ATOM   902  C CG  . PHE A 1 109 ? 15.944  -18.576 -12.547 1.00 22.97  ? 109 PHE A CG  1 
ATOM   903  C CD1 . PHE A 1 109 ? 16.342  -19.418 -13.572 1.00 27.09  ? 109 PHE A CD1 1 
ATOM   904  C CD2 . PHE A 1 109 ? 14.979  -17.617 -12.796 1.00 19.63  ? 109 PHE A CD2 1 
ATOM   905  C CE1 . PHE A 1 109 ? 15.783  -19.317 -14.835 1.00 33.00  ? 109 PHE A CE1 1 
ATOM   906  C CE2 . PHE A 1 109 ? 14.411  -17.518 -14.055 1.00 32.61  ? 109 PHE A CE2 1 
ATOM   907  C CZ  . PHE A 1 109 ? 14.811  -18.367 -15.077 1.00 28.56  ? 109 PHE A CZ  1 
ATOM   908  N N   . GLU A 1 110 ? 17.240  -15.796 -10.330 1.00 24.85  ? 110 GLU A N   1 
ATOM   909  C CA  . GLU A 1 110 ? 17.133  -14.348 -10.526 1.00 26.48  ? 110 GLU A CA  1 
ATOM   910  C C   . GLU A 1 110 ? 18.522  -13.719 -10.562 1.00 29.70  ? 110 GLU A C   1 
ATOM   911  O O   . GLU A 1 110 ? 18.818  -12.842 -11.378 1.00 32.87  ? 110 GLU A O   1 
ATOM   912  C CB  . GLU A 1 110 ? 16.271  -13.714 -9.434  1.00 24.42  ? 110 GLU A CB  1 
ATOM   913  C CG  . GLU A 1 110 ? 14.813  -14.163 -9.430  1.00 32.58  ? 110 GLU A CG  1 
ATOM   914  C CD  . GLU A 1 110 ? 14.127  -13.931 -8.094  1.00 40.41  ? 110 GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 110 ? 14.581  -13.058 -7.329  1.00 45.94  ? 110 GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 110 ? 13.127  -14.606 -7.778  1.00 46.01  ? 110 GLU A OE2 1 
ATOM   917  N N   . ALA A 1 111 ? 19.415  -14.160 -9.678  1.00 30.35  ? 111 ALA A N   1 
ATOM   918  C CA  . ALA A 1 111 ? 20.767  -13.600 -9.655  1.00 30.24  ? 111 ALA A CA  1 
ATOM   919  C C   . ALA A 1 111 ? 21.515  -13.865 -10.957 1.00 29.25  ? 111 ALA A C   1 
ATOM   920  O O   . ALA A 1 111 ? 22.216  -12.985 -11.466 1.00 33.74  ? 111 ALA A O   1 
ATOM   921  C CB  . ALA A 1 111 ? 21.552  -14.159 -8.477  1.00 32.73  ? 111 ALA A CB  1 
ATOM   922  N N   . LEU A 1 112 ? 21.365  -15.076 -11.479 1.00 27.32  ? 112 LEU A N   1 
ATOM   923  C CA  . LEU A 1 112 ? 21.965  -15.488 -12.742 1.00 30.09  ? 112 LEU A CA  1 
ATOM   924  C C   . LEU A 1 112 ? 21.653  -14.526 -13.878 1.00 31.40  ? 112 LEU A C   1 
ATOM   925  O O   . LEU A 1 112 ? 22.535  -14.154 -14.655 1.00 27.35  ? 112 LEU A O   1 
ATOM   926  C CB  . LEU A 1 112 ? 21.471  -16.899 -13.089 1.00 34.99  ? 112 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 112 ? 22.067  -17.495 -14.367 1.00 41.94  ? 112 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 112 ? 23.580  -17.560 -14.269 1.00 30.38  ? 112 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 112 ? 21.491  -18.875 -14.643 1.00 52.47  ? 112 LEU A CD2 1 
ATOM   930  N N   . TRP A 1 113 ? 20.395  -14.092 -14.004 1.00 33.10  ? 113 TRP A N   1 
ATOM   931  C CA  . TRP A 1 113 ? 20.023  -13.211 -15.116 1.00 31.48  ? 113 TRP A CA  1 
ATOM   932  C C   . TRP A 1 113 ? 20.569  -11.810 -14.912 1.00 32.19  ? 113 TRP A C   1 
ATOM   933  O O   . TRP A 1 113 ? 20.957  -11.133 -15.865 1.00 37.54  ? 113 TRP A O   1 
ATOM   934  C CB  . TRP A 1 113 ? 18.491  -13.226 -15.325 1.00 31.62  ? 113 TRP A CB  1 
ATOM   935  C CG  . TRP A 1 113 ? 18.200  -14.544 -16.009 1.00 30.40  ? 113 TRP A CG  1 
ATOM   936  C CD1 . TRP A 1 113 ? 17.659  -15.676 -15.485 1.00 24.37  ? 113 TRP A CD1 1 
ATOM   937  C CD2 . TRP A 1 113 ? 18.472  -14.822 -17.385 1.00 32.88  ? 113 TRP A CD2 1 
ATOM   938  N NE1 . TRP A 1 113 ? 17.572  -16.652 -16.450 1.00 26.68  ? 113 TRP A NE1 1 
ATOM   939  C CE2 . TRP A 1 113 ? 18.064  -16.150 -17.624 1.00 35.43  ? 113 TRP A CE2 1 
ATOM   940  C CE3 . TRP A 1 113 ? 19.020  -14.063 -18.419 1.00 28.66  ? 113 TRP A CE3 1 
ATOM   941  C CZ2 . TRP A 1 113 ? 18.184  -16.752 -18.876 1.00 34.05  ? 113 TRP A CZ2 1 
ATOM   942  C CZ3 . TRP A 1 113 ? 19.137  -14.665 -19.657 1.00 26.68  ? 113 TRP A CZ3 1 
ATOM   943  C CH2 . TRP A 1 113 ? 18.723  -15.982 -19.872 1.00 29.96  ? 113 TRP A CH2 1 
ATOM   944  N N   . ALA A 1 114 ? 20.614  -11.389 -13.651 1.00 23.60  ? 114 ALA A N   1 
ATOM   945  C CA  . ALA A 1 114 ? 21.307  -10.155 -13.314 1.00 29.53  ? 114 ALA A CA  1 
ATOM   946  C C   . ALA A 1 114 ? 22.788  -10.238 -13.674 1.00 32.77  ? 114 ALA A C   1 
ATOM   947  O O   . ALA A 1 114 ? 23.427  -9.249  -14.032 1.00 39.94  ? 114 ALA A O   1 
ATOM   948  C CB  . ALA A 1 114 ? 21.170  -9.861  -11.826 1.00 44.78  ? 114 ALA A CB  1 
ATOM   949  N N   . ALA A 1 115 ? 23.347  -11.441 -13.550 1.00 34.77  ? 115 ALA A N   1 
ATOM   950  C CA  . ALA A 1 115 ? 24.767  -11.633 -13.854 1.00 39.10  ? 115 ALA A CA  1 
ATOM   951  C C   . ALA A 1 115 ? 25.001  -11.580 -15.358 1.00 32.49  ? 115 ALA A C   1 
ATOM   952  O O   . ALA A 1 115 ? 25.965  -11.007 -15.862 1.00 34.76  ? 115 ALA A O   1 
ATOM   953  C CB  . ALA A 1 115 ? 25.262  -12.939 -13.263 1.00 33.64  ? 115 ALA A CB  1 
ATOM   954  N N   . VAL A 1 116 ? 24.082  -12.189 -16.101 1.00 25.67  ? 116 VAL A N   1 
ATOM   955  C CA  . VAL A 1 116 ? 24.193  -12.123 -17.558 1.00 32.80  ? 116 VAL A CA  1 
ATOM   956  C C   . VAL A 1 116 ? 24.065  -10.696 -18.076 1.00 38.20  ? 116 VAL A C   1 
ATOM   957  O O   . VAL A 1 116 ? 24.813  -10.259 -18.952 1.00 39.55  ? 116 VAL A O   1 
ATOM   958  C CB  . VAL A 1 116 ? 23.125  -13.031 -18.186 1.00 28.04  ? 116 VAL A CB  1 
ATOM   959  C CG1 . VAL A 1 116 ? 23.142  -12.889 -19.698 1.00 46.59  ? 116 VAL A CG1 1 
ATOM   960  C CG2 . VAL A 1 116 ? 23.375  -14.458 -17.724 1.00 19.07  ? 116 VAL A CG2 1 
ATOM   961  N N   . TYR A 1 117 ? 23.122  -9.954  -17.527 1.00 38.85  ? 117 TYR A N   1 
ATOM   962  C CA  . TYR A 1 117 ? 22.880  -8.550  -17.833 1.00 35.18  ? 117 TYR A CA  1 
ATOM   963  C C   . TYR A 1 117 ? 24.145  -7.726  -17.680 1.00 38.41  ? 117 TYR A C   1 
ATOM   964  O O   . TYR A 1 117 ? 24.569  -7.028  -18.599 1.00 55.05  ? 117 TYR A O   1 
ATOM   965  C CB  . TYR A 1 117 ? 21.786  -8.020  -16.906 1.00 29.18  ? 117 TYR A CB  1 
ATOM   966  C CG  . TYR A 1 117 ? 21.445  -6.556  -17.004 1.00 30.77  ? 117 TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 117 ? 21.197  -5.965  -18.234 1.00 35.79  ? 117 TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 117 ? 21.358  -5.750  -15.874 1.00 34.25  ? 117 TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 117 ? 20.880  -4.620  -18.323 1.00 38.23  ? 117 TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 117 ? 21.045  -4.404  -15.951 1.00 38.37  ? 117 TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 117 ? 20.808  -3.843  -17.190 1.00 38.33  ? 117 TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 117 ? 20.489  -2.516  -17.323 1.00 28.23  ? 117 TYR A OH  1 
ATOM   973  N N   . ILE A 1 118 ? 24.741  -7.820  -16.492 1.00 37.21  ? 118 ILE A N   1 
ATOM   974  C CA  . ILE A 1 118 ? 25.906  -6.999  -16.184 1.00 34.66  ? 118 ILE A CA  1 
ATOM   975  C C   . ILE A 1 118 ? 27.104  -7.452  -17.009 1.00 28.09  ? 118 ILE A C   1 
ATOM   976  O O   . ILE A 1 118 ? 27.781  -6.610  -17.593 1.00 37.32  ? 118 ILE A O   1 
ATOM   977  C CB  . ILE A 1 118 ? 26.291  -7.029  -14.699 1.00 35.84  ? 118 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 118 ? 25.152  -6.749  -13.722 1.00 40.52  ? 118 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 118 ? 27.443  -6.063  -14.452 1.00 44.34  ? 118 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 118 ? 25.633  -6.692  -12.285 1.00 33.69  ? 118 ILE A CD1 1 
ATOM   981  N N   . ASP A 1 119 ? 27.343  -8.757  -17.061 1.00 30.50  ? 119 ASP A N   1 
ATOM   982  C CA  . ASP A 1 119 ? 28.434  -9.304  -17.853 1.00 37.21  ? 119 ASP A CA  1 
ATOM   983  C C   . ASP A 1 119 ? 28.249  -9.028  -19.348 1.00 52.95  ? 119 ASP A C   1 
ATOM   984  O O   . ASP A 1 119 ? 29.202  -9.201  -20.118 1.00 45.44  ? 119 ASP A O   1 
ATOM   985  C CB  . ASP A 1 119 ? 28.565  -10.809 -17.645 1.00 43.42  ? 119 ASP A CB  1 
ATOM   986  C CG  . ASP A 1 119 ? 29.693  -11.430 -18.443 1.00 49.15  ? 119 ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 119 ? 29.609  -11.449 -19.686 1.00 57.73  ? 119 ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 119 ? 30.673  -11.913 -17.833 1.00 62.93  ? 119 ASP A OD2 1 
ATOM   989  N N   . SER A 1 120 ? 27.057  -8.621  -19.763 1.00 48.30  ? 120 SER A N   1 
ATOM   990  C CA  . SER A 1 120 ? 26.758  -8.323  -21.151 1.00 49.01  ? 120 SER A CA  1 
ATOM   991  C C   . SER A 1 120 ? 27.034  -6.859  -21.477 1.00 46.39  ? 120 SER A C   1 
ATOM   992  O O   . SER A 1 120 ? 26.899  -6.444  -22.624 1.00 42.05  ? 120 SER A O   1 
ATOM   993  C CB  . SER A 1 120 ? 25.279  -8.589  -21.483 1.00 42.52  ? 120 SER A CB  1 
ATOM   994  O OG  . SER A 1 120 ? 24.545  -7.394  -21.242 1.00 32.65  ? 120 SER A OG  1 
ATOM   995  N N   . GLY A 1 121 ? 27.383  -6.105  -20.442 1.00 45.81  ? 121 GLY A N   1 
ATOM   996  C CA  . GLY A 1 121 ? 27.577  -4.666  -20.568 1.00 28.85  ? 121 GLY A CA  1 
ATOM   997  C C   . GLY A 1 121 ? 26.274  -3.951  -20.286 1.00 33.91  ? 121 GLY A C   1 
ATOM   998  O O   . GLY A 1 121 ? 25.951  -2.909  -20.855 1.00 54.12  ? 121 GLY A O   1 
ATOM   999  N N   . ARG A 1 122 ? 25.508  -4.556  -19.383 1.00 36.86  ? 122 ARG A N   1 
ATOM   1000 C CA  . ARG A 1 122 ? 24.186  -4.012  -19.073 1.00 33.38  ? 122 ARG A CA  1 
ATOM   1001 C C   . ARG A 1 122 ? 23.352  -3.808  -20.331 1.00 35.91  ? 122 ARG A C   1 
ATOM   1002 O O   . ARG A 1 122 ? 22.668  -2.801  -20.504 1.00 30.60  ? 122 ARG A O   1 
ATOM   1003 C CB  . ARG A 1 122 ? 24.369  -2.727  -18.266 1.00 31.17  ? 122 ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 122 ? 24.750  -2.997  -16.803 1.00 33.97  ? 122 ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 122 ? 24.565  -1.747  -15.966 1.00 35.80  ? 122 ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 122 ? 23.978  -1.948  -14.645 1.00 35.95  ? 122 ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 122 ? 24.644  -2.528  -13.651 1.00 41.82  ? 122 ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 122 ? 25.884  -2.930  -13.907 1.00 31.66  ? 122 ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 122 ? 24.100  -2.702  -12.452 1.00 40.01  ? 122 ARG A NH2 1 
ATOM   1010 N N   . ASP A 1 123 ? 23.351  -4.787  -21.231 1.00 38.89  ? 123 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 123 ? 22.539  -4.716  -22.451 1.00 40.44  ? 123 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 123 ? 21.229  -5.448  -22.217 1.00 35.13  ? 123 ASP A C   1 
ATOM   1013 O O   . ASP A 1 123 ? 21.167  -6.678  -22.179 1.00 29.74  ? 123 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 123 ? 23.345  -5.284  -23.611 1.00 44.05  ? 123 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 123 ? 22.637  -5.381  -24.941 1.00 50.71  ? 123 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 123 ? 21.397  -5.267  -25.005 1.00 44.50  ? 123 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 123 ? 23.337  -5.586  -25.962 1.00 39.55  ? 123 ASP A OD2 1 
ATOM   1018 N N   . ALA A 1 124 ? 20.129  -4.722  -22.023 1.00 37.99  ? 124 ALA A N   1 
ATOM   1019 C CA  . ALA A 1 124 ? 18.884  -5.396  -21.655 1.00 31.40  ? 124 ALA A CA  1 
ATOM   1020 C C   . ALA A 1 124 ? 18.217  -6.096  -22.828 1.00 31.37  ? 124 ALA A C   1 
ATOM   1021 O O   . ALA A 1 124 ? 17.586  -7.142  -22.617 1.00 27.52  ? 124 ALA A O   1 
ATOM   1022 C CB  . ALA A 1 124 ? 17.905  -4.411  -21.036 1.00 24.01  ? 124 ALA A CB  1 
ATOM   1023 N N   . ASN A 1 125 ? 18.357  -5.518  -24.022 1.00 34.84  ? 125 ASN A N   1 
ATOM   1024 C CA  . ASN A 1 125 ? 17.759  -6.147  -25.209 1.00 32.76  ? 125 ASN A CA  1 
ATOM   1025 C C   . ASN A 1 125 ? 18.340  -7.542  -25.414 1.00 29.13  ? 125 ASN A C   1 
ATOM   1026 O O   . ASN A 1 125 ? 17.612  -8.528  -25.511 1.00 44.20  ? 125 ASN A O   1 
ATOM   1027 C CB  . ASN A 1 125 ? 17.963  -5.276  -26.450 1.00 32.25  ? 125 ASN A CB  1 
ATOM   1028 C CG  . ASN A 1 125 ? 17.335  -3.902  -26.338 1.00 36.56  ? 125 ASN A CG  1 
ATOM   1029 O OD1 . ASN A 1 125 ? 16.251  -3.725  -25.780 1.00 41.55  ? 125 ASN A OD1 1 
ATOM   1030 N ND2 . ASN A 1 125 ? 18.030  -2.899  -26.874 1.00 30.94  ? 125 ASN A ND2 1 
ATOM   1031 N N   . PHE A 1 126 ? 19.667  -7.634  -25.463 1.00 39.61  ? 126 PHE A N   1 
ATOM   1032 C CA  . PHE A 1 126 ? 20.357  -8.906  -25.637 1.00 43.69  ? 126 PHE A CA  1 
ATOM   1033 C C   . PHE A 1 126 ? 19.923  -9.915  -24.580 1.00 39.08  ? 126 PHE A C   1 
ATOM   1034 O O   . PHE A 1 126 ? 19.579  -11.056 -24.870 1.00 43.61  ? 126 PHE A O   1 
ATOM   1035 C CB  . PHE A 1 126 ? 21.872  -8.728  -25.541 1.00 49.43  ? 126 PHE A CB  1 
ATOM   1036 C CG  . PHE A 1 126 ? 22.683  -10.003 -25.386 1.00 49.12  ? 126 PHE A CG  1 
ATOM   1037 C CD1 . PHE A 1 126 ? 23.003  -10.750 -26.506 1.00 47.41  ? 126 PHE A CD1 1 
ATOM   1038 C CD2 . PHE A 1 126 ? 23.140  -10.449 -24.155 1.00 48.71  ? 126 PHE A CD2 1 
ATOM   1039 C CE1 . PHE A 1 126 ? 23.756  -11.901 -26.407 1.00 46.82  ? 126 PHE A CE1 1 
ATOM   1040 C CE2 . PHE A 1 126 ? 23.877  -11.612 -24.042 1.00 49.11  ? 126 PHE A CE2 1 
ATOM   1041 C CZ  . PHE A 1 126 ? 24.185  -12.343 -25.172 1.00 47.51  ? 126 PHE A CZ  1 
ATOM   1042 N N   . THR A 1 127 ? 20.000  -9.440  -23.340 1.00 37.91  ? 127 THR A N   1 
ATOM   1043 C CA  . THR A 1 127 ? 19.670  -10.275 -22.185 1.00 37.55  ? 127 THR A CA  1 
ATOM   1044 C C   . THR A 1 127 ? 18.200  -10.654 -22.229 1.00 33.65  ? 127 THR A C   1 
ATOM   1045 O O   . THR A 1 127 ? 17.821  -11.788 -21.932 1.00 31.33  ? 127 THR A O   1 
ATOM   1046 C CB  . THR A 1 127 ? 20.027  -9.541  -20.879 1.00 31.98  ? 127 THR A CB  1 
ATOM   1047 O OG1 . THR A 1 127 ? 21.436  -9.273  -20.902 1.00 35.56  ? 127 THR A OG1 1 
ATOM   1048 C CG2 . THR A 1 127 ? 19.745  -10.408 -19.665 1.00 21.56  ? 127 THR A CG2 1 
ATOM   1049 N N   . ARG A 1 128 ? 17.375  -9.685  -22.631 1.00 30.64  ? 128 ARG A N   1 
ATOM   1050 C CA  . ARG A 1 128 ? 15.955  -9.975  -22.778 1.00 30.61  ? 128 ARG A CA  1 
ATOM   1051 C C   . ARG A 1 128 ? 15.736  -11.096 -23.791 1.00 32.05  ? 128 ARG A C   1 
ATOM   1052 O O   . ARG A 1 128 ? 15.065  -12.088 -23.523 1.00 40.04  ? 128 ARG A O   1 
ATOM   1053 C CB  . ARG A 1 128 ? 15.180  -8.747  -23.259 1.00 26.81  ? 128 ARG A CB  1 
ATOM   1054 C CG  . ARG A 1 128 ? 13.714  -9.076  -23.518 1.00 30.02  ? 128 ARG A CG  1 
ATOM   1055 C CD  . ARG A 1 128 ? 13.003  -7.864  -24.116 1.00 26.87  ? 128 ARG A CD  1 
ATOM   1056 N NE  . ARG A 1 128 ? 13.502  -7.631  -25.463 1.00 30.51  ? 128 ARG A NE  1 
ATOM   1057 C CZ  . ARG A 1 128 ? 13.679  -6.448  -26.025 1.00 37.12  ? 128 ARG A CZ  1 
ATOM   1058 N NH1 . ARG A 1 128 ? 13.397  -5.339  -25.356 1.00 33.63  ? 128 ARG A NH1 1 
ATOM   1059 N NH2 . ARG A 1 128 ? 14.149  -6.395  -27.264 1.00 43.61  ? 128 ARG A NH2 1 
ATOM   1060 N N   . GLU A 1 129 ? 16.321  -10.897 -24.970 1.00 30.79  ? 129 GLU A N   1 
ATOM   1061 C CA  . GLU A 1 129 ? 16.200  -11.874 -26.053 1.00 28.86  ? 129 GLU A CA  1 
ATOM   1062 C C   . GLU A 1 129 ? 16.837  -13.203 -25.698 1.00 33.01  ? 129 GLU A C   1 
ATOM   1063 O O   . GLU A 1 129 ? 16.422  -14.272 -26.159 1.00 43.47  ? 129 GLU A O   1 
ATOM   1064 C CB  . GLU A 1 129 ? 16.816  -11.265 -27.323 1.00 36.48  ? 129 GLU A CB  1 
ATOM   1065 C CG  . GLU A 1 129 ? 16.030  -10.050 -27.811 1.00 43.35  ? 129 GLU A CG  1 
ATOM   1066 C CD  . GLU A 1 129 ? 14.538  -10.329 -27.859 1.00 48.82  ? 129 GLU A CD  1 
ATOM   1067 O OE1 . GLU A 1 129 ? 14.129  -11.231 -28.625 1.00 43.53  ? 129 GLU A OE1 1 
ATOM   1068 O OE2 . GLU A 1 129 ? 13.779  -9.652  -27.136 1.00 58.32  ? 129 GLU A OE2 1 
ATOM   1069 N N   . LEU A 1 130 ? 17.868  -13.197 -24.846 1.00 39.03  ? 130 LEU A N   1 
ATOM   1070 C CA  . LEU A 1 130 ? 18.435  -14.494 -24.451 1.00 42.51  ? 130 LEU A CA  1 
ATOM   1071 C C   . LEU A 1 130 ? 17.472  -15.232 -23.529 1.00 36.68  ? 130 LEU A C   1 
ATOM   1072 O O   . LEU A 1 130 ? 17.270  -16.440 -23.616 1.00 52.13  ? 130 LEU A O   1 
ATOM   1073 C CB  . LEU A 1 130 ? 19.800  -14.308 -23.791 1.00 37.70  ? 130 LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 130 ? 20.864  -15.351 -24.122 1.00 45.91  ? 130 LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 130 ? 21.685  -15.690 -22.886 1.00 55.06  ? 130 LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 130 ? 20.231  -16.604 -24.705 1.00 46.25  ? 130 LEU A CD2 1 
ATOM   1077 N N   . PHE A 1 131 ? 16.844  -14.491 -22.620 1.00 38.11  ? 131 PHE A N   1 
ATOM   1078 C CA  . PHE A 1 131 ? 15.824  -15.089 -21.752 1.00 33.53  ? 131 PHE A CA  1 
ATOM   1079 C C   . PHE A 1 131 ? 14.699  -15.667 -22.602 1.00 32.66  ? 131 PHE A C   1 
ATOM   1080 O O   . PHE A 1 131 ? 14.132  -16.722 -22.304 1.00 31.02  ? 131 PHE A O   1 
ATOM   1081 C CB  . PHE A 1 131 ? 15.360  -14.021 -20.774 1.00 29.25  ? 131 PHE A CB  1 
ATOM   1082 C CG  . PHE A 1 131 ? 14.407  -14.402 -19.656 1.00 34.94  ? 131 PHE A CG  1 
ATOM   1083 C CD1 . PHE A 1 131 ? 14.882  -14.825 -18.423 1.00 29.20  ? 131 PHE A CD1 1 
ATOM   1084 C CD2 . PHE A 1 131 ? 13.032  -14.329 -19.830 1.00 25.18  ? 131 PHE A CD2 1 
ATOM   1085 C CE1 . PHE A 1 131 ? 14.026  -15.171 -17.393 1.00 30.17  ? 131 PHE A CE1 1 
ATOM   1086 C CE2 . PHE A 1 131 ? 12.171  -14.673 -18.807 1.00 19.14  ? 131 PHE A CE2 1 
ATOM   1087 C CZ  . PHE A 1 131 ? 12.659  -15.089 -17.582 1.00 20.08  ? 131 PHE A CZ  1 
ATOM   1088 N N   . TYR A 1 132 ? 14.348  -14.981 -23.693 1.00 33.40  ? 132 TYR A N   1 
ATOM   1089 C CA  . TYR A 1 132 ? 13.210  -15.386 -24.513 1.00 33.88  ? 132 TYR A CA  1 
ATOM   1090 C C   . TYR A 1 132 ? 13.493  -16.658 -25.302 1.00 31.49  ? 132 TYR A C   1 
ATOM   1091 O O   . TYR A 1 132 ? 12.619  -17.502 -25.484 1.00 38.66  ? 132 TYR A O   1 
ATOM   1092 C CB  . TYR A 1 132 ? 12.820  -14.270 -25.493 1.00 36.77  ? 132 TYR A CB  1 
ATOM   1093 C CG  . TYR A 1 132 ? 12.064  -13.150 -24.808 1.00 40.46  ? 132 TYR A CG  1 
ATOM   1094 C CD1 . TYR A 1 132 ? 11.636  -13.290 -23.491 1.00 36.69  ? 132 TYR A CD1 1 
ATOM   1095 C CD2 . TYR A 1 132 ? 11.787  -11.964 -25.471 1.00 40.83  ? 132 TYR A CD2 1 
ATOM   1096 C CE1 . TYR A 1 132 ? 10.945  -12.273 -22.848 1.00 35.61  ? 132 TYR A CE1 1 
ATOM   1097 C CE2 . TYR A 1 132 ? 11.096  -10.946 -24.836 1.00 48.05  ? 132 TYR A CE2 1 
ATOM   1098 C CZ  . TYR A 1 132 ? 10.678  -11.105 -23.528 1.00 43.43  ? 132 TYR A CZ  1 
ATOM   1099 O OH  . TYR A 1 132 ? 9.991   -10.086 -22.908 1.00 33.30  ? 132 TYR A OH  1 
ATOM   1100 N N   . LYS A 1 133 ? 14.728  -16.786 -25.774 1.00 36.81  ? 133 LYS A N   1 
ATOM   1101 C CA  . LYS A 1 133 ? 15.110  -17.968 -26.530 1.00 44.68  ? 133 LYS A CA  1 
ATOM   1102 C C   . LYS A 1 133 ? 15.067  -19.211 -25.655 1.00 50.17  ? 133 LYS A C   1 
ATOM   1103 O O   . LYS A 1 133 ? 14.790  -20.312 -26.128 1.00 61.32  ? 133 LYS A O   1 
ATOM   1104 C CB  . LYS A 1 133 ? 16.504  -17.776 -27.122 1.00 50.56  ? 133 LYS A CB  1 
ATOM   1105 C CG  . LYS A 1 133 ? 17.244  -19.076 -27.390 1.00 51.58  ? 133 LYS A CG  1 
ATOM   1106 C CD  . LYS A 1 133 ? 18.443  -18.815 -28.292 1.00 55.16  ? 133 LYS A CD  1 
ATOM   1107 C CE  . LYS A 1 133 ? 18.562  -19.897 -29.363 1.00 57.13  ? 133 LYS A CE  1 
ATOM   1108 N NZ  . LYS A 1 133 ? 19.923  -19.894 -29.970 1.00 58.48  ? 133 LYS A NZ  1 
ATOM   1109 N N   . LEU A 1 134 ? 15.340  -19.058 -24.357 1.00 48.29  ? 134 LEU A N   1 
ATOM   1110 C CA  . LEU A 1 134 ? 15.299  -20.237 -23.501 1.00 42.33  ? 134 LEU A CA  1 
ATOM   1111 C C   . LEU A 1 134 ? 13.916  -20.491 -22.915 1.00 39.80  ? 134 LEU A C   1 
ATOM   1112 O O   . LEU A 1 134 ? 13.565  -21.662 -22.711 1.00 35.15  ? 134 LEU A O   1 
ATOM   1113 C CB  . LEU A 1 134 ? 16.306  -20.110 -22.357 1.00 46.31  ? 134 LEU A CB  1 
ATOM   1114 C CG  . LEU A 1 134 ? 17.794  -20.100 -22.693 1.00 48.13  ? 134 LEU A CG  1 
ATOM   1115 C CD1 . LEU A 1 134 ? 18.571  -19.339 -21.628 1.00 35.50  ? 134 LEU A CD1 1 
ATOM   1116 C CD2 . LEU A 1 134 ? 18.354  -21.512 -22.839 1.00 32.84  ? 134 LEU A CD2 1 
ATOM   1117 N N   . PHE A 1 135 ? 13.131  -19.462 -22.600 1.00 39.39  ? 135 PHE A N   1 
ATOM   1118 C CA  . PHE A 1 135 ? 11.930  -19.676 -21.791 1.00 36.99  ? 135 PHE A CA  1 
ATOM   1119 C C   . PHE A 1 135 ? 10.626  -19.172 -22.386 1.00 25.78  ? 135 PHE A C   1 
ATOM   1120 O O   . PHE A 1 135 ? 9.564   -19.423 -21.810 1.00 35.55  ? 135 PHE A O   1 
ATOM   1121 C CB  . PHE A 1 135 ? 12.123  -19.006 -20.417 1.00 32.75  ? 135 PHE A CB  1 
ATOM   1122 C CG  . PHE A 1 135 ? 13.452  -19.353 -19.764 1.00 37.87  ? 135 PHE A CG  1 
ATOM   1123 C CD1 . PHE A 1 135 ? 13.874  -20.661 -19.626 1.00 39.19  ? 135 PHE A CD1 1 
ATOM   1124 C CD2 . PHE A 1 135 ? 14.278  -18.348 -19.288 1.00 35.84  ? 135 PHE A CD2 1 
ATOM   1125 C CE1 . PHE A 1 135 ? 15.084  -20.966 -19.035 1.00 38.00  ? 135 PHE A CE1 1 
ATOM   1126 C CE2 . PHE A 1 135 ? 15.487  -18.644 -18.697 1.00 36.18  ? 135 PHE A CE2 1 
ATOM   1127 C CZ  . PHE A 1 135 ? 15.907  -19.955 -18.568 1.00 35.36  ? 135 PHE A CZ  1 
ATOM   1128 N N   . LYS A 1 136 ? 10.653  -18.469 -23.507 1.00 27.10  ? 136 LYS A N   1 
ATOM   1129 C CA  . LYS A 1 136 ? 9.424   -17.971 -24.114 1.00 33.44  ? 136 LYS A CA  1 
ATOM   1130 C C   . LYS A 1 136 ? 8.429   -19.105 -24.341 1.00 35.87  ? 136 LYS A C   1 
ATOM   1131 O O   . LYS A 1 136 ? 7.239   -18.968 -24.045 1.00 40.99  ? 136 LYS A O   1 
ATOM   1132 C CB  . LYS A 1 136 ? 9.735   -17.251 -25.434 1.00 39.61  ? 136 LYS A CB  1 
ATOM   1133 C CG  . LYS A 1 136 ? 8.522   -16.584 -26.061 1.00 39.96  ? 136 LYS A CG  1 
ATOM   1134 C CD  . LYS A 1 136 ? 8.886   -15.823 -27.327 1.00 41.08  ? 136 LYS A CD  1 
ATOM   1135 C CE  . LYS A 1 136 ? 7.728   -15.868 -28.317 1.00 48.15  ? 136 LYS A CE  1 
ATOM   1136 N NZ  . LYS A 1 136 ? 7.687   -14.671 -29.204 1.00 50.99  ? 136 LYS A NZ  1 
ATOM   1137 N N   . GLU A 1 137 ? 8.935   -20.223 -24.851 1.00 41.02  ? 137 GLU A N   1 
ATOM   1138 C CA  . GLU A 1 137 ? 8.111   -21.407 -25.077 1.00 40.72  ? 137 GLU A CA  1 
ATOM   1139 C C   . GLU A 1 137 ? 7.309   -21.755 -23.827 1.00 45.96  ? 137 GLU A C   1 
ATOM   1140 O O   . GLU A 1 137 ? 6.077   -21.798 -23.830 1.00 49.70  ? 137 GLU A O   1 
ATOM   1141 C CB  . GLU A 1 137 ? 9.005   -22.569 -25.513 1.00 46.26  ? 137 GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 137 ? 8.771   -23.065 -26.933 1.00 59.29  ? 137 GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 137 ? 8.836   -24.574 -27.069 1.00 69.52  ? 137 GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 137 ? 9.957   -25.129 -27.098 1.00 67.15  ? 137 GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 137 ? 7.777   -25.232 -27.153 1.00 80.06  ? 137 GLU A OE2 1 
ATOM   1146 N N   . ASP A 1 138 ? 8.002   -21.987 -22.718 1.00 51.23  ? 138 ASP A N   1 
ATOM   1147 C CA  . ASP A 1 138 ? 7.383   -22.352 -21.454 1.00 46.62  ? 138 ASP A CA  1 
ATOM   1148 C C   . ASP A 1 138 ? 6.431   -21.308 -20.901 1.00 35.00  ? 138 ASP A C   1 
ATOM   1149 O O   . ASP A 1 138 ? 5.460   -21.634 -20.216 1.00 37.94  ? 138 ASP A O   1 
ATOM   1150 C CB  . ASP A 1 138 ? 8.491   -22.607 -20.416 1.00 55.76  ? 138 ASP A CB  1 
ATOM   1151 C CG  . ASP A 1 138 ? 9.356   -23.775 -20.873 1.00 58.01  ? 138 ASP A CG  1 
ATOM   1152 O OD1 . ASP A 1 138 ? 8.880   -24.924 -20.747 1.00 49.79  ? 138 ASP A OD1 1 
ATOM   1153 O OD2 . ASP A 1 138 ? 10.473  -23.505 -21.353 1.00 56.94  ? 138 ASP A OD2 1 
ATOM   1154 N N   . ILE A 1 139 ? 6.714   -20.046 -21.190 1.00 33.50  ? 139 ILE A N   1 
ATOM   1155 C CA  . ILE A 1 139 ? 5.875   -18.949 -20.713 1.00 30.49  ? 139 ILE A CA  1 
ATOM   1156 C C   . ILE A 1 139 ? 4.576   -18.848 -21.492 1.00 33.69  ? 139 ILE A C   1 
ATOM   1157 O O   . ILE A 1 139 ? 3.495   -18.595 -20.961 1.00 34.38  ? 139 ILE A O   1 
ATOM   1158 C CB  . ILE A 1 139 ? 6.649   -17.618 -20.814 1.00 32.21  ? 139 ILE A CB  1 
ATOM   1159 C CG1 . ILE A 1 139 ? 7.935   -17.593 -19.981 1.00 41.16  ? 139 ILE A CG1 1 
ATOM   1160 C CG2 . ILE A 1 139 ? 5.738   -16.452 -20.476 1.00 38.73  ? 139 ILE A CG2 1 
ATOM   1161 C CD1 . ILE A 1 139 ? 8.756   -16.325 -20.128 1.00 28.24  ? 139 ILE A CD1 1 
ATOM   1162 N N   . LEU A 1 140 ? 4.677   -19.036 -22.807 1.00 39.27  ? 140 LEU A N   1 
ATOM   1163 C CA  . LEU A 1 140 ? 3.499   -18.930 -23.665 1.00 36.81  ? 140 LEU A CA  1 
ATOM   1164 C C   . LEU A 1 140 ? 2.501   -20.033 -23.334 1.00 37.16  ? 140 LEU A C   1 
ATOM   1165 O O   . LEU A 1 140 ? 1.290   -19.814 -23.362 1.00 38.72  ? 140 LEU A O   1 
ATOM   1166 C CB  . LEU A 1 140 ? 3.930   -18.990 -25.130 1.00 39.00  ? 140 LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 140 ? 4.672   -17.740 -25.626 1.00 37.77  ? 140 LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 140 ? 4.894   -17.783 -27.129 1.00 29.49  ? 140 LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 140 ? 3.894   -16.505 -25.206 1.00 45.06  ? 140 LEU A CD2 1 
ATOM   1170 N N   . SER A 1 141 ? 3.079   -21.179 -23.017 1.00 34.11  ? 141 SER A N   1 
ATOM   1171 C CA  . SER A 1 141 ? 2.405   -22.398 -22.606 1.00 33.03  ? 141 SER A CA  1 
ATOM   1172 C C   . SER A 1 141 ? 1.651   -22.147 -21.310 1.00 37.01  ? 141 SER A C   1 
ATOM   1173 O O   . SER A 1 141 ? 0.466   -22.471 -21.211 1.00 48.16  ? 141 SER A O   1 
ATOM   1174 C CB  . SER A 1 141 ? 3.425   -23.526 -22.469 1.00 42.67  ? 141 SER A CB  1 
ATOM   1175 O OG  . SER A 1 141 ? 2.891   -24.689 -21.871 1.00 62.98  ? 141 SER A OG  1 
ATOM   1176 N N   . ALA A 1 142 ? 2.322   -21.545 -20.324 1.00 37.20  ? 142 ALA A N   1 
ATOM   1177 C CA  . ALA A 1 142 ? 1.621   -21.256 -19.072 1.00 35.97  ? 142 ALA A CA  1 
ATOM   1178 C C   . ALA A 1 142 ? 0.489   -20.266 -19.336 1.00 37.61  ? 142 ALA A C   1 
ATOM   1179 O O   . ALA A 1 142 ? -0.592  -20.370 -18.757 1.00 53.69  ? 142 ALA A O   1 
ATOM   1180 C CB  . ALA A 1 142 ? 2.553   -20.731 -17.996 1.00 39.14  ? 142 ALA A CB  1 
ATOM   1181 N N   . ILE A 1 143 ? 0.787   -19.323 -20.220 1.00 31.27  ? 143 ILE A N   1 
ATOM   1182 C CA  . ILE A 1 143 ? -0.174  -18.313 -20.651 1.00 33.94  ? 143 ILE A CA  1 
ATOM   1183 C C   . ILE A 1 143 ? -1.351  -18.985 -21.344 1.00 49.40  ? 143 ILE A C   1 
ATOM   1184 O O   . ILE A 1 143 ? -2.519  -18.647 -21.157 1.00 49.48  ? 143 ILE A O   1 
ATOM   1185 C CB  . ILE A 1 143 ? 0.528   -17.302 -21.572 1.00 40.35  ? 143 ILE A CB  1 
ATOM   1186 C CG1 . ILE A 1 143 ? 1.620   -16.490 -20.857 1.00 40.84  ? 143 ILE A CG1 1 
ATOM   1187 C CG2 . ILE A 1 143 ? -0.462  -16.377 -22.256 1.00 44.33  ? 143 ILE A CG2 1 
ATOM   1188 C CD1 . ILE A 1 143 ? 2.280   -15.464 -21.749 1.00 36.76  ? 143 ILE A CD1 1 
ATOM   1189 N N   . LYS A 1 144 ? -1.034  -19.989 -22.158 1.00 54.47  ? 144 LYS A N   1 
ATOM   1190 C CA  . LYS A 1 144 ? -2.037  -20.847 -22.765 1.00 54.13  ? 144 LYS A CA  1 
ATOM   1191 C C   . LYS A 1 144 ? -2.973  -21.428 -21.706 1.00 56.65  ? 144 LYS A C   1 
ATOM   1192 O O   . LYS A 1 144 ? -4.199  -21.299 -21.755 1.00 58.16  ? 144 LYS A O   1 
ATOM   1193 C CB  . LYS A 1 144 ? -1.356  -21.982 -23.533 1.00 60.11  ? 144 LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 144 ? -1.500  -21.893 -25.046 1.00 69.71  ? 144 LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 144 ? -2.527  -22.892 -25.554 1.00 77.69  ? 144 LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 144 ? -3.502  -22.257 -26.542 1.00 79.00  ? 144 LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 144 ? -4.526  -21.416 -25.873 1.00 78.51  ? 144 LYS A NZ  1 
ATOM   1198 N N   . GLU A 1 145 ? -2.378  -22.088 -20.717 1.00 48.43  ? 145 GLU A N   1 
ATOM   1199 C CA  . GLU A 1 145 ? -3.137  -22.721 -19.652 1.00 46.66  ? 145 GLU A CA  1 
ATOM   1200 C C   . GLU A 1 145 ? -3.914  -21.728 -18.798 1.00 55.76  ? 145 GLU A C   1 
ATOM   1201 O O   . GLU A 1 145 ? -4.855  -22.130 -18.103 1.00 54.13  ? 145 GLU A O   1 
ATOM   1202 C CB  . GLU A 1 145 ? -2.203  -23.510 -18.728 1.00 52.93  ? 145 GLU A CB  1 
ATOM   1203 C CG  . GLU A 1 145 ? -1.272  -24.506 -19.399 1.00 64.89  ? 145 GLU A CG  1 
ATOM   1204 C CD  . GLU A 1 145 ? -0.273  -25.116 -18.438 1.00 73.97  ? 145 GLU A CD  1 
ATOM   1205 O OE1 . GLU A 1 145 ? 0.385   -24.363 -17.681 1.00 69.67  ? 145 GLU A OE1 1 
ATOM   1206 O OE2 . GLU A 1 145 ? -0.143  -26.360 -18.433 1.00 82.68  ? 145 GLU A OE2 1 
ATOM   1207 N N   . GLY A 1 146 ? -3.531  -20.456 -18.806 1.00 64.05  ? 146 GLY A N   1 
ATOM   1208 C CA  . GLY A 1 146 ? -4.075  -19.519 -17.822 1.00 65.40  ? 146 GLY A CA  1 
ATOM   1209 C C   . GLY A 1 146 ? -3.520  -19.937 -16.450 1.00 72.92  ? 146 GLY A C   1 
ATOM   1210 O O   . GLY A 1 146 ? -2.450  -20.542 -16.451 1.00 72.26  ? 146 GLY A O   1 
ATOM   1211 N N   . ARG A 1 147 ? -4.243  -19.621 -15.402 1.00 81.96  ? 147 ARG A N   1 
ATOM   1212 C CA  . ARG A 1 147 ? -4.075  -19.931 -13.999 1.00 91.47  ? 147 ARG A CA  1 
ATOM   1213 C C   . ARG A 1 147 ? -2.626  -19.988 -13.517 1.00 94.39  ? 147 ARG A C   1 
ATOM   1214 O O   . ARG A 1 147 ? -1.756  -20.486 -14.262 1.00 85.36  ? 147 ARG A O   1 
ATOM   1215 C CB  . ARG A 1 147 ? -4.749  -21.281 -13.661 1.00 91.92  ? 147 ARG A CB  1 
ATOM   1216 C CG  . ARG A 1 147 ? -4.567  -21.676 -12.190 1.00 91.08  ? 147 ARG A CG  1 
ATOM   1217 C CD  . ARG A 1 147 ? -4.989  -23.114 -11.938 1.00 93.49  ? 147 ARG A CD  1 
ATOM   1218 N NE  . ARG A 1 147 ? -4.373  -24.050 -12.866 1.00 90.81  ? 147 ARG A NE  1 
ATOM   1219 C CZ  . ARG A 1 147 ? -4.806  -25.276 -13.120 1.00 84.17  ? 147 ARG A CZ  1 
ATOM   1220 N NH1 . ARG A 1 147 ? -5.893  -25.750 -12.533 1.00 74.31  ? 147 ARG A NH1 1 
ATOM   1221 N NH2 . ARG A 1 147 ? -4.150  -26.038 -13.986 1.00 83.90  ? 147 ARG A NH2 1 
ATOM   1222 O OXT . ARG A 1 147 ? -2.362  -19.554 -12.383 1.00 97.67  ? 147 ARG A OXT 1 
ATOM   1223 N N   . MET B 1 1   ? -6.465  24.340  -25.093 1.00 74.03  ? 201 MET B N   1 
ATOM   1224 C CA  . MET B 1 1   ? -6.620  24.562  -23.660 1.00 88.73  ? 201 MET B CA  1 
ATOM   1225 C C   . MET B 1 1   ? -5.273  24.682  -22.955 1.00 94.03  ? 201 MET B C   1 
ATOM   1226 O O   . MET B 1 1   ? -4.951  25.747  -22.434 1.00 87.84  ? 201 MET B O   1 
ATOM   1227 C CB  . MET B 1 1   ? -7.424  23.427  -23.018 1.00 86.66  ? 201 MET B CB  1 
ATOM   1228 C CG  . MET B 1 1   ? -8.519  23.912  -22.079 1.00 88.51  ? 201 MET B CG  1 
ATOM   1229 S SD  . MET B 1 1   ? -9.965  24.526  -22.968 1.00 95.91  ? 201 MET B SD  1 
ATOM   1230 C CE  . MET B 1 1   ? -11.237 23.409  -22.360 1.00 66.19  ? 201 MET B CE  1 
ATOM   1231 N N   . LYS B 1 2   ? -4.541  23.583  -22.898 1.00 98.72  ? 202 LYS B N   1 
ATOM   1232 C CA  . LYS B 1 2   ? -3.172  23.545  -22.373 1.00 100.08 ? 202 LYS B CA  1 
ATOM   1233 C C   . LYS B 1 2   ? -2.556  22.170  -22.699 1.00 98.23  ? 202 LYS B C   1 
ATOM   1234 O O   . LYS B 1 2   ? -2.096  21.420  -21.843 1.00 98.00  ? 202 LYS B O   1 
ATOM   1235 C CB  . LYS B 1 2   ? -3.273  23.688  -20.832 1.00 101.60 ? 202 LYS B CB  1 
ATOM   1236 C CG  . LYS B 1 2   ? -4.228  22.746  -20.120 1.00 103.13 ? 202 LYS B CG  1 
ATOM   1237 C CD  . LYS B 1 2   ? -5.675  23.178  -20.277 1.00 103.53 ? 202 LYS B CD  1 
ATOM   1238 C CE  . LYS B 1 2   ? -6.632  22.044  -19.894 1.00 103.60 ? 202 LYS B CE  1 
ATOM   1239 N NZ  . LYS B 1 2   ? -7.871  22.588  -19.267 1.00 104.68 ? 202 LYS B NZ  1 
ATOM   1240 N N   . MET B 1 3   ? -2.480  21.883  -23.991 1.00 96.38  ? 203 MET B N   1 
ATOM   1241 C CA  . MET B 1 3   ? -1.841  20.609  -24.400 1.00 92.11  ? 203 MET B CA  1 
ATOM   1242 C C   . MET B 1 3   ? -0.654  20.854  -25.354 1.00 90.30  ? 203 MET B C   1 
ATOM   1243 O O   . MET B 1 3   ? 0.452   21.118  -24.879 1.00 80.89  ? 203 MET B O   1 
ATOM   1244 C CB  . MET B 1 3   ? -2.942  19.935  -25.237 1.00 92.57  ? 203 MET B CB  1 
ATOM   1245 C CG  . MET B 1 3   ? -2.652  18.504  -25.694 1.00 90.49  ? 203 MET B CG  1 
ATOM   1246 S SD  . MET B 1 3   ? -3.515  18.048  -27.216 1.00 91.19  ? 203 MET B SD  1 
ATOM   1247 C CE  . MET B 1 3   ? -2.553  18.970  -28.421 1.00 57.70  ? 203 MET B CE  1 
ATOM   1248 N N   . LEU B 1 4   ? -0.862  20.708  -26.657 1.00 94.83  ? 204 LEU B N   1 
ATOM   1249 C CA  . LEU B 1 4   ? 0.064   20.859  -27.758 1.00 98.61  ? 204 LEU B CA  1 
ATOM   1250 C C   . LEU B 1 4   ? 1.370   20.086  -27.574 1.00 99.92  ? 204 LEU B C   1 
ATOM   1251 O O   . LEU B 1 4   ? 2.348   20.392  -28.260 1.00 99.46  ? 204 LEU B O   1 
ATOM   1252 C CB  . LEU B 1 4   ? 0.368   22.347  -27.991 1.00 100.22 ? 204 LEU B CB  1 
ATOM   1253 C CG  . LEU B 1 4   ? -0.558  23.065  -28.971 1.00 99.94  ? 204 LEU B CG  1 
ATOM   1254 C CD1 . LEU B 1 4   ? 0.027   24.399  -29.406 1.00 96.89  ? 204 LEU B CD1 1 
ATOM   1255 C CD2 . LEU B 1 4   ? -0.842  22.186  -30.187 1.00 91.81  ? 204 LEU B CD2 1 
ATOM   1256 N N   . GLU B 1 5   ? 1.386   19.105  -26.693 1.00 88.90  ? 205 GLU B N   1 
ATOM   1257 C CA  . GLU B 1 5   ? 2.487   18.204  -26.469 1.00 82.28  ? 205 GLU B CA  1 
ATOM   1258 C C   . GLU B 1 5   ? 3.854   18.847  -26.486 1.00 82.15  ? 205 GLU B C   1 
ATOM   1259 O O   . GLU B 1 5   ? 4.678   18.546  -27.349 1.00 74.27  ? 205 GLU B O   1 
ATOM   1260 C CB  . GLU B 1 5   ? 2.430   17.035  -27.462 1.00 76.36  ? 205 GLU B CB  1 
ATOM   1261 C CG  . GLU B 1 5   ? 2.049   15.701  -26.851 1.00 76.78  ? 205 GLU B CG  1 
ATOM   1262 C CD  . GLU B 1 5   ? 0.593   15.609  -26.442 1.00 77.55  ? 205 GLU B CD  1 
ATOM   1263 O OE1 . GLU B 1 5   ? 0.212   16.209  -25.416 1.00 76.20  ? 205 GLU B OE1 1 
ATOM   1264 O OE2 . GLU B 1 5   ? -0.180  14.925  -27.155 1.00 65.33  ? 205 GLU B OE2 1 
ATOM   1265 N N   . GLN B 1 6   ? 4.099   19.742  -25.532 1.00 81.18  ? 206 GLN B N   1 
ATOM   1266 C CA  . GLN B 1 6   ? 5.431   20.290  -25.306 1.00 81.74  ? 206 GLN B CA  1 
ATOM   1267 C C   . GLN B 1 6   ? 6.221   19.300  -24.441 1.00 74.16  ? 206 GLN B C   1 
ATOM   1268 O O   . GLN B 1 6   ? 7.409   19.467  -24.175 1.00 61.35  ? 206 GLN B O   1 
ATOM   1269 C CB  . GLN B 1 6   ? 5.371   21.658  -24.643 1.00 88.81  ? 206 GLN B CB  1 
ATOM   1270 C CG  . GLN B 1 6   ? 4.135   21.913  -23.801 1.00 90.60  ? 206 GLN B CG  1 
ATOM   1271 C CD  . GLN B 1 6   ? 3.062   22.709  -24.532 1.00 97.56  ? 206 GLN B CD  1 
ATOM   1272 O OE1 . GLN B 1 6   ? 1.910   22.747  -24.105 1.00 103.35 ? 206 GLN B OE1 1 
ATOM   1273 N NE2 . GLN B 1 6   ? 3.429   23.341  -25.647 1.00 101.21 ? 206 GLN B NE2 1 
ATOM   1274 N N   . LEU B 1 7   ? 5.479   18.282  -24.031 1.00 65.02  ? 207 LEU B N   1 
ATOM   1275 C CA  . LEU B 1 7   ? 5.934   17.126  -23.280 1.00 53.39  ? 207 LEU B CA  1 
ATOM   1276 C C   . LEU B 1 7   ? 7.014   16.381  -24.050 1.00 49.40  ? 207 LEU B C   1 
ATOM   1277 O O   . LEU B 1 7   ? 8.012   15.920  -23.501 1.00 59.95  ? 207 LEU B O   1 
ATOM   1278 C CB  . LEU B 1 7   ? 4.738   16.216  -22.990 1.00 46.17  ? 207 LEU B CB  1 
ATOM   1279 C CG  . LEU B 1 7   ? 4.982   15.053  -22.026 1.00 42.66  ? 207 LEU B CG  1 
ATOM   1280 C CD1 . LEU B 1 7   ? 5.696   15.520  -20.766 1.00 34.71  ? 207 LEU B CD1 1 
ATOM   1281 C CD2 . LEU B 1 7   ? 3.661   14.380  -21.683 1.00 46.45  ? 207 LEU B CD2 1 
ATOM   1282 N N   . GLU B 1 8   ? 6.841   16.245  -25.367 1.00 57.73  ? 208 GLU B N   1 
ATOM   1283 C CA  . GLU B 1 8   ? 7.898   15.610  -26.149 1.00 63.44  ? 208 GLU B CA  1 
ATOM   1284 C C   . GLU B 1 8   ? 9.170   16.452  -26.060 1.00 61.83  ? 208 GLU B C   1 
ATOM   1285 O O   . GLU B 1 8   ? 10.272  15.928  -26.186 1.00 66.83  ? 208 GLU B O   1 
ATOM   1286 C CB  . GLU B 1 8   ? 7.500   15.435  -27.608 1.00 68.33  ? 208 GLU B CB  1 
ATOM   1287 C CG  . GLU B 1 8   ? 6.422   14.392  -27.858 1.00 73.11  ? 208 GLU B CG  1 
ATOM   1288 C CD  . GLU B 1 8   ? 5.733   14.624  -29.191 1.00 76.76  ? 208 GLU B CD  1 
ATOM   1289 O OE1 . GLU B 1 8   ? 5.175   15.730  -29.375 1.00 97.81  ? 208 GLU B OE1 1 
ATOM   1290 O OE2 . GLU B 1 8   ? 5.762   13.710  -30.042 1.00 58.27  ? 208 GLU B OE2 1 
ATOM   1291 N N   . LYS B 1 9   ? 8.984   17.752  -25.843 1.00 65.66  ? 209 LYS B N   1 
ATOM   1292 C CA  . LYS B 1 9   ? 10.118  18.659  -25.689 1.00 72.49  ? 209 LYS B CA  1 
ATOM   1293 C C   . LYS B 1 9   ? 10.658  18.611  -24.263 1.00 72.86  ? 209 LYS B C   1 
ATOM   1294 O O   . LYS B 1 9   ? 11.866  18.681  -24.026 1.00 63.27  ? 209 LYS B O   1 
ATOM   1295 C CB  . LYS B 1 9   ? 9.702   20.076  -26.090 1.00 74.79  ? 209 LYS B CB  1 
ATOM   1296 C CG  . LYS B 1 9   ? 8.787   20.104  -27.311 1.00 81.06  ? 209 LYS B CG  1 
ATOM   1297 C CD  . LYS B 1 9   ? 7.998   21.402  -27.384 1.00 87.17  ? 209 LYS B CD  1 
ATOM   1298 C CE  . LYS B 1 9   ? 8.843   22.539  -27.942 1.00 87.84  ? 209 LYS B CE  1 
ATOM   1299 N NZ  . LYS B 1 9   ? 9.760   22.075  -29.010 1.00 80.58  ? 209 LYS B NZ  1 
ATOM   1300 N N   . LYS B 1 10  ? 9.751   18.482  -23.300 1.00 66.28  ? 210 LYS B N   1 
ATOM   1301 C CA  . LYS B 1 10  ? 10.120  18.320  -21.900 1.00 59.91  ? 210 LYS B CA  1 
ATOM   1302 C C   . LYS B 1 10  ? 10.975  17.066  -21.715 1.00 57.45  ? 210 LYS B C   1 
ATOM   1303 O O   . LYS B 1 10  ? 12.043  17.137  -21.104 1.00 58.85  ? 210 LYS B O   1 
ATOM   1304 C CB  . LYS B 1 10  ? 8.869   18.246  -21.025 1.00 60.86  ? 210 LYS B CB  1 
ATOM   1305 C CG  . LYS B 1 10  ? 8.182   19.589  -20.832 1.00 66.10  ? 210 LYS B CG  1 
ATOM   1306 C CD  . LYS B 1 10  ? 7.311   19.591  -19.588 1.00 73.89  ? 210 LYS B CD  1 
ATOM   1307 C CE  . LYS B 1 10  ? 7.685   20.710  -18.627 1.00 78.83  ? 210 LYS B CE  1 
ATOM   1308 N NZ  . LYS B 1 10  ? 9.048   20.526  -18.035 1.00 83.29  ? 210 LYS B NZ  1 
ATOM   1309 N N   . LEU B 1 11  ? 10.468  15.972  -22.265 1.00 51.00  ? 211 LEU B N   1 
ATOM   1310 C CA  . LEU B 1 11  ? 11.047  14.649  -22.274 1.00 48.44  ? 211 LEU B CA  1 
ATOM   1311 C C   . LEU B 1 11  ? 12.322  14.560  -23.106 1.00 48.16  ? 211 LEU B C   1 
ATOM   1312 O O   . LEU B 1 11  ? 13.273  13.882  -22.716 1.00 57.88  ? 211 LEU B O   1 
ATOM   1313 C CB  . LEU B 1 11  ? 10.063  13.629  -22.852 1.00 52.51  ? 211 LEU B CB  1 
ATOM   1314 C CG  . LEU B 1 11  ? 8.999   13.006  -21.961 1.00 52.30  ? 211 LEU B CG  1 
ATOM   1315 C CD1 . LEU B 1 11  ? 7.849   12.502  -22.832 1.00 57.30  ? 211 LEU B CD1 1 
ATOM   1316 C CD2 . LEU B 1 11  ? 9.565   11.880  -21.111 1.00 39.67  ? 211 LEU B CD2 1 
ATOM   1317 N N   . GLY B 1 12  ? 12.346  15.217  -24.264 1.00 44.77  ? 212 GLY B N   1 
ATOM   1318 C CA  . GLY B 1 12  ? 13.470  15.037  -25.178 1.00 48.45  ? 212 GLY B CA  1 
ATOM   1319 C C   . GLY B 1 12  ? 13.242  13.819  -26.061 1.00 49.12  ? 212 GLY B C   1 
ATOM   1320 O O   . GLY B 1 12  ? 14.166  13.115  -26.457 1.00 47.25  ? 212 GLY B O   1 
ATOM   1321 N N   . TYR B 1 13  ? 11.976  13.554  -26.380 1.00 47.20  ? 213 TYR B N   1 
ATOM   1322 C CA  . TYR B 1 13  ? 11.635  12.460  -27.271 1.00 46.57  ? 213 TYR B CA  1 
ATOM   1323 C C   . TYR B 1 13  ? 10.379  12.783  -28.079 1.00 51.71  ? 213 TYR B C   1 
ATOM   1324 O O   . TYR B 1 13  ? 9.415   13.298  -27.509 1.00 67.64  ? 213 TYR B O   1 
ATOM   1325 C CB  . TYR B 1 13  ? 11.399  11.169  -26.489 1.00 43.63  ? 213 TYR B CB  1 
ATOM   1326 C CG  . TYR B 1 13  ? 11.086  9.968   -27.358 1.00 36.59  ? 213 TYR B CG  1 
ATOM   1327 C CD1 . TYR B 1 13  ? 12.088  9.360   -28.100 1.00 34.51  ? 213 TYR B CD1 1 
ATOM   1328 C CD2 . TYR B 1 13  ? 9.809   9.443   -27.441 1.00 37.78  ? 213 TYR B CD2 1 
ATOM   1329 C CE1 . TYR B 1 13  ? 11.817  8.267   -28.895 1.00 39.29  ? 213 TYR B CE1 1 
ATOM   1330 C CE2 . TYR B 1 13  ? 9.526   8.345   -28.235 1.00 43.11  ? 213 TYR B CE2 1 
ATOM   1331 C CZ  . TYR B 1 13  ? 10.538  7.761   -28.963 1.00 42.93  ? 213 TYR B CZ  1 
ATOM   1332 O OH  . TYR B 1 13  ? 10.290  6.668   -29.760 1.00 45.41  ? 213 TYR B OH  1 
ATOM   1333 N N   . THR B 1 14  ? 10.409  12.464  -29.367 1.00 47.48  ? 214 THR B N   1 
ATOM   1334 C CA  . THR B 1 14  ? 9.268   12.677  -30.257 1.00 47.31  ? 214 THR B CA  1 
ATOM   1335 C C   . THR B 1 14  ? 8.648   11.345  -30.651 1.00 44.58  ? 214 THR B C   1 
ATOM   1336 O O   . THR B 1 14  ? 9.317   10.498  -31.241 1.00 54.84  ? 214 THR B O   1 
ATOM   1337 C CB  . THR B 1 14  ? 9.694   13.457  -31.515 1.00 52.76  ? 214 THR B CB  1 
ATOM   1338 O OG1 . THR B 1 14  ? 10.252  14.722  -31.132 1.00 45.20  ? 214 THR B OG1 1 
ATOM   1339 C CG2 . THR B 1 14  ? 8.506   13.777  -32.404 1.00 49.82  ? 214 THR B CG2 1 
ATOM   1340 N N   . PHE B 1 15  ? 7.374   11.139  -30.331 1.00 42.17  ? 215 PHE B N   1 
ATOM   1341 C CA  . PHE B 1 15  ? 6.693   9.888   -30.640 1.00 48.01  ? 215 PHE B CA  1 
ATOM   1342 C C   . PHE B 1 15  ? 6.392   9.723   -32.124 1.00 54.96  ? 215 PHE B C   1 
ATOM   1343 O O   . PHE B 1 15  ? 5.905   10.655  -32.762 1.00 62.45  ? 215 PHE B O   1 
ATOM   1344 C CB  . PHE B 1 15  ? 5.373   9.803   -29.858 1.00 48.80  ? 215 PHE B CB  1 
ATOM   1345 C CG  . PHE B 1 15  ? 5.552   9.197   -28.476 1.00 51.59  ? 215 PHE B CG  1 
ATOM   1346 C CD1 . PHE B 1 15  ? 5.997   9.994   -27.432 1.00 51.59  ? 215 PHE B CD1 1 
ATOM   1347 C CD2 . PHE B 1 15  ? 5.282   7.860   -28.246 1.00 49.20  ? 215 PHE B CD2 1 
ATOM   1348 C CE1 . PHE B 1 15  ? 6.165   9.451   -26.171 1.00 47.54  ? 215 PHE B CE1 1 
ATOM   1349 C CE2 . PHE B 1 15  ? 5.449   7.310   -26.988 1.00 45.36  ? 215 PHE B CE2 1 
ATOM   1350 C CZ  . PHE B 1 15  ? 5.886   8.113   -25.952 1.00 48.07  ? 215 PHE B CZ  1 
ATOM   1351 N N   . LYS B 1 16  ? 6.676   8.541   -32.658 1.00 59.78  ? 216 LYS B N   1 
ATOM   1352 C CA  . LYS B 1 16  ? 6.416   8.236   -34.064 1.00 63.16  ? 216 LYS B CA  1 
ATOM   1353 C C   . LYS B 1 16  ? 4.945   7.855   -34.224 1.00 68.52  ? 216 LYS B C   1 
ATOM   1354 O O   . LYS B 1 16  ? 4.438   7.715   -35.330 1.00 83.69  ? 216 LYS B O   1 
ATOM   1355 C CB  . LYS B 1 16  ? 7.324   7.116   -34.574 1.00 54.38  ? 216 LYS B CB  1 
ATOM   1356 C CG  . LYS B 1 16  ? 8.801   7.484   -34.547 1.00 53.47  ? 216 LYS B CG  1 
ATOM   1357 C CD  . LYS B 1 16  ? 9.684   6.382   -35.101 1.00 54.89  ? 216 LYS B CD  1 
ATOM   1358 C CE  . LYS B 1 16  ? 9.404   5.053   -34.420 1.00 61.78  ? 216 LYS B CE  1 
ATOM   1359 N NZ  . LYS B 1 16  ? 10.656  4.330   -34.057 1.00 63.47  ? 216 LYS B NZ  1 
ATOM   1360 N N   . ASP B 1 17  ? 4.319   7.708   -33.066 1.00 64.58  ? 217 ASP B N   1 
ATOM   1361 C CA  . ASP B 1 17  ? 2.912   7.365   -32.908 1.00 48.16  ? 217 ASP B CA  1 
ATOM   1362 C C   . ASP B 1 17  ? 2.305   8.224   -31.806 1.00 48.48  ? 217 ASP B C   1 
ATOM   1363 O O   . ASP B 1 17  ? 2.144   7.781   -30.671 1.00 73.15  ? 217 ASP B O   1 
ATOM   1364 C CB  . ASP B 1 17  ? 2.774   5.881   -32.606 1.00 42.58  ? 217 ASP B CB  1 
ATOM   1365 C CG  . ASP B 1 17  ? 1.360   5.372   -32.482 1.00 42.58  ? 217 ASP B CG  1 
ATOM   1366 O OD1 . ASP B 1 17  ? 0.439   6.190   -32.287 1.00 60.00  ? 217 ASP B OD1 1 
ATOM   1367 O OD2 . ASP B 1 17  ? 1.175   4.138   -32.576 1.00 62.60  ? 217 ASP B OD2 1 
ATOM   1368 N N   . LYS B 1 18  ? 1.991   9.460   -32.162 1.00 50.98  ? 218 LYS B N   1 
ATOM   1369 C CA  . LYS B 1 18  ? 1.378   10.445  -31.288 1.00 52.80  ? 218 LYS B CA  1 
ATOM   1370 C C   . LYS B 1 18  ? 0.171   9.884   -30.543 1.00 52.91  ? 218 LYS B C   1 
ATOM   1371 O O   . LYS B 1 18  ? -0.088  10.243  -29.390 1.00 61.84  ? 218 LYS B O   1 
ATOM   1372 C CB  . LYS B 1 18  ? 0.948   11.666  -32.105 1.00 52.56  ? 218 LYS B CB  1 
ATOM   1373 C CG  . LYS B 1 18  ? 1.983   12.769  -32.170 1.00 59.45  ? 218 LYS B CG  1 
ATOM   1374 C CD  . LYS B 1 18  ? 3.251   12.333  -32.885 1.00 60.29  ? 218 LYS B CD  1 
ATOM   1375 C CE  . LYS B 1 18  ? 4.183   13.523  -33.107 1.00 61.95  ? 218 LYS B CE  1 
ATOM   1376 N NZ  . LYS B 1 18  ? 5.565   13.212  -32.573 1.00 71.44  ? 218 LYS B NZ  1 
ATOM   1377 N N   . SER B 1 19  ? -0.580  8.995   -31.186 1.00 44.44  ? 219 SER B N   1 
ATOM   1378 C CA  . SER B 1 19  ? -1.723  8.386   -30.513 1.00 50.86  ? 219 SER B CA  1 
ATOM   1379 C C   . SER B 1 19  ? -1.296  7.546   -29.311 1.00 52.90  ? 219 SER B C   1 
ATOM   1380 O O   . SER B 1 19  ? -2.039  7.393   -28.340 1.00 38.64  ? 219 SER B O   1 
ATOM   1381 C CB  . SER B 1 19  ? -2.504  7.515   -31.502 1.00 53.23  ? 219 SER B CB  1 
ATOM   1382 O OG  . SER B 1 19  ? -1.800  6.307   -31.772 1.00 34.74  ? 219 SER B OG  1 
ATOM   1383 N N   . LEU B 1 20  ? -0.096  6.979   -29.397 1.00 56.85  ? 220 LEU B N   1 
ATOM   1384 C CA  . LEU B 1 20  ? 0.488   6.160   -28.340 1.00 53.42  ? 220 LEU B CA  1 
ATOM   1385 C C   . LEU B 1 20  ? 0.795   7.040   -27.131 1.00 50.28  ? 220 LEU B C   1 
ATOM   1386 O O   . LEU B 1 20  ? 0.444   6.678   -26.013 1.00 47.25  ? 220 LEU B O   1 
ATOM   1387 C CB  . LEU B 1 20  ? 1.745   5.437   -28.819 1.00 55.00  ? 220 LEU B CB  1 
ATOM   1388 C CG  . LEU B 1 20  ? 1.863   3.951   -28.471 1.00 56.48  ? 220 LEU B CG  1 
ATOM   1389 C CD1 . LEU B 1 20  ? 3.261   3.423   -28.763 1.00 45.75  ? 220 LEU B CD1 1 
ATOM   1390 C CD2 . LEU B 1 20  ? 1.511   3.706   -27.010 1.00 54.56  ? 220 LEU B CD2 1 
ATOM   1391 N N   . LEU B 1 21  ? 1.426   8.181   -27.378 1.00 53.90  ? 221 LEU B N   1 
ATOM   1392 C CA  . LEU B 1 21  ? 1.640   9.214   -26.377 1.00 50.75  ? 221 LEU B CA  1 
ATOM   1393 C C   . LEU B 1 21  ? 0.327   9.563   -25.670 1.00 51.27  ? 221 LEU B C   1 
ATOM   1394 O O   . LEU B 1 21  ? 0.295   9.659   -24.445 1.00 50.10  ? 221 LEU B O   1 
ATOM   1395 C CB  . LEU B 1 21  ? 2.197   10.488  -27.002 1.00 51.52  ? 221 LEU B CB  1 
ATOM   1396 C CG  . LEU B 1 21  ? 3.223   11.302  -26.225 1.00 61.24  ? 221 LEU B CG  1 
ATOM   1397 C CD1 . LEU B 1 21  ? 3.376   12.683  -26.851 1.00 60.79  ? 221 LEU B CD1 1 
ATOM   1398 C CD2 . LEU B 1 21  ? 2.875   11.435  -24.750 1.00 61.52  ? 221 LEU B CD2 1 
ATOM   1399 N N   . GLU B 1 22  ? -0.702  9.757   -26.481 1.00 52.87  ? 222 GLU B N   1 
ATOM   1400 C CA  . GLU B 1 22  ? -2.012  10.226  -26.057 1.00 51.96  ? 222 GLU B CA  1 
ATOM   1401 C C   . GLU B 1 22  ? -2.671  9.248   -25.090 1.00 48.16  ? 222 GLU B C   1 
ATOM   1402 O O   . GLU B 1 22  ? -3.150  9.589   -24.009 1.00 49.27  ? 222 GLU B O   1 
ATOM   1403 C CB  . GLU B 1 22  ? -2.905  10.436  -27.282 1.00 50.35  ? 222 GLU B CB  1 
ATOM   1404 C CG  . GLU B 1 22  ? -3.010  11.857  -27.799 1.00 55.91  ? 222 GLU B CG  1 
ATOM   1405 C CD  . GLU B 1 22  ? -4.075  12.022  -28.866 1.00 59.94  ? 222 GLU B CD  1 
ATOM   1406 O OE1 . GLU B 1 22  ? -4.269  11.087  -29.670 1.00 48.99  ? 222 GLU B OE1 1 
ATOM   1407 O OE2 . GLU B 1 22  ? -4.731  13.086  -28.916 1.00 74.55  ? 222 GLU B OE2 1 
ATOM   1408 N N   . LYS B 1 23  ? -2.694  7.990   -25.502 1.00 39.78  ? 223 LYS B N   1 
ATOM   1409 C CA  . LYS B 1 23  ? -3.296  6.933   -24.696 1.00 44.51  ? 223 LYS B CA  1 
ATOM   1410 C C   . LYS B 1 23  ? -2.653  6.853   -23.321 1.00 44.20  ? 223 LYS B C   1 
ATOM   1411 O O   . LYS B 1 23  ? -3.294  6.458   -22.347 1.00 65.12  ? 223 LYS B O   1 
ATOM   1412 C CB  . LYS B 1 23  ? -3.161  5.623   -25.465 1.00 49.65  ? 223 LYS B CB  1 
ATOM   1413 C CG  . LYS B 1 23  ? -3.847  4.404   -24.894 1.00 59.26  ? 223 LYS B CG  1 
ATOM   1414 C CD  . LYS B 1 23  ? -3.434  3.156   -25.667 1.00 65.61  ? 223 LYS B CD  1 
ATOM   1415 C CE  . LYS B 1 23  ? -4.266  1.947   -25.274 1.00 70.08  ? 223 LYS B CE  1 
ATOM   1416 N NZ  . LYS B 1 23  ? -4.719  1.163   -26.461 1.00 70.98  ? 223 LYS B NZ  1 
ATOM   1417 N N   . ALA B 1 24  ? -1.383  7.222   -23.198 1.00 45.03  ? 224 ALA B N   1 
ATOM   1418 C CA  . ALA B 1 24  ? -0.679  7.126   -21.921 1.00 49.34  ? 224 ALA B CA  1 
ATOM   1419 C C   . ALA B 1 24  ? -1.101  8.183   -20.903 1.00 53.73  ? 224 ALA B C   1 
ATOM   1420 O O   . ALA B 1 24  ? -1.013  7.973   -19.688 1.00 43.09  ? 224 ALA B O   1 
ATOM   1421 C CB  . ALA B 1 24  ? 0.819   7.213   -22.178 1.00 30.44  ? 224 ALA B CB  1 
ATOM   1422 N N   . LEU B 1 25  ? -1.557  9.330   -21.391 1.00 51.50  ? 225 LEU B N   1 
ATOM   1423 C CA  . LEU B 1 25  ? -2.041  10.417  -20.555 1.00 47.49  ? 225 LEU B CA  1 
ATOM   1424 C C   . LEU B 1 25  ? -3.559  10.380  -20.418 1.00 41.87  ? 225 LEU B C   1 
ATOM   1425 O O   . LEU B 1 25  ? -4.166  11.252  -19.793 1.00 35.64  ? 225 LEU B O   1 
ATOM   1426 C CB  . LEU B 1 25  ? -1.626  11.776  -21.128 1.00 50.38  ? 225 LEU B CB  1 
ATOM   1427 C CG  . LEU B 1 25  ? -0.231  11.914  -21.730 1.00 53.91  ? 225 LEU B CG  1 
ATOM   1428 C CD1 . LEU B 1 25  ? -0.265  12.782  -22.981 1.00 46.59  ? 225 LEU B CD1 1 
ATOM   1429 C CD2 . LEU B 1 25  ? 0.742   12.500  -20.720 1.00 39.18  ? 225 LEU B CD2 1 
ATOM   1430 N N   . THR B 1 26  ? -4.228  9.386   -21.005 1.00 38.59  ? 226 THR B N   1 
ATOM   1431 C CA  . THR B 1 26  ? -5.690  9.434   -20.961 1.00 47.87  ? 226 THR B CA  1 
ATOM   1432 C C   . THR B 1 26  ? -6.272  8.414   -19.994 1.00 55.37  ? 226 THR B C   1 
ATOM   1433 O O   . THR B 1 26  ? -6.123  7.212   -20.214 1.00 60.33  ? 226 THR B O   1 
ATOM   1434 C CB  . THR B 1 26  ? -6.294  9.187   -22.358 1.00 56.91  ? 226 THR B CB  1 
ATOM   1435 O OG1 . THR B 1 26  ? -5.686  10.052  -23.323 1.00 64.89  ? 226 THR B OG1 1 
ATOM   1436 C CG2 . THR B 1 26  ? -7.778  9.528   -22.371 1.00 69.60  ? 226 THR B CG2 1 
ATOM   1437 N N   . HIS B 1 27  ? -6.937  8.868   -18.943 1.00 59.33  ? 227 HIS B N   1 
ATOM   1438 C CA  . HIS B 1 27  ? -7.658  8.024   -17.994 1.00 52.96  ? 227 HIS B CA  1 
ATOM   1439 C C   . HIS B 1 27  ? -8.960  7.507   -18.599 1.00 42.66  ? 227 HIS B C   1 
ATOM   1440 O O   . HIS B 1 27  ? -9.504  8.116   -19.521 1.00 54.71  ? 227 HIS B O   1 
ATOM   1441 C CB  . HIS B 1 27  ? -7.930  8.826   -16.723 1.00 61.37  ? 227 HIS B CB  1 
ATOM   1442 C CG  . HIS B 1 27  ? -8.693  8.133   -15.643 1.00 68.95  ? 227 HIS B CG  1 
ATOM   1443 N ND1 . HIS B 1 27  ? -9.981  7.668   -15.787 1.00 72.21  ? 227 HIS B ND1 1 
ATOM   1444 C CD2 . HIS B 1 27  ? -8.341  7.837   -14.368 1.00 71.15  ? 227 HIS B CD2 1 
ATOM   1445 C CE1 . HIS B 1 27  ? -10.390 7.108   -14.664 1.00 72.50  ? 227 HIS B CE1 1 
ATOM   1446 N NE2 . HIS B 1 27  ? -9.409  7.198   -13.783 1.00 73.76  ? 227 HIS B NE2 1 
ATOM   1447 N N   . VAL B 1 28  ? -9.479  6.391   -18.099 1.00 45.08  ? 228 VAL B N   1 
ATOM   1448 C CA  . VAL B 1 28  ? -10.697 5.788   -18.618 1.00 55.21  ? 228 VAL B CA  1 
ATOM   1449 C C   . VAL B 1 28  ? -11.833 6.814   -18.676 1.00 54.11  ? 228 VAL B C   1 
ATOM   1450 O O   . VAL B 1 28  ? -12.624 6.795   -19.613 1.00 49.89  ? 228 VAL B O   1 
ATOM   1451 C CB  . VAL B 1 28  ? -11.192 4.595   -17.778 1.00 53.81  ? 228 VAL B CB  1 
ATOM   1452 C CG1 . VAL B 1 28  ? -11.425 3.374   -18.651 1.00 61.84  ? 228 VAL B CG1 1 
ATOM   1453 C CG2 . VAL B 1 28  ? -10.221 4.258   -16.663 1.00 41.84  ? 228 VAL B CG2 1 
ATOM   1454 N N   . SER B 1 29  ? -11.891 7.675   -17.677 1.00 56.12  ? 229 SER B N   1 
ATOM   1455 C CA  . SER B 1 29  ? -12.904 8.703   -17.502 1.00 58.57  ? 229 SER B CA  1 
ATOM   1456 C C   . SER B 1 29  ? -13.098 9.548   -18.760 1.00 66.71  ? 229 SER B C   1 
ATOM   1457 O O   . SER B 1 29  ? -14.188 10.042  -19.057 1.00 81.55  ? 229 SER B O   1 
ATOM   1458 C CB  . SER B 1 29  ? -12.504 9.624   -16.342 1.00 57.58  ? 229 SER B CB  1 
ATOM   1459 O OG  . SER B 1 29  ? -11.243 10.221  -16.620 1.00 66.61  ? 229 SER B OG  1 
ATOM   1460 N N   . TYR B 1 30  ? -12.006 9.707   -19.488 1.00 64.45  ? 230 TYR B N   1 
ATOM   1461 C CA  . TYR B 1 30  ? -11.916 10.501  -20.696 1.00 63.05  ? 230 TYR B CA  1 
ATOM   1462 C C   . TYR B 1 30  ? -12.101 9.629   -21.933 1.00 64.00  ? 230 TYR B C   1 
ATOM   1463 O O   . TYR B 1 30  ? -12.338 10.161  -23.016 1.00 73.21  ? 230 TYR B O   1 
ATOM   1464 C CB  . TYR B 1 30  ? -10.551 11.185  -20.749 1.00 66.58  ? 230 TYR B CB  1 
ATOM   1465 C CG  . TYR B 1 30  ? -10.500 12.425  -21.604 1.00 69.98  ? 230 TYR B CG  1 
ATOM   1466 C CD1 . TYR B 1 30  ? -10.560 12.342  -22.989 1.00 73.20  ? 230 TYR B CD1 1 
ATOM   1467 C CD2 . TYR B 1 30  ? -10.393 13.682  -21.020 1.00 71.77  ? 230 TYR B CD2 1 
ATOM   1468 C CE1 . TYR B 1 30  ? -10.513 13.477  -23.774 1.00 73.27  ? 230 TYR B CE1 1 
ATOM   1469 C CE2 . TYR B 1 30  ? -10.345 14.821  -21.802 1.00 74.79  ? 230 TYR B CE2 1 
ATOM   1470 C CZ  . TYR B 1 30  ? -10.403 14.715  -23.177 1.00 73.37  ? 230 TYR B CZ  1 
ATOM   1471 O OH  . TYR B 1 30  ? -10.353 15.853  -23.957 1.00 66.77  ? 230 TYR B OH  1 
ATOM   1472 N N   . SER B 1 31  ? -11.973 8.328   -21.712 1.00 64.23  ? 231 SER B N   1 
ATOM   1473 C CA  . SER B 1 31  ? -12.090 7.299   -22.727 1.00 59.23  ? 231 SER B CA  1 
ATOM   1474 C C   . SER B 1 31  ? -11.919 5.888   -22.161 1.00 69.22  ? 231 SER B C   1 
ATOM   1475 O O   . SER B 1 31  ? -10.798 5.453   -21.900 1.00 81.80  ? 231 SER B O   1 
ATOM   1476 C CB  . SER B 1 31  ? -11.048 7.496   -23.833 1.00 45.54  ? 231 SER B CB  1 
ATOM   1477 O OG  . SER B 1 31  ? -10.959 6.304   -24.592 1.00 51.74  ? 231 SER B OG  1 
ATOM   1478 N N   . LYS B 1 32  ? -13.033 5.190   -21.977 1.00 68.60  ? 232 LYS B N   1 
ATOM   1479 C CA  . LYS B 1 32  ? -13.067 3.826   -21.473 1.00 64.51  ? 232 LYS B CA  1 
ATOM   1480 C C   . LYS B 1 32  ? -12.460 2.845   -22.472 1.00 68.03  ? 232 LYS B C   1 
ATOM   1481 O O   . LYS B 1 32  ? -12.239 1.677   -22.157 1.00 60.21  ? 232 LYS B O   1 
ATOM   1482 C CB  . LYS B 1 32  ? -14.504 3.418   -21.140 1.00 65.77  ? 232 LYS B CB  1 
ATOM   1483 C CG  . LYS B 1 32  ? -15.276 2.771   -22.279 1.00 65.69  ? 232 LYS B CG  1 
ATOM   1484 C CD  . LYS B 1 32  ? -16.600 2.201   -21.793 1.00 66.46  ? 232 LYS B CD  1 
ATOM   1485 C CE  . LYS B 1 32  ? -17.721 2.396   -22.796 1.00 69.20  ? 232 LYS B CE  1 
ATOM   1486 N NZ  . LYS B 1 32  ? -19.034 2.701   -22.154 1.00 59.83  ? 232 LYS B NZ  1 
ATOM   1487 N N   . LYS B 1 33  ? -12.192 3.322   -23.679 1.00 72.23  ? 233 LYS B N   1 
ATOM   1488 C CA  . LYS B 1 33  ? -11.672 2.500   -24.759 1.00 73.73  ? 233 LYS B CA  1 
ATOM   1489 C C   . LYS B 1 33  ? -10.186 2.719   -25.006 1.00 72.74  ? 233 LYS B C   1 
ATOM   1490 O O   . LYS B 1 33  ? -9.487  1.830   -25.503 1.00 88.74  ? 233 LYS B O   1 
ATOM   1491 C CB  . LYS B 1 33  ? -12.457 2.791   -26.046 1.00 72.91  ? 233 LYS B CB  1 
ATOM   1492 C CG  . LYS B 1 33  ? -13.963 2.878   -25.848 1.00 71.73  ? 233 LYS B CG  1 
ATOM   1493 C CD  . LYS B 1 33  ? -14.707 2.118   -26.938 1.00 67.39  ? 233 LYS B CD  1 
ATOM   1494 C CE  . LYS B 1 33  ? -16.086 2.702   -27.197 1.00 61.96  ? 233 LYS B CE  1 
ATOM   1495 N NZ  . LYS B 1 33  ? -16.302 2.994   -28.645 1.00 53.63  ? 233 LYS B NZ  1 
ATOM   1496 N N   . GLU B 1 34  ? -9.660  3.898   -24.682 1.00 65.36  ? 234 GLU B N   1 
ATOM   1497 C CA  . GLU B 1 34  ? -8.240  4.133   -24.932 1.00 67.04  ? 234 GLU B CA  1 
ATOM   1498 C C   . GLU B 1 34  ? -7.597  4.917   -23.794 1.00 70.48  ? 234 GLU B C   1 
ATOM   1499 O O   . GLU B 1 34  ? -7.338  6.118   -23.890 1.00 63.60  ? 234 GLU B O   1 
ATOM   1500 C CB  . GLU B 1 34  ? -8.061  4.852   -26.271 1.00 71.06  ? 234 GLU B CB  1 
ATOM   1501 C CG  . GLU B 1 34  ? -8.310  3.950   -27.469 1.00 78.93  ? 234 GLU B CG  1 
ATOM   1502 C CD  . GLU B 1 34  ? -7.065  3.209   -27.931 1.00 80.73  ? 234 GLU B CD  1 
ATOM   1503 O OE1 . GLU B 1 34  ? -5.978  3.822   -27.996 1.00 62.42  ? 234 GLU B OE1 1 
ATOM   1504 O OE2 . GLU B 1 34  ? -7.177  2.002   -28.240 1.00 99.76  ? 234 GLU B OE2 1 
ATOM   1505 N N   . HIS B 1 35  ? -7.340  4.198   -22.696 1.00 65.23  ? 235 HIS B N   1 
ATOM   1506 C CA  . HIS B 1 35  ? -6.741  4.819   -21.519 1.00 66.36  ? 235 HIS B CA  1 
ATOM   1507 C C   . HIS B 1 35  ? -5.347  4.262   -21.245 1.00 60.46  ? 235 HIS B C   1 
ATOM   1508 O O   . HIS B 1 35  ? -4.785  3.576   -22.099 1.00 62.15  ? 235 HIS B O   1 
ATOM   1509 C CB  . HIS B 1 35  ? -7.656  4.674   -20.304 1.00 64.23  ? 235 HIS B CB  1 
ATOM   1510 C CG  . HIS B 1 35  ? -8.298  3.343   -20.117 1.00 57.12  ? 235 HIS B CG  1 
ATOM   1511 N ND1 . HIS B 1 35  ? -8.094  2.596   -18.976 1.00 64.46  ? 235 HIS B ND1 1 
ATOM   1512 C CD2 . HIS B 1 35  ? -9.129  2.616   -20.895 1.00 49.40  ? 235 HIS B CD2 1 
ATOM   1513 C CE1 . HIS B 1 35  ? -8.771  1.463   -19.057 1.00 58.92  ? 235 HIS B CE1 1 
ATOM   1514 N NE2 . HIS B 1 35  ? -9.407  1.454   -20.213 1.00 54.98  ? 235 HIS B NE2 1 
ATOM   1515 N N   . TYR B 1 36  ? -4.772  4.561   -20.081 1.00 52.99  ? 236 TYR B N   1 
ATOM   1516 C CA  . TYR B 1 36  ? -3.384  4.182   -19.840 1.00 52.35  ? 236 TYR B CA  1 
ATOM   1517 C C   . TYR B 1 36  ? -3.259  2.815   -19.182 1.00 53.31  ? 236 TYR B C   1 
ATOM   1518 O O   . TYR B 1 36  ? -2.152  2.422   -18.802 1.00 54.16  ? 236 TYR B O   1 
ATOM   1519 C CB  . TYR B 1 36  ? -2.691  5.257   -18.988 1.00 54.49  ? 236 TYR B CB  1 
ATOM   1520 C CG  . TYR B 1 36  ? -3.330  5.588   -17.666 1.00 51.87  ? 236 TYR B CG  1 
ATOM   1521 C CD1 . TYR B 1 36  ? -3.175  4.771   -16.551 1.00 50.73  ? 236 TYR B CD1 1 
ATOM   1522 C CD2 . TYR B 1 36  ? -4.095  6.740   -17.502 1.00 52.26  ? 236 TYR B CD2 1 
ATOM   1523 C CE1 . TYR B 1 36  ? -3.741  5.041   -15.328 1.00 46.94  ? 236 TYR B CE1 1 
ATOM   1524 C CE2 . TYR B 1 36  ? -4.672  7.028   -16.277 1.00 50.87  ? 236 TYR B CE2 1 
ATOM   1525 C CZ  . TYR B 1 36  ? -4.495  6.187   -15.201 1.00 51.59  ? 236 TYR B CZ  1 
ATOM   1526 O OH  . TYR B 1 36  ? -5.054  6.451   -13.973 1.00 73.25  ? 236 TYR B OH  1 
ATOM   1527 N N   . GLU B 1 37  ? -4.364  2.107   -19.001 1.00 52.55  ? 237 GLU B N   1 
ATOM   1528 C CA  . GLU B 1 37  ? -4.348  0.910   -18.178 1.00 52.19  ? 237 GLU B CA  1 
ATOM   1529 C C   . GLU B 1 37  ? -3.280  -0.116  -18.533 1.00 55.74  ? 237 GLU B C   1 
ATOM   1530 O O   . GLU B 1 37  ? -2.524  -0.536  -17.644 1.00 55.57  ? 237 GLU B O   1 
ATOM   1531 C CB  . GLU B 1 37  ? -5.722  0.206   -18.226 1.00 50.96  ? 237 GLU B CB  1 
ATOM   1532 C CG  . GLU B 1 37  ? -5.648  -1.073  -17.402 1.00 52.45  ? 237 GLU B CG  1 
ATOM   1533 C CD  . GLU B 1 37  ? -6.929  -1.873  -17.387 1.00 52.49  ? 237 GLU B CD  1 
ATOM   1534 O OE1 . GLU B 1 37  ? -7.991  -1.273  -17.131 1.00 70.82  ? 237 GLU B OE1 1 
ATOM   1535 O OE2 . GLU B 1 37  ? -6.855  -3.096  -17.625 1.00 50.21  ? 237 GLU B OE2 1 
ATOM   1536 N N   . THR B 1 38  ? -3.171  -0.559  -19.784 1.00 54.61  ? 238 THR B N   1 
ATOM   1537 C CA  . THR B 1 38  ? -2.214  -1.641  -20.046 1.00 53.69  ? 238 THR B CA  1 
ATOM   1538 C C   . THR B 1 38  ? -0.780  -1.134  -20.141 1.00 51.97  ? 238 THR B C   1 
ATOM   1539 O O   . THR B 1 38  ? 0.154   -1.859  -19.787 1.00 42.91  ? 238 THR B O   1 
ATOM   1540 C CB  . THR B 1 38  ? -2.538  -2.432  -21.327 1.00 47.97  ? 238 THR B CB  1 
ATOM   1541 O OG1 . THR B 1 38  ? -3.916  -2.826  -21.328 1.00 30.47  ? 238 THR B OG1 1 
ATOM   1542 C CG2 . THR B 1 38  ? -1.712  -3.716  -21.346 1.00 25.31  ? 238 THR B CG2 1 
ATOM   1543 N N   . LEU B 1 39  ? -0.605  0.096   -20.616 1.00 46.80  ? 239 LEU B N   1 
ATOM   1544 C CA  . LEU B 1 39  ? 0.729   0.683   -20.658 1.00 40.18  ? 239 LEU B CA  1 
ATOM   1545 C C   . LEU B 1 39  ? 1.290   0.826   -19.244 1.00 29.57  ? 239 LEU B C   1 
ATOM   1546 O O   . LEU B 1 39  ? 2.493   0.727   -19.026 1.00 42.63  ? 239 LEU B O   1 
ATOM   1547 C CB  . LEU B 1 39  ? 0.704   2.046   -21.349 1.00 40.62  ? 239 LEU B CB  1 
ATOM   1548 C CG  . LEU B 1 39  ? 0.311   2.036   -22.830 1.00 41.66  ? 239 LEU B CG  1 
ATOM   1549 C CD1 . LEU B 1 39  ? 0.008   3.448   -23.308 1.00 32.86  ? 239 LEU B CD1 1 
ATOM   1550 C CD2 . LEU B 1 39  ? 1.409   1.395   -23.668 1.00 32.10  ? 239 LEU B CD2 1 
ATOM   1551 N N   . GLU B 1 40  ? 0.382   1.062   -18.310 1.00 34.73  ? 240 GLU B N   1 
ATOM   1552 C CA  . GLU B 1 40  ? 0.702   1.258   -16.904 1.00 39.79  ? 240 GLU B CA  1 
ATOM   1553 C C   . GLU B 1 40  ? 1.270   -0.034  -16.323 1.00 33.92  ? 240 GLU B C   1 
ATOM   1554 O O   . GLU B 1 40  ? 2.209   -0.008  -15.537 1.00 33.14  ? 240 GLU B O   1 
ATOM   1555 C CB  . GLU B 1 40  ? -0.532  1.704   -16.117 1.00 33.31  ? 240 GLU B CB  1 
ATOM   1556 C CG  . GLU B 1 40  ? -0.417  1.571   -14.609 1.00 43.03  ? 240 GLU B CG  1 
ATOM   1557 C CD  . GLU B 1 40  ? -1.740  1.827   -13.906 1.00 48.36  ? 240 GLU B CD  1 
ATOM   1558 O OE1 . GLU B 1 40  ? -2.808  1.605   -14.510 1.00 52.77  ? 240 GLU B OE1 1 
ATOM   1559 O OE2 . GLU B 1 40  ? -1.741  2.269   -12.737 1.00 51.10  ? 240 GLU B OE2 1 
ATOM   1560 N N   . PHE B 1 41  ? 0.666   -1.136  -16.744 1.00 33.38  ? 241 PHE B N   1 
ATOM   1561 C CA  . PHE B 1 41  ? 1.009   -2.469  -16.255 1.00 34.48  ? 241 PHE B CA  1 
ATOM   1562 C C   . PHE B 1 41  ? 2.431   -2.834  -16.683 1.00 36.88  ? 241 PHE B C   1 
ATOM   1563 O O   . PHE B 1 41  ? 3.166   -3.445  -15.900 1.00 31.14  ? 241 PHE B O   1 
ATOM   1564 C CB  . PHE B 1 41  ? -0.038  -3.455  -16.759 1.00 35.09  ? 241 PHE B CB  1 
ATOM   1565 C CG  . PHE B 1 41  ? 0.125   -4.879  -16.268 1.00 39.33  ? 241 PHE B CG  1 
ATOM   1566 C CD1 . PHE B 1 41  ? 0.909   -5.782  -16.970 1.00 35.78  ? 241 PHE B CD1 1 
ATOM   1567 C CD2 . PHE B 1 41  ? -0.507  -5.289  -15.112 1.00 40.46  ? 241 PHE B CD2 1 
ATOM   1568 C CE1 . PHE B 1 41  ? 1.044   -7.077  -16.513 1.00 37.68  ? 241 PHE B CE1 1 
ATOM   1569 C CE2 . PHE B 1 41  ? -0.374  -6.578  -14.645 1.00 42.70  ? 241 PHE B CE2 1 
ATOM   1570 C CZ  . PHE B 1 41  ? 0.411   -7.475  -15.352 1.00 44.36  ? 241 PHE B CZ  1 
ATOM   1571 N N   . LEU B 1 42  ? 2.794   -2.429  -17.890 1.00 30.62  ? 242 LEU B N   1 
ATOM   1572 C CA  . LEU B 1 42  ? 4.092   -2.546  -18.531 1.00 33.43  ? 242 LEU B CA  1 
ATOM   1573 C C   . LEU B 1 42  ? 5.116   -1.558  -17.985 1.00 32.37  ? 242 LEU B C   1 
ATOM   1574 O O   . LEU B 1 42  ? 6.264   -1.916  -17.700 1.00 37.57  ? 242 LEU B O   1 
ATOM   1575 C CB  . LEU B 1 42  ? 3.949   -2.317  -20.041 1.00 31.01  ? 242 LEU B CB  1 
ATOM   1576 C CG  . LEU B 1 42  ? 4.820   -3.077  -21.029 1.00 30.29  ? 242 LEU B CG  1 
ATOM   1577 C CD1 . LEU B 1 42  ? 5.040   -2.252  -22.299 1.00 27.46  ? 242 LEU B CD1 1 
ATOM   1578 C CD2 . LEU B 1 42  ? 6.163   -3.486  -20.445 1.00 17.68  ? 242 LEU B CD2 1 
ATOM   1579 N N   . GLY B 1 43  ? 4.751   -0.285  -17.839 1.00 30.17  ? 243 GLY B N   1 
ATOM   1580 C CA  . GLY B 1 43  ? 5.727   0.683   -17.362 1.00 30.06  ? 243 GLY B CA  1 
ATOM   1581 C C   . GLY B 1 43  ? 6.058   0.532   -15.893 1.00 27.61  ? 243 GLY B C   1 
ATOM   1582 O O   . GLY B 1 43  ? 7.128   0.945   -15.435 1.00 30.93  ? 243 GLY B O   1 
ATOM   1583 N N   . ASP B 1 44  ? 5.154   -0.064  -15.116 1.00 34.90  ? 244 ASP B N   1 
ATOM   1584 C CA  . ASP B 1 44  ? 5.479   -0.290  -13.698 1.00 40.52  ? 244 ASP B CA  1 
ATOM   1585 C C   . ASP B 1 44  ? 6.690   -1.213  -13.610 1.00 27.21  ? 244 ASP B C   1 
ATOM   1586 O O   . ASP B 1 44  ? 7.594   -0.932  -12.833 1.00 31.90  ? 244 ASP B O   1 
ATOM   1587 C CB  . ASP B 1 44  ? 4.302   -0.860  -12.940 1.00 46.88  ? 244 ASP B CB  1 
ATOM   1588 C CG  . ASP B 1 44  ? 4.529   -1.795  -11.781 1.00 56.11  ? 244 ASP B CG  1 
ATOM   1589 O OD1 . ASP B 1 44  ? 5.594   -1.867  -11.129 1.00 54.27  ? 244 ASP B OD1 1 
ATOM   1590 O OD2 . ASP B 1 44  ? 3.541   -2.520  -11.479 1.00 55.37  ? 244 ASP B OD2 1 
ATOM   1591 N N   . ALA B 1 45  ? 6.649   -2.280  -14.396 1.00 30.44  ? 245 ALA B N   1 
ATOM   1592 C CA  . ALA B 1 45  ? 7.739   -3.252  -14.426 1.00 29.54  ? 245 ALA B CA  1 
ATOM   1593 C C   . ALA B 1 45  ? 8.975   -2.607  -15.043 1.00 27.10  ? 245 ALA B C   1 
ATOM   1594 O O   . ALA B 1 45  ? 10.103  -2.780  -14.584 1.00 25.02  ? 245 ALA B O   1 
ATOM   1595 C CB  . ALA B 1 45  ? 7.309   -4.494  -15.177 1.00 23.91  ? 245 ALA B CB  1 
ATOM   1596 N N   . LEU B 1 46  ? 8.703   -1.833  -16.087 1.00 26.13  ? 246 LEU B N   1 
ATOM   1597 C CA  . LEU B 1 46  ? 9.716   -1.088  -16.820 1.00 28.60  ? 246 LEU B CA  1 
ATOM   1598 C C   . LEU B 1 46  ? 10.499  -0.175  -15.881 1.00 26.04  ? 246 LEU B C   1 
ATOM   1599 O O   . LEU B 1 46  ? 11.714  -0.287  -15.717 1.00 30.82  ? 246 LEU B O   1 
ATOM   1600 C CB  . LEU B 1 46  ? 9.052   -0.261  -17.921 1.00 35.17  ? 246 LEU B CB  1 
ATOM   1601 C CG  . LEU B 1 46  ? 9.761   -0.181  -19.266 1.00 37.34  ? 246 LEU B CG  1 
ATOM   1602 C CD1 . LEU B 1 46  ? 9.753   1.243   -19.800 1.00 29.16  ? 246 LEU B CD1 1 
ATOM   1603 C CD2 . LEU B 1 46  ? 11.178  -0.714  -19.138 1.00 34.86  ? 246 LEU B CD2 1 
ATOM   1604 N N   . VAL B 1 47  ? 9.755   0.738   -15.276 1.00 30.29  ? 247 VAL B N   1 
ATOM   1605 C CA  . VAL B 1 47  ? 10.305  1.731   -14.365 1.00 35.73  ? 247 VAL B CA  1 
ATOM   1606 C C   . VAL B 1 47  ? 10.884  1.101   -13.105 1.00 30.26  ? 247 VAL B C   1 
ATOM   1607 O O   . VAL B 1 47  ? 11.896  1.548   -12.554 1.00 27.64  ? 247 VAL B O   1 
ATOM   1608 C CB  . VAL B 1 47  ? 9.214   2.750   -13.965 1.00 35.78  ? 247 VAL B CB  1 
ATOM   1609 C CG1 . VAL B 1 47  ? 9.794   3.718   -12.952 1.00 20.28  ? 247 VAL B CG1 1 
ATOM   1610 C CG2 . VAL B 1 47  ? 8.677   3.453   -15.201 1.00 35.02  ? 247 VAL B CG2 1 
ATOM   1611 N N   . ASN B 1 48  ? 10.250  0.031   -12.625 1.00 32.92  ? 248 ASN B N   1 
ATOM   1612 C CA  . ASN B 1 48  ? 10.841  -0.689  -11.492 1.00 33.80  ? 248 ASN B CA  1 
ATOM   1613 C C   . ASN B 1 48  ? 12.265  -1.123  -11.815 1.00 36.36  ? 248 ASN B C   1 
ATOM   1614 O O   . ASN B 1 48  ? 13.213  -0.932  -11.054 1.00 40.04  ? 248 ASN B O   1 
ATOM   1615 C CB  . ASN B 1 48  ? 9.968   -1.897  -11.139 1.00 31.19  ? 248 ASN B CB  1 
ATOM   1616 C CG  . ASN B 1 48  ? 10.509  -2.619  -9.917  1.00 33.06  ? 248 ASN B CG  1 
ATOM   1617 O OD1 . ASN B 1 48  ? 10.184  -2.243  -8.793  1.00 32.73  ? 248 ASN B OD1 1 
ATOM   1618 N ND2 . ASN B 1 48  ? 11.332  -3.628  -10.150 1.00 30.07  ? 248 ASN B ND2 1 
ATOM   1619 N N   . PHE B 1 49  ? 12.452  -1.720  -12.993 1.00 38.75  ? 249 PHE B N   1 
ATOM   1620 C CA  . PHE B 1 49  ? 13.774  -2.134  -13.440 1.00 30.37  ? 249 PHE B CA  1 
ATOM   1621 C C   . PHE B 1 49  ? 14.767  -0.986  -13.531 1.00 28.22  ? 249 PHE B C   1 
ATOM   1622 O O   . PHE B 1 49  ? 15.872  -1.084  -12.996 1.00 25.32  ? 249 PHE B O   1 
ATOM   1623 C CB  . PHE B 1 49  ? 13.649  -2.811  -14.814 1.00 28.24  ? 249 PHE B CB  1 
ATOM   1624 C CG  . PHE B 1 49  ? 14.965  -3.013  -15.547 1.00 28.28  ? 249 PHE B CG  1 
ATOM   1625 C CD1 . PHE B 1 49  ? 16.030  -3.668  -14.964 1.00 28.59  ? 249 PHE B CD1 1 
ATOM   1626 C CD2 . PHE B 1 49  ? 15.117  -2.539  -16.837 1.00 33.89  ? 249 PHE B CD2 1 
ATOM   1627 C CE1 . PHE B 1 49  ? 17.221  -3.841  -15.629 1.00 34.63  ? 249 PHE B CE1 1 
ATOM   1628 C CE2 . PHE B 1 49  ? 16.304  -2.711  -17.522 1.00 44.89  ? 249 PHE B CE2 1 
ATOM   1629 C CZ  . PHE B 1 49  ? 17.361  -3.375  -16.922 1.00 47.53  ? 249 PHE B CZ  1 
ATOM   1630 N N   . PHE B 1 50  ? 14.420  0.098   -14.223 1.00 33.84  ? 250 PHE B N   1 
ATOM   1631 C CA  . PHE B 1 50  ? 15.373  1.198   -14.380 1.00 38.98  ? 250 PHE B CA  1 
ATOM   1632 C C   . PHE B 1 50  ? 15.891  1.710   -13.035 1.00 39.93  ? 250 PHE B C   1 
ATOM   1633 O O   . PHE B 1 50  ? 17.066  1.992   -12.854 1.00 37.41  ? 250 PHE B O   1 
ATOM   1634 C CB  . PHE B 1 50  ? 14.748  2.376   -15.110 1.00 25.68  ? 250 PHE B CB  1 
ATOM   1635 C CG  . PHE B 1 50  ? 14.245  2.153   -16.515 1.00 27.33  ? 250 PHE B CG  1 
ATOM   1636 C CD1 . PHE B 1 50  ? 14.780  1.156   -17.314 1.00 33.78  ? 250 PHE B CD1 1 
ATOM   1637 C CD2 . PHE B 1 50  ? 13.232  2.970   -17.010 1.00 23.37  ? 250 PHE B CD2 1 
ATOM   1638 C CE1 . PHE B 1 50  ? 14.327  0.948   -18.609 1.00 23.27  ? 250 PHE B CE1 1 
ATOM   1639 C CE2 . PHE B 1 50  ? 12.779  2.774   -18.304 1.00 31.13  ? 250 PHE B CE2 1 
ATOM   1640 C CZ  . PHE B 1 50  ? 13.326  1.779   -19.095 1.00 29.01  ? 250 PHE B CZ  1 
ATOM   1641 N N   . ILE B 1 51  ? 14.994  1.851   -12.068 1.00 41.89  ? 251 ILE B N   1 
ATOM   1642 C CA  . ILE B 1 51  ? 15.384  2.412   -10.779 1.00 48.92  ? 251 ILE B CA  1 
ATOM   1643 C C   . ILE B 1 51  ? 16.168  1.415   -9.947  1.00 49.00  ? 251 ILE B C   1 
ATOM   1644 O O   . ILE B 1 51  ? 17.125  1.760   -9.248  1.00 45.50  ? 251 ILE B O   1 
ATOM   1645 C CB  . ILE B 1 51  ? 14.124  2.881   -10.023 1.00 49.46  ? 251 ILE B CB  1 
ATOM   1646 C CG1 . ILE B 1 51  ? 13.602  4.230   -10.531 1.00 50.11  ? 251 ILE B CG1 1 
ATOM   1647 C CG2 . ILE B 1 51  ? 14.359  2.900   -8.524  1.00 46.93  ? 251 ILE B CG2 1 
ATOM   1648 C CD1 . ILE B 1 51  ? 12.100  4.297   -10.669 1.00 44.61  ? 251 ILE B CD1 1 
ATOM   1649 N N   . VAL B 1 52  ? 15.780  0.138   -10.014 1.00 41.89  ? 252 VAL B N   1 
ATOM   1650 C CA  . VAL B 1 52  ? 16.544  -0.841  -9.237  1.00 33.88  ? 252 VAL B CA  1 
ATOM   1651 C C   . VAL B 1 52  ? 17.962  -0.926  -9.776  1.00 31.20  ? 252 VAL B C   1 
ATOM   1652 O O   . VAL B 1 52  ? 18.900  -0.945  -8.985  1.00 27.75  ? 252 VAL B O   1 
ATOM   1653 C CB  . VAL B 1 52  ? 15.885  -2.231  -9.260  1.00 34.31  ? 252 VAL B CB  1 
ATOM   1654 C CG1 . VAL B 1 52  ? 16.853  -3.297  -8.766  1.00 27.01  ? 252 VAL B CG1 1 
ATOM   1655 C CG2 . VAL B 1 52  ? 14.609  -2.228  -8.434  1.00 18.67  ? 252 VAL B CG2 1 
ATOM   1656 N N   . ASP B 1 53  ? 18.121  -0.980  -11.103 1.00 32.57  ? 253 ASP B N   1 
ATOM   1657 C CA  . ASP B 1 53  ? 19.455  -1.085  -11.687 1.00 36.72  ? 253 ASP B CA  1 
ATOM   1658 C C   . ASP B 1 53  ? 20.342  0.082   -11.253 1.00 40.76  ? 253 ASP B C   1 
ATOM   1659 O O   . ASP B 1 53  ? 21.564  -0.063  -11.185 1.00 43.59  ? 253 ASP B O   1 
ATOM   1660 C CB  . ASP B 1 53  ? 19.425  -1.133  -13.215 1.00 31.15  ? 253 ASP B CB  1 
ATOM   1661 C CG  . ASP B 1 53  ? 20.780  -1.527  -13.778 1.00 36.14  ? 253 ASP B CG  1 
ATOM   1662 O OD1 . ASP B 1 53  ? 21.635  -1.963  -12.982 1.00 42.52  ? 253 ASP B OD1 1 
ATOM   1663 O OD2 . ASP B 1 53  ? 20.991  -1.408  -15.004 1.00 44.55  ? 253 ASP B OD2 1 
ATOM   1664 N N   . LEU B 1 54  ? 19.716  1.218   -10.974 1.00 41.34  ? 254 LEU B N   1 
ATOM   1665 C CA  . LEU B 1 54  ? 20.430  2.393   -10.472 1.00 51.87  ? 254 LEU B CA  1 
ATOM   1666 C C   . LEU B 1 54  ? 20.796  2.206   -8.998  1.00 50.04  ? 254 LEU B C   1 
ATOM   1667 O O   . LEU B 1 54  ? 21.936  2.404   -8.579  1.00 43.65  ? 254 LEU B O   1 
ATOM   1668 C CB  . LEU B 1 54  ? 19.583  3.647   -10.673 1.00 53.16  ? 254 LEU B CB  1 
ATOM   1669 C CG  . LEU B 1 54  ? 20.175  4.797   -11.483 1.00 49.81  ? 254 LEU B CG  1 
ATOM   1670 C CD1 . LEU B 1 54  ? 21.037  4.281   -12.619 1.00 60.09  ? 254 LEU B CD1 1 
ATOM   1671 C CD2 . LEU B 1 54  ? 19.073  5.702   -12.021 1.00 52.98  ? 254 LEU B CD2 1 
ATOM   1672 N N   . LEU B 1 55  ? 19.800  1.820   -8.212  1.00 53.16  ? 255 LEU B N   1 
ATOM   1673 C CA  . LEU B 1 55  ? 19.948  1.505   -6.799  1.00 49.83  ? 255 LEU B CA  1 
ATOM   1674 C C   . LEU B 1 55  ? 21.166  0.619   -6.568  1.00 44.37  ? 255 LEU B C   1 
ATOM   1675 O O   . LEU B 1 55  ? 22.157  1.004   -5.955  1.00 50.07  ? 255 LEU B O   1 
ATOM   1676 C CB  . LEU B 1 55  ? 18.698  0.791   -6.286  1.00 46.44  ? 255 LEU B CB  1 
ATOM   1677 C CG  . LEU B 1 55  ? 17.913  1.479   -5.174  1.00 49.98  ? 255 LEU B CG  1 
ATOM   1678 C CD1 . LEU B 1 55  ? 16.884  0.532   -4.582  1.00 40.44  ? 255 LEU B CD1 1 
ATOM   1679 C CD2 . LEU B 1 55  ? 18.858  2.004   -4.101  1.00 67.18  ? 255 LEU B CD2 1 
ATOM   1680 N N   . VAL B 1 56  ? 21.064  -0.581  -7.113  1.00 38.54  ? 256 VAL B N   1 
ATOM   1681 C CA  . VAL B 1 56  ? 22.083  -1.615  -7.071  1.00 39.93  ? 256 VAL B CA  1 
ATOM   1682 C C   . VAL B 1 56  ? 23.437  -1.139  -7.571  1.00 44.97  ? 256 VAL B C   1 
ATOM   1683 O O   . VAL B 1 56  ? 24.487  -1.728  -7.283  1.00 50.17  ? 256 VAL B O   1 
ATOM   1684 C CB  . VAL B 1 56  ? 21.574  -2.820  -7.896  1.00 38.90  ? 256 VAL B CB  1 
ATOM   1685 C CG1 . VAL B 1 56  ? 22.661  -3.402  -8.783  1.00 34.34  ? 256 VAL B CG1 1 
ATOM   1686 C CG2 . VAL B 1 56  ? 21.011  -3.870  -6.948  1.00 35.83  ? 256 VAL B CG2 1 
ATOM   1687 N N   . GLN B 1 57  ? 23.479  -0.056  -8.338  1.00 47.34  ? 257 GLN B N   1 
ATOM   1688 C CA  . GLN B 1 57  ? 24.722  0.411   -8.938  1.00 51.06  ? 257 GLN B CA  1 
ATOM   1689 C C   . GLN B 1 57  ? 25.409  1.483   -8.103  1.00 53.38  ? 257 GLN B C   1 
ATOM   1690 O O   . GLN B 1 57  ? 26.638  1.510   -7.972  1.00 50.75  ? 257 GLN B O   1 
ATOM   1691 C CB  . GLN B 1 57  ? 24.404  0.940   -10.338 1.00 55.68  ? 257 GLN B CB  1 
ATOM   1692 C CG  . GLN B 1 57  ? 25.471  0.689   -11.393 1.00 61.79  ? 257 GLN B CG  1 
ATOM   1693 C CD  . GLN B 1 57  ? 24.908  0.770   -12.802 1.00 62.49  ? 257 GLN B CD  1 
ATOM   1694 O OE1 . GLN B 1 57  ? 25.535  1.301   -13.717 1.00 55.00  ? 257 GLN B OE1 1 
ATOM   1695 N NE2 . GLN B 1 57  ? 23.702  0.233   -12.963 1.00 62.57  ? 257 GLN B NE2 1 
ATOM   1696 N N   . TYR B 1 58  ? 24.612  2.386   -7.538  1.00 49.52  ? 258 TYR B N   1 
ATOM   1697 C CA  . TYR B 1 58  ? 25.168  3.568   -6.894  1.00 61.37  ? 258 TYR B CA  1 
ATOM   1698 C C   . TYR B 1 58  ? 24.919  3.586   -5.400  1.00 64.55  ? 258 TYR B C   1 
ATOM   1699 O O   . TYR B 1 58  ? 25.514  4.382   -4.671  1.00 69.99  ? 258 TYR B O   1 
ATOM   1700 C CB  . TYR B 1 58  ? 24.587  4.828   -7.575  1.00 69.80  ? 258 TYR B CB  1 
ATOM   1701 C CG  . TYR B 1 58  ? 25.113  4.947   -8.994  1.00 79.43  ? 258 TYR B CG  1 
ATOM   1702 C CD1 . TYR B 1 58  ? 26.363  5.492   -9.249  1.00 86.00  ? 258 TYR B CD1 1 
ATOM   1703 C CD2 . TYR B 1 58  ? 24.358  4.510   -10.077 1.00 86.29  ? 258 TYR B CD2 1 
ATOM   1704 C CE1 . TYR B 1 58  ? 26.849  5.604   -10.539 1.00 89.65  ? 258 TYR B CE1 1 
ATOM   1705 C CE2 . TYR B 1 58  ? 24.837  4.617   -11.370 1.00 93.08  ? 258 TYR B CE2 1 
ATOM   1706 C CZ  . TYR B 1 58  ? 26.083  5.165   -11.599 1.00 93.56  ? 258 TYR B CZ  1 
ATOM   1707 O OH  . TYR B 1 58  ? 26.571  5.277   -12.883 1.00 85.03  ? 258 TYR B OH  1 
ATOM   1708 N N   . SER B 1 59  ? 24.048  2.702   -4.924  1.00 72.11  ? 259 SER B N   1 
ATOM   1709 C CA  . SER B 1 59  ? 23.793  2.645   -3.484  1.00 76.35  ? 259 SER B CA  1 
ATOM   1710 C C   . SER B 1 59  ? 25.084  2.324   -2.735  1.00 80.07  ? 259 SER B C   1 
ATOM   1711 O O   . SER B 1 59  ? 25.924  1.582   -3.248  1.00 83.06  ? 259 SER B O   1 
ATOM   1712 C CB  . SER B 1 59  ? 22.713  1.610   -3.178  1.00 75.82  ? 259 SER B CB  1 
ATOM   1713 O OG  . SER B 1 59  ? 22.600  1.359   -1.788  1.00 78.72  ? 259 SER B OG  1 
ATOM   1714 N N   . PRO B 1 60  ? 25.247  2.883   -1.545  1.00 83.89  ? 260 PRO B N   1 
ATOM   1715 C CA  . PRO B 1 60  ? 26.443  2.632   -0.734  1.00 83.91  ? 260 PRO B CA  1 
ATOM   1716 C C   . PRO B 1 60  ? 26.430  1.213   -0.161  1.00 84.70  ? 260 PRO B C   1 
ATOM   1717 O O   . PRO B 1 60  ? 27.381  0.462   -0.359  1.00 81.34  ? 260 PRO B O   1 
ATOM   1718 C CB  . PRO B 1 60  ? 26.352  3.655   0.395   1.00 80.00  ? 260 PRO B CB  1 
ATOM   1719 C CG  . PRO B 1 60  ? 25.240  4.579   0.036   1.00 80.65  ? 260 PRO B CG  1 
ATOM   1720 C CD  . PRO B 1 60  ? 24.316  3.805   -0.869  1.00 83.96  ? 260 PRO B CD  1 
ATOM   1721 N N   . ASN B 1 61  ? 25.346  0.881   0.529   1.00 83.83  ? 261 ASN B N   1 
ATOM   1722 C CA  . ASN B 1 61  ? 25.105  -0.424  1.120   1.00 78.93  ? 261 ASN B CA  1 
ATOM   1723 C C   . ASN B 1 61  ? 24.349  -1.339  0.160   1.00 77.43  ? 261 ASN B C   1 
ATOM   1724 O O   . ASN B 1 61  ? 23.126  -1.237  0.032   1.00 69.19  ? 261 ASN B O   1 
ATOM   1725 C CB  . ASN B 1 61  ? 24.307  -0.272  2.415   1.00 79.00  ? 261 ASN B CB  1 
ATOM   1726 C CG  . ASN B 1 61  ? 24.464  -1.436  3.371   1.00 81.24  ? 261 ASN B CG  1 
ATOM   1727 O OD1 . ASN B 1 61  ? 25.566  -1.736  3.840   1.00 75.31  ? 261 ASN B OD1 1 
ATOM   1728 N ND2 . ASN B 1 61  ? 23.346  -2.091  3.666   1.00 74.27  ? 261 ASN B ND2 1 
ATOM   1729 N N   . LYS B 1 62  ? 25.069  -2.234  -0.502  1.00 77.42  ? 262 LYS B N   1 
ATOM   1730 C CA  . LYS B 1 62  ? 24.525  -3.186  -1.456  1.00 69.83  ? 262 LYS B CA  1 
ATOM   1731 C C   . LYS B 1 62  ? 23.823  -4.352  -0.762  1.00 66.21  ? 262 LYS B C   1 
ATOM   1732 O O   . LYS B 1 62  ? 23.938  -5.494  -1.211  1.00 52.31  ? 262 LYS B O   1 
ATOM   1733 C CB  . LYS B 1 62  ? 25.636  -3.746  -2.346  1.00 65.86  ? 262 LYS B CB  1 
ATOM   1734 C CG  . LYS B 1 62  ? 25.852  -3.004  -3.651  1.00 58.18  ? 262 LYS B CG  1 
ATOM   1735 C CD  . LYS B 1 62  ? 25.928  -1.501  -3.434  1.00 53.19  ? 262 LYS B CD  1 
ATOM   1736 C CE  . LYS B 1 62  ? 26.390  -0.809  -4.709  1.00 54.29  ? 262 LYS B CE  1 
ATOM   1737 N NZ  . LYS B 1 62  ? 27.800  -1.164  -5.048  1.00 50.79  ? 262 LYS B NZ  1 
ATOM   1738 N N   . ARG B 1 63  ? 23.113  -4.061  0.316   1.00 67.15  ? 263 ARG B N   1 
ATOM   1739 C CA  . ARG B 1 63  ? 22.475  -5.060  1.151   1.00 73.05  ? 263 ARG B CA  1 
ATOM   1740 C C   . ARG B 1 63  ? 20.958  -5.026  1.002   1.00 67.82  ? 263 ARG B C   1 
ATOM   1741 O O   . ARG B 1 63  ? 20.364  -3.951  0.904   1.00 61.67  ? 263 ARG B O   1 
ATOM   1742 C CB  . ARG B 1 63  ? 22.864  -4.848  2.617   1.00 82.81  ? 263 ARG B CB  1 
ATOM   1743 C CG  . ARG B 1 63  ? 24.350  -5.050  2.894   1.00 93.12  ? 263 ARG B CG  1 
ATOM   1744 C CD  . ARG B 1 63  ? 24.636  -5.095  4.391   1.00 102.39 ? 263 ARG B CD  1 
ATOM   1745 N NE  . ARG B 1 63  ? 25.030  -6.444  4.832   1.00 104.65 ? 263 ARG B NE  1 
ATOM   1746 C CZ  . ARG B 1 63  ? 26.280  -6.879  4.892   1.00 101.98 ? 263 ARG B CZ  1 
ATOM   1747 N NH1 . ARG B 1 63  ? 27.278  -6.068  4.559   1.00 82.26  ? 263 ARG B NH1 1 
ATOM   1748 N NH2 . ARG B 1 63  ? 26.532  -8.117  5.292   1.00 91.16  ? 263 ARG B NH2 1 
ATOM   1749 N N   . GLU B 1 64  ? 20.359  -6.212  0.990   1.00 65.52  ? 264 GLU B N   1 
ATOM   1750 C CA  . GLU B 1 64  ? 18.914  -6.334  0.839   1.00 71.58  ? 264 GLU B CA  1 
ATOM   1751 C C   . GLU B 1 64  ? 18.197  -5.444  1.850   1.00 75.81  ? 264 GLU B C   1 
ATOM   1752 O O   . GLU B 1 64  ? 17.147  -4.880  1.549   1.00 86.46  ? 264 GLU B O   1 
ATOM   1753 C CB  . GLU B 1 64  ? 18.463  -7.787  1.000   1.00 75.71  ? 264 GLU B CB  1 
ATOM   1754 C CG  . GLU B 1 64  ? 17.114  -8.104  0.375   1.00 78.24  ? 264 GLU B CG  1 
ATOM   1755 C CD  . GLU B 1 64  ? 15.947  -7.791  1.295   1.00 82.66  ? 264 GLU B CD  1 
ATOM   1756 O OE1 . GLU B 1 64  ? 16.146  -7.751  2.528   1.00 96.69  ? 264 GLU B OE1 1 
ATOM   1757 O OE2 . GLU B 1 64  ? 14.820  -7.579  0.797   1.00 79.17  ? 264 GLU B OE2 1 
ATOM   1758 N N   . GLY B 1 65  ? 18.778  -5.329  3.036   1.00 81.97  ? 265 GLY B N   1 
ATOM   1759 C CA  . GLY B 1 65  ? 18.232  -4.557  4.135   1.00 80.91  ? 265 GLY B CA  1 
ATOM   1760 C C   . GLY B 1 65  ? 18.139  -3.073  3.829   1.00 73.47  ? 265 GLY B C   1 
ATOM   1761 O O   . GLY B 1 65  ? 17.072  -2.485  3.998   1.00 56.75  ? 265 GLY B O   1 
ATOM   1762 N N   . PHE B 1 66  ? 19.253  -2.513  3.390   1.00 74.09  ? 266 PHE B N   1 
ATOM   1763 C CA  . PHE B 1 66  ? 19.367  -1.138  2.931   1.00 77.68  ? 266 PHE B CA  1 
ATOM   1764 C C   . PHE B 1 66  ? 18.566  -0.918  1.647   1.00 72.79  ? 266 PHE B C   1 
ATOM   1765 O O   . PHE B 1 66  ? 17.723  -0.023  1.578   1.00 73.58  ? 266 PHE B O   1 
ATOM   1766 C CB  . PHE B 1 66  ? 20.837  -0.783  2.696   1.00 78.81  ? 266 PHE B CB  1 
ATOM   1767 C CG  . PHE B 1 66  ? 21.112  0.662   2.321   1.00 78.13  ? 266 PHE B CG  1 
ATOM   1768 C CD1 . PHE B 1 66  ? 20.879  1.684   3.223   1.00 79.15  ? 266 PHE B CD1 1 
ATOM   1769 C CD2 . PHE B 1 66  ? 21.603  0.987   1.068   1.00 76.91  ? 266 PHE B CD2 1 
ATOM   1770 C CE1 . PHE B 1 66  ? 21.127  3.002   2.896   1.00 78.68  ? 266 PHE B CE1 1 
ATOM   1771 C CE2 . PHE B 1 66  ? 21.855  2.304   0.734   1.00 75.48  ? 266 PHE B CE2 1 
ATOM   1772 C CZ  . PHE B 1 66  ? 21.621  3.318   1.641   1.00 76.69  ? 266 PHE B CZ  1 
ATOM   1773 N N   . LEU B 1 67  ? 18.841  -1.739  0.642   1.00 61.99  ? 267 LEU B N   1 
ATOM   1774 C CA  . LEU B 1 67  ? 18.242  -1.607  -0.677  1.00 57.93  ? 267 LEU B CA  1 
ATOM   1775 C C   . LEU B 1 67  ? 16.726  -1.451  -0.647  1.00 55.44  ? 267 LEU B C   1 
ATOM   1776 O O   . LEU B 1 67  ? 16.206  -0.390  -0.997  1.00 76.33  ? 267 LEU B O   1 
ATOM   1777 C CB  . LEU B 1 67  ? 18.618  -2.818  -1.547  1.00 53.67  ? 267 LEU B CB  1 
ATOM   1778 C CG  . LEU B 1 67  ? 20.114  -2.943  -1.846  1.00 53.14  ? 267 LEU B CG  1 
ATOM   1779 C CD1 . LEU B 1 67  ? 20.361  -3.845  -3.043  1.00 55.58  ? 267 LEU B CD1 1 
ATOM   1780 C CD2 . LEU B 1 67  ? 20.719  -1.561  -2.053  1.00 56.98  ? 267 LEU B CD2 1 
ATOM   1781 N N   . SER B 1 68  ? 16.026  -2.492  -0.247  1.00 50.48  ? 268 SER B N   1 
ATOM   1782 C CA  . SER B 1 68  ? 14.582  -2.620  -0.300  1.00 59.46  ? 268 SER B CA  1 
ATOM   1783 C C   . SER B 1 68  ? 13.783  -1.496  0.330   1.00 67.61  ? 268 SER B C   1 
ATOM   1784 O O   . SER B 1 68  ? 12.709  -1.185  -0.215  1.00 79.91  ? 268 SER B O   1 
ATOM   1785 C CB  . SER B 1 68  ? 14.192  -3.961  0.359   1.00 67.13  ? 268 SER B CB  1 
ATOM   1786 O OG  . SER B 1 68  ? 14.605  -5.030  -0.484  1.00 73.64  ? 268 SER B OG  1 
ATOM   1787 N N   . PRO B 1 69  ? 14.162  -0.860  1.426   1.00 73.32  ? 269 PRO B N   1 
ATOM   1788 C CA  . PRO B 1 69  ? 13.394  0.305   1.902   1.00 67.83  ? 269 PRO B CA  1 
ATOM   1789 C C   . PRO B 1 69  ? 13.861  1.575   1.201   1.00 59.60  ? 269 PRO B C   1 
ATOM   1790 O O   . PRO B 1 69  ? 13.103  2.528   1.041   1.00 48.13  ? 269 PRO B O   1 
ATOM   1791 C CB  . PRO B 1 69  ? 13.701  0.343   3.392   1.00 71.16  ? 269 PRO B CB  1 
ATOM   1792 C CG  . PRO B 1 69  ? 14.994  -0.369  3.567   1.00 78.16  ? 269 PRO B CG  1 
ATOM   1793 C CD  . PRO B 1 69  ? 15.277  -1.150  2.326   1.00 77.85  ? 269 PRO B CD  1 
ATOM   1794 N N   . LEU B 1 70  ? 15.115  1.598   0.759   1.00 60.18  ? 270 LEU B N   1 
ATOM   1795 C CA  . LEU B 1 70  ? 15.564  2.681   -0.116  1.00 55.41  ? 270 LEU B CA  1 
ATOM   1796 C C   . LEU B 1 70  ? 14.772  2.578   -1.422  1.00 57.96  ? 270 LEU B C   1 
ATOM   1797 O O   . LEU B 1 70  ? 14.240  3.555   -1.940  1.00 59.50  ? 270 LEU B O   1 
ATOM   1798 C CB  . LEU B 1 70  ? 17.053  2.591   -0.373  1.00 56.02  ? 270 LEU B CB  1 
ATOM   1799 C CG  . LEU B 1 70  ? 17.875  3.826   -0.697  1.00 57.13  ? 270 LEU B CG  1 
ATOM   1800 C CD1 . LEU B 1 70  ? 19.290  3.418   -1.104  1.00 48.83  ? 270 LEU B CD1 1 
ATOM   1801 C CD2 . LEU B 1 70  ? 17.271  4.685   -1.801  1.00 52.31  ? 270 LEU B CD2 1 
ATOM   1802 N N   . LYS B 1 71  ? 14.697  1.357   -1.938  1.00 58.72  ? 271 LYS B N   1 
ATOM   1803 C CA  . LYS B 1 71  ? 13.957  1.068   -3.160  1.00 61.31  ? 271 LYS B CA  1 
ATOM   1804 C C   . LYS B 1 71  ? 12.526  1.580   -3.096  1.00 51.80  ? 271 LYS B C   1 
ATOM   1805 O O   . LYS B 1 71  ? 12.094  2.339   -3.970  1.00 45.95  ? 271 LYS B O   1 
ATOM   1806 C CB  . LYS B 1 71  ? 13.946  -0.437  -3.444  1.00 65.77  ? 271 LYS B CB  1 
ATOM   1807 C CG  . LYS B 1 71  ? 12.866  -0.876  -4.423  1.00 66.99  ? 271 LYS B CG  1 
ATOM   1808 C CD  . LYS B 1 71  ? 12.952  -2.377  -4.678  1.00 64.37  ? 271 LYS B CD  1 
ATOM   1809 C CE  . LYS B 1 71  ? 11.846  -2.831  -5.610  1.00 58.34  ? 271 LYS B CE  1 
ATOM   1810 N NZ  . LYS B 1 71  ? 10.538  -2.242  -5.215  1.00 54.56  ? 271 LYS B NZ  1 
ATOM   1811 N N   . ALA B 1 72  ? 11.767  1.189   -2.074  1.00 52.51  ? 272 ALA B N   1 
ATOM   1812 C CA  . ALA B 1 72  ? 10.355  1.577   -2.010  1.00 55.29  ? 272 ALA B CA  1 
ATOM   1813 C C   . ALA B 1 72  ? 10.162  3.069   -1.765  1.00 58.13  ? 272 ALA B C   1 
ATOM   1814 O O   . ALA B 1 72  ? 9.034   3.565   -1.739  1.00 56.56  ? 272 ALA B O   1 
ATOM   1815 C CB  . ALA B 1 72  ? 9.624   0.763   -0.955  1.00 38.85  ? 272 ALA B CB  1 
ATOM   1816 N N   . TYR B 1 73  ? 11.239  3.824   -1.593  1.00 68.28  ? 273 TYR B N   1 
ATOM   1817 C CA  . TYR B 1 73  ? 11.159  5.276   -1.548  1.00 80.19  ? 273 TYR B CA  1 
ATOM   1818 C C   . TYR B 1 73  ? 11.220  5.844   -2.969  1.00 70.92  ? 273 TYR B C   1 
ATOM   1819 O O   . TYR B 1 73  ? 10.475  6.758   -3.310  1.00 59.59  ? 273 TYR B O   1 
ATOM   1820 C CB  . TYR B 1 73  ? 12.293  5.853   -0.698  1.00 96.14  ? 273 TYR B CB  1 
ATOM   1821 C CG  . TYR B 1 73  ? 11.820  6.478   0.592   1.00 98.34  ? 273 TYR B CG  1 
ATOM   1822 C CD1 . TYR B 1 73  ? 11.263  7.758   0.596   1.00 104.68 ? 273 TYR B CD1 1 
ATOM   1823 C CD2 . TYR B 1 73  ? 11.912  5.787   1.797   1.00 107.96 ? 273 TYR B CD2 1 
ATOM   1824 C CE1 . TYR B 1 73  ? 10.830  8.330   1.778   1.00 105.06 ? 273 TYR B CE1 1 
ATOM   1825 C CE2 . TYR B 1 73  ? 11.478  6.359   2.979   1.00 108.60 ? 273 TYR B CE2 1 
ATOM   1826 C CZ  . TYR B 1 73  ? 10.946  7.630   2.964   1.00 111.69 ? 273 TYR B CZ  1 
ATOM   1827 O OH  . TYR B 1 73  ? 10.512  8.202   4.141   1.00 117.07 ? 273 TYR B OH  1 
ATOM   1828 N N   . LEU B 1 74  ? 12.125  5.265   -3.743  1.00 61.94  ? 274 LEU B N   1 
ATOM   1829 C CA  . LEU B 1 74  ? 12.427  5.636   -5.112  1.00 56.15  ? 274 LEU B CA  1 
ATOM   1830 C C   . LEU B 1 74  ? 11.250  5.351   -6.044  1.00 53.48  ? 274 LEU B C   1 
ATOM   1831 O O   . LEU B 1 74  ? 10.978  6.082   -6.996  1.00 38.50  ? 274 LEU B O   1 
ATOM   1832 C CB  . LEU B 1 74  ? 13.664  4.888   -5.613  1.00 59.61  ? 274 LEU B CB  1 
ATOM   1833 C CG  . LEU B 1 74  ? 15.023  5.210   -4.999  1.00 59.07  ? 274 LEU B CG  1 
ATOM   1834 C CD1 . LEU B 1 74  ? 16.142  4.651   -5.875  1.00 41.78  ? 274 LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 1 74  ? 15.212  6.707   -4.794  1.00 47.97  ? 274 LEU B CD2 1 
ATOM   1836 N N   . ILE B 1 75  ? 10.540  4.266   -5.764  1.00 55.16  ? 275 ILE B N   1 
ATOM   1837 C CA  . ILE B 1 75  ? 9.361   3.898   -6.548  1.00 55.51  ? 275 ILE B CA  1 
ATOM   1838 C C   . ILE B 1 75  ? 8.112   4.380   -5.819  1.00 46.86  ? 275 ILE B C   1 
ATOM   1839 O O   . ILE B 1 75  ? 6.996   4.037   -6.197  1.00 43.29  ? 275 ILE B O   1 
ATOM   1840 C CB  . ILE B 1 75  ? 9.299   2.385   -6.811  1.00 59.85  ? 275 ILE B CB  1 
ATOM   1841 C CG1 . ILE B 1 75  ? 10.610  1.802   -7.362  1.00 55.08  ? 275 ILE B CG1 1 
ATOM   1842 C CG2 . ILE B 1 75  ? 8.152   2.004   -7.733  1.00 72.60  ? 275 ILE B CG2 1 
ATOM   1843 C CD1 . ILE B 1 75  ? 10.463  0.377   -7.852  1.00 56.72  ? 275 ILE B CD1 1 
ATOM   1844 N N   . SER B 1 76  ? 8.340   5.184   -4.784  1.00 44.06  ? 276 SER B N   1 
ATOM   1845 C CA  . SER B 1 76  ? 7.269   5.742   -3.967  1.00 45.16  ? 276 SER B CA  1 
ATOM   1846 C C   . SER B 1 76  ? 6.510   6.829   -4.722  1.00 56.73  ? 276 SER B C   1 
ATOM   1847 O O   . SER B 1 76  ? 7.033   7.456   -5.647  1.00 48.77  ? 276 SER B O   1 
ATOM   1848 C CB  . SER B 1 76  ? 7.839   6.262   -2.652  1.00 46.90  ? 276 SER B CB  1 
ATOM   1849 O OG  . SER B 1 76  ? 7.875   7.671   -2.549  1.00 58.32  ? 276 SER B OG  1 
ATOM   1850 N N   . GLU B 1 77  ? 5.253   7.042   -4.335  1.00 61.85  ? 277 GLU B N   1 
ATOM   1851 C CA  . GLU B 1 77  ? 4.439   8.084   -4.950  1.00 68.77  ? 277 GLU B CA  1 
ATOM   1852 C C   . GLU B 1 77  ? 5.175   9.421   -4.941  1.00 62.26  ? 277 GLU B C   1 
ATOM   1853 O O   . GLU B 1 77  ? 5.413   10.025  -5.982  1.00 43.91  ? 277 GLU B O   1 
ATOM   1854 C CB  . GLU B 1 77  ? 3.106   8.225   -4.219  1.00 79.70  ? 277 GLU B CB  1 
ATOM   1855 C CG  . GLU B 1 77  ? 1.895   7.919   -5.087  1.00 89.89  ? 277 GLU B CG  1 
ATOM   1856 C CD  . GLU B 1 77  ? 1.618   9.013   -6.095  1.00 96.88  ? 277 GLU B CD  1 
ATOM   1857 O OE1 . GLU B 1 77  ? 1.616   10.201  -5.703  1.00 103.24 ? 277 GLU B OE1 1 
ATOM   1858 O OE2 . GLU B 1 77  ? 1.392   8.694   -7.282  1.00 105.19 ? 277 GLU B OE2 1 
ATOM   1859 N N   . GLU B 1 78  ? 5.530   9.849   -3.741  1.00 67.04  ? 278 GLU B N   1 
ATOM   1860 C CA  . GLU B 1 78  ? 6.280   11.072  -3.487  1.00 69.06  ? 278 GLU B CA  1 
ATOM   1861 C C   . GLU B 1 78  ? 7.415   11.275  -4.483  1.00 65.90  ? 278 GLU B C   1 
ATOM   1862 O O   . GLU B 1 78  ? 7.575   12.345  -5.081  1.00 73.16  ? 278 GLU B O   1 
ATOM   1863 C CB  . GLU B 1 78  ? 6.801   11.026  -2.048  1.00 68.56  ? 278 GLU B CB  1 
ATOM   1864 C CG  . GLU B 1 78  ? 7.181   12.368  -1.440  1.00 71.19  ? 278 GLU B CG  1 
ATOM   1865 C CD  . GLU B 1 78  ? 8.132   12.199  -0.268  1.00 79.48  ? 278 GLU B CD  1 
ATOM   1866 O OE1 . GLU B 1 78  ? 7.655   11.976  0.864   1.00 85.27  ? 278 GLU B OE1 1 
ATOM   1867 O OE2 . GLU B 1 78  ? 9.359   12.279  -0.486  1.00 90.27  ? 278 GLU B OE2 1 
ATOM   1868 N N   . PHE B 1 79  ? 8.237   10.247  -4.698  1.00 59.98  ? 279 PHE B N   1 
ATOM   1869 C CA  . PHE B 1 79  ? 9.333   10.419  -5.649  1.00 52.69  ? 279 PHE B CA  1 
ATOM   1870 C C   . PHE B 1 79  ? 8.777   10.522  -7.068  1.00 49.63  ? 279 PHE B C   1 
ATOM   1871 O O   . PHE B 1 79  ? 9.179   11.413  -7.812  1.00 56.26  ? 279 PHE B O   1 
ATOM   1872 C CB  . PHE B 1 79  ? 10.355  9.288   -5.584  1.00 53.69  ? 279 PHE B CB  1 
ATOM   1873 C CG  . PHE B 1 79  ? 11.696  9.637   -6.224  1.00 52.24  ? 279 PHE B CG  1 
ATOM   1874 C CD1 . PHE B 1 79  ? 12.584  10.499  -5.599  1.00 48.34  ? 279 PHE B CD1 1 
ATOM   1875 C CD2 . PHE B 1 79  ? 12.055  9.096   -7.446  1.00 45.65  ? 279 PHE B CD2 1 
ATOM   1876 C CE1 . PHE B 1 79  ? 13.800  10.812  -6.184  1.00 51.96  ? 279 PHE B CE1 1 
ATOM   1877 C CE2 . PHE B 1 79  ? 13.270  9.407   -8.033  1.00 53.50  ? 279 PHE B CE2 1 
ATOM   1878 C CZ  . PHE B 1 79  ? 14.152  10.271  -7.410  1.00 51.91  ? 279 PHE B CZ  1 
ATOM   1879 N N   . PHE B 1 80  ? 7.878   9.597   -7.389  1.00 45.54  ? 280 PHE B N   1 
ATOM   1880 C CA  . PHE B 1 80  ? 7.346   9.512   -8.742  1.00 47.40  ? 280 PHE B CA  1 
ATOM   1881 C C   . PHE B 1 80  ? 6.782   10.870  -9.143  1.00 51.93  ? 280 PHE B C   1 
ATOM   1882 O O   . PHE B 1 80  ? 7.087   11.381  -10.217 1.00 54.70  ? 280 PHE B O   1 
ATOM   1883 C CB  . PHE B 1 80  ? 6.292   8.419   -8.855  1.00 49.39  ? 280 PHE B CB  1 
ATOM   1884 C CG  . PHE B 1 80  ? 6.828   7.077   -9.328  1.00 45.70  ? 280 PHE B CG  1 
ATOM   1885 C CD1 . PHE B 1 80  ? 8.135   6.704   -9.071  1.00 41.38  ? 280 PHE B CD1 1 
ATOM   1886 C CD2 . PHE B 1 80  ? 6.006   6.207   -10.029 1.00 44.99  ? 280 PHE B CD2 1 
ATOM   1887 C CE1 . PHE B 1 80  ? 8.619   5.481   -9.507  1.00 40.46  ? 280 PHE B CE1 1 
ATOM   1888 C CE2 . PHE B 1 80  ? 6.483   4.979   -10.459 1.00 39.91  ? 280 PHE B CE2 1 
ATOM   1889 C CZ  . PHE B 1 80  ? 7.787   4.609   -10.192 1.00 32.03  ? 280 PHE B CZ  1 
ATOM   1890 N N   . ASN B 1 81  ? 5.981   11.461  -8.263  1.00 57.20  ? 281 ASN B N   1 
ATOM   1891 C CA  . ASN B 1 81  ? 5.463   12.804  -8.525  1.00 56.44  ? 281 ASN B CA  1 
ATOM   1892 C C   . ASN B 1 81  ? 6.601   13.807  -8.664  1.00 56.39  ? 281 ASN B C   1 
ATOM   1893 O O   . ASN B 1 81  ? 6.582   14.674  -9.537  1.00 66.38  ? 281 ASN B O   1 
ATOM   1894 C CB  . ASN B 1 81  ? 4.494   13.215  -7.417  1.00 49.05  ? 281 ASN B CB  1 
ATOM   1895 C CG  . ASN B 1 81  ? 3.139   12.567  -7.656  1.00 47.47  ? 281 ASN B CG  1 
ATOM   1896 O OD1 . ASN B 1 81  ? 2.178   13.233  -8.042  1.00 54.44  ? 281 ASN B OD1 1 
ATOM   1897 N ND2 . ASN B 1 81  ? 3.069   11.262  -7.434  1.00 58.48  ? 281 ASN B ND2 1 
ATOM   1898 N N   . LEU B 1 82  ? 7.593   13.666  -7.795  1.00 50.91  ? 282 LEU B N   1 
ATOM   1899 C CA  . LEU B 1 82  ? 8.783   14.504  -7.874  1.00 57.17  ? 282 LEU B CA  1 
ATOM   1900 C C   . LEU B 1 82  ? 9.359   14.478  -9.283  1.00 58.22  ? 282 LEU B C   1 
ATOM   1901 O O   . LEU B 1 82  ? 9.667   15.501  -9.880  1.00 53.58  ? 282 LEU B O   1 
ATOM   1902 C CB  . LEU B 1 82  ? 9.827   14.011  -6.874  1.00 67.82  ? 282 LEU B CB  1 
ATOM   1903 C CG  . LEU B 1 82  ? 10.828  15.019  -6.315  1.00 70.98  ? 282 LEU B CG  1 
ATOM   1904 C CD1 . LEU B 1 82  ? 11.024  14.794  -4.819  1.00 66.66  ? 282 LEU B CD1 1 
ATOM   1905 C CD2 . LEU B 1 82  ? 12.152  14.933  -7.057  1.00 78.00  ? 282 LEU B CD2 1 
ATOM   1906 N N   . LEU B 1 83  ? 9.504   13.264  -9.813  1.00 59.61  ? 283 LEU B N   1 
ATOM   1907 C CA  . LEU B 1 83  ? 10.090  13.089  -11.133 1.00 53.30  ? 283 LEU B CA  1 
ATOM   1908 C C   . LEU B 1 83  ? 9.165   13.666  -12.205 1.00 51.41  ? 283 LEU B C   1 
ATOM   1909 O O   . LEU B 1 83  ? 9.614   14.344  -13.123 1.00 45.03  ? 283 LEU B O   1 
ATOM   1910 C CB  . LEU B 1 83  ? 10.339  11.617  -11.437 1.00 44.57  ? 283 LEU B CB  1 
ATOM   1911 C CG  . LEU B 1 83  ? 11.221  10.822  -10.484 1.00 50.62  ? 283 LEU B CG  1 
ATOM   1912 C CD1 . LEU B 1 83  ? 10.824  9.352   -10.483 1.00 46.75  ? 283 LEU B CD1 1 
ATOM   1913 C CD2 . LEU B 1 83  ? 12.685  10.990  -10.866 1.00 57.75  ? 283 LEU B CD2 1 
ATOM   1914 N N   . ALA B 1 84  ? 7.882   13.356  -12.043 1.00 37.94  ? 284 ALA B N   1 
ATOM   1915 C CA  . ALA B 1 84  ? 6.886   13.776  -13.018 1.00 46.10  ? 284 ALA B CA  1 
ATOM   1916 C C   . ALA B 1 84  ? 6.852   15.294  -13.159 1.00 49.19  ? 284 ALA B C   1 
ATOM   1917 O O   . ALA B 1 84  ? 6.651   15.819  -14.257 1.00 47.60  ? 284 ALA B O   1 
ATOM   1918 C CB  . ALA B 1 84  ? 5.513   13.237  -12.631 1.00 27.98  ? 284 ALA B CB  1 
ATOM   1919 N N   . GLN B 1 85  ? 7.040   15.993  -12.049 1.00 48.17  ? 285 GLN B N   1 
ATOM   1920 C CA  . GLN B 1 85  ? 6.927   17.457  -12.027 1.00 56.21  ? 285 GLN B CA  1 
ATOM   1921 C C   . GLN B 1 85  ? 7.965   18.105  -12.931 1.00 59.07  ? 285 GLN B C   1 
ATOM   1922 O O   . GLN B 1 85  ? 7.823   19.252  -13.367 1.00 52.54  ? 285 GLN B O   1 
ATOM   1923 C CB  . GLN B 1 85  ? 7.018   17.920  -10.577 1.00 57.69  ? 285 GLN B CB  1 
ATOM   1924 C CG  . GLN B 1 85  ? 6.585   19.319  -10.226 1.00 54.06  ? 285 GLN B CG  1 
ATOM   1925 C CD  . GLN B 1 85  ? 5.411   19.838  -11.025 1.00 59.27  ? 285 GLN B CD  1 
ATOM   1926 O OE1 . GLN B 1 85  ? 4.351   19.214  -11.084 1.00 60.09  ? 285 GLN B OE1 1 
ATOM   1927 N NE2 . GLN B 1 85  ? 5.598   21.003  -11.644 1.00 57.91  ? 285 GLN B NE2 1 
ATOM   1928 N N   . LYS B 1 86  ? 9.045   17.401  -13.266 1.00 59.11  ? 286 LYS B N   1 
ATOM   1929 C CA  . LYS B 1 86  ? 10.026  17.956  -14.196 1.00 59.84  ? 286 LYS B CA  1 
ATOM   1930 C C   . LYS B 1 86  ? 9.542   17.799  -15.638 1.00 63.30  ? 286 LYS B C   1 
ATOM   1931 O O   . LYS B 1 86  ? 10.240  18.145  -16.589 1.00 65.14  ? 286 LYS B O   1 
ATOM   1932 C CB  . LYS B 1 86  ? 11.390  17.289  -14.024 1.00 61.54  ? 286 LYS B CB  1 
ATOM   1933 C CG  . LYS B 1 86  ? 11.676  16.820  -12.608 1.00 70.47  ? 286 LYS B CG  1 
ATOM   1934 C CD  . LYS B 1 86  ? 11.986  17.989  -11.681 1.00 73.33  ? 286 LYS B CD  1 
ATOM   1935 C CE  . LYS B 1 86  ? 13.092  17.634  -10.703 1.00 75.26  ? 286 LYS B CE  1 
ATOM   1936 N NZ  . LYS B 1 86  ? 12.558  17.347  -9.342  1.00 87.10  ? 286 LYS B NZ  1 
ATOM   1937 N N   . LEU B 1 87  ? 8.334   17.264  -15.781 1.00 60.29  ? 287 LEU B N   1 
ATOM   1938 C CA  . LEU B 1 87  ? 7.681   17.094  -17.066 1.00 58.32  ? 287 LEU B CA  1 
ATOM   1939 C C   . LEU B 1 87  ? 6.305   17.757  -17.040 1.00 61.03  ? 287 LEU B C   1 
ATOM   1940 O O   . LEU B 1 87  ? 5.572   17.711  -18.027 1.00 59.89  ? 287 LEU B O   1 
ATOM   1941 C CB  . LEU B 1 87  ? 7.500   15.626  -17.437 1.00 57.25  ? 287 LEU B CB  1 
ATOM   1942 C CG  . LEU B 1 87  ? 8.688   14.676  -17.344 1.00 49.46  ? 287 LEU B CG  1 
ATOM   1943 C CD1 . LEU B 1 87  ? 8.210   13.240  -17.529 1.00 35.72  ? 287 LEU B CD1 1 
ATOM   1944 C CD2 . LEU B 1 87  ? 9.771   15.029  -18.352 1.00 34.66  ? 287 LEU B CD2 1 
ATOM   1945 N N   . GLU B 1 88  ? 5.964   18.343  -15.898 1.00 64.57  ? 288 GLU B N   1 
ATOM   1946 C CA  . GLU B 1 88  ? 4.679   18.978  -15.652 1.00 64.20  ? 288 GLU B CA  1 
ATOM   1947 C C   . GLU B 1 88  ? 3.522   18.136  -16.187 1.00 66.20  ? 288 GLU B C   1 
ATOM   1948 O O   . GLU B 1 88  ? 2.549   18.687  -16.705 1.00 70.23  ? 288 GLU B O   1 
ATOM   1949 C CB  . GLU B 1 88  ? 4.648   20.377  -16.282 1.00 66.11  ? 288 GLU B CB  1 
ATOM   1950 C CG  . GLU B 1 88  ? 5.840   21.246  -15.902 1.00 64.35  ? 288 GLU B CG  1 
ATOM   1951 C CD  . GLU B 1 88  ? 5.781   22.660  -16.438 1.00 62.10  ? 288 GLU B CD  1 
ATOM   1952 O OE1 . GLU B 1 88  ? 4.770   23.366  -16.232 1.00 48.43  ? 288 GLU B OE1 1 
ATOM   1953 O OE2 . GLU B 1 88  ? 6.763   23.102  -17.072 1.00 66.42  ? 288 GLU B OE2 1 
ATOM   1954 N N   . LEU B 1 89  ? 3.642   16.822  -16.058 1.00 66.90  ? 289 LEU B N   1 
ATOM   1955 C CA  . LEU B 1 89  ? 2.746   15.833  -16.625 1.00 60.09  ? 289 LEU B CA  1 
ATOM   1956 C C   . LEU B 1 89  ? 1.324   16.056  -16.121 1.00 62.00  ? 289 LEU B C   1 
ATOM   1957 O O   . LEU B 1 89  ? 0.368   15.759  -16.833 1.00 54.84  ? 289 LEU B O   1 
ATOM   1958 C CB  . LEU B 1 89  ? 3.200   14.414  -16.277 1.00 60.25  ? 289 LEU B CB  1 
ATOM   1959 C CG  . LEU B 1 89  ? 2.980   13.333  -17.337 1.00 58.65  ? 289 LEU B CG  1 
ATOM   1960 C CD1 . LEU B 1 89  ? 3.665   12.032  -16.939 1.00 51.36  ? 289 LEU B CD1 1 
ATOM   1961 C CD2 . LEU B 1 89  ? 1.496   13.103  -17.571 1.00 65.66  ? 289 LEU B CD2 1 
ATOM   1962 N N   . HIS B 1 90  ? 1.251   16.566  -14.900 1.00 67.97  ? 290 HIS B N   1 
ATOM   1963 C CA  . HIS B 1 90  ? -0.021  16.830  -14.245 1.00 74.52  ? 290 HIS B CA  1 
ATOM   1964 C C   . HIS B 1 90  ? -0.981  17.569  -15.176 1.00 74.63  ? 290 HIS B C   1 
ATOM   1965 O O   . HIS B 1 90  ? -2.182  17.292  -15.140 1.00 65.37  ? 290 HIS B O   1 
ATOM   1966 C CB  . HIS B 1 90  ? 0.213   17.626  -12.954 1.00 77.08  ? 290 HIS B CB  1 
ATOM   1967 C CG  . HIS B 1 90  ? 0.270   19.106  -13.158 1.00 73.04  ? 290 HIS B CG  1 
ATOM   1968 N ND1 . HIS B 1 90  ? 1.397   19.746  -13.624 1.00 75.62  ? 290 HIS B ND1 1 
ATOM   1969 C CD2 . HIS B 1 90  ? -0.669  20.068  -12.984 1.00 69.87  ? 290 HIS B CD2 1 
ATOM   1970 C CE1 . HIS B 1 90  ? 1.155   21.042  -13.715 1.00 75.72  ? 290 HIS B CE1 1 
ATOM   1971 N NE2 . HIS B 1 90  ? -0.094  21.265  -13.334 1.00 71.21  ? 290 HIS B NE2 1 
ATOM   1972 N N   . LYS B 1 91  ? -0.445  18.471  -15.987 1.00 72.85  ? 291 LYS B N   1 
ATOM   1973 C CA  . LYS B 1 91  ? -1.200  19.393  -16.820 1.00 72.05  ? 291 LYS B CA  1 
ATOM   1974 C C   . LYS B 1 91  ? -1.526  18.797  -18.182 1.00 68.34  ? 291 LYS B C   1 
ATOM   1975 O O   . LYS B 1 91  ? -2.423  19.261  -18.888 1.00 68.53  ? 291 LYS B O   1 
ATOM   1976 C CB  . LYS B 1 91  ? -0.422  20.702  -16.980 1.00 69.40  ? 291 LYS B CB  1 
ATOM   1977 C CG  . LYS B 1 91  ? 0.819   20.590  -17.851 1.00 72.21  ? 291 LYS B CG  1 
ATOM   1978 C CD  . LYS B 1 91  ? 1.229   21.963  -18.370 1.00 78.84  ? 291 LYS B CD  1 
ATOM   1979 C CE  . LYS B 1 91  ? 2.739   22.033  -18.603 1.00 83.75  ? 291 LYS B CE  1 
ATOM   1980 N NZ  . LYS B 1 91  ? 3.235   23.440  -18.541 1.00 82.86  ? 291 LYS B NZ  1 
ATOM   1981 N N   . PHE B 1 92  ? -0.805  17.754  -18.581 1.00 68.42  ? 292 PHE B N   1 
ATOM   1982 C CA  . PHE B 1 92  ? -1.099  17.146  -19.873 1.00 64.86  ? 292 PHE B CA  1 
ATOM   1983 C C   . PHE B 1 92  ? -2.032  15.945  -19.737 1.00 68.05  ? 292 PHE B C   1 
ATOM   1984 O O   . PHE B 1 92  ? -2.460  15.377  -20.747 1.00 77.70  ? 292 PHE B O   1 
ATOM   1985 C CB  . PHE B 1 92  ? 0.188   16.711  -20.563 1.00 56.16  ? 292 PHE B CB  1 
ATOM   1986 C CG  . PHE B 1 92  ? 1.272   17.758  -20.698 1.00 58.11  ? 292 PHE B CG  1 
ATOM   1987 C CD1 . PHE B 1 92  ? 1.283   18.624  -21.783 1.00 55.80  ? 292 PHE B CD1 1 
ATOM   1988 C CD2 . PHE B 1 92  ? 2.283   17.872  -19.759 1.00 53.71  ? 292 PHE B CD2 1 
ATOM   1989 C CE1 . PHE B 1 92  ? 2.284   19.569  -21.917 1.00 50.81  ? 292 PHE B CE1 1 
ATOM   1990 C CE2 . PHE B 1 92  ? 3.287   18.815  -19.891 1.00 52.85  ? 292 PHE B CE2 1 
ATOM   1991 C CZ  . PHE B 1 92  ? 3.290   19.669  -20.977 1.00 47.91  ? 292 PHE B CZ  1 
ATOM   1992 N N   . ILE B 1 93  ? -2.358  15.536  -18.515 1.00 72.68  ? 293 ILE B N   1 
ATOM   1993 C CA  . ILE B 1 93  ? -3.228  14.372  -18.339 1.00 72.15  ? 293 ILE B CA  1 
ATOM   1994 C C   . ILE B 1 93  ? -4.686  14.700  -18.650 1.00 67.97  ? 293 ILE B C   1 
ATOM   1995 O O   . ILE B 1 93  ? -5.184  15.772  -18.312 1.00 60.33  ? 293 ILE B O   1 
ATOM   1996 C CB  . ILE B 1 93  ? -3.125  13.799  -16.911 1.00 69.81  ? 293 ILE B CB  1 
ATOM   1997 C CG1 . ILE B 1 93  ? -1.843  13.007  -16.640 1.00 63.68  ? 293 ILE B CG1 1 
ATOM   1998 C CG2 . ILE B 1 93  ? -4.357  12.962  -16.597 1.00 68.21  ? 293 ILE B CG2 1 
ATOM   1999 C CD1 . ILE B 1 93  ? -1.329  13.133  -15.221 1.00 36.27  ? 293 ILE B CD1 1 
ATOM   2000 N N   . ARG B 1 94  ? -5.365  13.757  -19.295 1.00 67.81  ? 294 ARG B N   1 
ATOM   2001 C CA  . ARG B 1 94  ? -6.731  13.937  -19.766 1.00 67.18  ? 294 ARG B CA  1 
ATOM   2002 C C   . ARG B 1 94  ? -7.749  13.119  -18.982 1.00 66.72  ? 294 ARG B C   1 
ATOM   2003 O O   . ARG B 1 94  ? -8.239  12.100  -19.466 1.00 66.47  ? 294 ARG B O   1 
ATOM   2004 C CB  . ARG B 1 94  ? -6.822  13.566  -21.252 1.00 61.01  ? 294 ARG B CB  1 
ATOM   2005 C CG  . ARG B 1 94  ? -5.834  14.307  -22.143 1.00 53.02  ? 294 ARG B CG  1 
ATOM   2006 C CD  . ARG B 1 94  ? -6.309  14.291  -23.586 1.00 61.66  ? 294 ARG B CD  1 
ATOM   2007 N NE  . ARG B 1 94  ? -6.862  12.993  -23.965 1.00 65.89  ? 294 ARG B NE  1 
ATOM   2008 C CZ  . ARG B 1 94  ? -6.773  12.459  -25.177 1.00 65.27  ? 294 ARG B CZ  1 
ATOM   2009 N NH1 . ARG B 1 94  ? -6.145  13.105  -26.147 1.00 59.23  ? 294 ARG B NH1 1 
ATOM   2010 N NH2 . ARG B 1 94  ? -7.313  11.271  -25.427 1.00 74.48  ? 294 ARG B NH2 1 
ATOM   2011 N N   . ILE B 1 95  ? -8.069  13.577  -17.781 1.00 72.43  ? 295 ILE B N   1 
ATOM   2012 C CA  . ILE B 1 95  ? -9.000  12.886  -16.891 1.00 78.62  ? 295 ILE B CA  1 
ATOM   2013 C C   . ILE B 1 95  ? -10.344 13.603  -16.847 1.00 83.61  ? 295 ILE B C   1 
ATOM   2014 O O   . ILE B 1 95  ? -10.414 14.812  -17.066 1.00 73.38  ? 295 ILE B O   1 
ATOM   2015 C CB  . ILE B 1 95  ? -8.411  12.761  -15.470 1.00 72.33  ? 295 ILE B CB  1 
ATOM   2016 C CG1 . ILE B 1 95  ? -9.401  12.398  -14.365 1.00 73.98  ? 295 ILE B CG1 1 
ATOM   2017 C CG2 . ILE B 1 95  ? -7.666  14.040  -15.097 1.00 69.42  ? 295 ILE B CG2 1 
ATOM   2018 C CD1 . ILE B 1 95  ? -9.800  10.941  -14.313 1.00 75.29  ? 295 ILE B CD1 1 
ATOM   2019 N N   . LYS B 1 96  ? -11.403 12.858  -16.550 1.00 91.35  ? 296 LYS B N   1 
ATOM   2020 C CA  . LYS B 1 96  ? -12.739 13.419  -16.410 1.00 102.61 ? 296 LYS B CA  1 
ATOM   2021 C C   . LYS B 1 96  ? -13.148 13.542  -14.943 1.00 106.04 ? 296 LYS B C   1 
ATOM   2022 O O   . LYS B 1 96  ? -12.757 12.737  -14.096 1.00 83.12  ? 296 LYS B O   1 
ATOM   2023 C CB  . LYS B 1 96  ? -13.758 12.563  -17.165 1.00 106.91 ? 296 LYS B CB  1 
ATOM   2024 C CG  . LYS B 1 96  ? -15.203 13.019  -17.012 1.00 108.93 ? 296 LYS B CG  1 
ATOM   2025 C CD  . LYS B 1 96  ? -15.945 12.915  -18.341 1.00 108.77 ? 296 LYS B CD  1 
ATOM   2026 C CE  . LYS B 1 96  ? -14.961 12.832  -19.503 1.00 110.14 ? 296 LYS B CE  1 
ATOM   2027 N NZ  . LYS B 1 96  ? -14.148 14.079  -19.625 1.00 111.29 ? 296 LYS B NZ  1 
ATOM   2028 N N   . ARG B 1 97  ? -13.958 14.568  -14.667 1.00 113.11 ? 297 ARG B N   1 
ATOM   2029 C CA  . ARG B 1 97  ? -14.517 14.819  -13.347 1.00 114.36 ? 297 ARG B CA  1 
ATOM   2030 C C   . ARG B 1 97  ? -13.491 15.397  -12.378 1.00 109.74 ? 297 ARG B C   1 
ATOM   2031 O O   . ARG B 1 97  ? -13.563 15.140  -11.172 1.00 106.42 ? 297 ARG B O   1 
ATOM   2032 C CB  . ARG B 1 97  ? -15.094 13.523  -12.770 1.00 116.48 ? 297 ARG B CB  1 
ATOM   2033 C CG  . ARG B 1 97  ? -16.128 12.882  -13.687 1.00 119.68 ? 297 ARG B CG  1 
ATOM   2034 C CD  . ARG B 1 97  ? -17.209 12.173  -12.874 1.00 116.67 ? 297 ARG B CD  1 
ATOM   2035 N NE  . ARG B 1 97  ? -18.550 12.628  -13.223 1.00 122.39 ? 297 ARG B NE  1 
ATOM   2036 C CZ  . ARG B 1 97  ? -18.967 13.892  -13.147 1.00 124.92 ? 297 ARG B CZ  1 
ATOM   2037 N NH1 . ARG B 1 97  ? -18.144 14.851  -12.746 1.00 128.73 ? 297 ARG B NH1 1 
ATOM   2038 N NH2 . ARG B 1 97  ? -20.210 14.204  -13.487 1.00 127.02 ? 297 ARG B NH2 1 
ATOM   2039 N N   . GLY B 1 98  ? -12.533 16.166  -12.884 1.00 103.16 ? 298 GLY B N   1 
ATOM   2040 C CA  . GLY B 1 98  ? -11.527 16.866  -12.118 1.00 99.68  ? 298 GLY B CA  1 
ATOM   2041 C C   . GLY B 1 98  ? -10.962 16.126  -10.923 1.00 97.51  ? 298 GLY B C   1 
ATOM   2042 O O   . GLY B 1 98  ? -10.577 16.757  -9.932  1.00 97.02  ? 298 GLY B O   1 
ATOM   2043 N N   . LYS B 1 99  ? -10.898 14.804  -11.003 1.00 96.08  ? 299 LYS B N   1 
ATOM   2044 C CA  . LYS B 1 99  ? -10.376 13.935  -9.965  1.00 88.00  ? 299 LYS B CA  1 
ATOM   2045 C C   . LYS B 1 99  ? -9.000  13.424  -10.379 1.00 86.53  ? 299 LYS B C   1 
ATOM   2046 O O   . LYS B 1 99  ? -8.833  12.271  -10.756 1.00 96.50  ? 299 LYS B O   1 
ATOM   2047 C CB  . LYS B 1 99  ? -11.338 12.773  -9.721  1.00 78.94  ? 299 LYS B CB  1 
ATOM   2048 C CG  . LYS B 1 99  ? -11.977 12.268  -11.005 1.00 82.39  ? 299 LYS B CG  1 
ATOM   2049 C CD  . LYS B 1 99  ? -11.390 10.931  -11.429 1.00 81.71  ? 299 LYS B CD  1 
ATOM   2050 C CE  . LYS B 1 99  ? -11.048 10.088  -10.214 1.00 81.86  ? 299 LYS B CE  1 
ATOM   2051 N NZ  . LYS B 1 99  ? -11.821 8.816   -10.142 1.00 77.31  ? 299 LYS B NZ  1 
ATOM   2052 N N   . ILE B 1 100 ? -8.018  14.317  -10.312 1.00 85.02  ? 300 ILE B N   1 
ATOM   2053 C CA  . ILE B 1 100 ? -6.667  13.934  -10.750 1.00 92.25  ? 300 ILE B CA  1 
ATOM   2054 C C   . ILE B 1 100 ? -6.158  12.729  -9.931  1.00 93.27  ? 300 ILE B C   1 
ATOM   2055 O O   . ILE B 1 100 ? -6.157  11.629  -10.473 1.00 98.77  ? 300 ILE B O   1 
ATOM   2056 C CB  . ILE B 1 100 ? -5.660  15.089  -10.490 1.00 99.03  ? 300 ILE B CB  1 
ATOM   2057 C CG1 . ILE B 1 100 ? -6.204  16.474  -10.871 1.00 98.85  ? 300 ILE B CG1 1 
ATOM   2058 C CG2 . ILE B 1 100 ? -4.360  14.794  -11.244 1.00 96.65  ? 300 ILE B CG2 1 
ATOM   2059 C CD1 . ILE B 1 100 ? -5.503  17.099  -12.047 1.00 99.63  ? 300 ILE B CD1 1 
ATOM   2060 N N   . ASN B 1 101 ? -5.894  12.929  -8.647  1.00 91.38  ? 301 ASN B N   1 
ATOM   2061 C CA  . ASN B 1 101 ? -5.398  11.904  -7.741  1.00 91.25  ? 301 ASN B CA  1 
ATOM   2062 C C   . ASN B 1 101 ? -3.887  11.728  -7.905  1.00 92.01  ? 301 ASN B C   1 
ATOM   2063 O O   . ASN B 1 101 ? -3.404  11.323  -8.965  1.00 96.81  ? 301 ASN B O   1 
ATOM   2064 C CB  . ASN B 1 101 ? -6.115  10.570  -7.944  1.00 93.99  ? 301 ASN B CB  1 
ATOM   2065 C CG  . ASN B 1 101 ? -7.620  10.655  -7.776  1.00 100.02 ? 301 ASN B CG  1 
ATOM   2066 O OD1 . ASN B 1 101 ? -8.156  10.628  -6.662  1.00 101.81 ? 301 ASN B OD1 1 
ATOM   2067 N ND2 . ASN B 1 101 ? -8.325  10.757  -8.904  1.00 96.37  ? 301 ASN B ND2 1 
ATOM   2068 N N   . GLU B 1 102 ? -3.140  12.036  -6.853  1.00 87.84  ? 302 GLU B N   1 
ATOM   2069 C CA  . GLU B 1 102 ? -1.687  11.905  -6.834  1.00 78.39  ? 302 GLU B CA  1 
ATOM   2070 C C   . GLU B 1 102 ? -1.276  10.482  -7.197  1.00 75.23  ? 302 GLU B C   1 
ATOM   2071 O O   . GLU B 1 102 ? -0.241  10.217  -7.802  1.00 70.57  ? 302 GLU B O   1 
ATOM   2072 C CB  . GLU B 1 102 ? -1.147  12.280  -5.457  1.00 75.70  ? 302 GLU B CB  1 
ATOM   2073 C CG  . GLU B 1 102 ? 0.316   12.683  -5.425  1.00 72.63  ? 302 GLU B CG  1 
ATOM   2074 C CD  . GLU B 1 102 ? 0.687   13.333  -4.100  1.00 77.71  ? 302 GLU B CD  1 
ATOM   2075 O OE1 . GLU B 1 102 ? 0.767   12.597  -3.094  1.00 71.80  ? 302 GLU B OE1 1 
ATOM   2076 O OE2 . GLU B 1 102 ? 0.892   14.564  -4.068  1.00 90.72  ? 302 GLU B OE2 1 
ATOM   2077 N N   . THR B 1 103 ? -2.140  9.558   -6.803  1.00 72.37  ? 303 THR B N   1 
ATOM   2078 C CA  . THR B 1 103 ? -2.003  8.156   -7.184  1.00 69.13  ? 303 THR B CA  1 
ATOM   2079 C C   . THR B 1 103 ? -2.862  7.924   -8.420  1.00 69.84  ? 303 THR B C   1 
ATOM   2080 O O   . THR B 1 103 ? -3.804  7.140   -8.473  1.00 81.78  ? 303 THR B O   1 
ATOM   2081 C CB  . THR B 1 103 ? -2.374  7.235   -6.013  1.00 65.07  ? 303 THR B CB  1 
ATOM   2082 O OG1 . THR B 1 103 ? -1.322  7.329   -5.033  1.00 50.41  ? 303 THR B OG1 1 
ATOM   2083 C CG2 . THR B 1 103 ? -2.466  5.778   -6.433  1.00 52.97  ? 303 THR B CG2 1 
ATOM   2084 N N   . ILE B 1 104 ? -2.531  8.702   -9.435  1.00 59.61  ? 304 ILE B N   1 
ATOM   2085 C CA  . ILE B 1 104 ? -3.069  8.571   -10.790 1.00 63.61  ? 304 ILE B CA  1 
ATOM   2086 C C   . ILE B 1 104 ? -2.038  9.228   -11.726 1.00 60.88  ? 304 ILE B C   1 
ATOM   2087 O O   . ILE B 1 104 ? -1.767  8.743   -12.815 1.00 87.07  ? 304 ILE B O   1 
ATOM   2088 C CB  . ILE B 1 104 ? -4.409  9.368   -10.917 1.00 71.59  ? 304 ILE B CB  1 
ATOM   2089 C CG1 . ILE B 1 104 ? -5.639  8.458   -10.879 1.00 71.98  ? 304 ILE B CG1 1 
ATOM   2090 C CG2 . ILE B 1 104 ? -4.417  10.243  -12.169 1.00 56.57  ? 304 ILE B CG2 1 
ATOM   2091 C CD1 . ILE B 1 104 ? -6.904  9.103   -11.411 1.00 80.63  ? 304 ILE B CD1 1 
ATOM   2092 N N   . ILE B 1 105 ? -1.432  10.309  -11.235 1.00 52.64  ? 305 ILE B N   1 
ATOM   2093 C CA  . ILE B 1 105 ? -0.290  10.873  -11.944 1.00 54.19  ? 305 ILE B CA  1 
ATOM   2094 C C   . ILE B 1 105 ? 0.906   9.934   -11.788 1.00 54.79  ? 305 ILE B C   1 
ATOM   2095 O O   . ILE B 1 105 ? 1.898   10.030  -12.516 1.00 53.55  ? 305 ILE B O   1 
ATOM   2096 C CB  . ILE B 1 105 ? 0.086   12.273  -11.437 1.00 54.75  ? 305 ILE B CB  1 
ATOM   2097 C CG1 . ILE B 1 105 ? 1.297   12.249  -10.502 1.00 40.90  ? 305 ILE B CG1 1 
ATOM   2098 C CG2 . ILE B 1 105 ? -1.093  12.969  -10.773 1.00 63.98  ? 305 ILE B CG2 1 
ATOM   2099 C CD1 . ILE B 1 105 ? 2.533   12.870  -11.104 1.00 36.21  ? 305 ILE B CD1 1 
ATOM   2100 N N   . GLY B 1 106 ? 0.813   8.996   -10.847 1.00 47.44  ? 306 GLY B N   1 
ATOM   2101 C CA  . GLY B 1 106 ? 1.829   7.961   -10.708 1.00 41.77  ? 306 GLY B CA  1 
ATOM   2102 C C   . GLY B 1 106 ? 1.645   6.886   -11.769 1.00 39.82  ? 306 GLY B C   1 
ATOM   2103 O O   . GLY B 1 106 ? 2.627   6.328   -12.272 1.00 43.52  ? 306 GLY B O   1 
ATOM   2104 N N   . ASP B 1 107 ? 0.396   6.598   -12.132 1.00 33.95  ? 307 ASP B N   1 
ATOM   2105 C CA  . ASP B 1 107 ? 0.132   5.565   -13.127 1.00 42.56  ? 307 ASP B CA  1 
ATOM   2106 C C   . ASP B 1 107 ? 0.443   6.036   -14.549 1.00 44.14  ? 307 ASP B C   1 
ATOM   2107 O O   . ASP B 1 107 ? 0.742   5.221   -15.424 1.00 41.70  ? 307 ASP B O   1 
ATOM   2108 C CB  . ASP B 1 107 ? -1.324  5.107   -13.092 1.00 43.77  ? 307 ASP B CB  1 
ATOM   2109 C CG  . ASP B 1 107 ? -1.920  5.025   -11.706 1.00 50.74  ? 307 ASP B CG  1 
ATOM   2110 O OD1 . ASP B 1 107 ? -1.148  4.977   -10.729 1.00 63.21  ? 307 ASP B OD1 1 
ATOM   2111 O OD2 . ASP B 1 107 ? -3.168  5.011   -11.612 1.00 66.00  ? 307 ASP B OD2 1 
ATOM   2112 N N   . VAL B 1 108 ? 0.352   7.343   -14.744 1.00 38.64  ? 308 VAL B N   1 
ATOM   2113 C CA  . VAL B 1 108 ? 0.602   7.998   -16.015 1.00 35.99  ? 308 VAL B CA  1 
ATOM   2114 C C   . VAL B 1 108 ? 2.095   8.137   -16.256 1.00 31.52  ? 308 VAL B C   1 
ATOM   2115 O O   . VAL B 1 108 ? 2.610   7.956   -17.359 1.00 45.59  ? 308 VAL B O   1 
ATOM   2116 C CB  . VAL B 1 108 ? -0.081  9.376   -16.085 1.00 39.30  ? 308 VAL B CB  1 
ATOM   2117 C CG1 . VAL B 1 108 ? 0.227   10.063  -17.403 1.00 51.15  ? 308 VAL B CG1 1 
ATOM   2118 C CG2 . VAL B 1 108 ? -1.583  9.204   -15.923 1.00 33.20  ? 308 VAL B CG2 1 
ATOM   2119 N N   . PHE B 1 109 ? 2.826   8.445   -15.189 1.00 32.17  ? 309 PHE B N   1 
ATOM   2120 C CA  . PHE B 1 109 ? 4.284   8.459   -15.317 1.00 23.45  ? 309 PHE B CA  1 
ATOM   2121 C C   . PHE B 1 109 ? 4.768   7.088   -15.767 1.00 32.35  ? 309 PHE B C   1 
ATOM   2122 O O   . PHE B 1 109 ? 5.639   6.963   -16.638 1.00 34.74  ? 309 PHE B O   1 
ATOM   2123 C CB  . PHE B 1 109 ? 4.888   8.907   -13.994 1.00 31.64  ? 309 PHE B CB  1 
ATOM   2124 C CG  . PHE B 1 109 ? 6.401   9.043   -14.021 1.00 41.01  ? 309 PHE B CG  1 
ATOM   2125 C CD1 . PHE B 1 109 ? 7.010   10.096  -14.679 1.00 43.21  ? 309 PHE B CD1 1 
ATOM   2126 C CD2 . PHE B 1 109 ? 7.199   8.108   -13.392 1.00 42.88  ? 309 PHE B CD2 1 
ATOM   2127 C CE1 . PHE B 1 109 ? 8.385   10.223  -14.713 1.00 37.26  ? 309 PHE B CE1 1 
ATOM   2128 C CE2 . PHE B 1 109 ? 8.576   8.230   -13.413 1.00 47.89  ? 309 PHE B CE2 1 
ATOM   2129 C CZ  . PHE B 1 109 ? 9.172   9.291   -14.066 1.00 41.59  ? 309 PHE B CZ  1 
ATOM   2130 N N   . GLU B 1 110 ? 4.197   6.024   -15.199 1.00 38.48  ? 310 GLU B N   1 
ATOM   2131 C CA  . GLU B 1 110 ? 4.547   4.672   -15.638 1.00 44.79  ? 310 GLU B CA  1 
ATOM   2132 C C   . GLU B 1 110 ? 4.081   4.385   -17.062 1.00 39.92  ? 310 GLU B C   1 
ATOM   2133 O O   . GLU B 1 110 ? 4.877   3.956   -17.899 1.00 38.70  ? 310 GLU B O   1 
ATOM   2134 C CB  . GLU B 1 110 ? 3.958   3.610   -14.697 1.00 41.32  ? 310 GLU B CB  1 
ATOM   2135 C CG  . GLU B 1 110 ? 4.578   3.641   -13.307 1.00 39.59  ? 310 GLU B CG  1 
ATOM   2136 C CD  . GLU B 1 110 ? 3.915   2.667   -12.352 1.00 44.80  ? 310 GLU B CD  1 
ATOM   2137 O OE1 . GLU B 1 110 ? 2.670   2.601   -12.327 1.00 49.27  ? 310 GLU B OE1 1 
ATOM   2138 O OE2 . GLU B 1 110 ? 4.648   1.966   -11.615 1.00 40.29  ? 310 GLU B OE2 1 
ATOM   2139 N N   . ALA B 1 111 ? 2.802   4.598   -17.347 1.00 33.33  ? 311 ALA B N   1 
ATOM   2140 C CA  . ALA B 1 111 ? 2.272   4.414   -18.692 1.00 38.82  ? 311 ALA B CA  1 
ATOM   2141 C C   . ALA B 1 111 ? 3.114   5.131   -19.753 1.00 44.67  ? 311 ALA B C   1 
ATOM   2142 O O   . ALA B 1 111 ? 3.375   4.546   -20.810 1.00 40.72  ? 311 ALA B O   1 
ATOM   2143 C CB  . ALA B 1 111 ? 0.840   4.915   -18.784 1.00 38.21  ? 311 ALA B CB  1 
ATOM   2144 N N   . LEU B 1 112 ? 3.501   6.365   -19.446 1.00 36.91  ? 312 LEU B N   1 
ATOM   2145 C CA  . LEU B 1 112 ? 4.303   7.218   -20.302 1.00 34.86  ? 312 LEU B CA  1 
ATOM   2146 C C   . LEU B 1 112 ? 5.626   6.562   -20.683 1.00 37.05  ? 312 LEU B C   1 
ATOM   2147 O O   . LEU B 1 112 ? 6.088   6.672   -21.812 1.00 35.90  ? 312 LEU B O   1 
ATOM   2148 C CB  . LEU B 1 112 ? 4.665   8.563   -19.641 1.00 29.10  ? 312 LEU B CB  1 
ATOM   2149 C CG  . LEU B 1 112 ? 5.629   9.386   -20.518 1.00 30.47  ? 312 LEU B CG  1 
ATOM   2150 C CD1 . LEU B 1 112 ? 4.855   10.009  -21.667 1.00 24.41  ? 312 LEU B CD1 1 
ATOM   2151 C CD2 . LEU B 1 112 ? 6.352   10.437  -19.700 1.00 39.00  ? 312 LEU B CD2 1 
ATOM   2152 N N   . TRP B 1 113 ? 6.222   5.888   -19.697 1.00 37.05  ? 313 TRP B N   1 
ATOM   2153 C CA  . TRP B 1 113 ? 7.496   5.221   -19.970 1.00 31.98  ? 313 TRP B CA  1 
ATOM   2154 C C   . TRP B 1 113 ? 7.286   3.931   -20.738 1.00 26.64  ? 313 TRP B C   1 
ATOM   2155 O O   . TRP B 1 113 ? 8.121   3.579   -21.579 1.00 30.04  ? 313 TRP B O   1 
ATOM   2156 C CB  . TRP B 1 113 ? 8.264   5.052   -18.644 1.00 27.63  ? 313 TRP B CB  1 
ATOM   2157 C CG  . TRP B 1 113 ? 8.811   6.425   -18.328 1.00 33.14  ? 313 TRP B CG  1 
ATOM   2158 C CD1 . TRP B 1 113 ? 8.368   7.285   -17.375 1.00 33.90  ? 313 TRP B CD1 1 
ATOM   2159 C CD2 . TRP B 1 113 ? 9.899   7.071   -18.998 1.00 33.21  ? 313 TRP B CD2 1 
ATOM   2160 N NE1 . TRP B 1 113 ? 9.124   8.434   -17.408 1.00 36.46  ? 313 TRP B NE1 1 
ATOM   2161 C CE2 . TRP B 1 113 ? 10.066  8.330   -18.392 1.00 32.62  ? 313 TRP B CE2 1 
ATOM   2162 C CE3 . TRP B 1 113 ? 10.750  6.715   -20.047 1.00 32.12  ? 313 TRP B CE3 1 
ATOM   2163 C CZ2 . TRP B 1 113 ? 11.051  9.232   -18.799 1.00 38.00  ? 313 TRP B CZ2 1 
ATOM   2164 C CZ3 . TRP B 1 113 ? 11.727  7.602   -20.456 1.00 31.87  ? 313 TRP B CZ3 1 
ATOM   2165 C CH2 . TRP B 1 113 ? 11.869  8.847   -19.831 1.00 39.71  ? 313 TRP B CH2 1 
ATOM   2166 N N   . ALA B 1 114 ? 6.183   3.216   -20.512 1.00 30.94  ? 314 ALA B N   1 
ATOM   2167 C CA  . ALA B 1 114 ? 5.937   2.030   -21.330 1.00 30.36  ? 314 ALA B CA  1 
ATOM   2168 C C   . ALA B 1 114 ? 5.726   2.445   -22.789 1.00 31.90  ? 314 ALA B C   1 
ATOM   2169 O O   . ALA B 1 114 ? 6.150   1.720   -23.689 1.00 33.18  ? 314 ALA B O   1 
ATOM   2170 C CB  . ALA B 1 114 ? 4.740   1.242   -20.828 1.00 35.69  ? 314 ALA B CB  1 
ATOM   2171 N N   . ALA B 1 115 ? 5.085   3.593   -22.972 1.00 36.39  ? 315 ALA B N   1 
ATOM   2172 C CA  . ALA B 1 115 ? 4.722   4.171   -24.258 1.00 40.53  ? 315 ALA B CA  1 
ATOM   2173 C C   . ALA B 1 115 ? 5.931   4.582   -25.098 1.00 37.93  ? 315 ALA B C   1 
ATOM   2174 O O   . ALA B 1 115 ? 5.947   4.302   -26.300 1.00 38.43  ? 315 ALA B O   1 
ATOM   2175 C CB  . ALA B 1 115 ? 3.806   5.375   -24.060 1.00 47.24  ? 315 ALA B CB  1 
ATOM   2176 N N   . VAL B 1 116 ? 6.909   5.226   -24.476 1.00 36.84  ? 316 VAL B N   1 
ATOM   2177 C CA  . VAL B 1 116 ? 8.189   5.572   -25.070 1.00 34.69  ? 316 VAL B CA  1 
ATOM   2178 C C   . VAL B 1 116 ? 8.939   4.310   -25.507 1.00 42.14  ? 316 VAL B C   1 
ATOM   2179 O O   . VAL B 1 116 ? 9.479   4.240   -26.604 1.00 39.06  ? 316 VAL B O   1 
ATOM   2180 C CB  . VAL B 1 116 ? 9.098   6.346   -24.097 1.00 39.42  ? 316 VAL B CB  1 
ATOM   2181 C CG1 . VAL B 1 116 ? 10.462  6.577   -24.747 1.00 54.45  ? 316 VAL B CG1 1 
ATOM   2182 C CG2 . VAL B 1 116 ? 8.495   7.669   -23.663 1.00 30.65  ? 316 VAL B CG2 1 
ATOM   2183 N N   . TYR B 1 117 ? 8.967   3.321   -24.619 1.00 44.65  ? 317 TYR B N   1 
ATOM   2184 C CA  . TYR B 1 117 ? 9.643   2.048   -24.788 1.00 41.43  ? 317 TYR B CA  1 
ATOM   2185 C C   . TYR B 1 117 ? 9.119   1.314   -26.020 1.00 48.60  ? 317 TYR B C   1 
ATOM   2186 O O   . TYR B 1 117 ? 9.901   0.927   -26.888 1.00 41.83  ? 317 TYR B O   1 
ATOM   2187 C CB  . TYR B 1 117 ? 9.464   1.167   -23.544 1.00 32.92  ? 317 TYR B CB  1 
ATOM   2188 C CG  . TYR B 1 117 ? 9.833   -0.289  -23.716 1.00 36.04  ? 317 TYR B CG  1 
ATOM   2189 C CD1 . TYR B 1 117 ? 11.144  -0.666  -23.988 1.00 38.65  ? 317 TYR B CD1 1 
ATOM   2190 C CD2 . TYR B 1 117 ? 8.893   -1.307  -23.608 1.00 29.98  ? 317 TYR B CD2 1 
ATOM   2191 C CE1 . TYR B 1 117 ? 11.514  -1.986  -24.148 1.00 33.04  ? 317 TYR B CE1 1 
ATOM   2192 C CE2 . TYR B 1 117 ? 9.257   -2.629  -23.768 1.00 28.29  ? 317 TYR B CE2 1 
ATOM   2193 C CZ  . TYR B 1 117 ? 10.561  -2.976  -24.040 1.00 37.00  ? 317 TYR B CZ  1 
ATOM   2194 O OH  . TYR B 1 117 ? 10.934  -4.299  -24.202 1.00 30.41  ? 317 TYR B OH  1 
ATOM   2195 N N   . ILE B 1 118 ? 7.801   1.126   -26.070 1.00 49.96  ? 318 ILE B N   1 
ATOM   2196 C CA  . ILE B 1 118 ? 7.152   0.439   -27.176 1.00 46.59  ? 318 ILE B CA  1 
ATOM   2197 C C   . ILE B 1 118 ? 7.335   1.177   -28.503 1.00 43.14  ? 318 ILE B C   1 
ATOM   2198 O O   . ILE B 1 118 ? 7.549   0.539   -29.531 1.00 48.08  ? 318 ILE B O   1 
ATOM   2199 C CB  . ILE B 1 118 ? 5.640   0.278   -26.943 1.00 46.86  ? 318 ILE B CB  1 
ATOM   2200 C CG1 . ILE B 1 118 ? 5.252   -0.314  -25.591 1.00 49.71  ? 318 ILE B CG1 1 
ATOM   2201 C CG2 . ILE B 1 118 ? 5.016   -0.553  -28.062 1.00 58.68  ? 318 ILE B CG2 1 
ATOM   2202 C CD1 . ILE B 1 118 ? 4.134   -1.332  -25.715 1.00 44.07  ? 318 ILE B CD1 1 
ATOM   2203 N N   . ASP B 1 119 ? 7.241   2.498   -28.483 1.00 46.09  ? 319 ASP B N   1 
ATOM   2204 C CA  . ASP B 1 119 ? 7.278   3.330   -29.680 1.00 47.22  ? 319 ASP B CA  1 
ATOM   2205 C C   . ASP B 1 119 ? 8.676   3.334   -30.283 1.00 57.60  ? 319 ASP B C   1 
ATOM   2206 O O   . ASP B 1 119 ? 8.865   3.362   -31.493 1.00 66.59  ? 319 ASP B O   1 
ATOM   2207 C CB  . ASP B 1 119 ? 6.856   4.767   -29.368 1.00 40.23  ? 319 ASP B CB  1 
ATOM   2208 C CG  . ASP B 1 119 ? 6.721   5.620   -30.612 1.00 41.30  ? 319 ASP B CG  1 
ATOM   2209 O OD1 . ASP B 1 119 ? 6.022   5.203   -31.560 1.00 44.02  ? 319 ASP B OD1 1 
ATOM   2210 O OD2 . ASP B 1 119 ? 7.317   6.713   -30.641 1.00 42.14  ? 319 ASP B OD2 1 
ATOM   2211 N N   . SER B 1 120 ? 9.633   3.287   -29.365 1.00 60.68  ? 320 SER B N   1 
ATOM   2212 C CA  . SER B 1 120 ? 11.050  3.197   -29.629 1.00 48.81  ? 320 SER B CA  1 
ATOM   2213 C C   . SER B 1 120 ? 11.441  1.881   -30.290 1.00 35.77  ? 320 SER B C   1 
ATOM   2214 O O   . SER B 1 120 ? 12.612  1.704   -30.631 1.00 38.94  ? 320 SER B O   1 
ATOM   2215 C CB  . SER B 1 120 ? 11.808  3.326   -28.299 1.00 55.93  ? 320 SER B CB  1 
ATOM   2216 O OG  . SER B 1 120 ? 11.807  2.074   -27.629 1.00 47.94  ? 320 SER B OG  1 
ATOM   2217 N N   . GLY B 1 121 ? 10.495  0.969   -30.455 1.00 37.47  ? 321 GLY B N   1 
ATOM   2218 C CA  . GLY B 1 121 ? 10.677  -0.364  -30.975 1.00 40.03  ? 321 GLY B CA  1 
ATOM   2219 C C   . GLY B 1 121 ? 11.055  -1.381  -29.912 1.00 39.84  ? 321 GLY B C   1 
ATOM   2220 O O   . GLY B 1 121 ? 11.854  -2.285  -30.175 1.00 31.29  ? 321 GLY B O   1 
ATOM   2221 N N   . ARG B 1 122 ? 10.505  -1.273  -28.699 1.00 40.79  ? 322 ARG B N   1 
ATOM   2222 C CA  . ARG B 1 122 ? 10.857  -2.266  -27.675 1.00 43.37  ? 322 ARG B CA  1 
ATOM   2223 C C   . ARG B 1 122 ? 12.349  -2.205  -27.372 1.00 32.72  ? 322 ARG B C   1 
ATOM   2224 O O   . ARG B 1 122 ? 13.033  -3.211  -27.218 1.00 36.60  ? 322 ARG B O   1 
ATOM   2225 C CB  . ARG B 1 122 ? 10.467  -3.652  -28.169 1.00 47.32  ? 322 ARG B CB  1 
ATOM   2226 C CG  . ARG B 1 122 ? 9.392   -4.419  -27.442 1.00 41.61  ? 322 ARG B CG  1 
ATOM   2227 C CD  . ARG B 1 122 ? 8.184   -3.564  -27.123 1.00 46.96  ? 322 ARG B CD  1 
ATOM   2228 N NE  . ARG B 1 122 ? 7.270   -4.225  -26.191 1.00 45.06  ? 322 ARG B NE  1 
ATOM   2229 C CZ  . ARG B 1 122 ? 5.972   -4.341  -26.442 1.00 46.82  ? 322 ARG B CZ  1 
ATOM   2230 N NH1 . ARG B 1 122 ? 5.490   -3.843  -27.573 1.00 37.75  ? 322 ARG B NH1 1 
ATOM   2231 N NH2 . ARG B 1 122 ? 5.170   -4.943  -25.580 1.00 45.76  ? 322 ARG B NH2 1 
ATOM   2232 N N   . ASP B 1 123 ? 12.921  -1.010  -27.340 1.00 30.29  ? 323 ASP B N   1 
ATOM   2233 C CA  . ASP B 1 123 ? 14.383  -0.892  -27.155 1.00 32.64  ? 323 ASP B CA  1 
ATOM   2234 C C   . ASP B 1 123 ? 14.654  -0.467  -25.703 1.00 42.76  ? 323 ASP B C   1 
ATOM   2235 O O   . ASP B 1 123 ? 14.637  0.713   -25.339 1.00 38.02  ? 323 ASP B O   1 
ATOM   2236 C CB  . ASP B 1 123 ? 14.825  0.185   -28.166 1.00 37.03  ? 323 ASP B CB  1 
ATOM   2237 C CG  . ASP B 1 123 ? 16.303  0.479   -28.139 1.00 36.06  ? 323 ASP B CG  1 
ATOM   2238 O OD1 . ASP B 1 123 ? 17.005  -0.006  -27.234 1.00 46.82  ? 323 ASP B OD1 1 
ATOM   2239 O OD2 . ASP B 1 123 ? 16.783  1.213   -29.025 1.00 68.54  ? 323 ASP B OD2 1 
ATOM   2240 N N   . ALA B 1 124 ? 15.051  -1.456  -24.898 1.00 40.96  ? 324 ALA B N   1 
ATOM   2241 C CA  . ALA B 1 124 ? 15.163  -1.204  -23.463 1.00 47.06  ? 324 ALA B CA  1 
ATOM   2242 C C   . ALA B 1 124 ? 16.311  -0.257  -23.131 1.00 41.75  ? 324 ALA B C   1 
ATOM   2243 O O   . ALA B 1 124 ? 16.172  0.690   -22.351 1.00 36.44  ? 324 ALA B O   1 
ATOM   2244 C CB  . ALA B 1 124 ? 15.326  -2.516  -22.708 1.00 45.61  ? 324 ALA B CB  1 
ATOM   2245 N N   . ASN B 1 125 ? 17.447  -0.552  -23.744 1.00 34.25  ? 325 ASN B N   1 
ATOM   2246 C CA  . ASN B 1 125 ? 18.659  0.245   -23.567 1.00 37.44  ? 325 ASN B CA  1 
ATOM   2247 C C   . ASN B 1 125 ? 18.391  1.726   -23.789 1.00 32.49  ? 325 ASN B C   1 
ATOM   2248 O O   . ASN B 1 125 ? 18.668  2.557   -22.926 1.00 32.53  ? 325 ASN B O   1 
ATOM   2249 C CB  . ASN B 1 125 ? 19.740  -0.280  -24.524 1.00 39.04  ? 325 ASN B CB  1 
ATOM   2250 C CG  . ASN B 1 125 ? 20.115  -1.712  -24.176 1.00 44.51  ? 325 ASN B CG  1 
ATOM   2251 O OD1 . ASN B 1 125 ? 19.958  -2.103  -23.014 1.00 40.70  ? 325 ASN B OD1 1 
ATOM   2252 N ND2 . ASN B 1 125 ? 20.599  -2.473  -25.152 1.00 42.03  ? 325 ASN B ND2 1 
ATOM   2253 N N   . PHE B 1 126 ? 17.832  2.063   -24.949 1.00 43.69  ? 326 PHE B N   1 
ATOM   2254 C CA  . PHE B 1 126 ? 17.502  3.429   -25.321 1.00 38.81  ? 326 PHE B CA  1 
ATOM   2255 C C   . PHE B 1 126 ? 16.662  4.108   -24.245 1.00 44.37  ? 326 PHE B C   1 
ATOM   2256 O O   . PHE B 1 126 ? 16.958  5.201   -23.762 1.00 45.19  ? 326 PHE B O   1 
ATOM   2257 C CB  . PHE B 1 126 ? 16.718  3.457   -26.637 1.00 47.42  ? 326 PHE B CB  1 
ATOM   2258 C CG  . PHE B 1 126 ? 15.948  4.742   -26.901 1.00 47.30  ? 326 PHE B CG  1 
ATOM   2259 C CD1 . PHE B 1 126 ? 16.609  5.870   -27.365 1.00 59.40  ? 326 PHE B CD1 1 
ATOM   2260 C CD2 . PHE B 1 126 ? 14.585  4.832   -26.698 1.00 40.10  ? 326 PHE B CD2 1 
ATOM   2261 C CE1 . PHE B 1 126 ? 15.928  7.047   -27.614 1.00 59.11  ? 326 PHE B CE1 1 
ATOM   2262 C CE2 . PHE B 1 126 ? 13.894  6.003   -26.944 1.00 52.59  ? 326 PHE B CE2 1 
ATOM   2263 C CZ  . PHE B 1 126 ? 14.563  7.118   -27.407 1.00 53.32  ? 326 PHE B CZ  1 
ATOM   2264 N N   . THR B 1 127 ? 15.577  3.397   -23.931 1.00 44.52  ? 327 THR B N   1 
ATOM   2265 C CA  . THR B 1 127 ? 14.571  3.917   -23.008 1.00 41.97  ? 327 THR B CA  1 
ATOM   2266 C C   . THR B 1 127 ? 15.186  4.109   -21.633 1.00 45.05  ? 327 THR B C   1 
ATOM   2267 O O   . THR B 1 127 ? 14.979  5.111   -20.949 1.00 35.95  ? 327 THR B O   1 
ATOM   2268 C CB  . THR B 1 127 ? 13.344  2.991   -22.956 1.00 35.69  ? 327 THR B CB  1 
ATOM   2269 O OG1 . THR B 1 127 ? 13.003  2.601   -24.293 1.00 49.46  ? 327 THR B OG1 1 
ATOM   2270 C CG2 . THR B 1 127 ? 12.127  3.716   -22.410 1.00 30.94  ? 327 THR B CG2 1 
ATOM   2271 N N   . ARG B 1 128 ? 15.986  3.127   -21.203 1.00 42.03  ? 328 ARG B N   1 
ATOM   2272 C CA  . ARG B 1 128 ? 16.624  3.341   -19.900 1.00 41.50  ? 328 ARG B CA  1 
ATOM   2273 C C   . ARG B 1 128 ? 17.532  4.562   -19.944 1.00 42.87  ? 328 ARG B C   1 
ATOM   2274 O O   . ARG B 1 128 ? 17.588  5.381   -19.028 1.00 32.19  ? 328 ARG B O   1 
ATOM   2275 C CB  . ARG B 1 128 ? 17.378  2.068   -19.514 1.00 43.32  ? 328 ARG B CB  1 
ATOM   2276 C CG  . ARG B 1 128 ? 18.209  2.241   -18.253 1.00 42.57  ? 328 ARG B CG  1 
ATOM   2277 C CD  . ARG B 1 128 ? 19.676  2.011   -18.578 1.00 42.24  ? 328 ARG B CD  1 
ATOM   2278 N NE  . ARG B 1 128 ? 19.862  0.629   -19.017 1.00 46.06  ? 328 ARG B NE  1 
ATOM   2279 C CZ  . ARG B 1 128 ? 20.863  0.302   -19.826 1.00 44.29  ? 328 ARG B CZ  1 
ATOM   2280 N NH1 . ARG B 1 128 ? 21.700  1.240   -20.241 1.00 46.85  ? 328 ARG B NH1 1 
ATOM   2281 N NH2 . ARG B 1 128 ? 20.996  -0.956  -20.200 1.00 47.51  ? 328 ARG B NH2 1 
ATOM   2282 N N   . GLU B 1 129 ? 18.275  4.729   -21.044 1.00 37.58  ? 329 GLU B N   1 
ATOM   2283 C CA  . GLU B 1 129 ? 19.163  5.887   -21.131 1.00 41.91  ? 329 GLU B CA  1 
ATOM   2284 C C   . GLU B 1 129 ? 18.389  7.194   -21.077 1.00 43.73  ? 329 GLU B C   1 
ATOM   2285 O O   . GLU B 1 129 ? 18.734  8.108   -20.327 1.00 58.28  ? 329 GLU B O   1 
ATOM   2286 C CB  . GLU B 1 129 ? 20.007  5.801   -22.408 1.00 44.06  ? 329 GLU B CB  1 
ATOM   2287 C CG  . GLU B 1 129 ? 20.953  4.607   -22.423 1.00 46.47  ? 329 GLU B CG  1 
ATOM   2288 C CD  . GLU B 1 129 ? 22.091  4.719   -21.435 1.00 56.19  ? 329 GLU B CD  1 
ATOM   2289 O OE1 . GLU B 1 129 ? 21.855  5.025   -20.244 1.00 56.54  ? 329 GLU B OE1 1 
ATOM   2290 O OE2 . GLU B 1 129 ? 23.253  4.492   -21.846 1.00 83.10  ? 329 GLU B OE2 1 
ATOM   2291 N N   . LEU B 1 130 ? 17.329  7.292   -21.874 1.00 40.23  ? 330 LEU B N   1 
ATOM   2292 C CA  . LEU B 1 130 ? 16.481  8.480   -21.826 1.00 46.10  ? 330 LEU B CA  1 
ATOM   2293 C C   . LEU B 1 130 ? 15.993  8.758   -20.410 1.00 43.85  ? 330 LEU B C   1 
ATOM   2294 O O   . LEU B 1 130 ? 16.018  9.903   -19.955 1.00 61.26  ? 330 LEU B O   1 
ATOM   2295 C CB  . LEU B 1 130 ? 15.292  8.306   -22.773 1.00 57.47  ? 330 LEU B CB  1 
ATOM   2296 C CG  . LEU B 1 130 ? 14.882  9.525   -23.605 1.00 60.20  ? 330 LEU B CG  1 
ATOM   2297 C CD1 . LEU B 1 130 ? 13.538  9.279   -24.275 1.00 74.19  ? 330 LEU B CD1 1 
ATOM   2298 C CD2 . LEU B 1 130 ? 14.839  10.779  -22.749 1.00 52.75  ? 330 LEU B CD2 1 
ATOM   2299 N N   . PHE B 1 131 ? 15.548  7.718   -19.707 1.00 40.91  ? 331 PHE B N   1 
ATOM   2300 C CA  . PHE B 1 131 ? 15.100  7.840   -18.330 1.00 40.86  ? 331 PHE B CA  1 
ATOM   2301 C C   . PHE B 1 131 ? 16.224  8.352   -17.435 1.00 40.32  ? 331 PHE B C   1 
ATOM   2302 O O   . PHE B 1 131 ? 16.004  9.178   -16.548 1.00 42.20  ? 331 PHE B O   1 
ATOM   2303 C CB  . PHE B 1 131 ? 14.614  6.494   -17.788 1.00 40.75  ? 331 PHE B CB  1 
ATOM   2304 C CG  . PHE B 1 131 ? 14.019  6.511   -16.390 1.00 34.35  ? 331 PHE B CG  1 
ATOM   2305 C CD1 . PHE B 1 131 ? 14.802  6.335   -15.259 1.00 34.41  ? 331 PHE B CD1 1 
ATOM   2306 C CD2 . PHE B 1 131 ? 12.657  6.703   -16.223 1.00 34.39  ? 331 PHE B CD2 1 
ATOM   2307 C CE1 . PHE B 1 131 ? 14.220  6.346   -14.004 1.00 32.04  ? 331 PHE B CE1 1 
ATOM   2308 C CE2 . PHE B 1 131 ? 12.066  6.719   -14.978 1.00 25.56  ? 331 PHE B CE2 1 
ATOM   2309 C CZ  . PHE B 1 131 ? 12.866  6.538   -13.861 1.00 27.56  ? 331 PHE B CZ  1 
ATOM   2310 N N   . TYR B 1 132 ? 17.434  7.824   -17.650 1.00 36.44  ? 332 TYR B N   1 
ATOM   2311 C CA  . TYR B 1 132 ? 18.501  8.263   -16.739 1.00 41.59  ? 332 TYR B CA  1 
ATOM   2312 C C   . TYR B 1 132 ? 18.820  9.732   -17.012 1.00 44.78  ? 332 TYR B C   1 
ATOM   2313 O O   . TYR B 1 132 ? 18.821  10.508  -16.061 1.00 42.91  ? 332 TYR B O   1 
ATOM   2314 C CB  . TYR B 1 132 ? 19.745  7.396   -16.857 1.00 43.76  ? 332 TYR B CB  1 
ATOM   2315 C CG  . TYR B 1 132 ? 19.545  6.020   -16.263 1.00 45.98  ? 332 TYR B CG  1 
ATOM   2316 C CD1 . TYR B 1 132 ? 18.406  5.745   -15.514 1.00 51.66  ? 332 TYR B CD1 1 
ATOM   2317 C CD2 . TYR B 1 132 ? 20.482  5.017   -16.450 1.00 47.93  ? 332 TYR B CD2 1 
ATOM   2318 C CE1 . TYR B 1 132 ? 18.209  4.492   -14.964 1.00 51.75  ? 332 TYR B CE1 1 
ATOM   2319 C CE2 . TYR B 1 132 ? 20.289  3.764   -15.902 1.00 48.35  ? 332 TYR B CE2 1 
ATOM   2320 C CZ  . TYR B 1 132 ? 19.155  3.512   -15.164 1.00 45.60  ? 332 TYR B CZ  1 
ATOM   2321 O OH  . TYR B 1 132 ? 18.962  2.264   -14.621 1.00 45.44  ? 332 TYR B OH  1 
ATOM   2322 N N   . LYS B 1 133 ? 19.055  10.040  -18.278 1.00 45.89  ? 333 LYS B N   1 
ATOM   2323 C CA  . LYS B 1 133 ? 19.237  11.387  -18.787 1.00 51.76  ? 333 LYS B CA  1 
ATOM   2324 C C   . LYS B 1 133 ? 18.337  12.392  -18.069 1.00 48.28  ? 333 LYS B C   1 
ATOM   2325 O O   . LYS B 1 133 ? 18.793  13.466  -17.689 1.00 47.86  ? 333 LYS B O   1 
ATOM   2326 C CB  . LYS B 1 133 ? 18.930  11.440  -20.290 1.00 57.92  ? 333 LYS B CB  1 
ATOM   2327 C CG  . LYS B 1 133 ? 19.752  12.465  -21.057 1.00 61.40  ? 333 LYS B CG  1 
ATOM   2328 C CD  . LYS B 1 133 ? 21.136  12.614  -20.436 1.00 65.57  ? 333 LYS B CD  1 
ATOM   2329 C CE  . LYS B 1 133 ? 22.219  12.109  -21.382 1.00 66.60  ? 333 LYS B CE  1 
ATOM   2330 N NZ  . LYS B 1 133 ? 23.234  11.281  -20.661 1.00 85.82  ? 333 LYS B NZ  1 
ATOM   2331 N N   . LEU B 1 134 ? 17.077  12.002  -17.903 1.00 44.92  ? 334 LEU B N   1 
ATOM   2332 C CA  . LEU B 1 134 ? 16.048  12.820  -17.296 1.00 39.67  ? 334 LEU B CA  1 
ATOM   2333 C C   . LEU B 1 134 ? 16.110  12.771  -15.775 1.00 47.46  ? 334 LEU B C   1 
ATOM   2334 O O   . LEU B 1 134 ? 15.882  13.808  -15.145 1.00 44.23  ? 334 LEU B O   1 
ATOM   2335 C CB  . LEU B 1 134 ? 14.650  12.393  -17.772 1.00 40.25  ? 334 LEU B CB  1 
ATOM   2336 C CG  . LEU B 1 134 ? 14.441  12.268  -19.284 1.00 45.35  ? 334 LEU B CG  1 
ATOM   2337 C CD1 . LEU B 1 134 ? 12.996  11.943  -19.628 1.00 44.42  ? 334 LEU B CD1 1 
ATOM   2338 C CD2 . LEU B 1 134 ? 14.858  13.539  -20.011 1.00 57.85  ? 334 LEU B CD2 1 
ATOM   2339 N N   . PHE B 1 135 ? 16.393  11.615  -15.168 1.00 54.84  ? 335 PHE B N   1 
ATOM   2340 C CA  . PHE B 1 135 ? 16.291  11.527  -13.714 1.00 57.29  ? 335 PHE B CA  1 
ATOM   2341 C C   . PHE B 1 135 ? 17.429  10.842  -12.978 1.00 55.34  ? 335 PHE B C   1 
ATOM   2342 O O   . PHE B 1 135 ? 17.318  10.607  -11.760 1.00 40.39  ? 335 PHE B O   1 
ATOM   2343 C CB  . PHE B 1 135 ? 15.010  10.764  -13.341 1.00 58.25  ? 335 PHE B CB  1 
ATOM   2344 C CG  . PHE B 1 135 ? 13.784  11.076  -14.173 1.00 53.92  ? 335 PHE B CG  1 
ATOM   2345 C CD1 . PHE B 1 135 ? 13.190  12.326  -14.098 1.00 51.43  ? 335 PHE B CD1 1 
ATOM   2346 C CD2 . PHE B 1 135 ? 13.246  10.114  -15.012 1.00 43.79  ? 335 PHE B CD2 1 
ATOM   2347 C CE1 . PHE B 1 135 ? 12.066  12.606  -14.855 1.00 47.51  ? 335 PHE B CE1 1 
ATOM   2348 C CE2 . PHE B 1 135 ? 12.121  10.389  -15.768 1.00 40.47  ? 335 PHE B CE2 1 
ATOM   2349 C CZ  . PHE B 1 135 ? 11.536  11.638  -15.687 1.00 43.87  ? 335 PHE B CZ  1 
ATOM   2350 N N   . LYS B 1 136 ? 18.553  10.470  -13.580 1.00 53.22  ? 336 LYS B N   1 
ATOM   2351 C CA  . LYS B 1 136 ? 19.543  9.773   -12.746 1.00 60.86  ? 336 LYS B CA  1 
ATOM   2352 C C   . LYS B 1 136 ? 20.114  10.669  -11.654 1.00 61.52  ? 336 LYS B C   1 
ATOM   2353 O O   . LYS B 1 136 ? 20.358  10.197  -10.540 1.00 66.97  ? 336 LYS B O   1 
ATOM   2354 C CB  . LYS B 1 136 ? 20.656  9.199   -13.626 1.00 65.55  ? 336 LYS B CB  1 
ATOM   2355 C CG  . LYS B 1 136 ? 21.972  8.945   -12.905 1.00 64.32  ? 336 LYS B CG  1 
ATOM   2356 C CD  . LYS B 1 136 ? 22.938  8.167   -13.787 1.00 58.06  ? 336 LYS B CD  1 
ATOM   2357 C CE  . LYS B 1 136 ? 23.912  7.363   -12.941 1.00 55.96  ? 336 LYS B CE  1 
ATOM   2358 N NZ  . LYS B 1 136 ? 25.254  7.274   -13.587 1.00 61.05  ? 336 LYS B NZ  1 
ATOM   2359 N N   . GLU B 1 137 ? 20.346  11.957  -11.907 1.00 67.09  ? 337 GLU B N   1 
ATOM   2360 C CA  . GLU B 1 137 ? 20.947  12.811  -10.879 1.00 60.70  ? 337 GLU B CA  1 
ATOM   2361 C C   . GLU B 1 137 ? 20.057  12.862  -9.643  1.00 54.89  ? 337 GLU B C   1 
ATOM   2362 O O   . GLU B 1 137 ? 20.563  12.860  -8.521  1.00 54.68  ? 337 GLU B O   1 
ATOM   2363 C CB  . GLU B 1 137 ? 21.202  14.227  -11.394 1.00 57.17  ? 337 GLU B CB  1 
ATOM   2364 C CG  . GLU B 1 137 ? 19.934  14.937  -11.850 1.00 65.21  ? 337 GLU B CG  1 
ATOM   2365 C CD  . GLU B 1 137 ? 20.135  16.425  -12.056 1.00 69.34  ? 337 GLU B CD  1 
ATOM   2366 O OE1 . GLU B 1 137 ? 21.060  16.787  -12.803 1.00 84.24  ? 337 GLU B OE1 1 
ATOM   2367 O OE2 . GLU B 1 137 ? 19.376  17.221  -11.467 1.00 62.46  ? 337 GLU B OE2 1 
ATOM   2368 N N   . ASP B 1 138 ? 18.748  12.905  -9.869  1.00 52.25  ? 338 ASP B N   1 
ATOM   2369 C CA  . ASP B 1 138 ? 17.790  12.907  -8.779  1.00 51.72  ? 338 ASP B CA  1 
ATOM   2370 C C   . ASP B 1 138 ? 17.952  11.645  -7.937  1.00 61.71  ? 338 ASP B C   1 
ATOM   2371 O O   . ASP B 1 138 ? 18.238  11.716  -6.747  1.00 65.25  ? 338 ASP B O   1 
ATOM   2372 C CB  . ASP B 1 138 ? 16.348  12.951  -9.278  1.00 54.11  ? 338 ASP B CB  1 
ATOM   2373 C CG  . ASP B 1 138 ? 16.021  14.282  -9.928  1.00 64.57  ? 338 ASP B CG  1 
ATOM   2374 O OD1 . ASP B 1 138 ? 16.552  14.520  -11.028 1.00 75.22  ? 338 ASP B OD1 1 
ATOM   2375 O OD2 . ASP B 1 138 ? 15.250  15.050  -9.321  1.00 66.99  ? 338 ASP B OD2 1 
ATOM   2376 N N   . ILE B 1 139 ? 17.744  10.509  -8.604  1.00 57.37  ? 339 ILE B N   1 
ATOM   2377 C CA  . ILE B 1 139 ? 17.820  9.236   -7.895  1.00 49.01  ? 339 ILE B CA  1 
ATOM   2378 C C   . ILE B 1 139 ? 19.150  9.106   -7.161  1.00 50.54  ? 339 ILE B C   1 
ATOM   2379 O O   . ILE B 1 139 ? 19.162  8.884   -5.950  1.00 52.43  ? 339 ILE B O   1 
ATOM   2380 C CB  . ILE B 1 139 ? 17.628  8.045   -8.850  1.00 42.47  ? 339 ILE B CB  1 
ATOM   2381 C CG1 . ILE B 1 139 ? 16.356  8.117   -9.693  1.00 35.10  ? 339 ILE B CG1 1 
ATOM   2382 C CG2 . ILE B 1 139 ? 17.683  6.740   -8.065  1.00 48.74  ? 339 ILE B CG2 1 
ATOM   2383 C CD1 . ILE B 1 139 ? 16.498  7.551   -11.089 1.00 38.82  ? 339 ILE B CD1 1 
ATOM   2384 N N   . LEU B 1 140 ? 20.267  9.247   -7.869  1.00 58.41  ? 340 LEU B N   1 
ATOM   2385 C CA  . LEU B 1 140 ? 21.589  9.170   -7.255  1.00 56.17  ? 340 LEU B CA  1 
ATOM   2386 C C   . LEU B 1 140 ? 21.682  10.095  -6.044  1.00 56.97  ? 340 LEU B C   1 
ATOM   2387 O O   . LEU B 1 140 ? 22.373  9.793   -5.068  1.00 66.48  ? 340 LEU B O   1 
ATOM   2388 C CB  . LEU B 1 140 ? 22.685  9.507   -8.265  1.00 53.39  ? 340 LEU B CB  1 
ATOM   2389 C CG  . LEU B 1 140 ? 22.912  8.505   -9.404  1.00 56.70  ? 340 LEU B CG  1 
ATOM   2390 C CD1 . LEU B 1 140 ? 24.337  8.605   -9.925  1.00 65.71  ? 340 LEU B CD1 1 
ATOM   2391 C CD2 . LEU B 1 140 ? 22.609  7.080   -8.973  1.00 45.11  ? 340 LEU B CD2 1 
ATOM   2392 N N   . SER B 1 141 ? 20.983  11.220  -6.101  1.00 57.26  ? 341 SER B N   1 
ATOM   2393 C CA  . SER B 1 141 ? 20.916  12.147  -4.974  1.00 66.66  ? 341 SER B CA  1 
ATOM   2394 C C   . SER B 1 141 ? 19.978  11.607  -3.897  1.00 69.47  ? 341 SER B C   1 
ATOM   2395 O O   . SER B 1 141 ? 20.362  11.465  -2.735  1.00 86.78  ? 341 SER B O   1 
ATOM   2396 C CB  . SER B 1 141 ? 20.473  13.533  -5.442  1.00 68.13  ? 341 SER B CB  1 
ATOM   2397 O OG  . SER B 1 141 ? 19.116  13.805  -5.123  1.00 67.04  ? 341 SER B OG  1 
ATOM   2398 N N   . ALA B 1 142 ? 18.743  11.293  -4.275  1.00 62.57  ? 342 ALA B N   1 
ATOM   2399 C CA  . ALA B 1 142 ? 17.761  10.754  -3.344  1.00 63.19  ? 342 ALA B CA  1 
ATOM   2400 C C   . ALA B 1 142 ? 18.284  9.527   -2.605  1.00 60.96  ? 342 ALA B C   1 
ATOM   2401 O O   . ALA B 1 142 ? 17.854  9.262   -1.483  1.00 65.55  ? 342 ALA B O   1 
ATOM   2402 C CB  . ALA B 1 142 ? 16.478  10.389  -4.079  1.00 78.05  ? 342 ALA B CB  1 
ATOM   2403 N N   . ILE B 1 143 ? 19.192  8.794   -3.231  1.00 60.82  ? 343 ILE B N   1 
ATOM   2404 C CA  . ILE B 1 143 ? 19.760  7.592   -2.630  1.00 65.94  ? 343 ILE B CA  1 
ATOM   2405 C C   . ILE B 1 143 ? 20.759  7.956   -1.538  1.00 70.48  ? 343 ILE B C   1 
ATOM   2406 O O   . ILE B 1 143 ? 20.699  7.440   -0.418  1.00 91.08  ? 343 ILE B O   1 
ATOM   2407 C CB  . ILE B 1 143 ? 20.453  6.691   -3.672  1.00 64.09  ? 343 ILE B CB  1 
ATOM   2408 C CG1 . ILE B 1 143 ? 19.508  5.880   -4.554  1.00 63.64  ? 343 ILE B CG1 1 
ATOM   2409 C CG2 . ILE B 1 143 ? 21.456  5.763   -2.992  1.00 56.57  ? 343 ILE B CG2 1 
ATOM   2410 C CD1 . ILE B 1 143 ? 20.226  5.094   -5.647  1.00 52.67  ? 343 ILE B CD1 1 
ATOM   2411 N N   . LYS B 1 144 ? 21.699  8.854   -1.837  1.00 72.88  ? 344 LYS B N   1 
ATOM   2412 C CA  . LYS B 1 144 ? 22.686  9.252   -0.841  1.00 78.93  ? 344 LYS B CA  1 
ATOM   2413 C C   . LYS B 1 144 ? 22.080  10.202  0.193   1.00 85.22  ? 344 LYS B C   1 
ATOM   2414 O O   . LYS B 1 144 ? 22.786  10.646  1.098   1.00 80.63  ? 344 LYS B O   1 
ATOM   2415 C CB  . LYS B 1 144 ? 23.894  9.916   -1.512  1.00 83.83  ? 344 LYS B CB  1 
ATOM   2416 C CG  . LYS B 1 144 ? 25.107  10.052  -0.607  1.00 89.02  ? 344 LYS B CG  1 
ATOM   2417 C CD  . LYS B 1 144 ? 25.099  8.958   0.457   1.00 95.09  ? 344 LYS B CD  1 
ATOM   2418 C CE  . LYS B 1 144 ? 26.331  9.058   1.350   1.00 98.57  ? 344 LYS B CE  1 
ATOM   2419 N NZ  . LYS B 1 144 ? 27.110  7.787   1.382   1.00 93.16  ? 344 LYS B NZ  1 
ATOM   2420 N N   . GLU B 1 145 ? 20.799  10.496  0.049   1.00 87.79  ? 345 GLU B N   1 
ATOM   2421 C CA  . GLU B 1 145 ? 20.026  11.387  0.902   1.00 93.18  ? 345 GLU B CA  1 
ATOM   2422 C C   . GLU B 1 145 ? 19.636  10.740  2.224   1.00 96.29  ? 345 GLU B C   1 
ATOM   2423 O O   . GLU B 1 145 ? 18.494  10.864  2.672   1.00 86.56  ? 345 GLU B O   1 
ATOM   2424 C CB  . GLU B 1 145 ? 18.757  11.841  0.163   1.00 93.73  ? 345 GLU B CB  1 
ATOM   2425 C CG  . GLU B 1 145 ? 18.215  13.191  0.605   1.00 89.63  ? 345 GLU B CG  1 
ATOM   2426 C CD  . GLU B 1 145 ? 19.143  14.334  0.236   1.00 83.82  ? 345 GLU B CD  1 
ATOM   2427 O OE1 . GLU B 1 145 ? 20.370  14.188  0.438   1.00 60.12  ? 345 GLU B OE1 1 
ATOM   2428 O OE2 . GLU B 1 145 ? 18.635  15.366  -0.252  1.00 83.07  ? 345 GLU B OE2 1 
ATOM   2429 N N   . GLY B 1 146 ? 20.578  10.045  2.864   1.00 99.44  ? 346 GLY B N   1 
ATOM   2430 C CA  . GLY B 1 146 ? 20.292  9.418   4.143   1.00 102.42 ? 346 GLY B CA  1 
ATOM   2431 C C   . GLY B 1 146 ? 19.655  8.051   3.986   1.00 107.02 ? 346 GLY B C   1 
ATOM   2432 O O   . GLY B 1 146 ? 20.077  7.240   3.156   1.00 111.38 ? 346 GLY B O   1 
ATOM   2433 N N   . ARG B 1 147 ? 18.629  7.785   4.795   1.00 111.81 ? 347 ARG B N   1 
ATOM   2434 C CA  . ARG B 1 147 ? 17.997  6.468   4.768   1.00 120.52 ? 347 ARG B CA  1 
ATOM   2435 C C   . ARG B 1 147 ? 16.591  6.490   5.335   1.00 120.53 ? 347 ARG B C   1 
ATOM   2436 O O   . ARG B 1 147 ? 16.176  7.557   5.817   1.00 123.26 ? 347 ARG B O   1 
ATOM   2437 C CB  . ARG B 1 147 ? 18.876  5.467   5.541   1.00 123.66 ? 347 ARG B CB  1 
ATOM   2438 C CG  . ARG B 1 147 ? 19.253  5.925   6.942   1.00 125.34 ? 347 ARG B CG  1 
ATOM   2439 C CD  . ARG B 1 147 ? 20.462  6.819   6.933   1.00 125.73 ? 347 ARG B CD  1 
ATOM   2440 N NE  . ARG B 1 147 ? 21.082  6.935   8.253   1.00 126.99 ? 347 ARG B NE  1 
ATOM   2441 C CZ  . ARG B 1 147 ? 21.403  8.085   8.860   1.00 126.51 ? 347 ARG B CZ  1 
ATOM   2442 N NH1 . ARG B 1 147 ? 21.137  9.248   8.268   1.00 122.34 ? 347 ARG B NH1 1 
ATOM   2443 N NH2 . ARG B 1 147 ? 21.986  8.068   10.071  1.00 123.23 ? 347 ARG B NH2 1 
ATOM   2444 O OXT . ARG B 1 147 ? 15.910  5.452   5.297   1.00 114.68 ? 347 ARG B OXT 1 
HETATM 2445 O O   . HOH C 2 .   ? 10.664  -4.936  -12.758 1.00 28.55  ? 401 HOH A O   1 
HETATM 2446 O O   . HOH C 2 .   ? 12.859  -17.443 -4.256  1.00 35.31  ? 402 HOH A O   1 
HETATM 2447 O O   . HOH C 2 .   ? 25.249  -10.293 -5.623  1.00 36.55  ? 403 HOH A O   1 
HETATM 2448 O O   . HOH C 2 .   ? 23.101  -15.348 -0.760  1.00 27.06  ? 404 HOH A O   1 
HETATM 2449 O O   . HOH C 2 .   ? 9.360   -7.638  -26.276 1.00 30.45  ? 405 HOH A O   1 
HETATM 2450 O O   . HOH C 2 .   ? 10.797  -17.612 -2.929  1.00 41.42  ? 406 HOH A O   1 
HETATM 2451 O O   . HOH C 2 .   ? 12.520  -16.896 -7.258  1.00 28.39  ? 407 HOH A O   1 
HETATM 2452 O O   . HOH C 2 .   ? 8.892   -16.736 -4.895  1.00 46.85  ? 408 HOH A O   1 
HETATM 2453 O O   . HOH C 2 .   ? 10.747  -11.302 -10.502 1.00 43.08  ? 410 HOH A O   1 
HETATM 2454 O O   . HOH C 2 .   ? 20.454  -12.414 -27.165 1.00 52.70  ? 412 HOH A O   1 
HETATM 2455 O O   . HOH C 2 .   ? 32.908  -9.779  7.288   1.00 55.92  ? 413 HOH A O   1 
HETATM 2456 O O   . HOH C 2 .   ? 28.686  -9.772  1.339   1.00 51.98  ? 414 HOH A O   1 
HETATM 2457 O O   . HOH C 2 .   ? -0.695  -16.207 -26.694 1.00 42.98  ? 416 HOH A O   1 
HETATM 2458 O O   . HOH C 2 .   ? 23.405  -15.506 6.994   1.00 56.29  ? 419 HOH A O   1 
HETATM 2459 O O   . HOH C 2 .   ? 27.736  -16.378 6.541   1.00 35.53  ? 420 HOH A O   1 
HETATM 2460 O O   . HOH C 2 .   ? 3.976   -13.987 -7.229  1.00 44.91  ? 421 HOH A O   1 
HETATM 2461 O O   . HOH C 2 .   ? 13.970  -5.950  -6.634  1.00 31.55  ? 424 HOH A O   1 
HETATM 2462 O O   . HOH C 2 .   ? 20.269  -3.520  -28.880 1.00 39.08  ? 425 HOH A O   1 
HETATM 2463 O O   . HOH C 2 .   ? 5.409   -5.216  -12.360 1.00 45.25  ? 426 HOH A O   1 
HETATM 2464 O O   . HOH C 2 .   ? 26.908  -7.864  -6.723  1.00 47.07  ? 428 HOH A O   1 
HETATM 2465 O O   . HOH C 2 .   ? 13.816  -8.011  -5.046  1.00 65.50  ? 429 HOH A O   1 
HETATM 2466 O O   . HOH C 2 .   ? 8.620   -24.139 -5.261  1.00 42.37  ? 430 HOH A O   1 
HETATM 2467 O O   . HOH C 2 .   ? 20.338  -19.964 -25.513 1.00 53.07  ? 431 HOH A O   1 
HETATM 2468 O O   . HOH C 2 .   ? 15.161  -9.937  -3.538  1.00 44.93  ? 432 HOH A O   1 
HETATM 2469 O O   . HOH C 2 .   ? 31.953  -16.217 -4.624  1.00 56.92  ? 433 HOH A O   1 
HETATM 2470 O O   . HOH C 2 .   ? 18.354  -14.052 -0.247  1.00 59.50  ? 434 HOH A O   1 
HETATM 2471 O O   . HOH C 2 .   ? 16.473  -14.269 1.341   1.00 54.07  ? 435 HOH A O   1 
HETATM 2472 O O   . HOH C 2 .   ? 14.672  -26.716 -10.820 1.00 51.39  ? 436 HOH A O   1 
HETATM 2473 O O   . HOH C 2 .   ? 18.311  -11.512 -34.887 1.00 71.07  ? 437 HOH A O   1 
HETATM 2474 O O   . HOH C 2 .   ? 0.777   -25.053 -24.933 1.00 66.53  ? 438 HOH A O   1 
HETATM 2475 O O   . HOH C 2 .   ? -5.278  -15.582 -15.421 1.00 42.77  ? 439 HOH A O   1 
HETATM 2476 O O   . HOH C 2 .   ? 24.661  -16.477 -26.691 1.00 86.43  ? 440 HOH A O   1 
HETATM 2477 O O   . HOH C 2 .   ? 4.222   -22.665 -26.169 1.00 59.72  ? 442 HOH A O   1 
HETATM 2478 O O   . HOH C 2 .   ? 14.416  -20.663 -29.218 1.00 44.43  ? 443 HOH A O   1 
HETATM 2479 O O   . HOH C 2 .   ? -15.088 -3.757  -19.906 1.00 62.93  ? 444 HOH A O   1 
HETATM 2480 O O   . HOH C 2 .   ? 26.619  -13.948 6.938   1.00 60.35  ? 445 HOH A O   1 
HETATM 2481 O O   . HOH C 2 .   ? -8.297  -6.948  -24.044 1.00 56.06  ? 446 HOH A O   1 
HETATM 2482 O O   . HOH C 2 .   ? 21.672  -12.704 2.446   1.00 49.72  ? 448 HOH A O   1 
HETATM 2483 O O   . HOH C 2 .   ? 5.255   -24.032 -18.683 1.00 52.54  ? 449 HOH A O   1 
HETATM 2484 O O   . HOH C 2 .   ? 19.831  -8.863  -28.992 1.00 47.22  ? 450 HOH A O   1 
HETATM 2485 O O   . HOH C 2 .   ? 20.704  -14.426 0.907   1.00 42.54  ? 451 HOH A O   1 
HETATM 2486 O O   . HOH C 2 .   ? 12.094  -15.978 0.665   1.00 45.29  ? 454 HOH A O   1 
HETATM 2487 O O   . HOH C 2 .   ? 16.928  -17.440 0.490   1.00 45.80  ? 455 HOH A O   1 
HETATM 2488 O O   . HOH C 2 .   ? 22.904  -11.143 -30.427 1.00 62.82  ? 456 HOH A O   1 
HETATM 2489 O O   . HOH C 2 .   ? 18.226  -9.725  -2.530  1.00 58.90  ? 457 HOH A O   1 
HETATM 2490 O O   . HOH C 2 .   ? 8.260   -13.702 -32.539 1.00 60.11  ? 460 HOH A O   1 
HETATM 2491 O O   . HOH C 2 .   ? 16.721  -27.888 -25.461 1.00 71.31  ? 461 HOH A O   1 
HETATM 2492 O O   . HOH C 2 .   ? 1.399   -17.183 -7.358  1.00 65.74  ? 462 HOH A O   1 
HETATM 2493 O O   . HOH C 2 .   ? 14.883  -15.430 -1.151  1.00 40.85  ? 465 HOH A O   1 
HETATM 2494 O O   . HOH C 2 .   ? 28.106  -10.300 -1.362  1.00 41.03  ? 467 HOH A O   1 
HETATM 2495 O O   . HOH C 2 .   ? 37.114  -22.998 -6.692  1.00 51.24  ? 468 HOH A O   1 
HETATM 2496 O O   . HOH C 2 .   ? 11.477  -20.422 -26.137 1.00 50.80  ? 470 HOH A O   1 
HETATM 2497 O O   . HOH C 2 .   ? -0.867  -25.113 -23.014 1.00 61.29  ? 471 HOH A O   1 
HETATM 2498 O O   . HOH C 2 .   ? 23.715  -28.559 -29.417 1.00 60.49  ? 472 HOH A O   1 
HETATM 2499 O O   . HOH C 2 .   ? 12.699  -25.688 -21.944 1.00 47.70  ? 474 HOH A O   1 
HETATM 2500 O O   . HOH C 2 .   ? 32.692  -10.532 -7.093  1.00 66.49  ? 475 HOH A O   1 
HETATM 2501 O O   . HOH C 2 .   ? 19.391  -32.168 -13.702 1.00 63.70  ? 476 HOH A O   1 
HETATM 2502 O O   . HOH C 2 .   ? 36.114  -15.631 -7.903  1.00 88.52  ? 478 HOH A O   1 
HETATM 2503 O O   . HOH C 2 .   ? 11.869  -26.514 -27.497 1.00 51.86  ? 479 HOH A O   1 
HETATM 2504 O O   . HOH C 2 .   ? 7.219   -11.017 -30.766 1.00 56.81  ? 481 HOH A O   1 
HETATM 2505 O O   . HOH C 2 .   ? 20.817  -17.418 5.515   1.00 68.03  ? 482 HOH A O   1 
HETATM 2506 O O   . HOH C 2 .   ? 13.819  -28.232 -25.182 1.00 79.09  ? 483 HOH A O   1 
HETATM 2507 O O   . HOH C 2 .   ? 20.404  -0.079  -28.895 1.00 58.78  ? 484 HOH A O   1 
HETATM 2508 O O   . HOH C 2 .   ? 35.865  -19.552 -4.706  1.00 68.34  ? 485 HOH A O   1 
HETATM 2509 O O   . HOH C 2 .   ? 14.129  -29.498 -18.174 1.00 71.16  ? 487 HOH A O   1 
HETATM 2510 O O   . HOH C 2 .   ? 26.249  -4.091  -34.701 1.00 88.53  ? 488 HOH A O   1 
HETATM 2511 O O   . HOH C 2 .   ? -8.249  -8.431  -27.179 1.00 55.46  ? 490 HOH A O   1 
HETATM 2512 O O   . HOH C 2 .   ? 35.965  -9.204  -5.003  1.00 60.73  ? 491 HOH A O   1 
HETATM 2513 O O   . HOH C 2 .   ? -10.121 -13.652 -22.294 1.00 49.92  ? 493 HOH A O   1 
HETATM 2514 O O   . HOH C 2 .   ? 11.948  -25.946 -0.990  1.00 52.99  ? 494 HOH A O   1 
HETATM 2515 O O   . HOH C 2 .   ? 31.699  -20.518 5.367   1.00 77.95  ? 495 HOH A O   1 
HETATM 2516 O O   . HOH C 2 .   ? 27.585  -31.023 -20.525 1.00 57.74  ? 496 HOH A O   1 
HETATM 2517 O O   . HOH C 2 .   ? 25.649  -25.684 -29.870 1.00 98.02  ? 497 HOH A O   1 
HETATM 2518 O O   . HOH C 2 .   ? 28.245  -17.835 -25.980 1.00 75.98  ? 498 HOH A O   1 
HETATM 2519 O O   . HOH C 2 .   ? -7.129  -18.514 -15.820 1.00 53.28  ? 499 HOH A O   1 
HETATM 2520 O O   . HOH C 2 .   ? 22.058  -7.024  -28.379 1.00 49.61  ? 500 HOH A O   1 
HETATM 2521 O O   . HOH C 2 .   ? 6.191   -26.396 -20.374 1.00 93.35  ? 501 HOH A O   1 
HETATM 2522 O O   . HOH C 2 .   ? 12.047  -13.261 -30.504 1.00 71.30  ? 502 HOH A O   1 
HETATM 2523 O O   . HOH C 2 .   ? 35.297  -8.190  -23.715 1.00 52.70  ? 503 HOH A O   1 
HETATM 2524 O O   . HOH C 2 .   ? 20.502  -17.487 -31.811 1.00 65.64  ? 505 HOH A O   1 
HETATM 2525 O O   . HOH C 2 .   ? 18.091  -33.745 -16.408 1.00 81.27  ? 506 HOH A O   1 
HETATM 2526 O O   . HOH C 2 .   ? 16.950  -6.809  -30.278 1.00 77.72  ? 507 HOH A O   1 
HETATM 2527 O O   . HOH C 2 .   ? 18.145  -10.947 -30.926 1.00 82.32  ? 508 HOH A O   1 
HETATM 2528 O O   . HOH C 2 .   ? 24.800  -0.308  -20.924 1.00 60.57  ? 509 HOH A O   1 
HETATM 2529 O O   . HOH C 2 .   ? 29.522  -4.394  -17.286 1.00 47.57  ? 513 HOH A O   1 
HETATM 2530 O O   . HOH C 2 .   ? 35.909  -22.151 -4.479  1.00 57.89  ? 514 HOH A O   1 
HETATM 2531 O O   . HOH C 2 .   ? 20.196  -29.051 -22.241 1.00 48.19  ? 515 HOH A O   1 
HETATM 2532 O O   . HOH C 2 .   ? 19.262  -14.409 -27.885 1.00 54.91  ? 516 HOH A O   1 
HETATM 2533 O O   . HOH C 2 .   ? 23.446  -18.433 5.869   1.00 49.35  ? 517 HOH A O   1 
HETATM 2534 O O   . HOH C 2 .   ? 2.511   -25.013 -18.783 1.00 59.84  ? 520 HOH A O   1 
HETATM 2535 O O   . HOH C 2 .   ? 32.235  -7.724  -14.218 1.00 62.38  ? 521 HOH A O   1 
HETATM 2536 O O   . HOH C 2 .   ? 19.778  -7.102  -32.255 1.00 79.29  ? 525 HOH A O   1 
HETATM 2537 O O   . HOH C 2 .   ? -6.811  -28.891 -15.437 1.00 99.43  ? 526 HOH A O   1 
HETATM 2538 O O   . HOH C 2 .   ? 30.881  -19.690 8.604   1.00 44.83  ? 527 HOH A O   1 
HETATM 2539 O O   . HOH C 2 .   ? 26.144  -27.894 0.596   1.00 55.79  ? 528 HOH A O   1 
HETATM 2540 O O   . HOH C 2 .   ? 25.289  -3.947  -29.622 1.00 50.59  ? 529 HOH A O   1 
HETATM 2541 O O   . HOH C 2 .   ? 27.408  -29.885 -22.924 1.00 67.36  ? 530 HOH A O   1 
HETATM 2542 O O   . HOH C 2 .   ? 14.672  -23.731 -26.556 1.00 73.55  ? 531 HOH A O   1 
HETATM 2543 O O   . HOH C 2 .   ? 21.952  -20.023 -28.072 1.00 63.65  ? 533 HOH A O   1 
HETATM 2544 O O   . HOH C 2 .   ? 9.630   -16.515 -31.860 1.00 99.33  ? 540 HOH A O   1 
HETATM 2545 O O   . HOH C 2 .   ? 15.687  -29.572 -11.319 1.00 62.82  ? 541 HOH A O   1 
HETATM 2546 O O   . HOH C 2 .   ? 11.400  -6.348  -3.686  1.00 66.92  ? 542 HOH A O   1 
HETATM 2547 O O   . HOH C 2 .   ? -15.168 -0.306  -30.979 1.00 72.58  ? 543 HOH A O   1 
HETATM 2548 O O   . HOH C 2 .   ? 31.154  -5.875  -27.859 1.00 79.47  ? 544 HOH A O   1 
HETATM 2549 O O   . HOH C 2 .   ? 17.612  -15.594 -32.946 1.00 57.73  ? 545 HOH A O   1 
HETATM 2550 O O   . HOH C 2 .   ? 5.909   -26.201 -5.381  1.00 80.25  ? 546 HOH A O   1 
HETATM 2551 O O   . HOH C 2 .   ? -12.776 0.514   -29.379 1.00 58.05  ? 547 HOH A O   1 
HETATM 2552 O O   . HOH C 2 .   ? -1.261  -3.530  -9.862  1.00 46.39  ? 549 HOH A O   1 
HETATM 2553 O O   . HOH C 2 .   ? 22.342  -0.044  -27.351 1.00 52.84  ? 550 HOH A O   1 
HETATM 2554 O O   . HOH C 2 .   ? 32.604  -24.355 -19.109 1.00 55.66  ? 552 HOH A O   1 
HETATM 2555 O O   . HOH C 2 .   ? 23.577  -28.127 -23.252 1.00 62.90  ? 553 HOH A O   1 
HETATM 2556 O O   . HOH C 2 .   ? -6.792  -28.678 -12.988 1.00 62.96  ? 555 HOH A O   1 
HETATM 2557 O O   . HOH C 2 .   ? 28.725  -6.103  -27.631 1.00 98.52  ? 556 HOH A O   1 
HETATM 2558 O O   . HOH C 2 .   ? 31.533  -7.970  -11.124 1.00 60.70  ? 557 HOH A O   1 
HETATM 2559 O O   . HOH C 2 .   ? 27.078  -21.314 -26.827 1.00 85.47  ? 558 HOH A O   1 
HETATM 2560 O O   . HOH C 2 .   ? 15.460  -13.057 -0.568  1.00 47.55  ? 559 HOH A O   1 
HETATM 2561 O O   . HOH C 2 .   ? -12.278 -4.770  -24.742 1.00 81.60  ? 562 HOH A O   1 
HETATM 2562 O O   . HOH C 2 .   ? -12.743 -2.314  -27.688 1.00 59.06  ? 563 HOH A O   1 
HETATM 2563 O O   . HOH C 2 .   ? 11.161  -21.411 4.269   1.00 77.87  ? 565 HOH A O   1 
HETATM 2564 O O   . HOH C 2 .   ? 11.119  -19.168 -28.500 1.00 42.86  ? 568 HOH A O   1 
HETATM 2565 O O   . HOH C 2 .   ? -2.809  -14.023 -6.665  1.00 71.85  ? 572 HOH A O   1 
HETATM 2566 O O   . HOH C 2 .   ? 15.562  -21.826 8.580   1.00 61.88  ? 573 HOH A O   1 
HETATM 2567 O O   . HOH C 2 .   ? 32.178  -19.084 -26.360 1.00 40.28  ? 575 HOH A O   1 
HETATM 2568 O O   . HOH C 2 .   ? 29.270  -5.551  -10.949 1.00 99.13  ? 576 HOH A O   1 
HETATM 2569 O O   . HOH C 2 .   ? 17.888  -11.132 0.217   1.00 88.76  ? 578 HOH A O   1 
HETATM 2570 O O   . HOH C 2 .   ? 11.093  -7.557  -28.557 1.00 89.77  ? 579 HOH A O   1 
HETATM 2571 O O   . HOH C 2 .   ? 12.502  -23.881 -25.675 1.00 75.20  ? 580 HOH A O   1 
HETATM 2572 O O   . HOH C 2 .   ? 15.641  -24.253 10.443  1.00 98.25  ? 581 HOH A O   1 
HETATM 2573 O O   . HOH C 2 .   ? 9.927   -27.834 -20.361 1.00 93.51  ? 582 HOH A O   1 
HETATM 2574 O O   . HOH C 2 .   ? -8.160  -4.586  -22.220 1.00 98.46  ? 583 HOH A O   1 
HETATM 2575 O O   . HOH C 2 .   ? 37.619  -21.869 -9.792  1.00 93.56  ? 584 HOH A O   1 
HETATM 2576 O O   . HOH C 2 .   ? 21.371  -22.694 -25.261 1.00 85.83  ? 585 HOH A O   1 
HETATM 2577 O O   . HOH C 2 .   ? 30.237  -32.926 -19.653 1.00 61.53  ? 586 HOH A O   1 
HETATM 2578 O O   . HOH C 2 .   ? 27.955  -2.990  -30.725 1.00 75.58  ? 587 HOH A O   1 
HETATM 2579 O O   . HOH C 2 .   ? 5.578   -24.805 -29.753 1.00 56.43  ? 588 HOH A O   1 
HETATM 2580 O O   . HOH C 2 .   ? 27.393  -7.075  -3.892  1.00 76.41  ? 589 HOH A O   1 
HETATM 2581 O O   . HOH C 2 .   ? 35.017  -24.480 -13.657 1.00 89.13  ? 590 HOH A O   1 
HETATM 2582 O O   . HOH C 2 .   ? 13.181  -19.278 2.430   1.00 82.04  ? 591 HOH A O   1 
HETATM 2583 O O   . HOH C 2 .   ? 0.043   -6.511  -10.976 1.00 62.22  ? 592 HOH A O   1 
HETATM 2584 O O   . HOH C 2 .   ? 23.587  -18.664 -30.853 1.00 88.29  ? 593 HOH A O   1 
HETATM 2585 O O   . HOH C 2 .   ? -10.135 -2.978  -25.834 1.00 64.96  ? 594 HOH A O   1 
HETATM 2586 O O   . HOH C 2 .   ? 28.524  -5.156  -4.925  1.00 60.54  ? 595 HOH A O   1 
HETATM 2587 O O   . HOH C 2 .   ? 20.828  -12.908 -33.928 1.00 77.60  ? 596 HOH A O   1 
HETATM 2588 O O   . HOH C 2 .   ? -0.556  -12.372 -5.640  1.00 61.51  ? 599 HOH A O   1 
HETATM 2589 O O   . HOH C 2 .   ? 17.151  -30.111 -22.882 1.00 92.10  ? 605 HOH A O   1 
HETATM 2590 O O   . HOH C 2 .   ? 29.449  -20.148 -27.654 1.00 94.79  ? 606 HOH A O   1 
HETATM 2591 O O   . HOH C 2 .   ? 28.735  -3.269  -12.911 1.00 77.94  ? 607 HOH A O   1 
HETATM 2592 O O   . HOH C 2 .   ? 10.551  -27.577 1.482   1.00 100.29 ? 608 HOH A O   1 
HETATM 2593 O O   . HOH C 2 .   ? 20.333  -15.724 -33.923 1.00 72.97  ? 609 HOH A O   1 
HETATM 2594 O O   . HOH C 2 .   ? 9.942   -7.364  -8.919  1.00 57.27  ? 610 HOH A O   1 
HETATM 2595 O O   . HOH C 2 .   ? -0.276  -15.663 -5.699  1.00 60.77  ? 612 HOH A O   1 
HETATM 2596 O O   . HOH C 2 .   ? 6.761   -9.242  -33.593 1.00 65.27  ? 616 HOH A O   1 
HETATM 2597 O O   . HOH C 2 .   ? 24.100  -1.509  -23.526 1.00 82.68  ? 619 HOH A O   1 
HETATM 2598 O O   . HOH C 2 .   ? 24.587  -29.444 -21.367 1.00 80.99  ? 620 HOH A O   1 
HETATM 2599 O O   . HOH C 2 .   ? 12.195  -11.864 -32.639 1.00 66.35  ? 621 HOH A O   1 
HETATM 2600 O O   . HOH C 2 .   ? 12.578  -5.498  -29.594 1.00 60.38  ? 623 HOH A O   1 
HETATM 2601 O O   . HOH C 2 .   ? -1.481  -25.833 -14.483 1.00 76.42  ? 624 HOH A O   1 
HETATM 2602 O O   . HOH C 2 .   ? 8.394   -8.930  -29.761 1.00 90.67  ? 628 HOH A O   1 
HETATM 2603 O O   . HOH C 2 .   ? 16.846  -16.606 2.973   1.00 68.94  ? 629 HOH A O   1 
HETATM 2604 O O   . HOH C 2 .   ? 18.928  -18.159 1.898   1.00 69.31  ? 630 HOH A O   1 
HETATM 2605 O O   . HOH C 2 .   ? 12.276  -23.533 -28.330 1.00 81.29  ? 632 HOH A O   1 
HETATM 2606 O O   . HOH C 2 .   ? 27.067  -23.291 -28.887 1.00 84.59  ? 633 HOH A O   1 
HETATM 2607 O O   . HOH C 2 .   ? 28.549  -34.253 -18.678 1.00 101.63 ? 634 HOH A O   1 
HETATM 2608 O O   . HOH C 2 .   ? 16.477  -4.281  -29.614 1.00 80.32  ? 635 HOH A O   1 
HETATM 2609 O O   . HOH C 2 .   ? 20.020  -15.285 -36.560 1.00 99.01  ? 637 HOH A O   1 
HETATM 2610 O O   . HOH C 2 .   ? 8.819   -26.359 -24.078 1.00 88.17  ? 639 HOH A O   1 
HETATM 2611 O O   . HOH C 2 .   ? 29.131  -14.496 -24.664 1.00 79.33  ? 641 HOH A O   1 
HETATM 2612 O O   . HOH C 2 .   ? 25.607  -6.004  -28.228 1.00 74.70  ? 644 HOH A O   1 
HETATM 2613 O O   . HOH C 2 .   ? 14.405  -26.645 10.414  1.00 75.27  ? 645 HOH A O   1 
HETATM 2614 O O   . HOH C 2 .   ? 37.127  -20.138 -12.212 1.00 75.89  ? 649 HOH A O   1 
HETATM 2615 O O   . HOH C 2 .   ? 25.911  -30.340 1.074   1.00 72.24  ? 650 HOH A O   1 
HETATM 2616 O O   . HOH C 2 .   ? 28.023  -5.818  -32.488 1.00 72.48  ? 651 HOH A O   1 
HETATM 2617 O O   . HOH C 2 .   ? 25.585  -9.267  -29.254 1.00 87.12  ? 652 HOH A O   1 
HETATM 2618 O O   . HOH D 2 .   ? 7.166   1.030   -11.396 1.00 36.40  ? 409 HOH B O   1 
HETATM 2619 O O   . HOH D 2 .   ? 11.882  -5.664  -7.889  1.00 41.53  ? 411 HOH B O   1 
HETATM 2620 O O   . HOH D 2 .   ? 20.026  13.033  -14.978 1.00 49.71  ? 415 HOH B O   1 
HETATM 2621 O O   . HOH D 2 .   ? 3.390   -4.908  -13.993 1.00 30.85  ? 417 HOH B O   1 
HETATM 2622 O O   . HOH D 2 .   ? -2.790  1.090   -22.193 1.00 39.21  ? 418 HOH B O   1 
HETATM 2623 O O   . HOH D 2 .   ? 17.736  7.359   -25.233 1.00 60.84  ? 422 HOH B O   1 
HETATM 2624 O O   . HOH D 2 .   ? 25.528  9.105   -17.033 1.00 61.20  ? 423 HOH B O   1 
HETATM 2625 O O   . HOH D 2 .   ? 3.532   16.677  -12.578 1.00 53.83  ? 427 HOH B O   1 
HETATM 2626 O O   . HOH D 2 .   ? 12.551  15.415  -30.561 1.00 64.86  ? 441 HOH B O   1 
HETATM 2627 O O   . HOH D 2 .   ? 8.382   17.484  -30.158 1.00 38.48  ? 447 HOH B O   1 
HETATM 2628 O O   . HOH D 2 .   ? 29.092  2.517   -10.157 1.00 63.58  ? 452 HOH B O   1 
HETATM 2629 O O   . HOH D 2 .   ? 4.038   26.574  -16.045 1.00 54.47  ? 453 HOH B O   1 
HETATM 2630 O O   . HOH D 2 .   ? 17.911  10.611  -26.177 1.00 48.40  ? 458 HOH B O   1 
HETATM 2631 O O   . HOH D 2 .   ? -6.818  4.061   -16.559 1.00 52.66  ? 459 HOH B O   1 
HETATM 2632 O O   . HOH D 2 .   ? 28.014  -10.571 5.018   1.00 45.15  ? 463 HOH B O   1 
HETATM 2633 O O   . HOH D 2 .   ? 1.565   -3.451  -12.290 1.00 36.21  ? 464 HOH B O   1 
HETATM 2634 O O   . HOH D 2 .   ? -7.299  0.557   -24.013 1.00 57.34  ? 466 HOH B O   1 
HETATM 2635 O O   . HOH D 2 .   ? 14.452  3.133   -32.579 1.00 91.75  ? 469 HOH B O   1 
HETATM 2636 O O   . HOH D 2 .   ? 15.240  17.260  -21.657 1.00 56.91  ? 473 HOH B O   1 
HETATM 2637 O O   . HOH D 2 .   ? -2.562  -0.389  -24.494 1.00 72.42  ? 477 HOH B O   1 
HETATM 2638 O O   . HOH D 2 .   ? -7.632  3.637   -14.174 1.00 49.53  ? 480 HOH B O   1 
HETATM 2639 O O   . HOH D 2 .   ? -0.680  -2.304  -13.212 1.00 64.69  ? 486 HOH B O   1 
HETATM 2640 O O   . HOH D 2 .   ? 24.533  5.199   -18.889 1.00 68.27  ? 489 HOH B O   1 
HETATM 2641 O O   . HOH D 2 .   ? 4.495   2.634   -31.972 1.00 50.72  ? 492 HOH B O   1 
HETATM 2642 O O   . HOH D 2 .   ? -6.309  8.039   -26.198 1.00 52.30  ? 504 HOH B O   1 
HETATM 2643 O O   . HOH D 2 .   ? 16.285  2.588   4.415   1.00 61.70  ? 510 HOH B O   1 
HETATM 2644 O O   . HOH D 2 .   ? 8.464   -2.499  -2.786  1.00 58.48  ? 511 HOH B O   1 
HETATM 2645 O O   . HOH D 2 .   ? -0.283  -1.728  -25.359 1.00 51.53  ? 512 HOH B O   1 
HETATM 2646 O O   . HOH D 2 .   ? 22.416  9.872   -17.347 1.00 43.39  ? 518 HOH B O   1 
HETATM 2647 O O   . HOH D 2 .   ? 6.523   3.629   -33.202 1.00 51.38  ? 519 HOH B O   1 
HETATM 2648 O O   . HOH D 2 .   ? 19.072  19.652  -1.853  1.00 51.79  ? 522 HOH B O   1 
HETATM 2649 O O   . HOH D 2 .   ? 0.703   -1.887  -27.643 1.00 76.12  ? 523 HOH B O   1 
HETATM 2650 O O   . HOH D 2 .   ? 1.313   22.926  -21.656 1.00 94.09  ? 524 HOH B O   1 
HETATM 2651 O O   . HOH D 2 .   ? -9.722  11.324  -27.128 1.00 72.21  ? 532 HOH B O   1 
HETATM 2652 O O   . HOH D 2 .   ? 5.454   11.911  2.283   1.00 70.46  ? 534 HOH B O   1 
HETATM 2653 O O   . HOH D 2 .   ? -13.947 12.836  -24.443 1.00 77.63  ? 535 HOH B O   1 
HETATM 2654 O O   . HOH D 2 .   ? -2.918  14.926  -31.119 1.00 78.25  ? 536 HOH B O   1 
HETATM 2655 O O   . HOH D 2 .   ? 27.228  9.520   -13.457 1.00 61.00  ? 537 HOH B O   1 
HETATM 2656 O O   . HOH D 2 .   ? 24.218  11.736  -23.733 1.00 84.44  ? 538 HOH B O   1 
HETATM 2657 O O   . HOH D 2 .   ? -12.066 10.654  -26.316 1.00 49.27  ? 539 HOH B O   1 
HETATM 2658 O O   . HOH D 2 .   ? -2.478  2.022   -29.865 1.00 66.10  ? 548 HOH B O   1 
HETATM 2659 O O   . HOH D 2 .   ? 7.055   -0.602  -2.519  1.00 49.79  ? 551 HOH B O   1 
HETATM 2660 O O   . HOH D 2 .   ? -11.305 -1.444  -20.979 1.00 59.69  ? 554 HOH B O   1 
HETATM 2661 O O   . HOH D 2 .   ? 16.340  15.357  -27.961 1.00 65.60  ? 560 HOH B O   1 
HETATM 2662 O O   . HOH D 2 .   ? 17.354  -9.809  4.067   1.00 65.86  ? 561 HOH B O   1 
HETATM 2663 O O   . HOH D 2 .   ? 8.028   0.383   -33.592 1.00 66.98  ? 564 HOH B O   1 
HETATM 2664 O O   . HOH D 2 .   ? 9.476   -2.551  -34.555 1.00 60.42  ? 566 HOH B O   1 
HETATM 2665 O O   . HOH D 2 .   ? 7.299   9.327   2.239   1.00 76.11  ? 567 HOH B O   1 
HETATM 2666 O O   . HOH D 2 .   ? 29.627  1.406   -5.244  1.00 58.12  ? 569 HOH B O   1 
HETATM 2667 O O   . HOH D 2 .   ? 19.146  17.376  -3.039  1.00 58.59  ? 570 HOH B O   1 
HETATM 2668 O O   . HOH D 2 .   ? 6.699   2.547   -1.497  1.00 54.68  ? 571 HOH B O   1 
HETATM 2669 O O   . HOH D 2 .   ? 15.341  1.767   6.445   1.00 51.87  ? 574 HOH B O   1 
HETATM 2670 O O   . HOH D 2 .   ? 11.282  10.111  -34.019 1.00 67.77  ? 577 HOH B O   1 
HETATM 2671 O O   . HOH D 2 .   ? 14.901  14.219  -5.952  1.00 65.58  ? 597 HOH B O   1 
HETATM 2672 O O   . HOH D 2 .   ? -9.335  0.826   -16.225 1.00 79.33  ? 598 HOH B O   1 
HETATM 2673 O O   . HOH D 2 .   ? -0.091  25.111  -9.141  1.00 53.37  ? 600 HOH B O   1 
HETATM 2674 O O   . HOH D 2 .   ? 23.241  13.400  -2.399  1.00 95.67  ? 601 HOH B O   1 
HETATM 2675 O O   . HOH D 2 .   ? 12.388  -1.109  -33.929 1.00 55.98  ? 602 HOH B O   1 
HETATM 2676 O O   . HOH D 2 .   ? 15.960  18.498  -3.803  1.00 74.98  ? 603 HOH B O   1 
HETATM 2677 O O   . HOH D 2 .   ? -14.708 10.172  -27.467 1.00 64.85  ? 604 HOH B O   1 
HETATM 2678 O O   . HOH D 2 .   ? 0.328   5.016   -8.860  1.00 75.53  ? 611 HOH B O   1 
HETATM 2679 O O   . HOH D 2 .   ? 2.090   22.473  -9.419  1.00 98.52  ? 613 HOH B O   1 
HETATM 2680 O O   . HOH D 2 .   ? 11.223  11.048  -1.926  1.00 66.98  ? 614 HOH B O   1 
HETATM 2681 O O   . HOH D 2 .   ? -5.006  2.491   -11.892 1.00 86.43  ? 615 HOH B O   1 
HETATM 2682 O O   . HOH D 2 .   ? -14.060 15.638  -21.764 1.00 98.06  ? 617 HOH B O   1 
HETATM 2683 O O   . HOH D 2 .   ? 10.938  0.958   -34.384 1.00 80.69  ? 618 HOH B O   1 
HETATM 2684 O O   . HOH D 2 .   ? 10.727  -5.030  -31.824 1.00 95.66  ? 622 HOH B O   1 
HETATM 2685 O O   . HOH D 2 .   ? 4.280   21.151  -7.642  1.00 74.16  ? 625 HOH B O   1 
HETATM 2686 O O   . HOH D 2 .   ? -0.343  27.741  -10.187 1.00 57.53  ? 626 HOH B O   1 
HETATM 2687 O O   . HOH D 2 .   ? 0.772   1.653   -31.088 1.00 73.87  ? 627 HOH B O   1 
HETATM 2688 O O   . HOH D 2 .   ? 12.949  2.130   -35.350 1.00 57.45  ? 631 HOH B O   1 
HETATM 2689 O O   . HOH D 2 .   ? 4.928   9.360   3.556   1.00 98.22  ? 636 HOH B O   1 
HETATM 2690 O O   . HOH D 2 .   ? -6.966  27.400  -21.617 1.00 60.54  ? 638 HOH B O   1 
HETATM 2691 O O   . HOH D 2 .   ? 21.828  8.288   -19.636 1.00 71.70  ? 640 HOH B O   1 
HETATM 2692 O O   . HOH D 2 .   ? 2.791   4.688   -8.896  1.00 68.45  ? 642 HOH B O   1 
HETATM 2693 O O   . HOH D 2 .   ? -16.749 17.182  -14.535 1.00 73.27  ? 643 HOH B O   1 
HETATM 2694 O O   . HOH D 2 .   ? 3.606   22.490  -11.394 1.00 75.99  ? 646 HOH B O   1 
HETATM 2695 O O   . HOH D 2 .   ? -8.114  5.657   -11.010 1.00 72.18  ? 647 HOH B O   1 
HETATM 2696 O O   . HOH D 2 .   ? 16.845  13.345  -30.686 1.00 81.52  ? 648 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  TYR 30  30  30  TYR TYR A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  HIS 35  35  35  HIS HIS A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 TRP 113 113 113 TRP TRP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
B 1 1   MET 1   201 201 MET MET B . n 
B 1 2   LYS 2   202 202 LYS LYS B . n 
B 1 3   MET 3   203 203 MET MET B . n 
B 1 4   LEU 4   204 204 LEU LEU B . n 
B 1 5   GLU 5   205 205 GLU GLU B . n 
B 1 6   GLN 6   206 206 GLN GLN B . n 
B 1 7   LEU 7   207 207 LEU LEU B . n 
B 1 8   GLU 8   208 208 GLU GLU B . n 
B 1 9   LYS 9   209 209 LYS LYS B . n 
B 1 10  LYS 10  210 210 LYS LYS B . n 
B 1 11  LEU 11  211 211 LEU LEU B . n 
B 1 12  GLY 12  212 212 GLY GLY B . n 
B 1 13  TYR 13  213 213 TYR TYR B . n 
B 1 14  THR 14  214 214 THR THR B . n 
B 1 15  PHE 15  215 215 PHE PHE B . n 
B 1 16  LYS 16  216 216 LYS LYS B . n 
B 1 17  ASP 17  217 217 ASP ASP B . n 
B 1 18  LYS 18  218 218 LYS LYS B . n 
B 1 19  SER 19  219 219 SER SER B . n 
B 1 20  LEU 20  220 220 LEU LEU B . n 
B 1 21  LEU 21  221 221 LEU LEU B . n 
B 1 22  GLU 22  222 222 GLU GLU B . n 
B 1 23  LYS 23  223 223 LYS LYS B . n 
B 1 24  ALA 24  224 224 ALA ALA B . n 
B 1 25  LEU 25  225 225 LEU LEU B . n 
B 1 26  THR 26  226 226 THR THR B . n 
B 1 27  HIS 27  227 227 HIS HIS B . n 
B 1 28  VAL 28  228 228 VAL VAL B . n 
B 1 29  SER 29  229 229 SER SER B . n 
B 1 30  TYR 30  230 230 TYR TYR B . n 
B 1 31  SER 31  231 231 SER SER B . n 
B 1 32  LYS 32  232 232 LYS LYS B . n 
B 1 33  LYS 33  233 233 LYS LYS B . n 
B 1 34  GLU 34  234 234 GLU GLU B . n 
B 1 35  HIS 35  235 235 HIS HIS B . n 
B 1 36  TYR 36  236 236 TYR TYR B . n 
B 1 37  GLU 37  237 237 GLU GLU B . n 
B 1 38  THR 38  238 238 THR THR B . n 
B 1 39  LEU 39  239 239 LEU LEU B . n 
B 1 40  GLU 40  240 240 GLU GLU B . n 
B 1 41  PHE 41  241 241 PHE PHE B . n 
B 1 42  LEU 42  242 242 LEU LEU B . n 
B 1 43  GLY 43  243 243 GLY GLY B . n 
B 1 44  ASP 44  244 244 ASP ASP B . n 
B 1 45  ALA 45  245 245 ALA ALA B . n 
B 1 46  LEU 46  246 246 LEU LEU B . n 
B 1 47  VAL 47  247 247 VAL VAL B . n 
B 1 48  ASN 48  248 248 ASN ASN B . n 
B 1 49  PHE 49  249 249 PHE PHE B . n 
B 1 50  PHE 50  250 250 PHE PHE B . n 
B 1 51  ILE 51  251 251 ILE ILE B . n 
B 1 52  VAL 52  252 252 VAL VAL B . n 
B 1 53  ASP 53  253 253 ASP ASP B . n 
B 1 54  LEU 54  254 254 LEU LEU B . n 
B 1 55  LEU 55  255 255 LEU LEU B . n 
B 1 56  VAL 56  256 256 VAL VAL B . n 
B 1 57  GLN 57  257 257 GLN GLN B . n 
B 1 58  TYR 58  258 258 TYR TYR B . n 
B 1 59  SER 59  259 259 SER SER B . n 
B 1 60  PRO 60  260 260 PRO PRO B . n 
B 1 61  ASN 61  261 261 ASN ASN B . n 
B 1 62  LYS 62  262 262 LYS LYS B . n 
B 1 63  ARG 63  263 263 ARG ARG B . n 
B 1 64  GLU 64  264 264 GLU GLU B . n 
B 1 65  GLY 65  265 265 GLY GLY B . n 
B 1 66  PHE 66  266 266 PHE PHE B . n 
B 1 67  LEU 67  267 267 LEU LEU B . n 
B 1 68  SER 68  268 268 SER SER B . n 
B 1 69  PRO 69  269 269 PRO PRO B . n 
B 1 70  LEU 70  270 270 LEU LEU B . n 
B 1 71  LYS 71  271 271 LYS LYS B . n 
B 1 72  ALA 72  272 272 ALA ALA B . n 
B 1 73  TYR 73  273 273 TYR TYR B . n 
B 1 74  LEU 74  274 274 LEU LEU B . n 
B 1 75  ILE 75  275 275 ILE ILE B . n 
B 1 76  SER 76  276 276 SER SER B . n 
B 1 77  GLU 77  277 277 GLU GLU B . n 
B 1 78  GLU 78  278 278 GLU GLU B . n 
B 1 79  PHE 79  279 279 PHE PHE B . n 
B 1 80  PHE 80  280 280 PHE PHE B . n 
B 1 81  ASN 81  281 281 ASN ASN B . n 
B 1 82  LEU 82  282 282 LEU LEU B . n 
B 1 83  LEU 83  283 283 LEU LEU B . n 
B 1 84  ALA 84  284 284 ALA ALA B . n 
B 1 85  GLN 85  285 285 GLN GLN B . n 
B 1 86  LYS 86  286 286 LYS LYS B . n 
B 1 87  LEU 87  287 287 LEU LEU B . n 
B 1 88  GLU 88  288 288 GLU GLU B . n 
B 1 89  LEU 89  289 289 LEU LEU B . n 
B 1 90  HIS 90  290 290 HIS HIS B . n 
B 1 91  LYS 91  291 291 LYS LYS B . n 
B 1 92  PHE 92  292 292 PHE PHE B . n 
B 1 93  ILE 93  293 293 ILE ILE B . n 
B 1 94  ARG 94  294 294 ARG ARG B . n 
B 1 95  ILE 95  295 295 ILE ILE B . n 
B 1 96  LYS 96  296 296 LYS LYS B . n 
B 1 97  ARG 97  297 297 ARG ARG B . n 
B 1 98  GLY 98  298 298 GLY GLY B . n 
B 1 99  LYS 99  299 299 LYS LYS B . n 
B 1 100 ILE 100 300 300 ILE ILE B . n 
B 1 101 ASN 101 301 301 ASN ASN B . n 
B 1 102 GLU 102 302 302 GLU GLU B . n 
B 1 103 THR 103 303 303 THR THR B . n 
B 1 104 ILE 104 304 304 ILE ILE B . n 
B 1 105 ILE 105 305 305 ILE ILE B . n 
B 1 106 GLY 106 306 306 GLY GLY B . n 
B 1 107 ASP 107 307 307 ASP ASP B . n 
B 1 108 VAL 108 308 308 VAL VAL B . n 
B 1 109 PHE 109 309 309 PHE PHE B . n 
B 1 110 GLU 110 310 310 GLU GLU B . n 
B 1 111 ALA 111 311 311 ALA ALA B . n 
B 1 112 LEU 112 312 312 LEU LEU B . n 
B 1 113 TRP 113 313 313 TRP TRP B . n 
B 1 114 ALA 114 314 314 ALA ALA B . n 
B 1 115 ALA 115 315 315 ALA ALA B . n 
B 1 116 VAL 116 316 316 VAL VAL B . n 
B 1 117 TYR 117 317 317 TYR TYR B . n 
B 1 118 ILE 118 318 318 ILE ILE B . n 
B 1 119 ASP 119 319 319 ASP ASP B . n 
B 1 120 SER 120 320 320 SER SER B . n 
B 1 121 GLY 121 321 321 GLY GLY B . n 
B 1 122 ARG 122 322 322 ARG ARG B . n 
B 1 123 ASP 123 323 323 ASP ASP B . n 
B 1 124 ALA 124 324 324 ALA ALA B . n 
B 1 125 ASN 125 325 325 ASN ASN B . n 
B 1 126 PHE 126 326 326 PHE PHE B . n 
B 1 127 THR 127 327 327 THR THR B . n 
B 1 128 ARG 128 328 328 ARG ARG B . n 
B 1 129 GLU 129 329 329 GLU GLU B . n 
B 1 130 LEU 130 330 330 LEU LEU B . n 
B 1 131 PHE 131 331 331 PHE PHE B . n 
B 1 132 TYR 132 332 332 TYR TYR B . n 
B 1 133 LYS 133 333 333 LYS LYS B . n 
B 1 134 LEU 134 334 334 LEU LEU B . n 
B 1 135 PHE 135 335 335 PHE PHE B . n 
B 1 136 LYS 136 336 336 LYS LYS B . n 
B 1 137 GLU 137 337 337 GLU GLU B . n 
B 1 138 ASP 138 338 338 ASP ASP B . n 
B 1 139 ILE 139 339 339 ILE ILE B . n 
B 1 140 LEU 140 340 340 LEU LEU B . n 
B 1 141 SER 141 341 341 SER SER B . n 
B 1 142 ALA 142 342 342 ALA ALA B . n 
B 1 143 ILE 143 343 343 ILE ILE B . n 
B 1 144 LYS 144 344 344 LYS LYS B . n 
B 1 145 GLU 145 345 345 GLU GLU B . n 
B 1 146 GLY 146 346 346 GLY GLY B . n 
B 1 147 ARG 147 347 347 ARG ARG B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2230  ? 
1 MORE         -13   ? 
1 'SSA (A^2)'  14350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-12-19 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHARP     phasing          . ? 1 
SHELXL-97 refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 36  ? ? CG A TYR 36  ? ? CD1 A TYR 36  ? ? 124.68 121.00 3.68  0.60 N 
2 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH1 A ARG 122 ? ? 117.10 120.30 -3.20 0.50 N 
3 1 CB B ASP 244 ? ? CG B ASP 244 ? ? OD1 B ASP 244 ? ? 124.41 118.30 6.11  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 3   ? ? -62.08  -75.14  
2  1 LEU A 4   ? ? 59.82   -8.61   
3  1 LYS A 96  ? ? -100.04 -92.16  
4  1 LYS A 99  ? ? -152.41 63.29   
5  1 ASN A 101 ? ? 53.09   170.39  
6  1 LYS B 202 ? ? -169.87 60.34   
7  1 MET B 203 ? ? -122.36 -98.83  
8  1 LEU B 204 ? ? 50.25   18.79   
9  1 SER B 231 ? ? -178.90 102.06  
10 1 HIS B 235 ? ? -114.57 -168.66 
11 1 LYS B 262 ? ? -76.92  38.83   
12 1 ARG B 294 ? ? -109.50 76.08   
13 1 ARG B 297 ? ? 75.14   31.28   
14 1 LYS B 299 ? ? -105.34 73.50   
15 1 ASN B 301 ? ? 80.87   115.89  
16 1 THR B 303 ? ? -95.02  58.20   
17 1 ILE B 304 ? ? -156.98 -36.38  
18 1 GLU B 345 ? ? -77.12  44.21   
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   401 401 HOH HOH A . 
C 2 HOH 2   402 402 HOH HOH A . 
C 2 HOH 3   403 403 HOH HOH A . 
C 2 HOH 4   404 404 HOH HOH A . 
C 2 HOH 5   405 405 HOH HOH A . 
C 2 HOH 6   406 406 HOH HOH A . 
C 2 HOH 7   407 407 HOH HOH A . 
C 2 HOH 8   408 408 HOH HOH A . 
C 2 HOH 9   410 410 HOH HOH A . 
C 2 HOH 10  412 412 HOH HOH A . 
C 2 HOH 11  413 413 HOH HOH A . 
C 2 HOH 12  414 414 HOH HOH A . 
C 2 HOH 13  416 416 HOH HOH A . 
C 2 HOH 14  419 419 HOH HOH A . 
C 2 HOH 15  420 420 HOH HOH A . 
C 2 HOH 16  421 421 HOH HOH A . 
C 2 HOH 17  424 424 HOH HOH A . 
C 2 HOH 18  425 425 HOH HOH A . 
C 2 HOH 19  426 426 HOH HOH A . 
C 2 HOH 20  428 428 HOH HOH A . 
C 2 HOH 21  429 429 HOH HOH A . 
C 2 HOH 22  430 430 HOH HOH A . 
C 2 HOH 23  431 431 HOH HOH A . 
C 2 HOH 24  432 432 HOH HOH A . 
C 2 HOH 25  433 433 HOH HOH A . 
C 2 HOH 26  434 434 HOH HOH A . 
C 2 HOH 27  435 435 HOH HOH A . 
C 2 HOH 28  436 436 HOH HOH A . 
C 2 HOH 29  437 437 HOH HOH A . 
C 2 HOH 30  438 438 HOH HOH A . 
C 2 HOH 31  439 439 HOH HOH A . 
C 2 HOH 32  440 440 HOH HOH A . 
C 2 HOH 33  442 442 HOH HOH A . 
C 2 HOH 34  443 443 HOH HOH A . 
C 2 HOH 35  444 444 HOH HOH A . 
C 2 HOH 36  445 445 HOH HOH A . 
C 2 HOH 37  446 446 HOH HOH A . 
C 2 HOH 38  448 448 HOH HOH A . 
C 2 HOH 39  449 449 HOH HOH A . 
C 2 HOH 40  450 450 HOH HOH A . 
C 2 HOH 41  451 451 HOH HOH A . 
C 2 HOH 42  454 454 HOH HOH A . 
C 2 HOH 43  455 455 HOH HOH A . 
C 2 HOH 44  456 456 HOH HOH A . 
C 2 HOH 45  457 457 HOH HOH A . 
C 2 HOH 46  460 460 HOH HOH A . 
C 2 HOH 47  461 461 HOH HOH A . 
C 2 HOH 48  462 462 HOH HOH A . 
C 2 HOH 49  465 465 HOH HOH A . 
C 2 HOH 50  467 467 HOH HOH A . 
C 2 HOH 51  468 468 HOH HOH A . 
C 2 HOH 52  470 470 HOH HOH A . 
C 2 HOH 53  471 471 HOH HOH A . 
C 2 HOH 54  472 472 HOH HOH A . 
C 2 HOH 55  474 474 HOH HOH A . 
C 2 HOH 56  475 475 HOH HOH A . 
C 2 HOH 57  476 476 HOH HOH A . 
C 2 HOH 58  478 478 HOH HOH A . 
C 2 HOH 59  479 479 HOH HOH A . 
C 2 HOH 60  481 481 HOH HOH A . 
C 2 HOH 61  482 482 HOH HOH A . 
C 2 HOH 62  483 483 HOH HOH A . 
C 2 HOH 63  484 484 HOH HOH A . 
C 2 HOH 64  485 485 HOH HOH A . 
C 2 HOH 65  487 487 HOH HOH A . 
C 2 HOH 66  488 488 HOH HOH A . 
C 2 HOH 67  490 490 HOH HOH A . 
C 2 HOH 68  491 491 HOH HOH A . 
C 2 HOH 69  493 493 HOH HOH A . 
C 2 HOH 70  494 494 HOH HOH A . 
C 2 HOH 71  495 495 HOH HOH A . 
C 2 HOH 72  496 496 HOH HOH A . 
C 2 HOH 73  497 497 HOH HOH A . 
C 2 HOH 74  498 498 HOH HOH A . 
C 2 HOH 75  499 499 HOH HOH A . 
C 2 HOH 76  500 500 HOH HOH A . 
C 2 HOH 77  501 501 HOH HOH A . 
C 2 HOH 78  502 502 HOH HOH A . 
C 2 HOH 79  503 503 HOH HOH A . 
C 2 HOH 80  505 505 HOH HOH A . 
C 2 HOH 81  506 506 HOH HOH A . 
C 2 HOH 82  507 507 HOH HOH A . 
C 2 HOH 83  508 508 HOH HOH A . 
C 2 HOH 84  509 509 HOH HOH A . 
C 2 HOH 85  513 513 HOH HOH A . 
C 2 HOH 86  514 514 HOH HOH A . 
C 2 HOH 87  515 515 HOH HOH A . 
C 2 HOH 88  516 516 HOH HOH A . 
C 2 HOH 89  517 517 HOH HOH A . 
C 2 HOH 90  520 520 HOH HOH A . 
C 2 HOH 91  521 521 HOH HOH A . 
C 2 HOH 92  525 525 HOH HOH A . 
C 2 HOH 93  526 526 HOH HOH A . 
C 2 HOH 94  527 527 HOH HOH A . 
C 2 HOH 95  528 528 HOH HOH A . 
C 2 HOH 96  529 529 HOH HOH A . 
C 2 HOH 97  530 530 HOH HOH A . 
C 2 HOH 98  531 531 HOH HOH A . 
C 2 HOH 99  533 533 HOH HOH A . 
C 2 HOH 100 540 540 HOH HOH A . 
C 2 HOH 101 541 541 HOH HOH A . 
C 2 HOH 102 542 542 HOH HOH A . 
C 2 HOH 103 543 543 HOH HOH A . 
C 2 HOH 104 544 544 HOH HOH A . 
C 2 HOH 105 545 545 HOH HOH A . 
C 2 HOH 106 546 546 HOH HOH A . 
C 2 HOH 107 547 547 HOH HOH A . 
C 2 HOH 108 549 549 HOH HOH A . 
C 2 HOH 109 550 550 HOH HOH A . 
C 2 HOH 110 552 552 HOH HOH A . 
C 2 HOH 111 553 553 HOH HOH A . 
C 2 HOH 112 555 555 HOH HOH A . 
C 2 HOH 113 556 556 HOH HOH A . 
C 2 HOH 114 557 557 HOH HOH A . 
C 2 HOH 115 558 558 HOH HOH A . 
C 2 HOH 116 559 559 HOH HOH A . 
C 2 HOH 117 562 562 HOH HOH A . 
C 2 HOH 118 563 563 HOH HOH A . 
C 2 HOH 119 565 565 HOH HOH A . 
C 2 HOH 120 568 568 HOH HOH A . 
C 2 HOH 121 572 572 HOH HOH A . 
C 2 HOH 122 573 573 HOH HOH A . 
C 2 HOH 123 575 575 HOH HOH A . 
C 2 HOH 124 576 576 HOH HOH A . 
C 2 HOH 125 578 578 HOH HOH A . 
C 2 HOH 126 579 579 HOH HOH A . 
C 2 HOH 127 580 580 HOH HOH A . 
C 2 HOH 128 581 581 HOH HOH A . 
C 2 HOH 129 582 582 HOH HOH A . 
C 2 HOH 130 583 583 HOH HOH A . 
C 2 HOH 131 584 584 HOH HOH A . 
C 2 HOH 132 585 585 HOH HOH A . 
C 2 HOH 133 586 586 HOH HOH A . 
C 2 HOH 134 587 587 HOH HOH A . 
C 2 HOH 135 588 588 HOH HOH A . 
C 2 HOH 136 589 589 HOH HOH A . 
C 2 HOH 137 590 590 HOH HOH A . 
C 2 HOH 138 591 591 HOH HOH A . 
C 2 HOH 139 592 592 HOH HOH A . 
C 2 HOH 140 593 593 HOH HOH A . 
C 2 HOH 141 594 594 HOH HOH A . 
C 2 HOH 142 595 595 HOH HOH A . 
C 2 HOH 143 596 596 HOH HOH A . 
C 2 HOH 144 599 599 HOH HOH A . 
C 2 HOH 145 605 605 HOH HOH A . 
C 2 HOH 146 606 606 HOH HOH A . 
C 2 HOH 147 607 607 HOH HOH A . 
C 2 HOH 148 608 608 HOH HOH A . 
C 2 HOH 149 609 609 HOH HOH A . 
C 2 HOH 150 610 610 HOH HOH A . 
C 2 HOH 151 612 612 HOH HOH A . 
C 2 HOH 152 616 616 HOH HOH A . 
C 2 HOH 153 619 619 HOH HOH A . 
C 2 HOH 154 620 620 HOH HOH A . 
C 2 HOH 155 621 621 HOH HOH A . 
C 2 HOH 156 623 623 HOH HOH A . 
C 2 HOH 157 624 624 HOH HOH A . 
C 2 HOH 158 628 628 HOH HOH A . 
C 2 HOH 159 629 629 HOH HOH A . 
C 2 HOH 160 630 630 HOH HOH A . 
C 2 HOH 161 632 632 HOH HOH A . 
C 2 HOH 162 633 633 HOH HOH A . 
C 2 HOH 163 634 634 HOH HOH A . 
C 2 HOH 164 635 635 HOH HOH A . 
C 2 HOH 165 637 637 HOH HOH A . 
C 2 HOH 166 639 639 HOH HOH A . 
C 2 HOH 167 641 641 HOH HOH A . 
C 2 HOH 168 644 644 HOH HOH A . 
C 2 HOH 169 645 645 HOH HOH A . 
C 2 HOH 170 649 649 HOH HOH A . 
C 2 HOH 171 650 650 HOH HOH A . 
C 2 HOH 172 651 651 HOH HOH A . 
C 2 HOH 173 652 652 HOH HOH A . 
D 2 HOH 1   409 409 HOH HOH B . 
D 2 HOH 2   411 411 HOH HOH B . 
D 2 HOH 3   415 415 HOH HOH B . 
D 2 HOH 4   417 417 HOH HOH B . 
D 2 HOH 5   418 418 HOH HOH B . 
D 2 HOH 6   422 422 HOH HOH B . 
D 2 HOH 7   423 423 HOH HOH B . 
D 2 HOH 8   427 427 HOH HOH B . 
D 2 HOH 9   441 441 HOH HOH B . 
D 2 HOH 10  447 447 HOH HOH B . 
D 2 HOH 11  452 452 HOH HOH B . 
D 2 HOH 12  453 453 HOH HOH B . 
D 2 HOH 13  458 458 HOH HOH B . 
D 2 HOH 14  459 459 HOH HOH B . 
D 2 HOH 15  463 463 HOH HOH B . 
D 2 HOH 16  464 464 HOH HOH B . 
D 2 HOH 17  466 466 HOH HOH B . 
D 2 HOH 18  469 469 HOH HOH B . 
D 2 HOH 19  473 473 HOH HOH B . 
D 2 HOH 20  477 477 HOH HOH B . 
D 2 HOH 21  480 480 HOH HOH B . 
D 2 HOH 22  486 486 HOH HOH B . 
D 2 HOH 23  489 489 HOH HOH B . 
D 2 HOH 24  492 492 HOH HOH B . 
D 2 HOH 25  504 504 HOH HOH B . 
D 2 HOH 26  510 510 HOH HOH B . 
D 2 HOH 27  511 511 HOH HOH B . 
D 2 HOH 28  512 512 HOH HOH B . 
D 2 HOH 29  518 518 HOH HOH B . 
D 2 HOH 30  519 519 HOH HOH B . 
D 2 HOH 31  522 522 HOH HOH B . 
D 2 HOH 32  523 523 HOH HOH B . 
D 2 HOH 33  524 524 HOH HOH B . 
D 2 HOH 34  532 532 HOH HOH B . 
D 2 HOH 35  534 534 HOH HOH B . 
D 2 HOH 36  535 535 HOH HOH B . 
D 2 HOH 37  536 536 HOH HOH B . 
D 2 HOH 38  537 537 HOH HOH B . 
D 2 HOH 39  538 538 HOH HOH B . 
D 2 HOH 40  539 539 HOH HOH B . 
D 2 HOH 41  548 548 HOH HOH B . 
D 2 HOH 42  551 551 HOH HOH B . 
D 2 HOH 43  554 554 HOH HOH B . 
D 2 HOH 44  560 560 HOH HOH B . 
D 2 HOH 45  561 561 HOH HOH B . 
D 2 HOH 46  564 564 HOH HOH B . 
D 2 HOH 47  566 566 HOH HOH B . 
D 2 HOH 48  567 567 HOH HOH B . 
D 2 HOH 49  569 569 HOH HOH B . 
D 2 HOH 50  570 570 HOH HOH B . 
D 2 HOH 51  571 571 HOH HOH B . 
D 2 HOH 52  574 574 HOH HOH B . 
D 2 HOH 53  577 577 HOH HOH B . 
D 2 HOH 54  597 597 HOH HOH B . 
D 2 HOH 55  598 598 HOH HOH B . 
D 2 HOH 56  600 600 HOH HOH B . 
D 2 HOH 57  601 601 HOH HOH B . 
D 2 HOH 58  602 602 HOH HOH B . 
D 2 HOH 59  603 603 HOH HOH B . 
D 2 HOH 60  604 604 HOH HOH B . 
D 2 HOH 61  611 611 HOH HOH B . 
D 2 HOH 62  613 613 HOH HOH B . 
D 2 HOH 63  614 614 HOH HOH B . 
D 2 HOH 64  615 615 HOH HOH B . 
D 2 HOH 65  617 617 HOH HOH B . 
D 2 HOH 66  618 618 HOH HOH B . 
D 2 HOH 67  622 622 HOH HOH B . 
D 2 HOH 68  625 625 HOH HOH B . 
D 2 HOH 69  626 626 HOH HOH B . 
D 2 HOH 70  627 627 HOH HOH B . 
D 2 HOH 71  631 631 HOH HOH B . 
D 2 HOH 72  636 636 HOH HOH B . 
D 2 HOH 73  638 638 HOH HOH B . 
D 2 HOH 74  640 640 HOH HOH B . 
D 2 HOH 75  642 642 HOH HOH B . 
D 2 HOH 76  643 643 HOH HOH B . 
D 2 HOH 77  646 646 HOH HOH B . 
D 2 HOH 78  647 647 HOH HOH B . 
D 2 HOH 79  648 648 HOH HOH B . 
#