data_1I5Z
# 
_entry.id   1I5Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I5Z         
RCSB  RCSB012946   
WWPDB D_1000012946 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G6N . unspecified 
PDB 3GAP . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I5Z 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'White, M.A.' 1 
'Lee, J.C.'   2 
'Fox, R.O.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The effect of the D53H point mutation on the macroscopic  
motions of E. coli Cyclic AMP Receptor Protein
;
'To be Published' ?   ?   ?   ?    ?      ?  ?         0353 ? ? ? 
1       'Structure of a Complex of Catabolite Gene Activator Protein and Cyclic AMP at 2.5 A Resolution'            J.Mol.Biol. 
198 311 326 1987 JMOBAK UK 0022-2836 0070 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'White, M.A.'  1 
primary 'Liu, D.'      2 
primary 'Lin, S.-H.'   3 
primary 'Fox, R.O.'    4 
primary 'Lee, J.C.'    5 
1       'Weber, I.T.'  6 
1       'Steitz, T.A.' 7 
# 
_cell.entry_id           1I5Z 
_cell.length_a           46.028 
_cell.length_b           93.024 
_cell.length_c           105.503 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I5Z 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATABOLITE GENE ACTIVATOR PROTEIN'      23541.242 2   ? ? ? ? 
2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143   2   ? ? ? ? 
3 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"   329.206   3   ? ? ? ? 
4 water       nat water                                    18.015    252 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CAMP RECEPTOR PROTEIN, CRP, CAP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   LEU n 
1 3   GLY n 
1 4   LYS n 
1 5   PRO n 
1 6   GLN n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  THR n 
1 11  LEU n 
1 12  GLU n 
1 13  TRP n 
1 14  PHE n 
1 15  LEU n 
1 16  SER n 
1 17  HIS n 
1 18  CYS n 
1 19  HIS n 
1 20  ILE n 
1 21  HIS n 
1 22  LYS n 
1 23  TYR n 
1 24  PRO n 
1 25  SER n 
1 26  LYS n 
1 27  SER n 
1 28  THR n 
1 29  LEU n 
1 30  ILE n 
1 31  HIS n 
1 32  GLN n 
1 33  GLY n 
1 34  GLU n 
1 35  LYS n 
1 36  ALA n 
1 37  GLU n 
1 38  THR n 
1 39  LEU n 
1 40  TYR n 
1 41  TYR n 
1 42  ILE n 
1 43  VAL n 
1 44  LYS n 
1 45  GLY n 
1 46  SER n 
1 47  VAL n 
1 48  ALA n 
1 49  VAL n 
1 50  LEU n 
1 51  ILE n 
1 52  LYS n 
1 53  ASP n 
1 54  GLU n 
1 55  GLU n 
1 56  GLY n 
1 57  LYS n 
1 58  GLU n 
1 59  MET n 
1 60  ILE n 
1 61  LEU n 
1 62  SER n 
1 63  TYR n 
1 64  LEU n 
1 65  ASN n 
1 66  GLN n 
1 67  GLY n 
1 68  ASP n 
1 69  PHE n 
1 70  ILE n 
1 71  GLY n 
1 72  GLU n 
1 73  LEU n 
1 74  GLY n 
1 75  LEU n 
1 76  PHE n 
1 77  GLU n 
1 78  GLU n 
1 79  GLY n 
1 80  GLN n 
1 81  GLU n 
1 82  ARG n 
1 83  SER n 
1 84  ALA n 
1 85  TRP n 
1 86  VAL n 
1 87  ARG n 
1 88  ALA n 
1 89  LYS n 
1 90  THR n 
1 91  ALA n 
1 92  CYS n 
1 93  GLU n 
1 94  VAL n 
1 95  ALA n 
1 96  GLU n 
1 97  ILE n 
1 98  SER n 
1 99  TYR n 
1 100 LYS n 
1 101 LYS n 
1 102 PHE n 
1 103 ARG n 
1 104 GLN n 
1 105 LEU n 
1 106 ILE n 
1 107 GLN n 
1 108 VAL n 
1 109 ASN n 
1 110 PRO n 
1 111 ASP n 
1 112 ILE n 
1 113 LEU n 
1 114 MET n 
1 115 ARG n 
1 116 LEU n 
1 117 SER n 
1 118 ALA n 
1 119 GLN n 
1 120 MET n 
1 121 ALA n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 GLN n 
1 126 VAL n 
1 127 THR n 
1 128 SER n 
1 129 GLU n 
1 130 LYS n 
1 131 VAL n 
1 132 GLY n 
1 133 ASN n 
1 134 LEU n 
1 135 ALA n 
1 136 PHE n 
1 137 LEU n 
1 138 ASP n 
1 139 VAL n 
1 140 THR n 
1 141 GLY n 
1 142 ARG n 
1 143 ILE n 
1 144 ALA n 
1 145 GLN n 
1 146 THR n 
1 147 LEU n 
1 148 LEU n 
1 149 ASN n 
1 150 LEU n 
1 151 ALA n 
1 152 LYS n 
1 153 GLN n 
1 154 PRO n 
1 155 ASP n 
1 156 ALA n 
1 157 MET n 
1 158 THR n 
1 159 HIS n 
1 160 PRO n 
1 161 ASP n 
1 162 GLY n 
1 163 MET n 
1 164 GLN n 
1 165 ILE n 
1 166 LYS n 
1 167 ILE n 
1 168 THR n 
1 169 ARG n 
1 170 GLN n 
1 171 GLU n 
1 172 ILE n 
1 173 GLY n 
1 174 GLN n 
1 175 ILE n 
1 176 VAL n 
1 177 GLY n 
1 178 CYS n 
1 179 SER n 
1 180 ARG n 
1 181 GLU n 
1 182 THR n 
1 183 VAL n 
1 184 GLY n 
1 185 ARG n 
1 186 ILE n 
1 187 LEU n 
1 188 LYS n 
1 189 MET n 
1 190 LEU n 
1 191 GLU n 
1 192 ASP n 
1 193 GLN n 
1 194 ASN n 
1 195 LEU n 
1 196 ILE n 
1 197 SER n 
1 198 ALA n 
1 199 HIS n 
1 200 GLY n 
1 201 LYS n 
1 202 THR n 
1 203 ILE n 
1 204 VAL n 
1 205 VAL n 
1 206 TYR n 
1 207 GLY n 
1 208 THR n 
1 209 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CRP_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_accession          P0ACJ8 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I5Z A 1 ? 209 ? P0ACJ8 2 ? 210 ? 1 209 
2 1 1I5Z B 1 ? 209 ? P0ACJ8 2 ? 210 ? 1 209 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"   'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                                 ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                  'C11 H12 N2 O2'   204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER'      'C4 H12 N O3 1'   122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1I5Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.71 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIQUID DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    
'100mM KCl, 1mM EDTA, 50mM TRIS, 35% Glycerol, cAMP, pH 7.8, LIQUID DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1998-06-25 
_diffrn_detector.details                MULTILAYER 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'MULTILAYER OPTICS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1I5Z 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.9000 
_reflns.number_obs                   38852 
_reflns.number_all                   38852 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              0.05 
_reflns.pdbx_netI_over_sigmaI        11.500 
_reflns.B_iso_Wilson_estimate        28.4 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.89 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.27 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1924 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I5Z 
_refine.ls_number_reflns_obs                     36001 
_refine.ls_number_reflns_all                     36001 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               1679462.51 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             46.51 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1796 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               38.5 
_refine.aniso_B[1][1]                            -0.52 
_refine.aniso_B[2][2]                            0.38 
_refine.aniso_B[3][3]                            0.15 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.347 
_refine.solvent_model_param_bsol                 49.24 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      '3GAP CRP DIMER' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            SHELLS 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I5Z 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.10 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.12 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3223 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               3557 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        46.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.73  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.42  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.25  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.93 
_refine_ls_shell.number_reflns_R_work             1622 
_refine_ls_shell.R_factor_R_work                  0.293 
_refine_ls_shell.percent_reflns_obs               95.3 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.R_factor_R_free_error            0.037 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             79 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 LIGAND.PARAM      LIGAND.TOP  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1I5Z 
_struct.title                     'STRUCTURE OF CRP-CAMP AT 1.9 A' 
_struct.pdbx_descriptor           'CATABOLITE GENE ACTIVATOR PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I5Z 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;CAMP receptor Protein (CRP), Allostery, DNA binding Cyclic AMP, Transcription Regulation, CATABOLITE ACTIVATOR PROTEIN (CAP), DNA BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The Dimer is the biological unit' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? SER A 16  ? ASP A 8   SER A 16  1 ? 9  
HELX_P HELX_P2  2  TYR A 99  ? ASN A 109 ? TYR A 99  ASN A 109 1 ? 11 
HELX_P HELX_P3  3  PRO A 110 ? LEU A 137 ? PRO A 110 LEU A 137 1 ? 28 
HELX_P HELX_P4  4  ASP A 138 ? LEU A 150 ? ASP A 138 LEU A 150 1 ? 13 
HELX_P HELX_P5  5  ALA A 151 ? GLN A 153 ? ALA A 151 GLN A 153 5 ? 3  
HELX_P HELX_P6  6  THR A 168 ? GLY A 177 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P7  7  SER A 179 ? GLN A 193 ? SER A 179 GLN A 193 1 ? 15 
HELX_P HELX_P8  8  ASP B 8   ? HIS B 17  ? ASP B 8   HIS B 17  1 ? 10 
HELX_P HELX_P9  9  TYR B 99  ? ASN B 109 ? TYR B 99  ASN B 109 1 ? 11 
HELX_P HELX_P10 10 PRO B 110 ? LEU B 137 ? PRO B 110 LEU B 137 1 ? 28 
HELX_P HELX_P11 11 ASP B 138 ? ALA B 151 ? ASP B 138 ALA B 151 1 ? 14 
HELX_P HELX_P12 12 THR B 168 ? GLY B 177 ? THR B 168 GLY B 177 1 ? 10 
HELX_P HELX_P13 13 SER B 179 ? GLN B 193 ? SER B 179 GLN B 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 19  ? TYR A 23  ? HIS A 19  TYR A 23  
A 2 CYS A 92  ? SER A 98  ? CYS A 92  SER A 98  
A 3 THR A 38  ? LYS A 44  ? THR A 38  LYS A 44  
A 4 PHE A 69  ? ILE A 70  ? PHE A 69  ILE A 70  
B 1 THR A 28  ? ILE A 30  ? THR A 28  ILE A 30  
B 2 TRP A 85  ? ALA A 88  ? TRP A 85  ALA A 88  
B 3 VAL A 47  ? LYS A 52  ? VAL A 47  LYS A 52  
B 4 GLU A 58  ? LEU A 64  ? GLU A 58  LEU A 64  
C 1 GLN A 164 ? LYS A 166 ? GLN A 164 LYS A 166 
C 2 THR A 202 ? VAL A 205 ? THR A 202 VAL A 205 
C 3 ILE A 196 ? HIS A 199 ? ILE A 196 HIS A 199 
D 1 HIS B 19  ? TYR B 23  ? HIS B 19  TYR B 23  
D 2 CYS B 92  ? SER B 98  ? CYS B 92  SER B 98  
D 3 THR B 38  ? LYS B 44  ? THR B 38  LYS B 44  
D 4 PHE B 69  ? ILE B 70  ? PHE B 69  ILE B 70  
E 1 THR B 28  ? ILE B 30  ? THR B 28  ILE B 30  
E 2 TRP B 85  ? ALA B 88  ? TRP B 85  ALA B 88  
E 3 SER B 46  ? LYS B 52  ? SER B 46  LYS B 52  
E 4 GLU B 58  ? ASN B 65  ? GLU B 58  ASN B 65  
F 1 MET B 157 ? HIS B 159 ? MET B 157 HIS B 159 
F 2 GLY B 162 ? LYS B 166 ? GLY B 162 LYS B 166 
F 3 THR B 202 ? TYR B 206 ? THR B 202 TYR B 206 
F 4 ILE B 196 ? HIS B 199 ? ILE B 196 HIS B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 23  ? O TYR A 23  N CYS A 92  ? N CYS A 92  
A 2 3 O ILE A 97  ? O ILE A 97  N LEU A 39  ? N LEU A 39  
A 3 4 N TYR A 40  ? N TYR A 40  O ILE A 70  ? O ILE A 70  
B 1 2 N LEU A 29  ? N LEU A 29  O VAL A 86  ? O VAL A 86  
B 2 3 O ARG A 87  ? O ARG A 87  N ALA A 48  ? N ALA A 48  
B 3 4 O ILE A 51  ? O ILE A 51  N MET A 59  ? N MET A 59  
C 1 2 O ILE A 165 ? O ILE A 165 N ILE A 203 ? N ILE A 203 
C 2 3 N VAL A 204 ? N VAL A 204 O SER A 197 ? O SER A 197 
D 1 2 O TYR B 23  ? O TYR B 23  N CYS B 92  ? N CYS B 92  
D 2 3 O ILE B 97  ? O ILE B 97  N LEU B 39  ? N LEU B 39  
D 3 4 N TYR B 40  ? N TYR B 40  O ILE B 70  ? O ILE B 70  
E 1 2 N LEU B 29  ? N LEU B 29  O VAL B 86  ? O VAL B 86  
E 2 3 O ARG B 87  ? O ARG B 87  N ALA B 48  ? N ALA B 48  
E 3 4 N ILE B 51  ? N ILE B 51  O MET B 59  ? O MET B 59  
F 1 2 N HIS B 159 ? N HIS B 159 O GLY B 162 ? O GLY B 162 
F 2 3 O ILE B 165 ? O ILE B 165 N ILE B 203 ? N ILE B 203 
F 3 4 N VAL B 204 ? N VAL B 204 O SER B 197 ? O SER B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE TRS A 351' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE TRS A 352' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CMP A 301' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CMP A 302' 
AC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CMP B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  TRP A 13  ? TRP A 13  . ? 1_555 ? 
2  AC1 3  ASN A 109 ? ASN A 109 . ? 1_555 ? 
3  AC1 3  ASP B 138 ? ASP B 138 . ? 2_665 ? 
4  AC2 6  LYS A 130 ? LYS A 130 . ? 1_555 ? 
5  AC2 6  ASN A 133 ? ASN A 133 . ? 1_555 ? 
6  AC2 6  LEU A 134 ? LEU A 134 . ? 1_555 ? 
7  AC2 6  ARG A 142 ? ARG A 142 . ? 1_555 ? 
8  AC2 6  THR A 146 ? THR A 146 . ? 1_555 ? 
9  AC2 6  ILE A 175 ? ILE A 175 . ? 1_555 ? 
10 AC3 14 VAL A 49  ? VAL A 49  . ? 1_555 ? 
11 AC3 14 LEU A 61  ? LEU A 61  . ? 1_555 ? 
12 AC3 14 ILE A 70  ? ILE A 70  . ? 1_555 ? 
13 AC3 14 GLY A 71  ? GLY A 71  . ? 1_555 ? 
14 AC3 14 GLU A 72  ? GLU A 72  . ? 1_555 ? 
15 AC3 14 LEU A 73  ? LEU A 73  . ? 1_555 ? 
16 AC3 14 ARG A 82  ? ARG A 82  . ? 1_555 ? 
17 AC3 14 SER A 83  ? SER A 83  . ? 1_555 ? 
18 AC3 14 ARG A 123 ? ARG A 123 . ? 1_555 ? 
19 AC3 14 THR A 127 ? THR A 127 . ? 1_555 ? 
20 AC3 14 HOH H .   ? HOH A 553 . ? 1_555 ? 
21 AC3 14 HOH H .   ? HOH A 627 . ? 1_555 ? 
22 AC3 14 LEU B 124 ? LEU B 124 . ? 1_555 ? 
23 AC3 14 SER B 128 ? SER B 128 . ? 1_555 ? 
24 AC4 13 LYS A 57  ? LYS A 57  . ? 1_555 ? 
25 AC4 13 GLU A 58  ? GLU A 58  . ? 1_555 ? 
26 AC4 13 GLN A 170 ? GLN A 170 . ? 1_555 ? 
27 AC4 13 GLY A 173 ? GLY A 173 . ? 1_555 ? 
28 AC4 13 GLN A 174 ? GLN A 174 . ? 1_555 ? 
29 AC4 13 GLY A 177 ? GLY A 177 . ? 1_555 ? 
30 AC4 13 CYS A 178 ? CYS A 178 . ? 1_555 ? 
31 AC4 13 SER A 179 ? SER A 179 . ? 1_555 ? 
32 AC4 13 ARG A 180 ? ARG A 180 . ? 1_555 ? 
33 AC4 13 HOH H .   ? HOH A 526 . ? 1_555 ? 
34 AC4 13 HOH H .   ? HOH A 667 . ? 1_555 ? 
35 AC4 13 ALA B 135 ? ALA B 135 . ? 1_555 ? 
36 AC4 13 PHE B 136 ? PHE B 136 . ? 1_555 ? 
37 AC5 15 LEU A 124 ? LEU A 124 . ? 1_555 ? 
38 AC5 15 SER A 128 ? SER A 128 . ? 1_555 ? 
39 AC5 15 HOH H .   ? HOH A 554 . ? 1_555 ? 
40 AC5 15 VAL B 49  ? VAL B 49  . ? 1_555 ? 
41 AC5 15 LEU B 61  ? LEU B 61  . ? 1_555 ? 
42 AC5 15 ILE B 70  ? ILE B 70  . ? 1_555 ? 
43 AC5 15 GLY B 71  ? GLY B 71  . ? 1_555 ? 
44 AC5 15 GLU B 72  ? GLU B 72  . ? 1_555 ? 
45 AC5 15 LEU B 73  ? LEU B 73  . ? 1_555 ? 
46 AC5 15 ARG B 82  ? ARG B 82  . ? 1_555 ? 
47 AC5 15 SER B 83  ? SER B 83  . ? 1_555 ? 
48 AC5 15 ALA B 84  ? ALA B 84  . ? 1_555 ? 
49 AC5 15 THR B 127 ? THR B 127 . ? 1_555 ? 
50 AC5 15 HOH I .   ? HOH B 542 . ? 1_555 ? 
51 AC5 15 HOH I .   ? HOH B 546 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I5Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I5Z 
_atom_sites.fract_transf_matrix[1][1]   0.021726 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010750 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009478 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLN A 1 6   ? 29.363 62.098 59.554 1.00 56.94  ? 6   GLN A N     1 
ATOM   2    C CA    . GLN A 1 6   ? 30.589 62.264 60.385 1.00 56.95  ? 6   GLN A CA    1 
ATOM   3    C C     . GLN A 1 6   ? 30.843 61.016 61.230 1.00 55.35  ? 6   GLN A C     1 
ATOM   4    O O     . GLN A 1 6   ? 31.554 60.101 60.810 1.00 55.94  ? 6   GLN A O     1 
ATOM   5    C CB    . GLN A 1 6   ? 30.442 63.486 61.298 1.00 58.98  ? 6   GLN A CB    1 
ATOM   6    C CG    . GLN A 1 6   ? 30.263 64.804 60.556 1.00 61.75  ? 6   GLN A CG    1 
ATOM   7    C CD    . GLN A 1 6   ? 31.470 65.183 59.713 1.00 63.34  ? 6   GLN A CD    1 
ATOM   8    O OE1   . GLN A 1 6   ? 31.447 66.184 58.995 1.00 64.62  ? 6   GLN A OE1   1 
ATOM   9    N NE2   . GLN A 1 6   ? 32.532 64.387 59.799 1.00 63.82  ? 6   GLN A NE2   1 
ATOM   10   N N     . THR A 1 7   ? 30.260 60.987 62.424 1.00 52.63  ? 7   THR A N     1 
ATOM   11   C CA    . THR A 1 7   ? 30.419 59.850 63.318 1.00 48.79  ? 7   THR A CA    1 
ATOM   12   C C     . THR A 1 7   ? 29.359 59.895 64.411 1.00 46.66  ? 7   THR A C     1 
ATOM   13   O O     . THR A 1 7   ? 28.611 60.867 64.524 1.00 46.57  ? 7   THR A O     1 
ATOM   14   C CB    . THR A 1 7   ? 31.820 59.847 63.967 1.00 48.56  ? 7   THR A CB    1 
ATOM   15   O OG1   . THR A 1 7   ? 32.034 58.599 64.638 1.00 46.49  ? 7   THR A OG1   1 
ATOM   16   C CG2   . THR A 1 7   ? 31.947 60.990 64.971 1.00 48.56  ? 7   THR A CG2   1 
ATOM   17   N N     . ASP A 1 8   ? 29.296 58.836 65.212 1.00 43.68  ? 8   ASP A N     1 
ATOM   18   C CA    . ASP A 1 8   ? 28.329 58.749 66.299 1.00 41.20  ? 8   ASP A CA    1 
ATOM   19   C C     . ASP A 1 8   ? 28.882 57.886 67.431 1.00 39.49  ? 8   ASP A C     1 
ATOM   20   O O     . ASP A 1 8   ? 29.969 57.322 67.313 1.00 38.91  ? 8   ASP A O     1 
ATOM   21   C CB    . ASP A 1 8   ? 27.004 58.169 65.785 1.00 40.54  ? 8   ASP A CB    1 
ATOM   22   C CG    . ASP A 1 8   ? 27.185 56.853 65.055 1.00 39.10  ? 8   ASP A CG    1 
ATOM   23   O OD1   . ASP A 1 8   ? 27.738 55.908 65.655 1.00 36.32  ? 8   ASP A OD1   1 
ATOM   24   O OD2   . ASP A 1 8   ? 26.768 56.764 63.881 1.00 39.23  ? 8   ASP A OD2   1 
ATOM   25   N N     . PRO A 1 9   ? 28.145 57.783 68.548 1.00 38.28  ? 9   PRO A N     1 
ATOM   26   C CA    . PRO A 1 9   ? 28.606 56.975 69.682 1.00 38.01  ? 9   PRO A CA    1 
ATOM   27   C C     . PRO A 1 9   ? 28.826 55.496 69.367 1.00 37.08  ? 9   PRO A C     1 
ATOM   28   O O     . PRO A 1 9   ? 29.716 54.861 69.940 1.00 36.03  ? 9   PRO A O     1 
ATOM   29   C CB    . PRO A 1 9   ? 27.511 57.191 70.724 1.00 37.89  ? 9   PRO A CB    1 
ATOM   30   C CG    . PRO A 1 9   ? 27.068 58.603 70.439 1.00 39.41  ? 9   PRO A CG    1 
ATOM   31   C CD    . PRO A 1 9   ? 26.973 58.596 68.930 1.00 37.56  ? 9   PRO A CD    1 
ATOM   32   N N     . THR A 1 10  ? 28.011 54.942 68.473 1.00 35.02  ? 10  THR A N     1 
ATOM   33   C CA    . THR A 1 10  ? 28.157 53.534 68.114 1.00 34.34  ? 10  THR A CA    1 
ATOM   34   C C     . THR A 1 10  ? 29.470 53.307 67.378 1.00 33.03  ? 10  THR A C     1 
ATOM   35   O O     . THR A 1 10  ? 30.211 52.370 67.684 1.00 32.53  ? 10  THR A O     1 
ATOM   36   C CB    . THR A 1 10  ? 26.993 53.040 67.229 1.00 34.61  ? 10  THR A CB    1 
ATOM   37   O OG1   . THR A 1 10  ? 25.774 53.085 67.977 1.00 35.50  ? 10  THR A OG1   1 
ATOM   38   C CG2   . THR A 1 10  ? 27.236 51.599 66.784 1.00 33.80  ? 10  THR A CG2   1 
ATOM   39   N N     . LEU A 1 11  ? 29.758 54.163 66.404 1.00 33.00  ? 11  LEU A N     1 
ATOM   40   C CA    . LEU A 1 11  ? 30.998 54.051 65.651 1.00 34.53  ? 11  LEU A CA    1 
ATOM   41   C C     . LEU A 1 11  ? 32.204 54.323 66.550 1.00 34.39  ? 11  LEU A C     1 
ATOM   42   O O     . LEU A 1 11  ? 33.243 53.673 66.412 1.00 34.20  ? 11  LEU A O     1 
ATOM   43   C CB    . LEU A 1 11  ? 30.998 55.026 64.468 1.00 36.73  ? 11  LEU A CB    1 
ATOM   44   C CG    . LEU A 1 11  ? 30.013 54.719 63.331 1.00 41.23  ? 11  LEU A CG    1 
ATOM   45   C CD1   . LEU A 1 11  ? 30.018 55.859 62.321 1.00 41.40  ? 11  LEU A CD1   1 
ATOM   46   C CD2   . LEU A 1 11  ? 30.398 53.408 62.654 1.00 41.89  ? 11  LEU A CD2   1 
ATOM   47   N N     . GLU A 1 12  ? 32.076 55.281 67.467 1.00 32.79  ? 12  GLU A N     1 
ATOM   48   C CA    . GLU A 1 12  ? 33.189 55.592 68.362 1.00 32.42  ? 12  GLU A CA    1 
ATOM   49   C C     . GLU A 1 12  ? 33.427 54.468 69.369 1.00 31.38  ? 12  GLU A C     1 
ATOM   50   O O     . GLU A 1 12  ? 34.564 54.208 69.762 1.00 32.49  ? 12  GLU A O     1 
ATOM   51   C CB    . GLU A 1 12  ? 32.951 56.925 69.078 1.00 33.76  ? 12  GLU A CB    1 
ATOM   52   C CG    . GLU A 1 12  ? 33.001 58.113 68.125 1.00 34.03  ? 12  GLU A CG    1 
ATOM   53   C CD    . GLU A 1 12  ? 34.292 58.157 67.322 1.00 35.64  ? 12  GLU A CD    1 
ATOM   54   O OE1   . GLU A 1 12  ? 34.250 58.610 66.159 1.00 38.14  ? 12  GLU A OE1   1 
ATOM   55   O OE2   . GLU A 1 12  ? 35.353 57.748 67.848 1.00 35.87  ? 12  GLU A OE2   1 
ATOM   56   N N     . TRP A 1 13  ? 32.353 53.806 69.783 1.00 30.49  ? 13  TRP A N     1 
ATOM   57   C CA    . TRP A 1 13  ? 32.469 52.683 70.704 1.00 30.27  ? 13  TRP A CA    1 
ATOM   58   C C     . TRP A 1 13  ? 33.320 51.635 69.987 1.00 30.43  ? 13  TRP A C     1 
ATOM   59   O O     . TRP A 1 13  ? 34.273 51.088 70.545 1.00 29.33  ? 13  TRP A O     1 
ATOM   60   C CB    . TRP A 1 13  ? 31.076 52.122 71.013 1.00 31.19  ? 13  TRP A CB    1 
ATOM   61   C CG    . TRP A 1 13  ? 31.067 50.718 71.542 1.00 33.23  ? 13  TRP A CG    1 
ATOM   62   C CD1   . TRP A 1 13  ? 31.491 50.295 72.771 1.00 34.99  ? 13  TRP A CD1   1 
ATOM   63   C CD2   . TRP A 1 13  ? 30.594 49.552 70.857 1.00 34.31  ? 13  TRP A CD2   1 
ATOM   64   N NE1   . TRP A 1 13  ? 31.308 48.935 72.894 1.00 35.84  ? 13  TRP A NE1   1 
ATOM   65   C CE2   . TRP A 1 13  ? 30.759 48.455 71.733 1.00 35.97  ? 13  TRP A CE2   1 
ATOM   66   C CE3   . TRP A 1 13  ? 30.045 49.327 69.586 1.00 35.95  ? 13  TRP A CE3   1 
ATOM   67   C CZ2   . TRP A 1 13  ? 30.393 47.150 71.379 1.00 37.07  ? 13  TRP A CZ2   1 
ATOM   68   C CZ3   . TRP A 1 13  ? 29.680 48.027 69.233 1.00 36.67  ? 13  TRP A CZ3   1 
ATOM   69   C CH2   . TRP A 1 13  ? 29.857 46.958 70.128 1.00 37.01  ? 13  TRP A CH2   1 
ATOM   70   N N     . PHE A 1 14  ? 32.974 51.375 68.732 1.00 29.92  ? 14  PHE A N     1 
ATOM   71   C CA    . PHE A 1 14  ? 33.701 50.406 67.919 1.00 29.60  ? 14  PHE A CA    1 
ATOM   72   C C     . PHE A 1 14  ? 35.178 50.790 67.767 1.00 27.71  ? 14  PHE A C     1 
ATOM   73   O O     . PHE A 1 14  ? 36.070 49.981 68.029 1.00 28.50  ? 14  PHE A O     1 
ATOM   74   C CB    . PHE A 1 14  ? 33.022 50.286 66.544 1.00 27.44  ? 14  PHE A CB    1 
ATOM   75   C CG    . PHE A 1 14  ? 33.940 49.824 65.442 1.00 27.12  ? 14  PHE A CG    1 
ATOM   76   C CD1   . PHE A 1 14  ? 34.255 50.675 64.385 1.00 26.19  ? 14  PHE A CD1   1 
ATOM   77   C CD2   . PHE A 1 14  ? 34.491 48.549 65.460 1.00 26.33  ? 14  PHE A CD2   1 
ATOM   78   C CE1   . PHE A 1 14  ? 35.106 50.265 63.366 1.00 26.01  ? 14  PHE A CE1   1 
ATOM   79   C CE2   . PHE A 1 14  ? 35.351 48.124 64.437 1.00 27.40  ? 14  PHE A CE2   1 
ATOM   80   C CZ    . PHE A 1 14  ? 35.656 48.983 63.392 1.00 25.48  ? 14  PHE A CZ    1 
ATOM   81   N N     . LEU A 1 15  ? 35.429 52.025 67.351 1.00 28.20  ? 15  LEU A N     1 
ATOM   82   C CA    . LEU A 1 15  ? 36.791 52.516 67.158 1.00 29.84  ? 15  LEU A CA    1 
ATOM   83   C C     . LEU A 1 15  ? 37.665 52.491 68.410 1.00 29.67  ? 15  LEU A C     1 
ATOM   84   O O     . LEU A 1 15  ? 38.888 52.353 68.299 1.00 31.55  ? 15  LEU A O     1 
ATOM   85   C CB    . LEU A 1 15  ? 36.762 53.936 66.579 1.00 29.46  ? 15  LEU A CB    1 
ATOM   86   C CG    . LEU A 1 15  ? 36.174 54.018 65.165 1.00 31.36  ? 15  LEU A CG    1 
ATOM   87   C CD1   . LEU A 1 15  ? 36.078 55.465 64.703 1.00 31.48  ? 15  LEU A CD1   1 
ATOM   88   C CD2   . LEU A 1 15  ? 37.051 53.211 64.222 1.00 32.19  ? 15  LEU A CD2   1 
ATOM   89   N N     . SER A 1 16  ? 37.057 52.614 69.590 1.00 28.94  ? 16  SER A N     1 
ATOM   90   C CA    . SER A 1 16  ? 37.829 52.601 70.838 1.00 28.38  ? 16  SER A CA    1 
ATOM   91   C C     . SER A 1 16  ? 38.414 51.215 71.107 1.00 29.19  ? 16  SER A C     1 
ATOM   92   O O     . SER A 1 16  ? 39.253 51.041 71.996 1.00 27.96  ? 16  SER A O     1 
ATOM   93   C CB    . SER A 1 16  ? 36.964 53.041 72.033 1.00 28.76  ? 16  SER A CB    1 
ATOM   94   O OG    . SER A 1 16  ? 35.971 52.081 72.354 1.00 28.37  ? 16  SER A OG    1 
ATOM   95   N N     . HIS A 1 17  ? 37.965 50.233 70.335 1.00 27.39  ? 17  HIS A N     1 
ATOM   96   C CA    . HIS A 1 17  ? 38.457 48.864 70.465 1.00 29.54  ? 17  HIS A CA    1 
ATOM   97   C C     . HIS A 1 17  ? 39.520 48.581 69.407 1.00 29.04  ? 17  HIS A C     1 
ATOM   98   O O     . HIS A 1 17  ? 40.078 47.485 69.361 1.00 28.07  ? 17  HIS A O     1 
ATOM   99   C CB    . HIS A 1 17  ? 37.312 47.865 70.288 1.00 30.70  ? 17  HIS A CB    1 
ATOM   100  C CG    . HIS A 1 17  ? 36.343 47.842 71.426 1.00 33.10  ? 17  HIS A CG    1 
ATOM   101  N ND1   . HIS A 1 17  ? 36.580 47.146 72.592 1.00 35.79  ? 17  HIS A ND1   1 
ATOM   102  C CD2   . HIS A 1 17  ? 35.133 48.429 71.578 1.00 33.31  ? 17  HIS A CD2   1 
ATOM   103  C CE1   . HIS A 1 17  ? 35.556 47.303 73.412 1.00 36.51  ? 17  HIS A CE1   1 
ATOM   104  N NE2   . HIS A 1 17  ? 34.664 48.078 72.821 1.00 34.90  ? 17  HIS A NE2   1 
ATOM   105  N N     . CYS A 1 18  ? 39.796 49.570 68.560 1.00 29.20  ? 18  CYS A N     1 
ATOM   106  C CA    . CYS A 1 18  ? 40.784 49.408 67.493 1.00 30.87  ? 18  CYS A CA    1 
ATOM   107  C C     . CYS A 1 18  ? 42.075 50.187 67.694 1.00 31.78  ? 18  CYS A C     1 
ATOM   108  O O     . CYS A 1 18  ? 42.126 51.163 68.440 1.00 34.29  ? 18  CYS A O     1 
ATOM   109  C CB    . CYS A 1 18  ? 40.206 49.860 66.145 1.00 30.82  ? 18  CYS A CB    1 
ATOM   110  S SG    . CYS A 1 18  ? 38.616 49.165 65.692 1.00 31.22  ? 18  CYS A SG    1 
ATOM   111  N N     . HIS A 1 19  ? 43.118 49.741 67.003 1.00 34.72  ? 19  HIS A N     1 
ATOM   112  C CA    . HIS A 1 19  ? 44.404 50.423 67.022 1.00 35.40  ? 19  HIS A CA    1 
ATOM   113  C C     . HIS A 1 19  ? 44.430 51.201 65.712 1.00 35.53  ? 19  HIS A C     1 
ATOM   114  O O     . HIS A 1 19  ? 43.931 50.713 64.693 1.00 31.92  ? 19  HIS A O     1 
ATOM   115  C CB    . HIS A 1 19  ? 45.559 49.419 67.058 1.00 40.20  ? 19  HIS A CB    1 
ATOM   116  C CG    . HIS A 1 19  ? 45.904 48.950 68.435 1.00 43.38  ? 19  HIS A CG    1 
ATOM   117  N ND1   . HIS A 1 19  ? 46.347 49.807 69.420 1.00 44.69  ? 19  HIS A ND1   1 
ATOM   118  C CD2   . HIS A 1 19  ? 45.854 47.720 68.999 1.00 44.74  ? 19  HIS A CD2   1 
ATOM   119  C CE1   . HIS A 1 19  ? 46.555 49.125 70.532 1.00 45.82  ? 19  HIS A CE1   1 
ATOM   120  N NE2   . HIS A 1 19  ? 46.263 47.857 70.303 1.00 44.70  ? 19  HIS A NE2   1 
ATOM   121  N N     . ILE A 1 20  ? 44.985 52.411 65.740 1.00 34.37  ? 20  ILE A N     1 
ATOM   122  C CA    . ILE A 1 20  ? 45.056 53.239 64.541 1.00 37.44  ? 20  ILE A CA    1 
ATOM   123  C C     . ILE A 1 20  ? 46.447 53.170 63.920 1.00 38.45  ? 20  ILE A C     1 
ATOM   124  O O     . ILE A 1 20  ? 47.454 53.254 64.621 1.00 37.77  ? 20  ILE A O     1 
ATOM   125  C CB    . ILE A 1 20  ? 44.748 54.724 64.852 1.00 39.45  ? 20  ILE A CB    1 
ATOM   126  C CG1   . ILE A 1 20  ? 43.418 54.845 65.605 1.00 41.62  ? 20  ILE A CG1   1 
ATOM   127  C CG2   . ILE A 1 20  ? 44.699 55.523 63.557 1.00 40.35  ? 20  ILE A CG2   1 
ATOM   128  C CD1   . ILE A 1 20  ? 42.214 54.317 64.845 1.00 42.12  ? 20  ILE A CD1   1 
ATOM   129  N N     . HIS A 1 21  ? 46.492 53.022 62.600 1.00 38.21  ? 21  HIS A N     1 
ATOM   130  C CA    . HIS A 1 21  ? 47.755 52.949 61.875 1.00 39.48  ? 21  HIS A CA    1 
ATOM   131  C C     . HIS A 1 21  ? 47.733 53.934 60.718 1.00 39.74  ? 21  HIS A C     1 
ATOM   132  O O     . HIS A 1 21  ? 46.688 54.166 60.106 1.00 38.29  ? 21  HIS A O     1 
ATOM   133  C CB    . HIS A 1 21  ? 47.971 51.535 61.330 1.00 41.34  ? 21  HIS A CB    1 
ATOM   134  C CG    . HIS A 1 21  ? 48.023 50.483 62.391 1.00 44.17  ? 21  HIS A CG    1 
ATOM   135  N ND1   . HIS A 1 21  ? 49.113 50.312 63.217 1.00 45.90  ? 21  HIS A ND1   1 
ATOM   136  C CD2   . HIS A 1 21  ? 47.110 49.561 62.777 1.00 44.44  ? 21  HIS A CD2   1 
ATOM   137  C CE1   . HIS A 1 21  ? 48.869 49.329 64.066 1.00 45.95  ? 21  HIS A CE1   1 
ATOM   138  N NE2   . HIS A 1 21  ? 47.660 48.856 63.820 1.00 44.65  ? 21  HIS A NE2   1 
ATOM   139  N N     . LYS A 1 22  ? 48.887 54.520 60.421 1.00 38.54  ? 22  LYS A N     1 
ATOM   140  C CA    . LYS A 1 22  ? 48.977 55.466 59.325 1.00 38.90  ? 22  LYS A CA    1 
ATOM   141  C C     . LYS A 1 22  ? 49.667 54.828 58.129 1.00 37.69  ? 22  LYS A C     1 
ATOM   142  O O     . LYS A 1 22  ? 50.612 54.052 58.282 1.00 38.18  ? 22  LYS A O     1 
ATOM   143  C CB    . LYS A 1 22  ? 49.728 56.724 59.766 1.00 42.03  ? 22  LYS A CB    1 
ATOM   144  C CG    . LYS A 1 22  ? 49.019 57.494 60.873 1.00 43.62  ? 22  LYS A CG    1 
ATOM   145  C CD    . LYS A 1 22  ? 49.639 58.869 61.084 1.00 49.25  ? 22  LYS A CD    1 
ATOM   146  C CE    . LYS A 1 22  ? 51.106 58.771 61.476 1.00 51.39  ? 22  LYS A CE    1 
ATOM   147  N NZ    . LYS A 1 22  ? 51.724 60.120 61.631 1.00 53.08  ? 22  LYS A NZ    1 
ATOM   148  N N     . TYR A 1 23  ? 49.179 55.156 56.938 1.00 37.45  ? 23  TYR A N     1 
ATOM   149  C CA    . TYR A 1 23  ? 49.728 54.621 55.695 1.00 35.27  ? 23  TYR A CA    1 
ATOM   150  C C     . TYR A 1 23  ? 49.984 55.741 54.695 1.00 34.72  ? 23  TYR A C     1 
ATOM   151  O O     . TYR A 1 23  ? 49.050 56.420 54.260 1.00 35.10  ? 23  TYR A O     1 
ATOM   152  C CB    . TYR A 1 23  ? 48.753 53.613 55.078 1.00 34.59  ? 23  TYR A CB    1 
ATOM   153  C CG    . TYR A 1 23  ? 48.602 52.335 55.870 1.00 35.52  ? 23  TYR A CG    1 
ATOM   154  C CD1   . TYR A 1 23  ? 49.443 51.249 55.642 1.00 35.45  ? 23  TYR A CD1   1 
ATOM   155  C CD2   . TYR A 1 23  ? 47.630 52.220 56.866 1.00 36.59  ? 23  TYR A CD2   1 
ATOM   156  C CE1   . TYR A 1 23  ? 49.321 50.078 56.383 1.00 37.77  ? 23  TYR A CE1   1 
ATOM   157  C CE2   . TYR A 1 23  ? 47.502 51.055 57.615 1.00 36.52  ? 23  TYR A CE2   1 
ATOM   158  C CZ    . TYR A 1 23  ? 48.348 49.988 57.369 1.00 38.10  ? 23  TYR A CZ    1 
ATOM   159  O OH    . TYR A 1 23  ? 48.220 48.827 58.103 1.00 39.27  ? 23  TYR A OH    1 
ATOM   160  N N     . PRO A 1 24  ? 51.257 55.957 54.324 1.00 33.21  ? 24  PRO A N     1 
ATOM   161  C CA    . PRO A 1 24  ? 51.608 57.005 53.362 1.00 33.11  ? 24  PRO A CA    1 
ATOM   162  C C     . PRO A 1 24  ? 50.973 56.695 52.014 1.00 32.58  ? 24  PRO A C     1 
ATOM   163  O O     . PRO A 1 24  ? 50.697 55.534 51.705 1.00 30.45  ? 24  PRO A O     1 
ATOM   164  C CB    . PRO A 1 24  ? 53.132 56.926 53.300 1.00 33.90  ? 24  PRO A CB    1 
ATOM   165  C CG    . PRO A 1 24  ? 53.505 56.445 54.660 1.00 34.67  ? 24  PRO A CG    1 
ATOM   166  C CD    . PRO A 1 24  ? 52.468 55.369 54.921 1.00 34.47  ? 24  PRO A CD    1 
ATOM   167  N N     . SER A 1 25  ? 50.734 57.731 51.218 1.00 31.67  ? 25  SER A N     1 
ATOM   168  C CA    . SER A 1 25  ? 50.143 57.555 49.903 1.00 32.02  ? 25  SER A CA    1 
ATOM   169  C C     . SER A 1 25  ? 50.981 56.550 49.114 1.00 32.36  ? 25  SER A C     1 
ATOM   170  O O     . SER A 1 25  ? 52.211 56.592 49.151 1.00 29.79  ? 25  SER A O     1 
ATOM   171  C CB    . SER A 1 25  ? 50.090 58.898 49.164 1.00 33.29  ? 25  SER A CB    1 
ATOM   172  O OG    . SER A 1 25  ? 49.471 58.770 47.895 1.00 38.15  ? 25  SER A OG    1 
ATOM   173  N N     . LYS A 1 26  ? 50.294 55.638 48.430 1.00 32.09  ? 26  LYS A N     1 
ATOM   174  C CA    . LYS A 1 26  ? 50.908 54.595 47.612 1.00 33.59  ? 26  LYS A CA    1 
ATOM   175  C C     . LYS A 1 26  ? 51.357 53.352 48.378 1.00 31.86  ? 26  LYS A C     1 
ATOM   176  O O     . LYS A 1 26  ? 51.817 52.388 47.769 1.00 31.32  ? 26  LYS A O     1 
ATOM   177  C CB    . LYS A 1 26  ? 52.087 55.159 46.804 1.00 37.70  ? 26  LYS A CB    1 
ATOM   178  C CG    . LYS A 1 26  ? 51.683 56.202 45.770 1.00 41.29  ? 26  LYS A CG    1 
ATOM   179  C CD    . LYS A 1 26  ? 50.685 55.637 44.766 1.00 46.01  ? 26  LYS A CD    1 
ATOM   180  C CE    . LYS A 1 26  ? 51.272 54.458 43.991 1.00 48.80  ? 26  LYS A CE    1 
ATOM   181  N NZ    . LYS A 1 26  ? 50.281 53.840 43.062 1.00 49.02  ? 26  LYS A NZ    1 
ATOM   182  N N     . SER A 1 27  ? 51.229 53.363 49.703 1.00 29.70  ? 27  SER A N     1 
ATOM   183  C CA    . SER A 1 27  ? 51.615 52.191 50.481 1.00 28.87  ? 27  SER A CA    1 
ATOM   184  C C     . SER A 1 27  ? 50.469 51.175 50.448 1.00 28.29  ? 27  SER A C     1 
ATOM   185  O O     . SER A 1 27  ? 49.291 51.545 50.364 1.00 25.90  ? 27  SER A O     1 
ATOM   186  C CB    . SER A 1 27  ? 51.944 52.573 51.931 1.00 29.99  ? 27  SER A CB    1 
ATOM   187  O OG    . SER A 1 27  ? 50.799 53.029 52.626 1.00 34.56  ? 27  SER A OG    1 
ATOM   188  N N     . THR A 1 28  ? 50.818 49.896 50.508 1.00 25.39  ? 28  THR A N     1 
ATOM   189  C CA    . THR A 1 28  ? 49.823 48.834 50.468 1.00 26.41  ? 28  THR A CA    1 
ATOM   190  C C     . THR A 1 28  ? 49.360 48.430 51.858 1.00 27.08  ? 28  THR A C     1 
ATOM   191  O O     . THR A 1 28  ? 50.172 48.115 52.726 1.00 30.21  ? 28  THR A O     1 
ATOM   192  C CB    . THR A 1 28  ? 50.378 47.593 49.740 1.00 25.47  ? 28  THR A CB    1 
ATOM   193  O OG1   . THR A 1 28  ? 50.726 47.959 48.402 1.00 24.03  ? 28  THR A OG1   1 
ATOM   194  C CG2   . THR A 1 28  ? 49.338 46.477 49.700 1.00 25.82  ? 28  THR A CG2   1 
ATOM   195  N N     . LEU A 1 29  ? 48.047 48.451 52.064 1.00 26.41  ? 29  LEU A N     1 
ATOM   196  C CA    . LEU A 1 29  ? 47.464 48.069 53.353 1.00 27.77  ? 29  LEU A CA    1 
ATOM   197  C C     . LEU A 1 29  ? 47.191 46.567 53.407 1.00 26.12  ? 29  LEU A C     1 
ATOM   198  O O     . LEU A 1 29  ? 47.444 45.899 54.416 1.00 25.63  ? 29  LEU A O     1 
ATOM   199  C CB    . LEU A 1 29  ? 46.133 48.795 53.578 1.00 28.49  ? 29  LEU A CB    1 
ATOM   200  C CG    . LEU A 1 29  ? 46.078 50.295 53.873 1.00 33.24  ? 29  LEU A CG    1 
ATOM   201  C CD1   . LEU A 1 29  ? 46.523 51.106 52.666 1.00 31.28  ? 29  LEU A CD1   1 
ATOM   202  C CD2   . LEU A 1 29  ? 44.644 50.649 54.252 1.00 35.22  ? 29  LEU A CD2   1 
ATOM   203  N N     . ILE A 1 30  ? 46.662 46.051 52.306 1.00 24.22  ? 30  ILE A N     1 
ATOM   204  C CA    . ILE A 1 30  ? 46.292 44.644 52.195 1.00 22.92  ? 30  ILE A CA    1 
ATOM   205  C C     . ILE A 1 30  ? 46.847 44.018 50.915 1.00 22.28  ? 30  ILE A C     1 
ATOM   206  O O     . ILE A 1 30  ? 46.688 44.578 49.831 1.00 20.81  ? 30  ILE A O     1 
ATOM   207  C CB    . ILE A 1 30  ? 44.753 44.510 52.164 1.00 22.87  ? 30  ILE A CB    1 
ATOM   208  C CG1   . ILE A 1 30  ? 44.156 45.074 53.457 1.00 22.96  ? 30  ILE A CG1   1 
ATOM   209  C CG2   . ILE A 1 30  ? 44.359 43.055 51.962 1.00 20.31  ? 30  ILE A CG2   1 
ATOM   210  C CD1   . ILE A 1 30  ? 42.642 45.167 53.443 1.00 24.39  ? 30  ILE A CD1   1 
ATOM   211  N N     . HIS A 1 31  ? 47.485 42.857 51.041 1.00 22.21  ? 31  HIS A N     1 
ATOM   212  C CA    . HIS A 1 31  ? 48.044 42.161 49.876 1.00 23.86  ? 31  HIS A CA    1 
ATOM   213  C C     . HIS A 1 31  ? 47.184 40.950 49.522 1.00 23.49  ? 31  HIS A C     1 
ATOM   214  O O     . HIS A 1 31  ? 46.798 40.179 50.397 1.00 22.21  ? 31  HIS A O     1 
ATOM   215  C CB    . HIS A 1 31  ? 49.474 41.679 50.171 1.00 24.56  ? 31  HIS A CB    1 
ATOM   216  C CG    . HIS A 1 31  ? 50.457 42.785 50.400 1.00 24.45  ? 31  HIS A CG    1 
ATOM   217  N ND1   . HIS A 1 31  ? 51.132 43.408 49.371 1.00 27.37  ? 31  HIS A ND1   1 
ATOM   218  C CD2   . HIS A 1 31  ? 50.861 43.395 51.538 1.00 26.43  ? 31  HIS A CD2   1 
ATOM   219  C CE1   . HIS A 1 31  ? 51.911 44.352 49.867 1.00 25.86  ? 31  HIS A CE1   1 
ATOM   220  N NE2   . HIS A 1 31  ? 51.764 44.366 51.179 1.00 24.22  ? 31  HIS A NE2   1 
ATOM   221  N N     . GLN A 1 32  ? 46.886 40.768 48.241 1.00 24.08  ? 32  GLN A N     1 
ATOM   222  C CA    . GLN A 1 32  ? 46.092 39.609 47.855 1.00 25.17  ? 32  GLN A CA    1 
ATOM   223  C C     . GLN A 1 32  ? 46.811 38.331 48.298 1.00 27.00  ? 32  GLN A C     1 
ATOM   224  O O     . GLN A 1 32  ? 48.033 38.227 48.184 1.00 24.27  ? 32  GLN A O     1 
ATOM   225  C CB    . GLN A 1 32  ? 45.890 39.565 46.341 1.00 26.87  ? 32  GLN A CB    1 
ATOM   226  C CG    . GLN A 1 32  ? 44.855 38.536 45.913 1.00 27.91  ? 32  GLN A CG    1 
ATOM   227  C CD    . GLN A 1 32  ? 44.770 38.379 44.408 1.00 31.52  ? 32  GLN A CD    1 
ATOM   228  O OE1   . GLN A 1 32  ? 45.598 37.707 43.793 1.00 32.87  ? 32  GLN A OE1   1 
ATOM   229  N NE2   . GLN A 1 32  ? 43.770 39.009 43.806 1.00 30.22  ? 32  GLN A NE2   1 
ATOM   230  N N     . GLY A 1 33  ? 46.058 37.366 48.819 1.00 25.93  ? 33  GLY A N     1 
ATOM   231  C CA    . GLY A 1 33  ? 46.667 36.115 49.240 1.00 27.04  ? 33  GLY A CA    1 
ATOM   232  C C     . GLY A 1 33  ? 46.948 36.004 50.726 1.00 25.12  ? 33  GLY A C     1 
ATOM   233  O O     . GLY A 1 33  ? 47.099 34.898 51.244 1.00 26.34  ? 33  GLY A O     1 
ATOM   234  N N     . GLU A 1 34  ? 47.048 37.139 51.410 1.00 25.28  ? 34  GLU A N     1 
ATOM   235  C CA    . GLU A 1 34  ? 47.293 37.135 52.847 1.00 26.20  ? 34  GLU A CA    1 
ATOM   236  C C     . GLU A 1 34  ? 46.131 36.462 53.561 1.00 26.90  ? 34  GLU A C     1 
ATOM   237  O O     . GLU A 1 34  ? 44.999 36.464 53.068 1.00 25.59  ? 34  GLU A O     1 
ATOM   238  C CB    . GLU A 1 34  ? 47.456 38.570 53.381 1.00 26.24  ? 34  GLU A CB    1 
ATOM   239  C CG    . GLU A 1 34  ? 48.865 39.137 53.231 1.00 27.76  ? 34  GLU A CG    1 
ATOM   240  C CD    . GLU A 1 34  ? 48.960 40.622 53.553 1.00 29.57  ? 34  GLU A CD    1 
ATOM   241  O OE1   . GLU A 1 34  ? 50.095 41.102 53.760 1.00 32.60  ? 34  GLU A OE1   1 
ATOM   242  O OE2   . GLU A 1 34  ? 47.917 41.315 53.580 1.00 29.85  ? 34  GLU A OE2   1 
ATOM   243  N N     . LYS A 1 35  ? 46.416 35.869 54.715 1.00 26.42  ? 35  LYS A N     1 
ATOM   244  C CA    . LYS A 1 35  ? 45.376 35.224 55.506 1.00 27.53  ? 35  LYS A CA    1 
ATOM   245  C C     . LYS A 1 35  ? 44.505 36.336 56.083 1.00 27.10  ? 35  LYS A C     1 
ATOM   246  O O     . LYS A 1 35  ? 45.011 37.279 56.694 1.00 27.30  ? 35  LYS A O     1 
ATOM   247  C CB    . LYS A 1 35  ? 46.015 34.391 56.619 1.00 31.27  ? 35  LYS A CB    1 
ATOM   248  C CG    . LYS A 1 35  ? 46.613 33.086 56.108 1.00 39.02  ? 35  LYS A CG    1 
ATOM   249  C CD    . LYS A 1 35  ? 47.684 32.521 57.032 1.00 43.06  ? 35  LYS A CD    1 
ATOM   250  C CE    . LYS A 1 35  ? 49.037 33.182 56.772 1.00 45.36  ? 35  LYS A CE    1 
ATOM   251  N NZ    . LYS A 1 35  ? 50.115 32.622 57.632 1.00 50.19  ? 35  LYS A NZ    1 
ATOM   252  N N     . ALA A 1 36  ? 43.198 36.236 55.863 1.00 27.64  ? 36  ALA A N     1 
ATOM   253  C CA    . ALA A 1 36  ? 42.260 37.249 56.338 1.00 26.62  ? 36  ALA A CA    1 
ATOM   254  C C     . ALA A 1 36  ? 41.867 37.004 57.793 1.00 27.54  ? 36  ALA A C     1 
ATOM   255  O O     . ALA A 1 36  ? 41.119 36.078 58.088 1.00 26.46  ? 36  ALA A O     1 
ATOM   256  C CB    . ALA A 1 36  ? 41.019 37.254 55.447 1.00 25.27  ? 36  ALA A CB    1 
ATOM   257  N N     . GLU A 1 37  ? 42.373 37.841 58.695 1.00 27.74  ? 37  GLU A N     1 
ATOM   258  C CA    . GLU A 1 37  ? 42.077 37.699 60.119 1.00 30.18  ? 37  GLU A CA    1 
ATOM   259  C C     . GLU A 1 37  ? 41.817 39.050 60.781 1.00 28.92  ? 37  GLU A C     1 
ATOM   260  O O     . GLU A 1 37  ? 41.601 39.123 61.990 1.00 29.42  ? 37  GLU A O     1 
ATOM   261  C CB    . GLU A 1 37  ? 43.253 37.007 60.831 1.00 32.09  ? 37  GLU A CB    1 
ATOM   262  C CG    . GLU A 1 37  ? 43.583 35.616 60.284 1.00 36.86  ? 37  GLU A CG    1 
ATOM   263  C CD    . GLU A 1 37  ? 44.850 35.019 60.884 1.00 41.62  ? 37  GLU A CD    1 
ATOM   264  O OE1   . GLU A 1 37  ? 45.122 33.824 60.629 1.00 45.26  ? 37  GLU A OE1   1 
ATOM   265  O OE2   . GLU A 1 37  ? 45.577 35.740 61.601 1.00 41.61  ? 37  GLU A OE2   1 
ATOM   266  N N     . THR A 1 38  ? 41.818 40.113 59.984 1.00 27.35  ? 38  THR A N     1 
ATOM   267  C CA    . THR A 1 38  ? 41.632 41.459 60.514 1.00 27.32  ? 38  THR A CA    1 
ATOM   268  C C     . THR A 1 38  ? 40.675 42.324 59.703 1.00 25.46  ? 38  THR A C     1 
ATOM   269  O O     . THR A 1 38  ? 40.646 42.239 58.478 1.00 23.56  ? 38  THR A O     1 
ATOM   270  C CB    . THR A 1 38  ? 42.990 42.190 60.572 1.00 30.01  ? 38  THR A CB    1 
ATOM   271  O OG1   . THR A 1 38  ? 43.900 41.432 61.380 1.00 34.55  ? 38  THR A OG1   1 
ATOM   272  C CG2   . THR A 1 38  ? 42.829 43.583 61.149 1.00 32.79  ? 38  THR A CG2   1 
ATOM   273  N N     . LEU A 1 39  ? 39.915 43.168 60.401 1.00 24.54  ? 39  LEU A N     1 
ATOM   274  C CA    . LEU A 1 39  ? 38.974 44.091 59.767 1.00 24.63  ? 39  LEU A CA    1 
ATOM   275  C C     . LEU A 1 39  ? 39.553 45.505 59.881 1.00 24.98  ? 39  LEU A C     1 
ATOM   276  O O     . LEU A 1 39  ? 40.184 45.844 60.888 1.00 24.30  ? 39  LEU A O     1 
ATOM   277  C CB    . LEU A 1 39  ? 37.609 44.036 60.464 1.00 24.71  ? 39  LEU A CB    1 
ATOM   278  C CG    . LEU A 1 39  ? 36.552 45.020 59.937 1.00 26.63  ? 39  LEU A CG    1 
ATOM   279  C CD1   . LEU A 1 39  ? 36.064 44.563 58.568 1.00 25.07  ? 39  LEU A CD1   1 
ATOM   280  C CD2   . LEU A 1 39  ? 35.376 45.105 60.907 1.00 26.65  ? 39  LEU A CD2   1 
ATOM   281  N N     . TYR A 1 40  ? 39.341 46.314 58.845 1.00 25.28  ? 40  TYR A N     1 
ATOM   282  C CA    . TYR A 1 40  ? 39.835 47.691 58.794 1.00 26.58  ? 40  TYR A CA    1 
ATOM   283  C C     . TYR A 1 40  ? 38.697 48.686 58.626 1.00 23.81  ? 40  TYR A C     1 
ATOM   284  O O     . TYR A 1 40  ? 37.635 48.354 58.118 1.00 22.47  ? 40  TYR A O     1 
ATOM   285  C CB    . TYR A 1 40  ? 40.784 47.872 57.603 1.00 28.60  ? 40  TYR A CB    1 
ATOM   286  C CG    . TYR A 1 40  ? 42.060 47.076 57.691 1.00 31.82  ? 40  TYR A CG    1 
ATOM   287  C CD1   . TYR A 1 40  ? 43.202 47.616 58.286 1.00 34.35  ? 40  TYR A CD1   1 
ATOM   288  C CD2   . TYR A 1 40  ? 42.131 45.782 57.183 1.00 32.40  ? 40  TYR A CD2   1 
ATOM   289  C CE1   . TYR A 1 40  ? 44.384 46.885 58.368 1.00 36.38  ? 40  TYR A CE1   1 
ATOM   290  C CE2   . TYR A 1 40  ? 43.308 45.042 57.263 1.00 35.90  ? 40  TYR A CE2   1 
ATOM   291  C CZ    . TYR A 1 40  ? 44.430 45.601 57.856 1.00 38.09  ? 40  TYR A CZ    1 
ATOM   292  O OH    . TYR A 1 40  ? 45.598 44.874 57.929 1.00 40.03  ? 40  TYR A OH    1 
ATOM   293  N N     . TYR A 1 41  ? 38.951 49.923 59.027 1.00 24.98  ? 41  TYR A N     1 
ATOM   294  C CA    . TYR A 1 41  ? 37.969 50.994 58.899 1.00 24.23  ? 41  TYR A CA    1 
ATOM   295  C C     . TYR A 1 41  ? 38.748 52.273 58.612 1.00 25.20  ? 41  TYR A C     1 
ATOM   296  O O     . TYR A 1 41  ? 39.645 52.631 59.375 1.00 25.78  ? 41  TYR A O     1 
ATOM   297  C CB    . TYR A 1 41  ? 37.183 51.142 60.198 1.00 26.39  ? 41  TYR A CB    1 
ATOM   298  C CG    . TYR A 1 41  ? 36.131 52.222 60.132 1.00 26.81  ? 41  TYR A CG    1 
ATOM   299  C CD1   . TYR A 1 41  ? 34.823 51.925 59.750 1.00 28.87  ? 41  TYR A CD1   1 
ATOM   300  C CD2   . TYR A 1 41  ? 36.446 53.547 60.444 1.00 28.65  ? 41  TYR A CD2   1 
ATOM   301  C CE1   . TYR A 1 41  ? 33.851 52.917 59.686 1.00 30.16  ? 41  TYR A CE1   1 
ATOM   302  C CE2   . TYR A 1 41  ? 35.480 54.551 60.379 1.00 27.98  ? 41  TYR A CE2   1 
ATOM   303  C CZ    . TYR A 1 41  ? 34.187 54.227 60.003 1.00 30.63  ? 41  TYR A CZ    1 
ATOM   304  O OH    . TYR A 1 41  ? 33.222 55.198 59.961 1.00 30.05  ? 41  TYR A OH    1 
ATOM   305  N N     . ILE A 1 42  ? 38.421 52.951 57.516 1.00 25.01  ? 42  ILE A N     1 
ATOM   306  C CA    . ILE A 1 42  ? 39.133 54.174 57.147 1.00 27.05  ? 42  ILE A CA    1 
ATOM   307  C C     . ILE A 1 42  ? 38.638 55.383 57.934 1.00 27.56  ? 42  ILE A C     1 
ATOM   308  O O     . ILE A 1 42  ? 37.502 55.825 57.768 1.00 25.84  ? 42  ILE A O     1 
ATOM   309  C CB    . ILE A 1 42  ? 38.992 54.481 55.637 1.00 25.92  ? 42  ILE A CB    1 
ATOM   310  C CG1   . ILE A 1 42  ? 39.473 53.284 54.813 1.00 23.43  ? 42  ILE A CG1   1 
ATOM   311  C CG2   . ILE A 1 42  ? 39.820 55.722 55.272 1.00 26.07  ? 42  ILE A CG2   1 
ATOM   312  C CD1   . ILE A 1 42  ? 39.239 53.440 53.305 1.00 24.51  ? 42  ILE A CD1   1 
ATOM   313  N N     . VAL A 1 43  ? 39.507 55.903 58.795 1.00 29.89  ? 43  VAL A N     1 
ATOM   314  C CA    . VAL A 1 43  ? 39.192 57.069 59.608 1.00 32.79  ? 43  VAL A CA    1 
ATOM   315  C C     . VAL A 1 43  ? 39.495 58.321 58.787 1.00 33.19  ? 43  VAL A C     1 
ATOM   316  O O     . VAL A 1 43  ? 38.837 59.350 58.935 1.00 33.75  ? 43  VAL A O     1 
ATOM   317  C CB    . VAL A 1 43  ? 40.039 57.082 60.907 1.00 35.13  ? 43  VAL A CB    1 
ATOM   318  C CG1   . VAL A 1 43  ? 39.830 58.388 61.659 1.00 38.03  ? 43  VAL A CG1   1 
ATOM   319  C CG2   . VAL A 1 43  ? 39.657 55.890 61.788 1.00 34.97  ? 43  VAL A CG2   1 
ATOM   320  N N     . LYS A 1 44  ? 40.489 58.221 57.910 1.00 32.65  ? 44  LYS A N     1 
ATOM   321  C CA    . LYS A 1 44  ? 40.866 59.344 57.057 1.00 32.71  ? 44  LYS A CA    1 
ATOM   322  C C     . LYS A 1 44  ? 41.613 58.866 55.819 1.00 31.22  ? 44  LYS A C     1 
ATOM   323  O O     . LYS A 1 44  ? 42.387 57.913 55.885 1.00 30.93  ? 44  LYS A O     1 
ATOM   324  C CB    . LYS A 1 44  ? 41.749 60.324 57.833 1.00 35.10  ? 44  LYS A CB    1 
ATOM   325  C CG    . LYS A 1 44  ? 42.160 61.553 57.033 1.00 39.41  ? 44  LYS A CG    1 
ATOM   326  C CD    . LYS A 1 44  ? 43.059 62.468 57.855 1.00 42.13  ? 44  LYS A CD    1 
ATOM   327  C CE    . LYS A 1 44  ? 43.542 63.647 57.028 1.00 44.86  ? 44  LYS A CE    1 
ATOM   328  N NZ    . LYS A 1 44  ? 44.423 64.543 57.823 1.00 47.58  ? 44  LYS A NZ    1 
ATOM   329  N N     . GLY A 1 45  ? 41.373 59.533 54.695 1.00 30.72  ? 45  GLY A N     1 
ATOM   330  C CA    . GLY A 1 45  ? 42.041 59.173 53.455 1.00 30.59  ? 45  GLY A CA    1 
ATOM   331  C C     . GLY A 1 45  ? 41.194 58.349 52.500 1.00 30.13  ? 45  GLY A C     1 
ATOM   332  O O     . GLY A 1 45  ? 40.000 58.146 52.725 1.00 27.78  ? 45  GLY A O     1 
ATOM   333  N N     . SER A 1 46  ? 41.821 57.886 51.422 1.00 28.75  ? 46  SER A N     1 
ATOM   334  C CA    . SER A 1 46  ? 41.145 57.072 50.420 1.00 29.28  ? 46  SER A CA    1 
ATOM   335  C C     . SER A 1 46  ? 42.095 55.994 49.918 1.00 28.11  ? 46  SER A C     1 
ATOM   336  O O     . SER A 1 46  ? 43.312 56.154 49.973 1.00 27.28  ? 46  SER A O     1 
ATOM   337  C CB    . SER A 1 46  ? 40.679 57.938 49.243 1.00 32.17  ? 46  SER A CB    1 
ATOM   338  O OG    . SER A 1 46  ? 41.774 58.595 48.627 1.00 36.97  ? 46  SER A OG    1 
ATOM   339  N N     . VAL A 1 47  ? 41.532 54.896 49.424 1.00 26.07  ? 47  VAL A N     1 
ATOM   340  C CA    . VAL A 1 47  ? 42.337 53.790 48.925 1.00 25.43  ? 47  VAL A CA    1 
ATOM   341  C C     . VAL A 1 47  ? 41.777 53.276 47.602 1.00 25.10  ? 47  VAL A C     1 
ATOM   342  O O     . VAL A 1 47  ? 40.675 53.651 47.190 1.00 24.79  ? 47  VAL A O     1 
ATOM   343  C CB    . VAL A 1 47  ? 42.333 52.603 49.924 1.00 24.03  ? 47  VAL A CB    1 
ATOM   344  C CG1   . VAL A 1 47  ? 42.805 53.061 51.303 1.00 24.05  ? 47  VAL A CG1   1 
ATOM   345  C CG2   . VAL A 1 47  ? 40.927 52.016 50.022 1.00 23.18  ? 47  VAL A CG2   1 
ATOM   346  N N     . ALA A 1 48  ? 42.551 52.421 46.940 1.00 24.46  ? 48  ALA A N     1 
ATOM   347  C CA    . ALA A 1 48  ? 42.130 51.805 45.689 1.00 23.07  ? 48  ALA A CA    1 
ATOM   348  C C     . ALA A 1 48  ? 42.213 50.298 45.899 1.00 23.93  ? 48  ALA A C     1 
ATOM   349  O O     . ALA A 1 48  ? 43.164 49.805 46.511 1.00 24.14  ? 48  ALA A O     1 
ATOM   350  C CB    . ALA A 1 48  ? 43.046 52.218 44.546 1.00 25.30  ? 48  ALA A CB    1 
ATOM   351  N N     . VAL A 1 49  ? 41.206 49.579 45.411 1.00 21.15  ? 49  VAL A N     1 
ATOM   352  C CA    . VAL A 1 49  ? 41.165 48.125 45.522 1.00 20.46  ? 49  VAL A CA    1 
ATOM   353  C C     . VAL A 1 49  ? 41.468 47.595 44.126 1.00 22.48  ? 49  VAL A C     1 
ATOM   354  O O     . VAL A 1 49  ? 40.766 47.935 43.172 1.00 23.40  ? 49  VAL A O     1 
ATOM   355  C CB    . VAL A 1 49  ? 39.768 47.629 45.966 1.00 20.54  ? 49  VAL A CB    1 
ATOM   356  C CG1   . VAL A 1 49  ? 39.752 46.100 46.046 1.00 19.16  ? 49  VAL A CG1   1 
ATOM   357  C CG2   . VAL A 1 49  ? 39.409 48.240 47.339 1.00 18.74  ? 49  VAL A CG2   1 
ATOM   358  N N     . LEU A 1 50  ? 42.510 46.776 43.999 1.00 23.18  ? 50  LEU A N     1 
ATOM   359  C CA    . LEU A 1 50  ? 42.871 46.254 42.685 1.00 25.31  ? 50  LEU A CA    1 
ATOM   360  C C     . LEU A 1 50  ? 43.129 44.756 42.608 1.00 26.43  ? 50  LEU A C     1 
ATOM   361  O O     . LEU A 1 50  ? 43.459 44.108 43.605 1.00 23.97  ? 50  LEU A O     1 
ATOM   362  C CB    . LEU A 1 50  ? 44.118 46.960 42.150 1.00 29.69  ? 50  LEU A CB    1 
ATOM   363  C CG    . LEU A 1 50  ? 44.254 48.481 42.242 1.00 34.72  ? 50  LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 50  ? 44.926 48.842 43.558 1.00 34.62  ? 50  LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 50  ? 45.096 48.982 41.077 1.00 35.42  ? 50  LEU A CD2   1 
ATOM   366  N N     . ILE A 1 51  ? 42.968 44.215 41.402 1.00 25.33  ? 51  ILE A N     1 
ATOM   367  C CA    . ILE A 1 51  ? 43.241 42.807 41.147 1.00 27.61  ? 51  ILE A CA    1 
ATOM   368  C C     . ILE A 1 51  ? 44.208 42.780 39.967 1.00 29.29  ? 51  ILE A C     1 
ATOM   369  O O     . ILE A 1 51  ? 44.347 43.777 39.252 1.00 26.92  ? 51  ILE A O     1 
ATOM   370  C CB    . ILE A 1 51  ? 41.959 42.002 40.808 1.00 28.56  ? 51  ILE A CB    1 
ATOM   371  C CG1   . ILE A 1 51  ? 41.183 42.679 39.678 1.00 29.47  ? 51  ILE A CG1   1 
ATOM   372  C CG2   . ILE A 1 51  ? 41.094 41.861 42.056 1.00 28.79  ? 51  ILE A CG2   1 
ATOM   373  C CD1   . ILE A 1 51  ? 39.895 41.962 39.319 1.00 31.37  ? 51  ILE A CD1   1 
ATOM   374  N N     . LYS A 1 52  ? 44.878 41.650 39.767 1.00 31.99  ? 52  LYS A N     1 
ATOM   375  C CA    . LYS A 1 52  ? 45.847 41.533 38.684 1.00 36.41  ? 52  LYS A CA    1 
ATOM   376  C C     . LYS A 1 52  ? 45.653 40.323 37.785 1.00 39.17  ? 52  LYS A C     1 
ATOM   377  O O     . LYS A 1 52  ? 44.952 39.372 38.126 1.00 38.80  ? 52  LYS A O     1 
ATOM   378  C CB    . LYS A 1 52  ? 47.266 41.483 39.248 1.00 37.71  ? 52  LYS A CB    1 
ATOM   379  C CG    . LYS A 1 52  ? 47.715 42.745 39.944 1.00 41.27  ? 52  LYS A CG    1 
ATOM   380  C CD    . LYS A 1 52  ? 49.145 42.606 40.443 1.00 43.94  ? 52  LYS A CD    1 
ATOM   381  C CE    . LYS A 1 52  ? 49.564 43.832 41.238 1.00 46.89  ? 52  LYS A CE    1 
ATOM   382  N NZ    . LYS A 1 52  ? 50.935 43.694 41.794 1.00 49.86  ? 52  LYS A NZ    1 
ATOM   383  N N     . ASP A 1 53  ? 46.314 40.380 36.635 1.00 42.31  ? 53  ASP A N     1 
ATOM   384  C CA    . ASP A 1 53  ? 46.280 39.323 35.634 1.00 45.77  ? 53  ASP A CA    1 
ATOM   385  C C     . ASP A 1 53  ? 47.652 38.638 35.678 1.00 47.62  ? 53  ASP A C     1 
ATOM   386  O O     . ASP A 1 53  ? 48.564 39.124 36.348 1.00 47.01  ? 53  ASP A O     1 
ATOM   387  C CB    . ASP A 1 53  ? 46.006 39.959 34.269 1.00 48.54  ? 53  ASP A CB    1 
ATOM   388  C CG    . ASP A 1 53  ? 46.079 38.975 33.126 1.00 51.67  ? 53  ASP A CG    1 
ATOM   389  O OD1   . ASP A 1 53  ? 46.177 39.445 31.970 1.00 51.61  ? 53  ASP A OD1   1 
ATOM   390  O OD2   . ASP A 1 53  ? 46.029 37.749 33.368 1.00 54.52  ? 53  ASP A OD2   1 
ATOM   391  N N     . GLU A 1 54  ? 47.798 37.517 34.978 1.00 50.10  ? 54  GLU A N     1 
ATOM   392  C CA    . GLU A 1 54  ? 49.054 36.769 34.968 1.00 51.68  ? 54  GLU A CA    1 
ATOM   393  C C     . GLU A 1 54  ? 50.283 37.575 34.569 1.00 51.67  ? 54  GLU A C     1 
ATOM   394  O O     . GLU A 1 54  ? 51.376 37.330 35.079 1.00 53.42  ? 54  GLU A O     1 
ATOM   395  C CB    . GLU A 1 54  ? 48.942 35.552 34.047 1.00 53.33  ? 54  GLU A CB    1 
ATOM   396  C CG    . GLU A 1 54  ? 48.636 35.897 32.599 1.00 57.43  ? 54  GLU A CG    1 
ATOM   397  C CD    . GLU A 1 54  ? 48.791 34.704 31.671 1.00 59.62  ? 54  GLU A CD    1 
ATOM   398  O OE1   . GLU A 1 54  ? 48.179 33.650 31.950 1.00 60.95  ? 54  GLU A OE1   1 
ATOM   399  O OE2   . GLU A 1 54  ? 49.523 34.823 30.663 1.00 59.79  ? 54  GLU A OE2   1 
ATOM   400  N N     . GLU A 1 55  ? 50.120 38.528 33.658 1.00 50.94  ? 55  GLU A N     1 
ATOM   401  C CA    . GLU A 1 55  ? 51.255 39.329 33.220 1.00 51.11  ? 55  GLU A CA    1 
ATOM   402  C C     . GLU A 1 55  ? 51.393 40.684 33.912 1.00 48.89  ? 55  GLU A C     1 
ATOM   403  O O     . GLU A 1 55  ? 52.073 41.578 33.411 1.00 49.67  ? 55  GLU A O     1 
ATOM   404  C CB    . GLU A 1 55  ? 51.230 39.505 31.693 1.00 53.83  ? 55  GLU A CB    1 
ATOM   405  C CG    . GLU A 1 55  ? 49.878 39.846 31.096 1.00 56.90  ? 55  GLU A CG    1 
ATOM   406  C CD    . GLU A 1 55  ? 49.925 39.969 29.580 1.00 59.66  ? 55  GLU A CD    1 
ATOM   407  O OE1   . GLU A 1 55  ? 50.532 40.939 29.073 1.00 60.28  ? 55  GLU A OE1   1 
ATOM   408  O OE2   . GLU A 1 55  ? 49.359 39.090 28.895 1.00 60.76  ? 55  GLU A OE2   1 
ATOM   409  N N     . GLY A 1 56  ? 50.744 40.834 35.063 1.00 47.39  ? 56  GLY A N     1 
ATOM   410  C CA    . GLY A 1 56  ? 50.857 42.072 35.814 1.00 44.25  ? 56  GLY A CA    1 
ATOM   411  C C     . GLY A 1 56  ? 49.922 43.224 35.497 1.00 42.52  ? 56  GLY A C     1 
ATOM   412  O O     . GLY A 1 56  ? 50.077 44.310 36.056 1.00 41.29  ? 56  GLY A O     1 
ATOM   413  N N     . LYS A 1 57  ? 48.966 43.019 34.601 1.00 40.86  ? 57  LYS A N     1 
ATOM   414  C CA    . LYS A 1 57  ? 48.026 44.086 34.286 1.00 40.37  ? 57  LYS A CA    1 
ATOM   415  C C     . LYS A 1 57  ? 47.144 44.288 35.517 1.00 38.25  ? 57  LYS A C     1 
ATOM   416  O O     . LYS A 1 57  ? 46.728 43.320 36.153 1.00 36.34  ? 57  LYS A O     1 
ATOM   417  C CB    . LYS A 1 57  ? 47.168 43.716 33.071 1.00 42.31  ? 57  LYS A CB    1 
ATOM   418  C CG    . LYS A 1 57  ? 47.950 43.679 31.762 1.00 45.98  ? 57  LYS A CG    1 
ATOM   419  C CD    . LYS A 1 57  ? 47.028 43.608 30.547 1.00 49.05  ? 57  LYS A CD    1 
ATOM   420  C CE    . LYS A 1 57  ? 46.329 42.261 30.427 1.00 50.65  ? 57  LYS A CE    1 
ATOM   421  N NZ    . LYS A 1 57  ? 47.283 41.161 30.104 1.00 51.56  ? 57  LYS A NZ    1 
ATOM   422  N N     . GLU A 1 58  ? 46.873 45.545 35.850 1.00 37.05  ? 58  GLU A N     1 
ATOM   423  C CA    . GLU A 1 58  ? 46.058 45.870 37.014 1.00 36.30  ? 58  GLU A CA    1 
ATOM   424  C C     . GLU A 1 58  ? 44.687 46.420 36.649 1.00 35.58  ? 58  GLU A C     1 
ATOM   425  O O     . GLU A 1 58  ? 44.538 47.185 35.696 1.00 34.21  ? 58  GLU A O     1 
ATOM   426  C CB    . GLU A 1 58  ? 46.793 46.881 37.895 1.00 39.00  ? 58  GLU A CB    1 
ATOM   427  C CG    . GLU A 1 58  ? 48.135 46.385 38.415 1.00 42.58  ? 58  GLU A CG    1 
ATOM   428  C CD    . GLU A 1 58  ? 48.979 47.497 39.014 1.00 45.74  ? 58  GLU A CD    1 
ATOM   429  O OE1   . GLU A 1 58  ? 48.589 48.055 40.059 1.00 48.11  ? 58  GLU A OE1   1 
ATOM   430  O OE2   . GLU A 1 58  ? 50.035 47.818 38.430 1.00 50.47  ? 58  GLU A OE2   1 
ATOM   431  N N     . MET A 1 59  ? 43.687 46.016 37.421 1.00 33.29  ? 59  MET A N     1 
ATOM   432  C CA    . MET A 1 59  ? 42.316 46.460 37.225 1.00 34.46  ? 59  MET A CA    1 
ATOM   433  C C     . MET A 1 59  ? 41.829 46.995 38.569 1.00 34.47  ? 59  MET A C     1 
ATOM   434  O O     . MET A 1 59  ? 41.982 46.335 39.598 1.00 33.02  ? 59  MET A O     1 
ATOM   435  C CB    . MET A 1 59  ? 41.450 45.278 36.764 1.00 37.09  ? 59  MET A CB    1 
ATOM   436  C CG    . MET A 1 59  ? 39.937 45.482 36.833 1.00 41.70  ? 59  MET A CG    1 
ATOM   437  S SD    . MET A 1 59  ? 39.267 46.762 35.750 1.00 48.92  ? 59  MET A SD    1 
ATOM   438  C CE    . MET A 1 59  ? 40.304 46.596 34.316 1.00 43.77  ? 59  MET A CE    1 
ATOM   439  N N     . ILE A 1 60  ? 41.271 48.201 38.563 1.00 32.63  ? 60  ILE A N     1 
ATOM   440  C CA    . ILE A 1 60  ? 40.759 48.802 39.787 1.00 33.25  ? 60  ILE A CA    1 
ATOM   441  C C     . ILE A 1 60  ? 39.304 48.400 39.981 1.00 32.41  ? 60  ILE A C     1 
ATOM   442  O O     . ILE A 1 60  ? 38.456 48.702 39.137 1.00 32.63  ? 60  ILE A O     1 
ATOM   443  C CB    . ILE A 1 60  ? 40.856 50.344 39.739 1.00 33.22  ? 60  ILE A CB    1 
ATOM   444  C CG1   . ILE A 1 60  ? 42.329 50.765 39.739 1.00 35.20  ? 60  ILE A CG1   1 
ATOM   445  C CG2   . ILE A 1 60  ? 40.110 50.959 40.930 1.00 34.57  ? 60  ILE A CG2   1 
ATOM   446  C CD1   . ILE A 1 60  ? 42.548 52.247 39.536 1.00 37.71  ? 60  ILE A CD1   1 
ATOM   447  N N     . LEU A 1 61  ? 39.017 47.711 41.084 1.00 29.75  ? 61  LEU A N     1 
ATOM   448  C CA    . LEU A 1 61  ? 37.653 47.281 41.380 1.00 29.07  ? 61  LEU A CA    1 
ATOM   449  C C     . LEU A 1 61  ? 36.846 48.402 41.996 1.00 29.40  ? 61  LEU A C     1 
ATOM   450  O O     . LEU A 1 61  ? 35.630 48.479 41.803 1.00 29.36  ? 61  LEU A O     1 
ATOM   451  C CB    . LEU A 1 61  ? 37.647 46.098 42.356 1.00 30.05  ? 61  LEU A CB    1 
ATOM   452  C CG    . LEU A 1 61  ? 38.081 44.730 41.829 1.00 32.66  ? 61  LEU A CG    1 
ATOM   453  C CD1   . LEU A 1 61  ? 38.188 43.736 42.982 1.00 29.91  ? 61  LEU A CD1   1 
ATOM   454  C CD2   . LEU A 1 61  ? 37.068 44.254 40.796 1.00 31.33  ? 61  LEU A CD2   1 
ATOM   455  N N     . SER A 1 62  ? 37.519 49.274 42.744 1.00 26.91  ? 62  SER A N     1 
ATOM   456  C CA    . SER A 1 62  ? 36.818 50.361 43.402 1.00 27.18  ? 62  SER A CA    1 
ATOM   457  C C     . SER A 1 62  ? 37.750 51.274 44.186 1.00 27.16  ? 62  SER A C     1 
ATOM   458  O O     . SER A 1 62  ? 38.903 50.934 44.457 1.00 25.73  ? 62  SER A O     1 
ATOM   459  C CB    . SER A 1 62  ? 35.779 49.766 44.367 1.00 29.54  ? 62  SER A CB    1 
ATOM   460  O OG    . SER A 1 62  ? 35.106 50.761 45.110 1.00 31.71  ? 62  SER A OG    1 
ATOM   461  N N     . TYR A 1 63  ? 37.242 52.452 44.526 1.00 27.12  ? 63  TYR A N     1 
ATOM   462  C CA    . TYR A 1 63  ? 37.978 53.385 45.362 1.00 29.00  ? 63  TYR A CA    1 
ATOM   463  C C     . TYR A 1 63  ? 37.138 53.350 46.628 1.00 28.07  ? 63  TYR A C     1 
ATOM   464  O O     . TYR A 1 63  ? 35.929 53.143 46.545 1.00 29.67  ? 63  TYR A O     1 
ATOM   465  C CB    . TYR A 1 63  ? 37.970 54.807 44.786 1.00 31.03  ? 63  TYR A CB    1 
ATOM   466  C CG    . TYR A 1 63  ? 38.854 55.006 43.570 1.00 34.62  ? 63  TYR A CG    1 
ATOM   467  C CD1   . TYR A 1 63  ? 40.194 54.616 43.581 1.00 35.70  ? 63  TYR A CD1   1 
ATOM   468  C CD2   . TYR A 1 63  ? 38.359 55.622 42.423 1.00 37.79  ? 63  TYR A CD2   1 
ATOM   469  C CE1   . TYR A 1 63  ? 41.020 54.840 42.476 1.00 38.78  ? 63  TYR A CE1   1 
ATOM   470  C CE2   . TYR A 1 63  ? 39.174 55.851 41.315 1.00 39.44  ? 63  TYR A CE2   1 
ATOM   471  C CZ    . TYR A 1 63  ? 40.501 55.458 41.348 1.00 39.32  ? 63  TYR A CZ    1 
ATOM   472  O OH    . TYR A 1 63  ? 41.301 55.688 40.250 1.00 41.14  ? 63  TYR A OH    1 
ATOM   473  N N     . LEU A 1 64  ? 37.762 53.499 47.791 1.00 26.47  ? 64  LEU A N     1 
ATOM   474  C CA    . LEU A 1 64  ? 37.016 53.516 49.046 1.00 26.04  ? 64  LEU A CA    1 
ATOM   475  C C     . LEU A 1 64  ? 37.506 54.730 49.815 1.00 26.03  ? 64  LEU A C     1 
ATOM   476  O O     . LEU A 1 64  ? 38.648 55.153 49.645 1.00 26.51  ? 64  LEU A O     1 
ATOM   477  C CB    . LEU A 1 64  ? 37.237 52.226 49.840 1.00 25.21  ? 64  LEU A CB    1 
ATOM   478  C CG    . LEU A 1 64  ? 36.676 50.972 49.151 1.00 25.20  ? 64  LEU A CG    1 
ATOM   479  C CD1   . LEU A 1 64  ? 37.050 49.732 49.954 1.00 25.55  ? 64  LEU A CD1   1 
ATOM   480  C CD2   . LEU A 1 64  ? 35.155 51.090 49.012 1.00 23.56  ? 64  LEU A CD2   1 
ATOM   481  N N     . ASN A 1 65  ? 36.651 55.285 50.663 1.00 28.00  ? 65  ASN A N     1 
ATOM   482  C CA    . ASN A 1 65  ? 37.004 56.499 51.385 1.00 28.84  ? 65  ASN A CA    1 
ATOM   483  C C     . ASN A 1 65  ? 36.749 56.474 52.885 1.00 29.03  ? 65  ASN A C     1 
ATOM   484  O O     . ASN A 1 65  ? 36.455 55.431 53.465 1.00 25.64  ? 65  ASN A O     1 
ATOM   485  C CB    . ASN A 1 65  ? 36.241 57.666 50.751 1.00 30.95  ? 65  ASN A CB    1 
ATOM   486  C CG    . ASN A 1 65  ? 36.479 57.767 49.252 1.00 33.85  ? 65  ASN A CG    1 
ATOM   487  O OD1   . ASN A 1 65  ? 37.540 58.208 48.808 1.00 35.70  ? 65  ASN A OD1   1 
ATOM   488  N ND2   . ASN A 1 65  ? 35.494 57.345 48.465 1.00 36.22  ? 65  ASN A ND2   1 
ATOM   489  N N     . GLN A 1 66  ? 36.872 57.646 53.509 1.00 29.82  ? 66  GLN A N     1 
ATOM   490  C CA    . GLN A 1 66  ? 36.653 57.784 54.941 1.00 28.88  ? 66  GLN A CA    1 
ATOM   491  C C     . GLN A 1 66  ? 35.275 57.236 55.290 1.00 28.18  ? 66  GLN A C     1 
ATOM   492  O O     . GLN A 1 66  ? 34.294 57.540 54.612 1.00 28.28  ? 66  GLN A O     1 
ATOM   493  C CB    . GLN A 1 66  ? 36.750 59.259 55.351 1.00 31.62  ? 66  GLN A CB    1 
ATOM   494  C CG    . GLN A 1 66  ? 36.557 59.509 56.840 1.00 36.35  ? 66  GLN A CG    1 
ATOM   495  C CD    . GLN A 1 66  ? 36.833 60.955 57.225 1.00 41.49  ? 66  GLN A CD    1 
ATOM   496  O OE1   . GLN A 1 66  ? 37.888 61.508 56.897 1.00 42.53  ? 66  GLN A OE1   1 
ATOM   497  N NE2   . GLN A 1 66  ? 35.891 61.571 57.929 1.00 42.79  ? 66  GLN A NE2   1 
ATOM   498  N N     . GLY A 1 67  ? 35.206 56.426 56.340 1.00 26.55  ? 67  GLY A N     1 
ATOM   499  C CA    . GLY A 1 67  ? 33.938 55.843 56.736 1.00 26.92  ? 67  GLY A CA    1 
ATOM   500  C C     . GLY A 1 67  ? 33.731 54.445 56.171 1.00 28.03  ? 67  GLY A C     1 
ATOM   501  O O     . GLY A 1 67  ? 32.811 53.732 56.583 1.00 27.63  ? 67  GLY A O     1 
ATOM   502  N N     . ASP A 1 68  ? 34.576 54.042 55.224 1.00 26.08  ? 68  ASP A N     1 
ATOM   503  C CA    . ASP A 1 68  ? 34.452 52.709 54.637 1.00 26.01  ? 68  ASP A CA    1 
ATOM   504  C C     . ASP A 1 68  ? 35.225 51.621 55.371 1.00 26.24  ? 68  ASP A C     1 
ATOM   505  O O     . ASP A 1 68  ? 36.354 51.832 55.824 1.00 25.10  ? 68  ASP A O     1 
ATOM   506  C CB    . ASP A 1 68  ? 34.913 52.704 53.170 1.00 26.40  ? 68  ASP A CB    1 
ATOM   507  C CG    . ASP A 1 68  ? 33.941 53.405 52.248 1.00 29.57  ? 68  ASP A CG    1 
ATOM   508  O OD1   . ASP A 1 68  ? 32.720 53.342 52.513 1.00 30.62  ? 68  ASP A OD1   1 
ATOM   509  O OD2   . ASP A 1 68  ? 34.394 54.005 51.254 1.00 28.25  ? 68  ASP A OD2   1 
ATOM   510  N N     . PHE A 1 69  ? 34.598 50.456 55.493 1.00 22.95  ? 69  PHE A N     1 
ATOM   511  C CA    . PHE A 1 69  ? 35.234 49.297 56.100 1.00 22.61  ? 69  PHE A CA    1 
ATOM   512  C C     . PHE A 1 69  ? 36.058 48.662 54.969 1.00 22.51  ? 69  PHE A C     1 
ATOM   513  O O     . PHE A 1 69  ? 35.712 48.821 53.788 1.00 20.61  ? 69  PHE A O     1 
ATOM   514  C CB    . PHE A 1 69  ? 34.182 48.279 56.553 1.00 24.37  ? 69  PHE A CB    1 
ATOM   515  C CG    . PHE A 1 69  ? 33.525 48.606 57.867 1.00 22.25  ? 69  PHE A CG    1 
ATOM   516  C CD1   . PHE A 1 69  ? 34.123 48.234 59.070 1.00 23.93  ? 69  PHE A CD1   1 
ATOM   517  C CD2   . PHE A 1 69  ? 32.299 49.262 57.899 1.00 24.77  ? 69  PHE A CD2   1 
ATOM   518  C CE1   . PHE A 1 69  ? 33.507 48.509 60.293 1.00 25.03  ? 69  PHE A CE1   1 
ATOM   519  C CE2   . PHE A 1 69  ? 31.671 49.543 59.112 1.00 24.70  ? 69  PHE A CE2   1 
ATOM   520  C CZ    . PHE A 1 69  ? 32.278 49.165 60.312 1.00 25.56  ? 69  PHE A CZ    1 
ATOM   521  N N     . ILE A 1 70  ? 37.144 47.975 55.323 1.00 21.86  ? 70  ILE A N     1 
ATOM   522  C CA    . ILE A 1 70  ? 37.969 47.277 54.329 1.00 23.47  ? 70  ILE A CA    1 
ATOM   523  C C     . ILE A 1 70  ? 38.390 45.947 54.945 1.00 23.29  ? 70  ILE A C     1 
ATOM   524  O O     . ILE A 1 70  ? 38.455 45.820 56.169 1.00 24.82  ? 70  ILE A O     1 
ATOM   525  C CB    . ILE A 1 70  ? 39.282 48.027 53.961 1.00 25.50  ? 70  ILE A CB    1 
ATOM   526  C CG1   . ILE A 1 70  ? 39.173 49.521 54.256 1.00 27.26  ? 70  ILE A CG1   1 
ATOM   527  C CG2   . ILE A 1 70  ? 39.578 47.827 52.482 1.00 25.74  ? 70  ILE A CG2   1 
ATOM   528  C CD1   . ILE A 1 70  ? 40.465 50.271 53.958 1.00 31.19  ? 70  ILE A CD1   1 
ATOM   529  N N     . GLY A 1 71  ? 38.697 44.966 54.099 1.00 20.85  ? 71  GLY A N     1 
ATOM   530  C CA    . GLY A 1 71  ? 39.121 43.664 54.590 1.00 20.78  ? 71  GLY A CA    1 
ATOM   531  C C     . GLY A 1 71  ? 38.023 42.914 55.319 1.00 20.87  ? 71  GLY A C     1 
ATOM   532  O O     . GLY A 1 71  ? 38.289 42.162 56.259 1.00 21.57  ? 71  GLY A O     1 
ATOM   533  N N     . GLU A 1 72  ? 36.784 43.097 54.875 1.00 20.36  ? 72  GLU A N     1 
ATOM   534  C CA    . GLU A 1 72  ? 35.644 42.446 55.513 1.00 21.32  ? 72  GLU A CA    1 
ATOM   535  C C     . GLU A 1 72  ? 35.221 41.111 54.899 1.00 21.69  ? 72  GLU A C     1 
ATOM   536  O O     . GLU A 1 72  ? 34.500 40.335 55.530 1.00 20.53  ? 72  GLU A O     1 
ATOM   537  C CB    . GLU A 1 72  ? 34.433 43.390 55.492 1.00 22.60  ? 72  GLU A CB    1 
ATOM   538  C CG    . GLU A 1 72  ? 33.679 43.476 54.152 1.00 22.85  ? 72  GLU A CG    1 
ATOM   539  C CD    . GLU A 1 72  ? 34.427 44.232 53.056 1.00 23.57  ? 72  GLU A CD    1 
ATOM   540  O OE1   . GLU A 1 72  ? 35.497 44.816 53.341 1.00 21.22  ? 72  GLU A OE1   1 
ATOM   541  O OE2   . GLU A 1 72  ? 33.934 44.252 51.901 1.00 23.93  ? 72  GLU A OE2   1 
ATOM   542  N N     . LEU A 1 73  ? 35.669 40.834 53.679 1.00 22.08  ? 73  LEU A N     1 
ATOM   543  C CA    . LEU A 1 73  ? 35.234 39.626 52.994 1.00 22.09  ? 73  LEU A CA    1 
ATOM   544  C C     . LEU A 1 73  ? 35.596 38.262 53.590 1.00 23.42  ? 73  LEU A C     1 
ATOM   545  O O     . LEU A 1 73  ? 34.980 37.258 53.232 1.00 24.65  ? 73  LEU A O     1 
ATOM   546  C CB    . LEU A 1 73  ? 35.635 39.705 51.515 1.00 21.34  ? 73  LEU A CB    1 
ATOM   547  C CG    . LEU A 1 73  ? 35.003 40.897 50.771 1.00 21.87  ? 73  LEU A CG    1 
ATOM   548  C CD1   . LEU A 1 73  ? 35.417 40.859 49.298 1.00 21.12  ? 73  LEU A CD1   1 
ATOM   549  C CD2   . LEU A 1 73  ? 33.464 40.848 50.875 1.00 21.52  ? 73  LEU A CD2   1 
ATOM   550  N N     . GLY A 1 74  ? 36.561 38.211 54.501 1.00 22.92  ? 74  GLY A N     1 
ATOM   551  C CA    . GLY A 1 74  ? 36.903 36.931 55.098 1.00 23.29  ? 74  GLY A CA    1 
ATOM   552  C C     . GLY A 1 74  ? 36.364 36.772 56.515 1.00 24.64  ? 74  GLY A C     1 
ATOM   553  O O     . GLY A 1 74  ? 36.677 35.801 57.201 1.00 26.26  ? 74  GLY A O     1 
ATOM   554  N N     . LEU A 1 75  ? 35.532 37.709 56.954 1.00 24.57  ? 75  LEU A N     1 
ATOM   555  C CA    . LEU A 1 75  ? 35.001 37.680 58.324 1.00 27.68  ? 75  LEU A CA    1 
ATOM   556  C C     . LEU A 1 75  ? 34.035 36.553 58.701 1.00 28.91  ? 75  LEU A C     1 
ATOM   557  O O     . LEU A 1 75  ? 34.019 36.096 59.849 1.00 29.20  ? 75  LEU A O     1 
ATOM   558  C CB    . LEU A 1 75  ? 34.324 39.019 58.635 1.00 26.91  ? 75  LEU A CB    1 
ATOM   559  C CG    . LEU A 1 75  ? 33.554 39.166 59.955 1.00 29.06  ? 75  LEU A CG    1 
ATOM   560  C CD1   . LEU A 1 75  ? 34.529 39.187 61.129 1.00 27.07  ? 75  LEU A CD1   1 
ATOM   561  C CD2   . LEU A 1 75  ? 32.741 40.452 59.928 1.00 29.41  ? 75  LEU A CD2   1 
ATOM   562  N N     . PHE A 1 76  ? 33.247 36.095 57.738 1.00 27.58  ? 76  PHE A N     1 
ATOM   563  C CA    . PHE A 1 76  ? 32.226 35.087 58.008 1.00 31.54  ? 76  PHE A CA    1 
ATOM   564  C C     . PHE A 1 76  ? 32.635 33.625 57.904 1.00 33.91  ? 76  PHE A C     1 
ATOM   565  O O     . PHE A 1 76  ? 31.821 32.727 58.129 1.00 36.18  ? 76  PHE A O     1 
ATOM   566  C CB    . PHE A 1 76  ? 31.027 35.383 57.106 1.00 28.02  ? 76  PHE A CB    1 
ATOM   567  C CG    . PHE A 1 76  ? 30.577 36.814 57.183 1.00 28.04  ? 76  PHE A CG    1 
ATOM   568  C CD1   . PHE A 1 76  ? 29.726 37.238 58.202 1.00 28.57  ? 76  PHE A CD1   1 
ATOM   569  C CD2   . PHE A 1 76  ? 31.082 37.761 56.295 1.00 28.45  ? 76  PHE A CD2   1 
ATOM   570  C CE1   . PHE A 1 76  ? 29.392 38.582 58.336 1.00 29.11  ? 76  PHE A CE1   1 
ATOM   571  C CE2   . PHE A 1 76  ? 30.755 39.110 56.420 1.00 26.64  ? 76  PHE A CE2   1 
ATOM   572  C CZ    . PHE A 1 76  ? 29.909 39.523 57.442 1.00 29.89  ? 76  PHE A CZ    1 
ATOM   573  N N     . GLU A 1 77  ? 33.897 33.386 57.574 1.00 36.42  ? 77  GLU A N     1 
ATOM   574  C CA    . GLU A 1 77  ? 34.406 32.026 57.457 1.00 39.45  ? 77  GLU A CA    1 
ATOM   575  C C     . GLU A 1 77  ? 35.919 32.061 57.625 1.00 39.28  ? 77  GLU A C     1 
ATOM   576  O O     . GLU A 1 77  ? 36.614 32.743 56.878 1.00 38.43  ? 77  GLU A O     1 
ATOM   577  C CB    . GLU A 1 77  ? 34.044 31.444 56.090 1.00 41.40  ? 77  GLU A CB    1 
ATOM   578  C CG    . GLU A 1 77  ? 34.348 29.964 55.942 1.00 47.60  ? 77  GLU A CG    1 
ATOM   579  C CD    . GLU A 1 77  ? 34.002 29.441 54.562 1.00 49.80  ? 77  GLU A CD    1 
ATOM   580  O OE1   . GLU A 1 77  ? 32.843 29.618 54.135 1.00 51.08  ? 77  GLU A OE1   1 
ATOM   581  O OE2   . GLU A 1 77  ? 34.886 28.853 53.905 1.00 54.23  ? 77  GLU A OE2   1 
ATOM   582  N N     . GLU A 1 78  ? 36.425 31.334 58.617 1.00 40.74  ? 78  GLU A N     1 
ATOM   583  C CA    . GLU A 1 78  ? 37.864 31.292 58.873 1.00 42.40  ? 78  GLU A CA    1 
ATOM   584  C C     . GLU A 1 78  ? 38.641 30.626 57.744 1.00 40.17  ? 78  GLU A C     1 
ATOM   585  O O     . GLU A 1 78  ? 38.078 29.887 56.937 1.00 40.38  ? 78  GLU A O     1 
ATOM   586  C CB    . GLU A 1 78  ? 38.160 30.531 60.170 1.00 45.50  ? 78  GLU A CB    1 
ATOM   587  C CG    . GLU A 1 78  ? 37.667 31.199 61.434 1.00 50.61  ? 78  GLU A CG    1 
ATOM   588  C CD    . GLU A 1 78  ? 38.053 30.420 62.682 1.00 53.75  ? 78  GLU A CD    1 
ATOM   589  O OE1   . GLU A 1 78  ? 39.267 30.291 62.957 1.00 55.36  ? 78  GLU A OE1   1 
ATOM   590  O OE2   . GLU A 1 78  ? 37.144 29.933 63.385 1.00 56.42  ? 78  GLU A OE2   1 
ATOM   591  N N     . GLY A 1 79  ? 39.942 30.900 57.701 1.00 39.40  ? 79  GLY A N     1 
ATOM   592  C CA    . GLY A 1 79  ? 40.804 30.295 56.702 1.00 37.59  ? 79  GLY A CA    1 
ATOM   593  C C     . GLY A 1 79  ? 40.711 30.825 55.285 1.00 36.40  ? 79  GLY A C     1 
ATOM   594  O O     . GLY A 1 79  ? 41.019 30.101 54.334 1.00 37.45  ? 79  GLY A O     1 
ATOM   595  N N     . GLN A 1 80  ? 40.297 32.078 55.129 1.00 32.56  ? 80  GLN A N     1 
ATOM   596  C CA    . GLN A 1 80  ? 40.193 32.665 53.800 1.00 30.05  ? 80  GLN A CA    1 
ATOM   597  C C     . GLN A 1 80  ? 41.341 33.620 53.518 1.00 27.72  ? 80  GLN A C     1 
ATOM   598  O O     . GLN A 1 80  ? 41.984 34.129 54.435 1.00 28.91  ? 80  GLN A O     1 
ATOM   599  C CB    . GLN A 1 80  ? 38.868 33.409 53.645 1.00 28.83  ? 80  GLN A CB    1 
ATOM   600  C CG    . GLN A 1 80  ? 37.653 32.510 53.684 1.00 29.80  ? 80  GLN A CG    1 
ATOM   601  C CD    . GLN A 1 80  ? 36.377 33.282 53.454 1.00 31.44  ? 80  GLN A CD    1 
ATOM   602  O OE1   . GLN A 1 80  ? 35.768 33.800 54.393 1.00 34.05  ? 80  GLN A OE1   1 
ATOM   603  N NE2   . GLN A 1 80  ? 35.977 33.387 52.195 1.00 29.98  ? 80  GLN A NE2   1 
ATOM   604  N N     . GLU A 1 81  ? 41.588 33.863 52.239 1.00 26.75  ? 81  GLU A N     1 
ATOM   605  C CA    . GLU A 1 81  ? 42.658 34.764 51.823 1.00 26.06  ? 81  GLU A CA    1 
ATOM   606  C C     . GLU A 1 81  ? 42.068 36.077 51.350 1.00 24.91  ? 81  GLU A C     1 
ATOM   607  O O     . GLU A 1 81  ? 40.923 36.118 50.894 1.00 23.33  ? 81  GLU A O     1 
ATOM   608  C CB    . GLU A 1 81  ? 43.442 34.172 50.651 1.00 28.60  ? 81  GLU A CB    1 
ATOM   609  C CG    . GLU A 1 81  ? 44.130 32.845 50.909 1.00 35.47  ? 81  GLU A CG    1 
ATOM   610  C CD    . GLU A 1 81  ? 44.806 32.312 49.655 1.00 39.18  ? 81  GLU A CD    1 
ATOM   611  O OE1   . GLU A 1 81  ? 45.450 31.244 49.723 1.00 44.01  ? 81  GLU A OE1   1 
ATOM   612  O OE2   . GLU A 1 81  ? 44.693 32.968 48.596 1.00 41.26  ? 81  GLU A OE2   1 
ATOM   613  N N     . ARG A 1 82  ? 42.858 37.141 51.453 1.00 22.39  ? 82  ARG A N     1 
ATOM   614  C CA    . ARG A 1 82  ? 42.446 38.458 50.977 1.00 22.75  ? 82  ARG A CA    1 
ATOM   615  C C     . ARG A 1 82  ? 42.176 38.318 49.481 1.00 22.66  ? 82  ARG A C     1 
ATOM   616  O O     . ARG A 1 82  ? 42.984 37.735 48.746 1.00 25.12  ? 82  ARG A O     1 
ATOM   617  C CB    . ARG A 1 82  ? 43.563 39.478 51.204 1.00 21.80  ? 82  ARG A CB    1 
ATOM   618  C CG    . ARG A 1 82  ? 43.942 39.685 52.664 1.00 22.42  ? 82  ARG A CG    1 
ATOM   619  C CD    . ARG A 1 82  ? 42.761 40.181 53.494 1.00 23.63  ? 82  ARG A CD    1 
ATOM   620  N NE    . ARG A 1 82  ? 43.193 40.635 54.817 1.00 22.37  ? 82  ARG A NE    1 
ATOM   621  C CZ    . ARG A 1 82  ? 42.371 41.066 55.767 1.00 23.06  ? 82  ARG A CZ    1 
ATOM   622  N NH1   . ARG A 1 82  ? 41.060 41.100 55.548 1.00 21.01  ? 82  ARG A NH1   1 
ATOM   623  N NH2   . ARG A 1 82  ? 42.862 41.476 56.930 1.00 22.28  ? 82  ARG A NH2   1 
ATOM   624  N N     . SER A 1 83  ? 41.056 38.880 49.029 1.00 21.38  ? 83  SER A N     1 
ATOM   625  C CA    . SER A 1 83  ? 40.632 38.784 47.628 1.00 21.77  ? 83  SER A CA    1 
ATOM   626  C C     . SER A 1 83  ? 41.236 39.789 46.654 1.00 22.18  ? 83  SER A C     1 
ATOM   627  O O     . SER A 1 83  ? 41.035 39.666 45.443 1.00 23.26  ? 83  SER A O     1 
ATOM   628  C CB    . SER A 1 83  ? 39.109 38.906 47.549 1.00 23.43  ? 83  SER A CB    1 
ATOM   629  O OG    . SER A 1 83  ? 38.698 40.206 47.946 1.00 21.57  ? 83  SER A OG    1 
ATOM   630  N N     . ALA A 1 84  ? 41.954 40.782 47.167 1.00 20.21  ? 84  ALA A N     1 
ATOM   631  C CA    . ALA A 1 84  ? 42.560 41.801 46.312 1.00 21.69  ? 84  ALA A CA    1 
ATOM   632  C C     . ALA A 1 84  ? 43.578 42.612 47.106 1.00 21.81  ? 84  ALA A C     1 
ATOM   633  O O     . ALA A 1 84  ? 43.705 42.448 48.322 1.00 21.51  ? 84  ALA A O     1 
ATOM   634  C CB    . ALA A 1 84  ? 41.470 42.742 45.771 1.00 21.95  ? 84  ALA A CB    1 
ATOM   635  N N     . TRP A 1 85  ? 44.301 43.484 46.409 1.00 21.32  ? 85  TRP A N     1 
ATOM   636  C CA    . TRP A 1 85  ? 45.278 44.355 47.057 1.00 22.73  ? 85  TRP A CA    1 
ATOM   637  C C     . TRP A 1 85  ? 44.557 45.667 47.361 1.00 22.58  ? 85  TRP A C     1 
ATOM   638  O O     . TRP A 1 85  ? 43.654 46.070 46.630 1.00 24.01  ? 85  TRP A O     1 
ATOM   639  C CB    . TRP A 1 85  ? 46.460 44.654 46.122 1.00 23.46  ? 85  TRP A CB    1 
ATOM   640  C CG    . TRP A 1 85  ? 47.412 43.515 45.902 1.00 25.39  ? 85  TRP A CG    1 
ATOM   641  C CD1   . TRP A 1 85  ? 48.575 43.265 46.585 1.00 27.55  ? 85  TRP A CD1   1 
ATOM   642  C CD2   . TRP A 1 85  ? 47.308 42.497 44.900 1.00 27.81  ? 85  TRP A CD2   1 
ATOM   643  N NE1   . TRP A 1 85  ? 49.201 42.154 46.061 1.00 27.63  ? 85  TRP A NE1   1 
ATOM   644  C CE2   . TRP A 1 85  ? 48.443 41.665 45.028 1.00 26.06  ? 85  TRP A CE2   1 
ATOM   645  C CE3   . TRP A 1 85  ? 46.363 42.207 43.904 1.00 25.89  ? 85  TRP A CE3   1 
ATOM   646  C CZ2   . TRP A 1 85  ? 48.659 40.562 44.196 1.00 27.91  ? 85  TRP A CZ2   1 
ATOM   647  C CZ3   . TRP A 1 85  ? 46.579 41.112 43.078 1.00 28.29  ? 85  TRP A CZ3   1 
ATOM   648  C CH2   . TRP A 1 85  ? 47.718 40.303 43.229 1.00 28.04  ? 85  TRP A CH2   1 
ATOM   649  N N     . VAL A 1 86  ? 44.930 46.318 48.453 1.00 22.65  ? 86  VAL A N     1 
ATOM   650  C CA    . VAL A 1 86  ? 44.327 47.601 48.799 1.00 21.75  ? 86  VAL A CA    1 
ATOM   651  C C     . VAL A 1 86  ? 45.493 48.537 49.063 1.00 22.53  ? 86  VAL A C     1 
ATOM   652  O O     . VAL A 1 86  ? 46.315 48.296 49.954 1.00 22.09  ? 86  VAL A O     1 
ATOM   653  C CB    . VAL A 1 86  ? 43.430 47.516 50.047 1.00 21.93  ? 86  VAL A CB    1 
ATOM   654  C CG1   . VAL A 1 86  ? 42.784 48.878 50.312 1.00 20.63  ? 86  VAL A CG1   1 
ATOM   655  C CG2   . VAL A 1 86  ? 42.345 46.463 49.835 1.00 22.46  ? 86  VAL A CG2   1 
ATOM   656  N N     . ARG A 1 87  ? 45.548 49.608 48.283 1.00 24.53  ? 87  ARG A N     1 
ATOM   657  C CA    . ARG A 1 87  ? 46.637 50.568 48.362 1.00 24.15  ? 87  ARG A CA    1 
ATOM   658  C C     . ARG A 1 87  ? 46.149 51.979 48.641 1.00 23.93  ? 87  ARG A C     1 
ATOM   659  O O     . ARG A 1 87  ? 45.141 52.414 48.095 1.00 23.83  ? 87  ARG A O     1 
ATOM   660  C CB    . ARG A 1 87  ? 47.397 50.537 47.036 1.00 26.57  ? 87  ARG A CB    1 
ATOM   661  C CG    . ARG A 1 87  ? 48.626 51.421 46.956 1.00 32.24  ? 87  ARG A CG    1 
ATOM   662  C CD    . ARG A 1 87  ? 49.098 51.478 45.510 1.00 35.68  ? 87  ARG A CD    1 
ATOM   663  N NE    . ARG A 1 87  ? 49.342 50.140 44.976 1.00 41.74  ? 87  ARG A NE    1 
ATOM   664  C CZ    . ARG A 1 87  ? 49.232 49.812 43.692 1.00 43.55  ? 87  ARG A CZ    1 
ATOM   665  N NH1   . ARG A 1 87  ? 48.875 50.726 42.797 1.00 46.20  ? 87  ARG A NH1   1 
ATOM   666  N NH2   . ARG A 1 87  ? 49.478 48.569 43.301 1.00 44.51  ? 87  ARG A NH2   1 
ATOM   667  N N     . ALA A 1 88  ? 46.877 52.693 49.493 1.00 24.78  ? 88  ALA A N     1 
ATOM   668  C CA    . ALA A 1 88  ? 46.529 54.068 49.831 1.00 24.86  ? 88  ALA A CA    1 
ATOM   669  C C     . ALA A 1 88  ? 46.644 54.958 48.595 1.00 28.27  ? 88  ALA A C     1 
ATOM   670  O O     . ALA A 1 88  ? 47.632 54.889 47.861 1.00 27.36  ? 88  ALA A O     1 
ATOM   671  C CB    . ALA A 1 88  ? 47.457 54.587 50.944 1.00 22.91  ? 88  ALA A CB    1 
ATOM   672  N N     . LYS A 1 89  ? 45.627 55.785 48.370 1.00 29.82  ? 89  LYS A N     1 
ATOM   673  C CA    . LYS A 1 89  ? 45.606 56.705 47.238 1.00 35.02  ? 89  LYS A CA    1 
ATOM   674  C C     . LYS A 1 89  ? 46.123 58.050 47.736 1.00 35.49  ? 89  LYS A C     1 
ATOM   675  O O     . LYS A 1 89  ? 46.712 58.825 46.986 1.00 38.12  ? 89  LYS A O     1 
ATOM   676  C CB    . LYS A 1 89  ? 44.178 56.835 46.690 1.00 37.30  ? 89  LYS A CB    1 
ATOM   677  C CG    . LYS A 1 89  ? 44.069 57.661 45.415 1.00 41.51  ? 89  LYS A CG    1 
ATOM   678  C CD    . LYS A 1 89  ? 42.833 57.277 44.594 1.00 42.73  ? 89  LYS A CD    1 
ATOM   679  C CE    . LYS A 1 89  ? 41.535 57.470 45.365 1.00 44.76  ? 89  LYS A CE    1 
ATOM   680  N NZ    . LYS A 1 89  ? 41.250 58.905 45.665 1.00 45.90  ? 89  LYS A NZ    1 
ATOM   681  N N     . THR A 1 90  ? 45.888 58.310 49.016 1.00 35.68  ? 90  THR A N     1 
ATOM   682  C CA    . THR A 1 90  ? 46.349 59.523 49.682 1.00 34.58  ? 90  THR A CA    1 
ATOM   683  C C     . THR A 1 90  ? 46.856 59.015 51.021 1.00 35.14  ? 90  THR A C     1 
ATOM   684  O O     . THR A 1 90  ? 46.786 57.811 51.281 1.00 33.71  ? 90  THR A O     1 
ATOM   685  C CB    . THR A 1 90  ? 45.197 60.523 49.939 1.00 35.39  ? 90  THR A CB    1 
ATOM   686  O OG1   . THR A 1 90  ? 44.231 59.935 50.822 1.00 34.27  ? 90  THR A OG1   1 
ATOM   687  C CG2   . THR A 1 90  ? 44.524 60.913 48.629 1.00 34.44  ? 90  THR A CG2   1 
ATOM   688  N N     . ALA A 1 91  ? 47.371 59.905 51.865 1.00 33.59  ? 91  ALA A N     1 
ATOM   689  C CA    . ALA A 1 91  ? 47.839 59.483 53.180 1.00 32.82  ? 91  ALA A CA    1 
ATOM   690  C C     . ALA A 1 91  ? 46.600 58.970 53.909 1.00 32.42  ? 91  ALA A C     1 
ATOM   691  O O     . ALA A 1 91  ? 45.543 59.601 53.851 1.00 31.24  ? 91  ALA A O     1 
ATOM   692  C CB    . ALA A 1 91  ? 48.448 60.660 53.936 1.00 34.18  ? 91  ALA A CB    1 
ATOM   693  N N     . CYS A 1 92  ? 46.731 57.833 54.589 1.00 31.24  ? 92  CYS A N     1 
ATOM   694  C CA    . CYS A 1 92  ? 45.601 57.235 55.299 1.00 31.59  ? 92  CYS A CA    1 
ATOM   695  C C     . CYS A 1 92  ? 45.828 56.951 56.781 1.00 30.75  ? 92  CYS A C     1 
ATOM   696  O O     . CYS A 1 92  ? 46.951 56.708 57.225 1.00 29.47  ? 92  CYS A O     1 
ATOM   697  C CB    . CYS A 1 92  ? 45.201 55.911 54.633 1.00 31.91  ? 92  CYS A CB    1 
ATOM   698  S SG    . CYS A 1 92  ? 44.438 56.027 53.013 1.00 34.47  ? 92  CYS A SG    1 
ATOM   699  N N     . GLU A 1 93  ? 44.727 56.980 57.528 1.00 31.20  ? 93  GLU A N     1 
ATOM   700  C CA    . GLU A 1 93  ? 44.701 56.670 58.951 1.00 31.62  ? 93  GLU A CA    1 
ATOM   701  C C     . GLU A 1 93  ? 43.615 55.600 59.009 1.00 30.49  ? 93  GLU A C     1 
ATOM   702  O O     . GLU A 1 93  ? 42.450 55.887 58.760 1.00 29.53  ? 93  GLU A O     1 
ATOM   703  C CB    . GLU A 1 93  ? 44.297 57.896 59.773 1.00 32.32  ? 93  GLU A CB    1 
ATOM   704  C CG    . GLU A 1 93  ? 45.277 59.046 59.637 1.00 37.93  ? 93  GLU A CG    1 
ATOM   705  C CD    . GLU A 1 93  ? 44.928 60.231 60.511 1.00 40.49  ? 93  GLU A CD    1 
ATOM   706  O OE1   . GLU A 1 93  ? 45.578 61.287 60.350 1.00 43.69  ? 93  GLU A OE1   1 
ATOM   707  O OE2   . GLU A 1 93  ? 44.014 60.111 61.357 1.00 40.51  ? 93  GLU A OE2   1 
ATOM   708  N N     . VAL A 1 94  ? 44.002 54.368 59.319 1.00 30.61  ? 94  VAL A N     1 
ATOM   709  C CA    . VAL A 1 94  ? 43.049 53.266 59.332 1.00 30.14  ? 94  VAL A CA    1 
ATOM   710  C C     . VAL A 1 94  ? 42.999 52.517 60.654 1.00 30.78  ? 94  VAL A C     1 
ATOM   711  O O     . VAL A 1 94  ? 44.032 52.183 61.233 1.00 31.52  ? 94  VAL A O     1 
ATOM   712  C CB    . VAL A 1 94  ? 43.390 52.257 58.201 1.00 31.70  ? 94  VAL A CB    1 
ATOM   713  C CG1   . VAL A 1 94  ? 42.287 51.219 58.066 1.00 32.02  ? 94  VAL A CG1   1 
ATOM   714  C CG2   . VAL A 1 94  ? 43.582 52.999 56.882 1.00 31.55  ? 94  VAL A CG2   1 
ATOM   715  N N     . ALA A 1 95  ? 41.786 52.254 61.128 1.00 29.03  ? 95  ALA A N     1 
ATOM   716  C CA    . ALA A 1 95  ? 41.605 51.525 62.370 1.00 28.13  ? 95  ALA A CA    1 
ATOM   717  C C     . ALA A 1 95  ? 41.587 50.042 62.029 1.00 29.11  ? 95  ALA A C     1 
ATOM   718  O O     . ALA A 1 95  ? 41.113 49.659 60.959 1.00 28.23  ? 95  ALA A O     1 
ATOM   719  C CB    . ALA A 1 95  ? 40.291 51.930 63.030 1.00 28.11  ? 95  ALA A CB    1 
ATOM   720  N N     . GLU A 1 96  ? 42.111 49.210 62.924 1.00 26.57  ? 96  GLU A N     1 
ATOM   721  C CA    . GLU A 1 96  ? 42.118 47.776 62.680 1.00 29.86  ? 96  GLU A CA    1 
ATOM   722  C C     . GLU A 1 96  ? 41.756 46.994 63.930 1.00 29.18  ? 96  GLU A C     1 
ATOM   723  O O     . GLU A 1 96  ? 42.045 47.413 65.055 1.00 28.85  ? 96  GLU A O     1 
ATOM   724  C CB    . GLU A 1 96  ? 43.477 47.310 62.143 1.00 32.09  ? 96  GLU A CB    1 
ATOM   725  C CG    . GLU A 1 96  ? 44.611 47.277 63.149 1.00 38.91  ? 96  GLU A CG    1 
ATOM   726  C CD    . GLU A 1 96  ? 45.863 46.639 62.568 1.00 43.12  ? 96  GLU A CD    1 
ATOM   727  O OE1   . GLU A 1 96  ? 46.315 47.091 61.489 1.00 44.50  ? 96  GLU A OE1   1 
ATOM   728  O OE2   . GLU A 1 96  ? 46.391 45.687 63.185 1.00 43.49  ? 96  GLU A OE2   1 
ATOM   729  N N     . ILE A 1 97  ? 41.114 45.852 63.723 1.00 28.75  ? 97  ILE A N     1 
ATOM   730  C CA    . ILE A 1 97  ? 40.689 45.008 64.827 1.00 28.98  ? 97  ILE A CA    1 
ATOM   731  C C     . ILE A 1 97  ? 40.614 43.568 64.334 1.00 30.62  ? 97  ILE A C     1 
ATOM   732  O O     . ILE A 1 97  ? 40.264 43.316 63.179 1.00 29.89  ? 97  ILE A O     1 
ATOM   733  C CB    . ILE A 1 97  ? 39.305 45.471 65.355 1.00 30.01  ? 97  ILE A CB    1 
ATOM   734  C CG1   . ILE A 1 97  ? 38.892 44.632 66.564 1.00 31.21  ? 97  ILE A CG1   1 
ATOM   735  C CG2   . ILE A 1 97  ? 38.257 45.364 64.245 1.00 30.90  ? 97  ILE A CG2   1 
ATOM   736  C CD1   . ILE A 1 97  ? 37.641 45.131 67.251 1.00 30.87  ? 97  ILE A CD1   1 
ATOM   737  N N     . SER A 1 98  ? 40.968 42.624 65.198 1.00 29.72  ? 98  SER A N     1 
ATOM   738  C CA    . SER A 1 98  ? 40.930 41.217 64.823 1.00 29.33  ? 98  SER A CA    1 
ATOM   739  C C     . SER A 1 98  ? 39.491 40.788 64.559 1.00 28.69  ? 98  SER A C     1 
ATOM   740  O O     . SER A 1 98  ? 38.556 41.341 65.135 1.00 27.61  ? 98  SER A O     1 
ATOM   741  C CB    . SER A 1 98  ? 41.523 40.349 65.940 1.00 29.91  ? 98  SER A CB    1 
ATOM   742  O OG    . SER A 1 98  ? 40.664 40.326 67.072 1.00 30.30  ? 98  SER A OG    1 
ATOM   743  N N     . TYR A 1 99  ? 39.317 39.810 63.675 1.00 28.24  ? 99  TYR A N     1 
ATOM   744  C CA    . TYR A 1 99  ? 37.985 39.302 63.366 1.00 28.90  ? 99  TYR A CA    1 
ATOM   745  C C     . TYR A 1 99  ? 37.340 38.786 64.652 1.00 29.27  ? 99  TYR A C     1 
ATOM   746  O O     . TYR A 1 99  ? 36.155 39.011 64.907 1.00 28.91  ? 99  TYR A O     1 
ATOM   747  C CB    . TYR A 1 99  ? 38.077 38.153 62.360 1.00 27.89  ? 99  TYR A CB    1 
ATOM   748  C CG    . TYR A 1 99  ? 38.229 38.566 60.909 1.00 26.39  ? 99  TYR A CG    1 
ATOM   749  C CD1   . TYR A 1 99  ? 38.553 37.619 59.941 1.00 27.71  ? 99  TYR A CD1   1 
ATOM   750  C CD2   . TYR A 1 99  ? 37.990 39.879 60.492 1.00 25.84  ? 99  TYR A CD2   1 
ATOM   751  C CE1   . TYR A 1 99  ? 38.633 37.956 58.596 1.00 27.42  ? 99  TYR A CE1   1 
ATOM   752  C CE2   . TYR A 1 99  ? 38.066 40.230 59.135 1.00 24.94  ? 99  TYR A CE2   1 
ATOM   753  C CZ    . TYR A 1 99  ? 38.387 39.257 58.199 1.00 26.72  ? 99  TYR A CZ    1 
ATOM   754  O OH    . TYR A 1 99  ? 38.442 39.556 56.856 1.00 28.15  ? 99  TYR A OH    1 
ATOM   755  N N     . LYS A 1 100 ? 38.139 38.084 65.448 1.00 32.46  ? 100 LYS A N     1 
ATOM   756  C CA    . LYS A 1 100 ? 37.682 37.516 66.710 1.00 34.79  ? 100 LYS A CA    1 
ATOM   757  C C     . LYS A 1 100 ? 37.067 38.575 67.620 1.00 32.86  ? 100 LYS A C     1 
ATOM   758  O O     . LYS A 1 100 ? 35.971 38.388 68.146 1.00 34.16  ? 100 LYS A O     1 
ATOM   759  C CB    . LYS A 1 100 ? 38.849 36.840 67.431 1.00 37.98  ? 100 LYS A CB    1 
ATOM   760  C CG    . LYS A 1 100 ? 38.512 36.371 68.838 1.00 43.31  ? 100 LYS A CG    1 
ATOM   761  C CD    . LYS A 1 100 ? 39.763 35.940 69.582 1.00 47.63  ? 100 LYS A CD    1 
ATOM   762  C CE    . LYS A 1 100 ? 39.460 35.622 71.036 1.00 48.29  ? 100 LYS A CE    1 
ATOM   763  N NZ    . LYS A 1 100 ? 40.707 35.293 71.783 1.00 51.04  ? 100 LYS A NZ    1 
ATOM   764  N N     . LYS A 1 101 ? 37.776 39.682 67.813 1.00 33.41  ? 101 LYS A N     1 
ATOM   765  C CA    . LYS A 1 101 ? 37.271 40.752 68.664 1.00 33.20  ? 101 LYS A CA    1 
ATOM   766  C C     . LYS A 1 101 ? 36.047 41.419 68.056 1.00 32.85  ? 101 LYS A C     1 
ATOM   767  O O     . LYS A 1 101 ? 35.130 41.805 68.780 1.00 31.20  ? 101 LYS A O     1 
ATOM   768  C CB    . LYS A 1 101 ? 38.349 41.808 68.925 1.00 35.99  ? 101 LYS A CB    1 
ATOM   769  C CG    . LYS A 1 101 ? 39.338 41.437 70.019 1.00 40.58  ? 101 LYS A CG    1 
ATOM   770  C CD    . LYS A 1 101 ? 40.239 42.612 70.377 1.00 43.49  ? 101 LYS A CD    1 
ATOM   771  C CE    . LYS A 1 101 ? 41.166 42.271 71.539 1.00 46.52  ? 101 LYS A CE    1 
ATOM   772  N NZ    . LYS A 1 101 ? 42.046 43.418 71.919 1.00 49.41  ? 101 LYS A NZ    1 
ATOM   773  N N     . PHE A 1 102 ? 36.020 41.553 66.730 1.00 30.99  ? 102 PHE A N     1 
ATOM   774  C CA    . PHE A 1 102 ? 34.877 42.181 66.080 1.00 29.18  ? 102 PHE A CA    1 
ATOM   775  C C     . PHE A 1 102 ? 33.617 41.328 66.233 1.00 29.13  ? 102 PHE A C     1 
ATOM   776  O O     . PHE A 1 102 ? 32.530 41.858 66.461 1.00 28.43  ? 102 PHE A O     1 
ATOM   777  C CB    . PHE A 1 102 ? 35.153 42.429 64.588 1.00 28.49  ? 102 PHE A CB    1 
ATOM   778  C CG    . PHE A 1 102 ? 34.106 43.287 63.912 1.00 27.03  ? 102 PHE A CG    1 
ATOM   779  C CD1   . PHE A 1 102 ? 33.964 44.629 64.248 1.00 27.23  ? 102 PHE A CD1   1 
ATOM   780  C CD2   . PHE A 1 102 ? 33.242 42.743 62.963 1.00 28.20  ? 102 PHE A CD2   1 
ATOM   781  C CE1   . PHE A 1 102 ? 32.973 45.423 63.649 1.00 26.48  ? 102 PHE A CE1   1 
ATOM   782  C CE2   . PHE A 1 102 ? 32.248 43.525 62.357 1.00 26.53  ? 102 PHE A CE2   1 
ATOM   783  C CZ    . PHE A 1 102 ? 32.113 44.869 62.703 1.00 26.35  ? 102 PHE A CZ    1 
ATOM   784  N N     . ARG A 1 103 ? 33.754 40.010 66.108 1.00 31.80  ? 103 ARG A N     1 
ATOM   785  C CA    . ARG A 1 103 ? 32.590 39.133 66.242 1.00 33.84  ? 103 ARG A CA    1 
ATOM   786  C C     . ARG A 1 103 ? 31.999 39.259 67.640 1.00 33.85  ? 103 ARG A C     1 
ATOM   787  O O     . ARG A 1 103 ? 30.790 39.152 67.822 1.00 34.91  ? 103 ARG A O     1 
ATOM   788  C CB    . ARG A 1 103 ? 32.957 37.668 65.989 1.00 35.78  ? 103 ARG A CB    1 
ATOM   789  C CG    . ARG A 1 103 ? 33.444 37.361 64.590 1.00 39.47  ? 103 ARG A CG    1 
ATOM   790  C CD    . ARG A 1 103 ? 33.382 35.863 64.329 1.00 43.98  ? 103 ARG A CD    1 
ATOM   791  N NE    . ARG A 1 103 ? 34.106 35.484 63.123 1.00 46.76  ? 103 ARG A NE    1 
ATOM   792  C CZ    . ARG A 1 103 ? 35.428 35.384 63.047 1.00 46.78  ? 103 ARG A CZ    1 
ATOM   793  N NH1   . ARG A 1 103 ? 36.179 35.631 64.113 1.00 49.55  ? 103 ARG A NH1   1 
ATOM   794  N NH2   . ARG A 1 103 ? 36.001 35.044 61.904 1.00 47.64  ? 103 ARG A NH2   1 
ATOM   795  N N     . GLN A 1 104 ? 32.859 39.485 68.625 1.00 35.47  ? 104 GLN A N     1 
ATOM   796  C CA    . GLN A 1 104 ? 32.406 39.635 69.999 1.00 36.92  ? 104 GLN A CA    1 
ATOM   797  C C     . GLN A 1 104 ? 31.614 40.939 70.111 1.00 36.44  ? 104 GLN A C     1 
ATOM   798  O O     . GLN A 1 104 ? 30.613 41.009 70.825 1.00 37.09  ? 104 GLN A O     1 
ATOM   799  C CB    . GLN A 1 104 ? 33.611 39.634 70.950 1.00 38.37  ? 104 GLN A CB    1 
ATOM   800  C CG    . GLN A 1 104 ? 34.548 38.440 70.736 1.00 42.06  ? 104 GLN A CG    1 
ATOM   801  C CD    . GLN A 1 104 ? 35.714 38.397 71.713 1.00 43.85  ? 104 GLN A CD    1 
ATOM   802  O OE1   . GLN A 1 104 ? 36.216 39.435 72.149 1.00 44.06  ? 104 GLN A OE1   1 
ATOM   803  N NE2   . GLN A 1 104 ? 36.166 37.188 72.044 1.00 44.36  ? 104 GLN A NE2   1 
ATOM   804  N N     . LEU A 1 105 ? 32.050 41.965 69.383 1.00 34.87  ? 105 LEU A N     1 
ATOM   805  C CA    . LEU A 1 105 ? 31.363 43.253 69.405 1.00 34.93  ? 105 LEU A CA    1 
ATOM   806  C C     . LEU A 1 105 ? 29.980 43.143 68.766 1.00 35.07  ? 105 LEU A C     1 
ATOM   807  O O     . LEU A 1 105 ? 29.026 43.776 69.221 1.00 34.78  ? 105 LEU A O     1 
ATOM   808  C CB    . LEU A 1 105 ? 32.187 44.320 68.672 1.00 35.37  ? 105 LEU A CB    1 
ATOM   809  C CG    . LEU A 1 105 ? 33.564 44.673 69.250 1.00 36.06  ? 105 LEU A CG    1 
ATOM   810  C CD1   . LEU A 1 105 ? 34.108 45.907 68.538 1.00 35.60  ? 105 LEU A CD1   1 
ATOM   811  C CD2   . LEU A 1 105 ? 33.454 44.941 70.749 1.00 35.77  ? 105 LEU A CD2   1 
ATOM   812  N N     . ILE A 1 106 ? 29.880 42.336 67.712 1.00 34.99  ? 106 ILE A N     1 
ATOM   813  C CA    . ILE A 1 106 ? 28.615 42.137 67.011 1.00 35.30  ? 106 ILE A CA    1 
ATOM   814  C C     . ILE A 1 106 ? 27.550 41.626 67.979 1.00 36.72  ? 106 ILE A C     1 
ATOM   815  O O     . ILE A 1 106 ? 26.401 42.065 67.940 1.00 34.71  ? 106 ILE A O     1 
ATOM   816  C CB    . ILE A 1 106 ? 28.769 41.117 65.851 1.00 35.19  ? 106 ILE A CB    1 
ATOM   817  C CG1   . ILE A 1 106 ? 29.622 41.723 64.736 1.00 34.96  ? 106 ILE A CG1   1 
ATOM   818  C CG2   . ILE A 1 106 ? 27.397 40.715 65.311 1.00 34.74  ? 106 ILE A CG2   1 
ATOM   819  C CD1   . ILE A 1 106 ? 29.852 40.784 63.562 1.00 36.80  ? 106 ILE A CD1   1 
ATOM   820  N N     . GLN A 1 107 ? 27.942 40.695 68.844 1.00 37.27  ? 107 GLN A N     1 
ATOM   821  C CA    . GLN A 1 107 ? 27.024 40.130 69.825 1.00 39.04  ? 107 GLN A CA    1 
ATOM   822  C C     . GLN A 1 107 ? 26.591 41.181 70.847 1.00 38.06  ? 107 GLN A C     1 
ATOM   823  O O     . GLN A 1 107 ? 25.447 41.180 71.303 1.00 39.08  ? 107 GLN A O     1 
ATOM   824  C CB    . GLN A 1 107 ? 27.683 38.942 70.533 1.00 41.23  ? 107 GLN A CB    1 
ATOM   825  C CG    . GLN A 1 107 ? 27.958 37.756 69.615 1.00 42.54  ? 107 GLN A CG    1 
ATOM   826  C CD    . GLN A 1 107 ? 26.701 37.254 68.923 1.00 43.95  ? 107 GLN A CD    1 
ATOM   827  O OE1   . GLN A 1 107 ? 25.680 37.012 69.566 1.00 44.40  ? 107 GLN A OE1   1 
ATOM   828  N NE2   . GLN A 1 107 ? 26.773 37.087 67.604 1.00 44.10  ? 107 GLN A NE2   1 
ATOM   829  N N     . VAL A 1 108 ? 27.501 42.080 71.207 1.00 36.82  ? 108 VAL A N     1 
ATOM   830  C CA    . VAL A 1 108 ? 27.169 43.131 72.163 1.00 35.78  ? 108 VAL A CA    1 
ATOM   831  C C     . VAL A 1 108 ? 26.185 44.117 71.533 1.00 36.26  ? 108 VAL A C     1 
ATOM   832  O O     . VAL A 1 108 ? 25.200 44.511 72.163 1.00 35.73  ? 108 VAL A O     1 
ATOM   833  C CB    . VAL A 1 108 ? 28.425 43.902 72.617 1.00 35.42  ? 108 VAL A CB    1 
ATOM   834  C CG1   . VAL A 1 108 ? 28.040 44.979 73.625 1.00 35.34  ? 108 VAL A CG1   1 
ATOM   835  C CG2   . VAL A 1 108 ? 29.435 42.938 73.223 1.00 35.31  ? 108 VAL A CG2   1 
ATOM   836  N N     . ASN A 1 109 ? 26.449 44.510 70.287 1.00 34.58  ? 109 ASN A N     1 
ATOM   837  C CA    . ASN A 1 109 ? 25.577 45.448 69.571 1.00 34.51  ? 109 ASN A CA    1 
ATOM   838  C C     . ASN A 1 109 ? 25.646 45.166 68.070 1.00 34.57  ? 109 ASN A C     1 
ATOM   839  O O     . ASN A 1 109 ? 26.545 45.642 67.382 1.00 34.24  ? 109 ASN A O     1 
ATOM   840  C CB    . ASN A 1 109 ? 26.007 46.892 69.846 1.00 34.37  ? 109 ASN A CB    1 
ATOM   841  C CG    . ASN A 1 109 ? 25.102 47.921 69.172 1.00 35.42  ? 109 ASN A CG    1 
ATOM   842  O OD1   . ASN A 1 109 ? 25.342 49.127 69.267 1.00 37.78  ? 109 ASN A OD1   1 
ATOM   843  N ND2   . ASN A 1 109 ? 24.061 47.451 68.493 1.00 33.24  ? 109 ASN A ND2   1 
ATOM   844  N N     . PRO A 1 110 ? 24.690 44.381 67.551 1.00 34.49  ? 110 PRO A N     1 
ATOM   845  C CA    . PRO A 1 110 ? 24.598 44.001 66.135 1.00 34.26  ? 110 PRO A CA    1 
ATOM   846  C C     . PRO A 1 110 ? 24.502 45.171 65.157 1.00 33.15  ? 110 PRO A C     1 
ATOM   847  O O     . PRO A 1 110 ? 24.692 44.991 63.955 1.00 31.63  ? 110 PRO A O     1 
ATOM   848  C CB    . PRO A 1 110 ? 23.349 43.119 66.095 1.00 35.10  ? 110 PRO A CB    1 
ATOM   849  C CG    . PRO A 1 110 ? 23.330 42.508 67.465 1.00 36.58  ? 110 PRO A CG    1 
ATOM   850  C CD    . PRO A 1 110 ? 23.659 43.688 68.342 1.00 35.53  ? 110 PRO A CD    1 
ATOM   851  N N     . ASP A 1 111 ? 24.196 46.363 65.661 1.00 32.54  ? 111 ASP A N     1 
ATOM   852  C CA    . ASP A 1 111 ? 24.092 47.525 64.785 1.00 31.99  ? 111 ASP A CA    1 
ATOM   853  C C     . ASP A 1 111 ? 25.394 47.722 64.004 1.00 30.49  ? 111 ASP A C     1 
ATOM   854  O O     . ASP A 1 111 ? 25.380 48.200 62.866 1.00 27.41  ? 111 ASP A O     1 
ATOM   855  C CB    . ASP A 1 111 ? 23.806 48.791 65.591 1.00 35.05  ? 111 ASP A CB    1 
ATOM   856  C CG    . ASP A 1 111 ? 23.496 49.981 64.704 1.00 38.59  ? 111 ASP A CG    1 
ATOM   857  O OD1   . ASP A 1 111 ? 23.962 51.097 65.016 1.00 41.06  ? 111 ASP A OD1   1 
ATOM   858  O OD2   . ASP A 1 111 ? 22.777 49.799 63.695 1.00 40.36  ? 111 ASP A OD2   1 
ATOM   859  N N     . ILE A 1 112 ? 26.517 47.351 64.613 1.00 29.29  ? 112 ILE A N     1 
ATOM   860  C CA    . ILE A 1 112 ? 27.799 47.518 63.941 1.00 28.16  ? 112 ILE A CA    1 
ATOM   861  C C     . ILE A 1 112 ? 27.880 46.587 62.731 1.00 28.14  ? 112 ILE A C     1 
ATOM   862  O O     . ILE A 1 112 ? 28.519 46.918 61.727 1.00 27.48  ? 112 ILE A O     1 
ATOM   863  C CB    . ILE A 1 112 ? 28.993 47.289 64.912 1.00 28.82  ? 112 ILE A CB    1 
ATOM   864  C CG1   . ILE A 1 112 ? 30.277 47.833 64.278 1.00 28.49  ? 112 ILE A CG1   1 
ATOM   865  C CG2   . ILE A 1 112 ? 29.149 45.813 65.259 1.00 25.21  ? 112 ILE A CG2   1 
ATOM   866  C CD1   . ILE A 1 112 ? 30.271 49.337 64.062 1.00 30.26  ? 112 ILE A CD1   1 
ATOM   867  N N     . LEU A 1 113 ? 27.210 45.441 62.809 1.00 27.51  ? 113 LEU A N     1 
ATOM   868  C CA    . LEU A 1 113 ? 27.196 44.509 61.681 1.00 27.02  ? 113 LEU A CA    1 
ATOM   869  C C     . LEU A 1 113 ? 26.264 45.080 60.608 1.00 27.15  ? 113 LEU A C     1 
ATOM   870  O O     . LEU A 1 113 ? 26.534 44.968 59.414 1.00 25.56  ? 113 LEU A O     1 
ATOM   871  C CB    . LEU A 1 113 ? 26.698 43.123 62.111 1.00 26.54  ? 113 LEU A CB    1 
ATOM   872  C CG    . LEU A 1 113 ? 26.469 42.098 60.987 1.00 27.61  ? 113 LEU A CG    1 
ATOM   873  C CD1   . LEU A 1 113 ? 27.745 41.906 60.185 1.00 26.83  ? 113 LEU A CD1   1 
ATOM   874  C CD2   . LEU A 1 113 ? 26.016 40.775 61.576 1.00 29.76  ? 113 LEU A CD2   1 
ATOM   875  N N     . MET A 1 114 ? 25.163 45.691 61.035 1.00 25.90  ? 114 MET A N     1 
ATOM   876  C CA    . MET A 1 114 ? 24.226 46.283 60.084 1.00 27.50  ? 114 MET A CA    1 
ATOM   877  C C     . MET A 1 114 ? 24.940 47.313 59.213 1.00 27.31  ? 114 MET A C     1 
ATOM   878  O O     . MET A 1 114 ? 24.749 47.356 57.995 1.00 26.51  ? 114 MET A O     1 
ATOM   879  C CB    . MET A 1 114 ? 23.058 46.950 60.817 1.00 28.73  ? 114 MET A CB    1 
ATOM   880  C CG    . MET A 1 114 ? 21.936 45.999 61.196 1.00 32.48  ? 114 MET A CG    1 
ATOM   881  S SD    . MET A 1 114 ? 21.128 45.287 59.734 1.00 33.41  ? 114 MET A SD    1 
ATOM   882  C CE    . MET A 1 114 ? 19.991 46.580 59.299 1.00 34.56  ? 114 MET A CE    1 
ATOM   883  N N     . ARG A 1 115 ? 25.770 48.138 59.842 1.00 26.49  ? 115 ARG A N     1 
ATOM   884  C CA    . ARG A 1 115 ? 26.509 49.169 59.128 1.00 26.76  ? 115 ARG A CA    1 
ATOM   885  C C     . ARG A 1 115 ? 27.485 48.578 58.119 1.00 25.90  ? 115 ARG A C     1 
ATOM   886  O O     . ARG A 1 115 ? 27.648 49.104 57.018 1.00 24.39  ? 115 ARG A O     1 
ATOM   887  C CB    . ARG A 1 115 ? 27.252 50.050 60.128 1.00 30.49  ? 115 ARG A CB    1 
ATOM   888  C CG    . ARG A 1 115 ? 26.323 50.953 60.934 1.00 35.16  ? 115 ARG A CG    1 
ATOM   889  C CD    . ARG A 1 115 ? 26.853 51.167 62.336 1.00 38.57  ? 115 ARG A CD    1 
ATOM   890  N NE    . ARG A 1 115 ? 25.920 51.926 63.165 1.00 42.98  ? 115 ARG A NE    1 
ATOM   891  C CZ    . ARG A 1 115 ? 25.832 53.252 63.186 1.00 43.27  ? 115 ARG A CZ    1 
ATOM   892  N NH1   . ARG A 1 115 ? 26.623 53.993 62.421 1.00 43.14  ? 115 ARG A NH1   1 
ATOM   893  N NH2   . ARG A 1 115 ? 24.954 53.840 63.989 1.00 44.98  ? 115 ARG A NH2   1 
ATOM   894  N N     . LEU A 1 116 ? 28.139 47.492 58.508 1.00 24.65  ? 116 LEU A N     1 
ATOM   895  C CA    . LEU A 1 116 ? 29.090 46.816 57.630 1.00 25.57  ? 116 LEU A CA    1 
ATOM   896  C C     . LEU A 1 116 ? 28.361 46.155 56.461 1.00 24.40  ? 116 LEU A C     1 
ATOM   897  O O     . LEU A 1 116 ? 28.799 46.244 55.309 1.00 23.39  ? 116 LEU A O     1 
ATOM   898  C CB    . LEU A 1 116 ? 29.860 45.760 58.419 1.00 24.23  ? 116 LEU A CB    1 
ATOM   899  C CG    . LEU A 1 116 ? 30.728 44.814 57.591 1.00 27.70  ? 116 LEU A CG    1 
ATOM   900  C CD1   . LEU A 1 116 ? 31.749 45.620 56.818 1.00 27.60  ? 116 LEU A CD1   1 
ATOM   901  C CD2   . LEU A 1 116 ? 31.407 43.806 58.514 1.00 28.94  ? 116 LEU A CD2   1 
ATOM   902  N N     . SER A 1 117 ? 27.247 45.490 56.760 1.00 24.01  ? 117 SER A N     1 
ATOM   903  C CA    . SER A 1 117 ? 26.468 44.821 55.721 1.00 25.59  ? 117 SER A CA    1 
ATOM   904  C C     . SER A 1 117 ? 25.918 45.801 54.690 1.00 23.47  ? 117 SER A C     1 
ATOM   905  O O     . SER A 1 117 ? 25.827 45.473 53.506 1.00 22.94  ? 117 SER A O     1 
ATOM   906  C CB    . SER A 1 117 ? 25.318 44.026 56.346 1.00 26.22  ? 117 SER A CB    1 
ATOM   907  O OG    . SER A 1 117 ? 25.827 43.014 57.202 1.00 31.17  ? 117 SER A OG    1 
ATOM   908  N N     . ALA A 1 118 ? 25.547 46.999 55.135 1.00 23.45  ? 118 ALA A N     1 
ATOM   909  C CA    . ALA A 1 118 ? 25.027 48.021 54.224 1.00 20.79  ? 118 ALA A CA    1 
ATOM   910  C C     . ALA A 1 118 ? 26.057 48.347 53.148 1.00 21.86  ? 118 ALA A C     1 
ATOM   911  O O     . ALA A 1 118 ? 25.720 48.501 51.969 1.00 20.33  ? 118 ALA A O     1 
ATOM   912  C CB    . ALA A 1 118 ? 24.674 49.291 54.996 1.00 21.32  ? 118 ALA A CB    1 
ATOM   913  N N     . GLN A 1 119 ? 27.314 48.462 53.558 1.00 22.46  ? 119 GLN A N     1 
ATOM   914  C CA    . GLN A 1 119 ? 28.382 48.765 52.619 1.00 21.58  ? 119 GLN A CA    1 
ATOM   915  C C     . GLN A 1 119 ? 28.624 47.596 51.664 1.00 21.73  ? 119 GLN A C     1 
ATOM   916  O O     . GLN A 1 119 ? 28.877 47.807 50.479 1.00 19.61  ? 119 GLN A O     1 
ATOM   917  C CB    . GLN A 1 119 ? 29.670 49.131 53.370 1.00 22.90  ? 119 GLN A CB    1 
ATOM   918  C CG    . GLN A 1 119 ? 29.522 50.398 54.218 1.00 23.78  ? 119 GLN A CG    1 
ATOM   919  C CD    . GLN A 1 119 ? 30.837 50.908 54.783 1.00 25.45  ? 119 GLN A CD    1 
ATOM   920  O OE1   . GLN A 1 119 ? 31.889 50.287 54.618 1.00 23.04  ? 119 GLN A OE1   1 
ATOM   921  N NE2   . GLN A 1 119 ? 30.780 52.051 55.461 1.00 26.20  ? 119 GLN A NE2   1 
ATOM   922  N N     . MET A 1 120 ? 28.549 46.366 52.168 1.00 20.60  ? 120 MET A N     1 
ATOM   923  C CA    . MET A 1 120 ? 28.741 45.217 51.291 1.00 20.69  ? 120 MET A CA    1 
ATOM   924  C C     . MET A 1 120 ? 27.635 45.176 50.229 1.00 19.12  ? 120 MET A C     1 
ATOM   925  O O     . MET A 1 120 ? 27.893 44.859 49.068 1.00 19.00  ? 120 MET A O     1 
ATOM   926  C CB    . MET A 1 120 ? 28.755 43.908 52.097 1.00 23.07  ? 120 MET A CB    1 
ATOM   927  C CG    . MET A 1 120 ? 30.127 43.554 52.681 1.00 24.70  ? 120 MET A CG    1 
ATOM   928  S SD    . MET A 1 120 ? 30.155 41.856 53.349 1.00 30.43  ? 120 MET A SD    1 
ATOM   929  C CE    . MET A 1 120 ? 29.203 42.177 54.786 1.00 21.36  ? 120 MET A CE    1 
ATOM   930  N N     . ALA A 1 121 ? 26.408 45.511 50.616 1.00 20.41  ? 121 ALA A N     1 
ATOM   931  C CA    . ALA A 1 121 ? 25.302 45.506 49.658 1.00 20.23  ? 121 ALA A CA    1 
ATOM   932  C C     . ALA A 1 121 ? 25.559 46.530 48.553 1.00 21.39  ? 121 ALA A C     1 
ATOM   933  O O     . ALA A 1 121 ? 25.367 46.244 47.368 1.00 21.68  ? 121 ALA A O     1 
ATOM   934  C CB    . ALA A 1 121 ? 23.980 45.818 50.363 1.00 21.28  ? 121 ALA A CB    1 
ATOM   935  N N     . ARG A 1 122 ? 25.985 47.728 48.945 1.00 20.56  ? 122 ARG A N     1 
ATOM   936  C CA    . ARG A 1 122 ? 26.267 48.782 47.973 1.00 21.46  ? 122 ARG A CA    1 
ATOM   937  C C     . ARG A 1 122 ? 27.379 48.329 47.031 1.00 21.18  ? 122 ARG A C     1 
ATOM   938  O O     . ARG A 1 122 ? 27.319 48.552 45.821 1.00 20.15  ? 122 ARG A O     1 
ATOM   939  C CB    . ARG A 1 122 ? 26.694 50.070 48.693 1.00 26.07  ? 122 ARG A CB    1 
ATOM   940  C CG    . ARG A 1 122 ? 27.263 51.145 47.759 1.00 30.16  ? 122 ARG A CG    1 
ATOM   941  C CD    . ARG A 1 122 ? 26.208 51.647 46.787 1.00 36.26  ? 122 ARG A CD    1 
ATOM   942  N NE    . ARG A 1 122 ? 25.182 52.423 47.474 1.00 43.97  ? 122 ARG A NE    1 
ATOM   943  C CZ    . ARG A 1 122 ? 25.381 53.638 47.977 1.00 46.41  ? 122 ARG A CZ    1 
ATOM   944  N NH1   . ARG A 1 122 ? 26.569 54.221 47.863 1.00 47.51  ? 122 ARG A NH1   1 
ATOM   945  N NH2   . ARG A 1 122 ? 24.396 54.266 48.606 1.00 48.46  ? 122 ARG A NH2   1 
ATOM   946  N N     . ARG A 1 123 ? 28.396 47.678 47.583 1.00 20.35  ? 123 ARG A N     1 
ATOM   947  C CA    . ARG A 1 123 ? 29.507 47.227 46.756 1.00 21.46  ? 123 ARG A CA    1 
ATOM   948  C C     . ARG A 1 123 ? 29.094 46.186 45.731 1.00 21.40  ? 123 ARG A C     1 
ATOM   949  O O     . ARG A 1 123 ? 29.618 46.171 44.618 1.00 21.55  ? 123 ARG A O     1 
ATOM   950  C CB    . ARG A 1 123 ? 30.639 46.690 47.632 1.00 22.26  ? 123 ARG A CB    1 
ATOM   951  C CG    . ARG A 1 123 ? 31.344 47.811 48.368 1.00 23.73  ? 123 ARG A CG    1 
ATOM   952  C CD    . ARG A 1 123 ? 32.292 47.320 49.448 1.00 23.59  ? 123 ARG A CD    1 
ATOM   953  N NE    . ARG A 1 123 ? 32.592 48.431 50.344 1.00 24.83  ? 123 ARG A NE    1 
ATOM   954  C CZ    . ARG A 1 123 ? 33.473 48.394 51.334 1.00 24.37  ? 123 ARG A CZ    1 
ATOM   955  N NH1   . ARG A 1 123 ? 34.170 47.291 51.566 1.00 22.28  ? 123 ARG A NH1   1 
ATOM   956  N NH2   . ARG A 1 123 ? 33.634 49.462 52.110 1.00 23.95  ? 123 ARG A NH2   1 
ATOM   957  N N     . LEU A 1 124 ? 28.150 45.326 46.093 1.00 22.98  ? 124 LEU A N     1 
ATOM   958  C CA    . LEU A 1 124 ? 27.704 44.300 45.160 1.00 23.95  ? 124 LEU A CA    1 
ATOM   959  C C     . LEU A 1 124 ? 26.921 44.955 44.030 1.00 22.59  ? 124 LEU A C     1 
ATOM   960  O O     . LEU A 1 124 ? 27.051 44.563 42.874 1.00 20.93  ? 124 LEU A O     1 
ATOM   961  C CB    . LEU A 1 124 ? 26.848 43.252 45.876 1.00 23.78  ? 124 LEU A CB    1 
ATOM   962  C CG    . LEU A 1 124 ? 26.536 41.990 45.061 1.00 27.69  ? 124 LEU A CG    1 
ATOM   963  C CD1   . LEU A 1 124 ? 27.838 41.340 44.562 1.00 23.59  ? 124 LEU A CD1   1 
ATOM   964  C CD2   . LEU A 1 124 ? 25.747 41.014 45.924 1.00 26.82  ? 124 LEU A CD2   1 
ATOM   965  N N     . GLN A 1 125 ? 26.118 45.962 44.359 1.00 20.60  ? 125 GLN A N     1 
ATOM   966  C CA    . GLN A 1 125 ? 25.354 46.670 43.333 1.00 21.15  ? 125 GLN A CA    1 
ATOM   967  C C     . GLN A 1 125 ? 26.337 47.326 42.364 1.00 21.04  ? 125 GLN A C     1 
ATOM   968  O O     . GLN A 1 125 ? 26.212 47.195 41.145 1.00 20.67  ? 125 GLN A O     1 
ATOM   969  C CB    . GLN A 1 125 ? 24.480 47.771 43.944 1.00 20.83  ? 125 GLN A CB    1 
ATOM   970  C CG    . GLN A 1 125 ? 23.336 47.303 44.834 1.00 22.02  ? 125 GLN A CG    1 
ATOM   971  C CD    . GLN A 1 125 ? 22.697 48.461 45.595 1.00 26.39  ? 125 GLN A CD    1 
ATOM   972  O OE1   . GLN A 1 125 ? 23.395 49.357 46.079 1.00 24.26  ? 125 GLN A OE1   1 
ATOM   973  N NE2   . GLN A 1 125 ? 21.370 48.442 45.714 1.00 24.61  ? 125 GLN A NE2   1 
ATOM   974  N N     . VAL A 1 126 ? 27.322 48.030 42.914 1.00 20.75  ? 126 VAL A N     1 
ATOM   975  C CA    . VAL A 1 126 ? 28.307 48.730 42.090 1.00 22.18  ? 126 VAL A CA    1 
ATOM   976  C C     . VAL A 1 126 ? 29.165 47.807 41.242 1.00 20.98  ? 126 VAL A C     1 
ATOM   977  O O     . VAL A 1 126 ? 29.405 48.068 40.057 1.00 20.91  ? 126 VAL A O     1 
ATOM   978  C CB    . VAL A 1 126 ? 29.230 49.614 42.967 1.00 24.06  ? 126 VAL A CB    1 
ATOM   979  C CG1   . VAL A 1 126 ? 30.372 50.200 42.117 1.00 25.43  ? 126 VAL A CG1   1 
ATOM   980  C CG2   . VAL A 1 126 ? 28.408 50.735 43.600 1.00 27.71  ? 126 VAL A CG2   1 
ATOM   981  N N     . THR A 1 127 ? 29.633 46.720 41.841 1.00 21.41  ? 127 THR A N     1 
ATOM   982  C CA    . THR A 1 127 ? 30.473 45.781 41.118 1.00 22.98  ? 127 THR A CA    1 
ATOM   983  C C     . THR A 1 127 ? 29.685 45.070 40.013 1.00 23.53  ? 127 THR A C     1 
ATOM   984  O O     . THR A 1 127 ? 30.223 44.773 38.938 1.00 23.23  ? 127 THR A O     1 
ATOM   985  C CB    . THR A 1 127 ? 31.101 44.774 42.105 1.00 21.63  ? 127 THR A CB    1 
ATOM   986  O OG1   . THR A 1 127 ? 31.840 45.504 43.098 1.00 24.87  ? 127 THR A OG1   1 
ATOM   987  C CG2   . THR A 1 127 ? 32.055 43.831 41.386 1.00 24.74  ? 127 THR A CG2   1 
ATOM   988  N N     . SER A 1 128 ? 28.404 44.816 40.260 1.00 23.32  ? 128 SER A N     1 
ATOM   989  C CA    . SER A 1 128 ? 27.571 44.162 39.253 1.00 24.06  ? 128 SER A CA    1 
ATOM   990  C C     . SER A 1 128 ? 27.358 45.097 38.058 1.00 23.64  ? 128 SER A C     1 
ATOM   991  O O     . SER A 1 128 ? 27.301 44.647 36.905 1.00 22.90  ? 128 SER A O     1 
ATOM   992  C CB    . SER A 1 128 ? 26.224 43.754 39.857 1.00 23.74  ? 128 SER A CB    1 
ATOM   993  O OG    . SER A 1 128 ? 26.405 42.763 40.851 1.00 25.60  ? 128 SER A OG    1 
ATOM   994  N N     . GLU A 1 129 ? 27.240 46.394 38.328 1.00 25.56  ? 129 GLU A N     1 
ATOM   995  C CA    . GLU A 1 129 ? 27.073 47.363 37.246 1.00 26.54  ? 129 GLU A CA    1 
ATOM   996  C C     . GLU A 1 129 ? 28.345 47.346 36.412 1.00 26.94  ? 129 GLU A C     1 
ATOM   997  O O     . GLU A 1 129 ? 28.302 47.474 35.184 1.00 25.76  ? 129 GLU A O     1 
ATOM   998  C CB    . GLU A 1 129 ? 26.851 48.779 37.786 1.00 30.55  ? 129 GLU A CB    1 
ATOM   999  C CG    . GLU A 1 129 ? 25.541 48.976 38.517 1.00 38.31  ? 129 GLU A CG    1 
ATOM   1000 C CD    . GLU A 1 129 ? 25.153 50.441 38.642 1.00 43.52  ? 129 GLU A CD    1 
ATOM   1001 O OE1   . GLU A 1 129 ? 24.119 50.728 39.288 1.00 46.58  ? 129 GLU A OE1   1 
ATOM   1002 O OE2   . GLU A 1 129 ? 25.874 51.302 38.089 1.00 44.62  ? 129 GLU A OE2   1 
ATOM   1003 N N     . LYS A 1 130 ? 29.480 47.184 37.089 1.00 25.26  ? 130 LYS A N     1 
ATOM   1004 C CA    . LYS A 1 130 ? 30.774 47.148 36.417 1.00 26.49  ? 130 LYS A CA    1 
ATOM   1005 C C     . LYS A 1 130 ? 30.845 45.950 35.466 1.00 25.50  ? 130 LYS A C     1 
ATOM   1006 O O     . LYS A 1 130 ? 31.377 46.054 34.357 1.00 23.84  ? 130 LYS A O     1 
ATOM   1007 C CB    . LYS A 1 130 ? 31.901 47.081 37.456 1.00 26.31  ? 130 LYS A CB    1 
ATOM   1008 C CG    . LYS A 1 130 ? 33.295 47.239 36.878 1.00 32.13  ? 130 LYS A CG    1 
ATOM   1009 C CD    . LYS A 1 130 ? 34.348 47.397 37.973 1.00 36.48  ? 130 LYS A CD    1 
ATOM   1010 C CE    . LYS A 1 130 ? 34.124 48.644 38.820 1.00 37.35  ? 130 LYS A CE    1 
ATOM   1011 N NZ    . LYS A 1 130 ? 34.254 49.910 38.039 1.00 43.73  ? 130 LYS A NZ    1 
ATOM   1012 N N     . VAL A 1 131 ? 30.313 44.813 35.902 1.00 24.38  ? 131 VAL A N     1 
ATOM   1013 C CA    . VAL A 1 131 ? 30.292 43.617 35.065 1.00 26.07  ? 131 VAL A CA    1 
ATOM   1014 C C     . VAL A 1 131 ? 29.497 43.915 33.789 1.00 26.40  ? 131 VAL A C     1 
ATOM   1015 O O     . VAL A 1 131 ? 29.922 43.570 32.681 1.00 25.81  ? 131 VAL A O     1 
ATOM   1016 C CB    . VAL A 1 131 ? 29.635 42.422 35.809 1.00 28.08  ? 131 VAL A CB    1 
ATOM   1017 C CG1   . VAL A 1 131 ? 29.345 41.279 34.833 1.00 27.46  ? 131 VAL A CG1   1 
ATOM   1018 C CG2   . VAL A 1 131 ? 30.558 41.940 36.920 1.00 27.75  ? 131 VAL A CG2   1 
ATOM   1019 N N     . GLY A 1 132 ? 28.351 44.571 33.951 1.00 26.44  ? 132 GLY A N     1 
ATOM   1020 C CA    . GLY A 1 132 ? 27.522 44.910 32.805 1.00 26.11  ? 132 GLY A CA    1 
ATOM   1021 C C     . GLY A 1 132 ? 28.237 45.817 31.819 1.00 26.96  ? 132 GLY A C     1 
ATOM   1022 O O     . GLY A 1 132 ? 28.208 45.579 30.606 1.00 28.26  ? 132 GLY A O     1 
ATOM   1023 N N     . ASN A 1 133 ? 28.884 46.857 32.332 1.00 27.04  ? 133 ASN A N     1 
ATOM   1024 C CA    . ASN A 1 133 ? 29.609 47.794 31.480 1.00 29.43  ? 133 ASN A CA    1 
ATOM   1025 C C     . ASN A 1 133 ? 30.700 47.105 30.663 1.00 29.40  ? 133 ASN A C     1 
ATOM   1026 O O     . ASN A 1 133 ? 30.830 47.342 29.458 1.00 30.19  ? 133 ASN A O     1 
ATOM   1027 C CB    . ASN A 1 133 ? 30.234 48.911 32.320 1.00 31.15  ? 133 ASN A CB    1 
ATOM   1028 C CG    . ASN A 1 133 ? 29.197 49.805 32.968 1.00 33.22  ? 133 ASN A CG    1 
ATOM   1029 O OD1   . ASN A 1 133 ? 28.094 49.973 32.450 1.00 35.39  ? 133 ASN A OD1   1 
ATOM   1030 N ND2   . ASN A 1 133 ? 29.554 50.400 34.101 1.00 34.69  ? 133 ASN A ND2   1 
ATOM   1031 N N     . LEU A 1 134 ? 31.482 46.255 31.321 1.00 30.05  ? 134 LEU A N     1 
ATOM   1032 C CA    . LEU A 1 134 ? 32.566 45.532 30.659 1.00 31.54  ? 134 LEU A CA    1 
ATOM   1033 C C     . LEU A 1 134 ? 32.062 44.536 29.625 1.00 32.81  ? 134 LEU A C     1 
ATOM   1034 O O     . LEU A 1 134 ? 32.733 44.263 28.624 1.00 32.57  ? 134 LEU A O     1 
ATOM   1035 C CB    . LEU A 1 134 ? 33.421 44.792 31.696 1.00 31.42  ? 134 LEU A CB    1 
ATOM   1036 C CG    . LEU A 1 134 ? 34.233 45.695 32.627 1.00 33.02  ? 134 LEU A CG    1 
ATOM   1037 C CD1   . LEU A 1 134 ? 34.884 44.869 33.723 1.00 32.22  ? 134 LEU A CD1   1 
ATOM   1038 C CD2   . LEU A 1 134 ? 35.293 46.433 31.806 1.00 34.20  ? 134 LEU A CD2   1 
ATOM   1039 N N     . ALA A 1 135 ? 30.879 43.990 29.865 1.00 33.15  ? 135 ALA A N     1 
ATOM   1040 C CA    . ALA A 1 135 ? 30.307 43.012 28.953 1.00 34.06  ? 135 ALA A CA    1 
ATOM   1041 C C     . ALA A 1 135 ? 29.505 43.616 27.801 1.00 33.55  ? 135 ALA A C     1 
ATOM   1042 O O     . ALA A 1 135 ? 29.520 43.086 26.690 1.00 35.35  ? 135 ALA A O     1 
ATOM   1043 C CB    . ALA A 1 135 ? 29.426 42.036 29.737 1.00 36.02  ? 135 ALA A CB    1 
ATOM   1044 N N     . PHE A 1 136 ? 28.827 44.730 28.051 1.00 33.14  ? 136 PHE A N     1 
ATOM   1045 C CA    . PHE A 1 136 ? 27.979 45.340 27.027 1.00 34.05  ? 136 PHE A CA    1 
ATOM   1046 C C     . PHE A 1 136 ? 28.466 46.602 26.315 1.00 35.28  ? 136 PHE A C     1 
ATOM   1047 O O     . PHE A 1 136 ? 27.911 46.980 25.282 1.00 35.60  ? 136 PHE A O     1 
ATOM   1048 C CB    . PHE A 1 136 ? 26.605 45.633 27.620 1.00 33.01  ? 136 PHE A CB    1 
ATOM   1049 C CG    . PHE A 1 136 ? 25.936 44.437 28.235 1.00 30.31  ? 136 PHE A CG    1 
ATOM   1050 C CD1   . PHE A 1 136 ? 25.898 43.221 27.563 1.00 29.84  ? 136 PHE A CD1   1 
ATOM   1051 C CD2   . PHE A 1 136 ? 25.290 44.547 29.466 1.00 31.85  ? 136 PHE A CD2   1 
ATOM   1052 C CE1   . PHE A 1 136 ? 25.220 42.129 28.106 1.00 30.76  ? 136 PHE A CE1   1 
ATOM   1053 C CE2   . PHE A 1 136 ? 24.609 43.462 30.016 1.00 28.47  ? 136 PHE A CE2   1 
ATOM   1054 C CZ    . PHE A 1 136 ? 24.573 42.256 29.338 1.00 28.74  ? 136 PHE A CZ    1 
ATOM   1055 N N     . LEU A 1 137 ? 29.479 47.264 26.857 1.00 35.32  ? 137 LEU A N     1 
ATOM   1056 C CA    . LEU A 1 137 ? 29.978 48.485 26.240 1.00 35.32  ? 137 LEU A CA    1 
ATOM   1057 C C     . LEU A 1 137 ? 31.353 48.294 25.632 1.00 36.13  ? 137 LEU A C     1 
ATOM   1058 O O     . LEU A 1 137 ? 32.204 47.623 26.216 1.00 36.61  ? 137 LEU A O     1 
ATOM   1059 C CB    . LEU A 1 137 ? 30.055 49.606 27.279 1.00 36.27  ? 137 LEU A CB    1 
ATOM   1060 C CG    . LEU A 1 137 ? 28.781 49.990 28.032 1.00 36.15  ? 137 LEU A CG    1 
ATOM   1061 C CD1   . LEU A 1 137 ? 29.114 51.066 29.052 1.00 35.81  ? 137 LEU A CD1   1 
ATOM   1062 C CD2   . LEU A 1 137 ? 27.720 50.482 27.061 1.00 37.88  ? 137 LEU A CD2   1 
ATOM   1063 N N     . ASP A 1 138 ? 31.571 48.874 24.455 1.00 36.00  ? 138 ASP A N     1 
ATOM   1064 C CA    . ASP A 1 138 ? 32.881 48.787 23.827 1.00 36.95  ? 138 ASP A CA    1 
ATOM   1065 C C     . ASP A 1 138 ? 33.775 49.723 24.636 1.00 36.95  ? 138 ASP A C     1 
ATOM   1066 O O     . ASP A 1 138 ? 33.276 50.550 25.405 1.00 35.24  ? 138 ASP A O     1 
ATOM   1067 C CB    . ASP A 1 138 ? 32.832 49.224 22.353 1.00 38.69  ? 138 ASP A CB    1 
ATOM   1068 C CG    . ASP A 1 138 ? 32.128 50.552 22.152 1.00 39.86  ? 138 ASP A CG    1 
ATOM   1069 O OD1   . ASP A 1 138 ? 32.439 51.516 22.878 1.00 41.97  ? 138 ASP A OD1   1 
ATOM   1070 O OD2   . ASP A 1 138 ? 31.264 50.637 21.255 1.00 42.84  ? 138 ASP A OD2   1 
ATOM   1071 N N     . VAL A 1 139 ? 35.086 49.601 24.470 1.00 36.61  ? 139 VAL A N     1 
ATOM   1072 C CA    . VAL A 1 139 ? 36.014 50.431 25.231 1.00 38.01  ? 139 VAL A CA    1 
ATOM   1073 C C     . VAL A 1 139 ? 35.685 51.923 25.199 1.00 37.35  ? 139 VAL A C     1 
ATOM   1074 O O     . VAL A 1 139 ? 35.848 52.619 26.201 1.00 35.99  ? 139 VAL A O     1 
ATOM   1075 C CB    . VAL A 1 139 ? 37.468 50.232 24.755 1.00 39.46  ? 139 VAL A CB    1 
ATOM   1076 C CG1   . VAL A 1 139 ? 37.639 50.777 23.349 1.00 39.18  ? 139 VAL A CG1   1 
ATOM   1077 C CG2   . VAL A 1 139 ? 38.425 50.918 25.719 1.00 40.82  ? 139 VAL A CG2   1 
ATOM   1078 N N     . THR A 1 140 ? 35.210 52.416 24.060 1.00 36.82  ? 140 THR A N     1 
ATOM   1079 C CA    . THR A 1 140 ? 34.884 53.831 23.946 1.00 36.28  ? 140 THR A CA    1 
ATOM   1080 C C     . THR A 1 140 ? 33.731 54.232 24.866 1.00 36.41  ? 140 THR A C     1 
ATOM   1081 O O     . THR A 1 140 ? 33.784 55.280 25.517 1.00 35.52  ? 140 THR A O     1 
ATOM   1082 C CB    . THR A 1 140 ? 34.554 54.203 22.482 1.00 38.87  ? 140 THR A CB    1 
ATOM   1083 O OG1   . THR A 1 140 ? 35.693 53.923 21.660 1.00 38.69  ? 140 THR A OG1   1 
ATOM   1084 C CG2   . THR A 1 140 ? 34.211 55.681 22.363 1.00 38.71  ? 140 THR A CG2   1 
ATOM   1085 N N     . GLY A 1 141 ? 32.695 53.398 24.928 1.00 35.04  ? 141 GLY A N     1 
ATOM   1086 C CA    . GLY A 1 141 ? 31.561 53.690 25.788 1.00 32.43  ? 141 GLY A CA    1 
ATOM   1087 C C     . GLY A 1 141 ? 31.931 53.545 27.257 1.00 32.92  ? 141 GLY A C     1 
ATOM   1088 O O     . GLY A 1 141 ? 31.421 54.264 28.117 1.00 31.62  ? 141 GLY A O     1 
ATOM   1089 N N     . ARG A 1 142 ? 32.818 52.602 27.550 1.00 32.57  ? 142 ARG A N     1 
ATOM   1090 C CA    . ARG A 1 142 ? 33.269 52.385 28.921 1.00 34.20  ? 142 ARG A CA    1 
ATOM   1091 C C     . ARG A 1 142 ? 34.042 53.607 29.408 1.00 34.35  ? 142 ARG A C     1 
ATOM   1092 O O     . ARG A 1 142 ? 33.877 54.048 30.547 1.00 33.91  ? 142 ARG A O     1 
ATOM   1093 C CB    . ARG A 1 142 ? 34.150 51.135 28.989 1.00 34.13  ? 142 ARG A CB    1 
ATOM   1094 C CG    . ARG A 1 142 ? 33.417 49.916 29.517 1.00 38.70  ? 142 ARG A CG    1 
ATOM   1095 C CD    . ARG A 1 142 ? 33.746 48.661 28.742 1.00 40.65  ? 142 ARG A CD    1 
ATOM   1096 N NE    . ARG A 1 142 ? 35.176 48.386 28.670 1.00 42.55  ? 142 ARG A NE    1 
ATOM   1097 C CZ    . ARG A 1 142 ? 35.683 47.262 28.177 1.00 45.01  ? 142 ARG A CZ    1 
ATOM   1098 N NH1   . ARG A 1 142 ? 34.873 46.316 27.719 1.00 47.54  ? 142 ARG A NH1   1 
ATOM   1099 N NH2   . ARG A 1 142 ? 36.995 47.077 28.141 1.00 45.87  ? 142 ARG A NH2   1 
ATOM   1100 N N     . ILE A 1 143 ? 34.888 54.160 28.545 1.00 32.37  ? 143 ILE A N     1 
ATOM   1101 C CA    . ILE A 1 143 ? 35.652 55.331 28.933 1.00 33.80  ? 143 ILE A CA    1 
ATOM   1102 C C     . ILE A 1 143 ? 34.674 56.484 29.123 1.00 36.46  ? 143 ILE A C     1 
ATOM   1103 O O     . ILE A 1 143 ? 34.791 57.260 30.070 1.00 36.74  ? 143 ILE A O     1 
ATOM   1104 C CB    . ILE A 1 143 ? 36.718 55.685 27.871 1.00 33.49  ? 143 ILE A CB    1 
ATOM   1105 C CG1   . ILE A 1 143 ? 37.759 54.562 27.809 1.00 32.88  ? 143 ILE A CG1   1 
ATOM   1106 C CG2   . ILE A 1 143 ? 37.398 57.014 28.219 1.00 32.89  ? 143 ILE A CG2   1 
ATOM   1107 C CD1   . ILE A 1 143 ? 38.889 54.794 26.819 1.00 33.22  ? 143 ILE A CD1   1 
ATOM   1108 N N     . ALA A 1 144 ? 33.691 56.567 28.233 1.00 37.80  ? 144 ALA A N     1 
ATOM   1109 C CA    . ALA A 1 144 ? 32.678 57.610 28.303 1.00 40.73  ? 144 ALA A CA    1 
ATOM   1110 C C     . ALA A 1 144 ? 31.950 57.549 29.645 1.00 42.27  ? 144 ALA A C     1 
ATOM   1111 O O     . ALA A 1 144 ? 31.820 58.558 30.340 1.00 43.22  ? 144 ALA A O     1 
ATOM   1112 C CB    . ALA A 1 144 ? 31.681 57.440 27.160 1.00 39.94  ? 144 ALA A CB    1 
ATOM   1113 N N     . GLN A 1 145 ? 31.480 56.357 30.000 1.00 43.89  ? 145 GLN A N     1 
ATOM   1114 C CA    . GLN A 1 145 ? 30.761 56.150 31.254 1.00 46.29  ? 145 GLN A CA    1 
ATOM   1115 C C     . GLN A 1 145 ? 31.635 56.463 32.467 1.00 46.80  ? 145 GLN A C     1 
ATOM   1116 O O     . GLN A 1 145 ? 31.158 57.017 33.460 1.00 46.78  ? 145 GLN A O     1 
ATOM   1117 C CB    . GLN A 1 145 ? 30.266 54.704 31.343 1.00 47.67  ? 145 GLN A CB    1 
ATOM   1118 C CG    . GLN A 1 145 ? 29.602 54.351 32.669 1.00 51.08  ? 145 GLN A CG    1 
ATOM   1119 C CD    . GLN A 1 145 ? 28.283 55.074 32.887 1.00 53.08  ? 145 GLN A CD    1 
ATOM   1120 O OE1   . GLN A 1 145 ? 27.761 55.110 34.004 1.00 55.39  ? 145 GLN A OE1   1 
ATOM   1121 N NE2   . GLN A 1 145 ? 27.730 55.641 31.818 1.00 53.22  ? 145 GLN A NE2   1 
ATOM   1122 N N     . THR A 1 146 ? 32.911 56.104 32.383 1.00 47.45  ? 146 THR A N     1 
ATOM   1123 C CA    . THR A 1 146 ? 33.842 56.345 33.479 1.00 48.99  ? 146 THR A CA    1 
ATOM   1124 C C     . THR A 1 146 ? 34.053 57.835 33.730 1.00 52.13  ? 146 THR A C     1 
ATOM   1125 O O     . THR A 1 146 ? 34.109 58.274 34.878 1.00 53.40  ? 146 THR A O     1 
ATOM   1126 C CB    . THR A 1 146 ? 35.207 55.688 33.204 1.00 47.39  ? 146 THR A CB    1 
ATOM   1127 O OG1   . THR A 1 146 ? 35.048 54.265 33.143 1.00 41.62  ? 146 THR A OG1   1 
ATOM   1128 C CG2   . THR A 1 146 ? 36.201 56.037 34.307 1.00 46.51  ? 146 THR A CG2   1 
ATOM   1129 N N     . LEU A 1 147 ? 34.168 58.612 32.657 1.00 55.02  ? 147 LEU A N     1 
ATOM   1130 C CA    . LEU A 1 147 ? 34.374 60.049 32.786 1.00 58.52  ? 147 LEU A CA    1 
ATOM   1131 C C     . LEU A 1 147 ? 33.190 60.724 33.475 1.00 62.01  ? 147 LEU A C     1 
ATOM   1132 O O     . LEU A 1 147 ? 33.144 61.949 33.597 1.00 62.34  ? 147 LEU A O     1 
ATOM   1133 C CB    . LEU A 1 147 ? 34.609 60.677 31.408 1.00 57.40  ? 147 LEU A CB    1 
ATOM   1134 C CG    . LEU A 1 147 ? 35.900 60.254 30.701 1.00 56.87  ? 147 LEU A CG    1 
ATOM   1135 C CD1   . LEU A 1 147 ? 35.998 60.932 29.345 1.00 56.74  ? 147 LEU A CD1   1 
ATOM   1136 C CD2   . LEU A 1 147 ? 37.096 60.619 31.568 1.00 56.11  ? 147 LEU A CD2   1 
ATOM   1137 N N     . LEU A 1 148 ? 32.237 59.914 33.926 1.00 65.66  ? 148 LEU A N     1 
ATOM   1138 C CA    . LEU A 1 148 ? 31.054 60.413 34.616 1.00 68.48  ? 148 LEU A CA    1 
ATOM   1139 C C     . LEU A 1 148 ? 31.086 59.945 36.068 1.00 70.60  ? 148 LEU A C     1 
ATOM   1140 O O     . LEU A 1 148 ? 30.985 60.752 36.992 1.00 71.35  ? 148 LEU A O     1 
ATOM   1141 C CB    . LEU A 1 148 ? 29.787 59.895 33.934 1.00 69.25  ? 148 LEU A CB    1 
ATOM   1142 C CG    . LEU A 1 148 ? 29.622 60.228 32.449 1.00 69.09  ? 148 LEU A CG    1 
ATOM   1143 C CD1   . LEU A 1 148 ? 28.354 59.575 31.925 1.00 69.66  ? 148 LEU A CD1   1 
ATOM   1144 C CD2   . LEU A 1 148 ? 29.572 61.734 32.254 1.00 69.47  ? 148 LEU A CD2   1 
ATOM   1145 N N     . ASN A 1 149 ? 31.234 58.637 36.260 1.00 72.71  ? 149 ASN A N     1 
ATOM   1146 C CA    . ASN A 1 149 ? 31.289 58.058 37.598 1.00 75.27  ? 149 ASN A CA    1 
ATOM   1147 C C     . ASN A 1 149 ? 32.369 58.738 38.434 1.00 77.02  ? 149 ASN A C     1 
ATOM   1148 O O     . ASN A 1 149 ? 32.345 58.680 39.663 1.00 76.97  ? 149 ASN A O     1 
ATOM   1149 C CB    . ASN A 1 149 ? 31.580 56.557 37.518 1.00 75.24  ? 149 ASN A CB    1 
ATOM   1150 C CG    . ASN A 1 149 ? 30.494 55.788 36.795 1.00 76.04  ? 149 ASN A CG    1 
ATOM   1151 O OD1   . ASN A 1 149 ? 29.323 55.845 37.169 1.00 76.62  ? 149 ASN A OD1   1 
ATOM   1152 N ND2   . ASN A 1 149 ? 30.878 55.057 35.754 1.00 76.54  ? 149 ASN A ND2   1 
ATOM   1153 N N     . LEU A 1 150 ? 33.319 59.378 37.758 1.00 79.50  ? 150 LEU A N     1 
ATOM   1154 C CA    . LEU A 1 150 ? 34.409 60.069 38.436 1.00 81.84  ? 150 LEU A CA    1 
ATOM   1155 C C     . LEU A 1 150 ? 33.933 61.381 39.044 1.00 83.74  ? 150 LEU A C     1 
ATOM   1156 O O     . LEU A 1 150 ? 34.411 61.795 40.101 1.00 84.50  ? 150 LEU A O     1 
ATOM   1157 C CB    . LEU A 1 150 ? 35.555 60.337 37.457 1.00 81.24  ? 150 LEU A CB    1 
ATOM   1158 C CG    . LEU A 1 150 ? 36.298 59.105 36.935 1.00 80.98  ? 150 LEU A CG    1 
ATOM   1159 C CD1   . LEU A 1 150 ? 37.335 59.527 35.907 1.00 80.55  ? 150 LEU A CD1   1 
ATOM   1160 C CD2   . LEU A 1 150 ? 36.960 58.376 38.096 1.00 80.55  ? 150 LEU A CD2   1 
ATOM   1161 N N     . ALA A 1 151 ? 32.988 62.032 38.372 1.00 85.65  ? 151 ALA A N     1 
ATOM   1162 C CA    . ALA A 1 151 ? 32.441 63.295 38.850 1.00 87.47  ? 151 ALA A CA    1 
ATOM   1163 C C     . ALA A 1 151 ? 31.542 63.056 40.061 1.00 88.75  ? 151 ALA A C     1 
ATOM   1164 O O     . ALA A 1 151 ? 30.916 63.983 40.576 1.00 88.63  ? 151 ALA A O     1 
ATOM   1165 C CB    . ALA A 1 151 ? 31.654 63.976 37.737 1.00 87.43  ? 151 ALA A CB    1 
ATOM   1166 N N     . LYS A 1 152 ? 31.485 61.804 40.507 1.00 90.24  ? 152 LYS A N     1 
ATOM   1167 C CA    . LYS A 1 152 ? 30.668 61.430 41.656 1.00 91.90  ? 152 LYS A CA    1 
ATOM   1168 C C     . LYS A 1 152 ? 31.506 61.303 42.925 1.00 93.00  ? 152 LYS A C     1 
ATOM   1169 O O     . LYS A 1 152 ? 31.001 61.491 44.033 1.00 93.28  ? 152 LYS A O     1 
ATOM   1170 C CB    . LYS A 1 152 ? 29.942 60.108 41.381 1.00 91.87  ? 152 LYS A CB    1 
ATOM   1171 C CG    . LYS A 1 152 ? 29.207 59.534 42.588 1.00 92.31  ? 152 LYS A CG    1 
ATOM   1172 C CD    . LYS A 1 152 ? 28.209 60.528 43.166 1.00 92.07  ? 152 LYS A CD    1 
ATOM   1173 C CE    . LYS A 1 152 ? 27.590 60.005 44.452 1.00 92.06  ? 152 LYS A CE    1 
ATOM   1174 N NZ    . LYS A 1 152 ? 26.664 60.997 45.067 1.00 91.82  ? 152 LYS A NZ    1 
ATOM   1175 N N     . GLN A 1 153 ? 32.786 60.983 42.760 1.00 94.11  ? 153 GLN A N     1 
ATOM   1176 C CA    . GLN A 1 153 ? 33.689 60.840 43.897 1.00 95.21  ? 153 GLN A CA    1 
ATOM   1177 C C     . GLN A 1 153 ? 33.714 62.121 44.728 1.00 95.85  ? 153 GLN A C     1 
ATOM   1178 O O     . GLN A 1 153 ? 33.422 63.206 44.224 1.00 95.88  ? 153 GLN A O     1 
ATOM   1179 C CB    . GLN A 1 153 ? 35.103 60.511 43.408 1.00 95.53  ? 153 GLN A CB    1 
ATOM   1180 C CG    . GLN A 1 153 ? 35.230 59.152 42.732 1.00 95.98  ? 153 GLN A CG    1 
ATOM   1181 C CD    . GLN A 1 153 ? 35.028 57.989 43.692 1.00 96.43  ? 153 GLN A CD    1 
ATOM   1182 O OE1   . GLN A 1 153 ? 35.014 56.827 43.283 1.00 96.05  ? 153 GLN A OE1   1 
ATOM   1183 N NE2   . GLN A 1 153 ? 34.877 58.296 44.976 1.00 96.67  ? 153 GLN A NE2   1 
ATOM   1184 N N     . PRO A 1 154 ? 34.062 62.010 46.020 1.00 96.50  ? 154 PRO A N     1 
ATOM   1185 C CA    . PRO A 1 154 ? 34.115 63.183 46.897 1.00 97.06  ? 154 PRO A CA    1 
ATOM   1186 C C     . PRO A 1 154 ? 35.194 64.179 46.477 1.00 97.50  ? 154 PRO A C     1 
ATOM   1187 O O     . PRO A 1 154 ? 35.043 65.388 46.660 1.00 97.57  ? 154 PRO A O     1 
ATOM   1188 C CB    . PRO A 1 154 ? 34.387 62.570 48.269 1.00 96.82  ? 154 PRO A CB    1 
ATOM   1189 C CG    . PRO A 1 154 ? 35.213 61.369 47.933 1.00 96.70  ? 154 PRO A CG    1 
ATOM   1190 C CD    . PRO A 1 154 ? 34.472 60.795 46.747 1.00 96.45  ? 154 PRO A CD    1 
ATOM   1191 N N     . ASP A 1 155 ? 36.277 63.661 45.908 1.00 97.97  ? 155 ASP A N     1 
ATOM   1192 C CA    . ASP A 1 155 ? 37.387 64.494 45.462 1.00 98.48  ? 155 ASP A CA    1 
ATOM   1193 C C     . ASP A 1 155 ? 37.044 65.246 44.181 1.00 98.47  ? 155 ASP A C     1 
ATOM   1194 O O     . ASP A 1 155 ? 37.840 66.044 43.688 1.00 98.33  ? 155 ASP A O     1 
ATOM   1195 C CB    . ASP A 1 155 ? 38.628 63.628 45.230 1.00 99.21  ? 155 ASP A CB    1 
ATOM   1196 C CG    . ASP A 1 155 ? 38.413 62.577 44.158 1.00 99.76  ? 155 ASP A CG    1 
ATOM   1197 O OD1   . ASP A 1 155 ? 38.190 62.955 42.989 1.00 100.21 ? 155 ASP A OD1   1 
ATOM   1198 O OD2   . ASP A 1 155 ? 38.465 61.372 44.485 1.00 100.16 ? 155 ASP A OD2   1 
ATOM   1199 N N     . ALA A 1 156 ? 35.855 64.987 43.646 1.00 98.71  ? 156 ALA A N     1 
ATOM   1200 C CA    . ALA A 1 156 ? 35.409 65.639 42.421 1.00 98.89  ? 156 ALA A CA    1 
ATOM   1201 C C     . ALA A 1 156 ? 35.252 67.140 42.624 1.00 98.82  ? 156 ALA A C     1 
ATOM   1202 O O     . ALA A 1 156 ? 34.826 67.591 43.687 1.00 98.74  ? 156 ALA A O     1 
ATOM   1203 C CB    . ALA A 1 156 ? 34.089 65.035 41.959 1.00 98.92  ? 156 ALA A CB    1 
ATOM   1204 N N     . MET A 1 157 ? 35.599 67.908 41.596 1.00 98.84  ? 157 MET A N     1 
ATOM   1205 C CA    . MET A 1 157 ? 35.494 69.360 41.650 1.00 99.19  ? 157 MET A CA    1 
ATOM   1206 C C     . MET A 1 157 ? 34.408 69.881 40.718 1.00 99.11  ? 157 MET A C     1 
ATOM   1207 O O     . MET A 1 157 ? 33.556 69.121 40.257 1.00 98.97  ? 157 MET A O     1 
ATOM   1208 C CB    . MET A 1 157 ? 36.835 70.004 41.291 1.00 99.71  ? 157 MET A CB    1 
ATOM   1209 C CG    . MET A 1 157 ? 37.825 70.053 42.442 1.00 100.43 ? 157 MET A CG    1 
ATOM   1210 S SD    . MET A 1 157 ? 37.266 71.142 43.773 1.00 101.34 ? 157 MET A SD    1 
ATOM   1211 C CE    . MET A 1 157 ? 36.443 69.973 44.861 1.00 100.90 ? 157 MET A CE    1 
ATOM   1212 N N     . THR A 1 158 ? 34.445 71.181 40.445 1.00 99.03  ? 158 THR A N     1 
ATOM   1213 C CA    . THR A 1 158 ? 33.457 71.807 39.576 1.00 98.85  ? 158 THR A CA    1 
ATOM   1214 C C     . THR A 1 158 ? 34.091 72.523 38.389 1.00 98.59  ? 158 THR A C     1 
ATOM   1215 O O     . THR A 1 158 ? 35.307 72.486 38.201 1.00 98.61  ? 158 THR A O     1 
ATOM   1216 C CB    . THR A 1 158 ? 32.597 72.819 40.357 1.00 99.09  ? 158 THR A CB    1 
ATOM   1217 O OG1   . THR A 1 158 ? 33.446 73.800 40.966 1.00 99.43  ? 158 THR A OG1   1 
ATOM   1218 C CG2   . THR A 1 158 ? 31.792 72.110 41.435 1.00 98.93  ? 158 THR A CG2   1 
ATOM   1219 N N     . HIS A 1 159 ? 33.246 73.178 37.599 1.00 98.32  ? 159 HIS A N     1 
ATOM   1220 C CA    . HIS A 1 159 ? 33.670 73.911 36.409 1.00 98.44  ? 159 HIS A CA    1 
ATOM   1221 C C     . HIS A 1 159 ? 32.403 74.383 35.700 1.00 98.48  ? 159 HIS A C     1 
ATOM   1222 O O     . HIS A 1 159 ? 31.397 73.674 35.688 1.00 98.66  ? 159 HIS A O     1 
ATOM   1223 C CB    . HIS A 1 159 ? 34.481 72.990 35.488 1.00 98.46  ? 159 HIS A CB    1 
ATOM   1224 C CG    . HIS A 1 159 ? 34.897 73.625 34.197 1.00 98.19  ? 159 HIS A CG    1 
ATOM   1225 N ND1   . HIS A 1 159 ? 34.000 73.948 33.202 1.00 98.12  ? 159 HIS A ND1   1 
ATOM   1226 C CD2   . HIS A 1 159 ? 36.116 73.988 33.735 1.00 98.24  ? 159 HIS A CD2   1 
ATOM   1227 C CE1   . HIS A 1 159 ? 34.648 74.482 32.182 1.00 98.06  ? 159 HIS A CE1   1 
ATOM   1228 N NE2   . HIS A 1 159 ? 35.934 74.518 32.480 1.00 98.03  ? 159 HIS A NE2   1 
ATOM   1229 N N     . PRO A 1 160 ? 32.430 75.587 35.105 1.00 98.49  ? 160 PRO A N     1 
ATOM   1230 C CA    . PRO A 1 160 ? 31.235 76.082 34.413 1.00 98.31  ? 160 PRO A CA    1 
ATOM   1231 C C     . PRO A 1 160 ? 30.631 75.065 33.446 1.00 98.00  ? 160 PRO A C     1 
ATOM   1232 O O     . PRO A 1 160 ? 29.415 74.875 33.415 1.00 97.89  ? 160 PRO A O     1 
ATOM   1233 C CB    . PRO A 1 160 ? 31.737 77.348 33.711 1.00 98.47  ? 160 PRO A CB    1 
ATOM   1234 C CG    . PRO A 1 160 ? 33.212 77.104 33.552 1.00 98.41  ? 160 PRO A CG    1 
ATOM   1235 C CD    . PRO A 1 160 ? 33.573 76.486 34.875 1.00 98.58  ? 160 PRO A CD    1 
ATOM   1236 N N     . ASP A 1 161 ? 31.485 74.410 32.667 1.00 97.78  ? 161 ASP A N     1 
ATOM   1237 C CA    . ASP A 1 161 ? 31.035 73.407 31.706 1.00 97.28  ? 161 ASP A CA    1 
ATOM   1238 C C     . ASP A 1 161 ? 31.041 72.019 32.346 1.00 96.68  ? 161 ASP A C     1 
ATOM   1239 O O     . ASP A 1 161 ? 31.830 71.153 31.965 1.00 96.88  ? 161 ASP A O     1 
ATOM   1240 C CB    . ASP A 1 161 ? 31.944 73.407 30.473 1.00 97.34  ? 161 ASP A CB    1 
ATOM   1241 C CG    . ASP A 1 161 ? 32.006 74.760 29.789 1.00 97.19  ? 161 ASP A CG    1 
ATOM   1242 O OD1   . ASP A 1 161 ? 32.727 74.881 28.777 1.00 97.34  ? 161 ASP A OD1   1 
ATOM   1243 O OD2   . ASP A 1 161 ? 31.336 75.703 30.262 1.00 96.87  ? 161 ASP A OD2   1 
ATOM   1244 N N     . GLY A 1 162 ? 30.160 71.816 33.321 1.00 95.88  ? 162 GLY A N     1 
ATOM   1245 C CA    . GLY A 1 162 ? 30.086 70.533 33.997 1.00 94.77  ? 162 GLY A CA    1 
ATOM   1246 C C     . GLY A 1 162 ? 30.966 70.486 35.231 1.00 94.04  ? 162 GLY A C     1 
ATOM   1247 O O     . GLY A 1 162 ? 30.696 71.170 36.219 1.00 93.94  ? 162 GLY A O     1 
ATOM   1248 N N     . MET A 1 163 ? 32.018 69.675 35.175 1.00 92.99  ? 163 MET A N     1 
ATOM   1249 C CA    . MET A 1 163 ? 32.949 69.542 36.291 1.00 91.77  ? 163 MET A CA    1 
ATOM   1250 C C     . MET A 1 163 ? 34.332 69.109 35.812 1.00 90.10  ? 163 MET A C     1 
ATOM   1251 O O     . MET A 1 163 ? 34.471 68.484 34.760 1.00 90.02  ? 163 MET A O     1 
ATOM   1252 C CB    . MET A 1 163 ? 32.425 68.524 37.310 1.00 92.99  ? 163 MET A CB    1 
ATOM   1253 C CG    . MET A 1 163 ? 31.150 68.941 38.025 1.00 94.31  ? 163 MET A CG    1 
ATOM   1254 S SD    . MET A 1 163 ? 30.666 67.769 39.310 1.00 96.39  ? 163 MET A SD    1 
ATOM   1255 C CE    . MET A 1 163 ? 29.626 66.641 38.370 1.00 96.06  ? 163 MET A CE    1 
ATOM   1256 N N     . GLN A 1 164 ? 35.353 69.450 36.593 1.00 87.89  ? 164 GLN A N     1 
ATOM   1257 C CA    . GLN A 1 164 ? 36.728 69.094 36.263 1.00 85.24  ? 164 GLN A CA    1 
ATOM   1258 C C     . GLN A 1 164 ? 37.222 67.944 37.128 1.00 83.11  ? 164 GLN A C     1 
ATOM   1259 O O     . GLN A 1 164 ? 36.842 67.819 38.292 1.00 82.95  ? 164 GLN A O     1 
ATOM   1260 C CB    . GLN A 1 164 ? 37.661 70.293 36.455 1.00 86.00  ? 164 GLN A CB    1 
ATOM   1261 C CG    . GLN A 1 164 ? 37.604 71.332 35.349 1.00 86.75  ? 164 GLN A CG    1 
ATOM   1262 C CD    . GLN A 1 164 ? 38.673 72.403 35.503 1.00 87.06  ? 164 GLN A CD    1 
ATOM   1263 O OE1   . GLN A 1 164 ? 38.836 73.264 34.638 1.00 87.05  ? 164 GLN A OE1   1 
ATOM   1264 N NE2   . GLN A 1 164 ? 39.408 72.352 36.609 1.00 86.88  ? 164 GLN A NE2   1 
ATOM   1265 N N     . ILE A 1 165 ? 38.073 67.104 36.547 1.00 80.15  ? 165 ILE A N     1 
ATOM   1266 C CA    . ILE A 1 165 ? 38.641 65.971 37.263 1.00 76.91  ? 165 ILE A CA    1 
ATOM   1267 C C     . ILE A 1 165 ? 40.105 65.808 36.877 1.00 74.14  ? 165 ILE A C     1 
ATOM   1268 O O     . ILE A 1 165 ? 40.510 66.172 35.773 1.00 73.80  ? 165 ILE A O     1 
ATOM   1269 C CB    . ILE A 1 165 ? 37.889 64.647 36.951 1.00 77.38  ? 165 ILE A CB    1 
ATOM   1270 C CG1   . ILE A 1 165 ? 38.066 64.261 35.478 1.00 77.81  ? 165 ILE A CG1   1 
ATOM   1271 C CG2   . ILE A 1 165 ? 36.415 64.791 37.300 1.00 77.35  ? 165 ILE A CG2   1 
ATOM   1272 C CD1   . ILE A 1 165 ? 37.401 65.200 34.489 1.00 77.72  ? 165 ILE A CD1   1 
ATOM   1273 N N     . LYS A 1 166 ? 40.896 65.272 37.798 1.00 71.25  ? 166 LYS A N     1 
ATOM   1274 C CA    . LYS A 1 166 ? 42.315 65.055 37.556 1.00 68.64  ? 166 LYS A CA    1 
ATOM   1275 C C     . LYS A 1 166 ? 42.586 63.561 37.434 1.00 65.91  ? 166 LYS A C     1 
ATOM   1276 O O     . LYS A 1 166 ? 42.865 62.883 38.423 1.00 66.61  ? 166 LYS A O     1 
ATOM   1277 C CB    . LYS A 1 166 ? 43.141 65.656 38.699 1.00 69.39  ? 166 LYS A CB    1 
ATOM   1278 C CG    . LYS A 1 166 ? 42.683 65.236 40.087 1.00 70.01  ? 166 LYS A CG    1 
ATOM   1279 C CD    . LYS A 1 166 ? 43.472 65.949 41.172 1.00 70.82  ? 166 LYS A CD    1 
ATOM   1280 C CE    . LYS A 1 166 ? 42.960 65.575 42.554 1.00 71.04  ? 166 LYS A CE    1 
ATOM   1281 N NZ    . LYS A 1 166 ? 41.515 65.909 42.713 1.00 71.34  ? 166 LYS A NZ    1 
ATOM   1282 N N     . ILE A 1 167 ? 42.496 63.049 36.212 1.00 62.28  ? 167 ILE A N     1 
ATOM   1283 C CA    . ILE A 1 167 ? 42.721 61.632 35.975 1.00 57.86  ? 167 ILE A CA    1 
ATOM   1284 C C     . ILE A 1 167 ? 43.738 61.426 34.858 1.00 54.64  ? 167 ILE A C     1 
ATOM   1285 O O     . ILE A 1 167 ? 43.760 62.171 33.879 1.00 54.80  ? 167 ILE A O     1 
ATOM   1286 C CB    . ILE A 1 167 ? 41.396 60.919 35.604 1.00 57.97  ? 167 ILE A CB    1 
ATOM   1287 C CG1   . ILE A 1 167 ? 41.548 59.410 35.790 1.00 58.02  ? 167 ILE A CG1   1 
ATOM   1288 C CG2   . ILE A 1 167 ? 41.003 61.247 34.172 1.00 57.95  ? 167 ILE A CG2   1 
ATOM   1289 C CD1   . ILE A 1 167 ? 41.722 59.001 37.234 1.00 57.93  ? 167 ILE A CD1   1 
ATOM   1290 N N     . THR A 1 168 ? 44.580 60.411 35.012 1.00 50.35  ? 168 THR A N     1 
ATOM   1291 C CA    . THR A 1 168 ? 45.602 60.106 34.019 1.00 47.10  ? 168 THR A CA    1 
ATOM   1292 C C     . THR A 1 168 ? 45.123 59.021 33.060 1.00 45.40  ? 168 THR A C     1 
ATOM   1293 O O     . THR A 1 168 ? 44.076 58.406 33.279 1.00 43.56  ? 168 THR A O     1 
ATOM   1294 C CB    . THR A 1 168 ? 46.886 59.599 34.688 1.00 47.01  ? 168 THR A CB    1 
ATOM   1295 O OG1   . THR A 1 168 ? 46.634 58.323 35.288 1.00 45.51  ? 168 THR A OG1   1 
ATOM   1296 C CG2   . THR A 1 168 ? 47.351 60.576 35.762 1.00 48.25  ? 168 THR A CG2   1 
ATOM   1297 N N     . ARG A 1 169 ? 45.892 58.790 31.999 1.00 42.54  ? 169 ARG A N     1 
ATOM   1298 C CA    . ARG A 1 169 ? 45.550 57.755 31.029 1.00 40.90  ? 169 ARG A CA    1 
ATOM   1299 C C     . ARG A 1 169 ? 45.647 56.401 31.723 1.00 39.82  ? 169 ARG A C     1 
ATOM   1300 O O     . ARG A 1 169 ? 44.819 55.515 31.505 1.00 37.61  ? 169 ARG A O     1 
ATOM   1301 C CB    . ARG A 1 169 ? 46.520 57.774 29.840 1.00 40.16  ? 169 ARG A CB    1 
ATOM   1302 C CG    . ARG A 1 169 ? 46.348 58.934 28.865 1.00 40.63  ? 169 ARG A CG    1 
ATOM   1303 C CD    . ARG A 1 169 ? 47.376 58.830 27.732 1.00 41.45  ? 169 ARG A CD    1 
ATOM   1304 N NE    . ARG A 1 169 ? 47.215 59.866 26.711 1.00 42.66  ? 169 ARG A NE    1 
ATOM   1305 C CZ    . ARG A 1 169 ? 47.971 59.967 25.619 1.00 43.83  ? 169 ARG A CZ    1 
ATOM   1306 N NH1   . ARG A 1 169 ? 48.948 59.095 25.399 1.00 43.92  ? 169 ARG A NH1   1 
ATOM   1307 N NH2   . ARG A 1 169 ? 47.748 60.937 24.739 1.00 43.63  ? 169 ARG A NH2   1 
ATOM   1308 N N     . GLN A 1 170 ? 46.668 56.249 32.562 1.00 38.48  ? 170 GLN A N     1 
ATOM   1309 C CA    . GLN A 1 170 ? 46.882 54.998 33.279 1.00 38.65  ? 170 GLN A CA    1 
ATOM   1310 C C     . GLN A 1 170 ? 45.722 54.656 34.206 1.00 37.55  ? 170 GLN A C     1 
ATOM   1311 O O     . GLN A 1 170 ? 45.252 53.519 34.225 1.00 38.69  ? 170 GLN A O     1 
ATOM   1312 C CB    . GLN A 1 170 ? 48.187 55.060 34.085 1.00 40.09  ? 170 GLN A CB    1 
ATOM   1313 C CG    . GLN A 1 170 ? 48.486 53.789 34.872 1.00 42.56  ? 170 GLN A CG    1 
ATOM   1314 C CD    . GLN A 1 170 ? 49.843 53.823 35.558 1.00 44.26  ? 170 GLN A CD    1 
ATOM   1315 O OE1   . GLN A 1 170 ? 50.165 54.769 36.274 1.00 44.15  ? 170 GLN A OE1   1 
ATOM   1316 N NE2   . GLN A 1 170 ? 50.639 52.783 35.345 1.00 45.16  ? 170 GLN A NE2   1 
ATOM   1317 N N     . GLU A 1 171 ? 45.268 55.636 34.979 1.00 38.31  ? 171 GLU A N     1 
ATOM   1318 C CA    . GLU A 1 171 ? 44.162 55.415 35.901 1.00 38.43  ? 171 GLU A CA    1 
ATOM   1319 C C     . GLU A 1 171 ? 42.903 55.004 35.147 1.00 37.16  ? 171 GLU A C     1 
ATOM   1320 O O     . GLU A 1 171 ? 42.186 54.094 35.568 1.00 35.96  ? 171 GLU A O     1 
ATOM   1321 C CB    . GLU A 1 171 ? 43.896 56.678 36.722 1.00 41.18  ? 171 GLU A CB    1 
ATOM   1322 C CG    . GLU A 1 171 ? 44.998 57.002 37.724 1.00 45.51  ? 171 GLU A CG    1 
ATOM   1323 C CD    . GLU A 1 171 ? 44.717 58.267 38.518 1.00 48.03  ? 171 GLU A CD    1 
ATOM   1324 O OE1   . GLU A 1 171 ? 44.706 59.364 37.919 1.00 49.66  ? 171 GLU A OE1   1 
ATOM   1325 O OE2   . GLU A 1 171 ? 44.501 58.162 39.743 1.00 51.30  ? 171 GLU A OE2   1 
ATOM   1326 N N     . ILE A 1 172 ? 42.638 55.678 34.031 1.00 33.21  ? 172 ILE A N     1 
ATOM   1327 C CA    . ILE A 1 172 ? 41.473 55.363 33.216 1.00 31.47  ? 172 ILE A CA    1 
ATOM   1328 C C     . ILE A 1 172 ? 41.600 53.943 32.688 1.00 29.55  ? 172 ILE A C     1 
ATOM   1329 O O     . ILE A 1 172 ? 40.643 53.169 32.725 1.00 28.47  ? 172 ILE A O     1 
ATOM   1330 C CB    . ILE A 1 172 ? 41.348 56.324 32.006 1.00 32.05  ? 172 ILE A CB    1 
ATOM   1331 C CG1   . ILE A 1 172 ? 40.946 57.720 32.484 1.00 31.84  ? 172 ILE A CG1   1 
ATOM   1332 C CG2   . ILE A 1 172 ? 40.322 55.785 31.011 1.00 30.72  ? 172 ILE A CG2   1 
ATOM   1333 C CD1   . ILE A 1 172 ? 40.874 58.748 31.364 1.00 32.06  ? 172 ILE A CD1   1 
ATOM   1334 N N     . GLY A 1 173 ? 42.789 53.608 32.195 1.00 28.33  ? 173 GLY A N     1 
ATOM   1335 C CA    . GLY A 1 173 ? 43.023 52.280 31.658 1.00 29.61  ? 173 GLY A CA    1 
ATOM   1336 C C     . GLY A 1 173 ? 42.833 51.163 32.671 1.00 30.72  ? 173 GLY A C     1 
ATOM   1337 O O     . GLY A 1 173 ? 42.389 50.065 32.319 1.00 30.65  ? 173 GLY A O     1 
ATOM   1338 N N     . GLN A 1 174 ? 43.176 51.434 33.927 1.00 30.32  ? 174 GLN A N     1 
ATOM   1339 C CA    . GLN A 1 174 ? 43.031 50.435 34.987 1.00 30.66  ? 174 GLN A CA    1 
ATOM   1340 C C     . GLN A 1 174 ? 41.562 50.245 35.321 1.00 29.83  ? 174 GLN A C     1 
ATOM   1341 O O     . GLN A 1 174 ? 41.152 49.190 35.807 1.00 31.29  ? 174 GLN A O     1 
ATOM   1342 C CB    . GLN A 1 174 ? 43.767 50.882 36.246 1.00 30.98  ? 174 GLN A CB    1 
ATOM   1343 C CG    . GLN A 1 174 ? 45.255 51.051 36.066 1.00 34.87  ? 174 GLN A CG    1 
ATOM   1344 C CD    . GLN A 1 174 ? 45.922 51.570 37.319 1.00 37.74  ? 174 GLN A CD    1 
ATOM   1345 O OE1   . GLN A 1 174 ? 45.556 52.624 37.835 1.00 38.48  ? 174 GLN A OE1   1 
ATOM   1346 N NE2   . GLN A 1 174 ? 46.909 50.832 37.815 1.00 39.77  ? 174 GLN A NE2   1 
ATOM   1347 N N     . ILE A 1 175 ? 40.772 51.280 35.070 1.00 29.66  ? 175 ILE A N     1 
ATOM   1348 C CA    . ILE A 1 175 ? 39.349 51.216 35.344 1.00 31.08  ? 175 ILE A CA    1 
ATOM   1349 C C     . ILE A 1 175 ? 38.562 50.537 34.222 1.00 32.19  ? 175 ILE A C     1 
ATOM   1350 O O     . ILE A 1 175 ? 37.655 49.754 34.494 1.00 33.18  ? 175 ILE A O     1 
ATOM   1351 C CB    . ILE A 1 175 ? 38.777 52.628 35.596 1.00 31.74  ? 175 ILE A CB    1 
ATOM   1352 C CG1   . ILE A 1 175 ? 39.393 53.208 36.872 1.00 30.36  ? 175 ILE A CG1   1 
ATOM   1353 C CG2   . ILE A 1 175 ? 37.250 52.572 35.705 1.00 32.20  ? 175 ILE A CG2   1 
ATOM   1354 C CD1   . ILE A 1 175 ? 39.036 54.662 37.130 1.00 32.23  ? 175 ILE A CD1   1 
ATOM   1355 N N     . VAL A 1 176 ? 38.916 50.808 32.967 1.00 31.71  ? 176 VAL A N     1 
ATOM   1356 C CA    . VAL A 1 176 ? 38.183 50.220 31.844 1.00 31.07  ? 176 VAL A CA    1 
ATOM   1357 C C     . VAL A 1 176 ? 38.809 48.982 31.218 1.00 30.67  ? 176 VAL A C     1 
ATOM   1358 O O     . VAL A 1 176 ? 38.169 48.308 30.404 1.00 31.52  ? 176 VAL A O     1 
ATOM   1359 C CB    . VAL A 1 176 ? 37.940 51.256 30.716 1.00 31.86  ? 176 VAL A CB    1 
ATOM   1360 C CG1   . VAL A 1 176 ? 37.277 52.496 31.291 1.00 30.51  ? 176 VAL A CG1   1 
ATOM   1361 C CG2   . VAL A 1 176 ? 39.252 51.604 30.016 1.00 29.94  ? 176 VAL A CG2   1 
ATOM   1362 N N     . GLY A 1 177 ? 40.050 48.683 31.593 1.00 29.17  ? 177 GLY A N     1 
ATOM   1363 C CA    . GLY A 1 177 ? 40.734 47.524 31.050 1.00 30.56  ? 177 GLY A CA    1 
ATOM   1364 C C     . GLY A 1 177 ? 41.379 47.791 29.702 1.00 32.64  ? 177 GLY A C     1 
ATOM   1365 O O     . GLY A 1 177 ? 41.118 47.081 28.733 1.00 33.19  ? 177 GLY A O     1 
ATOM   1366 N N     . CYS A 1 178 ? 42.243 48.800 29.638 1.00 32.82  ? 178 CYS A N     1 
ATOM   1367 C CA    . CYS A 1 178 ? 42.902 49.145 28.383 1.00 34.68  ? 178 CYS A CA    1 
ATOM   1368 C C     . CYS A 1 178 ? 44.266 49.793 28.618 1.00 33.88  ? 178 CYS A C     1 
ATOM   1369 O O     . CYS A 1 178 ? 44.515 50.358 29.682 1.00 33.75  ? 178 CYS A O     1 
ATOM   1370 C CB    . CYS A 1 178 ? 42.001 50.095 27.596 1.00 36.70  ? 178 CYS A CB    1 
ATOM   1371 S SG    . CYS A 1 178 ? 42.594 50.490 25.958 1.00 47.42  ? 178 CYS A SG    1 
ATOM   1372 N N     . SER A 1 179 ? 45.143 49.713 27.621 1.00 33.25  ? 179 SER A N     1 
ATOM   1373 C CA    . SER A 1 179 ? 46.480 50.294 27.723 1.00 33.35  ? 179 SER A CA    1 
ATOM   1374 C C     . SER A 1 179 ? 46.421 51.820 27.708 1.00 33.52  ? 179 SER A C     1 
ATOM   1375 O O     . SER A 1 179 ? 45.445 52.405 27.245 1.00 33.64  ? 179 SER A O     1 
ATOM   1376 C CB    . SER A 1 179 ? 47.352 49.822 26.556 1.00 34.24  ? 179 SER A CB    1 
ATOM   1377 O OG    . SER A 1 179 ? 46.923 50.406 25.334 1.00 35.28  ? 179 SER A OG    1 
ATOM   1378 N N     . ARG A 1 180 ? 47.468 52.464 28.212 1.00 34.69  ? 180 ARG A N     1 
ATOM   1379 C CA    . ARG A 1 180 ? 47.509 53.923 28.223 1.00 37.83  ? 180 ARG A CA    1 
ATOM   1380 C C     . ARG A 1 180 ? 47.452 54.452 26.798 1.00 37.02  ? 180 ARG A C     1 
ATOM   1381 O O     . ARG A 1 180 ? 46.763 55.430 26.516 1.00 35.44  ? 180 ARG A O     1 
ATOM   1382 C CB    . ARG A 1 180 ? 48.786 54.432 28.900 1.00 40.15  ? 180 ARG A CB    1 
ATOM   1383 C CG    . ARG A 1 180 ? 48.643 54.632 30.390 1.00 44.03  ? 180 ARG A CG    1 
ATOM   1384 C CD    . ARG A 1 180 ? 49.835 55.376 30.968 1.00 47.50  ? 180 ARG A CD    1 
ATOM   1385 N NE    . ARG A 1 180 ? 51.081 54.635 30.811 1.00 49.79  ? 180 ARG A NE    1 
ATOM   1386 C CZ    . ARG A 1 180 ? 52.226 54.979 31.395 1.00 53.27  ? 180 ARG A CZ    1 
ATOM   1387 N NH1   . ARG A 1 180 ? 52.277 56.053 32.174 1.00 53.93  ? 180 ARG A NH1   1 
ATOM   1388 N NH2   . ARG A 1 180 ? 53.318 54.248 31.206 1.00 53.77  ? 180 ARG A NH2   1 
ATOM   1389 N N     . GLU A 1 181 ? 48.193 53.794 25.912 1.00 38.06  ? 181 GLU A N     1 
ATOM   1390 C CA    . GLU A 1 181 ? 48.244 54.163 24.502 1.00 39.78  ? 181 GLU A CA    1 
ATOM   1391 C C     . GLU A 1 181 ? 46.840 54.266 23.918 1.00 38.17  ? 181 GLU A C     1 
ATOM   1392 O O     . GLU A 1 181 ? 46.442 55.311 23.400 1.00 38.03  ? 181 GLU A O     1 
ATOM   1393 C CB    . GLU A 1 181 ? 49.045 53.116 23.718 1.00 43.22  ? 181 GLU A CB    1 
ATOM   1394 C CG    . GLU A 1 181 ? 48.843 53.175 22.209 1.00 49.71  ? 181 GLU A CG    1 
ATOM   1395 C CD    . GLU A 1 181 ? 49.314 51.915 21.501 1.00 52.77  ? 181 GLU A CD    1 
ATOM   1396 O OE1   . GLU A 1 181 ? 50.536 51.650 21.493 1.00 55.50  ? 181 GLU A OE1   1 
ATOM   1397 O OE2   . GLU A 1 181 ? 48.456 51.187 20.954 1.00 54.60  ? 181 GLU A OE2   1 
ATOM   1398 N N     . THR A 1 182 ? 46.090 53.173 24.006 1.00 36.69  ? 182 THR A N     1 
ATOM   1399 C CA    . THR A 1 182 ? 44.736 53.133 23.473 1.00 35.14  ? 182 THR A CA    1 
ATOM   1400 C C     . THR A 1 182 ? 43.834 54.167 24.136 1.00 32.67  ? 182 THR A C     1 
ATOM   1401 O O     . THR A 1 182 ? 43.013 54.797 23.472 1.00 32.08  ? 182 THR A O     1 
ATOM   1402 C CB    . THR A 1 182 ? 44.117 51.738 23.648 1.00 37.66  ? 182 THR A CB    1 
ATOM   1403 O OG1   . THR A 1 182 ? 44.998 50.754 23.094 1.00 40.70  ? 182 THR A OG1   1 
ATOM   1404 C CG2   . THR A 1 182 ? 42.774 51.658 22.943 1.00 37.30  ? 182 THR A CG2   1 
ATOM   1405 N N     . VAL A 1 183 ? 43.980 54.343 25.444 1.00 30.04  ? 183 VAL A N     1 
ATOM   1406 C CA    . VAL A 1 183 ? 43.168 55.326 26.150 1.00 29.72  ? 183 VAL A CA    1 
ATOM   1407 C C     . VAL A 1 183 ? 43.401 56.693 25.519 1.00 29.84  ? 183 VAL A C     1 
ATOM   1408 O O     . VAL A 1 183 ? 42.466 57.464 25.317 1.00 30.08  ? 183 VAL A O     1 
ATOM   1409 C CB    . VAL A 1 183 ? 43.535 55.403 27.656 1.00 29.24  ? 183 VAL A CB    1 
ATOM   1410 C CG1   . VAL A 1 183 ? 42.783 56.543 28.305 1.00 27.49  ? 183 VAL A CG1   1 
ATOM   1411 C CG2   . VAL A 1 183 ? 43.191 54.080 28.352 1.00 27.85  ? 183 VAL A CG2   1 
ATOM   1412 N N     . GLY A 1 184 ? 44.660 56.988 25.215 1.00 30.22  ? 184 GLY A N     1 
ATOM   1413 C CA    . GLY A 1 184 ? 44.986 58.260 24.596 1.00 32.70  ? 184 GLY A CA    1 
ATOM   1414 C C     . GLY A 1 184 ? 44.257 58.454 23.274 1.00 32.94  ? 184 GLY A C     1 
ATOM   1415 O O     . GLY A 1 184 ? 43.674 59.510 23.032 1.00 31.46  ? 184 GLY A O     1 
ATOM   1416 N N     . ARG A 1 185 ? 44.285 57.435 22.418 1.00 33.04  ? 185 ARG A N     1 
ATOM   1417 C CA    . ARG A 1 185 ? 43.619 57.515 21.117 1.00 33.90  ? 185 ARG A CA    1 
ATOM   1418 C C     . ARG A 1 185 ? 42.111 57.715 21.260 1.00 33.14  ? 185 ARG A C     1 
ATOM   1419 O O     . ARG A 1 185 ? 41.502 58.485 20.514 1.00 31.76  ? 185 ARG A O     1 
ATOM   1420 C CB    . ARG A 1 185 ? 43.889 56.248 20.299 1.00 34.55  ? 185 ARG A CB    1 
ATOM   1421 C CG    . ARG A 1 185 ? 45.352 56.040 19.941 1.00 37.80  ? 185 ARG A CG    1 
ATOM   1422 C CD    . ARG A 1 185 ? 45.556 54.772 19.130 1.00 38.62  ? 185 ARG A CD    1 
ATOM   1423 N NE    . ARG A 1 185 ? 46.966 54.571 18.810 1.00 42.90  ? 185 ARG A NE    1 
ATOM   1424 C CZ    . ARG A 1 185 ? 47.451 53.512 18.170 1.00 44.11  ? 185 ARG A CZ    1 
ATOM   1425 N NH1   . ARG A 1 185 ? 48.754 53.422 17.927 1.00 44.60  ? 185 ARG A NH1   1 
ATOM   1426 N NH2   . ARG A 1 185 ? 46.638 52.543 17.773 1.00 45.64  ? 185 ARG A NH2   1 
ATOM   1427 N N     . ILE A 1 186 ? 41.513 57.026 22.225 1.00 32.03  ? 186 ILE A N     1 
ATOM   1428 C CA    . ILE A 1 186 ? 40.077 57.135 22.450 1.00 32.58  ? 186 ILE A CA    1 
ATOM   1429 C C     . ILE A 1 186 ? 39.681 58.505 22.998 1.00 33.77  ? 186 ILE A C     1 
ATOM   1430 O O     . ILE A 1 186 ? 38.648 59.061 22.605 1.00 33.31  ? 186 ILE A O     1 
ATOM   1431 C CB    . ILE A 1 186 ? 39.587 56.026 23.404 1.00 33.16  ? 186 ILE A CB    1 
ATOM   1432 C CG1   . ILE A 1 186 ? 39.822 54.662 22.752 1.00 34.84  ? 186 ILE A CG1   1 
ATOM   1433 C CG2   . ILE A 1 186 ? 38.112 56.214 23.715 1.00 32.60  ? 186 ILE A CG2   1 
ATOM   1434 C CD1   . ILE A 1 186 ? 39.527 53.486 23.659 1.00 35.65  ? 186 ILE A CD1   1 
ATOM   1435 N N     . LEU A 1 187 ? 40.494 59.052 23.899 1.00 33.32  ? 187 LEU A N     1 
ATOM   1436 C CA    . LEU A 1 187 ? 40.203 60.370 24.459 1.00 36.11  ? 187 LEU A CA    1 
ATOM   1437 C C     . LEU A 1 187 ? 40.191 61.404 23.337 1.00 38.33  ? 187 LEU A C     1 
ATOM   1438 O O     . LEU A 1 187 ? 39.369 62.323 23.340 1.00 40.04  ? 187 LEU A O     1 
ATOM   1439 C CB    . LEU A 1 187 ? 41.250 60.769 25.507 1.00 35.38  ? 187 LEU A CB    1 
ATOM   1440 C CG    . LEU A 1 187 ? 41.245 60.011 26.839 1.00 35.69  ? 187 LEU A CG    1 
ATOM   1441 C CD1   . LEU A 1 187 ? 42.440 60.443 27.676 1.00 35.94  ? 187 LEU A CD1   1 
ATOM   1442 C CD2   . LEU A 1 187 ? 39.945 60.273 27.582 1.00 34.04  ? 187 LEU A CD2   1 
ATOM   1443 N N     . LYS A 1 188 ? 41.103 61.249 22.381 1.00 40.79  ? 188 LYS A N     1 
ATOM   1444 C CA    . LYS A 1 188 ? 41.191 62.176 21.254 1.00 44.70  ? 188 LYS A CA    1 
ATOM   1445 C C     . LYS A 1 188 ? 39.941 62.097 20.386 1.00 45.99  ? 188 LYS A C     1 
ATOM   1446 O O     . LYS A 1 188 ? 39.499 63.105 19.834 1.00 46.75  ? 188 LYS A O     1 
ATOM   1447 C CB    . LYS A 1 188 ? 42.415 61.875 20.388 1.00 45.84  ? 188 LYS A CB    1 
ATOM   1448 C CG    . LYS A 1 188 ? 42.529 62.796 19.175 1.00 48.30  ? 188 LYS A CG    1 
ATOM   1449 C CD    . LYS A 1 188 ? 43.488 62.249 18.130 1.00 50.54  ? 188 LYS A CD    1 
ATOM   1450 C CE    . LYS A 1 188 ? 43.473 63.109 16.871 1.00 51.84  ? 188 LYS A CE    1 
ATOM   1451 N NZ    . LYS A 1 188 ? 44.255 62.490 15.763 1.00 53.75  ? 188 LYS A NZ    1 
ATOM   1452 N N     . MET A 1 189 ? 39.383 60.897 20.249 1.00 45.85  ? 189 MET A N     1 
ATOM   1453 C CA    . MET A 1 189 ? 38.177 60.725 19.450 1.00 47.27  ? 189 MET A CA    1 
ATOM   1454 C C     . MET A 1 189 ? 37.010 61.405 20.142 1.00 47.74  ? 189 MET A C     1 
ATOM   1455 O O     . MET A 1 189 ? 36.198 62.069 19.497 1.00 47.11  ? 189 MET A O     1 
ATOM   1456 C CB    . MET A 1 189 ? 37.849 59.243 19.256 1.00 47.42  ? 189 MET A CB    1 
ATOM   1457 C CG    . MET A 1 189 ? 38.796 58.502 18.340 1.00 48.14  ? 189 MET A CG    1 
ATOM   1458 S SD    . MET A 1 189 ? 38.162 56.865 17.957 1.00 51.24  ? 189 MET A SD    1 
ATOM   1459 C CE    . MET A 1 189 ? 37.080 57.234 16.555 1.00 51.08  ? 189 MET A CE    1 
ATOM   1460 N N     . LEU A 1 190 ? 36.933 61.237 21.459 1.00 48.09  ? 190 LEU A N     1 
ATOM   1461 C CA    . LEU A 1 190 ? 35.863 61.834 22.241 1.00 50.38  ? 190 LEU A CA    1 
ATOM   1462 C C     . LEU A 1 190 ? 35.854 63.356 22.129 1.00 52.69  ? 190 LEU A C     1 
ATOM   1463 O O     . LEU A 1 190 ? 34.796 63.957 21.933 1.00 52.67  ? 190 LEU A O     1 
ATOM   1464 C CB    . LEU A 1 190 ? 35.976 61.417 23.711 1.00 48.90  ? 190 LEU A CB    1 
ATOM   1465 C CG    . LEU A 1 190 ? 35.786 59.921 23.994 1.00 49.10  ? 190 LEU A CG    1 
ATOM   1466 C CD1   . LEU A 1 190 ? 35.921 59.656 25.484 1.00 47.36  ? 190 LEU A CD1   1 
ATOM   1467 C CD2   . LEU A 1 190 ? 34.416 59.469 23.498 1.00 48.44  ? 190 LEU A CD2   1 
ATOM   1468 N N     . GLU A 1 191 ? 37.018 63.989 22.248 1.00 54.34  ? 191 GLU A N     1 
ATOM   1469 C CA    . GLU A 1 191 ? 37.052 65.441 22.140 1.00 57.02  ? 191 GLU A CA    1 
ATOM   1470 C C     . GLU A 1 191 ? 36.846 65.858 20.684 1.00 57.50  ? 191 GLU A C     1 
ATOM   1471 O O     . GLU A 1 191 ? 36.507 67.005 20.396 1.00 58.86  ? 191 GLU A O     1 
ATOM   1472 C CB    . GLU A 1 191 ? 38.359 66.009 22.719 1.00 57.83  ? 191 GLU A CB    1 
ATOM   1473 C CG    . GLU A 1 191 ? 39.645 65.603 22.031 1.00 59.71  ? 191 GLU A CG    1 
ATOM   1474 C CD    . GLU A 1 191 ? 40.873 66.067 22.806 1.00 60.62  ? 191 GLU A CD    1 
ATOM   1475 O OE1   . GLU A 1 191 ? 40.908 67.247 23.219 1.00 60.46  ? 191 GLU A OE1   1 
ATOM   1476 O OE2   . GLU A 1 191 ? 41.803 65.257 23.003 1.00 61.02  ? 191 GLU A OE2   1 
ATOM   1477 N N     . ASP A 1 192 ? 37.037 64.913 19.768 1.00 58.18  ? 192 ASP A N     1 
ATOM   1478 C CA    . ASP A 1 192 ? 36.821 65.174 18.349 1.00 58.91  ? 192 ASP A CA    1 
ATOM   1479 C C     . ASP A 1 192 ? 35.320 65.097 18.111 1.00 59.71  ? 192 ASP A C     1 
ATOM   1480 O O     . ASP A 1 192 ? 34.778 65.782 17.245 1.00 60.64  ? 192 ASP A O     1 
ATOM   1481 C CB    . ASP A 1 192 ? 37.528 64.130 17.481 1.00 58.04  ? 192 ASP A CB    1 
ATOM   1482 C CG    . ASP A 1 192 ? 38.960 64.506 17.162 1.00 57.22  ? 192 ASP A CG    1 
ATOM   1483 O OD1   . ASP A 1 192 ? 39.642 63.716 16.478 1.00 57.37  ? 192 ASP A OD1   1 
ATOM   1484 O OD2   . ASP A 1 192 ? 39.403 65.592 17.591 1.00 56.91  ? 192 ASP A OD2   1 
ATOM   1485 N N     . GLN A 1 193 ? 34.656 64.248 18.890 1.00 60.34  ? 193 GLN A N     1 
ATOM   1486 C CA    . GLN A 1 193 ? 33.213 64.082 18.793 1.00 61.03  ? 193 GLN A CA    1 
ATOM   1487 C C     . GLN A 1 193 ? 32.565 65.166 19.643 1.00 61.92  ? 193 GLN A C     1 
ATOM   1488 O O     . GLN A 1 193 ? 31.376 65.106 19.954 1.00 62.13  ? 193 GLN A O     1 
ATOM   1489 C CB    . GLN A 1 193 ? 32.795 62.701 19.304 1.00 60.25  ? 193 GLN A CB    1 
ATOM   1490 C CG    . GLN A 1 193 ? 33.386 61.539 18.517 1.00 59.94  ? 193 GLN A CG    1 
ATOM   1491 C CD    . GLN A 1 193 ? 32.990 60.186 19.079 1.00 59.28  ? 193 GLN A CD    1 
ATOM   1492 O OE1   . GLN A 1 193 ? 33.462 59.146 18.616 1.00 60.06  ? 193 GLN A OE1   1 
ATOM   1493 N NE2   . GLN A 1 193 ? 32.119 60.192 20.081 1.00 59.03  ? 193 GLN A NE2   1 
ATOM   1494 N N     . ASN A 1 194 ? 33.372 66.154 20.019 1.00 62.72  ? 194 ASN A N     1 
ATOM   1495 C CA    . ASN A 1 194 ? 32.917 67.278 20.827 1.00 63.50  ? 194 ASN A CA    1 
ATOM   1496 C C     . ASN A 1 194 ? 32.167 66.844 22.080 1.00 63.79  ? 194 ASN A C     1 
ATOM   1497 O O     . ASN A 1 194 ? 31.102 67.376 22.393 1.00 63.93  ? 194 ASN A O     1 
ATOM   1498 C CB    . ASN A 1 194 ? 32.029 68.198 19.985 1.00 63.98  ? 194 ASN A CB    1 
ATOM   1499 C CG    . ASN A 1 194 ? 32.732 68.702 18.740 1.00 64.25  ? 194 ASN A CG    1 
ATOM   1500 O OD1   . ASN A 1 194 ? 33.811 69.291 18.817 1.00 64.63  ? 194 ASN A OD1   1 
ATOM   1501 N ND2   . ASN A 1 194 ? 32.122 68.475 17.583 1.00 64.63  ? 194 ASN A ND2   1 
ATOM   1502 N N     . LEU A 1 195 ? 32.734 65.879 22.799 1.00 64.31  ? 195 LEU A N     1 
ATOM   1503 C CA    . LEU A 1 195 ? 32.122 65.376 24.025 1.00 64.51  ? 195 LEU A CA    1 
ATOM   1504 C C     . LEU A 1 195 ? 32.882 65.846 25.261 1.00 64.39  ? 195 LEU A C     1 
ATOM   1505 O O     . LEU A 1 195 ? 32.293 66.031 26.326 1.00 64.53  ? 195 LEU A O     1 
ATOM   1506 C CB    . LEU A 1 195 ? 32.078 63.844 24.007 1.00 64.95  ? 195 LEU A CB    1 
ATOM   1507 C CG    . LEU A 1 195 ? 31.192 63.179 22.950 1.00 65.83  ? 195 LEU A CG    1 
ATOM   1508 C CD1   . LEU A 1 195 ? 31.409 61.673 22.972 1.00 65.95  ? 195 LEU A CD1   1 
ATOM   1509 C CD2   . LEU A 1 195 ? 29.732 63.514 23.216 1.00 65.94  ? 195 LEU A CD2   1 
ATOM   1510 N N     . ILE A 1 196 ? 34.190 66.035 25.119 1.00 64.21  ? 196 ILE A N     1 
ATOM   1511 C CA    . ILE A 1 196 ? 35.018 66.476 26.238 1.00 64.35  ? 196 ILE A CA    1 
ATOM   1512 C C     . ILE A 1 196 ? 36.151 67.390 25.794 1.00 64.36  ? 196 ILE A C     1 
ATOM   1513 O O     . ILE A 1 196 ? 36.337 67.647 24.605 1.00 63.91  ? 196 ILE A O     1 
ATOM   1514 C CB    . ILE A 1 196 ? 35.658 65.280 26.981 1.00 63.97  ? 196 ILE A CB    1 
ATOM   1515 C CG1   . ILE A 1 196 ? 36.525 64.474 26.010 1.00 64.08  ? 196 ILE A CG1   1 
ATOM   1516 C CG2   . ILE A 1 196 ? 34.581 64.405 27.597 1.00 64.14  ? 196 ILE A CG2   1 
ATOM   1517 C CD1   . ILE A 1 196 ? 37.322 63.364 26.668 1.00 63.62  ? 196 ILE A CD1   1 
ATOM   1518 N N     . SER A 1 197 ? 36.908 67.869 26.774 1.00 65.09  ? 197 SER A N     1 
ATOM   1519 C CA    . SER A 1 197 ? 38.049 68.742 26.531 1.00 65.64  ? 197 SER A CA    1 
ATOM   1520 C C     . SER A 1 197 ? 39.160 68.336 27.495 1.00 65.23  ? 197 SER A C     1 
ATOM   1521 O O     . SER A 1 197 ? 39.036 68.514 28.706 1.00 65.13  ? 197 SER A O     1 
ATOM   1522 C CB    . SER A 1 197 ? 37.659 70.203 26.769 1.00 66.11  ? 197 SER A CB    1 
ATOM   1523 O OG    . SER A 1 197 ? 38.745 71.071 26.492 1.00 67.30  ? 197 SER A OG    1 
ATOM   1524 N N     . ALA A 1 198 ? 40.243 67.784 26.957 1.00 65.02  ? 198 ALA A N     1 
ATOM   1525 C CA    . ALA A 1 198 ? 41.359 67.346 27.789 1.00 64.94  ? 198 ALA A CA    1 
ATOM   1526 C C     . ALA A 1 198 ? 42.541 68.310 27.756 1.00 64.87  ? 198 ALA A C     1 
ATOM   1527 O O     . ALA A 1 198 ? 42.972 68.750 26.689 1.00 64.64  ? 198 ALA A O     1 
ATOM   1528 C CB    . ALA A 1 198 ? 41.811 65.955 27.360 1.00 64.48  ? 198 ALA A CB    1 
ATOM   1529 N N     . HIS A 1 199 ? 43.058 68.628 28.938 1.00 64.72  ? 199 HIS A N     1 
ATOM   1530 C CA    . HIS A 1 199 ? 44.200 69.525 29.079 1.00 64.64  ? 199 HIS A CA    1 
ATOM   1531 C C     . HIS A 1 199 ? 45.176 68.882 30.060 1.00 64.59  ? 199 HIS A C     1 
ATOM   1532 O O     . HIS A 1 199 ? 45.069 69.065 31.274 1.00 63.72  ? 199 HIS A O     1 
ATOM   1533 C CB    . HIS A 1 199 ? 43.737 70.890 29.599 1.00 65.13  ? 199 HIS A CB    1 
ATOM   1534 C CG    . HIS A 1 199 ? 44.825 71.916 29.670 1.00 65.27  ? 199 HIS A CG    1 
ATOM   1535 N ND1   . HIS A 1 199 ? 45.688 72.161 28.623 1.00 65.06  ? 199 HIS A ND1   1 
ATOM   1536 C CD2   . HIS A 1 199 ? 45.169 72.785 30.651 1.00 65.38  ? 199 HIS A CD2   1 
ATOM   1537 C CE1   . HIS A 1 199 ? 46.517 73.135 28.956 1.00 64.82  ? 199 HIS A CE1   1 
ATOM   1538 N NE2   . HIS A 1 199 ? 46.223 73.531 30.181 1.00 64.79  ? 199 HIS A NE2   1 
ATOM   1539 N N     . GLY A 1 200 ? 46.121 68.116 29.523 1.00 64.71  ? 200 GLY A N     1 
ATOM   1540 C CA    . GLY A 1 200 ? 47.088 67.440 30.364 1.00 65.34  ? 200 GLY A CA    1 
ATOM   1541 C C     . GLY A 1 200 ? 46.420 66.297 31.103 1.00 65.47  ? 200 GLY A C     1 
ATOM   1542 O O     . GLY A 1 200 ? 45.911 65.364 30.484 1.00 65.06  ? 200 GLY A O     1 
ATOM   1543 N N     . LYS A 1 201 ? 46.417 66.368 32.430 1.00 66.20  ? 201 LYS A N     1 
ATOM   1544 C CA    . LYS A 1 201 ? 45.794 65.336 33.246 1.00 66.69  ? 201 LYS A CA    1 
ATOM   1545 C C     . LYS A 1 201 ? 44.455 65.844 33.764 1.00 67.00  ? 201 LYS A C     1 
ATOM   1546 O O     . LYS A 1 201 ? 43.863 65.260 34.673 1.00 67.31  ? 201 LYS A O     1 
ATOM   1547 C CB    . LYS A 1 201 ? 46.704 64.960 34.420 1.00 67.84  ? 201 LYS A CB    1 
ATOM   1548 C CG    . LYS A 1 201 ? 48.029 64.328 34.007 1.00 68.55  ? 201 LYS A CG    1 
ATOM   1549 C CD    . LYS A 1 201 ? 47.813 63.044 33.217 1.00 69.85  ? 201 LYS A CD    1 
ATOM   1550 C CE    . LYS A 1 201 ? 49.135 62.384 32.854 1.00 70.99  ? 201 LYS A CE    1 
ATOM   1551 N NZ    . LYS A 1 201 ? 48.935 61.147 32.043 1.00 72.09  ? 201 LYS A NZ    1 
ATOM   1552 N N     . THR A 1 202 ? 43.989 66.940 33.176 1.00 66.85  ? 202 THR A N     1 
ATOM   1553 C CA    . THR A 1 202 ? 42.717 67.543 33.553 1.00 67.66  ? 202 THR A CA    1 
ATOM   1554 C C     . THR A 1 202 ? 41.754 67.404 32.377 1.00 68.31  ? 202 THR A C     1 
ATOM   1555 O O     . THR A 1 202 ? 42.142 67.607 31.226 1.00 68.41  ? 202 THR A O     1 
ATOM   1556 C CB    . THR A 1 202 ? 42.891 69.034 33.889 1.00 67.55  ? 202 THR A CB    1 
ATOM   1557 O OG1   . THR A 1 202 ? 43.929 69.184 34.865 1.00 67.08  ? 202 THR A OG1   1 
ATOM   1558 C CG2   . THR A 1 202 ? 41.596 69.607 34.444 1.00 67.15  ? 202 THR A CG2   1 
ATOM   1559 N N     . ILE A 1 203 ? 40.502 67.059 32.663 1.00 68.79  ? 203 ILE A N     1 
ATOM   1560 C CA    . ILE A 1 203 ? 39.516 66.879 31.602 1.00 69.64  ? 203 ILE A CA    1 
ATOM   1561 C C     . ILE A 1 203 ? 38.205 67.612 31.869 1.00 70.17  ? 203 ILE A C     1 
ATOM   1562 O O     . ILE A 1 203 ? 37.730 67.669 33.002 1.00 69.90  ? 203 ILE A O     1 
ATOM   1563 C CB    . ILE A 1 203 ? 39.204 65.378 31.392 1.00 69.57  ? 203 ILE A CB    1 
ATOM   1564 C CG1   . ILE A 1 203 ? 40.503 64.606 31.144 1.00 69.08  ? 203 ILE A CG1   1 
ATOM   1565 C CG2   . ILE A 1 203 ? 38.257 65.200 30.213 1.00 69.26  ? 203 ILE A CG2   1 
ATOM   1566 C CD1   . ILE A 1 203 ? 40.321 63.105 31.058 1.00 68.61  ? 203 ILE A CD1   1 
ATOM   1567 N N     . VAL A 1 204 ? 37.626 68.169 30.810 1.00 71.06  ? 204 VAL A N     1 
ATOM   1568 C CA    . VAL A 1 204 ? 36.363 68.891 30.908 1.00 72.23  ? 204 VAL A CA    1 
ATOM   1569 C C     . VAL A 1 204 ? 35.237 68.027 30.348 1.00 72.95  ? 204 VAL A C     1 
ATOM   1570 O O     . VAL A 1 204 ? 35.255 67.652 29.174 1.00 72.73  ? 204 VAL A O     1 
ATOM   1571 C CB    . VAL A 1 204 ? 36.411 70.216 30.116 1.00 72.12  ? 204 VAL A CB    1 
ATOM   1572 C CG1   . VAL A 1 204 ? 35.081 70.947 30.245 1.00 72.03  ? 204 VAL A CG1   1 
ATOM   1573 C CG2   . VAL A 1 204 ? 37.549 71.086 30.626 1.00 72.04  ? 204 VAL A CG2   1 
ATOM   1574 N N     . VAL A 1 205 ? 34.259 67.717 31.194 1.00 74.09  ? 205 VAL A N     1 
ATOM   1575 C CA    . VAL A 1 205 ? 33.125 66.894 30.789 1.00 75.05  ? 205 VAL A CA    1 
ATOM   1576 C C     . VAL A 1 205 ? 31.909 67.742 30.421 1.00 75.60  ? 205 VAL A C     1 
ATOM   1577 O O     . VAL A 1 205 ? 31.177 68.209 31.295 1.00 75.58  ? 205 VAL A O     1 
ATOM   1578 C CB    . VAL A 1 205 ? 32.721 65.917 31.913 1.00 74.98  ? 205 VAL A CB    1 
ATOM   1579 C CG1   . VAL A 1 205 ? 31.608 65.002 31.432 1.00 75.07  ? 205 VAL A CG1   1 
ATOM   1580 C CG2   . VAL A 1 205 ? 33.928 65.105 32.353 1.00 74.82  ? 205 VAL A CG2   1 
ATOM   1581 N N     . TYR A 1 206 ? 31.697 67.929 29.121 1.00 75.87  ? 206 TYR A N     1 
ATOM   1582 C CA    . TYR A 1 206 ? 30.573 68.717 28.626 1.00 76.43  ? 206 TYR A CA    1 
ATOM   1583 C C     . TYR A 1 206 ? 29.241 68.093 29.037 1.00 76.96  ? 206 TYR A C     1 
ATOM   1584 O O     . TYR A 1 206 ? 29.266 67.056 29.734 1.00 77.53  ? 206 TYR A O     1 
ATOM   1585 C CB    . TYR A 1 206 ? 30.639 68.825 27.098 1.00 75.41  ? 206 TYR A CB    1 
ATOM   1586 C CG    . TYR A 1 206 ? 31.874 69.524 26.564 1.00 75.00  ? 206 TYR A CG    1 
ATOM   1587 C CD1   . TYR A 1 206 ? 32.160 69.520 25.199 1.00 74.89  ? 206 TYR A CD1   1 
ATOM   1588 C CD2   . TYR A 1 206 ? 32.755 70.191 27.419 1.00 74.20  ? 206 TYR A CD2   1 
ATOM   1589 C CE1   . TYR A 1 206 ? 33.290 70.161 24.696 1.00 74.34  ? 206 TYR A CE1   1 
ATOM   1590 C CE2   . TYR A 1 206 ? 33.888 70.836 26.925 1.00 73.56  ? 206 TYR A CE2   1 
ATOM   1591 C CZ    . TYR A 1 206 ? 34.149 70.816 25.565 1.00 73.84  ? 206 TYR A CZ    1 
ATOM   1592 O OH    . TYR A 1 206 ? 35.267 71.447 25.071 1.00 73.41  ? 206 TYR A OH    1 
ATOM   1593 N N     . VAL B 1 1   ? 9.116  11.006 73.209 1.00 43.15  ? 1   VAL B N     1 
ATOM   1594 C CA    . VAL B 1 1   ? 10.107 12.122 73.181 1.00 43.93  ? 1   VAL B CA    1 
ATOM   1595 C C     . VAL B 1 1   ? 9.945  12.951 71.911 1.00 44.91  ? 1   VAL B C     1 
ATOM   1596 O O     . VAL B 1 1   ? 9.820  12.400 70.815 1.00 43.06  ? 1   VAL B O     1 
ATOM   1597 C CB    . VAL B 1 1   ? 11.557 11.587 73.217 1.00 43.80  ? 1   VAL B CB    1 
ATOM   1598 C CG1   . VAL B 1 1   ? 12.542 12.749 73.253 1.00 41.95  ? 1   VAL B CG1   1 
ATOM   1599 C CG2   . VAL B 1 1   ? 11.748 10.682 74.419 1.00 42.63  ? 1   VAL B CG2   1 
ATOM   1600 N N     . LEU B 1 2   ? 9.954  14.272 72.059 1.00 45.97  ? 2   LEU B N     1 
ATOM   1601 C CA    . LEU B 1 2   ? 9.820  15.157 70.908 1.00 48.39  ? 2   LEU B CA    1 
ATOM   1602 C C     . LEU B 1 2   ? 11.105 15.120 70.089 1.00 49.97  ? 2   LEU B C     1 
ATOM   1603 O O     . LEU B 1 2   ? 12.201 15.230 70.638 1.00 50.00  ? 2   LEU B O     1 
ATOM   1604 C CB    . LEU B 1 2   ? 9.534  16.592 71.357 1.00 47.56  ? 2   LEU B CB    1 
ATOM   1605 C CG    . LEU B 1 2   ? 9.447  17.608 70.212 1.00 48.91  ? 2   LEU B CG    1 
ATOM   1606 C CD1   . LEU B 1 2   ? 8.296  17.233 69.287 1.00 47.55  ? 2   LEU B CD1   1 
ATOM   1607 C CD2   . LEU B 1 2   ? 9.257  19.013 70.771 1.00 48.14  ? 2   LEU B CD2   1 
ATOM   1608 N N     . GLY B 1 3   ? 10.959 14.974 68.776 1.00 52.35  ? 3   GLY B N     1 
ATOM   1609 C CA    . GLY B 1 3   ? 12.111 14.906 67.895 1.00 55.97  ? 3   GLY B CA    1 
ATOM   1610 C C     . GLY B 1 3   ? 12.935 16.176 67.783 1.00 58.26  ? 3   GLY B C     1 
ATOM   1611 O O     . GLY B 1 3   ? 12.559 17.232 68.297 1.00 57.15  ? 3   GLY B O     1 
ATOM   1612 N N     . LYS B 1 4   ? 14.066 16.061 67.094 1.00 61.04  ? 4   LYS B N     1 
ATOM   1613 C CA    . LYS B 1 4   ? 14.987 17.174 66.887 1.00 64.47  ? 4   LYS B CA    1 
ATOM   1614 C C     . LYS B 1 4   ? 14.575 17.927 65.618 1.00 65.49  ? 4   LYS B C     1 
ATOM   1615 O O     . LYS B 1 4   ? 13.910 17.365 64.747 1.00 65.68  ? 4   LYS B O     1 
ATOM   1616 C CB    . LYS B 1 4   ? 16.412 16.626 66.742 1.00 66.37  ? 4   LYS B CB    1 
ATOM   1617 C CG    . LYS B 1 4   ? 17.518 17.557 67.214 1.00 69.56  ? 4   LYS B CG    1 
ATOM   1618 C CD    . LYS B 1 4   ? 18.877 16.872 67.136 1.00 71.91  ? 4   LYS B CD    1 
ATOM   1619 C CE    . LYS B 1 4   ? 19.987 17.759 67.684 1.00 72.74  ? 4   LYS B CE    1 
ATOM   1620 N NZ    . LYS B 1 4   ? 21.313 17.076 67.645 1.00 73.56  ? 4   LYS B NZ    1 
ATOM   1621 N N     . PRO B 1 5   ? 14.958 19.211 65.498 1.00 66.55  ? 5   PRO B N     1 
ATOM   1622 C CA    . PRO B 1 5   ? 14.594 19.984 64.305 1.00 66.95  ? 5   PRO B CA    1 
ATOM   1623 C C     . PRO B 1 5   ? 15.090 19.362 62.999 1.00 66.86  ? 5   PRO B C     1 
ATOM   1624 O O     . PRO B 1 5   ? 16.293 19.217 62.784 1.00 67.28  ? 5   PRO B O     1 
ATOM   1625 C CB    . PRO B 1 5   ? 15.215 21.357 64.579 1.00 67.15  ? 5   PRO B CB    1 
ATOM   1626 C CG    . PRO B 1 5   ? 16.382 21.033 65.469 1.00 67.36  ? 5   PRO B CG    1 
ATOM   1627 C CD    . PRO B 1 5   ? 15.779 20.026 66.411 1.00 66.90  ? 5   PRO B CD    1 
ATOM   1628 N N     . GLN B 1 6   ? 14.144 18.998 62.137 1.00 66.59  ? 6   GLN B N     1 
ATOM   1629 C CA    . GLN B 1 6   ? 14.439 18.388 60.842 1.00 65.93  ? 6   GLN B CA    1 
ATOM   1630 C C     . GLN B 1 6   ? 15.603 19.086 60.143 1.00 64.77  ? 6   GLN B C     1 
ATOM   1631 O O     . GLN B 1 6   ? 16.442 18.441 59.511 1.00 64.46  ? 6   GLN B O     1 
ATOM   1632 C CB    . GLN B 1 6   ? 13.187 18.435 59.963 1.00 66.89  ? 6   GLN B CB    1 
ATOM   1633 C CG    . GLN B 1 6   ? 13.358 17.847 58.574 1.00 68.22  ? 6   GLN B CG    1 
ATOM   1634 C CD    . GLN B 1 6   ? 12.045 17.778 57.816 1.00 69.05  ? 6   GLN B CD    1 
ATOM   1635 O OE1   . GLN B 1 6   ? 11.320 18.767 57.717 1.00 69.59  ? 6   GLN B OE1   1 
ATOM   1636 N NE2   . GLN B 1 6   ? 11.736 16.605 57.273 1.00 69.98  ? 6   GLN B NE2   1 
ATOM   1637 N N     . THR B 1 7   ? 15.640 20.409 60.257 1.00 63.33  ? 7   THR B N     1 
ATOM   1638 C CA    . THR B 1 7   ? 16.702 21.213 59.666 1.00 61.19  ? 7   THR B CA    1 
ATOM   1639 C C     . THR B 1 7   ? 17.134 22.247 60.702 1.00 58.92  ? 7   THR B C     1 
ATOM   1640 O O     . THR B 1 7   ? 16.707 22.185 61.855 1.00 59.40  ? 7   THR B O     1 
ATOM   1641 C CB    . THR B 1 7   ? 16.222 21.919 58.377 1.00 61.84  ? 7   THR B CB    1 
ATOM   1642 O OG1   . THR B 1 7   ? 17.227 22.834 57.923 1.00 63.49  ? 7   THR B OG1   1 
ATOM   1643 C CG2   . THR B 1 7   ? 14.938 22.664 58.628 1.00 62.19  ? 7   THR B CG2   1 
ATOM   1644 N N     . ASP B 1 8   ? 17.977 23.192 60.298 1.00 55.79  ? 8   ASP B N     1 
ATOM   1645 C CA    . ASP B 1 8   ? 18.465 24.214 61.216 1.00 52.14  ? 8   ASP B CA    1 
ATOM   1646 C C     . ASP B 1 8   ? 17.333 24.993 61.890 1.00 49.86  ? 8   ASP B C     1 
ATOM   1647 O O     . ASP B 1 8   ? 16.476 25.570 61.219 1.00 49.01  ? 8   ASP B O     1 
ATOM   1648 C CB    . ASP B 1 8   ? 19.393 25.177 60.476 1.00 53.45  ? 8   ASP B CB    1 
ATOM   1649 C CG    . ASP B 1 8   ? 20.082 26.146 61.409 1.00 54.14  ? 8   ASP B CG    1 
ATOM   1650 O OD1   . ASP B 1 8   ? 19.393 27.020 61.972 1.00 55.11  ? 8   ASP B OD1   1 
ATOM   1651 O OD2   . ASP B 1 8   ? 21.313 26.024 61.586 1.00 55.98  ? 8   ASP B OD2   1 
ATOM   1652 N N     . PRO B 1 9   ? 17.324 25.020 63.234 1.00 47.15  ? 9   PRO B N     1 
ATOM   1653 C CA    . PRO B 1 9   ? 16.307 25.719 64.028 1.00 45.44  ? 9   PRO B CA    1 
ATOM   1654 C C     . PRO B 1 9   ? 16.172 27.217 63.755 1.00 43.10  ? 9   PRO B C     1 
ATOM   1655 O O     . PRO B 1 9   ? 15.063 27.752 63.753 1.00 40.40  ? 9   PRO B O     1 
ATOM   1656 C CB    . PRO B 1 9   ? 16.722 25.417 65.469 1.00 46.94  ? 9   PRO B CB    1 
ATOM   1657 C CG    . PRO B 1 9   ? 18.203 25.218 65.366 1.00 48.15  ? 9   PRO B CG    1 
ATOM   1658 C CD    . PRO B 1 9   ? 18.331 24.397 64.110 1.00 47.75  ? 9   PRO B CD    1 
ATOM   1659 N N     . THR B 1 10  ? 17.292 27.897 63.532 1.00 39.92  ? 10  THR B N     1 
ATOM   1660 C CA    . THR B 1 10  ? 17.238 29.325 63.251 1.00 37.61  ? 10  THR B CA    1 
ATOM   1661 C C     . THR B 1 10  ? 16.578 29.539 61.890 1.00 35.38  ? 10  THR B C     1 
ATOM   1662 O O     . THR B 1 10  ? 15.775 30.455 61.711 1.00 34.42  ? 10  THR B O     1 
ATOM   1663 C CB    . THR B 1 10  ? 18.645 29.954 63.249 1.00 38.29  ? 10  THR B CB    1 
ATOM   1664 O OG1   . THR B 1 10  ? 19.234 29.805 64.548 1.00 37.47  ? 10  THR B OG1   1 
ATOM   1665 C CG2   . THR B 1 10  ? 18.569 31.436 62.906 1.00 35.79  ? 10  THR B CG2   1 
ATOM   1666 N N     . LEU B 1 11  ? 16.910 28.678 60.936 1.00 33.29  ? 11  LEU B N     1 
ATOM   1667 C CA    . LEU B 1 11  ? 16.338 28.774 59.602 1.00 32.09  ? 11  LEU B CA    1 
ATOM   1668 C C     . LEU B 1 11  ? 14.836 28.490 59.622 1.00 30.93  ? 11  LEU B C     1 
ATOM   1669 O O     . LEU B 1 11  ? 14.062 29.184 58.962 1.00 28.00  ? 11  LEU B O     1 
ATOM   1670 C CB    . LEU B 1 11  ? 17.056 27.813 58.651 1.00 33.89  ? 11  LEU B CB    1 
ATOM   1671 C CG    . LEU B 1 11  ? 18.514 28.186 58.347 1.00 34.80  ? 11  LEU B CG    1 
ATOM   1672 C CD1   . LEU B 1 11  ? 19.098 27.185 57.357 1.00 36.02  ? 11  LEU B CD1   1 
ATOM   1673 C CD2   . LEU B 1 11  ? 18.584 29.603 57.771 1.00 36.31  ? 11  LEU B CD2   1 
ATOM   1674 N N     . GLU B 1 12  ? 14.420 27.484 60.387 1.00 31.74  ? 12  GLU B N     1 
ATOM   1675 C CA    . GLU B 1 12  ? 12.997 27.151 60.478 1.00 32.78  ? 12  GLU B CA    1 
ATOM   1676 C C     . GLU B 1 12  ? 12.219 28.290 61.123 1.00 30.90  ? 12  GLU B C     1 
ATOM   1677 O O     . GLU B 1 12  ? 11.087 28.582 60.736 1.00 30.66  ? 12  GLU B O     1 
ATOM   1678 C CB    . GLU B 1 12  ? 12.790 25.864 61.282 1.00 35.72  ? 12  GLU B CB    1 
ATOM   1679 C CG    . GLU B 1 12  ? 13.090 24.610 60.484 1.00 42.92  ? 12  GLU B CG    1 
ATOM   1680 C CD    . GLU B 1 12  ? 12.282 24.544 59.196 1.00 47.66  ? 12  GLU B CD    1 
ATOM   1681 O OE1   . GLU B 1 12  ? 11.033 24.577 59.267 1.00 49.11  ? 12  GLU B OE1   1 
ATOM   1682 O OE2   . GLU B 1 12  ? 12.895 24.463 58.108 1.00 51.35  ? 12  GLU B OE2   1 
ATOM   1683 N N     . TRP B 1 13  ? 12.832 28.918 62.120 1.00 29.38  ? 13  TRP B N     1 
ATOM   1684 C CA    . TRP B 1 13  ? 12.225 30.049 62.814 1.00 29.69  ? 13  TRP B CA    1 
ATOM   1685 C C     . TRP B 1 13  ? 12.007 31.180 61.799 1.00 29.05  ? 13  TRP B C     1 
ATOM   1686 O O     . TRP B 1 13  ? 10.911 31.732 61.683 1.00 27.20  ? 13  TRP B O     1 
ATOM   1687 C CB    . TRP B 1 13  ? 13.157 30.509 63.938 1.00 31.00  ? 13  TRP B CB    1 
ATOM   1688 C CG    . TRP B 1 13  ? 12.828 31.849 64.504 1.00 32.93  ? 13  TRP B CG    1 
ATOM   1689 C CD1   . TRP B 1 13  ? 11.735 32.184 65.248 1.00 33.31  ? 13  TRP B CD1   1 
ATOM   1690 C CD2   . TRP B 1 13  ? 13.610 33.041 64.374 1.00 33.21  ? 13  TRP B CD2   1 
ATOM   1691 N NE1   . TRP B 1 13  ? 11.788 33.513 65.593 1.00 35.68  ? 13  TRP B NE1   1 
ATOM   1692 C CE2   . TRP B 1 13  ? 12.930 34.063 65.069 1.00 35.05  ? 13  TRP B CE2   1 
ATOM   1693 C CE3   . TRP B 1 13  ? 14.822 33.344 63.737 1.00 33.21  ? 13  TRP B CE3   1 
ATOM   1694 C CZ2   . TRP B 1 13  ? 13.421 35.374 65.148 1.00 35.90  ? 13  TRP B CZ2   1 
ATOM   1695 C CZ3   . TRP B 1 13  ? 15.312 34.647 63.815 1.00 36.15  ? 13  TRP B CZ3   1 
ATOM   1696 C CH2   . TRP B 1 13  ? 14.609 35.645 64.517 1.00 34.98  ? 13  TRP B CH2   1 
ATOM   1697 N N     . PHE B 1 14  ? 13.057 31.498 61.048 1.00 27.83  ? 14  PHE B N     1 
ATOM   1698 C CA    . PHE B 1 14  ? 12.999 32.539 60.027 1.00 25.54  ? 14  PHE B CA    1 
ATOM   1699 C C     . PHE B 1 14  ? 11.919 32.232 58.986 1.00 24.67  ? 14  PHE B C     1 
ATOM   1700 O O     . PHE B 1 14  ? 11.089 33.082 58.660 1.00 23.51  ? 14  PHE B O     1 
ATOM   1701 C CB    . PHE B 1 14  ? 14.374 32.661 59.355 1.00 26.66  ? 14  PHE B CB    1 
ATOM   1702 C CG    . PHE B 1 14  ? 14.338 33.262 57.971 1.00 26.18  ? 14  PHE B CG    1 
ATOM   1703 C CD1   . PHE B 1 14  ? 14.026 34.605 57.780 1.00 27.00  ? 14  PHE B CD1   1 
ATOM   1704 C CD2   . PHE B 1 14  ? 14.627 32.476 56.857 1.00 25.05  ? 14  PHE B CD2   1 
ATOM   1705 C CE1   . PHE B 1 14  ? 14.004 35.159 56.494 1.00 26.37  ? 14  PHE B CE1   1 
ATOM   1706 C CE2   . PHE B 1 14  ? 14.608 33.018 55.569 1.00 26.75  ? 14  PHE B CE2   1 
ATOM   1707 C CZ    . PHE B 1 14  ? 14.295 34.365 55.388 1.00 23.85  ? 14  PHE B CZ    1 
ATOM   1708 N N     . LEU B 1 15  ? 11.921 31.007 58.474 1.00 26.07  ? 15  LEU B N     1 
ATOM   1709 C CA    . LEU B 1 15  ? 10.942 30.608 57.473 1.00 28.18  ? 15  LEU B CA    1 
ATOM   1710 C C     . LEU B 1 15  ? 9.496  30.645 57.972 1.00 28.53  ? 15  LEU B C     1 
ATOM   1711 O O     . LEU B 1 15  ? 8.573  30.835 57.176 1.00 29.70  ? 15  LEU B O     1 
ATOM   1712 C CB    . LEU B 1 15  ? 11.283 29.212 56.938 1.00 27.81  ? 15  LEU B CB    1 
ATOM   1713 C CG    . LEU B 1 15  ? 12.537 29.159 56.059 1.00 28.57  ? 15  LEU B CG    1 
ATOM   1714 C CD1   . LEU B 1 15  ? 12.929 27.707 55.792 1.00 28.20  ? 15  LEU B CD1   1 
ATOM   1715 C CD2   . LEU B 1 15  ? 12.267 29.904 54.747 1.00 28.25  ? 15  LEU B CD2   1 
ATOM   1716 N N     . SER B 1 16  ? 9.291  30.477 59.276 1.00 28.59  ? 16  SER B N     1 
ATOM   1717 C CA    . SER B 1 16  ? 7.933  30.498 59.815 1.00 29.55  ? 16  SER B CA    1 
ATOM   1718 C C     . SER B 1 16  ? 7.342  31.903 59.725 1.00 28.96  ? 16  SER B C     1 
ATOM   1719 O O     . SER B 1 16  ? 6.129  32.082 59.831 1.00 29.08  ? 16  SER B O     1 
ATOM   1720 C CB    . SER B 1 16  ? 7.905  30.009 61.271 1.00 30.02  ? 16  SER B CB    1 
ATOM   1721 O OG    . SER B 1 16  ? 8.478  30.950 62.162 1.00 29.02  ? 16  SER B OG    1 
ATOM   1722 N N     . HIS B 1 17  ? 8.201  32.899 59.532 1.00 28.13  ? 17  HIS B N     1 
ATOM   1723 C CA    . HIS B 1 17  ? 7.742  34.276 59.419 1.00 27.42  ? 17  HIS B CA    1 
ATOM   1724 C C     . HIS B 1 17  ? 7.565  34.705 57.960 1.00 26.20  ? 17  HIS B C     1 
ATOM   1725 O O     . HIS B 1 17  ? 7.084  35.801 57.685 1.00 24.87  ? 17  HIS B O     1 
ATOM   1726 C CB    . HIS B 1 17  ? 8.710  35.230 60.136 1.00 27.92  ? 17  HIS B CB    1 
ATOM   1727 C CG    . HIS B 1 17  ? 8.662  35.127 61.631 1.00 31.43  ? 17  HIS B CG    1 
ATOM   1728 N ND1   . HIS B 1 17  ? 9.344  34.159 62.336 1.00 33.61  ? 17  HIS B ND1   1 
ATOM   1729 C CD2   . HIS B 1 17  ? 7.975  35.847 62.550 1.00 33.04  ? 17  HIS B CD2   1 
ATOM   1730 C CE1   . HIS B 1 17  ? 9.081  34.287 63.625 1.00 32.95  ? 17  HIS B CE1   1 
ATOM   1731 N NE2   . HIS B 1 17  ? 8.253  35.303 63.782 1.00 34.48  ? 17  HIS B NE2   1 
ATOM   1732 N N     . CYS B 1 18  ? 7.944  33.833 57.029 1.00 25.14  ? 18  CYS B N     1 
ATOM   1733 C CA    . CYS B 1 18  ? 7.813  34.130 55.601 1.00 25.16  ? 18  CYS B CA    1 
ATOM   1734 C C     . CYS B 1 18  ? 6.583  33.453 55.008 1.00 26.35  ? 18  CYS B C     1 
ATOM   1735 O O     . CYS B 1 18  ? 5.983  32.579 55.633 1.00 26.48  ? 18  CYS B O     1 
ATOM   1736 C CB    . CYS B 1 18  ? 9.018  33.594 54.815 1.00 26.58  ? 18  CYS B CB    1 
ATOM   1737 S SG    . CYS B 1 18  ? 10.663 34.143 55.311 1.00 25.35  ? 18  CYS B SG    1 
ATOM   1738 N N     . HIS B 1 19  ? 6.207  33.864 53.800 1.00 26.18  ? 19  HIS B N     1 
ATOM   1739 C CA    . HIS B 1 19  ? 5.119  33.201 53.094 1.00 26.25  ? 19  HIS B CA    1 
ATOM   1740 C C     . HIS B 1 19  ? 5.842  32.558 51.910 1.00 28.84  ? 19  HIS B C     1 
ATOM   1741 O O     . HIS B 1 19  ? 6.699  33.190 51.280 1.00 26.89  ? 19  HIS B O     1 
ATOM   1742 C CB    . HIS B 1 19  ? 3.999  34.176 52.665 1.00 26.91  ? 19  HIS B CB    1 
ATOM   1743 C CG    . HIS B 1 19  ? 4.466  35.403 51.942 1.00 24.87  ? 19  HIS B CG    1 
ATOM   1744 N ND1   . HIS B 1 19  ? 4.240  35.602 50.595 1.00 25.97  ? 19  HIS B ND1   1 
ATOM   1745 C CD2   . HIS B 1 19  ? 5.069  36.529 52.392 1.00 24.71  ? 19  HIS B CD2   1 
ATOM   1746 C CE1   . HIS B 1 19  ? 4.683  36.797 50.249 1.00 25.20  ? 19  HIS B CE1   1 
ATOM   1747 N NE2   . HIS B 1 19  ? 5.189  37.381 51.320 1.00 25.23  ? 19  HIS B NE2   1 
ATOM   1748 N N     . ILE B 1 20  ? 5.522  31.294 51.633 1.00 27.30  ? 20  ILE B N     1 
ATOM   1749 C CA    . ILE B 1 20  ? 6.197  30.537 50.575 1.00 29.66  ? 20  ILE B CA    1 
ATOM   1750 C C     . ILE B 1 20  ? 5.329  30.211 49.361 1.00 29.98  ? 20  ILE B C     1 
ATOM   1751 O O     . ILE B 1 20  ? 4.162  29.854 49.504 1.00 30.22  ? 20  ILE B O     1 
ATOM   1752 C CB    . ILE B 1 20  ? 6.756  29.225 51.172 1.00 30.02  ? 20  ILE B CB    1 
ATOM   1753 C CG1   . ILE B 1 20  ? 7.610  29.559 52.399 1.00 32.51  ? 20  ILE B CG1   1 
ATOM   1754 C CG2   . ILE B 1 20  ? 7.566  28.466 50.135 1.00 31.01  ? 20  ILE B CG2   1 
ATOM   1755 C CD1   . ILE B 1 20  ? 7.903  28.370 53.301 1.00 33.18  ? 20  ILE B CD1   1 
ATOM   1756 N N     . HIS B 1 21  ? 5.912  30.327 48.169 1.00 29.40  ? 21  HIS B N     1 
ATOM   1757 C CA    . HIS B 1 21  ? 5.188  30.056 46.928 1.00 30.99  ? 21  HIS B CA    1 
ATOM   1758 C C     . HIS B 1 21  ? 6.019  29.260 45.924 1.00 32.74  ? 21  HIS B C     1 
ATOM   1759 O O     . HIS B 1 21  ? 7.252  29.292 45.959 1.00 30.15  ? 21  HIS B O     1 
ATOM   1760 C CB    . HIS B 1 21  ? 4.747  31.378 46.296 1.00 31.96  ? 21  HIS B CB    1 
ATOM   1761 C CG    . HIS B 1 21  ? 4.039  32.288 47.250 1.00 32.13  ? 21  HIS B CG    1 
ATOM   1762 N ND1   . HIS B 1 21  ? 2.734  32.083 47.646 1.00 32.56  ? 21  HIS B ND1   1 
ATOM   1763 C CD2   . HIS B 1 21  ? 4.481  33.359 47.951 1.00 31.39  ? 21  HIS B CD2   1 
ATOM   1764 C CE1   . HIS B 1 21  ? 2.404  32.987 48.551 1.00 31.99  ? 21  HIS B CE1   1 
ATOM   1765 N NE2   . HIS B 1 21  ? 3.447  33.772 48.755 1.00 30.15  ? 21  HIS B NE2   1 
ATOM   1766 N N     . LYS B 1 22  ? 5.331  28.551 45.029 1.00 33.97  ? 22  LYS B N     1 
ATOM   1767 C CA    . LYS B 1 22  ? 5.982  27.746 44.000 1.00 35.67  ? 22  LYS B CA    1 
ATOM   1768 C C     . LYS B 1 22  ? 5.986  28.486 42.670 1.00 36.52  ? 22  LYS B C     1 
ATOM   1769 O O     . LYS B 1 22  ? 4.982  29.075 42.271 1.00 36.44  ? 22  LYS B O     1 
ATOM   1770 C CB    . LYS B 1 22  ? 5.261  26.403 43.829 1.00 38.99  ? 22  LYS B CB    1 
ATOM   1771 C CG    . LYS B 1 22  ? 5.282  25.512 45.066 1.00 41.15  ? 22  LYS B CG    1 
ATOM   1772 C CD    . LYS B 1 22  ? 4.743  24.113 44.763 1.00 45.53  ? 22  LYS B CD    1 
ATOM   1773 C CE    . LYS B 1 22  ? 3.311  24.162 44.245 1.00 46.58  ? 22  LYS B CE    1 
ATOM   1774 N NZ    . LYS B 1 22  ? 2.790  22.813 43.876 1.00 48.93  ? 22  LYS B NZ    1 
ATOM   1775 N N     . TYR B 1 23  ? 7.124  28.443 41.986 1.00 36.66  ? 23  TYR B N     1 
ATOM   1776 C CA    . TYR B 1 23  ? 7.290  29.110 40.701 1.00 38.20  ? 23  TYR B CA    1 
ATOM   1777 C C     . TYR B 1 23  ? 7.777  28.130 39.639 1.00 37.94  ? 23  TYR B C     1 
ATOM   1778 O O     . TYR B 1 23  ? 8.758  27.414 39.847 1.00 37.46  ? 23  TYR B O     1 
ATOM   1779 C CB    . TYR B 1 23  ? 8.315  30.233 40.834 1.00 39.54  ? 23  TYR B CB    1 
ATOM   1780 C CG    . TYR B 1 23  ? 7.900  31.363 41.746 1.00 40.40  ? 23  TYR B CG    1 
ATOM   1781 C CD1   . TYR B 1 23  ? 7.118  32.415 41.272 1.00 41.75  ? 23  TYR B CD1   1 
ATOM   1782 C CD2   . TYR B 1 23  ? 8.323  31.403 43.075 1.00 40.72  ? 23  TYR B CD2   1 
ATOM   1783 C CE1   . TYR B 1 23  ? 6.774  33.485 42.096 1.00 42.70  ? 23  TYR B CE1   1 
ATOM   1784 C CE2   . TYR B 1 23  ? 7.983  32.465 43.909 1.00 40.54  ? 23  TYR B CE2   1 
ATOM   1785 C CZ    . TYR B 1 23  ? 7.212  33.504 43.412 1.00 42.53  ? 23  TYR B CZ    1 
ATOM   1786 O OH    . TYR B 1 23  ? 6.891  34.569 44.221 1.00 42.96  ? 23  TYR B OH    1 
ATOM   1787 N N     . PRO B 1 24  ? 7.097  28.086 38.483 1.00 38.56  ? 24  PRO B N     1 
ATOM   1788 C CA    . PRO B 1 24  ? 7.506  27.175 37.409 1.00 37.60  ? 24  PRO B CA    1 
ATOM   1789 C C     . PRO B 1 24  ? 8.756  27.705 36.710 1.00 37.29  ? 24  PRO B C     1 
ATOM   1790 O O     . PRO B 1 24  ? 9.034  28.903 36.746 1.00 34.91  ? 24  PRO B O     1 
ATOM   1791 C CB    . PRO B 1 24  ? 6.288  27.162 36.492 1.00 38.75  ? 24  PRO B CB    1 
ATOM   1792 C CG    . PRO B 1 24  ? 5.763  28.565 36.630 1.00 39.68  ? 24  PRO B CG    1 
ATOM   1793 C CD    . PRO B 1 24  ? 5.851  28.791 38.131 1.00 38.67  ? 24  PRO B CD    1 
ATOM   1794 N N     . SER B 1 25  ? 9.511  26.812 36.080 1.00 35.75  ? 25  SER B N     1 
ATOM   1795 C CA    . SER B 1 25  ? 10.721 27.216 35.383 1.00 36.63  ? 25  SER B CA    1 
ATOM   1796 C C     . SER B 1 25  ? 10.417 28.331 34.392 1.00 36.03  ? 25  SER B C     1 
ATOM   1797 O O     . SER B 1 25  ? 9.331  28.379 33.808 1.00 34.70  ? 25  SER B O     1 
ATOM   1798 C CB    . SER B 1 25  ? 11.330 26.025 34.638 1.00 39.08  ? 25  SER B CB    1 
ATOM   1799 O OG    . SER B 1 25  ? 10.456 25.562 33.622 1.00 43.20  ? 25  SER B OG    1 
ATOM   1800 N N     . LYS B 1 26  ? 11.383 29.230 34.224 1.00 35.84  ? 26  LYS B N     1 
ATOM   1801 C CA    . LYS B 1 26  ? 11.284 30.356 33.302 1.00 36.16  ? 26  LYS B CA    1 
ATOM   1802 C C     . LYS B 1 26  ? 10.462 31.543 33.792 1.00 35.64  ? 26  LYS B C     1 
ATOM   1803 O O     . LYS B 1 26  ? 10.371 32.558 33.103 1.00 35.93  ? 26  LYS B O     1 
ATOM   1804 C CB    . LYS B 1 26  ? 10.751 29.877 31.948 1.00 38.84  ? 26  LYS B CB    1 
ATOM   1805 C CG    . LYS B 1 26  ? 11.653 28.851 31.280 1.00 41.27  ? 26  LYS B CG    1 
ATOM   1806 C CD    . LYS B 1 26  ? 11.050 28.321 29.988 1.00 44.95  ? 26  LYS B CD    1 
ATOM   1807 C CE    . LYS B 1 26  ? 12.003 27.348 29.314 1.00 47.18  ? 26  LYS B CE    1 
ATOM   1808 N NZ    . LYS B 1 26  ? 12.403 26.254 30.246 1.00 49.38  ? 26  LYS B NZ    1 
ATOM   1809 N N     . SER B 1 27  ? 9.867  31.429 34.974 1.00 34.53  ? 27  SER B N     1 
ATOM   1810 C CA    . SER B 1 27  ? 9.081  32.537 35.506 1.00 34.52  ? 27  SER B CA    1 
ATOM   1811 C C     . SER B 1 27  ? 10.010 33.585 36.117 1.00 33.57  ? 27  SER B C     1 
ATOM   1812 O O     . SER B 1 27  ? 11.083 33.261 36.625 1.00 31.73  ? 27  SER B O     1 
ATOM   1813 C CB    . SER B 1 27  ? 8.086  32.038 36.562 1.00 36.02  ? 27  SER B CB    1 
ATOM   1814 O OG    . SER B 1 27  ? 8.748  31.396 37.636 1.00 39.38  ? 27  SER B OG    1 
ATOM   1815 N N     . THR B 1 28  ? 9.595  34.843 36.055 1.00 32.34  ? 28  THR B N     1 
ATOM   1816 C CA    . THR B 1 28  ? 10.394 35.930 36.603 1.00 32.83  ? 28  THR B CA    1 
ATOM   1817 C C     . THR B 1 28  ? 9.973  36.226 38.036 1.00 32.21  ? 28  THR B C     1 
ATOM   1818 O O     . THR B 1 28  ? 8.831  36.614 38.286 1.00 32.12  ? 28  THR B O     1 
ATOM   1819 C CB    . THR B 1 28  ? 10.239 37.205 35.755 1.00 32.21  ? 28  THR B CB    1 
ATOM   1820 O OG1   . THR B 1 28  ? 10.592 36.917 34.397 1.00 33.30  ? 28  THR B OG1   1 
ATOM   1821 C CG2   . THR B 1 28  ? 11.139 38.313 36.281 1.00 31.07  ? 28  THR B CG2   1 
ATOM   1822 N N     . LEU B 1 29  ? 10.899 36.035 38.973 1.00 30.11  ? 29  LEU B N     1 
ATOM   1823 C CA    . LEU B 1 29  ? 10.627 36.282 40.386 1.00 29.80  ? 29  LEU B CA    1 
ATOM   1824 C C     . LEU B 1 29  ? 10.821 37.743 40.752 1.00 28.83  ? 29  LEU B C     1 
ATOM   1825 O O     . LEU B 1 29  ? 10.051 38.310 41.529 1.00 27.40  ? 29  LEU B O     1 
ATOM   1826 C CB    . LEU B 1 29  ? 11.557 35.450 41.271 1.00 31.40  ? 29  LEU B CB    1 
ATOM   1827 C CG    . LEU B 1 29  ? 11.617 33.938 41.055 1.00 35.98  ? 29  LEU B CG    1 
ATOM   1828 C CD1   . LEU B 1 29  ? 12.283 33.293 42.259 1.00 36.32  ? 29  LEU B CD1   1 
ATOM   1829 C CD2   . LEU B 1 29  ? 10.220 33.390 40.876 1.00 38.08  ? 29  LEU B CD2   1 
ATOM   1830 N N     . ILE B 1 30  ? 11.879 38.332 40.205 1.00 27.21  ? 30  ILE B N     1 
ATOM   1831 C CA    . ILE B 1 30  ? 12.234 39.720 40.463 1.00 26.82  ? 30  ILE B CA    1 
ATOM   1832 C C     . ILE B 1 30  ? 12.492 40.436 39.139 1.00 27.48  ? 30  ILE B C     1 
ATOM   1833 O O     . ILE B 1 30  ? 13.196 39.916 38.272 1.00 24.61  ? 30  ILE B O     1 
ATOM   1834 C CB    . ILE B 1 30  ? 13.522 39.806 41.329 1.00 26.21  ? 30  ILE B CB    1 
ATOM   1835 C CG1   . ILE B 1 30  ? 13.268 39.183 42.706 1.00 27.43  ? 30  ILE B CG1   1 
ATOM   1836 C CG2   . ILE B 1 30  ? 13.972 41.261 41.466 1.00 24.45  ? 30  ILE B CG2   1 
ATOM   1837 C CD1   . ILE B 1 30  ? 14.518 39.045 43.566 1.00 26.64  ? 30  ILE B CD1   1 
ATOM   1838 N N     . HIS B 1 31  ? 11.913 41.625 38.992 1.00 28.48  ? 31  HIS B N     1 
ATOM   1839 C CA    . HIS B 1 31  ? 12.086 42.433 37.787 1.00 29.19  ? 31  HIS B CA    1 
ATOM   1840 C C     . HIS B 1 31  ? 13.026 43.593 38.109 1.00 28.40  ? 31  HIS B C     1 
ATOM   1841 O O     . HIS B 1 31  ? 12.830 44.303 39.097 1.00 27.94  ? 31  HIS B O     1 
ATOM   1842 C CB    . HIS B 1 31  ? 10.739 42.998 37.317 1.00 33.66  ? 31  HIS B CB    1 
ATOM   1843 C CG    . HIS B 1 31  ? 9.772  41.957 36.844 1.00 35.51  ? 31  HIS B CG    1 
ATOM   1844 N ND1   . HIS B 1 31  ? 9.814  41.422 35.574 1.00 38.56  ? 31  HIS B ND1   1 
ATOM   1845 C CD2   . HIS B 1 31  ? 8.737  41.350 37.473 1.00 37.35  ? 31  HIS B CD2   1 
ATOM   1846 C CE1   . HIS B 1 31  ? 8.846  40.532 35.441 1.00 36.77  ? 31  HIS B CE1   1 
ATOM   1847 N NE2   . HIS B 1 31  ? 8.178  40.470 36.579 1.00 38.54  ? 31  HIS B NE2   1 
ATOM   1848 N N     . GLN B 1 32  ? 14.048 43.779 37.282 1.00 26.90  ? 32  GLN B N     1 
ATOM   1849 C CA    . GLN B 1 32  ? 14.987 44.871 37.494 1.00 27.24  ? 32  GLN B CA    1 
ATOM   1850 C C     . GLN B 1 32  ? 14.229 46.193 37.455 1.00 26.85  ? 32  GLN B C     1 
ATOM   1851 O O     . GLN B 1 32  ? 13.342 46.374 36.625 1.00 26.25  ? 32  GLN B O     1 
ATOM   1852 C CB    . GLN B 1 32  ? 16.057 44.880 36.400 1.00 27.56  ? 32  GLN B CB    1 
ATOM   1853 C CG    . GLN B 1 32  ? 17.118 45.948 36.609 1.00 28.28  ? 32  GLN B CG    1 
ATOM   1854 C CD    . GLN B 1 32  ? 18.111 46.021 35.471 1.00 32.25  ? 32  GLN B CD    1 
ATOM   1855 O OE1   . GLN B 1 32  ? 17.801 46.530 34.390 1.00 35.51  ? 32  GLN B OE1   1 
ATOM   1856 N NE2   . GLN B 1 32  ? 19.310 45.502 35.700 1.00 30.84  ? 32  GLN B NE2   1 
ATOM   1857 N N     . GLY B 1 33  ? 14.571 47.106 38.357 1.00 26.38  ? 33  GLY B N     1 
ATOM   1858 C CA    . GLY B 1 33  ? 13.920 48.404 38.375 1.00 30.13  ? 33  GLY B CA    1 
ATOM   1859 C C     . GLY B 1 33  ? 12.757 48.587 39.332 1.00 31.76  ? 33  GLY B C     1 
ATOM   1860 O O     . GLY B 1 33  ? 12.373 49.727 39.608 1.00 31.53  ? 33  GLY B O     1 
ATOM   1861 N N     . GLU B 1 34  ? 12.180 47.494 39.830 1.00 33.37  ? 34  GLU B N     1 
ATOM   1862 C CA    . GLU B 1 34  ? 11.058 47.603 40.768 1.00 34.57  ? 34  GLU B CA    1 
ATOM   1863 C C     . GLU B 1 34  ? 11.591 48.103 42.105 1.00 33.83  ? 34  GLU B C     1 
ATOM   1864 O O     . GLU B 1 34  ? 12.765 47.912 42.422 1.00 31.50  ? 34  GLU B O     1 
ATOM   1865 C CB    . GLU B 1 34  ? 10.395 46.249 41.039 1.00 37.83  ? 34  GLU B CB    1 
ATOM   1866 C CG    . GLU B 1 34  ? 10.144 45.341 39.857 1.00 44.97  ? 34  GLU B CG    1 
ATOM   1867 C CD    . GLU B 1 34  ? 9.408  44.074 40.277 1.00 47.85  ? 34  GLU B CD    1 
ATOM   1868 O OE1   . GLU B 1 34  ? 8.167  44.131 40.404 1.00 50.11  ? 34  GLU B OE1   1 
ATOM   1869 O OE2   . GLU B 1 34  ? 10.065 43.027 40.502 1.00 48.46  ? 34  GLU B OE2   1 
ATOM   1870 N N     . LYS B 1 35  ? 10.723 48.719 42.903 1.00 32.91  ? 35  LYS B N     1 
ATOM   1871 C CA    . LYS B 1 35  ? 11.146 49.201 44.213 1.00 33.08  ? 35  LYS B CA    1 
ATOM   1872 C C     . LYS B 1 35  ? 11.384 47.949 45.055 1.00 30.74  ? 35  LYS B C     1 
ATOM   1873 O O     . LYS B 1 35  ? 10.591 47.017 45.011 1.00 29.91  ? 35  LYS B O     1 
ATOM   1874 C CB    . LYS B 1 35  ? 10.048 50.055 44.853 1.00 37.19  ? 35  LYS B CB    1 
ATOM   1875 C CG    . LYS B 1 35  ? 9.402  51.059 43.903 1.00 42.57  ? 35  LYS B CG    1 
ATOM   1876 C CD    . LYS B 1 35  ? 10.432 51.916 43.167 1.00 46.18  ? 35  LYS B CD    1 
ATOM   1877 C CE    . LYS B 1 35  ? 11.272 52.751 44.122 1.00 47.22  ? 35  LYS B CE    1 
ATOM   1878 N NZ    . LYS B 1 35  ? 12.188 53.666 43.384 1.00 49.05  ? 35  LYS B NZ    1 
ATOM   1879 N N     . ALA B 1 36  ? 12.475 47.925 45.813 1.00 27.88  ? 36  ALA B N     1 
ATOM   1880 C CA    . ALA B 1 36  ? 12.800 46.766 46.644 1.00 25.18  ? 36  ALA B CA    1 
ATOM   1881 C C     . ALA B 1 36  ? 12.320 46.966 48.083 1.00 23.41  ? 36  ALA B C     1 
ATOM   1882 O O     . ALA B 1 36  ? 12.753 47.896 48.759 1.00 23.97  ? 36  ALA B O     1 
ATOM   1883 C CB    . ALA B 1 36  ? 14.308 46.527 46.625 1.00 23.99  ? 36  ALA B CB    1 
ATOM   1884 N N     . GLU B 1 37  ? 11.428 46.090 48.546 1.00 23.23  ? 37  GLU B N     1 
ATOM   1885 C CA    . GLU B 1 37  ? 10.893 46.188 49.907 1.00 24.12  ? 37  GLU B CA    1 
ATOM   1886 C C     . GLU B 1 37  ? 10.775 44.811 50.557 1.00 23.43  ? 37  GLU B C     1 
ATOM   1887 O O     . GLU B 1 37  ? 10.302 44.690 51.687 1.00 23.34  ? 37  GLU B O     1 
ATOM   1888 C CB    . GLU B 1 37  ? 9.493  46.818 49.901 1.00 25.92  ? 37  GLU B CB    1 
ATOM   1889 C CG    . GLU B 1 37  ? 9.358  48.134 49.151 1.00 28.65  ? 37  GLU B CG    1 
ATOM   1890 C CD    . GLU B 1 37  ? 7.914  48.628 49.135 1.00 27.66  ? 37  GLU B CD    1 
ATOM   1891 O OE1   . GLU B 1 37  ? 7.498  49.319 50.092 1.00 26.72  ? 37  GLU B OE1   1 
ATOM   1892 O OE2   . GLU B 1 37  ? 7.193  48.302 48.168 1.00 27.51  ? 37  GLU B OE2   1 
ATOM   1893 N N     . THR B 1 38  ? 11.194 43.772 49.847 1.00 22.56  ? 38  THR B N     1 
ATOM   1894 C CA    . THR B 1 38  ? 11.087 42.422 50.391 1.00 24.04  ? 38  THR B CA    1 
ATOM   1895 C C     . THR B 1 38  ? 12.317 41.579 50.121 1.00 23.18  ? 38  THR B C     1 
ATOM   1896 O O     . THR B 1 38  ? 13.030 41.806 49.144 1.00 23.06  ? 38  THR B O     1 
ATOM   1897 C CB    . THR B 1 38  ? 9.862  41.687 49.813 1.00 22.65  ? 38  THR B CB    1 
ATOM   1898 O OG1   . THR B 1 38  ? 10.021 41.525 48.399 1.00 22.93  ? 38  THR B OG1   1 
ATOM   1899 C CG2   . THR B 1 38  ? 8.595  42.487 50.079 1.00 22.94  ? 38  THR B CG2   1 
ATOM   1900 N N     . LEU B 1 39  ? 12.539 40.606 51.003 1.00 22.93  ? 39  LEU B N     1 
ATOM   1901 C CA    . LEU B 1 39  ? 13.663 39.670 50.944 1.00 22.61  ? 39  LEU B CA    1 
ATOM   1902 C C     . LEU B 1 39  ? 13.139 38.281 50.567 1.00 23.68  ? 39  LEU B C     1 
ATOM   1903 O O     . LEU B 1 39  ? 12.027 37.909 50.949 1.00 24.34  ? 39  LEU B O     1 
ATOM   1904 C CB    . LEU B 1 39  ? 14.337 39.609 52.321 1.00 23.12  ? 39  LEU B CB    1 
ATOM   1905 C CG    . LEU B 1 39  ? 15.537 38.683 52.536 1.00 23.90  ? 39  LEU B CG    1 
ATOM   1906 C CD1   . LEU B 1 39  ? 16.734 39.199 51.746 1.00 22.91  ? 39  LEU B CD1   1 
ATOM   1907 C CD2   . LEU B 1 39  ? 15.869 38.634 54.028 1.00 23.65  ? 39  LEU B CD2   1 
ATOM   1908 N N     . TYR B 1 40  ? 13.940 37.519 49.821 1.00 22.74  ? 40  TYR B N     1 
ATOM   1909 C CA    . TYR B 1 40  ? 13.562 36.173 49.389 1.00 22.32  ? 40  TYR B CA    1 
ATOM   1910 C C     . TYR B 1 40  ? 14.566 35.132 49.888 1.00 22.46  ? 40  TYR B C     1 
ATOM   1911 O O     . TYR B 1 40  ? 15.710 35.454 50.201 1.00 22.38  ? 40  TYR B O     1 
ATOM   1912 C CB    . TYR B 1 40  ? 13.515 36.095 47.858 1.00 22.55  ? 40  TYR B CB    1 
ATOM   1913 C CG    . TYR B 1 40  ? 12.458 36.958 47.206 1.00 23.14  ? 40  TYR B CG    1 
ATOM   1914 C CD1   . TYR B 1 40  ? 11.208 36.434 46.875 1.00 27.52  ? 40  TYR B CD1   1 
ATOM   1915 C CD2   . TYR B 1 40  ? 12.719 38.292 46.891 1.00 25.49  ? 40  TYR B CD2   1 
ATOM   1916 C CE1   . TYR B 1 40  ? 10.240 37.217 46.237 1.00 29.46  ? 40  TYR B CE1   1 
ATOM   1917 C CE2   . TYR B 1 40  ? 11.762 39.086 46.255 1.00 26.13  ? 40  TYR B CE2   1 
ATOM   1918 C CZ    . TYR B 1 40  ? 10.527 38.540 45.930 1.00 30.44  ? 40  TYR B CZ    1 
ATOM   1919 O OH    . TYR B 1 40  ? 9.582  39.310 45.295 1.00 32.50  ? 40  TYR B OH    1 
ATOM   1920 N N     . TYR B 1 41  ? 14.130 33.877 49.940 1.00 21.93  ? 41  TYR B N     1 
ATOM   1921 C CA    . TYR B 1 41  ? 14.985 32.773 50.366 1.00 24.59  ? 41  TYR B CA    1 
ATOM   1922 C C     . TYR B 1 41  ? 14.571 31.532 49.581 1.00 25.30  ? 41  TYR B C     1 
ATOM   1923 O O     . TYR B 1 41  ? 13.400 31.162 49.580 1.00 23.85  ? 41  TYR B O     1 
ATOM   1924 C CB    . TYR B 1 41  ? 14.820 32.507 51.862 1.00 26.48  ? 41  TYR B CB    1 
ATOM   1925 C CG    . TYR B 1 41  ? 15.688 31.380 52.386 1.00 26.39  ? 41  TYR B CG    1 
ATOM   1926 C CD1   . TYR B 1 41  ? 16.970 31.631 52.883 1.00 27.08  ? 41  TYR B CD1   1 
ATOM   1927 C CD2   . TYR B 1 41  ? 15.216 30.063 52.411 1.00 28.00  ? 41  TYR B CD2   1 
ATOM   1928 C CE1   . TYR B 1 41  ? 17.758 30.602 53.402 1.00 27.17  ? 41  TYR B CE1   1 
ATOM   1929 C CE2   . TYR B 1 41  ? 15.998 29.028 52.926 1.00 26.08  ? 41  TYR B CE2   1 
ATOM   1930 C CZ    . TYR B 1 41  ? 17.264 29.306 53.424 1.00 29.66  ? 41  TYR B CZ    1 
ATOM   1931 O OH    . TYR B 1 41  ? 18.020 28.299 53.977 1.00 30.01  ? 41  TYR B OH    1 
ATOM   1932 N N     . ILE B 1 42  ? 15.526 30.891 48.915 1.00 24.70  ? 42  ILE B N     1 
ATOM   1933 C CA    . ILE B 1 42  ? 15.215 29.706 48.125 1.00 24.55  ? 42  ILE B CA    1 
ATOM   1934 C C     . ILE B 1 42  ? 15.134 28.448 48.983 1.00 25.07  ? 42  ILE B C     1 
ATOM   1935 O O     . ILE B 1 42  ? 16.128 27.990 49.555 1.00 24.86  ? 42  ILE B O     1 
ATOM   1936 C CB    . ILE B 1 42  ? 16.256 29.478 47.007 1.00 23.78  ? 42  ILE B CB    1 
ATOM   1937 C CG1   . ILE B 1 42  ? 16.324 30.717 46.105 1.00 23.23  ? 42  ILE B CG1   1 
ATOM   1938 C CG2   . ILE B 1 42  ? 15.849 28.270 46.153 1.00 23.93  ? 42  ILE B CG2   1 
ATOM   1939 C CD1   . ILE B 1 42  ? 17.456 30.690 45.095 1.00 24.78  ? 42  ILE B CD1   1 
ATOM   1940 N N     . VAL B 1 43  ? 13.928 27.904 49.074 1.00 26.75  ? 43  VAL B N     1 
ATOM   1941 C CA    . VAL B 1 43  ? 13.687 26.691 49.836 1.00 28.11  ? 43  VAL B CA    1 
ATOM   1942 C C     . VAL B 1 43  ? 14.003 25.476 48.961 1.00 27.98  ? 43  VAL B C     1 
ATOM   1943 O O     . VAL B 1 43  ? 14.478 24.454 49.455 1.00 29.14  ? 43  VAL B O     1 
ATOM   1944 C CB    . VAL B 1 43  ? 12.216 26.627 50.302 1.00 29.73  ? 43  VAL B CB    1 
ATOM   1945 C CG1   . VAL B 1 43  ? 11.934 25.294 50.977 1.00 32.94  ? 43  VAL B CG1   1 
ATOM   1946 C CG2   . VAL B 1 43  ? 11.934 27.779 51.264 1.00 29.48  ? 43  VAL B CG2   1 
ATOM   1947 N N     . LYS B 1 44  ? 13.753 25.608 47.662 1.00 29.31  ? 44  LYS B N     1 
ATOM   1948 C CA    . LYS B 1 44  ? 13.995 24.535 46.702 1.00 30.29  ? 44  LYS B CA    1 
ATOM   1949 C C     . LYS B 1 44  ? 14.143 25.072 45.275 1.00 30.40  ? 44  LYS B C     1 
ATOM   1950 O O     . LYS B 1 44  ? 13.418 25.982 44.868 1.00 29.27  ? 44  LYS B O     1 
ATOM   1951 C CB    . LYS B 1 44  ? 12.831 23.538 46.766 1.00 35.18  ? 44  LYS B CB    1 
ATOM   1952 C CG    . LYS B 1 44  ? 12.700 22.608 45.576 1.00 41.32  ? 44  LYS B CG    1 
ATOM   1953 C CD    . LYS B 1 44  ? 13.735 21.499 45.585 1.00 44.29  ? 44  LYS B CD    1 
ATOM   1954 C CE    . LYS B 1 44  ? 13.407 20.455 44.523 1.00 45.10  ? 44  LYS B CE    1 
ATOM   1955 N NZ    . LYS B 1 44  ? 14.309 19.273 44.590 1.00 46.85  ? 44  LYS B NZ    1 
ATOM   1956 N N     . GLY B 1 45  ? 15.089 24.516 44.521 1.00 28.75  ? 45  GLY B N     1 
ATOM   1957 C CA    . GLY B 1 45  ? 15.278 24.940 43.143 1.00 29.66  ? 45  GLY B CA    1 
ATOM   1958 C C     . GLY B 1 45  ? 16.459 25.855 42.881 1.00 29.13  ? 45  GLY B C     1 
ATOM   1959 O O     . GLY B 1 45  ? 17.293 26.079 43.750 1.00 31.92  ? 45  GLY B O     1 
ATOM   1960 N N     . SER B 1 46  ? 16.530 26.388 41.667 1.00 31.01  ? 46  SER B N     1 
ATOM   1961 C CA    . SER B 1 46  ? 17.617 27.282 41.300 1.00 30.96  ? 46  SER B CA    1 
ATOM   1962 C C     . SER B 1 46  ? 17.136 28.396 40.371 1.00 29.97  ? 46  SER B C     1 
ATOM   1963 O O     . SER B 1 46  ? 16.209 28.215 39.574 1.00 30.36  ? 46  SER B O     1 
ATOM   1964 C CB    . SER B 1 46  ? 18.743 26.490 40.637 1.00 33.02  ? 46  SER B CB    1 
ATOM   1965 O OG    . SER B 1 46  ? 18.280 25.859 39.464 1.00 38.13  ? 46  SER B OG    1 
ATOM   1966 N N     . VAL B 1 47  ? 17.774 29.554 40.490 1.00 26.93  ? 47  VAL B N     1 
ATOM   1967 C CA    . VAL B 1 47  ? 17.422 30.713 39.689 1.00 25.55  ? 47  VAL B CA    1 
ATOM   1968 C C     . VAL B 1 47  ? 18.654 31.321 39.048 1.00 25.56  ? 47  VAL B C     1 
ATOM   1969 O O     . VAL B 1 47  ? 19.786 31.004 39.416 1.00 26.19  ? 47  VAL B O     1 
ATOM   1970 C CB    . VAL B 1 47  ? 16.765 31.813 40.556 1.00 25.17  ? 47  VAL B CB    1 
ATOM   1971 C CG1   . VAL B 1 47  ? 15.562 31.244 41.292 1.00 24.29  ? 47  VAL B CG1   1 
ATOM   1972 C CG2   . VAL B 1 47  ? 17.784 32.363 41.557 1.00 23.11  ? 47  VAL B CG2   1 
ATOM   1973 N N     . ALA B 1 48  ? 18.417 32.204 38.086 1.00 24.48  ? 48  ALA B N     1 
ATOM   1974 C CA    . ALA B 1 48  ? 19.493 32.896 37.409 1.00 24.65  ? 48  ALA B CA    1 
ATOM   1975 C C     . ALA B 1 48  ? 19.321 34.388 37.651 1.00 24.58  ? 48  ALA B C     1 
ATOM   1976 O O     . ALA B 1 48  ? 18.233 34.927 37.458 1.00 25.85  ? 48  ALA B O     1 
ATOM   1977 C CB    . ALA B 1 48  ? 19.451 32.607 35.907 1.00 25.92  ? 48  ALA B CB    1 
ATOM   1978 N N     . VAL B 1 49  ? 20.387 35.043 38.104 1.00 24.45  ? 49  VAL B N     1 
ATOM   1979 C CA    . VAL B 1 49  ? 20.358 36.487 38.319 1.00 23.55  ? 49  VAL B CA    1 
ATOM   1980 C C     . VAL B 1 49  ? 20.912 37.057 37.019 1.00 24.24  ? 49  VAL B C     1 
ATOM   1981 O O     . VAL B 1 49  ? 22.034 36.735 36.618 1.00 24.78  ? 49  VAL B O     1 
ATOM   1982 C CB    . VAL B 1 49  ? 21.270 36.917 39.492 1.00 22.75  ? 49  VAL B CB    1 
ATOM   1983 C CG1   . VAL B 1 49  ? 21.245 38.436 39.633 1.00 22.01  ? 49  VAL B CG1   1 
ATOM   1984 C CG2   . VAL B 1 49  ? 20.796 36.256 40.795 1.00 21.25  ? 49  VAL B CG2   1 
ATOM   1985 N N     . LEU B 1 50  ? 20.148 37.900 36.344 1.00 23.99  ? 50  LEU B N     1 
ATOM   1986 C CA    . LEU B 1 50  ? 20.659 38.405 35.084 1.00 26.64  ? 50  LEU B CA    1 
ATOM   1987 C C     . LEU B 1 50  ? 20.407 39.862 34.770 1.00 25.62  ? 50  LEU B C     1 
ATOM   1988 O O     . LEU B 1 50  ? 19.486 40.486 35.303 1.00 24.57  ? 50  LEU B O     1 
ATOM   1989 C CB    . LEU B 1 50  ? 20.128 37.537 33.949 1.00 30.27  ? 50  LEU B CB    1 
ATOM   1990 C CG    . LEU B 1 50  ? 18.613 37.402 33.890 1.00 31.60  ? 50  LEU B CG    1 
ATOM   1991 C CD1   . LEU B 1 50  ? 18.071 38.342 32.817 1.00 35.46  ? 50  LEU B CD1   1 
ATOM   1992 C CD2   . LEU B 1 50  ? 18.242 35.954 33.585 1.00 34.16  ? 50  LEU B CD2   1 
ATOM   1993 N N     . ILE B 1 51  ? 21.263 40.393 33.902 1.00 23.42  ? 51  ILE B N     1 
ATOM   1994 C CA    . ILE B 1 51  ? 21.169 41.765 33.442 1.00 25.66  ? 51  ILE B CA    1 
ATOM   1995 C C     . ILE B 1 51  ? 21.124 41.725 31.907 1.00 26.18  ? 51  ILE B C     1 
ATOM   1996 O O     . ILE B 1 51  ? 21.432 40.693 31.303 1.00 24.17  ? 51  ILE B O     1 
ATOM   1997 C CB    . ILE B 1 51  ? 22.373 42.606 33.936 1.00 27.31  ? 51  ILE B CB    1 
ATOM   1998 C CG1   . ILE B 1 51  ? 23.685 41.871 33.655 1.00 28.23  ? 51  ILE B CG1   1 
ATOM   1999 C CG2   . ILE B 1 51  ? 22.233 42.877 35.440 1.00 27.58  ? 51  ILE B CG2   1 
ATOM   2000 C CD1   . ILE B 1 51  ? 24.927 42.657 34.054 1.00 29.05  ? 51  ILE B CD1   1 
ATOM   2001 N N     . LYS B 1 52  ? 20.734 42.835 31.287 1.00 28.52  ? 52  LYS B N     1 
ATOM   2002 C CA    . LYS B 1 52  ? 20.615 42.908 29.828 1.00 31.60  ? 52  LYS B CA    1 
ATOM   2003 C C     . LYS B 1 52  ? 21.111 44.237 29.282 1.00 32.83  ? 52  LYS B C     1 
ATOM   2004 O O     . LYS B 1 52  ? 21.034 45.253 29.970 1.00 30.93  ? 52  LYS B O     1 
ATOM   2005 C CB    . LYS B 1 52  ? 19.151 42.773 29.412 1.00 32.46  ? 52  LYS B CB    1 
ATOM   2006 C CG    . LYS B 1 52  ? 18.422 41.561 29.941 1.00 37.16  ? 52  LYS B CG    1 
ATOM   2007 C CD    . LYS B 1 52  ? 16.962 41.615 29.518 1.00 39.72  ? 52  LYS B CD    1 
ATOM   2008 C CE    . LYS B 1 52  ? 16.182 40.416 30.025 1.00 44.25  ? 52  LYS B CE    1 
ATOM   2009 N NZ    . LYS B 1 52  ? 14.765 40.466 29.571 1.00 46.10  ? 52  LYS B NZ    1 
ATOM   2010 N N     . ASP B 1 53  ? 21.599 44.238 28.041 1.00 33.94  ? 53  ASP B N     1 
ATOM   2011 C CA    . ASP B 1 53  ? 22.047 45.485 27.432 1.00 36.68  ? 53  ASP B CA    1 
ATOM   2012 C C     . ASP B 1 53  ? 20.833 46.157 26.792 1.00 38.94  ? 53  ASP B C     1 
ATOM   2013 O O     . ASP B 1 53  ? 19.734 45.595 26.796 1.00 38.58  ? 53  ASP B O     1 
ATOM   2014 C CB    . ASP B 1 53  ? 23.163 45.246 26.397 1.00 35.23  ? 53  ASP B CB    1 
ATOM   2015 C CG    . ASP B 1 53  ? 22.672 44.604 25.107 1.00 36.18  ? 53  ASP B CG    1 
ATOM   2016 O OD1   . ASP B 1 53  ? 23.521 44.420 24.207 1.00 34.95  ? 53  ASP B OD1   1 
ATOM   2017 O OD2   . ASP B 1 53  ? 21.468 44.286 24.976 1.00 33.00  ? 53  ASP B OD2   1 
ATOM   2018 N N     . GLU B 1 54  ? 21.031 47.356 26.255 1.00 42.58  ? 54  GLU B N     1 
ATOM   2019 C CA    . GLU B 1 54  ? 19.950 48.124 25.639 1.00 46.34  ? 54  GLU B CA    1 
ATOM   2020 C C     . GLU B 1 54  ? 19.088 47.349 24.648 1.00 46.95  ? 54  GLU B C     1 
ATOM   2021 O O     . GLU B 1 54  ? 17.906 47.656 24.474 1.00 48.07  ? 54  GLU B O     1 
ATOM   2022 C CB    . GLU B 1 54  ? 20.520 49.360 24.936 1.00 49.78  ? 54  GLU B CB    1 
ATOM   2023 C CG    . GLU B 1 54  ? 21.413 50.234 25.808 1.00 55.07  ? 54  GLU B CG    1 
ATOM   2024 C CD    . GLU B 1 54  ? 20.731 50.697 27.081 1.00 57.74  ? 54  GLU B CD    1 
ATOM   2025 O OE1   . GLU B 1 54  ? 20.478 49.852 27.969 1.00 59.41  ? 54  GLU B OE1   1 
ATOM   2026 O OE2   . GLU B 1 54  ? 20.444 51.909 27.195 1.00 60.48  ? 54  GLU B OE2   1 
ATOM   2027 N N     . GLU B 1 55  ? 19.672 46.346 24.005 1.00 46.61  ? 55  GLU B N     1 
ATOM   2028 C CA    . GLU B 1 55  ? 18.954 45.564 23.010 1.00 46.76  ? 55  GLU B CA    1 
ATOM   2029 C C     . GLU B 1 55  ? 18.436 44.223 23.510 1.00 46.25  ? 55  GLU B C     1 
ATOM   2030 O O     . GLU B 1 55  ? 17.856 43.452 22.746 1.00 47.12  ? 55  GLU B O     1 
ATOM   2031 C CB    . GLU B 1 55  ? 19.852 45.363 21.792 1.00 48.12  ? 55  GLU B CB    1 
ATOM   2032 C CG    . GLU B 1 55  ? 20.262 46.678 21.152 1.00 51.06  ? 55  GLU B CG    1 
ATOM   2033 C CD    . GLU B 1 55  ? 21.460 46.539 20.241 1.00 53.32  ? 55  GLU B CD    1 
ATOM   2034 O OE1   . GLU B 1 55  ? 21.888 47.561 19.664 1.00 54.22  ? 55  GLU B OE1   1 
ATOM   2035 O OE2   . GLU B 1 55  ? 21.975 45.410 20.106 1.00 53.80  ? 55  GLU B OE2   1 
ATOM   2036 N N     . GLY B 1 56  ? 18.651 43.940 24.789 1.00 44.37  ? 56  GLY B N     1 
ATOM   2037 C CA    . GLY B 1 56  ? 18.161 42.693 25.345 1.00 41.45  ? 56  GLY B CA    1 
ATOM   2038 C C     . GLY B 1 56  ? 19.131 41.532 25.412 1.00 38.71  ? 56  GLY B C     1 
ATOM   2039 O O     . GLY B 1 56  ? 18.735 40.435 25.802 1.00 38.80  ? 56  GLY B O     1 
ATOM   2040 N N     . LYS B 1 57  ? 20.386 41.744 25.027 1.00 36.67  ? 57  LYS B N     1 
ATOM   2041 C CA    . LYS B 1 57  ? 21.363 40.662 25.094 1.00 34.81  ? 57  LYS B CA    1 
ATOM   2042 C C     . LYS B 1 57  ? 21.565 40.384 26.578 1.00 33.92  ? 57  LYS B C     1 
ATOM   2043 O O     . LYS B 1 57  ? 21.789 41.307 27.359 1.00 32.27  ? 57  LYS B O     1 
ATOM   2044 C CB    . LYS B 1 57  ? 22.683 41.075 24.435 1.00 35.32  ? 57  LYS B CB    1 
ATOM   2045 C CG    . LYS B 1 57  ? 23.722 39.959 24.385 1.00 35.79  ? 57  LYS B CG    1 
ATOM   2046 C CD    . LYS B 1 57  ? 24.891 40.309 23.464 1.00 37.75  ? 57  LYS B CD    1 
ATOM   2047 C CE    . LYS B 1 57  ? 25.657 41.532 23.948 1.00 37.05  ? 57  LYS B CE    1 
ATOM   2048 N NZ    . LYS B 1 57  ? 26.824 41.840 23.073 1.00 37.22  ? 57  LYS B NZ    1 
ATOM   2049 N N     . GLU B 1 58  ? 21.488 39.114 26.961 1.00 33.05  ? 58  GLU B N     1 
ATOM   2050 C CA    . GLU B 1 58  ? 21.602 38.724 28.364 1.00 32.31  ? 58  GLU B CA    1 
ATOM   2051 C C     . GLU B 1 58  ? 22.950 38.252 28.891 1.00 30.99  ? 58  GLU B C     1 
ATOM   2052 O O     . GLU B 1 58  ? 23.773 37.702 28.165 1.00 28.92  ? 58  GLU B O     1 
ATOM   2053 C CB    . GLU B 1 58  ? 20.588 37.617 28.669 1.00 33.29  ? 58  GLU B CB    1 
ATOM   2054 C CG    . GLU B 1 58  ? 19.137 37.998 28.462 1.00 38.45  ? 58  GLU B CG    1 
ATOM   2055 C CD    . GLU B 1 58  ? 18.203 36.817 28.654 1.00 40.62  ? 58  GLU B CD    1 
ATOM   2056 O OE1   . GLU B 1 58  ? 16.972 37.022 28.661 1.00 44.84  ? 58  GLU B OE1   1 
ATOM   2057 O OE2   . GLU B 1 58  ? 18.700 35.680 28.793 1.00 43.30  ? 58  GLU B OE2   1 
ATOM   2058 N N     . MET B 1 59  ? 23.156 38.481 30.184 1.00 29.52  ? 59  MET B N     1 
ATOM   2059 C CA    . MET B 1 59  ? 24.344 38.009 30.867 1.00 30.19  ? 59  MET B CA    1 
ATOM   2060 C C     . MET B 1 59  ? 23.937 37.599 32.271 1.00 28.52  ? 59  MET B C     1 
ATOM   2061 O O     . MET B 1 59  ? 23.249 38.337 32.973 1.00 25.56  ? 59  MET B O     1 
ATOM   2062 C CB    . MET B 1 59  ? 25.445 39.058 30.951 1.00 31.93  ? 59  MET B CB    1 
ATOM   2063 C CG    . MET B 1 59  ? 26.599 38.536 31.801 1.00 37.15  ? 59  MET B CG    1 
ATOM   2064 S SD    . MET B 1 59  ? 28.122 39.448 31.702 1.00 42.45  ? 59  MET B SD    1 
ATOM   2065 C CE    . MET B 1 59  ? 29.212 38.231 31.024 1.00 42.75  ? 59  MET B CE    1 
ATOM   2066 N N     . ILE B 1 60  ? 24.359 36.409 32.672 1.00 28.20  ? 60  ILE B N     1 
ATOM   2067 C CA    . ILE B 1 60  ? 24.032 35.900 33.990 1.00 28.77  ? 60  ILE B CA    1 
ATOM   2068 C C     . ILE B 1 60  ? 25.102 36.307 34.996 1.00 28.95  ? 60  ILE B C     1 
ATOM   2069 O O     . ILE B 1 60  ? 26.279 35.994 34.821 1.00 30.12  ? 60  ILE B O     1 
ATOM   2070 C CB    . ILE B 1 60  ? 23.891 34.358 33.943 1.00 31.89  ? 60  ILE B CB    1 
ATOM   2071 C CG1   . ILE B 1 60  ? 22.688 33.995 33.063 1.00 33.90  ? 60  ILE B CG1   1 
ATOM   2072 C CG2   . ILE B 1 60  ? 23.738 33.792 35.356 1.00 32.42  ? 60  ILE B CG2   1 
ATOM   2073 C CD1   . ILE B 1 60  ? 22.482 32.511 32.845 1.00 38.60  ? 60  ILE B CD1   1 
ATOM   2074 N N     . LEU B 1 61  ? 24.696 37.030 36.038 1.00 24.95  ? 61  LEU B N     1 
ATOM   2075 C CA    . LEU B 1 61  ? 25.633 37.456 37.067 1.00 25.50  ? 61  LEU B CA    1 
ATOM   2076 C C     . LEU B 1 61  ? 25.945 36.277 37.968 1.00 27.20  ? 61  LEU B C     1 
ATOM   2077 O O     . LEU B 1 61  ? 27.058 36.142 38.481 1.00 27.26  ? 61  LEU B O     1 
ATOM   2078 C CB    . LEU B 1 61  ? 25.041 38.597 37.904 1.00 25.90  ? 61  LEU B CB    1 
ATOM   2079 C CG    . LEU B 1 61  ? 24.976 39.969 37.229 1.00 26.42  ? 61  LEU B CG    1 
ATOM   2080 C CD1   . LEU B 1 61  ? 24.237 40.951 38.120 1.00 25.72  ? 61  LEU B CD1   1 
ATOM   2081 C CD2   . LEU B 1 61  ? 26.401 40.464 36.944 1.00 28.60  ? 61  LEU B CD2   1 
ATOM   2082 N N     . SER B 1 62  ? 24.956 35.411 38.154 1.00 26.17  ? 62  SER B N     1 
ATOM   2083 C CA    . SER B 1 62  ? 25.140 34.253 39.008 1.00 26.95  ? 62  SER B CA    1 
ATOM   2084 C C     . SER B 1 62  ? 23.900 33.389 39.039 1.00 27.90  ? 62  SER B C     1 
ATOM   2085 O O     . SER B 1 62  ? 22.794 33.852 38.753 1.00 24.86  ? 62  SER B O     1 
ATOM   2086 C CB    . SER B 1 62  ? 25.454 34.712 40.441 1.00 30.46  ? 62  SER B CB    1 
ATOM   2087 O OG    . SER B 1 62  ? 25.566 33.620 41.344 1.00 28.71  ? 62  SER B OG    1 
ATOM   2088 N N     . TYR B 1 63  ? 24.105 32.119 39.361 1.00 28.40  ? 63  TYR B N     1 
ATOM   2089 C CA    . TYR B 1 63  ? 23.006 31.193 39.532 1.00 27.96  ? 63  TYR B CA    1 
ATOM   2090 C C     . TYR B 1 63  ? 22.928 31.124 41.051 1.00 25.86  ? 63  TYR B C     1 
ATOM   2091 O O     . TYR B 1 63  ? 23.943 31.285 41.727 1.00 24.84  ? 63  TYR B O     1 
ATOM   2092 C CB    . TYR B 1 63  ? 23.346 29.810 38.984 1.00 31.63  ? 63  TYR B CB    1 
ATOM   2093 C CG    . TYR B 1 63  ? 23.216 29.682 37.486 1.00 33.40  ? 63  TYR B CG    1 
ATOM   2094 C CD1   . TYR B 1 63  ? 21.995 29.911 36.852 1.00 36.56  ? 63  TYR B CD1   1 
ATOM   2095 C CD2   . TYR B 1 63  ? 24.302 29.299 36.705 1.00 36.10  ? 63  TYR B CD2   1 
ATOM   2096 C CE1   . TYR B 1 63  ? 21.860 29.758 35.474 1.00 38.93  ? 63  TYR B CE1   1 
ATOM   2097 C CE2   . TYR B 1 63  ? 24.178 29.143 35.326 1.00 38.41  ? 63  TYR B CE2   1 
ATOM   2098 C CZ    . TYR B 1 63  ? 22.957 29.373 34.718 1.00 38.83  ? 63  TYR B CZ    1 
ATOM   2099 O OH    . TYR B 1 63  ? 22.829 29.209 33.357 1.00 40.56  ? 63  TYR B OH    1 
ATOM   2100 N N     . LEU B 1 64  ? 21.735 30.928 41.589 1.00 24.18  ? 64  LEU B N     1 
ATOM   2101 C CA    . LEU B 1 64  ? 21.574 30.812 43.034 1.00 25.09  ? 64  LEU B CA    1 
ATOM   2102 C C     . LEU B 1 64  ? 20.734 29.570 43.261 1.00 26.11  ? 64  LEU B C     1 
ATOM   2103 O O     . LEU B 1 64  ? 19.889 29.225 42.426 1.00 25.63  ? 64  LEU B O     1 
ATOM   2104 C CB    . LEU B 1 64  ? 20.894 32.052 43.618 1.00 24.52  ? 64  LEU B CB    1 
ATOM   2105 C CG    . LEU B 1 64  ? 21.718 33.343 43.535 1.00 25.69  ? 64  LEU B CG    1 
ATOM   2106 C CD1   . LEU B 1 64  ? 20.857 34.522 43.989 1.00 25.15  ? 64  LEU B CD1   1 
ATOM   2107 C CD2   . LEU B 1 64  ? 22.985 33.221 44.404 1.00 25.53  ? 64  LEU B CD2   1 
ATOM   2108 N N     . ASN B 1 65  ? 20.963 28.901 44.386 1.00 25.13  ? 65  ASN B N     1 
ATOM   2109 C CA    . ASN B 1 65  ? 20.258 27.661 44.669 1.00 27.81  ? 65  ASN B CA    1 
ATOM   2110 C C     . ASN B 1 65  ? 19.626 27.586 46.048 1.00 27.18  ? 65  ASN B C     1 
ATOM   2111 O O     . ASN B 1 65  ? 19.571 28.567 46.788 1.00 24.86  ? 65  ASN B O     1 
ATOM   2112 C CB    . ASN B 1 65  ? 21.231 26.494 44.502 1.00 30.27  ? 65  ASN B CB    1 
ATOM   2113 C CG    . ASN B 1 65  ? 21.956 26.533 43.173 1.00 33.77  ? 65  ASN B CG    1 
ATOM   2114 O OD1   . ASN B 1 65  ? 21.391 26.193 42.134 1.00 37.46  ? 65  ASN B OD1   1 
ATOM   2115 N ND2   . ASN B 1 65  ? 23.210 26.969 43.197 1.00 36.69  ? 65  ASN B ND2   1 
ATOM   2116 N N     . GLN B 1 66  ? 19.159 26.392 46.390 1.00 26.80  ? 66  GLN B N     1 
ATOM   2117 C CA    . GLN B 1 66  ? 18.531 26.165 47.679 1.00 26.82  ? 66  GLN B CA    1 
ATOM   2118 C C     . GLN B 1 66  ? 19.424 26.687 48.794 1.00 25.73  ? 66  GLN B C     1 
ATOM   2119 O O     . GLN B 1 66  ? 20.632 26.433 48.809 1.00 25.75  ? 66  GLN B O     1 
ATOM   2120 C CB    . GLN B 1 66  ? 18.277 24.672 47.882 1.00 30.58  ? 66  GLN B CB    1 
ATOM   2121 C CG    . GLN B 1 66  ? 17.499 24.353 49.137 1.00 35.75  ? 66  GLN B CG    1 
ATOM   2122 C CD    . GLN B 1 66  ? 17.272 22.867 49.301 1.00 41.02  ? 66  GLN B CD    1 
ATOM   2123 O OE1   . GLN B 1 66  ? 16.850 22.186 48.363 1.00 42.20  ? 66  GLN B OE1   1 
ATOM   2124 N NE2   . GLN B 1 66  ? 17.544 22.354 50.496 1.00 41.61  ? 66  GLN B NE2   1 
ATOM   2125 N N     . GLY B 1 67  ? 18.829 27.423 49.725 1.00 22.82  ? 67  GLY B N     1 
ATOM   2126 C CA    . GLY B 1 67  ? 19.599 27.957 50.833 1.00 23.59  ? 67  GLY B CA    1 
ATOM   2127 C C     . GLY B 1 67  ? 20.129 29.368 50.611 1.00 22.69  ? 67  GLY B C     1 
ATOM   2128 O O     . GLY B 1 67  ? 20.673 29.966 51.533 1.00 22.66  ? 67  GLY B O     1 
ATOM   2129 N N     . ASP B 1 68  ? 19.972 29.900 49.402 1.00 23.02  ? 68  ASP B N     1 
ATOM   2130 C CA    . ASP B 1 68  ? 20.448 31.257 49.095 1.00 22.81  ? 68  ASP B CA    1 
ATOM   2131 C C     . ASP B 1 68  ? 19.371 32.328 49.251 1.00 21.26  ? 68  ASP B C     1 
ATOM   2132 O O     . ASP B 1 68  ? 18.221 32.136 48.854 1.00 21.11  ? 68  ASP B O     1 
ATOM   2133 C CB    . ASP B 1 68  ? 20.972 31.353 47.651 1.00 24.65  ? 68  ASP B CB    1 
ATOM   2134 C CG    . ASP B 1 68  ? 22.332 30.708 47.463 1.00 25.89  ? 68  ASP B CG    1 
ATOM   2135 O OD1   . ASP B 1 68  ? 23.180 30.832 48.365 1.00 29.89  ? 68  ASP B OD1   1 
ATOM   2136 O OD2   . ASP B 1 68  ? 22.557 30.100 46.394 1.00 24.56  ? 68  ASP B OD2   1 
ATOM   2137 N N     . PHE B 1 69  ? 19.758 33.463 49.822 1.00 21.18  ? 69  PHE B N     1 
ATOM   2138 C CA    . PHE B 1 69  ? 18.851 34.599 49.974 1.00 21.30  ? 69  PHE B CA    1 
ATOM   2139 C C     . PHE B 1 69  ? 18.846 35.318 48.626 1.00 20.45  ? 69  PHE B C     1 
ATOM   2140 O O     . PHE B 1 69  ? 19.809 35.219 47.878 1.00 19.48  ? 69  PHE B O     1 
ATOM   2141 C CB    . PHE B 1 69  ? 19.393 35.578 51.016 1.00 22.09  ? 69  PHE B CB    1 
ATOM   2142 C CG    . PHE B 1 69  ? 19.175 35.150 52.428 1.00 23.54  ? 69  PHE B CG    1 
ATOM   2143 C CD1   . PHE B 1 69  ? 17.951 35.376 53.051 1.00 23.87  ? 69  PHE B CD1   1 
ATOM   2144 C CD2   . PHE B 1 69  ? 20.192 34.519 53.141 1.00 22.31  ? 69  PHE B CD2   1 
ATOM   2145 C CE1   . PHE B 1 69  ? 17.740 34.978 54.372 1.00 25.31  ? 69  PHE B CE1   1 
ATOM   2146 C CE2   . PHE B 1 69  ? 19.989 34.119 54.458 1.00 25.65  ? 69  PHE B CE2   1 
ATOM   2147 C CZ    . PHE B 1 69  ? 18.760 34.349 55.073 1.00 24.46  ? 69  PHE B CZ    1 
ATOM   2148 N N     . ILE B 1 70  ? 17.763 36.025 48.314 1.00 19.61  ? 70  ILE B N     1 
ATOM   2149 C CA    . ILE B 1 70  ? 17.689 36.810 47.081 1.00 20.70  ? 70  ILE B CA    1 
ATOM   2150 C C     . ILE B 1 70  ? 16.991 38.119 47.452 1.00 19.83  ? 70  ILE B C     1 
ATOM   2151 O O     . ILE B 1 70  ? 16.284 38.177 48.455 1.00 20.60  ? 70  ILE B O     1 
ATOM   2152 C CB    . ILE B 1 70  ? 16.815 36.190 45.970 1.00 21.59  ? 70  ILE B CB    1 
ATOM   2153 C CG1   . ILE B 1 70  ? 16.716 34.678 46.098 1.00 23.63  ? 70  ILE B CG1   1 
ATOM   2154 C CG2   . ILE B 1 70  ? 17.414 36.553 44.608 1.00 24.64  ? 70  ILE B CG2   1 
ATOM   2155 C CD1   . ILE B 1 70  ? 15.820 34.069 45.018 1.00 25.42  ? 70  ILE B CD1   1 
ATOM   2156 N N     . GLY B 1 71  ? 17.176 39.148 46.628 1.00 21.34  ? 71  GLY B N     1 
ATOM   2157 C CA    . GLY B 1 71  ? 16.548 40.439 46.874 1.00 19.85  ? 71  GLY B CA    1 
ATOM   2158 C C     . GLY B 1 71  ? 17.008 41.123 48.145 1.00 21.41  ? 71  GLY B C     1 
ATOM   2159 O O     . GLY B 1 71  ? 16.265 41.900 48.752 1.00 20.90  ? 71  GLY B O     1 
ATOM   2160 N N     . GLU B 1 72  ? 18.244 40.859 48.544 1.00 20.25  ? 72  GLU B N     1 
ATOM   2161 C CA    . GLU B 1 72  ? 18.764 41.443 49.773 1.00 21.60  ? 72  GLU B CA    1 
ATOM   2162 C C     . GLU B 1 72  ? 19.417 42.817 49.616 1.00 20.89  ? 72  GLU B C     1 
ATOM   2163 O O     . GLU B 1 72  ? 19.619 43.530 50.604 1.00 20.44  ? 72  GLU B O     1 
ATOM   2164 C CB    . GLU B 1 72  ? 19.787 40.485 50.406 1.00 21.48  ? 72  GLU B CB    1 
ATOM   2165 C CG    . GLU B 1 72  ? 21.183 40.483 49.746 1.00 21.51  ? 72  GLU B CG    1 
ATOM   2166 C CD    . GLU B 1 72  ? 21.259 39.738 48.411 1.00 22.32  ? 72  GLU B CD    1 
ATOM   2167 O OE1   . GLU B 1 72  ? 22.348 39.750 47.798 1.00 21.14  ? 72  GLU B OE1   1 
ATOM   2168 O OE2   . GLU B 1 72  ? 20.255 39.139 47.966 1.00 21.43  ? 72  GLU B OE2   1 
ATOM   2169 N N     . LEU B 1 73  ? 19.724 43.209 48.387 1.00 19.35  ? 73  LEU B N     1 
ATOM   2170 C CA    . LEU B 1 73  ? 20.442 44.462 48.197 1.00 21.54  ? 73  LEU B CA    1 
ATOM   2171 C C     . LEU B 1 73  ? 19.734 45.777 48.533 1.00 23.05  ? 73  LEU B C     1 
ATOM   2172 O O     . LEU B 1 73  ? 20.395 46.805 48.675 1.00 22.89  ? 73  LEU B O     1 
ATOM   2173 C CB    . LEU B 1 73  ? 21.042 44.495 46.784 1.00 21.22  ? 73  LEU B CB    1 
ATOM   2174 C CG    . LEU B 1 73  ? 21.975 43.295 46.522 1.00 18.37  ? 73  LEU B CG    1 
ATOM   2175 C CD1   . LEU B 1 73  ? 22.607 43.416 45.130 1.00 21.93  ? 73  LEU B CD1   1 
ATOM   2176 C CD2   . LEU B 1 73  ? 23.080 43.232 47.593 1.00 20.39  ? 73  LEU B CD2   1 
ATOM   2177 N N     . GLY B 1 74  ? 18.413 45.751 48.694 1.00 23.06  ? 74  GLY B N     1 
ATOM   2178 C CA    . GLY B 1 74  ? 17.705 46.979 49.029 1.00 23.12  ? 74  GLY B CA    1 
ATOM   2179 C C     . GLY B 1 74  ? 17.347 47.086 50.503 1.00 24.24  ? 74  GLY B C     1 
ATOM   2180 O O     . GLY B 1 74  ? 16.712 48.050 50.932 1.00 23.59  ? 74  GLY B O     1 
ATOM   2181 N N     . LEU B 1 75  ? 17.784 46.106 51.287 1.00 24.07  ? 75  LEU B N     1 
ATOM   2182 C CA    . LEU B 1 75  ? 17.474 46.030 52.716 1.00 23.09  ? 75  LEU B CA    1 
ATOM   2183 C C     . LEU B 1 75  ? 18.059 47.079 53.664 1.00 27.76  ? 75  LEU B C     1 
ATOM   2184 O O     . LEU B 1 75  ? 17.457 47.396 54.692 1.00 27.51  ? 75  LEU B O     1 
ATOM   2185 C CB    . LEU B 1 75  ? 17.878 44.646 53.242 1.00 24.09  ? 75  LEU B CB    1 
ATOM   2186 C CG    . LEU B 1 75  ? 17.840 44.462 54.766 1.00 24.76  ? 75  LEU B CG    1 
ATOM   2187 C CD1   . LEU B 1 75  ? 16.377 44.535 55.239 1.00 24.61  ? 75  LEU B CD1   1 
ATOM   2188 C CD2   . LEU B 1 75  ? 18.459 43.131 55.165 1.00 21.83  ? 75  LEU B CD2   1 
ATOM   2189 N N     . PHE B 1 76  ? 19.216 47.627 53.320 1.00 26.87  ? 76  PHE B N     1 
ATOM   2190 C CA    . PHE B 1 76  ? 19.886 48.555 54.214 1.00 28.94  ? 76  PHE B CA    1 
ATOM   2191 C C     . PHE B 1 76  ? 19.639 50.040 54.008 1.00 31.06  ? 76  PHE B C     1 
ATOM   2192 O O     . PHE B 1 76  ? 20.137 50.863 54.775 1.00 32.37  ? 76  PHE B O     1 
ATOM   2193 C CB    . PHE B 1 76  ? 21.374 48.230 54.182 1.00 27.02  ? 76  PHE B CB    1 
ATOM   2194 C CG    . PHE B 1 76  ? 21.661 46.777 54.443 1.00 26.77  ? 76  PHE B CG    1 
ATOM   2195 C CD1   . PHE B 1 76  ? 21.745 46.292 55.748 1.00 25.54  ? 76  PHE B CD1   1 
ATOM   2196 C CD2   . PHE B 1 76  ? 21.781 45.876 53.386 1.00 25.41  ? 76  PHE B CD2   1 
ATOM   2197 C CE1   . PHE B 1 76  ? 21.944 44.930 55.992 1.00 25.01  ? 76  PHE B CE1   1 
ATOM   2198 C CE2   . PHE B 1 76  ? 21.979 44.510 53.624 1.00 23.50  ? 76  PHE B CE2   1 
ATOM   2199 C CZ    . PHE B 1 76  ? 22.061 44.041 54.927 1.00 24.53  ? 76  PHE B CZ    1 
ATOM   2200 N N     . GLU B 1 77  ? 18.854 50.374 52.992 1.00 33.04  ? 77  GLU B N     1 
ATOM   2201 C CA    . GLU B 1 77  ? 18.516 51.760 52.691 1.00 36.55  ? 77  GLU B CA    1 
ATOM   2202 C C     . GLU B 1 77  ? 17.205 51.763 51.910 1.00 37.08  ? 77  GLU B C     1 
ATOM   2203 O O     . GLU B 1 77  ? 17.085 51.093 50.885 1.00 35.07  ? 77  GLU B O     1 
ATOM   2204 C CB    . GLU B 1 77  ? 19.626 52.408 51.861 1.00 39.61  ? 77  GLU B CB    1 
ATOM   2205 C CG    . GLU B 1 77  ? 19.423 53.896 51.613 1.00 44.87  ? 77  GLU B CG    1 
ATOM   2206 C CD    . GLU B 1 77  ? 20.563 54.523 50.829 1.00 48.80  ? 77  GLU B CD    1 
ATOM   2207 O OE1   . GLU B 1 77  ? 20.510 55.747 50.578 1.00 52.18  ? 77  GLU B OE1   1 
ATOM   2208 O OE2   . GLU B 1 77  ? 21.511 53.796 50.462 1.00 50.77  ? 77  GLU B OE2   1 
ATOM   2209 N N     . GLU B 1 78  ? 16.213 52.502 52.396 1.00 39.49  ? 78  GLU B N     1 
ATOM   2210 C CA    . GLU B 1 78  ? 14.928 52.541 51.709 1.00 40.15  ? 78  GLU B CA    1 
ATOM   2211 C C     . GLU B 1 78  ? 14.999 53.331 50.408 1.00 38.86  ? 78  GLU B C     1 
ATOM   2212 O O     . GLU B 1 78  ? 15.954 54.073 50.169 1.00 39.11  ? 78  GLU B O     1 
ATOM   2213 C CB    . GLU B 1 78  ? 13.846 53.124 52.630 1.00 45.08  ? 78  GLU B CB    1 
ATOM   2214 C CG    . GLU B 1 78  ? 13.433 52.185 53.763 1.00 48.79  ? 78  GLU B CG    1 
ATOM   2215 C CD    . GLU B 1 78  ? 12.384 52.787 54.687 1.00 52.85  ? 78  GLU B CD    1 
ATOM   2216 O OE1   . GLU B 1 78  ? 11.289 53.151 54.203 1.00 54.27  ? 78  GLU B OE1   1 
ATOM   2217 O OE2   . GLU B 1 78  ? 12.656 52.894 55.904 1.00 53.97  ? 78  GLU B OE2   1 
ATOM   2218 N N     . GLY B 1 79  ? 13.993 53.139 49.560 1.00 37.51  ? 79  GLY B N     1 
ATOM   2219 C CA    . GLY B 1 79  ? 13.933 53.841 48.291 1.00 37.13  ? 79  GLY B CA    1 
ATOM   2220 C C     . GLY B 1 79  ? 14.761 53.246 47.167 1.00 35.70  ? 79  GLY B C     1 
ATOM   2221 O O     . GLY B 1 79  ? 14.919 53.863 46.114 1.00 37.12  ? 79  GLY B O     1 
ATOM   2222 N N     . GLN B 1 80  ? 15.289 52.046 47.370 1.00 32.30  ? 80  GLN B N     1 
ATOM   2223 C CA    . GLN B 1 80  ? 16.101 51.425 46.335 1.00 31.88  ? 80  GLN B CA    1 
ATOM   2224 C C     . GLN B 1 80  ? 15.320 50.557 45.366 1.00 28.27  ? 80  GLN B C     1 
ATOM   2225 O O     . GLN B 1 80  ? 14.202 50.149 45.654 1.00 27.75  ? 80  GLN B O     1 
ATOM   2226 C CB    . GLN B 1 80  ? 17.216 50.619 46.980 1.00 30.12  ? 80  GLN B CB    1 
ATOM   2227 C CG    . GLN B 1 80  ? 18.140 51.492 47.782 1.00 34.25  ? 80  GLN B CG    1 
ATOM   2228 C CD    . GLN B 1 80  ? 19.403 50.786 48.132 1.00 34.06  ? 80  GLN B CD    1 
ATOM   2229 O OE1   . GLN B 1 80  ? 19.493 50.118 49.165 1.00 38.22  ? 80  GLN B OE1   1 
ATOM   2230 N NE2   . GLN B 1 80  ? 20.398 50.905 47.262 1.00 32.51  ? 80  GLN B NE2   1 
ATOM   2231 N N     . GLU B 1 81  ? 15.928 50.291 44.212 1.00 26.88  ? 81  GLU B N     1 
ATOM   2232 C CA    . GLU B 1 81  ? 15.326 49.469 43.166 1.00 26.17  ? 81  GLU B CA    1 
ATOM   2233 C C     . GLU B 1 81  ? 16.100 48.165 42.989 1.00 24.39  ? 81  GLU B C     1 
ATOM   2234 O O     . GLU B 1 81  ? 17.294 48.097 43.305 1.00 23.43  ? 81  GLU B O     1 
ATOM   2235 C CB    . GLU B 1 81  ? 15.330 50.224 41.830 1.00 28.34  ? 81  GLU B CB    1 
ATOM   2236 C CG    . GLU B 1 81  ? 14.351 51.383 41.751 1.00 34.57  ? 81  GLU B CG    1 
ATOM   2237 C CD    . GLU B 1 81  ? 14.639 52.306 40.574 1.00 39.69  ? 81  GLU B CD    1 
ATOM   2238 O OE1   . GLU B 1 81  ? 14.926 51.804 39.466 1.00 42.01  ? 81  GLU B OE1   1 
ATOM   2239 O OE2   . GLU B 1 81  ? 14.573 53.539 40.758 1.00 44.39  ? 81  GLU B OE2   1 
ATOM   2240 N N     . ARG B 1 82  ? 15.413 47.143 42.479 1.00 23.24  ? 82  ARG B N     1 
ATOM   2241 C CA    . ARG B 1 82  ? 16.025 45.839 42.219 1.00 23.50  ? 82  ARG B CA    1 
ATOM   2242 C C     . ARG B 1 82  ? 17.156 46.020 41.213 1.00 23.51  ? 82  ARG B C     1 
ATOM   2243 O O     . ARG B 1 82  ? 16.973 46.625 40.151 1.00 25.54  ? 82  ARG B O     1 
ATOM   2244 C CB    . ARG B 1 82  ? 14.990 44.860 41.655 1.00 23.39  ? 82  ARG B CB    1 
ATOM   2245 C CG    . ARG B 1 82  ? 13.812 44.588 42.576 1.00 23.73  ? 82  ARG B CG    1 
ATOM   2246 C CD    . ARG B 1 82  ? 14.243 43.941 43.892 1.00 23.49  ? 82  ARG B CD    1 
ATOM   2247 N NE    . ARG B 1 82  ? 13.081 43.553 44.694 1.00 21.80  ? 82  ARG B NE    1 
ATOM   2248 C CZ    . ARG B 1 82  ? 13.145 43.038 45.920 1.00 23.04  ? 82  ARG B CZ    1 
ATOM   2249 N NH1   . ARG B 1 82  ? 14.318 42.840 46.504 1.00 18.11  ? 82  ARG B NH1   1 
ATOM   2250 N NH2   . ARG B 1 82  ? 12.026 42.719 46.565 1.00 24.94  ? 82  ARG B NH2   1 
ATOM   2251 N N     . SER B 1 83  ? 18.319 45.466 41.534 1.00 22.97  ? 83  SER B N     1 
ATOM   2252 C CA    . SER B 1 83  ? 19.498 45.617 40.686 1.00 21.00  ? 83  SER B CA    1 
ATOM   2253 C C     . SER B 1 83  ? 19.580 44.718 39.452 1.00 23.21  ? 83  SER B C     1 
ATOM   2254 O O     . SER B 1 83  ? 20.388 44.973 38.557 1.00 23.80  ? 83  SER B O     1 
ATOM   2255 C CB    . SER B 1 83  ? 20.755 45.418 41.537 1.00 19.97  ? 83  SER B CB    1 
ATOM   2256 O OG    . SER B 1 83  ? 20.822 44.085 42.007 1.00 20.65  ? 83  SER B OG    1 
ATOM   2257 N N     . ALA B 1 84  ? 18.746 43.686 39.394 1.00 21.38  ? 84  ALA B N     1 
ATOM   2258 C CA    . ALA B 1 84  ? 18.763 42.748 38.274 1.00 23.38  ? 84  ALA B CA    1 
ATOM   2259 C C     . ALA B 1 84  ? 17.483 41.926 38.253 1.00 23.76  ? 84  ALA B C     1 
ATOM   2260 O O     . ALA B 1 84  ? 16.681 41.997 39.181 1.00 23.49  ? 84  ALA B O     1 
ATOM   2261 C CB    . ALA B 1 84  ? 19.964 41.808 38.409 1.00 22.56  ? 84  ALA B CB    1 
ATOM   2262 N N     . TRP B 1 85  ? 17.293 41.161 37.180 1.00 24.42  ? 85  TRP B N     1 
ATOM   2263 C CA    . TRP B 1 85  ? 16.137 40.281 37.053 1.00 24.98  ? 85  TRP B CA    1 
ATOM   2264 C C     . TRP B 1 85  ? 16.547 38.958 37.683 1.00 24.13  ? 85  TRP B C     1 
ATOM   2265 O O     . TRP B 1 85  ? 17.730 38.612 37.697 1.00 25.50  ? 85  TRP B O     1 
ATOM   2266 C CB    . TRP B 1 85  ? 15.805 39.991 35.582 1.00 26.70  ? 85  TRP B CB    1 
ATOM   2267 C CG    . TRP B 1 85  ? 15.099 41.076 34.847 1.00 29.67  ? 85  TRP B CG    1 
ATOM   2268 C CD1   . TRP B 1 85  ? 13.747 41.270 34.763 1.00 29.29  ? 85  TRP B CD1   1 
ATOM   2269 C CD2   . TRP B 1 85  ? 15.703 42.112 34.076 1.00 30.76  ? 85  TRP B CD2   1 
ATOM   2270 N NE1   . TRP B 1 85  ? 13.475 42.366 33.981 1.00 31.72  ? 85  TRP B NE1   1 
ATOM   2271 C CE2   . TRP B 1 85  ? 14.659 42.903 33.547 1.00 31.60  ? 85  TRP B CE2   1 
ATOM   2272 C CE3   . TRP B 1 85  ? 17.030 42.453 33.779 1.00 30.18  ? 85  TRP B CE3   1 
ATOM   2273 C CZ2   . TRP B 1 85  ? 14.900 44.016 32.737 1.00 34.39  ? 85  TRP B CZ2   1 
ATOM   2274 C CZ3   . TRP B 1 85  ? 17.269 43.558 32.975 1.00 31.94  ? 85  TRP B CZ3   1 
ATOM   2275 C CH2   . TRP B 1 85  ? 16.208 44.327 32.463 1.00 33.26  ? 85  TRP B CH2   1 
ATOM   2276 N N     . VAL B 1 86  ? 15.575 38.233 38.219 1.00 24.57  ? 86  VAL B N     1 
ATOM   2277 C CA    . VAL B 1 86  ? 15.831 36.918 38.786 1.00 24.48  ? 86  VAL B CA    1 
ATOM   2278 C C     . VAL B 1 86  ? 14.764 36.036 38.158 1.00 25.67  ? 86  VAL B C     1 
ATOM   2279 O O     . VAL B 1 86  ? 13.565 36.249 38.360 1.00 24.96  ? 86  VAL B O     1 
ATOM   2280 C CB    . VAL B 1 86  ? 15.706 36.891 40.318 1.00 25.02  ? 86  VAL B CB    1 
ATOM   2281 C CG1   . VAL B 1 86  ? 15.936 35.461 40.828 1.00 22.68  ? 86  VAL B CG1   1 
ATOM   2282 C CG2   . VAL B 1 86  ? 16.736 37.838 40.934 1.00 26.65  ? 86  VAL B CG2   1 
ATOM   2283 N N     . ARG B 1 87  ? 15.221 35.062 37.382 1.00 26.72  ? 87  ARG B N     1 
ATOM   2284 C CA    . ARG B 1 87  ? 14.351 34.146 36.654 1.00 29.50  ? 87  ARG B CA    1 
ATOM   2285 C C     . ARG B 1 87  ? 14.581 32.705 37.094 1.00 28.96  ? 87  ARG B C     1 
ATOM   2286 O O     . ARG B 1 87  ? 15.721 32.274 37.253 1.00 28.25  ? 87  ARG B O     1 
ATOM   2287 C CB    . ARG B 1 87  ? 14.641 34.276 35.153 1.00 31.50  ? 87  ARG B CB    1 
ATOM   2288 C CG    . ARG B 1 87  ? 13.843 33.340 34.251 1.00 36.35  ? 87  ARG B CG    1 
ATOM   2289 C CD    . ARG B 1 87  ? 14.533 33.208 32.897 1.00 40.73  ? 87  ARG B CD    1 
ATOM   2290 N NE    . ARG B 1 87  ? 14.631 34.489 32.205 1.00 44.48  ? 87  ARG B NE    1 
ATOM   2291 C CZ    . ARG B 1 87  ? 15.491 34.752 31.224 1.00 45.69  ? 87  ARG B CZ    1 
ATOM   2292 N NH1   . ARG B 1 87  ? 16.345 33.824 30.812 1.00 48.00  ? 87  ARG B NH1   1 
ATOM   2293 N NH2   . ARG B 1 87  ? 15.491 35.946 30.647 1.00 46.56  ? 87  ARG B NH2   1 
ATOM   2294 N N     . ALA B 1 88  ? 13.496 31.961 37.278 1.00 27.37  ? 88  ALA B N     1 
ATOM   2295 C CA    . ALA B 1 88  ? 13.597 30.571 37.696 1.00 28.04  ? 88  ALA B CA    1 
ATOM   2296 C C     . ALA B 1 88  ? 14.254 29.739 36.598 1.00 28.65  ? 88  ALA B C     1 
ATOM   2297 O O     . ALA B 1 88  ? 13.870 29.827 35.431 1.00 27.79  ? 88  ALA B O     1 
ATOM   2298 C CB    . ALA B 1 88  ? 12.206 30.017 38.017 1.00 29.66  ? 88  ALA B CB    1 
ATOM   2299 N N     . LYS B 1 89  ? 15.251 28.943 36.981 1.00 29.91  ? 89  LYS B N     1 
ATOM   2300 C CA    . LYS B 1 89  ? 15.964 28.077 36.045 1.00 33.11  ? 89  LYS B CA    1 
ATOM   2301 C C     . LYS B 1 89  ? 15.231 26.738 36.017 1.00 34.50  ? 89  LYS B C     1 
ATOM   2302 O O     . LYS B 1 89  ? 15.053 26.137 34.960 1.00 36.25  ? 89  LYS B O     1 
ATOM   2303 C CB    . LYS B 1 89  ? 17.408 27.870 36.505 1.00 35.49  ? 89  LYS B CB    1 
ATOM   2304 C CG    . LYS B 1 89  ? 18.463 28.139 35.443 1.00 41.09  ? 89  LYS B CG    1 
ATOM   2305 C CD    . LYS B 1 89  ? 18.233 27.322 34.180 1.00 42.57  ? 89  LYS B CD    1 
ATOM   2306 C CE    . LYS B 1 89  ? 19.370 27.535 33.192 1.00 46.18  ? 89  LYS B CE    1 
ATOM   2307 N NZ    . LYS B 1 89  ? 19.153 26.864 31.879 1.00 46.65  ? 89  LYS B NZ    1 
ATOM   2308 N N     . THR B 1 90  ? 14.825 26.278 37.197 1.00 34.53  ? 90  THR B N     1 
ATOM   2309 C CA    . THR B 1 90  ? 14.063 25.041 37.347 1.00 36.26  ? 90  THR B CA    1 
ATOM   2310 C C     . THR B 1 90  ? 12.833 25.428 38.156 1.00 37.77  ? 90  THR B C     1 
ATOM   2311 O O     . THR B 1 90  ? 12.674 26.598 38.514 1.00 37.11  ? 90  THR B O     1 
ATOM   2312 C CB    . THR B 1 90  ? 14.828 23.975 38.153 1.00 37.06  ? 90  THR B CB    1 
ATOM   2313 O OG1   . THR B 1 90  ? 15.026 24.439 39.496 1.00 38.30  ? 90  THR B OG1   1 
ATOM   2314 C CG2   . THR B 1 90  ? 16.174 23.676 37.511 1.00 37.22  ? 90  THR B CG2   1 
ATOM   2315 N N     . ALA B 1 91  ? 11.963 24.461 38.437 1.00 35.90  ? 91  ALA B N     1 
ATOM   2316 C CA    . ALA B 1 91  ? 10.781 24.730 39.250 1.00 36.01  ? 91  ALA B CA    1 
ATOM   2317 C C     . ALA B 1 91  ? 11.334 25.163 40.603 1.00 34.96  ? 91  ALA B C     1 
ATOM   2318 O O     . ALA B 1 91  ? 12.289 24.564 41.106 1.00 35.92  ? 91  ALA B O     1 
ATOM   2319 C CB    . ALA B 1 91  ? 9.933  23.462 39.402 1.00 35.25  ? 91  ALA B CB    1 
ATOM   2320 N N     . CYS B 1 92  ? 10.739 26.190 41.199 1.00 33.26  ? 92  CYS B N     1 
ATOM   2321 C CA    . CYS B 1 92  ? 11.230 26.695 42.478 1.00 33.61  ? 92  CYS B CA    1 
ATOM   2322 C C     . CYS B 1 92  ? 10.193 26.858 43.576 1.00 32.34  ? 92  CYS B C     1 
ATOM   2323 O O     . CYS B 1 92  ? 9.004  27.021 43.312 1.00 32.59  ? 92  CYS B O     1 
ATOM   2324 C CB    . CYS B 1 92  ? 11.901 28.061 42.280 1.00 35.18  ? 92  CYS B CB    1 
ATOM   2325 S SG    . CYS B 1 92  ? 13.462 28.044 41.397 1.00 39.01  ? 92  CYS B SG    1 
ATOM   2326 N N     . GLU B 1 93  ? 10.679 26.820 44.812 1.00 30.99  ? 93  GLU B N     1 
ATOM   2327 C CA    . GLU B 1 93  ? 9.861  27.039 45.995 1.00 31.49  ? 93  GLU B CA    1 
ATOM   2328 C C     . GLU B 1 93  ? 10.612 28.172 46.696 1.00 29.88  ? 93  GLU B C     1 
ATOM   2329 O O     . GLU B 1 93  ? 11.746 27.992 47.143 1.00 27.50  ? 93  GLU B O     1 
ATOM   2330 C CB    . GLU B 1 93  ? 9.816  25.793 46.875 1.00 35.59  ? 93  GLU B CB    1 
ATOM   2331 C CG    . GLU B 1 93  ? 9.052  26.000 48.167 1.00 40.39  ? 93  GLU B CG    1 
ATOM   2332 C CD    . GLU B 1 93  ? 8.801  24.707 48.916 1.00 44.50  ? 93  GLU B CD    1 
ATOM   2333 O OE1   . GLU B 1 93  ? 8.265  24.772 50.046 1.00 45.62  ? 93  GLU B OE1   1 
ATOM   2334 O OE2   . GLU B 1 93  ? 9.134  23.630 48.373 1.00 45.03  ? 93  GLU B OE2   1 
ATOM   2335 N N     . VAL B 1 94  ? 9.987  29.340 46.784 1.00 28.16  ? 94  VAL B N     1 
ATOM   2336 C CA    . VAL B 1 94  ? 10.653 30.500 47.371 1.00 26.48  ? 94  VAL B CA    1 
ATOM   2337 C C     . VAL B 1 94  ? 9.879  31.213 48.469 1.00 25.87  ? 94  VAL B C     1 
ATOM   2338 O O     . VAL B 1 94  ? 8.693  31.489 48.328 1.00 26.55  ? 94  VAL B O     1 
ATOM   2339 C CB    . VAL B 1 94  ? 10.990 31.525 46.261 1.00 26.72  ? 94  VAL B CB    1 
ATOM   2340 C CG1   . VAL B 1 94  ? 11.860 32.643 46.812 1.00 25.90  ? 94  VAL B CG1   1 
ATOM   2341 C CG2   . VAL B 1 94  ? 11.688 30.822 45.099 1.00 28.19  ? 94  VAL B CG2   1 
ATOM   2342 N N     . ALA B 1 95  ? 10.568 31.504 49.568 1.00 25.42  ? 95  ALA B N     1 
ATOM   2343 C CA    . ALA B 1 95  ? 9.966  32.211 50.692 1.00 26.28  ? 95  ALA B CA    1 
ATOM   2344 C C     . ALA B 1 95  ? 10.182 33.707 50.490 1.00 24.71  ? 95  ALA B C     1 
ATOM   2345 O O     . ALA B 1 95  ? 11.172 34.111 49.878 1.00 23.85  ? 95  ALA B O     1 
ATOM   2346 C CB    . ALA B 1 95  ? 10.618 31.764 51.999 1.00 27.27  ? 95  ALA B CB    1 
ATOM   2347 N N     . GLU B 1 96  ? 9.253  34.521 50.986 1.00 23.69  ? 96  GLU B N     1 
ATOM   2348 C CA    . GLU B 1 96  ? 9.364  35.976 50.889 1.00 24.14  ? 96  GLU B CA    1 
ATOM   2349 C C     . GLU B 1 96  ? 8.956  36.594 52.229 1.00 24.41  ? 96  GLU B C     1 
ATOM   2350 O O     . GLU B 1 96  ? 8.121  36.039 52.946 1.00 24.14  ? 96  GLU B O     1 
ATOM   2351 C CB    . GLU B 1 96  ? 8.472  36.533 49.757 1.00 27.11  ? 96  GLU B CB    1 
ATOM   2352 C CG    . GLU B 1 96  ? 8.551  38.076 49.622 1.00 29.48  ? 96  GLU B CG    1 
ATOM   2353 C CD    . GLU B 1 96  ? 7.712  38.647 48.473 1.00 36.44  ? 96  GLU B CD    1 
ATOM   2354 O OE1   . GLU B 1 96  ? 6.647  38.073 48.156 1.00 38.17  ? 96  GLU B OE1   1 
ATOM   2355 O OE2   . GLU B 1 96  ? 8.107  39.690 47.899 1.00 34.86  ? 96  GLU B OE2   1 
ATOM   2356 N N     . ILE B 1 97  ? 9.564  37.725 52.573 1.00 23.86  ? 97  ILE B N     1 
ATOM   2357 C CA    . ILE B 1 97  ? 9.260  38.425 53.824 1.00 23.56  ? 97  ILE B CA    1 
ATOM   2358 C C     . ILE B 1 97  ? 9.570  39.915 53.631 1.00 24.80  ? 97  ILE B C     1 
ATOM   2359 O O     . ILE B 1 97  ? 10.488 40.275 52.891 1.00 23.84  ? 97  ILE B O     1 
ATOM   2360 C CB    . ILE B 1 97  ? 10.100 37.837 55.007 1.00 24.21  ? 97  ILE B CB    1 
ATOM   2361 C CG1   . ILE B 1 97  ? 9.688  38.495 56.327 1.00 24.08  ? 97  ILE B CG1   1 
ATOM   2362 C CG2   . ILE B 1 97  ? 11.600 38.042 54.749 1.00 22.02  ? 97  ILE B CG2   1 
ATOM   2363 C CD1   . ILE B 1 97  ? 10.308 37.852 57.564 1.00 23.48  ? 97  ILE B CD1   1 
ATOM   2364 N N     . SER B 1 98  ? 8.797  40.790 54.267 1.00 24.66  ? 98  SER B N     1 
ATOM   2365 C CA    . SER B 1 98  ? 9.057  42.219 54.112 1.00 24.77  ? 98  SER B CA    1 
ATOM   2366 C C     . SER B 1 98  ? 10.334 42.603 54.856 1.00 24.61  ? 98  SER B C     1 
ATOM   2367 O O     . SER B 1 98  ? 10.709 41.962 55.842 1.00 24.75  ? 98  SER B O     1 
ATOM   2368 C CB    . SER B 1 98  ? 7.888  43.049 54.657 1.00 24.38  ? 98  SER B CB    1 
ATOM   2369 O OG    . SER B 1 98  ? 7.796  42.927 56.068 1.00 25.25  ? 98  SER B OG    1 
ATOM   2370 N N     . TYR B 1 99  ? 11.014 43.641 54.376 1.00 24.46  ? 99  TYR B N     1 
ATOM   2371 C CA    . TYR B 1 99  ? 12.225 44.108 55.040 1.00 24.56  ? 99  TYR B CA    1 
ATOM   2372 C C     . TYR B 1 99  ? 11.865 44.548 56.466 1.00 26.15  ? 99  TYR B C     1 
ATOM   2373 O O     . TYR B 1 99  ? 12.651 44.382 57.402 1.00 27.81  ? 99  TYR B O     1 
ATOM   2374 C CB    . TYR B 1 99  ? 12.823 45.298 54.287 1.00 24.24  ? 99  TYR B CB    1 
ATOM   2375 C CG    . TYR B 1 99  ? 13.469 44.995 52.942 1.00 23.60  ? 99  TYR B CG    1 
ATOM   2376 C CD1   . TYR B 1 99  ? 13.667 46.021 52.018 1.00 21.92  ? 99  TYR B CD1   1 
ATOM   2377 C CD2   . TYR B 1 99  ? 13.952 43.720 52.624 1.00 22.11  ? 99  TYR B CD2   1 
ATOM   2378 C CE1   . TYR B 1 99  ? 14.334 45.805 50.813 1.00 21.36  ? 99  TYR B CE1   1 
ATOM   2379 C CE2   . TYR B 1 99  ? 14.633 43.489 51.405 1.00 24.09  ? 99  TYR B CE2   1 
ATOM   2380 C CZ    . TYR B 1 99  ? 14.821 44.547 50.510 1.00 23.93  ? 99  TYR B CZ    1 
ATOM   2381 O OH    . TYR B 1 99  ? 15.530 44.381 49.338 1.00 21.90  ? 99  TYR B OH    1 
ATOM   2382 N N     . LYS B 1 100 ? 10.674 45.117 56.626 1.00 27.76  ? 100 LYS B N     1 
ATOM   2383 C CA    . LYS B 1 100 ? 10.220 45.574 57.938 1.00 29.13  ? 100 LYS B CA    1 
ATOM   2384 C C     . LYS B 1 100 ? 10.204 44.409 58.926 1.00 28.55  ? 100 LYS B C     1 
ATOM   2385 O O     . LYS B 1 100 ? 10.747 44.509 60.029 1.00 25.74  ? 100 LYS B O     1 
ATOM   2386 C CB    . LYS B 1 100 ? 8.816  46.192 57.832 1.00 32.00  ? 100 LYS B CB    1 
ATOM   2387 C CG    . LYS B 1 100 ? 8.246  46.714 59.155 1.00 38.13  ? 100 LYS B CG    1 
ATOM   2388 C CD    . LYS B 1 100 ? 6.882  47.379 58.949 1.00 41.46  ? 100 LYS B CD    1 
ATOM   2389 C CE    . LYS B 1 100 ? 6.286  47.884 60.264 1.00 44.12  ? 100 LYS B CE    1 
ATOM   2390 N NZ    . LYS B 1 100 ? 4.928  48.496 60.084 1.00 43.12  ? 100 LYS B NZ    1 
ATOM   2391 N N     . LYS B 1 101 ? 9.598  43.296 58.520 1.00 28.46  ? 101 LYS B N     1 
ATOM   2392 C CA    . LYS B 1 101 ? 9.523  42.125 59.390 1.00 29.95  ? 101 LYS B CA    1 
ATOM   2393 C C     . LYS B 1 101 ? 10.903 41.508 59.610 1.00 28.28  ? 101 LYS B C     1 
ATOM   2394 O O     . LYS B 1 101 ? 11.236 41.100 60.724 1.00 27.47  ? 101 LYS B O     1 
ATOM   2395 C CB    . LYS B 1 101 ? 8.578  41.080 58.789 1.00 31.56  ? 101 LYS B CB    1 
ATOM   2396 C CG    . LYS B 1 101 ? 8.182  39.955 59.742 1.00 37.06  ? 101 LYS B CG    1 
ATOM   2397 C CD    . LYS B 1 101 ? 7.106  39.071 59.108 1.00 40.91  ? 101 LYS B CD    1 
ATOM   2398 C CE    . LYS B 1 101 ? 6.479  38.108 60.110 1.00 43.45  ? 101 LYS B CE    1 
ATOM   2399 N NZ    . LYS B 1 101 ? 5.383  37.308 59.479 1.00 41.90  ? 101 LYS B NZ    1 
ATOM   2400 N N     . PHE B 1 102 ? 11.705 41.430 58.551 1.00 26.93  ? 102 PHE B N     1 
ATOM   2401 C CA    . PHE B 1 102 ? 13.039 40.854 58.682 1.00 27.42  ? 102 PHE B CA    1 
ATOM   2402 C C     . PHE B 1 102 ? 13.874 41.621 59.711 1.00 27.67  ? 102 PHE B C     1 
ATOM   2403 O O     . PHE B 1 102 ? 14.594 41.016 60.514 1.00 27.66  ? 102 PHE B O     1 
ATOM   2404 C CB    . PHE B 1 102 ? 13.766 40.843 57.330 1.00 24.81  ? 102 PHE B CB    1 
ATOM   2405 C CG    . PHE B 1 102 ? 15.034 40.030 57.335 1.00 24.93  ? 102 PHE B CG    1 
ATOM   2406 C CD1   . PHE B 1 102 ? 16.272 40.638 57.146 1.00 25.50  ? 102 PHE B CD1   1 
ATOM   2407 C CD2   . PHE B 1 102 ? 14.987 38.656 57.527 1.00 23.60  ? 102 PHE B CD2   1 
ATOM   2408 C CE1   . PHE B 1 102 ? 17.449 39.886 57.148 1.00 25.63  ? 102 PHE B CE1   1 
ATOM   2409 C CE2   . PHE B 1 102 ? 16.156 37.892 57.533 1.00 25.48  ? 102 PHE B CE2   1 
ATOM   2410 C CZ    . PHE B 1 102 ? 17.391 38.509 57.342 1.00 25.45  ? 102 PHE B CZ    1 
ATOM   2411 N N     . ARG B 1 103 ? 13.780 42.948 59.693 1.00 28.96  ? 103 ARG B N     1 
ATOM   2412 C CA    . ARG B 1 103 ? 14.533 43.762 60.649 1.00 30.72  ? 103 ARG B CA    1 
ATOM   2413 C C     . ARG B 1 103 ? 14.129 43.423 62.082 1.00 31.20  ? 103 ARG B C     1 
ATOM   2414 O O     . ARG B 1 103 ? 14.961 43.427 62.990 1.00 31.91  ? 103 ARG B O     1 
ATOM   2415 C CB    . ARG B 1 103 ? 14.311 45.253 60.379 1.00 33.28  ? 103 ARG B CB    1 
ATOM   2416 C CG    . ARG B 1 103 ? 15.195 45.820 59.274 1.00 33.80  ? 103 ARG B CG    1 
ATOM   2417 C CD    . ARG B 1 103 ? 14.767 47.229 58.916 1.00 35.57  ? 103 ARG B CD    1 
ATOM   2418 N NE    . ARG B 1 103 ? 15.645 47.854 57.930 1.00 37.22  ? 103 ARG B NE    1 
ATOM   2419 C CZ    . ARG B 1 103 ? 16.807 48.436 58.214 1.00 38.58  ? 103 ARG B CZ    1 
ATOM   2420 N NH1   . ARG B 1 103 ? 17.246 48.481 59.465 1.00 38.20  ? 103 ARG B NH1   1 
ATOM   2421 N NH2   . ARG B 1 103 ? 17.531 48.983 57.242 1.00 38.07  ? 103 ARG B NH2   1 
ATOM   2422 N N     . GLN B 1 104 ? 12.851 43.127 62.287 1.00 31.48  ? 104 GLN B N     1 
ATOM   2423 C CA    . GLN B 1 104 ? 12.384 42.763 63.619 1.00 33.29  ? 104 GLN B CA    1 
ATOM   2424 C C     . GLN B 1 104 ? 13.023 41.437 64.027 1.00 31.75  ? 104 GLN B C     1 
ATOM   2425 O O     . GLN B 1 104 ? 13.427 41.267 65.180 1.00 32.22  ? 104 GLN B O     1 
ATOM   2426 C CB    . GLN B 1 104 ? 10.856 42.657 63.636 1.00 36.50  ? 104 GLN B CB    1 
ATOM   2427 C CG    . GLN B 1 104 ? 10.170 43.999 63.443 1.00 40.46  ? 104 GLN B CG    1 
ATOM   2428 C CD    . GLN B 1 104 ? 8.673  43.888 63.227 1.00 43.73  ? 104 GLN B CD    1 
ATOM   2429 O OE1   . GLN B 1 104 ? 7.994  44.893 63.011 1.00 48.95  ? 104 GLN B OE1   1 
ATOM   2430 N NE2   . GLN B 1 104 ? 8.149  42.668 63.280 1.00 43.85  ? 104 GLN B NE2   1 
ATOM   2431 N N     . LEU B 1 105 ? 13.127 40.503 63.081 1.00 29.74  ? 105 LEU B N     1 
ATOM   2432 C CA    . LEU B 1 105 ? 13.745 39.208 63.362 1.00 29.53  ? 105 LEU B CA    1 
ATOM   2433 C C     . LEU B 1 105 ? 15.219 39.394 63.713 1.00 29.64  ? 105 LEU B C     1 
ATOM   2434 O O     . LEU B 1 105 ? 15.757 38.699 64.574 1.00 32.25  ? 105 LEU B O     1 
ATOM   2435 C CB    . LEU B 1 105 ? 13.633 38.266 62.154 1.00 26.92  ? 105 LEU B CB    1 
ATOM   2436 C CG    . LEU B 1 105 ? 12.244 37.880 61.635 1.00 28.96  ? 105 LEU B CG    1 
ATOM   2437 C CD1   . LEU B 1 105 ? 12.407 36.844 60.532 1.00 28.56  ? 105 LEU B CD1   1 
ATOM   2438 C CD2   . LEU B 1 105 ? 11.385 37.318 62.765 1.00 29.95  ? 105 LEU B CD2   1 
ATOM   2439 N N     . ILE B 1 106 ? 15.879 40.328 63.038 1.00 29.55  ? 106 ILE B N     1 
ATOM   2440 C CA    . ILE B 1 106 ? 17.289 40.586 63.307 1.00 29.54  ? 106 ILE B CA    1 
ATOM   2441 C C     . ILE B 1 106 ? 17.489 41.045 64.751 1.00 32.19  ? 106 ILE B C     1 
ATOM   2442 O O     . ILE B 1 106 ? 18.464 40.672 65.401 1.00 30.77  ? 106 ILE B O     1 
ATOM   2443 C CB    . ILE B 1 106 ? 17.845 41.659 62.346 1.00 28.30  ? 106 ILE B CB    1 
ATOM   2444 C CG1   . ILE B 1 106 ? 17.896 41.093 60.924 1.00 25.34  ? 106 ILE B CG1   1 
ATOM   2445 C CG2   . ILE B 1 106 ? 19.227 42.120 62.805 1.00 28.20  ? 106 ILE B CG2   1 
ATOM   2446 C CD1   . ILE B 1 106 ? 18.354 42.097 59.873 1.00 25.73  ? 106 ILE B CD1   1 
ATOM   2447 N N     . GLN B 1 107 ? 16.556 41.851 65.247 1.00 34.33  ? 107 GLN B N     1 
ATOM   2448 C CA    . GLN B 1 107 ? 16.631 42.351 66.616 1.00 37.75  ? 107 GLN B CA    1 
ATOM   2449 C C     . GLN B 1 107 ? 16.511 41.208 67.623 1.00 37.42  ? 107 GLN B C     1 
ATOM   2450 O O     . GLN B 1 107 ? 17.108 41.254 68.698 1.00 37.86  ? 107 GLN B O     1 
ATOM   2451 C CB    . GLN B 1 107 ? 15.519 43.377 66.860 1.00 40.84  ? 107 GLN B CB    1 
ATOM   2452 C CG    . GLN B 1 107 ? 15.643 44.637 66.011 1.00 45.96  ? 107 GLN B CG    1 
ATOM   2453 C CD    . GLN B 1 107 ? 16.872 45.466 66.359 1.00 49.95  ? 107 GLN B CD    1 
ATOM   2454 O OE1   . GLN B 1 107 ? 17.251 46.375 65.616 1.00 52.45  ? 107 GLN B OE1   1 
ATOM   2455 N NE2   . GLN B 1 107 ? 17.496 45.161 67.495 1.00 49.42  ? 107 GLN B NE2   1 
ATOM   2456 N N     . VAL B 1 108 ? 15.742 40.182 67.264 1.00 37.08  ? 108 VAL B N     1 
ATOM   2457 C CA    . VAL B 1 108 ? 15.535 39.023 68.127 1.00 36.77  ? 108 VAL B CA    1 
ATOM   2458 C C     . VAL B 1 108 ? 16.752 38.096 68.132 1.00 38.20  ? 108 VAL B C     1 
ATOM   2459 O O     . VAL B 1 108 ? 17.206 37.661 69.193 1.00 37.23  ? 108 VAL B O     1 
ATOM   2460 C CB    . VAL B 1 108 ? 14.280 38.225 67.688 1.00 37.08  ? 108 VAL B CB    1 
ATOM   2461 C CG1   . VAL B 1 108 ? 14.118 36.974 68.543 1.00 36.80  ? 108 VAL B CG1   1 
ATOM   2462 C CG2   . VAL B 1 108 ? 13.042 39.103 67.806 1.00 35.31  ? 108 VAL B CG2   1 
ATOM   2463 N N     . ASN B 1 109 ? 17.279 37.799 66.944 1.00 37.87  ? 109 ASN B N     1 
ATOM   2464 C CA    . ASN B 1 109 ? 18.451 36.934 66.808 1.00 37.19  ? 109 ASN B CA    1 
ATOM   2465 C C     . ASN B 1 109 ? 19.318 37.407 65.638 1.00 37.21  ? 109 ASN B C     1 
ATOM   2466 O O     . ASN B 1 109 ? 18.989 37.168 64.479 1.00 35.67  ? 109 ASN B O     1 
ATOM   2467 C CB    . ASN B 1 109 ? 18.017 35.481 66.576 1.00 37.84  ? 109 ASN B CB    1 
ATOM   2468 C CG    . ASN B 1 109 ? 19.197 34.515 66.507 1.00 40.00  ? 109 ASN B CG    1 
ATOM   2469 O OD1   . ASN B 1 109 ? 19.010 33.300 66.397 1.00 41.73  ? 109 ASN B OD1   1 
ATOM   2470 N ND2   . ASN B 1 109 ? 20.414 35.050 66.567 1.00 36.01  ? 109 ASN B ND2   1 
ATOM   2471 N N     . PRO B 1 110 ? 20.441 38.086 65.940 1.00 36.61  ? 110 PRO B N     1 
ATOM   2472 C CA    . PRO B 1 110 ? 21.398 38.621 64.961 1.00 36.99  ? 110 PRO B CA    1 
ATOM   2473 C C     . PRO B 1 110 ? 22.003 37.564 64.038 1.00 35.38  ? 110 PRO B C     1 
ATOM   2474 O O     . PRO B 1 110 ? 22.530 37.889 62.975 1.00 34.58  ? 110 PRO B O     1 
ATOM   2475 C CB    . PRO B 1 110 ? 22.467 39.274 65.838 1.00 37.68  ? 110 PRO B CB    1 
ATOM   2476 C CG    . PRO B 1 110 ? 21.712 39.659 67.075 1.00 38.97  ? 110 PRO B CG    1 
ATOM   2477 C CD    . PRO B 1 110 ? 20.838 38.455 67.310 1.00 38.03  ? 110 PRO B CD    1 
ATOM   2478 N N     . ASP B 1 111 ? 21.934 36.302 64.449 1.00 34.68  ? 111 ASP B N     1 
ATOM   2479 C CA    . ASP B 1 111 ? 22.497 35.218 63.650 1.00 34.12  ? 111 ASP B CA    1 
ATOM   2480 C C     . ASP B 1 111 ? 21.927 35.168 62.234 1.00 30.10  ? 111 ASP B C     1 
ATOM   2481 O O     . ASP B 1 111 ? 22.635 34.800 61.293 1.00 28.08  ? 111 ASP B O     1 
ATOM   2482 C CB    . ASP B 1 111 ? 22.277 33.864 64.336 1.00 37.29  ? 111 ASP B CB    1 
ATOM   2483 C CG    . ASP B 1 111 ? 22.933 33.786 65.708 1.00 43.77  ? 111 ASP B CG    1 
ATOM   2484 O OD1   . ASP B 1 111 ? 24.103 34.209 65.842 1.00 46.06  ? 111 ASP B OD1   1 
ATOM   2485 O OD2   . ASP B 1 111 ? 22.280 33.291 66.654 1.00 48.29  ? 111 ASP B OD2   1 
ATOM   2486 N N     . ILE B 1 112 ? 20.659 35.543 62.073 1.00 28.61  ? 112 ILE B N     1 
ATOM   2487 C CA    . ILE B 1 112 ? 20.046 35.511 60.750 1.00 27.96  ? 112 ILE B CA    1 
ATOM   2488 C C     . ILE B 1 112 ? 20.679 36.581 59.848 1.00 26.96  ? 112 ILE B C     1 
ATOM   2489 O O     . ILE B 1 112 ? 20.698 36.440 58.622 1.00 26.80  ? 112 ILE B O     1 
ATOM   2490 C CB    . ILE B 1 112 ? 18.499 35.693 60.830 1.00 28.35  ? 112 ILE B CB    1 
ATOM   2491 C CG1   . ILE B 1 112 ? 17.864 35.318 59.491 1.00 28.40  ? 112 ILE B CG1   1 
ATOM   2492 C CG2   . ILE B 1 112 ? 18.141 37.122 61.212 1.00 27.51  ? 112 ILE B CG2   1 
ATOM   2493 C CD1   . ILE B 1 112 ? 18.029 33.848 59.127 1.00 29.81  ? 112 ILE B CD1   1 
ATOM   2494 N N     . LEU B 1 113 ? 21.207 37.643 60.452 1.00 26.65  ? 113 LEU B N     1 
ATOM   2495 C CA    . LEU B 1 113 ? 21.873 38.688 59.672 1.00 26.53  ? 113 LEU B CA    1 
ATOM   2496 C C     . LEU B 1 113 ? 23.273 38.193 59.329 1.00 25.38  ? 113 LEU B C     1 
ATOM   2497 O O     . LEU B 1 113 ? 23.789 38.460 58.246 1.00 25.08  ? 113 LEU B O     1 
ATOM   2498 C CB    . LEU B 1 113 ? 21.977 40.003 60.459 1.00 26.11  ? 113 LEU B CB    1 
ATOM   2499 C CG    . LEU B 1 113 ? 22.776 41.110 59.750 1.00 27.29  ? 113 LEU B CG    1 
ATOM   2500 C CD1   . LEU B 1 113 ? 22.190 41.376 58.360 1.00 28.21  ? 113 LEU B CD1   1 
ATOM   2501 C CD2   . LEU B 1 113 ? 22.755 42.385 60.592 1.00 27.25  ? 113 LEU B CD2   1 
ATOM   2502 N N     . MET B 1 114 ? 23.889 37.467 60.257 1.00 26.16  ? 114 MET B N     1 
ATOM   2503 C CA    . MET B 1 114 ? 25.229 36.938 60.020 1.00 28.49  ? 114 MET B CA    1 
ATOM   2504 C C     . MET B 1 114 ? 25.195 36.005 58.808 1.00 27.16  ? 114 MET B C     1 
ATOM   2505 O O     . MET B 1 114 ? 26.083 36.042 57.954 1.00 28.46  ? 114 MET B O     1 
ATOM   2506 C CB    . MET B 1 114 ? 25.726 36.168 61.248 1.00 31.66  ? 114 MET B CB    1 
ATOM   2507 C CG    . MET B 1 114 ? 27.239 36.124 61.378 1.00 36.74  ? 114 MET B CG    1 
ATOM   2508 S SD    . MET B 1 114 ? 27.947 37.738 61.816 1.00 37.76  ? 114 MET B SD    1 
ATOM   2509 C CE    . MET B 1 114 ? 29.552 37.227 62.451 1.00 41.65  ? 114 MET B CE    1 
ATOM   2510 N N     . ARG B 1 115 ? 24.161 35.173 58.740 1.00 26.13  ? 115 ARG B N     1 
ATOM   2511 C CA    . ARG B 1 115 ? 23.996 34.224 57.639 1.00 26.64  ? 115 ARG B CA    1 
ATOM   2512 C C     . ARG B 1 115 ? 23.842 34.920 56.286 1.00 24.65  ? 115 ARG B C     1 
ATOM   2513 O O     . ARG B 1 115 ? 24.421 34.486 55.284 1.00 22.72  ? 115 ARG B O     1 
ATOM   2514 C CB    . ARG B 1 115 ? 22.778 33.332 57.898 1.00 30.04  ? 115 ARG B CB    1 
ATOM   2515 C CG    . ARG B 1 115 ? 22.997 32.273 58.967 1.00 35.24  ? 115 ARG B CG    1 
ATOM   2516 C CD    . ARG B 1 115 ? 21.675 31.636 59.380 1.00 38.70  ? 115 ARG B CD    1 
ATOM   2517 N NE    . ARG B 1 115 ? 21.868 30.498 60.276 1.00 43.94  ? 115 ARG B NE    1 
ATOM   2518 C CZ    . ARG B 1 115 ? 22.151 29.264 59.869 1.00 45.35  ? 115 ARG B CZ    1 
ATOM   2519 N NH1   . ARG B 1 115 ? 22.273 28.997 58.576 1.00 46.93  ? 115 ARG B NH1   1 
ATOM   2520 N NH2   . ARG B 1 115 ? 22.323 28.296 60.759 1.00 48.68  ? 115 ARG B NH2   1 
ATOM   2521 N N     . LEU B 1 116 ? 23.052 35.992 56.257 1.00 22.28  ? 116 LEU B N     1 
ATOM   2522 C CA    . LEU B 1 116 ? 22.837 36.751 55.025 1.00 22.89  ? 116 LEU B CA    1 
ATOM   2523 C C     . LEU B 1 116 ? 24.112 37.471 54.604 1.00 23.97  ? 116 LEU B C     1 
ATOM   2524 O O     . LEU B 1 116 ? 24.484 37.470 53.424 1.00 23.39  ? 116 LEU B O     1 
ATOM   2525 C CB    . LEU B 1 116 ? 21.717 37.778 55.221 1.00 23.77  ? 116 LEU B CB    1 
ATOM   2526 C CG    . LEU B 1 116 ? 21.446 38.767 54.079 1.00 24.88  ? 116 LEU B CG    1 
ATOM   2527 C CD1   . LEU B 1 116 ? 21.137 38.009 52.796 1.00 27.12  ? 116 LEU B CD1   1 
ATOM   2528 C CD2   . LEU B 1 116 ? 20.263 39.673 54.460 1.00 27.75  ? 116 LEU B CD2   1 
ATOM   2529 N N     . SER B 1 117 ? 24.781 38.088 55.572 1.00 24.08  ? 117 SER B N     1 
ATOM   2530 C CA    . SER B 1 117 ? 26.011 38.820 55.298 1.00 26.30  ? 117 SER B CA    1 
ATOM   2531 C C     . SER B 1 117 ? 27.089 37.893 54.732 1.00 25.73  ? 117 SER B C     1 
ATOM   2532 O O     . SER B 1 117 ? 27.846 38.273 53.827 1.00 22.26  ? 117 SER B O     1 
ATOM   2533 C CB    . SER B 1 117 ? 26.507 39.497 56.581 1.00 27.97  ? 117 SER B CB    1 
ATOM   2534 O OG    . SER B 1 117 ? 25.522 40.385 57.093 1.00 31.99  ? 117 SER B OG    1 
ATOM   2535 N N     . ALA B 1 118 ? 27.154 36.676 55.262 1.00 24.87  ? 118 ALA B N     1 
ATOM   2536 C CA    . ALA B 1 118 ? 28.133 35.709 54.787 1.00 23.91  ? 118 ALA B CA    1 
ATOM   2537 C C     . ALA B 1 118 ? 27.945 35.487 53.289 1.00 24.21  ? 118 ALA B C     1 
ATOM   2538 O O     . ALA B 1 118 ? 28.917 35.363 52.550 1.00 22.81  ? 118 ALA B O     1 
ATOM   2539 C CB    . ALA B 1 118 ? 27.983 34.390 55.539 1.00 24.52  ? 118 ALA B CB    1 
ATOM   2540 N N     . GLN B 1 119 ? 26.693 35.433 52.841 1.00 22.47  ? 119 GLN B N     1 
ATOM   2541 C CA    . GLN B 1 119 ? 26.417 35.224 51.423 1.00 22.29  ? 119 GLN B CA    1 
ATOM   2542 C C     . GLN B 1 119 ? 26.776 36.448 50.592 1.00 22.59  ? 119 GLN B C     1 
ATOM   2543 O O     . GLN B 1 119 ? 27.311 36.321 49.494 1.00 20.16  ? 119 GLN B O     1 
ATOM   2544 C CB    . GLN B 1 119 ? 24.951 34.824 51.211 1.00 22.34  ? 119 GLN B CB    1 
ATOM   2545 C CG    . GLN B 1 119 ? 24.704 33.343 51.536 1.00 22.11  ? 119 GLN B CG    1 
ATOM   2546 C CD    . GLN B 1 119 ? 23.249 32.923 51.421 1.00 23.91  ? 119 GLN B CD    1 
ATOM   2547 O OE1   . GLN B 1 119 ? 22.474 33.511 50.665 1.00 20.76  ? 119 GLN B OE1   1 
ATOM   2548 N NE2   . GLN B 1 119 ? 22.877 31.880 52.160 1.00 26.48  ? 119 GLN B NE2   1 
ATOM   2549 N N     . MET B 1 120 ? 26.495 37.637 51.108 1.00 21.09  ? 120 MET B N     1 
ATOM   2550 C CA    . MET B 1 120 ? 26.856 38.834 50.359 1.00 23.44  ? 120 MET B CA    1 
ATOM   2551 C C     . MET B 1 120 ? 28.374 38.886 50.174 1.00 21.21  ? 120 MET B C     1 
ATOM   2552 O O     . MET B 1 120 ? 28.863 39.265 49.109 1.00 20.71  ? 120 MET B O     1 
ATOM   2553 C CB    . MET B 1 120 ? 26.358 40.096 51.072 1.00 24.65  ? 120 MET B CB    1 
ATOM   2554 C CG    . MET B 1 120 ? 24.890 40.421 50.780 1.00 27.05  ? 120 MET B CG    1 
ATOM   2555 S SD    . MET B 1 120 ? 24.417 42.076 51.384 1.00 30.30  ? 120 MET B SD    1 
ATOM   2556 C CE    . MET B 1 120 ? 24.388 41.684 53.099 1.00 22.52  ? 120 MET B CE    1 
ATOM   2557 N N     . ALA B 1 121 ? 29.119 38.479 51.196 1.00 20.56  ? 121 ALA B N     1 
ATOM   2558 C CA    . ALA B 1 121 ? 30.579 38.491 51.108 1.00 21.29  ? 121 ALA B CA    1 
ATOM   2559 C C     . ALA B 1 121 ? 31.053 37.564 49.992 1.00 21.28  ? 121 ALA B C     1 
ATOM   2560 O O     . ALA B 1 121 ? 31.905 37.936 49.178 1.00 21.09  ? 121 ALA B O     1 
ATOM   2561 C CB    . ALA B 1 121 ? 31.198 38.068 52.437 1.00 20.90  ? 121 ALA B CB    1 
ATOM   2562 N N     . ARG B 1 122 ? 30.504 36.353 49.957 1.00 21.61  ? 122 ARG B N     1 
ATOM   2563 C CA    . ARG B 1 122 ? 30.885 35.395 48.930 1.00 22.17  ? 122 ARG B CA    1 
ATOM   2564 C C     . ARG B 1 122 ? 30.528 35.920 47.534 1.00 21.76  ? 122 ARG B C     1 
ATOM   2565 O O     . ARG B 1 122 ? 31.298 35.763 46.586 1.00 20.57  ? 122 ARG B O     1 
ATOM   2566 C CB    . ARG B 1 122 ? 30.197 34.045 49.175 1.00 24.30  ? 122 ARG B CB    1 
ATOM   2567 C CG    . ARG B 1 122 ? 30.539 32.984 48.126 1.00 28.12  ? 122 ARG B CG    1 
ATOM   2568 C CD    . ARG B 1 122 ? 32.050 32.842 48.025 1.00 33.44  ? 122 ARG B CD    1 
ATOM   2569 N NE    . ARG B 1 122 ? 32.479 31.936 46.966 1.00 38.84  ? 122 ARG B NE    1 
ATOM   2570 C CZ    . ARG B 1 122 ? 33.711 31.920 46.464 1.00 41.45  ? 122 ARG B CZ    1 
ATOM   2571 N NH1   . ARG B 1 122 ? 34.033 31.066 45.502 1.00 41.52  ? 122 ARG B NH1   1 
ATOM   2572 N NH2   . ARG B 1 122 ? 34.620 32.772 46.922 1.00 41.13  ? 122 ARG B NH2   1 
ATOM   2573 N N     . ARG B 1 123 ? 29.367 36.557 47.405 1.00 20.67  ? 123 ARG B N     1 
ATOM   2574 C CA    . ARG B 1 123 ? 28.951 37.076 46.105 1.00 20.43  ? 123 ARG B CA    1 
ATOM   2575 C C     . ARG B 1 123 ? 29.885 38.169 45.604 1.00 20.30  ? 123 ARG B C     1 
ATOM   2576 O O     . ARG B 1 123 ? 30.187 38.240 44.413 1.00 20.98  ? 123 ARG B O     1 
ATOM   2577 C CB    . ARG B 1 123 ? 27.507 37.593 46.183 1.00 21.22  ? 123 ARG B CB    1 
ATOM   2578 C CG    . ARG B 1 123 ? 26.536 36.451 46.358 1.00 23.14  ? 123 ARG B CG    1 
ATOM   2579 C CD    . ARG B 1 123 ? 25.133 36.872 46.726 1.00 23.01  ? 123 ARG B CD    1 
ATOM   2580 N NE    . ARG B 1 123 ? 24.397 35.687 47.147 1.00 22.57  ? 123 ARG B NE    1 
ATOM   2581 C CZ    . ARG B 1 123 ? 23.097 35.648 47.404 1.00 22.60  ? 123 ARG B CZ    1 
ATOM   2582 N NH1   . ARG B 1 123 ? 22.353 36.741 47.282 1.00 20.70  ? 123 ARG B NH1   1 
ATOM   2583 N NH2   . ARG B 1 123 ? 22.545 34.506 47.785 1.00 21.50  ? 123 ARG B NH2   1 
ATOM   2584 N N     . LEU B 1 124 ? 30.356 39.012 46.517 1.00 21.34  ? 124 LEU B N     1 
ATOM   2585 C CA    . LEU B 1 124 ? 31.258 40.079 46.130 1.00 21.67  ? 124 LEU B CA    1 
ATOM   2586 C C     . LEU B 1 124 ? 32.567 39.471 45.634 1.00 21.45  ? 124 LEU B C     1 
ATOM   2587 O O     . LEU B 1 124 ? 33.133 39.941 44.654 1.00 19.81  ? 124 LEU B O     1 
ATOM   2588 C CB    . LEU B 1 124 ? 31.518 41.029 47.310 1.00 25.27  ? 124 LEU B CB    1 
ATOM   2589 C CG    . LEU B 1 124 ? 32.240 42.338 46.953 1.00 30.32  ? 124 LEU B CG    1 
ATOM   2590 C CD1   . LEU B 1 124 ? 31.487 43.055 45.832 1.00 31.04  ? 124 LEU B CD1   1 
ATOM   2591 C CD2   . LEU B 1 124 ? 32.329 43.240 48.182 1.00 32.35  ? 124 LEU B CD2   1 
ATOM   2592 N N     . GLN B 1 125 ? 33.032 38.413 46.296 1.00 19.62  ? 125 GLN B N     1 
ATOM   2593 C CA    . GLN B 1 125 ? 34.280 37.759 45.887 1.00 22.83  ? 125 GLN B CA    1 
ATOM   2594 C C     . GLN B 1 125 ? 34.151 37.201 44.467 1.00 21.95  ? 125 GLN B C     1 
ATOM   2595 O O     . GLN B 1 125 ? 34.996 37.454 43.605 1.00 22.34  ? 125 GLN B O     1 
ATOM   2596 C CB    . GLN B 1 125 ? 34.641 36.610 46.850 1.00 22.23  ? 125 GLN B CB    1 
ATOM   2597 C CG    . GLN B 1 125 ? 34.925 37.027 48.299 1.00 24.39  ? 125 GLN B CG    1 
ATOM   2598 C CD    . GLN B 1 125 ? 35.111 35.832 49.238 1.00 25.71  ? 125 GLN B CD    1 
ATOM   2599 O OE1   . GLN B 1 125 ? 34.398 34.835 49.137 1.00 26.68  ? 125 GLN B OE1   1 
ATOM   2600 N NE2   . GLN B 1 125 ? 36.062 35.942 50.168 1.00 25.64  ? 125 GLN B NE2   1 
ATOM   2601 N N     . VAL B 1 126 ? 33.077 36.452 44.228 1.00 20.45  ? 126 VAL B N     1 
ATOM   2602 C CA    . VAL B 1 126 ? 32.830 35.826 42.932 1.00 22.02  ? 126 VAL B CA    1 
ATOM   2603 C C     . VAL B 1 126 ? 32.596 36.831 41.808 1.00 23.13  ? 126 VAL B C     1 
ATOM   2604 O O     . VAL B 1 126 ? 33.104 36.668 40.692 1.00 22.22  ? 126 VAL B O     1 
ATOM   2605 C CB    . VAL B 1 126 ? 31.615 34.860 43.023 1.00 24.76  ? 126 VAL B CB    1 
ATOM   2606 C CG1   . VAL B 1 126 ? 31.283 34.286 41.645 1.00 28.52  ? 126 VAL B CG1   1 
ATOM   2607 C CG2   . VAL B 1 126 ? 31.931 33.735 43.992 1.00 25.96  ? 126 VAL B CG2   1 
ATOM   2608 N N     . THR B 1 127 ? 31.821 37.869 42.097 1.00 21.32  ? 127 THR B N     1 
ATOM   2609 C CA    . THR B 1 127 ? 31.540 38.891 41.102 1.00 22.00  ? 127 THR B CA    1 
ATOM   2610 C C     . THR B 1 127 ? 32.800 39.690 40.763 1.00 21.14  ? 127 THR B C     1 
ATOM   2611 O O     . THR B 1 127 ? 33.011 40.079 39.609 1.00 21.01  ? 127 THR B O     1 
ATOM   2612 C CB    . THR B 1 127 ? 30.434 39.834 41.600 1.00 23.38  ? 127 THR B CB    1 
ATOM   2613 O OG1   . THR B 1 127 ? 29.273 39.053 41.920 1.00 27.41  ? 127 THR B OG1   1 
ATOM   2614 C CG2   . THR B 1 127 ? 30.073 40.851 40.528 1.00 24.07  ? 127 THR B CG2   1 
ATOM   2615 N N     . SER B 1 128 ? 33.652 39.920 41.755 1.00 20.95  ? 128 SER B N     1 
ATOM   2616 C CA    . SER B 1 128 ? 34.884 40.661 41.504 1.00 19.88  ? 128 SER B CA    1 
ATOM   2617 C C     . SER B 1 128 ? 35.805 39.869 40.571 1.00 22.96  ? 128 SER B C     1 
ATOM   2618 O O     . SER B 1 128 ? 36.513 40.444 39.731 1.00 24.28  ? 128 SER B O     1 
ATOM   2619 C CB    . SER B 1 128 ? 35.595 40.966 42.826 1.00 19.19  ? 128 SER B CB    1 
ATOM   2620 O OG    . SER B 1 128 ? 34.813 41.855 43.604 1.00 20.73  ? 128 SER B OG    1 
ATOM   2621 N N     . GLU B 1 129 ? 35.797 38.550 40.719 1.00 23.74  ? 129 GLU B N     1 
ATOM   2622 C CA    . GLU B 1 129 ? 36.607 37.685 39.870 1.00 26.30  ? 129 GLU B CA    1 
ATOM   2623 C C     . GLU B 1 129 ? 36.102 37.784 38.427 1.00 28.05  ? 129 GLU B C     1 
ATOM   2624 O O     . GLU B 1 129 ? 36.886 37.766 37.472 1.00 24.89  ? 129 GLU B O     1 
ATOM   2625 C CB    . GLU B 1 129 ? 36.514 36.239 40.363 1.00 29.77  ? 129 GLU B CB    1 
ATOM   2626 C CG    . GLU B 1 129 ? 37.055 35.210 39.386 1.00 34.53  ? 129 GLU B CG    1 
ATOM   2627 C CD    . GLU B 1 129 ? 36.882 33.786 39.886 1.00 39.02  ? 129 GLU B CD    1 
ATOM   2628 O OE1   . GLU B 1 129 ? 35.810 33.476 40.447 1.00 40.77  ? 129 GLU B OE1   1 
ATOM   2629 O OE2   . GLU B 1 129 ? 37.815 32.972 39.708 1.00 42.70  ? 129 GLU B OE2   1 
ATOM   2630 N N     . LYS B 1 130 ? 34.787 37.894 38.279 1.00 25.60  ? 130 LYS B N     1 
ATOM   2631 C CA    . LYS B 1 130 ? 34.170 38.007 36.963 1.00 27.80  ? 130 LYS B CA    1 
ATOM   2632 C C     . LYS B 1 130 ? 34.599 39.317 36.281 1.00 27.66  ? 130 LYS B C     1 
ATOM   2633 O O     . LYS B 1 130 ? 34.872 39.346 35.073 1.00 25.76  ? 130 LYS B O     1 
ATOM   2634 C CB    . LYS B 1 130 ? 32.646 37.935 37.111 1.00 29.51  ? 130 LYS B CB    1 
ATOM   2635 C CG    . LYS B 1 130 ? 31.904 37.558 35.842 1.00 34.00  ? 130 LYS B CG    1 
ATOM   2636 C CD    . LYS B 1 130 ? 30.410 37.356 36.106 1.00 35.26  ? 130 LYS B CD    1 
ATOM   2637 C CE    . LYS B 1 130 ? 30.134 36.116 36.952 1.00 35.69  ? 130 LYS B CE    1 
ATOM   2638 N NZ    . LYS B 1 130 ? 30.397 34.839 36.226 1.00 37.42  ? 130 LYS B NZ    1 
ATOM   2639 N N     . VAL B 1 131 ? 34.664 40.397 37.056 1.00 24.81  ? 131 VAL B N     1 
ATOM   2640 C CA    . VAL B 1 131 ? 35.088 41.688 36.523 1.00 26.41  ? 131 VAL B CA    1 
ATOM   2641 C C     . VAL B 1 131 ? 36.508 41.566 35.973 1.00 27.14  ? 131 VAL B C     1 
ATOM   2642 O O     . VAL B 1 131 ? 36.816 42.071 34.889 1.00 27.22  ? 131 VAL B O     1 
ATOM   2643 C CB    . VAL B 1 131 ? 35.055 42.791 37.615 1.00 24.60  ? 131 VAL B CB    1 
ATOM   2644 C CG1   . VAL B 1 131 ? 35.810 44.037 37.141 1.00 25.87  ? 131 VAL B CG1   1 
ATOM   2645 C CG2   . VAL B 1 131 ? 33.615 43.145 37.939 1.00 25.89  ? 131 VAL B CG2   1 
ATOM   2646 N N     . GLY B 1 132 ? 37.371 40.890 36.723 1.00 26.05  ? 132 GLY B N     1 
ATOM   2647 C CA    . GLY B 1 132 ? 38.739 40.710 36.274 1.00 28.86  ? 132 GLY B CA    1 
ATOM   2648 C C     . GLY B 1 132 ? 38.808 39.972 34.946 1.00 29.66  ? 132 GLY B C     1 
ATOM   2649 O O     . GLY B 1 132 ? 39.491 40.405 34.013 1.00 29.41  ? 132 GLY B O     1 
ATOM   2650 N N     . ASN B 1 133 ? 38.095 38.856 34.855 1.00 29.50  ? 133 ASN B N     1 
ATOM   2651 C CA    . ASN B 1 133 ? 38.088 38.049 33.638 1.00 30.95  ? 133 ASN B CA    1 
ATOM   2652 C C     . ASN B 1 133 ? 37.571 38.798 32.405 1.00 30.81  ? 133 ASN B C     1 
ATOM   2653 O O     . ASN B 1 133 ? 38.111 38.641 31.307 1.00 30.05  ? 133 ASN B O     1 
ATOM   2654 C CB    . ASN B 1 133 ? 37.275 36.774 33.876 1.00 31.51  ? 133 ASN B CB    1 
ATOM   2655 C CG    . ASN B 1 133 ? 37.988 35.794 34.803 1.00 34.39  ? 133 ASN B CG    1 
ATOM   2656 O OD1   . ASN B 1 133 ? 37.356 35.094 35.595 1.00 36.83  ? 133 ASN B OD1   1 
ATOM   2657 N ND2   . ASN B 1 133 ? 39.311 35.731 34.694 1.00 35.31  ? 133 ASN B ND2   1 
ATOM   2658 N N     . LEU B 1 134 ? 36.538 39.616 32.586 1.00 29.57  ? 134 LEU B N     1 
ATOM   2659 C CA    . LEU B 1 134 ? 35.972 40.389 31.484 1.00 28.86  ? 134 LEU B CA    1 
ATOM   2660 C C     . LEU B 1 134 ? 36.934 41.490 31.036 1.00 29.43  ? 134 LEU B C     1 
ATOM   2661 O O     . LEU B 1 134 ? 36.983 41.850 29.855 1.00 29.58  ? 134 LEU B O     1 
ATOM   2662 C CB    . LEU B 1 134 ? 34.637 41.006 31.906 1.00 29.71  ? 134 LEU B CB    1 
ATOM   2663 C CG    . LEU B 1 134 ? 33.511 40.019 32.238 1.00 32.73  ? 134 LEU B CG    1 
ATOM   2664 C CD1   . LEU B 1 134 ? 32.360 40.756 32.913 1.00 31.16  ? 134 LEU B CD1   1 
ATOM   2665 C CD2   . LEU B 1 134 ? 33.038 39.327 30.964 1.00 32.72  ? 134 LEU B CD2   1 
ATOM   2666 N N     . ALA B 1 135 ? 37.695 42.031 31.982 1.00 27.48  ? 135 ALA B N     1 
ATOM   2667 C CA    . ALA B 1 135 ? 38.653 43.083 31.667 1.00 29.63  ? 135 ALA B CA    1 
ATOM   2668 C C     . ALA B 1 135 ? 39.923 42.535 31.017 1.00 29.02  ? 135 ALA B C     1 
ATOM   2669 O O     . ALA B 1 135 ? 40.494 43.163 30.121 1.00 28.74  ? 135 ALA B O     1 
ATOM   2670 C CB    . ALA B 1 135 ? 39.018 43.854 32.939 1.00 29.43  ? 135 ALA B CB    1 
ATOM   2671 N N     . PHE B 1 136 ? 40.351 41.355 31.456 1.00 28.65  ? 136 PHE B N     1 
ATOM   2672 C CA    . PHE B 1 136 ? 41.585 40.765 30.954 1.00 29.61  ? 136 PHE B CA    1 
ATOM   2673 C C     . PHE B 1 136 ? 41.480 39.828 29.746 1.00 30.61  ? 136 PHE B C     1 
ATOM   2674 O O     . PHE B 1 136 ? 42.503 39.425 29.195 1.00 31.69  ? 136 PHE B O     1 
ATOM   2675 C CB    . PHE B 1 136 ? 42.305 40.032 32.094 1.00 29.84  ? 136 PHE B CB    1 
ATOM   2676 C CG    . PHE B 1 136 ? 42.625 40.906 33.285 1.00 27.78  ? 136 PHE B CG    1 
ATOM   2677 C CD1   . PHE B 1 136 ? 43.233 42.145 33.118 1.00 29.63  ? 136 PHE B CD1   1 
ATOM   2678 C CD2   . PHE B 1 136 ? 42.344 40.470 34.575 1.00 29.12  ? 136 PHE B CD2   1 
ATOM   2679 C CE1   . PHE B 1 136 ? 43.561 42.940 34.225 1.00 31.49  ? 136 PHE B CE1   1 
ATOM   2680 C CE2   . PHE B 1 136 ? 42.666 41.254 35.690 1.00 30.29  ? 136 PHE B CE2   1 
ATOM   2681 C CZ    . PHE B 1 136 ? 43.275 42.490 35.513 1.00 30.04  ? 136 PHE B CZ    1 
ATOM   2682 N N     . LEU B 1 137 ? 40.267 39.491 29.321 1.00 29.64  ? 137 LEU B N     1 
ATOM   2683 C CA    . LEU B 1 137 ? 40.098 38.580 28.188 1.00 29.80  ? 137 LEU B CA    1 
ATOM   2684 C C     . LEU B 1 137 ? 39.155 39.123 27.121 1.00 29.68  ? 137 LEU B C     1 
ATOM   2685 O O     . LEU B 1 137 ? 38.164 39.775 27.446 1.00 27.08  ? 137 LEU B O     1 
ATOM   2686 C CB    . LEU B 1 137 ? 39.541 37.238 28.684 1.00 31.06  ? 137 LEU B CB    1 
ATOM   2687 C CG    . LEU B 1 137 ? 40.346 36.438 29.712 1.00 31.44  ? 137 LEU B CG    1 
ATOM   2688 C CD1   . LEU B 1 137 ? 39.486 35.330 30.290 1.00 32.46  ? 137 LEU B CD1   1 
ATOM   2689 C CD2   . LEU B 1 137 ? 41.587 35.862 29.051 1.00 33.37  ? 137 LEU B CD2   1 
ATOM   2690 N N     . ASP B 1 138 ? 39.451 38.857 25.848 1.00 30.67  ? 138 ASP B N     1 
ATOM   2691 C CA    . ASP B 1 138 ? 38.551 39.302 24.787 1.00 31.05  ? 138 ASP B CA    1 
ATOM   2692 C C     . ASP B 1 138 ? 37.464 38.235 24.633 1.00 31.52  ? 138 ASP B C     1 
ATOM   2693 O O     . ASP B 1 138 ? 37.480 37.230 25.348 1.00 29.78  ? 138 ASP B O     1 
ATOM   2694 C CB    . ASP B 1 138 ? 39.298 39.526 23.461 1.00 36.11  ? 138 ASP B CB    1 
ATOM   2695 C CG    . ASP B 1 138 ? 39.942 38.265 22.914 1.00 38.37  ? 138 ASP B CG    1 
ATOM   2696 O OD1   . ASP B 1 138 ? 39.665 37.160 23.423 1.00 38.89  ? 138 ASP B OD1   1 
ATOM   2697 O OD2   . ASP B 1 138 ? 40.730 38.390 21.951 1.00 43.11  ? 138 ASP B OD2   1 
ATOM   2698 N N     . VAL B 1 139 ? 36.521 38.440 23.716 1.00 30.37  ? 139 VAL B N     1 
ATOM   2699 C CA    . VAL B 1 139 ? 35.427 37.482 23.552 1.00 30.17  ? 139 VAL B CA    1 
ATOM   2700 C C     . VAL B 1 139 ? 35.880 36.029 23.360 1.00 28.90  ? 139 VAL B C     1 
ATOM   2701 O O     . VAL B 1 139 ? 35.298 35.117 23.945 1.00 26.30  ? 139 VAL B O     1 
ATOM   2702 C CB    . VAL B 1 139 ? 34.479 37.901 22.392 1.00 31.05  ? 139 VAL B CB    1 
ATOM   2703 C CG1   . VAL B 1 139 ? 35.218 37.882 21.068 1.00 31.68  ? 139 VAL B CG1   1 
ATOM   2704 C CG2   . VAL B 1 139 ? 33.269 36.974 22.351 1.00 32.31  ? 139 VAL B CG2   1 
ATOM   2705 N N     . THR B 1 140 ? 36.920 35.810 22.559 1.00 27.01  ? 140 THR B N     1 
ATOM   2706 C CA    . THR B 1 140 ? 37.415 34.455 22.342 1.00 27.47  ? 140 THR B CA    1 
ATOM   2707 C C     . THR B 1 140 ? 37.976 33.879 23.645 1.00 27.53  ? 140 THR B C     1 
ATOM   2708 O O     . THR B 1 140 ? 37.694 32.732 24.003 1.00 26.03  ? 140 THR B O     1 
ATOM   2709 C CB    . THR B 1 140 ? 38.513 34.423 21.260 1.00 27.61  ? 140 THR B CB    1 
ATOM   2710 O OG1   . THR B 1 140 ? 37.950 34.822 20.006 1.00 29.30  ? 140 THR B OG1   1 
ATOM   2711 C CG2   . THR B 1 140 ? 39.089 33.016 21.122 1.00 26.09  ? 140 THR B CG2   1 
ATOM   2712 N N     . GLY B 1 141 ? 38.768 34.680 24.348 1.00 27.60  ? 141 GLY B N     1 
ATOM   2713 C CA    . GLY B 1 141 ? 39.344 34.229 25.605 1.00 28.27  ? 141 GLY B CA    1 
ATOM   2714 C C     . GLY B 1 141 ? 38.298 33.960 26.677 1.00 27.90  ? 141 GLY B C     1 
ATOM   2715 O O     . GLY B 1 141 ? 38.448 33.035 27.479 1.00 28.65  ? 141 GLY B O     1 
ATOM   2716 N N     . ARG B 1 142 ? 37.245 34.773 26.708 1.00 26.82  ? 142 ARG B N     1 
ATOM   2717 C CA    . ARG B 1 142 ? 36.181 34.593 27.693 1.00 26.99  ? 142 ARG B CA    1 
ATOM   2718 C C     . ARG B 1 142 ? 35.490 33.252 27.477 1.00 25.60  ? 142 ARG B C     1 
ATOM   2719 O O     . ARG B 1 142 ? 35.200 32.526 28.431 1.00 24.74  ? 142 ARG B O     1 
ATOM   2720 C CB    . ARG B 1 142 ? 35.144 35.722 27.585 1.00 29.50  ? 142 ARG B CB    1 
ATOM   2721 C CG    . ARG B 1 142 ? 35.642 37.099 28.004 1.00 30.59  ? 142 ARG B CG    1 
ATOM   2722 C CD    . ARG B 1 142 ? 34.617 38.166 27.620 1.00 32.24  ? 142 ARG B CD    1 
ATOM   2723 N NE    . ARG B 1 142 ? 35.108 39.522 27.836 1.00 35.33  ? 142 ARG B NE    1 
ATOM   2724 C CZ    . ARG B 1 142 ? 34.398 40.616 27.573 1.00 37.87  ? 142 ARG B CZ    1 
ATOM   2725 N NH1   . ARG B 1 142 ? 33.168 40.504 27.086 1.00 37.08  ? 142 ARG B NH1   1 
ATOM   2726 N NH2   . ARG B 1 142 ? 34.912 41.820 27.795 1.00 37.79  ? 142 ARG B NH2   1 
ATOM   2727 N N     . ILE B 1 143 ? 35.223 32.922 26.218 1.00 25.08  ? 143 ILE B N     1 
ATOM   2728 C CA    . ILE B 1 143 ? 34.565 31.662 25.902 1.00 24.16  ? 143 ILE B CA    1 
ATOM   2729 C C     . ILE B 1 143 ? 35.510 30.486 26.175 1.00 25.78  ? 143 ILE B C     1 
ATOM   2730 O O     . ILE B 1 143 ? 35.101 29.489 26.771 1.00 25.98  ? 143 ILE B O     1 
ATOM   2731 C CB    . ILE B 1 143 ? 34.077 31.649 24.424 1.00 25.42  ? 143 ILE B CB    1 
ATOM   2732 C CG1   . ILE B 1 143 ? 32.885 32.601 24.281 1.00 23.51  ? 143 ILE B CG1   1 
ATOM   2733 C CG2   . ILE B 1 143 ? 33.683 30.234 23.994 1.00 24.27  ? 143 ILE B CG2   1 
ATOM   2734 C CD1   . ILE B 1 143 ? 32.394 32.796 22.853 1.00 26.53  ? 143 ILE B CD1   1 
ATOM   2735 N N     . ALA B 1 144 ? 36.770 30.614 25.760 1.00 26.59  ? 144 ALA B N     1 
ATOM   2736 C CA    . ALA B 1 144 ? 37.751 29.554 25.975 1.00 28.07  ? 144 ALA B CA    1 
ATOM   2737 C C     . ALA B 1 144 ? 37.927 29.281 27.470 1.00 29.21  ? 144 ALA B C     1 
ATOM   2738 O O     . ALA B 1 144 ? 37.957 28.123 27.900 1.00 27.45  ? 144 ALA B O     1 
ATOM   2739 C CB    . ALA B 1 144 ? 39.099 29.938 25.349 1.00 29.09  ? 144 ALA B CB    1 
ATOM   2740 N N     . GLN B 1 145 ? 38.034 30.345 28.261 1.00 27.96  ? 145 GLN B N     1 
ATOM   2741 C CA    . GLN B 1 145 ? 38.209 30.179 29.698 1.00 28.55  ? 145 GLN B CA    1 
ATOM   2742 C C     . GLN B 1 145 ? 36.962 29.595 30.353 1.00 28.03  ? 145 GLN B C     1 
ATOM   2743 O O     . GLN B 1 145 ? 37.059 28.821 31.305 1.00 27.41  ? 145 GLN B O     1 
ATOM   2744 C CB    . GLN B 1 145 ? 38.566 31.515 30.357 1.00 32.19  ? 145 GLN B CB    1 
ATOM   2745 C CG    . GLN B 1 145 ? 39.023 31.359 31.802 1.00 36.97  ? 145 GLN B CG    1 
ATOM   2746 C CD    . GLN B 1 145 ? 40.186 30.384 31.931 1.00 41.18  ? 145 GLN B CD    1 
ATOM   2747 O OE1   . GLN B 1 145 ? 41.238 30.565 31.311 1.00 41.84  ? 145 GLN B OE1   1 
ATOM   2748 N NE2   . GLN B 1 145 ? 39.999 29.344 32.738 1.00 41.83  ? 145 GLN B NE2   1 
ATOM   2749 N N     . THR B 1 146 ? 35.788 29.960 29.848 1.00 27.23  ? 146 THR B N     1 
ATOM   2750 C CA    . THR B 1 146 ? 34.541 29.436 30.404 1.00 27.72  ? 146 THR B CA    1 
ATOM   2751 C C     . THR B 1 146 ? 34.442 27.929 30.168 1.00 28.59  ? 146 THR B C     1 
ATOM   2752 O O     . THR B 1 146 ? 33.988 27.188 31.043 1.00 29.02  ? 146 THR B O     1 
ATOM   2753 C CB    . THR B 1 146 ? 33.301 30.135 29.785 1.00 26.64  ? 146 THR B CB    1 
ATOM   2754 O OG1   . THR B 1 146 ? 33.240 31.487 30.250 1.00 25.19  ? 146 THR B OG1   1 
ATOM   2755 C CG2   . THR B 1 146 ? 32.015 29.415 30.176 1.00 27.03  ? 146 THR B CG2   1 
ATOM   2756 N N     . LEU B 1 147 ? 34.868 27.475 28.992 1.00 27.99  ? 147 LEU B N     1 
ATOM   2757 C CA    . LEU B 1 147 ? 34.819 26.046 28.686 1.00 28.56  ? 147 LEU B CA    1 
ATOM   2758 C C     . LEU B 1 147 ? 35.787 25.304 29.606 1.00 28.82  ? 147 LEU B C     1 
ATOM   2759 O O     . LEU B 1 147 ? 35.446 24.266 30.169 1.00 29.17  ? 147 LEU B O     1 
ATOM   2760 C CB    . LEU B 1 147 ? 35.204 25.792 27.223 1.00 29.11  ? 147 LEU B CB    1 
ATOM   2761 C CG    . LEU B 1 147 ? 34.335 26.426 26.128 1.00 29.35  ? 147 LEU B CG    1 
ATOM   2762 C CD1   . LEU B 1 147 ? 34.887 26.048 24.757 1.00 29.36  ? 147 LEU B CD1   1 
ATOM   2763 C CD2   . LEU B 1 147 ? 32.895 25.954 26.267 1.00 27.74  ? 147 LEU B CD2   1 
ATOM   2764 N N     . LEU B 1 148 ? 36.995 25.845 29.752 1.00 30.25  ? 148 LEU B N     1 
ATOM   2765 C CA    . LEU B 1 148 ? 38.004 25.238 30.618 1.00 32.53  ? 148 LEU B CA    1 
ATOM   2766 C C     . LEU B 1 148 ? 37.490 25.116 32.057 1.00 32.86  ? 148 LEU B C     1 
ATOM   2767 O O     . LEU B 1 148 ? 37.632 24.067 32.691 1.00 31.56  ? 148 LEU B O     1 
ATOM   2768 C CB    . LEU B 1 148 ? 39.293 26.071 30.602 1.00 34.15  ? 148 LEU B CB    1 
ATOM   2769 C CG    . LEU B 1 148 ? 40.152 26.025 29.330 1.00 38.04  ? 148 LEU B CG    1 
ATOM   2770 C CD1   . LEU B 1 148 ? 41.289 27.038 29.429 1.00 40.14  ? 148 LEU B CD1   1 
ATOM   2771 C CD2   . LEU B 1 148 ? 40.709 24.614 29.139 1.00 40.10  ? 148 LEU B CD2   1 
ATOM   2772 N N     . ASN B 1 149 ? 36.892 26.186 32.574 1.00 32.06  ? 149 ASN B N     1 
ATOM   2773 C CA    . ASN B 1 149 ? 36.379 26.155 33.940 1.00 32.94  ? 149 ASN B CA    1 
ATOM   2774 C C     . ASN B 1 149 ? 35.205 25.190 34.105 1.00 32.81  ? 149 ASN B C     1 
ATOM   2775 O O     . ASN B 1 149 ? 35.068 24.551 35.156 1.00 32.25  ? 149 ASN B O     1 
ATOM   2776 C CB    . ASN B 1 149 ? 36.014 27.570 34.401 1.00 35.28  ? 149 ASN B CB    1 
ATOM   2777 C CG    . ASN B 1 149 ? 37.247 28.404 34.725 1.00 37.58  ? 149 ASN B CG    1 
ATOM   2778 O OD1   . ASN B 1 149 ? 37.181 29.629 34.827 1.00 40.39  ? 149 ASN B OD1   1 
ATOM   2779 N ND2   . ASN B 1 149 ? 38.381 27.733 34.897 1.00 36.86  ? 149 ASN B ND2   1 
ATOM   2780 N N     . LEU B 1 150 ? 34.364 25.071 33.079 1.00 29.38  ? 150 LEU B N     1 
ATOM   2781 C CA    . LEU B 1 150 ? 33.244 24.136 33.149 1.00 29.42  ? 150 LEU B CA    1 
ATOM   2782 C C     . LEU B 1 150 ? 33.819 22.723 33.180 1.00 31.02  ? 150 LEU B C     1 
ATOM   2783 O O     . LEU B 1 150 ? 33.273 21.826 33.832 1.00 29.24  ? 150 LEU B O     1 
ATOM   2784 C CB    . LEU B 1 150 ? 32.322 24.288 31.934 1.00 29.99  ? 150 LEU B CB    1 
ATOM   2785 C CG    . LEU B 1 150 ? 31.385 25.498 31.923 1.00 28.86  ? 150 LEU B CG    1 
ATOM   2786 C CD1   . LEU B 1 150 ? 30.732 25.648 30.545 1.00 28.14  ? 150 LEU B CD1   1 
ATOM   2787 C CD2   . LEU B 1 150 ? 30.332 25.328 33.002 1.00 30.27  ? 150 LEU B CD2   1 
ATOM   2788 N N     . ALA B 1 151 ? 34.928 22.536 32.469 1.00 29.96  ? 151 ALA B N     1 
ATOM   2789 C CA    . ALA B 1 151 ? 35.596 21.243 32.412 1.00 31.63  ? 151 ALA B CA    1 
ATOM   2790 C C     . ALA B 1 151 ? 36.202 20.868 33.762 1.00 32.72  ? 151 ALA B C     1 
ATOM   2791 O O     . ALA B 1 151 ? 36.554 19.709 33.988 1.00 33.36  ? 151 ALA B O     1 
ATOM   2792 C CB    . ALA B 1 151 ? 36.689 21.267 31.344 1.00 32.89  ? 151 ALA B CB    1 
ATOM   2793 N N     . LYS B 1 152 ? 36.329 21.840 34.659 1.00 33.33  ? 152 LYS B N     1 
ATOM   2794 C CA    . LYS B 1 152 ? 36.903 21.559 35.970 1.00 35.41  ? 152 LYS B CA    1 
ATOM   2795 C C     . LYS B 1 152 ? 35.868 21.390 37.075 1.00 35.25  ? 152 LYS B C     1 
ATOM   2796 O O     . LYS B 1 152 ? 36.227 21.163 38.235 1.00 34.88  ? 152 LYS B O     1 
ATOM   2797 C CB    . LYS B 1 152 ? 37.902 22.648 36.362 1.00 38.08  ? 152 LYS B CB    1 
ATOM   2798 C CG    . LYS B 1 152 ? 39.150 22.721 35.485 1.00 42.49  ? 152 LYS B CG    1 
ATOM   2799 C CD    . LYS B 1 152 ? 39.963 21.423 35.504 1.00 46.44  ? 152 LYS B CD    1 
ATOM   2800 C CE    . LYS B 1 152 ? 39.444 20.399 34.496 1.00 48.63  ? 152 LYS B CE    1 
ATOM   2801 N NZ    . LYS B 1 152 ? 40.173 19.094 34.581 1.00 50.54  ? 152 LYS B NZ    1 
ATOM   2802 N N     . GLN B 1 153 ? 34.589 21.493 36.727 1.00 32.99  ? 153 GLN B N     1 
ATOM   2803 C CA    . GLN B 1 153 ? 33.538 21.326 37.724 1.00 34.30  ? 153 GLN B CA    1 
ATOM   2804 C C     . GLN B 1 153 ? 33.370 19.835 38.025 1.00 34.32  ? 153 GLN B C     1 
ATOM   2805 O O     . GLN B 1 153 ? 33.647 18.985 37.181 1.00 30.50  ? 153 GLN B O     1 
ATOM   2806 C CB    . GLN B 1 153 ? 32.212 21.896 37.221 1.00 37.19  ? 153 GLN B CB    1 
ATOM   2807 C CG    . GLN B 1 153 ? 32.280 23.340 36.755 1.00 40.44  ? 153 GLN B CG    1 
ATOM   2808 C CD    . GLN B 1 153 ? 30.903 23.959 36.600 1.00 44.86  ? 153 GLN B CD    1 
ATOM   2809 O OE1   . GLN B 1 153 ? 29.989 23.340 36.048 1.00 47.10  ? 153 GLN B OE1   1 
ATOM   2810 N NE2   . GLN B 1 153 ? 30.747 25.189 37.085 1.00 47.18  ? 153 GLN B NE2   1 
ATOM   2811 N N     . PRO B 1 154 ? 32.916 19.498 39.239 1.00 35.20  ? 154 PRO B N     1 
ATOM   2812 C CA    . PRO B 1 154 ? 32.737 18.085 39.587 1.00 36.74  ? 154 PRO B CA    1 
ATOM   2813 C C     . PRO B 1 154 ? 31.805 17.302 38.666 1.00 37.62  ? 154 PRO B C     1 
ATOM   2814 O O     . PRO B 1 154 ? 31.930 16.082 38.548 1.00 36.95  ? 154 PRO B O     1 
ATOM   2815 C CB    . PRO B 1 154 ? 32.241 18.141 41.035 1.00 36.62  ? 154 PRO B CB    1 
ATOM   2816 C CG    . PRO B 1 154 ? 31.622 19.491 41.149 1.00 39.17  ? 154 PRO B CG    1 
ATOM   2817 C CD    . PRO B 1 154 ? 32.562 20.369 40.370 1.00 35.79  ? 154 PRO B CD    1 
ATOM   2818 N N     . ASP B 1 155 ? 30.884 17.995 38.001 1.00 38.00  ? 155 ASP B N     1 
ATOM   2819 C CA    . ASP B 1 155 ? 29.950 17.326 37.100 1.00 39.13  ? 155 ASP B CA    1 
ATOM   2820 C C     . ASP B 1 155 ? 30.524 17.080 35.707 1.00 39.33  ? 155 ASP B C     1 
ATOM   2821 O O     . ASP B 1 155 ? 29.877 16.455 34.866 1.00 39.84  ? 155 ASP B O     1 
ATOM   2822 C CB    . ASP B 1 155 ? 28.644 18.125 36.983 1.00 42.37  ? 155 ASP B CB    1 
ATOM   2823 C CG    . ASP B 1 155 ? 28.849 19.500 36.377 1.00 44.48  ? 155 ASP B CG    1 
ATOM   2824 O OD1   . ASP B 1 155 ? 27.840 20.203 36.146 1.00 47.52  ? 155 ASP B OD1   1 
ATOM   2825 O OD2   . ASP B 1 155 ? 30.013 19.882 36.135 1.00 46.03  ? 155 ASP B OD2   1 
ATOM   2826 N N     . ALA B 1 156 ? 31.733 17.571 35.458 1.00 39.19  ? 156 ALA B N     1 
ATOM   2827 C CA    . ALA B 1 156 ? 32.368 17.370 34.160 1.00 40.04  ? 156 ALA B CA    1 
ATOM   2828 C C     . ALA B 1 156 ? 32.689 15.883 33.999 1.00 41.98  ? 156 ALA B C     1 
ATOM   2829 O O     . ALA B 1 156 ? 33.096 15.221 34.956 1.00 39.88  ? 156 ALA B O     1 
ATOM   2830 C CB    . ALA B 1 156 ? 33.638 18.198 34.064 1.00 40.09  ? 156 ALA B CB    1 
ATOM   2831 N N     . MET B 1 157 ? 32.501 15.365 32.789 1.00 43.39  ? 157 MET B N     1 
ATOM   2832 C CA    . MET B 1 157 ? 32.748 13.951 32.505 1.00 47.20  ? 157 MET B CA    1 
ATOM   2833 C C     . MET B 1 157 ? 34.140 13.693 31.934 1.00 46.80  ? 157 MET B C     1 
ATOM   2834 O O     . MET B 1 157 ? 34.596 14.405 31.043 1.00 45.17  ? 157 MET B O     1 
ATOM   2835 C CB    . MET B 1 157 ? 31.695 13.428 31.520 1.00 49.44  ? 157 MET B CB    1 
ATOM   2836 C CG    . MET B 1 157 ? 30.275 13.405 32.065 1.00 53.91  ? 157 MET B CG    1 
ATOM   2837 S SD    . MET B 1 157 ? 29.030 13.232 30.759 1.00 59.92  ? 157 MET B SD    1 
ATOM   2838 C CE    . MET B 1 157 ? 29.455 11.612 30.088 1.00 58.76  ? 157 MET B CE    1 
ATOM   2839 N N     . THR B 1 158 ? 34.811 12.669 32.453 1.00 46.99  ? 158 THR B N     1 
ATOM   2840 C CA    . THR B 1 158 ? 36.140 12.319 31.972 1.00 47.56  ? 158 THR B CA    1 
ATOM   2841 C C     . THR B 1 158 ? 35.999 11.802 30.546 1.00 47.70  ? 158 THR B C     1 
ATOM   2842 O O     . THR B 1 158 ? 35.059 11.074 30.231 1.00 48.72  ? 158 THR B O     1 
ATOM   2843 C CB    . THR B 1 158 ? 36.790 11.232 32.852 1.00 48.74  ? 158 THR B CB    1 
ATOM   2844 O OG1   . THR B 1 158 ? 36.951 11.735 34.185 1.00 50.27  ? 158 THR B OG1   1 
ATOM   2845 C CG2   . THR B 1 158 ? 38.156 10.844 32.304 1.00 49.76  ? 158 THR B CG2   1 
ATOM   2846 N N     . HIS B 1 159 ? 36.932 12.189 29.683 1.00 46.31  ? 159 HIS B N     1 
ATOM   2847 C CA    . HIS B 1 159 ? 36.900 11.780 28.285 1.00 45.63  ? 159 HIS B CA    1 
ATOM   2848 C C     . HIS B 1 159 ? 38.292 11.317 27.859 1.00 44.26  ? 159 HIS B C     1 
ATOM   2849 O O     . HIS B 1 159 ? 39.297 11.847 28.330 1.00 42.75  ? 159 HIS B O     1 
ATOM   2850 C CB    . HIS B 1 159 ? 36.462 12.965 27.417 1.00 45.46  ? 159 HIS B CB    1 
ATOM   2851 C CG    . HIS B 1 159 ? 36.272 12.624 25.973 1.00 46.65  ? 159 HIS B CG    1 
ATOM   2852 N ND1   . HIS B 1 159 ? 35.077 12.156 25.469 1.00 47.04  ? 159 HIS B ND1   1 
ATOM   2853 C CD2   . HIS B 1 159 ? 37.129 12.668 24.926 1.00 45.87  ? 159 HIS B CD2   1 
ATOM   2854 C CE1   . HIS B 1 159 ? 35.207 11.929 24.175 1.00 47.03  ? 159 HIS B CE1   1 
ATOM   2855 N NE2   . HIS B 1 159 ? 36.442 12.231 23.820 1.00 46.18  ? 159 HIS B NE2   1 
ATOM   2856 N N     . PRO B 1 160 ? 38.367 10.322 26.960 1.00 44.37  ? 160 PRO B N     1 
ATOM   2857 C CA    . PRO B 1 160 ? 39.663 9.813  26.493 1.00 44.50  ? 160 PRO B CA    1 
ATOM   2858 C C     . PRO B 1 160 ? 40.585 10.881 25.904 1.00 43.92  ? 160 PRO B C     1 
ATOM   2859 O O     . PRO B 1 160 ? 41.806 10.717 25.888 1.00 44.42  ? 160 PRO B O     1 
ATOM   2860 C CB    . PRO B 1 160 ? 39.268 8.741  25.471 1.00 44.94  ? 160 PRO B CB    1 
ATOM   2861 C CG    . PRO B 1 160 ? 37.897 9.167  25.021 1.00 46.64  ? 160 PRO B CG    1 
ATOM   2862 C CD    . PRO B 1 160 ? 37.262 9.592  26.317 1.00 43.98  ? 160 PRO B CD    1 
ATOM   2863 N N     . ASP B 1 161 ? 39.998 11.974 25.430 1.00 43.58  ? 161 ASP B N     1 
ATOM   2864 C CA    . ASP B 1 161 ? 40.766 13.070 24.849 1.00 42.02  ? 161 ASP B CA    1 
ATOM   2865 C C     . ASP B 1 161 ? 40.828 14.280 25.779 1.00 41.44  ? 161 ASP B C     1 
ATOM   2866 O O     . ASP B 1 161 ? 41.478 15.275 25.463 1.00 40.24  ? 161 ASP B O     1 
ATOM   2867 C CB    . ASP B 1 161 ? 40.154 13.481 23.507 1.00 44.69  ? 161 ASP B CB    1 
ATOM   2868 C CG    . ASP B 1 161 ? 40.392 12.451 22.417 1.00 45.02  ? 161 ASP B CG    1 
ATOM   2869 O OD1   . ASP B 1 161 ? 39.614 12.428 21.441 1.00 45.67  ? 161 ASP B OD1   1 
ATOM   2870 O OD2   . ASP B 1 161 ? 41.364 11.676 22.532 1.00 45.27  ? 161 ASP B OD2   1 
ATOM   2871 N N     . GLY B 1 162 ? 40.148 14.188 26.921 1.00 39.59  ? 162 GLY B N     1 
ATOM   2872 C CA    . GLY B 1 162 ? 40.141 15.282 27.878 1.00 39.07  ? 162 GLY B CA    1 
ATOM   2873 C C     . GLY B 1 162 ? 38.933 15.233 28.797 1.00 39.83  ? 162 GLY B C     1 
ATOM   2874 O O     . GLY B 1 162 ? 38.704 14.230 29.475 1.00 39.39  ? 162 GLY B O     1 
ATOM   2875 N N     . MET B 1 163 ? 38.167 16.320 28.833 1.00 38.29  ? 163 MET B N     1 
ATOM   2876 C CA    . MET B 1 163 ? 36.963 16.387 29.657 1.00 38.70  ? 163 MET B CA    1 
ATOM   2877 C C     . MET B 1 163 ? 35.769 16.730 28.768 1.00 38.94  ? 163 MET B C     1 
ATOM   2878 O O     . MET B 1 163 ? 35.894 17.504 27.817 1.00 40.93  ? 163 MET B O     1 
ATOM   2879 C CB    . MET B 1 163 ? 37.113 17.438 30.761 1.00 39.11  ? 163 MET B CB    1 
ATOM   2880 C CG    . MET B 1 163 ? 38.180 17.121 31.807 1.00 39.98  ? 163 MET B CG    1 
ATOM   2881 S SD    . MET B 1 163 ? 37.949 15.525 32.650 1.00 43.22  ? 163 MET B SD    1 
ATOM   2882 C CE    . MET B 1 163 ? 36.352 15.760 33.430 1.00 40.26  ? 163 MET B CE    1 
ATOM   2883 N N     . GLN B 1 164 ? 34.616 16.148 29.077 1.00 37.97  ? 164 GLN B N     1 
ATOM   2884 C CA    . GLN B 1 164 ? 33.406 16.377 28.300 1.00 39.94  ? 164 GLN B CA    1 
ATOM   2885 C C     . GLN B 1 164 ? 32.337 17.096 29.113 1.00 38.81  ? 164 GLN B C     1 
ATOM   2886 O O     . GLN B 1 164 ? 31.989 16.673 30.214 1.00 39.21  ? 164 GLN B O     1 
ATOM   2887 C CB    . GLN B 1 164 ? 32.855 15.041 27.797 1.00 41.58  ? 164 GLN B CB    1 
ATOM   2888 C CG    . GLN B 1 164 ? 31.501 15.127 27.120 1.00 47.50  ? 164 GLN B CG    1 
ATOM   2889 C CD    . GLN B 1 164 ? 30.997 13.769 26.653 1.00 49.72  ? 164 GLN B CD    1 
ATOM   2890 O OE1   . GLN B 1 164 ? 31.580 13.148 25.764 1.00 50.46  ? 164 GLN B OE1   1 
ATOM   2891 N NE2   . GLN B 1 164 ? 29.910 13.300 27.259 1.00 51.71  ? 164 GLN B NE2   1 
ATOM   2892 N N     . ILE B 1 165 ? 31.813 18.182 28.557 1.00 37.70  ? 165 ILE B N     1 
ATOM   2893 C CA    . ILE B 1 165 ? 30.781 18.956 29.233 1.00 37.27  ? 165 ILE B CA    1 
ATOM   2894 C C     . ILE B 1 165 ? 29.531 19.030 28.370 1.00 38.62  ? 165 ILE B C     1 
ATOM   2895 O O     . ILE B 1 165 ? 29.590 18.820 27.160 1.00 38.71  ? 165 ILE B O     1 
ATOM   2896 C CB    . ILE B 1 165 ? 31.257 20.394 29.520 1.00 37.05  ? 165 ILE B CB    1 
ATOM   2897 C CG1   . ILE B 1 165 ? 31.547 21.119 28.200 1.00 35.86  ? 165 ILE B CG1   1 
ATOM   2898 C CG2   . ILE B 1 165 ? 32.495 20.363 30.405 1.00 34.99  ? 165 ILE B CG2   1 
ATOM   2899 C CD1   . ILE B 1 165 ? 31.909 22.591 28.367 1.00 36.90  ? 165 ILE B CD1   1 
ATOM   2900 N N     . LYS B 1 166 ? 28.400 19.330 29.001 1.00 40.21  ? 166 LYS B N     1 
ATOM   2901 C CA    . LYS B 1 166 ? 27.133 19.453 28.290 1.00 41.92  ? 166 LYS B CA    1 
ATOM   2902 C C     . LYS B 1 166 ? 26.555 20.835 28.566 1.00 41.02  ? 166 LYS B C     1 
ATOM   2903 O O     . LYS B 1 166 ? 26.179 21.144 29.695 1.00 41.89  ? 166 LYS B O     1 
ATOM   2904 C CB    . LYS B 1 166 ? 26.153 18.375 28.755 1.00 45.85  ? 166 LYS B CB    1 
ATOM   2905 C CG    . LYS B 1 166 ? 26.579 16.960 28.394 1.00 50.09  ? 166 LYS B CG    1 
ATOM   2906 C CD    . LYS B 1 166 ? 25.607 15.931 28.946 1.00 53.45  ? 166 LYS B CD    1 
ATOM   2907 C CE    . LYS B 1 166 ? 26.078 14.517 28.644 1.00 55.21  ? 166 LYS B CE    1 
ATOM   2908 N NZ    . LYS B 1 166 ? 25.170 13.496 29.239 1.00 57.75  ? 166 LYS B NZ    1 
ATOM   2909 N N     . ILE B 1 167 ? 26.495 21.665 27.532 1.00 39.94  ? 167 ILE B N     1 
ATOM   2910 C CA    . ILE B 1 167 ? 25.975 23.021 27.672 1.00 39.38  ? 167 ILE B CA    1 
ATOM   2911 C C     . ILE B 1 167 ? 25.615 23.572 26.297 1.00 38.24  ? 167 ILE B C     1 
ATOM   2912 O O     . ILE B 1 167 ? 26.290 23.282 25.311 1.00 38.16  ? 167 ILE B O     1 
ATOM   2913 C CB    . ILE B 1 167 ? 27.024 23.941 28.350 1.00 39.54  ? 167 ILE B CB    1 
ATOM   2914 C CG1   . ILE B 1 167 ? 26.455 25.351 28.526 1.00 39.68  ? 167 ILE B CG1   1 
ATOM   2915 C CG2   . ILE B 1 167 ? 28.303 23.976 27.522 1.00 38.15  ? 167 ILE B CG2   1 
ATOM   2916 C CD1   . ILE B 1 167 ? 27.342 26.270 29.337 1.00 39.56  ? 167 ILE B CD1   1 
ATOM   2917 N N     . THR B 1 168 ? 24.552 24.368 26.234 1.00 36.72  ? 168 THR B N     1 
ATOM   2918 C CA    . THR B 1 168 ? 24.105 24.935 24.967 1.00 35.55  ? 168 THR B CA    1 
ATOM   2919 C C     . THR B 1 168 ? 24.834 26.224 24.618 1.00 35.60  ? 168 THR B C     1 
ATOM   2920 O O     . THR B 1 168 ? 25.447 26.854 25.479 1.00 32.90  ? 168 THR B O     1 
ATOM   2921 C CB    . THR B 1 168 ? 22.599 25.242 24.997 1.00 36.45  ? 168 THR B CB    1 
ATOM   2922 O OG1   . THR B 1 168 ? 22.340 26.264 25.970 1.00 36.06  ? 168 THR B OG1   1 
ATOM   2923 C CG2   . THR B 1 168 ? 21.810 23.992 25.361 1.00 37.91  ? 168 THR B CG2   1 
ATOM   2924 N N     . ARG B 1 169 ? 24.763 26.607 23.345 1.00 34.74  ? 169 ARG B N     1 
ATOM   2925 C CA    . ARG B 1 169 ? 25.395 27.834 22.882 1.00 36.08  ? 169 ARG B CA    1 
ATOM   2926 C C     . ARG B 1 169 ? 24.718 29.016 23.566 1.00 34.83  ? 169 ARG B C     1 
ATOM   2927 O O     . ARG B 1 169 ? 25.359 30.022 23.866 1.00 33.13  ? 169 ARG B O     1 
ATOM   2928 C CB    . ARG B 1 169 ? 25.257 27.974 21.364 1.00 38.06  ? 169 ARG B CB    1 
ATOM   2929 C CG    . ARG B 1 169 ? 25.975 26.900 20.565 1.00 43.57  ? 169 ARG B CG    1 
ATOM   2930 C CD    . ARG B 1 169 ? 25.903 27.196 19.073 1.00 47.08  ? 169 ARG B CD    1 
ATOM   2931 N NE    . ARG B 1 169 ? 26.546 26.153 18.280 1.00 52.61  ? 169 ARG B NE    1 
ATOM   2932 C CZ    . ARG B 1 169 ? 26.671 26.188 16.956 1.00 54.14  ? 169 ARG B CZ    1 
ATOM   2933 N NH1   . ARG B 1 169 ? 27.271 25.190 16.321 1.00 55.10  ? 169 ARG B NH1   1 
ATOM   2934 N NH2   . ARG B 1 169 ? 26.201 27.221 16.266 1.00 54.41  ? 169 ARG B NH2   1 
ATOM   2935 N N     . GLN B 1 170 ? 23.416 28.887 23.806 1.00 34.27  ? 170 GLN B N     1 
ATOM   2936 C CA    . GLN B 1 170 ? 22.665 29.945 24.466 1.00 35.28  ? 170 GLN B CA    1 
ATOM   2937 C C     . GLN B 1 170 ? 23.186 30.144 25.884 1.00 32.22  ? 170 GLN B C     1 
ATOM   2938 O O     . GLN B 1 170 ? 23.401 31.273 26.316 1.00 30.70  ? 170 GLN B O     1 
ATOM   2939 C CB    . GLN B 1 170 ? 21.174 29.603 24.524 1.00 38.50  ? 170 GLN B CB    1 
ATOM   2940 C CG    . GLN B 1 170 ? 20.364 30.595 25.347 1.00 43.78  ? 170 GLN B CG    1 
ATOM   2941 C CD    . GLN B 1 170 ? 18.918 30.177 25.523 1.00 47.09  ? 170 GLN B CD    1 
ATOM   2942 O OE1   . GLN B 1 170 ? 18.631 29.067 25.969 1.00 48.91  ? 170 GLN B OE1   1 
ATOM   2943 N NE2   . GLN B 1 170 ? 17.998 31.071 25.183 1.00 48.69  ? 170 GLN B NE2   1 
ATOM   2944 N N     . GLU B 1 171 ? 23.390 29.046 26.608 1.00 31.33  ? 171 GLU B N     1 
ATOM   2945 C CA    . GLU B 1 171 ? 23.877 29.142 27.979 1.00 31.35  ? 171 GLU B CA    1 
ATOM   2946 C C     . GLU B 1 171 ? 25.281 29.740 28.015 1.00 29.16  ? 171 GLU B C     1 
ATOM   2947 O O     . GLU B 1 171 ? 25.595 30.549 28.893 1.00 26.16  ? 171 GLU B O     1 
ATOM   2948 C CB    . GLU B 1 171 ? 23.873 27.770 28.657 1.00 35.54  ? 171 GLU B CB    1 
ATOM   2949 C CG    . GLU B 1 171 ? 24.154 27.847 30.154 1.00 44.75  ? 171 GLU B CG    1 
ATOM   2950 C CD    . GLU B 1 171 ? 23.910 26.533 30.874 1.00 49.57  ? 171 GLU B CD    1 
ATOM   2951 O OE1   . GLU B 1 171 ? 22.790 25.990 30.757 1.00 53.00  ? 171 GLU B OE1   1 
ATOM   2952 O OE2   . GLU B 1 171 ? 24.835 26.048 31.562 1.00 53.75  ? 171 GLU B OE2   1 
ATOM   2953 N N     . ILE B 1 172 ? 26.126 29.340 27.065 1.00 25.32  ? 172 ILE B N     1 
ATOM   2954 C CA    . ILE B 1 172 ? 27.481 29.872 26.999 1.00 25.45  ? 172 ILE B CA    1 
ATOM   2955 C C     . ILE B 1 172 ? 27.395 31.380 26.749 1.00 24.76  ? 172 ILE B C     1 
ATOM   2956 O O     . ILE B 1 172 ? 28.084 32.172 27.397 1.00 23.81  ? 172 ILE B O     1 
ATOM   2957 C CB    . ILE B 1 172 ? 28.292 29.197 25.856 1.00 24.76  ? 172 ILE B CB    1 
ATOM   2958 C CG1   . ILE B 1 172 ? 28.540 27.724 26.199 1.00 26.46  ? 172 ILE B CG1   1 
ATOM   2959 C CG2   . ILE B 1 172 ? 29.613 29.937 25.643 1.00 26.02  ? 172 ILE B CG2   1 
ATOM   2960 C CD1   . ILE B 1 172 ? 29.176 26.916 25.058 1.00 26.26  ? 172 ILE B CD1   1 
ATOM   2961 N N     . GLY B 1 173 ? 26.534 31.764 25.811 1.00 24.94  ? 173 GLY B N     1 
ATOM   2962 C CA    . GLY B 1 173 ? 26.361 33.173 25.496 1.00 25.23  ? 173 GLY B CA    1 
ATOM   2963 C C     . GLY B 1 173 ? 25.949 33.957 26.732 1.00 26.12  ? 173 GLY B C     1 
ATOM   2964 O O     . GLY B 1 173 ? 26.463 35.044 26.981 1.00 26.79  ? 173 GLY B O     1 
ATOM   2965 N N     . GLN B 1 174 ? 25.028 33.398 27.512 1.00 26.73  ? 174 GLN B N     1 
ATOM   2966 C CA    . GLN B 1 174 ? 24.551 34.051 28.730 1.00 28.14  ? 174 GLN B CA    1 
ATOM   2967 C C     . GLN B 1 174 ? 25.652 34.228 29.773 1.00 27.93  ? 174 GLN B C     1 
ATOM   2968 O O     . GLN B 1 174 ? 25.640 35.195 30.537 1.00 28.06  ? 174 GLN B O     1 
ATOM   2969 C CB    . GLN B 1 174 ? 23.406 33.252 29.353 1.00 29.49  ? 174 GLN B CB    1 
ATOM   2970 C CG    . GLN B 1 174 ? 22.144 33.202 28.515 1.00 30.78  ? 174 GLN B CG    1 
ATOM   2971 C CD    . GLN B 1 174 ? 21.058 32.359 29.162 1.00 30.95  ? 174 GLN B CD    1 
ATOM   2972 O OE1   . GLN B 1 174 ? 21.300 31.223 29.568 1.00 32.21  ? 174 GLN B OE1   1 
ATOM   2973 N NE2   . GLN B 1 174 ? 19.855 32.912 29.256 1.00 33.15  ? 174 GLN B NE2   1 
ATOM   2974 N N     . ILE B 1 175 ? 26.595 33.290 29.814 1.00 27.89  ? 175 ILE B N     1 
ATOM   2975 C CA    . ILE B 1 175 ? 27.698 33.364 30.772 1.00 25.89  ? 175 ILE B CA    1 
ATOM   2976 C C     . ILE B 1 175 ? 28.698 34.459 30.397 1.00 27.08  ? 175 ILE B C     1 
ATOM   2977 O O     . ILE B 1 175 ? 29.186 35.197 31.263 1.00 26.66  ? 175 ILE B O     1 
ATOM   2978 C CB    . ILE B 1 175 ? 28.449 32.015 30.856 1.00 28.20  ? 175 ILE B CB    1 
ATOM   2979 C CG1   . ILE B 1 175 ? 27.510 30.942 31.409 1.00 28.65  ? 175 ILE B CG1   1 
ATOM   2980 C CG2   . ILE B 1 175 ? 29.703 32.152 31.737 1.00 25.41  ? 175 ILE B CG2   1 
ATOM   2981 C CD1   . ILE B 1 175 ? 28.082 29.539 31.358 1.00 31.22  ? 175 ILE B CD1   1 
ATOM   2982 N N     . VAL B 1 176 ? 29.004 34.572 29.109 1.00 26.02  ? 176 VAL B N     1 
ATOM   2983 C CA    . VAL B 1 176 ? 29.969 35.574 28.668 1.00 28.21  ? 176 VAL B CA    1 
ATOM   2984 C C     . VAL B 1 176 ? 29.356 36.881 28.172 1.00 28.67  ? 176 VAL B C     1 
ATOM   2985 O O     . VAL B 1 176 ? 30.076 37.844 27.904 1.00 31.54  ? 176 VAL B O     1 
ATOM   2986 C CB    . VAL B 1 176 ? 30.885 35.006 27.564 1.00 29.13  ? 176 VAL B CB    1 
ATOM   2987 C CG1   . VAL B 1 176 ? 31.596 33.763 28.078 1.00 28.25  ? 176 VAL B CG1   1 
ATOM   2988 C CG2   . VAL B 1 176 ? 30.070 34.681 26.323 1.00 28.09  ? 176 VAL B CG2   1 
ATOM   2989 N N     . GLY B 1 177 ? 28.034 36.915 28.047 1.00 29.28  ? 177 GLY B N     1 
ATOM   2990 C CA    . GLY B 1 177 ? 27.375 38.122 27.584 1.00 30.52  ? 177 GLY B CA    1 
ATOM   2991 C C     . GLY B 1 177 ? 27.421 38.361 26.082 1.00 31.48  ? 177 GLY B C     1 
ATOM   2992 O O     . GLY B 1 177 ? 27.503 39.505 25.640 1.00 31.06  ? 177 GLY B O     1 
ATOM   2993 N N     . CYS B 1 178 ? 27.379 37.297 25.286 1.00 30.76  ? 178 CYS B N     1 
ATOM   2994 C CA    . CYS B 1 178 ? 27.388 37.466 23.836 1.00 31.71  ? 178 CYS B CA    1 
ATOM   2995 C C     . CYS B 1 178 ? 26.240 36.661 23.238 1.00 30.79  ? 178 CYS B C     1 
ATOM   2996 O O     . CYS B 1 178 ? 25.598 35.873 23.932 1.00 29.32  ? 178 CYS B O     1 
ATOM   2997 C CB    . CYS B 1 178 ? 28.733 37.028 23.233 1.00 32.88  ? 178 CYS B CB    1 
ATOM   2998 S SG    . CYS B 1 178 ? 29.049 35.252 23.214 1.00 36.27  ? 178 CYS B SG    1 
ATOM   2999 N N     . SER B 1 179 ? 25.984 36.861 21.951 1.00 31.45  ? 179 SER B N     1 
ATOM   3000 C CA    . SER B 1 179 ? 24.896 36.168 21.272 1.00 31.99  ? 179 SER B CA    1 
ATOM   3001 C C     . SER B 1 179 ? 25.212 34.710 20.974 1.00 33.18  ? 179 SER B C     1 
ATOM   3002 O O     . SER B 1 179 ? 26.366 34.289 20.984 1.00 31.03  ? 179 SER B O     1 
ATOM   3003 C CB    . SER B 1 179 ? 24.564 36.865 19.951 1.00 32.58  ? 179 SER B CB    1 
ATOM   3004 O OG    . SER B 1 179 ? 25.610 36.668 19.011 1.00 32.00  ? 179 SER B OG    1 
ATOM   3005 N N     . ARG B 1 180 ? 24.163 33.954 20.684 1.00 35.66  ? 180 ARG B N     1 
ATOM   3006 C CA    . ARG B 1 180 ? 24.287 32.545 20.353 1.00 38.28  ? 180 ARG B CA    1 
ATOM   3007 C C     . ARG B 1 180 ? 25.106 32.411 19.069 1.00 37.29  ? 180 ARG B C     1 
ATOM   3008 O O     . ARG B 1 180 ? 25.911 31.488 18.923 1.00 37.28  ? 180 ARG B O     1 
ATOM   3009 C CB    . ARG B 1 180 ? 22.897 31.949 20.145 1.00 41.79  ? 180 ARG B CB    1 
ATOM   3010 C CG    . ARG B 1 180 ? 22.848 30.444 20.232 1.00 48.00  ? 180 ARG B CG    1 
ATOM   3011 C CD    . ARG B 1 180 ? 21.434 29.940 20.018 1.00 52.20  ? 180 ARG B CD    1 
ATOM   3012 N NE    . ARG B 1 180 ? 20.459 30.762 20.729 1.00 55.32  ? 180 ARG B NE    1 
ATOM   3013 C CZ    . ARG B 1 180 ? 19.203 30.396 20.962 1.00 56.91  ? 180 ARG B CZ    1 
ATOM   3014 N NH1   . ARG B 1 180 ? 18.383 31.210 21.612 1.00 57.72  ? 180 ARG B NH1   1 
ATOM   3015 N NH2   . ARG B 1 180 ? 18.772 29.209 20.557 1.00 58.27  ? 180 ARG B NH2   1 
ATOM   3016 N N     . GLU B 1 181 ? 24.893 33.343 18.143 1.00 36.53  ? 181 GLU B N     1 
ATOM   3017 C CA    . GLU B 1 181 ? 25.603 33.348 16.865 1.00 37.11  ? 181 GLU B CA    1 
ATOM   3018 C C     . GLU B 1 181 ? 27.100 33.544 17.077 1.00 34.89  ? 181 GLU B C     1 
ATOM   3019 O O     . GLU B 1 181 ? 27.926 32.891 16.432 1.00 33.47  ? 181 GLU B O     1 
ATOM   3020 C CB    . GLU B 1 181 ? 25.062 34.460 15.954 1.00 40.71  ? 181 GLU B CB    1 
ATOM   3021 C CG    . GLU B 1 181 ? 23.632 34.240 15.455 1.00 45.51  ? 181 GLU B CG    1 
ATOM   3022 C CD    . GLU B 1 181 ? 22.572 34.480 16.520 1.00 48.18  ? 181 GLU B CD    1 
ATOM   3023 O OE1   . GLU B 1 181 ? 21.386 34.193 16.248 1.00 49.44  ? 181 GLU B OE1   1 
ATOM   3024 O OE2   . GLU B 1 181 ? 22.914 34.960 17.622 1.00 48.07  ? 181 GLU B OE2   1 
ATOM   3025 N N     . THR B 1 182 ? 27.447 34.454 17.979 1.00 31.87  ? 182 THR B N     1 
ATOM   3026 C CA    . THR B 1 182 ? 28.844 34.716 18.276 1.00 30.38  ? 182 THR B CA    1 
ATOM   3027 C C     . THR B 1 182 ? 29.475 33.458 18.876 1.00 29.04  ? 182 THR B C     1 
ATOM   3028 O O     . THR B 1 182 ? 30.579 33.078 18.495 1.00 27.39  ? 182 THR B O     1 
ATOM   3029 C CB    . THR B 1 182 ? 28.984 35.904 19.246 1.00 29.85  ? 182 THR B CB    1 
ATOM   3030 O OG1   . THR B 1 182 ? 28.565 37.103 18.580 1.00 29.01  ? 182 THR B OG1   1 
ATOM   3031 C CG2   . THR B 1 182 ? 30.429 36.059 19.713 1.00 29.12  ? 182 THR B CG2   1 
ATOM   3032 N N     . VAL B 1 183 ? 28.770 32.810 19.802 1.00 27.98  ? 183 VAL B N     1 
ATOM   3033 C CA    . VAL B 1 183 ? 29.281 31.583 20.417 1.00 28.06  ? 183 VAL B CA    1 
ATOM   3034 C C     . VAL B 1 183 ? 29.506 30.546 19.317 1.00 29.93  ? 183 VAL B C     1 
ATOM   3035 O O     . VAL B 1 183 ? 30.502 29.825 19.322 1.00 28.04  ? 183 VAL B O     1 
ATOM   3036 C CB    . VAL B 1 183 ? 28.289 31.008 21.459 1.00 30.24  ? 183 VAL B CB    1 
ATOM   3037 C CG1   . VAL B 1 183 ? 28.747 29.620 21.914 1.00 28.26  ? 183 VAL B CG1   1 
ATOM   3038 C CG2   . VAL B 1 183 ? 28.200 31.943 22.662 1.00 29.23  ? 183 VAL B CG2   1 
ATOM   3039 N N     . GLY B 1 184 ? 28.580 30.490 18.364 1.00 30.37  ? 184 GLY B N     1 
ATOM   3040 C CA    . GLY B 1 184 ? 28.702 29.542 17.271 1.00 31.66  ? 184 GLY B CA    1 
ATOM   3041 C C     . GLY B 1 184 ? 29.948 29.746 16.421 1.00 30.65  ? 184 GLY B C     1 
ATOM   3042 O O     . GLY B 1 184 ? 30.657 28.783 16.113 1.00 32.17  ? 184 GLY B O     1 
ATOM   3043 N N     . ARG B 1 185 ? 30.225 30.992 16.042 1.00 29.33  ? 185 ARG B N     1 
ATOM   3044 C CA    . ARG B 1 185 ? 31.392 31.285 15.214 1.00 30.19  ? 185 ARG B CA    1 
ATOM   3045 C C     . ARG B 1 185 ? 32.687 30.970 15.950 1.00 29.89  ? 185 ARG B C     1 
ATOM   3046 O O     . ARG B 1 185 ? 33.624 30.413 15.375 1.00 27.44  ? 185 ARG B O     1 
ATOM   3047 C CB    . ARG B 1 185 ? 31.415 32.760 14.789 1.00 30.37  ? 185 ARG B CB    1 
ATOM   3048 C CG    . ARG B 1 185 ? 30.300 33.200 13.854 1.00 31.25  ? 185 ARG B CG    1 
ATOM   3049 C CD    . ARG B 1 185 ? 30.625 34.571 13.252 1.00 31.45  ? 185 ARG B CD    1 
ATOM   3050 N NE    . ARG B 1 185 ? 30.783 35.608 14.273 1.00 34.01  ? 185 ARG B NE    1 
ATOM   3051 C CZ    . ARG B 1 185 ? 29.778 36.278 14.832 1.00 33.93  ? 185 ARG B CZ    1 
ATOM   3052 N NH1   . ARG B 1 185 ? 30.024 37.197 15.759 1.00 31.63  ? 185 ARG B NH1   1 
ATOM   3053 N NH2   . ARG B 1 185 ? 28.526 36.048 14.453 1.00 34.16  ? 185 ARG B NH2   1 
ATOM   3054 N N     . ILE B 1 186 ? 32.735 31.323 17.231 1.00 28.47  ? 186 ILE B N     1 
ATOM   3055 C CA    . ILE B 1 186 ? 33.930 31.086 18.022 1.00 28.13  ? 186 ILE B CA    1 
ATOM   3056 C C     . ILE B 1 186 ? 34.159 29.608 18.339 1.00 28.71  ? 186 ILE B C     1 
ATOM   3057 O O     . ILE B 1 186 ? 35.304 29.153 18.346 1.00 28.72  ? 186 ILE B O     1 
ATOM   3058 C CB    . ILE B 1 186 ? 33.902 31.960 19.305 1.00 28.51  ? 186 ILE B CB    1 
ATOM   3059 C CG1   . ILE B 1 186 ? 34.071 33.428 18.891 1.00 28.02  ? 186 ILE B CG1   1 
ATOM   3060 C CG2   . ILE B 1 186 ? 35.011 31.543 20.278 1.00 27.71  ? 186 ILE B CG2   1 
ATOM   3061 C CD1   . ILE B 1 186 ? 33.864 34.446 19.996 1.00 30.69  ? 186 ILE B CD1   1 
ATOM   3062 N N     . LEU B 1 187 ? 33.090 28.851 18.579 1.00 28.43  ? 187 LEU B N     1 
ATOM   3063 C CA    . LEU B 1 187 ? 33.250 27.426 18.864 1.00 29.82  ? 187 LEU B CA    1 
ATOM   3064 C C     . LEU B 1 187 ? 33.789 26.726 17.616 1.00 30.65  ? 187 LEU B C     1 
ATOM   3065 O O     . LEU B 1 187 ? 34.608 25.809 17.702 1.00 29.73  ? 187 LEU B O     1 
ATOM   3066 C CB    . LEU B 1 187 ? 31.919 26.787 19.276 1.00 29.78  ? 187 LEU B CB    1 
ATOM   3067 C CG    . LEU B 1 187 ? 31.342 27.108 20.661 1.00 28.48  ? 187 LEU B CG    1 
ATOM   3068 C CD1   . LEU B 1 187 ? 30.120 26.226 20.903 1.00 29.30  ? 187 LEU B CD1   1 
ATOM   3069 C CD2   . LEU B 1 187 ? 32.385 26.851 21.748 1.00 29.61  ? 187 LEU B CD2   1 
ATOM   3070 N N     . LYS B 1 188 ? 33.325 27.165 16.453 1.00 30.93  ? 188 LYS B N     1 
ATOM   3071 C CA    . LYS B 1 188 ? 33.781 26.580 15.200 1.00 33.21  ? 188 LYS B CA    1 
ATOM   3072 C C     . LYS B 1 188 ? 35.272 26.868 15.027 1.00 33.02  ? 188 LYS B C     1 
ATOM   3073 O O     . LYS B 1 188 ? 36.042 26.003 14.591 1.00 34.63  ? 188 LYS B O     1 
ATOM   3074 C CB    . LYS B 1 188 ? 32.968 27.151 14.030 1.00 35.38  ? 188 LYS B CB    1 
ATOM   3075 C CG    . LYS B 1 188 ? 33.340 26.589 12.658 1.00 39.40  ? 188 LYS B CG    1 
ATOM   3076 C CD    . LYS B 1 188 ? 34.539 27.312 12.043 1.00 42.91  ? 188 LYS B CD    1 
ATOM   3077 C CE    . LYS B 1 188 ? 34.188 28.745 11.638 1.00 44.64  ? 188 LYS B CE    1 
ATOM   3078 N NZ    . LYS B 1 188 ? 35.297 29.431 10.907 1.00 42.61  ? 188 LYS B NZ    1 
ATOM   3079 N N     . MET B 1 189 ? 35.683 28.082 15.381 1.00 32.36  ? 189 MET B N     1 
ATOM   3080 C CA    . MET B 1 189 ? 37.083 28.472 15.273 1.00 32.58  ? 189 MET B CA    1 
ATOM   3081 C C     . MET B 1 189 ? 37.946 27.641 16.219 1.00 32.25  ? 189 MET B C     1 
ATOM   3082 O O     . MET B 1 189 ? 38.990 27.118 15.826 1.00 32.55  ? 189 MET B O     1 
ATOM   3083 C CB    . MET B 1 189 ? 37.250 29.958 15.598 1.00 33.27  ? 189 MET B CB    1 
ATOM   3084 C CG    . MET B 1 189 ? 38.706 30.414 15.669 1.00 35.02  ? 189 MET B CG    1 
ATOM   3085 S SD    . MET B 1 189 ? 38.887 32.164 16.058 1.00 35.48  ? 189 MET B SD    1 
ATOM   3086 C CE    . MET B 1 189 ? 38.559 32.157 17.839 1.00 35.36  ? 189 MET B CE    1 
ATOM   3087 N N     . LEU B 1 190 ? 37.511 27.528 17.470 1.00 31.58  ? 190 LEU B N     1 
ATOM   3088 C CA    . LEU B 1 190 ? 38.250 26.748 18.456 1.00 33.15  ? 190 LEU B CA    1 
ATOM   3089 C C     . LEU B 1 190 ? 38.391 25.297 17.997 1.00 35.53  ? 190 LEU B C     1 
ATOM   3090 O O     . LEU B 1 190 ? 39.415 24.652 18.241 1.00 34.78  ? 190 LEU B O     1 
ATOM   3091 C CB    . LEU B 1 190 ? 37.543 26.809 19.814 1.00 31.36  ? 190 LEU B CB    1 
ATOM   3092 C CG    . LEU B 1 190 ? 37.571 28.197 20.459 1.00 30.70  ? 190 LEU B CG    1 
ATOM   3093 C CD1   . LEU B 1 190 ? 36.799 28.186 21.772 1.00 29.39  ? 190 LEU B CD1   1 
ATOM   3094 C CD2   . LEU B 1 190 ? 39.018 28.605 20.693 1.00 29.99  ? 190 LEU B CD2   1 
ATOM   3095 N N     . GLU B 1 191 ? 37.363 24.787 17.327 1.00 37.58  ? 191 GLU B N     1 
ATOM   3096 C CA    . GLU B 1 191 ? 37.407 23.419 16.830 1.00 41.44  ? 191 GLU B CA    1 
ATOM   3097 C C     . GLU B 1 191 ? 38.400 23.313 15.669 1.00 42.13  ? 191 GLU B C     1 
ATOM   3098 O O     . GLU B 1 191 ? 39.134 22.328 15.558 1.00 41.69  ? 191 GLU B O     1 
ATOM   3099 C CB    . GLU B 1 191 ? 36.012 22.965 16.385 1.00 43.11  ? 191 GLU B CB    1 
ATOM   3100 C CG    . GLU B 1 191 ? 35.962 21.515 15.929 1.00 47.47  ? 191 GLU B CG    1 
ATOM   3101 C CD    . GLU B 1 191 ? 34.553 20.955 15.892 1.00 50.08  ? 191 GLU B CD    1 
ATOM   3102 O OE1   . GLU B 1 191 ? 34.383 19.816 15.405 1.00 52.42  ? 191 GLU B OE1   1 
ATOM   3103 O OE2   . GLU B 1 191 ? 33.618 21.645 16.352 1.00 51.49  ? 191 GLU B OE2   1 
ATOM   3104 N N     . ASP B 1 192 ? 38.429 24.331 14.810 1.00 42.92  ? 192 ASP B N     1 
ATOM   3105 C CA    . ASP B 1 192 ? 39.358 24.331 13.683 1.00 44.72  ? 192 ASP B CA    1 
ATOM   3106 C C     . ASP B 1 192 ? 40.790 24.428 14.190 1.00 45.03  ? 192 ASP B C     1 
ATOM   3107 O O     . ASP B 1 192 ? 41.727 23.977 13.526 1.00 45.63  ? 192 ASP B O     1 
ATOM   3108 C CB    . ASP B 1 192 ? 39.074 25.497 12.727 1.00 46.26  ? 192 ASP B CB    1 
ATOM   3109 C CG    . ASP B 1 192 ? 37.818 25.285 11.905 1.00 47.41  ? 192 ASP B CG    1 
ATOM   3110 O OD1   . ASP B 1 192 ? 37.437 24.114 11.694 1.00 48.30  ? 192 ASP B OD1   1 
ATOM   3111 O OD2   . ASP B 1 192 ? 37.221 26.287 11.454 1.00 49.78  ? 192 ASP B OD2   1 
ATOM   3112 N N     . GLN B 1 193 ? 40.955 25.020 15.369 1.00 44.11  ? 193 GLN B N     1 
ATOM   3113 C CA    . GLN B 1 193 ? 42.271 25.159 15.978 1.00 44.24  ? 193 GLN B CA    1 
ATOM   3114 C C     . GLN B 1 193 ? 42.587 23.914 16.809 1.00 43.40  ? 193 GLN B C     1 
ATOM   3115 O O     . GLN B 1 193 ? 43.567 23.884 17.551 1.00 43.28  ? 193 GLN B O     1 
ATOM   3116 C CB    . GLN B 1 193 ? 42.318 26.401 16.872 1.00 44.34  ? 193 GLN B CB    1 
ATOM   3117 C CG    . GLN B 1 193 ? 41.952 27.695 16.167 1.00 47.14  ? 193 GLN B CG    1 
ATOM   3118 C CD    . GLN B 1 193 ? 42.034 28.897 17.087 1.00 48.27  ? 193 GLN B CD    1 
ATOM   3119 O OE1   . GLN B 1 193 ? 41.704 28.808 18.268 1.00 48.35  ? 193 GLN B OE1   1 
ATOM   3120 N NE2   . GLN B 1 193 ? 42.459 30.033 16.545 1.00 48.47  ? 193 GLN B NE2   1 
ATOM   3121 N N     . ASN B 1 194 ? 41.741 22.895 16.679 1.00 42.37  ? 194 ASN B N     1 
ATOM   3122 C CA    . ASN B 1 194 ? 41.907 21.633 17.394 1.00 42.02  ? 194 ASN B CA    1 
ATOM   3123 C C     . ASN B 1 194 ? 42.026 21.772 18.908 1.00 41.96  ? 194 ASN B C     1 
ATOM   3124 O O     . ASN B 1 194 ? 42.858 21.111 19.537 1.00 41.51  ? 194 ASN B O     1 
ATOM   3125 C CB    . ASN B 1 194 ? 43.126 20.872 16.860 1.00 44.02  ? 194 ASN B CB    1 
ATOM   3126 C CG    . ASN B 1 194 ? 42.905 20.319 15.463 1.00 45.77  ? 194 ASN B CG    1 
ATOM   3127 O OD1   . ASN B 1 194 ? 43.100 21.013 14.465 1.00 46.74  ? 194 ASN B OD1   1 
ATOM   3128 N ND2   . ASN B 1 194 ? 42.482 19.063 15.390 1.00 48.24  ? 194 ASN B ND2   1 
ATOM   3129 N N     . LEU B 1 195 ? 41.193 22.624 19.493 1.00 39.37  ? 195 LEU B N     1 
ATOM   3130 C CA    . LEU B 1 195 ? 41.212 22.824 20.936 1.00 39.06  ? 195 LEU B CA    1 
ATOM   3131 C C     . LEU B 1 195 ? 40.009 22.158 21.590 1.00 37.81  ? 195 LEU B C     1 
ATOM   3132 O O     . LEU B 1 195 ? 40.055 21.795 22.764 1.00 36.33  ? 195 LEU B O     1 
ATOM   3133 C CB    . LEU B 1 195 ? 41.219 24.319 21.268 1.00 40.07  ? 195 LEU B CB    1 
ATOM   3134 C CG    . LEU B 1 195 ? 42.454 25.096 20.813 1.00 41.77  ? 195 LEU B CG    1 
ATOM   3135 C CD1   . LEU B 1 195 ? 42.283 26.572 21.149 1.00 43.43  ? 195 LEU B CD1   1 
ATOM   3136 C CD2   . LEU B 1 195 ? 43.694 24.529 21.494 1.00 43.26  ? 195 LEU B CD2   1 
ATOM   3137 N N     . ILE B 1 196 ? 38.930 22.008 20.826 1.00 36.33  ? 196 ILE B N     1 
ATOM   3138 C CA    . ILE B 1 196 ? 37.712 21.382 21.329 1.00 36.94  ? 196 ILE B CA    1 
ATOM   3139 C C     . ILE B 1 196 ? 37.005 20.629 20.211 1.00 39.68  ? 196 ILE B C     1 
ATOM   3140 O O     . ILE B 1 196 ? 37.327 20.789 19.030 1.00 37.80  ? 196 ILE B O     1 
ATOM   3141 C CB    . ILE B 1 196 ? 36.695 22.420 21.871 1.00 34.62  ? 196 ILE B CB    1 
ATOM   3142 C CG1   . ILE B 1 196 ? 36.208 23.310 20.722 1.00 34.35  ? 196 ILE B CG1   1 
ATOM   3143 C CG2   . ILE B 1 196 ? 37.324 23.253 22.976 1.00 36.03  ? 196 ILE B CG2   1 
ATOM   3144 C CD1   . ILE B 1 196 ? 35.109 24.285 21.109 1.00 32.39  ? 196 ILE B CD1   1 
ATOM   3145 N N     . SER B 1 197 ? 36.031 19.820 20.608 1.00 41.99  ? 197 SER B N     1 
ATOM   3146 C CA    . SER B 1 197 ? 35.225 19.045 19.679 1.00 46.55  ? 197 SER B CA    1 
ATOM   3147 C C     . SER B 1 197 ? 33.773 19.287 20.062 1.00 48.15  ? 197 SER B C     1 
ATOM   3148 O O     . SER B 1 197 ? 33.383 19.060 21.208 1.00 47.41  ? 197 SER B O     1 
ATOM   3149 C CB    . SER B 1 197 ? 35.549 17.556 19.799 1.00 47.69  ? 197 SER B CB    1 
ATOM   3150 O OG    . SER B 1 197 ? 34.651 16.786 19.018 1.00 52.36  ? 197 SER B OG    1 
ATOM   3151 N N     . ALA B 1 198 ? 32.976 19.758 19.111 1.00 50.30  ? 198 ALA B N     1 
ATOM   3152 C CA    . ALA B 1 198 ? 31.574 20.031 19.384 1.00 54.40  ? 198 ALA B CA    1 
ATOM   3153 C C     . ALA B 1 198 ? 30.649 19.132 18.573 1.00 57.34  ? 198 ALA B C     1 
ATOM   3154 O O     . ALA B 1 198 ? 30.845 18.935 17.373 1.00 58.20  ? 198 ALA B O     1 
ATOM   3155 C CB    . ALA B 1 198 ? 31.262 21.497 19.100 1.00 53.11  ? 198 ALA B CB    1 
ATOM   3156 N N     . HIS B 1 199 ? 29.645 18.586 19.250 1.00 60.47  ? 199 HIS B N     1 
ATOM   3157 C CA    . HIS B 1 199 ? 28.657 17.713 18.626 1.00 62.76  ? 199 HIS B CA    1 
ATOM   3158 C C     . HIS B 1 199 ? 27.342 17.886 19.374 1.00 63.27  ? 199 HIS B C     1 
ATOM   3159 O O     . HIS B 1 199 ? 27.080 17.196 20.361 1.00 63.24  ? 199 HIS B O     1 
ATOM   3160 C CB    . HIS B 1 199 ? 29.110 16.253 18.692 1.00 64.31  ? 199 HIS B CB    1 
ATOM   3161 C CG    . HIS B 1 199 ? 29.323 15.629 17.348 1.00 67.08  ? 199 HIS B CG    1 
ATOM   3162 N ND1   . HIS B 1 199 ? 29.775 14.336 17.189 1.00 68.03  ? 199 HIS B ND1   1 
ATOM   3163 C CD2   . HIS B 1 199 ? 29.143 16.120 16.098 1.00 68.01  ? 199 HIS B CD2   1 
ATOM   3164 C CE1   . HIS B 1 199 ? 29.864 14.057 15.901 1.00 68.91  ? 199 HIS B CE1   1 
ATOM   3165 N NE2   . HIS B 1 199 ? 29.487 15.123 15.217 1.00 69.19  ? 199 HIS B NE2   1 
ATOM   3166 N N     . GLY B 1 200 ? 26.522 18.816 18.893 1.00 63.58  ? 200 GLY B N     1 
ATOM   3167 C CA    . GLY B 1 200 ? 25.253 19.090 19.537 1.00 63.51  ? 200 GLY B CA    1 
ATOM   3168 C C     . GLY B 1 200 ? 25.526 19.935 20.765 1.00 63.28  ? 200 GLY B C     1 
ATOM   3169 O O     . GLY B 1 200 ? 26.198 20.965 20.677 1.00 63.29  ? 200 GLY B O     1 
ATOM   3170 N N     . LYS B 1 201 ? 25.015 19.503 21.912 1.00 62.26  ? 201 LYS B N     1 
ATOM   3171 C CA    . LYS B 1 201 ? 25.234 20.235 23.152 1.00 61.50  ? 201 LYS B CA    1 
ATOM   3172 C C     . LYS B 1 201 ? 26.336 19.563 23.964 1.00 59.51  ? 201 LYS B C     1 
ATOM   3173 O O     . LYS B 1 201 ? 26.497 19.824 25.157 1.00 59.36  ? 201 LYS B O     1 
ATOM   3174 C CB    . LYS B 1 201 ? 23.935 20.315 23.961 1.00 63.22  ? 201 LYS B CB    1 
ATOM   3175 C CG    . LYS B 1 201 ? 22.980 21.408 23.481 1.00 65.07  ? 201 LYS B CG    1 
ATOM   3176 C CD    . LYS B 1 201 ? 22.599 21.235 22.015 1.00 66.27  ? 201 LYS B CD    1 
ATOM   3177 C CE    . LYS B 1 201 ? 21.860 22.456 21.482 1.00 67.13  ? 201 LYS B CE    1 
ATOM   3178 N NZ    . LYS B 1 201 ? 22.711 23.684 21.505 1.00 67.70  ? 201 LYS B NZ    1 
ATOM   3179 N N     . THR B 1 202 ? 27.090 18.693 23.297 1.00 56.61  ? 202 THR B N     1 
ATOM   3180 C CA    . THR B 1 202 ? 28.194 17.976 23.922 1.00 52.86  ? 202 THR B CA    1 
ATOM   3181 C C     . THR B 1 202 ? 29.510 18.533 23.387 1.00 49.50  ? 202 THR B C     1 
ATOM   3182 O O     . THR B 1 202 ? 29.756 18.525 22.181 1.00 49.24  ? 202 THR B O     1 
ATOM   3183 C CB    . THR B 1 202 ? 28.131 16.469 23.614 1.00 53.54  ? 202 THR B CB    1 
ATOM   3184 O OG1   . THR B 1 202 ? 26.917 15.922 24.146 1.00 54.67  ? 202 THR B OG1   1 
ATOM   3185 C CG2   . THR B 1 202 ? 29.323 15.751 24.235 1.00 54.11  ? 202 THR B CG2   1 
ATOM   3186 N N     . ILE B 1 203 ? 30.351 19.015 24.293 1.00 45.09  ? 203 ILE B N     1 
ATOM   3187 C CA    . ILE B 1 203 ? 31.635 19.589 23.916 1.00 40.99  ? 203 ILE B CA    1 
ATOM   3188 C C     . ILE B 1 203 ? 32.793 18.877 24.602 1.00 40.56  ? 203 ILE B C     1 
ATOM   3189 O O     . ILE B 1 203 ? 32.758 18.631 25.807 1.00 39.42  ? 203 ILE B O     1 
ATOM   3190 C CB    . ILE B 1 203 ? 31.699 21.087 24.291 1.00 39.21  ? 203 ILE B CB    1 
ATOM   3191 C CG1   . ILE B 1 203 ? 30.576 21.847 23.583 1.00 39.53  ? 203 ILE B CG1   1 
ATOM   3192 C CG2   . ILE B 1 203 ? 33.061 21.662 23.927 1.00 38.57  ? 203 ILE B CG2   1 
ATOM   3193 C CD1   . ILE B 1 203 ? 30.479 23.312 23.976 1.00 39.50  ? 203 ILE B CD1   1 
ATOM   3194 N N     . VAL B 1 204 ? 33.817 18.537 23.829 1.00 39.49  ? 204 VAL B N     1 
ATOM   3195 C CA    . VAL B 1 204 ? 34.983 17.884 24.397 1.00 39.04  ? 204 VAL B CA    1 
ATOM   3196 C C     . VAL B 1 204 ? 36.118 18.894 24.446 1.00 38.04  ? 204 VAL B C     1 
ATOM   3197 O O     . VAL B 1 204 ? 36.551 19.409 23.416 1.00 36.79  ? 204 VAL B O     1 
ATOM   3198 C CB    . VAL B 1 204 ? 35.428 16.662 23.560 1.00 40.19  ? 204 VAL B CB    1 
ATOM   3199 C CG1   . VAL B 1 204 ? 36.662 16.020 24.189 1.00 39.73  ? 204 VAL B CG1   1 
ATOM   3200 C CG2   . VAL B 1 204 ? 34.295 15.654 23.474 1.00 41.31  ? 204 VAL B CG2   1 
ATOM   3201 N N     . VAL B 1 205 ? 36.575 19.196 25.655 1.00 37.81  ? 205 VAL B N     1 
ATOM   3202 C CA    . VAL B 1 205 ? 37.669 20.134 25.850 1.00 39.01  ? 205 VAL B CA    1 
ATOM   3203 C C     . VAL B 1 205 ? 38.946 19.308 25.915 1.00 41.17  ? 205 VAL B C     1 
ATOM   3204 O O     . VAL B 1 205 ? 39.181 18.597 26.892 1.00 39.76  ? 205 VAL B O     1 
ATOM   3205 C CB    . VAL B 1 205 ? 37.498 20.917 27.168 1.00 38.65  ? 205 VAL B CB    1 
ATOM   3206 C CG1   . VAL B 1 205 ? 38.636 21.910 27.340 1.00 37.28  ? 205 VAL B CG1   1 
ATOM   3207 C CG2   . VAL B 1 205 ? 36.155 21.631 27.171 1.00 37.53  ? 205 VAL B CG2   1 
ATOM   3208 N N     . TYR B 1 206 ? 39.762 19.394 24.868 1.00 43.55  ? 206 TYR B N     1 
ATOM   3209 C CA    . TYR B 1 206 ? 41.002 18.630 24.805 1.00 46.51  ? 206 TYR B CA    1 
ATOM   3210 C C     . TYR B 1 206 ? 42.008 19.000 25.883 1.00 49.18  ? 206 TYR B C     1 
ATOM   3211 O O     . TYR B 1 206 ? 42.143 20.167 26.250 1.00 48.83  ? 206 TYR B O     1 
ATOM   3212 C CB    . TYR B 1 206 ? 41.654 18.785 23.430 1.00 46.05  ? 206 TYR B CB    1 
ATOM   3213 C CG    . TYR B 1 206 ? 40.790 18.302 22.292 1.00 44.97  ? 206 TYR B CG    1 
ATOM   3214 C CD1   . TYR B 1 206 ? 39.872 17.270 22.481 1.00 46.25  ? 206 TYR B CD1   1 
ATOM   3215 C CD2   . TYR B 1 206 ? 40.909 18.855 21.019 1.00 46.09  ? 206 TYR B CD2   1 
ATOM   3216 C CE1   . TYR B 1 206 ? 39.093 16.800 21.434 1.00 47.22  ? 206 TYR B CE1   1 
ATOM   3217 C CE2   . TYR B 1 206 ? 40.134 18.389 19.960 1.00 46.50  ? 206 TYR B CE2   1 
ATOM   3218 C CZ    . TYR B 1 206 ? 39.229 17.362 20.176 1.00 46.58  ? 206 TYR B CZ    1 
ATOM   3219 O OH    . TYR B 1 206 ? 38.464 16.890 19.138 1.00 47.56  ? 206 TYR B OH    1 
ATOM   3220 N N     . GLY B 1 207 ? 42.717 17.992 26.384 1.00 52.41  ? 207 GLY B N     1 
ATOM   3221 C CA    . GLY B 1 207 ? 43.712 18.228 27.413 1.00 56.50  ? 207 GLY B CA    1 
ATOM   3222 C C     . GLY B 1 207 ? 45.122 18.048 26.883 1.00 58.94  ? 207 GLY B C     1 
ATOM   3223 O O     . GLY B 1 207 ? 45.863 19.055 26.801 1.00 61.05  ? 207 GLY B O     1 
HETATM 3224 C C     . TRS C 2 .   ? 27.117 50.330 73.342 1.00 100.95 ? 351 TRS A C     1 
HETATM 3225 C C1    . TRS C 2 .   ? 27.020 48.792 73.391 1.00 101.05 ? 351 TRS A C1    1 
HETATM 3226 C C2    . TRS C 2 .   ? 27.232 50.755 71.852 1.00 100.43 ? 351 TRS A C2    1 
HETATM 3227 C C3    . TRS C 2 .   ? 28.257 50.874 74.223 1.00 101.07 ? 351 TRS A C3    1 
HETATM 3228 N N     . TRS C 2 .   ? 25.770 50.773 73.819 1.00 101.05 ? 351 TRS A N     1 
HETATM 3229 O O1    . TRS C 2 .   ? 25.987 48.281 72.567 1.00 101.69 ? 351 TRS A O1    1 
HETATM 3230 O O2    . TRS C 2 .   ? 26.995 52.145 71.678 1.00 99.99  ? 351 TRS A O2    1 
HETATM 3231 O O3    . TRS C 2 .   ? 28.121 50.470 75.576 1.00 101.38 ? 351 TRS A O3    1 
HETATM 3232 C C     . TRS D 2 .   ? 33.283 50.847 34.098 1.00 74.06  ? 352 TRS A C     1 
HETATM 3233 C C1    . TRS D 2 .   ? 34.063 49.750 33.342 1.00 73.79  ? 352 TRS A C1    1 
HETATM 3234 C C2    . TRS D 2 .   ? 32.571 50.182 35.306 1.00 73.63  ? 352 TRS A C2    1 
HETATM 3235 C C3    . TRS D 2 .   ? 32.324 51.626 33.181 1.00 74.32  ? 352 TRS A C3    1 
HETATM 3236 N N     . TRS D 2 .   ? 34.363 51.716 34.656 1.00 74.60  ? 352 TRS A N     1 
HETATM 3237 O O1    . TRS D 2 .   ? 34.933 49.014 34.185 1.00 72.79  ? 352 TRS A O1    1 
HETATM 3238 O O2    . TRS D 2 .   ? 32.023 51.140 36.201 1.00 73.39  ? 352 TRS A O2    1 
HETATM 3239 O O3    . TRS D 2 .   ? 33.001 52.216 32.094 1.00 74.65  ? 352 TRS A O3    1 
HETATM 3240 P P     . CMP E 3 .   ? 39.310 41.139 51.800 1.00 19.53  ? 301 CMP A P     1 
HETATM 3241 O O1P   . CMP E 3 .   ? 38.991 40.161 50.733 1.00 17.99  ? 301 CMP A O1P   1 
HETATM 3242 O O2P   . CMP E 3 .   ? 39.593 40.656 53.157 1.00 21.41  ? 301 CMP A O2P   1 
HETATM 3243 O "O5'" . CMP E 3 .   ? 40.708 41.826 51.254 1.00 20.08  ? 301 CMP A "O5'" 1 
HETATM 3244 C "C5'" . CMP E 3 .   ? 40.829 43.118 50.572 1.00 24.02  ? 301 CMP A "C5'" 1 
HETATM 3245 C "C4'" . CMP E 3 .   ? 39.524 43.949 50.389 1.00 21.44  ? 301 CMP A "C4'" 1 
HETATM 3246 O "O4'" . CMP E 3 .   ? 39.253 44.417 49.093 1.00 19.94  ? 301 CMP A "O4'" 1 
HETATM 3247 C "C3'" . CMP E 3 .   ? 38.292 43.144 50.645 1.00 21.01  ? 301 CMP A "C3'" 1 
HETATM 3248 O "O3'" . CMP E 3 .   ? 38.270 42.361 51.852 1.00 20.62  ? 301 CMP A "O3'" 1 
HETATM 3249 C "C2'" . CMP E 3 .   ? 37.280 44.142 50.404 1.00 21.58  ? 301 CMP A "C2'" 1 
HETATM 3250 O "O2'" . CMP E 3 .   ? 37.204 45.039 51.507 1.00 19.28  ? 301 CMP A "O2'" 1 
HETATM 3251 C "C1'" . CMP E 3 .   ? 37.911 44.944 49.244 1.00 20.23  ? 301 CMP A "C1'" 1 
HETATM 3252 N N9    . CMP E 3 .   ? 37.179 44.633 47.982 1.00 19.27  ? 301 CMP A N9    1 
HETATM 3253 C C8    . CMP E 3 .   ? 37.295 43.494 47.185 1.00 19.79  ? 301 CMP A C8    1 
HETATM 3254 N N7    . CMP E 3 .   ? 36.523 43.470 46.131 1.00 20.06  ? 301 CMP A N7    1 
HETATM 3255 C C5    . CMP E 3 .   ? 35.835 44.671 46.218 1.00 18.52  ? 301 CMP A C5    1 
HETATM 3256 C C6    . CMP E 3 .   ? 34.846 45.262 45.392 1.00 21.49  ? 301 CMP A C6    1 
HETATM 3257 N N6    . CMP E 3 .   ? 34.404 44.650 44.286 1.00 22.16  ? 301 CMP A N6    1 
HETATM 3258 N N1    . CMP E 3 .   ? 34.343 46.489 45.746 1.00 21.97  ? 301 CMP A N1    1 
HETATM 3259 C C2    . CMP E 3 .   ? 34.812 47.089 46.875 1.00 22.44  ? 301 CMP A C2    1 
HETATM 3260 N N3    . CMP E 3 .   ? 35.742 46.640 47.744 1.00 19.27  ? 301 CMP A N3    1 
HETATM 3261 C C4    . CMP E 3 .   ? 36.225 45.398 47.348 1.00 19.50  ? 301 CMP A C4    1 
HETATM 3262 P P     . CMP F 3 .   ? 49.237 50.944 31.444 1.00 39.95  ? 302 CMP A P     1 
HETATM 3263 O O1P   . CMP F 3 .   ? 49.312 50.837 29.956 1.00 40.25  ? 302 CMP A O1P   1 
HETATM 3264 O O2P   . CMP F 3 .   ? 50.302 51.682 32.157 1.00 42.08  ? 302 CMP A O2P   1 
HETATM 3265 O "O5'" . CMP F 3 .   ? 47.852 51.819 31.746 1.00 39.47  ? 302 CMP A "O5'" 1 
HETATM 3266 C "C5'" . CMP F 3 .   ? 46.627 51.321 32.396 1.00 38.79  ? 302 CMP A "C5'" 1 
HETATM 3267 C "C4'" . CMP F 3 .   ? 46.645 49.837 32.869 1.00 38.33  ? 302 CMP A "C4'" 1 
HETATM 3268 O "O4'" . CMP F 3 .   ? 45.455 49.128 32.674 1.00 37.11  ? 302 CMP A "O4'" 1 
HETATM 3269 C "C3'" . CMP F 3 .   ? 47.627 49.024 32.083 1.00 38.23  ? 302 CMP A "C3'" 1 
HETATM 3270 O "O3'" . CMP F 3 .   ? 48.986 49.507 32.163 1.00 39.84  ? 302 CMP A "O3'" 1 
HETATM 3271 C "C2'" . CMP F 3 .   ? 47.323 47.657 32.551 1.00 39.33  ? 302 CMP A "C2'" 1 
HETATM 3272 O "O2'" . CMP F 3 .   ? 48.052 47.303 33.704 1.00 41.42  ? 302 CMP A "O2'" 1 
HETATM 3273 C "C1'" . CMP F 3 .   ? 45.833 47.773 32.930 1.00 37.69  ? 302 CMP A "C1'" 1 
HETATM 3274 N N9    . CMP F 3 .   ? 44.925 46.881 32.142 1.00 36.27  ? 302 CMP A N9    1 
HETATM 3275 C C8    . CMP F 3 .   ? 43.824 46.178 32.606 1.00 35.75  ? 302 CMP A C8    1 
HETATM 3276 N N7    . CMP F 3 .   ? 43.198 45.462 31.705 1.00 34.69  ? 302 CMP A N7    1 
HETATM 3277 C C5    . CMP F 3 .   ? 43.927 45.696 30.545 1.00 35.66  ? 302 CMP A C5    1 
HETATM 3278 C C6    . CMP F 3 .   ? 43.788 45.224 29.206 1.00 35.16  ? 302 CMP A C6    1 
HETATM 3279 N N6    . CMP F 3 .   ? 42.811 44.391 28.860 1.00 35.68  ? 302 CMP A N6    1 
HETATM 3280 N N1    . CMP F 3 .   ? 44.691 45.644 28.255 1.00 36.42  ? 302 CMP A N1    1 
HETATM 3281 C C2    . CMP F 3 .   ? 45.676 46.492 28.629 1.00 36.53  ? 302 CMP A C2    1 
HETATM 3282 N N3    . CMP F 3 .   ? 45.925 47.014 29.849 1.00 37.31  ? 302 CMP A N3    1 
HETATM 3283 C C4    . CMP F 3 .   ? 44.989 46.564 30.789 1.00 36.77  ? 302 CMP A C4    1 
HETATM 3284 P P     . CMP G 3 .   ? 18.017 43.068 44.680 1.00 20.73  ? 401 CMP B P     1 
HETATM 3285 O O1P   . CMP G 3 .   ? 18.896 44.123 44.103 1.00 21.57  ? 401 CMP B O1P   1 
HETATM 3286 O O2P   . CMP G 3 .   ? 16.955 43.454 45.627 1.00 23.16  ? 401 CMP B O2P   1 
HETATM 3287 O "O5'" . CMP G 3 .   ? 17.246 42.462 43.361 1.00 20.52  ? 401 CMP B "O5'" 1 
HETATM 3288 C "C5'" . CMP G 3 .   ? 17.577 41.220 42.660 1.00 24.65  ? 401 CMP B "C5'" 1 
HETATM 3289 C "C4'" . CMP G 3 .   ? 18.740 40.357 43.243 1.00 20.83  ? 401 CMP B "C4'" 1 
HETATM 3290 O "O4'" . CMP G 3 .   ? 19.742 39.973 42.352 1.00 21.58  ? 401 CMP B "O4'" 1 
HETATM 3291 C "C3'" . CMP G 3 .   ? 19.556 41.097 44.247 1.00 20.64  ? 401 CMP B "C3'" 1 
HETATM 3292 O "O3'" . CMP G 3 .   ? 18.837 41.802 45.263 1.00 20.45  ? 401 CMP B "O3'" 1 
HETATM 3293 C "C2'" . CMP G 3 .   ? 20.525 40.072 44.596 1.00 21.39  ? 401 CMP B "C2'" 1 
HETATM 3294 O "O2'" . CMP G 3 .   ? 19.958 39.096 45.461 1.00 20.55  ? 401 CMP B "O2'" 1 
HETATM 3295 C "C1'" . CMP G 3 .   ? 20.723 39.377 43.232 1.00 21.25  ? 401 CMP B "C1'" 1 
HETATM 3296 N N9    . CMP G 3 .   ? 22.063 39.740 42.703 1.00 20.80  ? 401 CMP B N9    1 
HETATM 3297 C C8    . CMP G 3 .   ? 22.440 40.927 42.085 1.00 21.86  ? 401 CMP B C8    1 
HETATM 3298 N N7    . CMP G 3 .   ? 23.693 40.994 41.723 1.00 21.04  ? 401 CMP B N7    1 
HETATM 3299 C C5    . CMP G 3 .   ? 24.200 39.778 42.119 1.00 20.92  ? 401 CMP B C5    1 
HETATM 3300 C C6    . CMP G 3 .   ? 25.496 39.214 42.023 1.00 21.47  ? 401 CMP B C6    1 
HETATM 3301 N N6    . CMP G 3 .   ? 26.510 39.882 41.461 1.00 20.12  ? 401 CMP B N6    1 
HETATM 3302 N N1    . CMP G 3 .   ? 25.695 37.950 42.522 1.00 22.63  ? 401 CMP B N1    1 
HETATM 3303 C C2    . CMP G 3 .   ? 24.648 37.297 43.081 1.00 21.56  ? 401 CMP B C2    1 
HETATM 3304 N N3    . CMP G 3 .   ? 23.375 37.717 43.235 1.00 19.20  ? 401 CMP B N3    1 
HETATM 3305 C C4    . CMP G 3 .   ? 23.215 38.990 42.723 1.00 20.39  ? 401 CMP B C4    1 
HETATM 3306 O O     . HOH H 4 .   ? 35.763 59.282 63.967 1.00 43.41  ? 501 HOH A O     1 
HETATM 3307 O O     . HOH H 4 .   ? 30.924 48.380 18.848 1.00 46.01  ? 502 HOH A O     1 
HETATM 3308 O O     . HOH H 4 .   ? 43.198 48.420 71.401 1.00 64.10  ? 503 HOH A O     1 
HETATM 3309 O O     . HOH H 4 .   ? 36.533 46.669 22.678 1.00 47.40  ? 509 HOH A O     1 
HETATM 3310 O O     . HOH H 4 .   ? 41.019 48.489 24.734 1.00 47.37  ? 513 HOH A O     1 
HETATM 3311 O O     . HOH H 4 .   ? 49.480 47.515 28.890 1.00 58.50  ? 518 HOH A O     1 
HETATM 3312 O O     . HOH H 4 .   ? 51.023 47.154 33.568 1.00 44.92  ? 526 HOH A O     1 
HETATM 3313 O O     . HOH H 4 .   ? 25.644 47.831 33.780 1.00 40.00  ? 527 HOH A O     1 
HETATM 3314 O O     . HOH H 4 .   ? 25.884 51.671 35.251 1.00 57.34  ? 528 HOH A O     1 
HETATM 3315 O O     . HOH H 4 .   ? 29.994 50.648 38.796 1.00 33.29  ? 538 HOH A O     1 
HETATM 3316 O O     . HOH H 4 .   ? 36.272 53.190 40.091 1.00 50.58  ? 541 HOH A O     1 
HETATM 3317 O O     . HOH H 4 .   ? 33.094 47.798 41.528 1.00 41.73  ? 543 HOH A O     1 
HETATM 3318 O O     . HOH H 4 .   ? 22.991 53.216 41.981 1.00 58.96  ? 544 HOH A O     1 
HETATM 3319 O O     . HOH H 4 .   ? 24.396 51.406 44.245 1.00 56.86  ? 551 HOH A O     1 
HETATM 3320 O O     . HOH H 4 .   ? 32.294 47.959 44.474 1.00 26.91  ? 553 HOH A O     1 
HETATM 3321 O O     . HOH H 4 .   ? 19.437 46.789 44.741 1.00 23.84  ? 554 HOH A O     1 
HETATM 3322 O O     . HOH H 4 .   ? 50.942 44.821 44.436 1.00 58.20  ? 557 HOH A O     1 
HETATM 3323 O O     . HOH H 4 .   ? 36.705 40.376 45.806 1.00 21.41  ? 561 HOH A O     1 
HETATM 3324 O O     . HOH H 4 .   ? 49.458 47.241 45.721 1.00 47.82  ? 562 HOH A O     1 
HETATM 3325 O O     . HOH H 4 .   ? 32.444 50.520 45.899 1.00 33.60  ? 563 HOH A O     1 
HETATM 3326 O O     . HOH H 4 .   ? 52.088 42.016 47.062 1.00 44.01  ? 564 HOH A O     1 
HETATM 3327 O O     . HOH H 4 .   ? 50.278 39.310 47.070 1.00 31.63  ? 568 HOH A O     1 
HETATM 3328 O O     . HOH H 4 .   ? 39.445 35.025 47.670 1.00 67.30  ? 569 HOH A O     1 
HETATM 3329 O O     . HOH H 4 .   ? 39.796 32.768 50.085 1.00 33.03  ? 573 HOH A O     1 
HETATM 3330 O O     . HOH H 4 .   ? 31.115 51.221 50.780 1.00 32.99  ? 575 HOH A O     1 
HETATM 3331 O O     . HOH H 4 .   ? 47.633 62.706 51.030 1.00 45.72  ? 576 HOH A O     1 
HETATM 3332 O O     . HOH H 4 .   ? 23.336 49.520 51.267 1.00 26.22  ? 577 HOH A O     1 
HETATM 3333 O O     . HOH H 4 .   ? 33.376 33.621 51.398 1.00 31.95  ? 578 HOH A O     1 
HETATM 3334 O O     . HOH H 4 .   ? 37.690 60.301 52.103 1.00 42.17  ? 581 HOH A O     1 
HETATM 3335 O O     . HOH H 4 .   ? 51.953 60.098 51.771 1.00 41.44  ? 582 HOH A O     1 
HETATM 3336 O O     . HOH H 4 .   ? 28.157 31.729 51.991 1.00 49.85  ? 584 HOH A O     1 
HETATM 3337 O O     . HOH H 4 .   ? 52.641 46.235 52.861 1.00 41.11  ? 588 HOH A O     1 
HETATM 3338 O O     . HOH H 4 .   ? 30.441 31.663 54.095 1.00 54.02  ? 591 HOH A O     1 
HETATM 3339 O O     . HOH H 4 .   ? 52.132 49.527 54.281 1.00 51.03  ? 592 HOH A O     1 
HETATM 3340 O O     . HOH H 4 .   ? 55.249 46.288 54.292 1.00 29.83  ? 594 HOH A O     1 
HETATM 3341 O O     . HOH H 4 .   ? 39.359 61.799 54.342 1.00 36.38  ? 595 HOH A O     1 
HETATM 3342 O O     . HOH H 4 .   ? 33.613 35.591 54.794 1.00 27.05  ? 596 HOH A O     1 
HETATM 3343 O O     . HOH H 4 .   ? 52.192 39.894 55.052 1.00 29.40  ? 597 HOH A O     1 
HETATM 3344 O O     . HOH H 4 .   ? 28.177 53.771 54.927 1.00 49.98  ? 598 HOH A O     1 
HETATM 3345 O O     . HOH H 4 .   ? 45.827 41.675 55.317 1.00 31.02  ? 600 HOH A O     1 
HETATM 3346 O O     . HOH H 4 .   ? 51.782 37.115 55.753 1.00 25.38  ? 602 HOH A O     1 
HETATM 3347 O O     . HOH H 4 .   ? 49.070 36.035 55.889 1.00 26.39  ? 603 HOH A O     1 
HETATM 3348 O O     . HOH H 4 .   ? 39.004 34.314 56.664 1.00 29.60  ? 605 HOH A O     1 
HETATM 3349 O O     . HOH H 4 .   ? 27.212 51.717 56.850 1.00 35.77  ? 606 HOH A O     1 
HETATM 3350 O O     . HOH H 4 .   ? 24.353 52.279 57.342 1.00 33.53  ? 608 HOH A O     1 
HETATM 3351 O O     . HOH H 4 .   ? 48.675 58.925 57.536 1.00 37.56  ? 609 HOH A O     1 
HETATM 3352 O O     . HOH H 4 .   ? 23.184 50.032 58.974 1.00 47.61  ? 610 HOH A O     1 
HETATM 3353 O O     . HOH H 4 .   ? 51.765 51.141 58.939 1.00 49.07  ? 611 HOH A O     1 
HETATM 3354 O O     . HOH H 4 .   ? 44.596 39.814 58.553 1.00 40.53  ? 612 HOH A O     1 
HETATM 3355 O O     . HOH H 4 .   ? 31.045 54.588 58.560 1.00 34.43  ? 613 HOH A O     1 
HETATM 3356 O O     . HOH H 4 .   ? 28.493 53.155 59.177 1.00 44.27  ? 614 HOH A O     1 
HETATM 3357 O O     . HOH H 4 .   ? 22.400 51.487 61.603 1.00 53.89  ? 616 HOH A O     1 
HETATM 3358 O O     . HOH H 4 .   ? 25.045 55.762 68.068 1.00 40.47  ? 619 HOH A O     1 
HETATM 3359 O O     . HOH H 4 .   ? 42.237 43.361 67.733 1.00 35.87  ? 620 HOH A O     1 
HETATM 3360 O O     . HOH H 4 .   ? 23.781 51.279 68.482 1.00 47.71  ? 621 HOH A O     1 
HETATM 3361 O O     . HOH H 4 .   ? 42.061 39.407 69.189 1.00 40.50  ? 622 HOH A O     1 
HETATM 3362 O O     . HOH H 4 .   ? 36.559 56.369 69.774 1.00 36.28  ? 623 HOH A O     1 
HETATM 3363 O O     . HOH H 4 .   ? 35.702 51.286 75.007 1.00 40.62  ? 625 HOH A O     1 
HETATM 3364 O O     . HOH H 4 .   ? 48.435 40.834 33.525 1.00 50.08  ? 626 HOH A O     1 
HETATM 3365 O O     . HOH H 4 .   ? 38.339 37.492 50.916 1.00 26.97  ? 627 HOH A O     1 
HETATM 3366 O O     . HOH H 4 .   ? 40.828 36.978 64.404 1.00 36.02  ? 629 HOH A O     1 
HETATM 3367 O O     . HOH H 4 .   ? 33.241 55.319 49.139 1.00 38.62  ? 630 HOH A O     1 
HETATM 3368 O O     . HOH H 4 .   ? 51.496 58.563 56.472 1.00 39.08  ? 631 HOH A O     1 
HETATM 3369 O O     . HOH H 4 .   ? 46.869 32.694 52.934 1.00 36.68  ? 632 HOH A O     1 
HETATM 3370 O O     . HOH H 4 .   ? 39.350 45.159 28.547 1.00 37.56  ? 635 HOH A O     1 
HETATM 3371 O O     . HOH H 4 .   ? 43.909 39.395 41.104 1.00 35.72  ? 639 HOH A O     1 
HETATM 3372 O O     . HOH H 4 .   ? 37.108 34.308 59.624 1.00 50.28  ? 641 HOH A O     1 
HETATM 3373 O O     . HOH H 4 .   ? 32.743 51.991 75.399 1.00 41.85  ? 642 HOH A O     1 
HETATM 3374 O O     . HOH H 4 .   ? 45.709 51.507 20.446 1.00 41.30  ? 643 HOH A O     1 
HETATM 3375 O O     . HOH H 4 .   ? 36.644 49.008 36.922 1.00 42.73  ? 644 HOH A O     1 
HETATM 3376 O O     . HOH H 4 .   ? 35.437 41.996 71.462 1.00 42.43  ? 645 HOH A O     1 
HETATM 3377 O O     . HOH H 4 .   ? 51.725 61.150 54.722 1.00 54.71  ? 647 HOH A O     1 
HETATM 3378 O O     . HOH H 4 .   ? 48.103 57.181 22.637 1.00 46.68  ? 648 HOH A O     1 
HETATM 3379 O O     . HOH H 4 .   ? 26.479 34.100 70.555 1.00 43.80  ? 649 HOH A O     1 
HETATM 3380 O O     . HOH H 4 .   ? 29.357 37.254 66.015 1.00 40.76  ? 650 HOH A O     1 
HETATM 3381 O O     . HOH H 4 .   ? 38.275 58.612 46.182 1.00 48.62  ? 652 HOH A O     1 
HETATM 3382 O O     . HOH H 4 .   ? 49.258 61.142 21.989 1.00 53.41  ? 654 HOH A O     1 
HETATM 3383 O O     . HOH H 4 .   ? 48.490 46.181 56.917 1.00 45.48  ? 655 HOH A O     1 
HETATM 3384 O O     . HOH H 4 .   ? 44.641 62.148 54.254 1.00 45.81  ? 656 HOH A O     1 
HETATM 3385 O O     . HOH H 4 .   ? 42.227 62.130 62.204 1.00 59.54  ? 659 HOH A O     1 
HETATM 3386 O O     . HOH H 4 .   ? 28.893 54.908 27.550 1.00 48.57  ? 661 HOH A O     1 
HETATM 3387 O O     . HOH H 4 .   ? 42.625 32.886 57.254 1.00 52.45  ? 666 HOH A O     1 
HETATM 3388 O O     . HOH H 4 .   ? 45.308 43.967 25.851 1.00 52.53  ? 667 HOH A O     1 
HETATM 3389 O O     . HOH H 4 .   ? 26.038 48.538 30.644 1.00 54.46  ? 671 HOH A O     1 
HETATM 3390 O O     . HOH H 4 .   ? 51.140 53.527 62.124 1.00 49.01  ? 672 HOH A O     1 
HETATM 3391 O O     . HOH H 4 .   ? 48.738 57.236 36.885 1.00 55.57  ? 675 HOH A O     1 
HETATM 3392 O O     . HOH H 4 .   ? 35.047 35.682 68.307 1.00 57.46  ? 676 HOH A O     1 
HETATM 3393 O O     . HOH H 4 .   ? 44.732 37.673 30.544 1.00 59.36  ? 678 HOH A O     1 
HETATM 3394 O O     . HOH H 4 .   ? 50.302 51.819 26.174 1.00 43.13  ? 683 HOH A O     1 
HETATM 3395 O O     . HOH H 4 .   ? 47.438 61.698 58.317 1.00 58.12  ? 687 HOH A O     1 
HETATM 3396 O O     . HOH H 4 .   ? 33.443 59.858 57.982 1.00 56.92  ? 688 HOH A O     1 
HETATM 3397 O O     . HOH H 4 .   ? 31.557 33.383 62.889 1.00 71.60  ? 689 HOH A O     1 
HETATM 3398 O O     . HOH H 4 .   ? 48.877 46.389 60.260 1.00 65.30  ? 697 HOH A O     1 
HETATM 3399 O O     . HOH H 4 .   ? 31.011 52.673 47.803 1.00 81.61  ? 701 HOH A O     1 
HETATM 3400 O O     . HOH H 4 .   ? 30.911 54.197 41.167 1.00 58.44  ? 702 HOH A O     1 
HETATM 3401 O O     . HOH H 4 .   ? 50.728 62.436 50.202 1.00 51.66  ? 703 HOH A O     1 
HETATM 3402 O O     . HOH H 4 .   ? 47.761 49.892 18.614 1.00 54.88  ? 704 HOH A O     1 
HETATM 3403 O O     . HOH H 4 .   ? 34.439 31.904 62.606 1.00 55.95  ? 705 HOH A O     1 
HETATM 3404 O O     . HOH H 4 .   ? 31.383 56.129 53.050 1.00 62.45  ? 710 HOH A O     1 
HETATM 3405 O O     . HOH H 4 .   ? 32.510 58.302 49.944 1.00 77.16  ? 711 HOH A O     1 
HETATM 3406 O O     . HOH H 4 .   ? 43.212 33.090 62.684 1.00 65.16  ? 712 HOH A O     1 
HETATM 3407 O O     . HOH H 4 .   ? 48.912 49.522 35.743 1.00 44.92  ? 713 HOH A O     1 
HETATM 3408 O O     . HOH H 4 .   ? 33.446 41.946 73.817 1.00 46.53  ? 717 HOH A O     1 
HETATM 3409 O O     . HOH H 4 .   ? 45.834 33.094 45.743 1.00 43.82  ? 719 HOH A O     1 
HETATM 3410 O O     . HOH H 4 .   ? 30.664 57.934 22.242 1.00 52.94  ? 725 HOH A O     1 
HETATM 3411 O O     . HOH H 4 .   ? 46.771 59.352 20.930 1.00 45.30  ? 729 HOH A O     1 
HETATM 3412 O O     . HOH H 4 .   ? 44.319 30.859 53.917 1.00 57.41  ? 733 HOH A O     1 
HETATM 3413 O O     . HOH H 4 .   ? 47.520 37.800 57.847 1.00 42.13  ? 735 HOH A O     1 
HETATM 3414 O O     . HOH H 4 .   ? 45.203 36.485 41.056 1.00 53.52  ? 736 HOH A O     1 
HETATM 3415 O O     . HOH H 4 .   ? 44.205 55.389 41.172 1.00 58.39  ? 737 HOH A O     1 
HETATM 3416 O O     . HOH H 4 .   ? 42.967 35.306 46.816 1.00 51.41  ? 738 HOH A O     1 
HETATM 3417 O O     . HOH H 4 .   ? 44.452 47.836 25.015 1.00 62.18  ? 739 HOH A O     1 
HETATM 3418 O O     . HOH H 4 .   ? 23.655 47.264 40.231 1.00 39.22  ? 741 HOH A O     1 
HETATM 3419 O O     . HOH H 4 .   ? 40.321 34.068 59.798 1.00 57.64  ? 743 HOH A O     1 
HETATM 3420 O O     . HOH H 4 .   ? 22.954 50.755 48.518 1.00 36.78  ? 745 HOH A O     1 
HETATM 3421 O O     . HOH H 4 .   ? 53.044 35.157 34.905 1.00 43.46  ? 746 HOH A O     1 
HETATM 3422 O O     . HOH H 4 .   ? 35.319 62.420 52.751 1.00 58.33  ? 748 HOH A O     1 
HETATM 3423 O O     . HOH H 4 .   ? 44.975 48.358 21.947 1.00 51.59  ? 750 HOH A O     1 
HETATM 3424 O O     . HOH H 4 .   ? 21.122 49.305 42.191 1.00 49.78  ? 751 HOH A O     1 
HETATM 3425 O O     . HOH H 4 .   ? 33.495 54.638 46.025 1.00 55.73  ? 753 HOH A O     1 
HETATM 3426 O O     . HOH H 4 .   ? 34.254 29.729 60.174 1.00 51.58  ? 756 HOH A O     1 
HETATM 3427 O O     . HOH H 4 .   ? 26.947 62.387 66.276 1.00 52.02  ? 761 HOH A O     1 
HETATM 3428 O O     . HOH H 4 .   ? 39.037 46.619 74.929 1.00 61.68  ? 764 HOH A O     1 
HETATM 3429 O O     . HOH H 4 .   ? 23.110 35.521 68.880 1.00 57.15  ? 765 HOH A O     1 
HETATM 3430 O O     . HOH I 4 .   ? 25.581 40.764 19.065 1.00 50.02  ? 504 HOH B O     1 
HETATM 3431 O O     . HOH I 4 .   ? 27.258 38.695 20.459 1.00 36.23  ? 505 HOH B O     1 
HETATM 3432 O O     . HOH I 4 .   ? 21.604 34.850 21.475 1.00 43.79  ? 506 HOH B O     1 
HETATM 3433 O O     . HOH I 4 .   ? 23.364 43.714 21.606 1.00 43.78  ? 507 HOH B O     1 
HETATM 3434 O O     . HOH I 4 .   ? 29.020 40.910 21.648 1.00 36.15  ? 508 HOH B O     1 
HETATM 3435 O O     . HOH I 4 .   ? 21.705 37.954 21.867 1.00 49.49  ? 510 HOH B O     1 
HETATM 3436 O O     . HOH I 4 .   ? 31.066 40.031 23.683 1.00 38.85  ? 511 HOH B O     1 
HETATM 3437 O O     . HOH I 4 .   ? 26.153 45.165 23.795 1.00 39.58  ? 512 HOH B O     1 
HETATM 3438 O O     . HOH I 4 .   ? 20.967 37.095 24.865 1.00 42.45  ? 514 HOH B O     1 
HETATM 3439 O O     . HOH I 4 .   ? 41.828 37.193 25.595 1.00 37.80  ? 515 HOH B O     1 
HETATM 3440 O O     . HOH I 4 .   ? 23.668 36.153 25.859 1.00 27.96  ? 516 HOH B O     1 
HETATM 3441 O O     . HOH I 4 .   ? 42.224 41.609 25.935 1.00 65.20  ? 517 HOH B O     1 
HETATM 3442 O O     . HOH I 4 .   ? 23.039 24.682 28.639 1.00 39.78  ? 519 HOH B O     1 
HETATM 3443 O O     . HOH I 4 .   ? 28.882 19.542 31.783 1.00 41.82  ? 520 HOH B O     1 
HETATM 3444 O O     . HOH I 4 .   ? 20.613 29.844 31.759 1.00 45.58  ? 521 HOH B O     1 
HETATM 3445 O O     . HOH I 4 .   ? 18.081 31.648 32.371 1.00 42.72  ? 522 HOH B O     1 
HETATM 3446 O O     . HOH I 4 .   ? 13.392 37.040 32.832 1.00 49.75  ? 523 HOH B O     1 
HETATM 3447 O O     . HOH I 4 .   ? 20.321 45.211 33.056 1.00 38.45  ? 524 HOH B O     1 
HETATM 3448 O O     . HOH I 4 .   ? 7.095  29.885 33.165 1.00 47.88  ? 525 HOH B O     1 
HETATM 3449 O O     . HOH I 4 .   ? 28.623 35.198 33.942 1.00 39.01  ? 529 HOH B O     1 
HETATM 3450 O O     . HOH I 4 .   ? 23.658 46.772 35.981 1.00 54.68  ? 530 HOH B O     1 
HETATM 3451 O O     . HOH I 4 .   ? 33.723 34.536 39.133 1.00 32.16  ? 531 HOH B O     1 
HETATM 3452 O O     . HOH I 4 .   ? 28.541 32.377 36.428 1.00 72.40  ? 532 HOH B O     1 
HETATM 3453 O O     . HOH I 4 .   ? 27.914 26.893 37.202 1.00 52.86  ? 533 HOH B O     1 
HETATM 3454 O O     . HOH I 4 .   ? 34.686 15.865 37.145 1.00 49.85  ? 534 HOH B O     1 
HETATM 3455 O O     . HOH I 4 .   ? 39.285 33.083 37.435 1.00 41.74  ? 535 HOH B O     1 
HETATM 3456 O O     . HOH I 4 .   ? 23.314 44.930 38.423 1.00 37.92  ? 536 HOH B O     1 
HETATM 3457 O O     . HOH I 4 .   ? 35.549 31.682 42.839 1.00 85.84  ? 537 HOH B O     1 
HETATM 3458 O O     . HOH I 4 .   ? 26.658 30.959 39.162 1.00 37.75  ? 539 HOH B O     1 
HETATM 3459 O O     . HOH I 4 .   ? 22.454 25.588 39.559 1.00 55.05  ? 540 HOH B O     1 
HETATM 3460 O O     . HOH I 4 .   ? 23.572 43.956 41.419 1.00 26.82  ? 542 HOH B O     1 
HETATM 3461 O O     . HOH I 4 .   ? 13.775 21.816 41.691 1.00 55.88  ? 545 HOH B O     1 
HETATM 3462 O O     . HOH I 4 .   ? 28.069 36.451 42.731 1.00 25.27  ? 546 HOH B O     1 
HETATM 3463 O O     . HOH I 4 .   ? 7.645  37.307 43.080 1.00 48.53  ? 547 HOH B O     1 
HETATM 3464 O O     . HOH I 4 .   ? 18.481 51.459 43.550 1.00 35.08  ? 548 HOH B O     1 
HETATM 3465 O O     . HOH I 4 .   ? 27.235 33.779 43.561 1.00 31.61  ? 549 HOH B O     1 
HETATM 3466 O O     . HOH I 4 .   ? 29.431 30.855 45.569 1.00 48.12  ? 550 HOH B O     1 
HETATM 3467 O O     . HOH I 4 .   ? 37.706 37.253 44.214 1.00 37.78  ? 552 HOH B O     1 
HETATM 3468 O O     . HOH I 4 .   ? 19.288 23.905 44.766 1.00 40.49  ? 555 HOH B O     1 
HETATM 3469 O O     . HOH I 4 .   ? 9.675  41.861 45.095 1.00 45.97  ? 556 HOH B O     1 
HETATM 3470 O O     . HOH I 4 .   ? 1.249  35.785 45.339 1.00 48.70  ? 558 HOH B O     1 
HETATM 3471 O O     . HOH I 4 .   ? 24.685 28.785 45.346 1.00 35.31  ? 559 HOH B O     1 
HETATM 3472 O O     . HOH I 4 .   ? 16.748 22.390 45.627 1.00 35.03  ? 560 HOH B O     1 
HETATM 3473 O O     . HOH I 4 .   ? 7.278  46.058 46.504 1.00 39.05  ? 565 HOH B O     1 
HETATM 3474 O O     . HOH I 4 .   ? 8.009  34.375 46.825 1.00 35.43  ? 566 HOH B O     1 
HETATM 3475 O O     . HOH I 4 .   ? 9.665  44.422 47.029 1.00 28.59  ? 567 HOH B O     1 
HETATM 3476 O O     . HOH I 4 .   ? 25.209 32.894 48.195 1.00 39.12  ? 570 HOH B O     1 
HETATM 3477 O O     . HOH I 4 .   ? 12.387 50.969 47.959 1.00 42.28  ? 571 HOH B O     1 
HETATM 3478 O O     . HOH I 4 .   ? 15.101 49.902 49.285 1.00 33.71  ? 572 HOH B O     1 
HETATM 3479 O O     . HOH I 4 .   ? 20.638 48.309 50.803 1.00 24.94  ? 574 HOH B O     1 
HETATM 3480 O O     . HOH I 4 .   ? 12.518 49.501 51.333 1.00 32.74  ? 579 HOH B O     1 
HETATM 3481 O O     . HOH I 4 .   ? 6.390  39.913 51.768 1.00 25.69  ? 580 HOH B O     1 
HETATM 3482 O O     . HOH I 4 .   ? 8.581  50.056 52.540 1.00 35.75  ? 583 HOH B O     1 
HETATM 3483 O O     . HOH I 4 .   ? 26.463 52.245 52.632 1.00 43.80  ? 585 HOH B O     1 
HETATM 3484 O O     . HOH I 4 .   ? 23.488 52.615 51.810 1.00 65.79  ? 586 HOH B O     1 
HETATM 3485 O O     . HOH I 4 .   ? 15.053 49.254 52.892 1.00 27.36  ? 587 HOH B O     1 
HETATM 3486 O O     . HOH I 4 .   ? 31.291 34.435 53.283 1.00 23.53  ? 589 HOH B O     1 
HETATM 3487 O O     . HOH I 4 .   ? 10.965 48.625 53.639 1.00 41.56  ? 590 HOH B O     1 
HETATM 3488 O O     . HOH I 4 .   ? 20.839 28.876 54.104 1.00 33.04  ? 593 HOH B O     1 
HETATM 3489 O O     . HOH I 4 .   ? 24.631 31.887 55.138 1.00 32.17  ? 599 HOH B O     1 
HETATM 3490 O O     . HOH I 4 .   ? 14.632 47.893 55.550 1.00 35.20  ? 601 HOH B O     1 
HETATM 3491 O O     . HOH I 4 .   ? 22.224 30.422 56.146 1.00 36.50  ? 604 HOH B O     1 
HETATM 3492 O O     . HOH I 4 .   ? 20.492 49.735 57.545 1.00 41.53  ? 607 HOH B O     1 
HETATM 3493 O O     . HOH I 4 .   ? 11.191 46.713 61.453 1.00 39.54  ? 615 HOH B O     1 
HETATM 3494 O O     . HOH I 4 .   ? 8.520  38.697 65.162 1.00 54.13  ? 617 HOH B O     1 
HETATM 3495 O O     . HOH I 4 .   ? 8.633  33.216 66.575 1.00 44.52  ? 618 HOH B O     1 
HETATM 3496 O O     . HOH I 4 .   ? 34.373 11.878 35.771 1.00 52.58  ? 624 HOH B O     1 
HETATM 3497 O O     . HOH I 4 .   ? 38.437 37.466 19.882 1.00 31.72  ? 628 HOH B O     1 
HETATM 3498 O O     . HOH I 4 .   ? 21.604 27.226 21.959 1.00 37.42  ? 633 HOH B O     1 
HETATM 3499 O O     . HOH I 4 .   ? 25.259 37.863 16.541 1.00 51.95  ? 634 HOH B O     1 
HETATM 3500 O O     . HOH I 4 .   ? 5.960  29.809 56.598 1.00 35.46  ? 636 HOH B O     1 
HETATM 3501 O O     . HOH I 4 .   ? 22.434 33.499 25.154 1.00 37.57  ? 637 HOH B O     1 
HETATM 3502 O O     . HOH I 4 .   ? 38.409 42.686 26.799 1.00 48.77  ? 638 HOH B O     1 
HETATM 3503 O O     . HOH I 4 .   ? 16.306 38.976 26.827 1.00 54.02  ? 640 HOH B O     1 
HETATM 3504 O O     . HOH I 4 .   ? 43.007 11.737 20.011 1.00 41.46  ? 646 HOH B O     1 
HETATM 3505 O O     . HOH I 4 .   ? 11.827 49.025 59.445 1.00 46.65  ? 651 HOH B O     1 
HETATM 3506 O O     . HOH I 4 .   ? 9.285  51.831 47.310 1.00 53.15  ? 653 HOH B O     1 
HETATM 3507 O O     . HOH I 4 .   ? 12.126 21.886 37.385 1.00 51.44  ? 657 HOH B O     1 
HETATM 3508 O O     . HOH I 4 .   ? 28.866 16.435 32.211 1.00 46.96  ? 658 HOH B O     1 
HETATM 3509 O O     . HOH I 4 .   ? 26.946 31.277 14.316 1.00 48.39  ? 660 HOH B O     1 
HETATM 3510 O O     . HOH I 4 .   ? 32.713 11.708 22.467 1.00 56.46  ? 662 HOH B O     1 
HETATM 3511 O O     . HOH I 4 .   ? 19.762 26.678 26.888 1.00 46.27  ? 663 HOH B O     1 
HETATM 3512 O O     . HOH I 4 .   ? 15.912 35.031 26.809 1.00 58.39  ? 664 HOH B O     1 
HETATM 3513 O O     . HOH I 4 .   ? 26.332 33.771 64.320 1.00 50.45  ? 665 HOH B O     1 
HETATM 3514 O O     . HOH I 4 .   ? 35.896 19.291 40.215 1.00 45.06  ? 668 HOH B O     1 
HETATM 3515 O O     . HOH I 4 .   ? 26.867 31.009 57.150 1.00 46.20  ? 669 HOH B O     1 
HETATM 3516 O O     . HOH I 4 .   ? 10.535 44.780 43.808 1.00 44.37  ? 670 HOH B O     1 
HETATM 3517 O O     . HOH I 4 .   ? 25.362 30.008 52.870 1.00 54.14  ? 673 HOH B O     1 
HETATM 3518 O O     . HOH I 4 .   ? 25.630 31.934 61.725 1.00 61.40  ? 674 HOH B O     1 
HETATM 3519 O O     . HOH I 4 .   ? 26.089 18.830 32.894 1.00 66.90  ? 679 HOH B O     1 
HETATM 3520 O O     . HOH I 4 .   ? 5.321  44.720 55.543 1.00 58.49  ? 680 HOH B O     1 
HETATM 3521 O O     . HOH I 4 .   ? 9.350  26.791 59.384 1.00 38.28  ? 681 HOH B O     1 
HETATM 3522 O O     . HOH I 4 .   ? 4.297  36.360 45.661 1.00 53.30  ? 682 HOH B O     1 
HETATM 3523 O O     . HOH I 4 .   ? 7.752  24.629 42.148 1.00 37.88  ? 684 HOH B O     1 
HETATM 3524 O O     . HOH I 4 .   ? 14.932 30.176 32.381 1.00 44.51  ? 685 HOH B O     1 
HETATM 3525 O O     . HOH I 4 .   ? 16.169 47.609 62.242 1.00 52.29  ? 686 HOH B O     1 
HETATM 3526 O O     . HOH I 4 .   ? 34.818 34.898 36.384 1.00 36.13  ? 690 HOH B O     1 
HETATM 3527 O O     . HOH I 4 .   ? 15.154 30.233 67.479 1.00 72.22  ? 691 HOH B O     1 
HETATM 3528 O O     . HOH I 4 .   ? 7.523  27.204 56.940 1.00 59.51  ? 692 HOH B O     1 
HETATM 3529 O O     . HOH I 4 .   ? 27.370 33.054 59.325 1.00 37.66  ? 695 HOH B O     1 
HETATM 3530 O O     . HOH I 4 .   ? 27.433 34.249 12.599 1.00 40.71  ? 696 HOH B O     1 
HETATM 3531 O O     . HOH I 4 .   ? 8.047  49.110 41.970 1.00 43.66  ? 698 HOH B O     1 
HETATM 3532 O O     . HOH I 4 .   ? 12.330 39.852 31.563 1.00 60.76  ? 706 HOH B O     1 
HETATM 3533 O O     . HOH I 4 .   ? 4.021  29.949 53.605 1.00 41.52  ? 708 HOH B O     1 
HETATM 3534 O O     . HOH I 4 .   ? 27.847 39.201 15.799 1.00 47.14  ? 709 HOH B O     1 
HETATM 3535 O O     . HOH I 4 .   ? 28.780 32.888 40.172 1.00 50.69  ? 714 HOH B O     1 
HETATM 3536 O O     . HOH I 4 .   ? 29.394 36.371 40.010 1.00 48.49  ? 715 HOH B O     1 
HETATM 3537 O O     . HOH I 4 .   ? 8.799  13.973 67.446 1.00 47.69  ? 716 HOH B O     1 
HETATM 3538 O O     . HOH I 4 .   ? 14.804 27.038 32.410 1.00 41.95  ? 718 HOH B O     1 
HETATM 3539 O O     . HOH I 4 .   ? 22.379 21.823 29.342 1.00 50.68  ? 720 HOH B O     1 
HETATM 3540 O O     . HOH I 4 .   ? 5.562  25.065 39.892 1.00 51.46  ? 722 HOH B O     1 
HETATM 3541 O O     . HOH I 4 .   ? 29.280 20.512 39.197 1.00 50.28  ? 726 HOH B O     1 
HETATM 3542 O O     . HOH I 4 .   ? 45.737 23.024 14.568 1.00 60.98  ? 727 HOH B O     1 
HETATM 3543 O O     . HOH I 4 .   ? 42.253 30.949 19.963 1.00 53.73  ? 728 HOH B O     1 
HETATM 3544 O O     . HOH I 4 .   ? 25.102 27.050 40.643 1.00 51.76  ? 731 HOH B O     1 
HETATM 3545 O O     . HOH I 4 .   ? 8.688  52.773 56.077 1.00 52.74  ? 732 HOH B O     1 
HETATM 3546 O O     . HOH I 4 .   ? 41.208 32.240 27.927 1.00 49.46  ? 734 HOH B O     1 
HETATM 3547 O O     . HOH I 4 .   ? 34.064 8.818  34.698 1.00 52.66  ? 740 HOH B O     1 
HETATM 3548 O O     . HOH I 4 .   ? 22.597 52.552 54.850 1.00 47.48  ? 744 HOH B O     1 
HETATM 3549 O O     . HOH I 4 .   ? 25.005 34.240 10.917 1.00 44.97  ? 747 HOH B O     1 
HETATM 3550 O O     . HOH I 4 .   ? 6.217  31.770 63.948 1.00 50.46  ? 749 HOH B O     1 
HETATM 3551 O O     . HOH I 4 .   ? 19.387 24.173 52.208 1.00 56.08  ? 752 HOH B O     1 
HETATM 3552 O O     . HOH I 4 .   ? 4.212  30.191 59.453 1.00 63.21  ? 755 HOH B O     1 
HETATM 3553 O O     . HOH I 4 .   ? 39.789 37.838 38.042 1.00 43.03  ? 758 HOH B O     1 
HETATM 3554 O O     . HOH I 4 .   ? 23.075 26.569 57.055 1.00 50.28  ? 759 HOH B O     1 
HETATM 3555 O O     . HOH I 4 .   ? 9.798  40.747 67.208 1.00 55.64  ? 760 HOH B O     1 
HETATM 3556 O O     . HOH I 4 .   ? 30.714 21.099 33.786 1.00 54.68  ? 763 HOH B O     1 
HETATM 3557 O O     . HOH I 4 .   ? 30.750 29.508 11.602 1.00 50.51  ? 766 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   LEU 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  TRP 13  13  13  TRP TRP A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  CYS 18  18  18  CYS CYS A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  TYR 23  23  23  TYR TYR A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  MET 59  59  59  MET MET A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  TRP 85  85  85  TRP TRP A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 MET 157 157 157 MET MET A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 MET 163 163 163 MET MET A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 HIS 199 199 199 HIS HIS A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 TYR 206 206 206 TYR TYR A . n 
A 1 207 GLY 207 207 ?   ?   ?   A . n 
A 1 208 THR 208 208 ?   ?   ?   A . n 
A 1 209 ARG 209 209 ?   ?   ?   A . n 
B 1 1   VAL 1   1   1   VAL VAL B . n 
B 1 2   LEU 2   2   2   LEU LEU B . n 
B 1 3   GLY 3   3   3   GLY GLY B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  GLU 12  12  12  GLU GLU B . n 
B 1 13  TRP 13  13  13  TRP TRP B . n 
B 1 14  PHE 14  14  14  PHE PHE B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  CYS 18  18  18  CYS CYS B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  HIS 21  21  21  HIS HIS B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  TYR 23  23  23  TYR TYR B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  THR 28  28  28  THR THR B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  ILE 30  30  30  ILE ILE B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  THR 38  38  38  THR THR B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  TYR 40  40  40  TYR TYR B . n 
B 1 41  TYR 41  41  41  TYR TYR B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  LYS 57  57  57  LYS LYS B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  MET 59  59  59  MET MET B . n 
B 1 60  ILE 60  60  60  ILE ILE B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  ASP 68  68  68  ASP ASP B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  GLN 80  80  80  GLN GLN B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  TRP 85  85  85  TRP TRP B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  CYS 92  92  92  CYS CYS B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  SER 98  98  98  SER SER B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 PRO 110 110 110 PRO PRO B . n 
B 1 111 ASP 111 111 111 ASP ASP B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 GLN 119 119 119 GLN GLN B . n 
B 1 120 MET 120 120 120 MET MET B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 GLN 125 125 125 GLN GLN B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ASN 133 133 133 ASN ASN B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 PHE 136 136 136 PHE PHE B . n 
B 1 137 LEU 137 137 137 LEU LEU B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 THR 140 140 140 THR THR B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 GLN 145 145 145 GLN GLN B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 ASN 149 149 149 ASN ASN B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 LYS 152 152 152 LYS LYS B . n 
B 1 153 GLN 153 153 153 GLN GLN B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 ASP 155 155 155 ASP ASP B . n 
B 1 156 ALA 156 156 156 ALA ALA B . n 
B 1 157 MET 157 157 157 MET MET B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 ASP 161 161 161 ASP ASP B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 MET 163 163 163 MET MET B . n 
B 1 164 GLN 164 164 164 GLN GLN B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 THR 168 168 168 THR THR B . n 
B 1 169 ARG 169 169 169 ARG ARG B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 GLU 171 171 171 GLU GLU B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 GLN 174 174 174 GLN GLN B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 CYS 178 178 178 CYS CYS B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 ARG 185 185 185 ARG ARG B . n 
B 1 186 ILE 186 186 186 ILE ILE B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 MET 189 189 189 MET MET B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n 
B 1 193 GLN 193 193 193 GLN GLN B . n 
B 1 194 ASN 194 194 194 ASN ASN B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 SER 197 197 197 SER SER B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 HIS 199 199 199 HIS HIS B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 LYS 201 201 201 LYS LYS B . n 
B 1 202 THR 202 202 202 THR THR B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 VAL 204 204 204 VAL VAL B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 TYR 206 206 206 TYR TYR B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 THR 208 208 ?   ?   ?   B . n 
B 1 209 ARG 209 209 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5580  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  20790 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-06-17 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 26  ? ? 83.18   -4.03   
2 1 LEU A 147 ? ? -62.96  4.83    
3 1 MET A 157 ? ? -111.52 -164.19 
4 1 HIS A 159 ? ? 173.78  143.51  
5 1 LYS B 26  ? ? 78.80   -2.82   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A LEU 2   ? A LEU 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A PRO 5   ? A PRO 5   
6  1 Y 1 A GLY 207 ? A GLY 207 
7  1 Y 1 A THR 208 ? A THR 208 
8  1 Y 1 A ARG 209 ? A ARG 209 
9  1 Y 1 B THR 208 ? B THR 208 
10 1 Y 1 B ARG 209 ? B ARG 209 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
3 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"   CMP 
4 water                                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 TRS 1   351 351 TRS TRS A . 
D 2 TRS 1   352 352 TRS TRS A . 
E 3 CMP 1   301 301 CMP CMP A . 
F 3 CMP 1   302 302 CMP CMP A . 
G 3 CMP 1   401 401 CMP CMP B . 
H 4 HOH 1   501 501 HOH HOH A . 
H 4 HOH 2   502 502 HOH HOH A . 
H 4 HOH 3   503 503 HOH HOH A . 
H 4 HOH 4   509 509 HOH HOH A . 
H 4 HOH 5   513 513 HOH HOH A . 
H 4 HOH 6   518 518 HOH HOH A . 
H 4 HOH 7   526 526 HOH HOH A . 
H 4 HOH 8   527 527 HOH HOH A . 
H 4 HOH 9   528 528 HOH HOH A . 
H 4 HOH 10  538 538 HOH HOH A . 
H 4 HOH 11  541 541 HOH HOH A . 
H 4 HOH 12  543 543 HOH HOH A . 
H 4 HOH 13  544 544 HOH HOH A . 
H 4 HOH 14  551 551 HOH HOH A . 
H 4 HOH 15  553 553 HOH HOH A . 
H 4 HOH 16  554 554 HOH HOH A . 
H 4 HOH 17  557 557 HOH HOH A . 
H 4 HOH 18  561 561 HOH HOH A . 
H 4 HOH 19  562 562 HOH HOH A . 
H 4 HOH 20  563 563 HOH HOH A . 
H 4 HOH 21  564 564 HOH HOH A . 
H 4 HOH 22  568 568 HOH HOH A . 
H 4 HOH 23  569 569 HOH HOH A . 
H 4 HOH 24  573 573 HOH HOH A . 
H 4 HOH 25  575 575 HOH HOH A . 
H 4 HOH 26  576 576 HOH HOH A . 
H 4 HOH 27  577 577 HOH HOH A . 
H 4 HOH 28  578 578 HOH HOH A . 
H 4 HOH 29  581 581 HOH HOH A . 
H 4 HOH 30  582 582 HOH HOH A . 
H 4 HOH 31  584 584 HOH HOH A . 
H 4 HOH 32  588 588 HOH HOH A . 
H 4 HOH 33  591 591 HOH HOH A . 
H 4 HOH 34  592 592 HOH HOH A . 
H 4 HOH 35  594 594 HOH HOH A . 
H 4 HOH 36  595 595 HOH HOH A . 
H 4 HOH 37  596 596 HOH HOH A . 
H 4 HOH 38  597 597 HOH HOH A . 
H 4 HOH 39  598 598 HOH HOH A . 
H 4 HOH 40  600 600 HOH HOH A . 
H 4 HOH 41  602 602 HOH HOH A . 
H 4 HOH 42  603 603 HOH HOH A . 
H 4 HOH 43  605 605 HOH HOH A . 
H 4 HOH 44  606 606 HOH HOH A . 
H 4 HOH 45  608 608 HOH HOH A . 
H 4 HOH 46  609 609 HOH HOH A . 
H 4 HOH 47  610 610 HOH HOH A . 
H 4 HOH 48  611 611 HOH HOH A . 
H 4 HOH 49  612 612 HOH HOH A . 
H 4 HOH 50  613 613 HOH HOH A . 
H 4 HOH 51  614 614 HOH HOH A . 
H 4 HOH 52  616 616 HOH HOH A . 
H 4 HOH 53  619 619 HOH HOH A . 
H 4 HOH 54  620 620 HOH HOH A . 
H 4 HOH 55  621 621 HOH HOH A . 
H 4 HOH 56  622 622 HOH HOH A . 
H 4 HOH 57  623 623 HOH HOH A . 
H 4 HOH 58  625 625 HOH HOH A . 
H 4 HOH 59  626 626 HOH HOH A . 
H 4 HOH 60  627 627 HOH HOH A . 
H 4 HOH 61  629 629 HOH HOH A . 
H 4 HOH 62  630 630 HOH HOH A . 
H 4 HOH 63  631 631 HOH HOH A . 
H 4 HOH 64  632 632 HOH HOH A . 
H 4 HOH 65  635 635 HOH HOH A . 
H 4 HOH 66  639 639 HOH HOH A . 
H 4 HOH 67  641 641 HOH HOH A . 
H 4 HOH 68  642 642 HOH HOH A . 
H 4 HOH 69  643 643 HOH HOH A . 
H 4 HOH 70  644 644 HOH HOH A . 
H 4 HOH 71  645 645 HOH HOH A . 
H 4 HOH 72  647 647 HOH HOH A . 
H 4 HOH 73  648 648 HOH HOH A . 
H 4 HOH 74  649 649 HOH HOH A . 
H 4 HOH 75  650 650 HOH HOH A . 
H 4 HOH 76  652 652 HOH HOH A . 
H 4 HOH 77  654 654 HOH HOH A . 
H 4 HOH 78  655 655 HOH HOH A . 
H 4 HOH 79  656 656 HOH HOH A . 
H 4 HOH 80  659 659 HOH HOH A . 
H 4 HOH 81  661 661 HOH HOH A . 
H 4 HOH 82  666 666 HOH HOH A . 
H 4 HOH 83  667 667 HOH HOH A . 
H 4 HOH 84  671 671 HOH HOH A . 
H 4 HOH 85  672 672 HOH HOH A . 
H 4 HOH 86  675 675 HOH HOH A . 
H 4 HOH 87  676 676 HOH HOH A . 
H 4 HOH 88  678 678 HOH HOH A . 
H 4 HOH 89  683 683 HOH HOH A . 
H 4 HOH 90  687 687 HOH HOH A . 
H 4 HOH 91  688 688 HOH HOH A . 
H 4 HOH 92  689 689 HOH HOH A . 
H 4 HOH 93  697 697 HOH HOH A . 
H 4 HOH 94  701 701 HOH HOH A . 
H 4 HOH 95  702 702 HOH HOH A . 
H 4 HOH 96  703 703 HOH HOH A . 
H 4 HOH 97  704 704 HOH HOH A . 
H 4 HOH 98  705 705 HOH HOH A . 
H 4 HOH 99  710 710 HOH HOH A . 
H 4 HOH 100 711 711 HOH HOH A . 
H 4 HOH 101 712 712 HOH HOH A . 
H 4 HOH 102 713 713 HOH HOH A . 
H 4 HOH 103 717 717 HOH HOH A . 
H 4 HOH 104 719 719 HOH HOH A . 
H 4 HOH 105 725 725 HOH HOH A . 
H 4 HOH 106 729 729 HOH HOH A . 
H 4 HOH 107 733 733 HOH HOH A . 
H 4 HOH 108 735 735 HOH HOH A . 
H 4 HOH 109 736 736 HOH HOH A . 
H 4 HOH 110 737 737 HOH HOH A . 
H 4 HOH 111 738 738 HOH HOH A . 
H 4 HOH 112 739 739 HOH HOH A . 
H 4 HOH 113 741 741 HOH HOH A . 
H 4 HOH 114 743 743 HOH HOH A . 
H 4 HOH 115 745 745 HOH HOH A . 
H 4 HOH 116 746 746 HOH HOH A . 
H 4 HOH 117 748 748 HOH HOH A . 
H 4 HOH 118 750 750 HOH HOH A . 
H 4 HOH 119 751 751 HOH HOH A . 
H 4 HOH 120 753 753 HOH HOH A . 
H 4 HOH 121 756 756 HOH HOH A . 
H 4 HOH 122 761 761 HOH HOH A . 
H 4 HOH 123 764 764 HOH HOH A . 
H 4 HOH 124 765 765 HOH HOH A . 
I 4 HOH 1   504 504 HOH HOH B . 
I 4 HOH 2   505 505 HOH HOH B . 
I 4 HOH 3   506 506 HOH HOH B . 
I 4 HOH 4   507 507 HOH HOH B . 
I 4 HOH 5   508 508 HOH HOH B . 
I 4 HOH 6   510 510 HOH HOH B . 
I 4 HOH 7   511 511 HOH HOH B . 
I 4 HOH 8   512 512 HOH HOH B . 
I 4 HOH 9   514 514 HOH HOH B . 
I 4 HOH 10  515 515 HOH HOH B . 
I 4 HOH 11  516 516 HOH HOH B . 
I 4 HOH 12  517 517 HOH HOH B . 
I 4 HOH 13  519 519 HOH HOH B . 
I 4 HOH 14  520 520 HOH HOH B . 
I 4 HOH 15  521 521 HOH HOH B . 
I 4 HOH 16  522 522 HOH HOH B . 
I 4 HOH 17  523 523 HOH HOH B . 
I 4 HOH 18  524 524 HOH HOH B . 
I 4 HOH 19  525 525 HOH HOH B . 
I 4 HOH 20  529 529 HOH HOH B . 
I 4 HOH 21  530 530 HOH HOH B . 
I 4 HOH 22  531 531 HOH HOH B . 
I 4 HOH 23  532 532 HOH HOH B . 
I 4 HOH 24  533 533 HOH HOH B . 
I 4 HOH 25  534 534 HOH HOH B . 
I 4 HOH 26  535 535 HOH HOH B . 
I 4 HOH 27  536 536 HOH HOH B . 
I 4 HOH 28  537 537 HOH HOH B . 
I 4 HOH 29  539 539 HOH HOH B . 
I 4 HOH 30  540 540 HOH HOH B . 
I 4 HOH 31  542 542 HOH HOH B . 
I 4 HOH 32  545 545 HOH HOH B . 
I 4 HOH 33  546 546 HOH HOH B . 
I 4 HOH 34  547 547 HOH HOH B . 
I 4 HOH 35  548 548 HOH HOH B . 
I 4 HOH 36  549 549 HOH HOH B . 
I 4 HOH 37  550 550 HOH HOH B . 
I 4 HOH 38  552 552 HOH HOH B . 
I 4 HOH 39  555 555 HOH HOH B . 
I 4 HOH 40  556 556 HOH HOH B . 
I 4 HOH 41  558 558 HOH HOH B . 
I 4 HOH 42  559 559 HOH HOH B . 
I 4 HOH 43  560 560 HOH HOH B . 
I 4 HOH 44  565 565 HOH HOH B . 
I 4 HOH 45  566 566 HOH HOH B . 
I 4 HOH 46  567 567 HOH HOH B . 
I 4 HOH 47  570 570 HOH HOH B . 
I 4 HOH 48  571 571 HOH HOH B . 
I 4 HOH 49  572 572 HOH HOH B . 
I 4 HOH 50  574 574 HOH HOH B . 
I 4 HOH 51  579 579 HOH HOH B . 
I 4 HOH 52  580 580 HOH HOH B . 
I 4 HOH 53  583 583 HOH HOH B . 
I 4 HOH 54  585 585 HOH HOH B . 
I 4 HOH 55  586 586 HOH HOH B . 
I 4 HOH 56  587 587 HOH HOH B . 
I 4 HOH 57  589 589 HOH HOH B . 
I 4 HOH 58  590 590 HOH HOH B . 
I 4 HOH 59  593 593 HOH HOH B . 
I 4 HOH 60  599 599 HOH HOH B . 
I 4 HOH 61  601 601 HOH HOH B . 
I 4 HOH 62  604 604 HOH HOH B . 
I 4 HOH 63  607 607 HOH HOH B . 
I 4 HOH 64  615 615 HOH HOH B . 
I 4 HOH 65  617 617 HOH HOH B . 
I 4 HOH 66  618 618 HOH HOH B . 
I 4 HOH 67  624 624 HOH HOH B . 
I 4 HOH 68  628 628 HOH HOH B . 
I 4 HOH 69  633 633 HOH HOH B . 
I 4 HOH 70  634 634 HOH HOH B . 
I 4 HOH 71  636 636 HOH HOH B . 
I 4 HOH 72  637 637 HOH HOH B . 
I 4 HOH 73  638 638 HOH HOH B . 
I 4 HOH 74  640 640 HOH HOH B . 
I 4 HOH 75  646 646 HOH HOH B . 
I 4 HOH 76  651 651 HOH HOH B . 
I 4 HOH 77  653 653 HOH HOH B . 
I 4 HOH 78  657 657 HOH HOH B . 
I 4 HOH 79  658 658 HOH HOH B . 
I 4 HOH 80  660 660 HOH HOH B . 
I 4 HOH 81  662 662 HOH HOH B . 
I 4 HOH 82  663 663 HOH HOH B . 
I 4 HOH 83  664 664 HOH HOH B . 
I 4 HOH 84  665 665 HOH HOH B . 
I 4 HOH 85  668 668 HOH HOH B . 
I 4 HOH 86  669 669 HOH HOH B . 
I 4 HOH 87  670 670 HOH HOH B . 
I 4 HOH 88  673 673 HOH HOH B . 
I 4 HOH 89  674 674 HOH HOH B . 
I 4 HOH 90  679 679 HOH HOH B . 
I 4 HOH 91  680 680 HOH HOH B . 
I 4 HOH 92  681 681 HOH HOH B . 
I 4 HOH 93  682 682 HOH HOH B . 
I 4 HOH 94  684 684 HOH HOH B . 
I 4 HOH 95  685 685 HOH HOH B . 
I 4 HOH 96  686 686 HOH HOH B . 
I 4 HOH 97  690 690 HOH HOH B . 
I 4 HOH 98  691 691 HOH HOH B . 
I 4 HOH 99  692 692 HOH HOH B . 
I 4 HOH 100 695 695 HOH HOH B . 
I 4 HOH 101 696 696 HOH HOH B . 
I 4 HOH 102 698 698 HOH HOH B . 
I 4 HOH 103 706 706 HOH HOH B . 
I 4 HOH 104 708 708 HOH HOH B . 
I 4 HOH 105 709 709 HOH HOH B . 
I 4 HOH 106 714 714 HOH HOH B . 
I 4 HOH 107 715 715 HOH HOH B . 
I 4 HOH 108 716 716 HOH HOH B . 
I 4 HOH 109 718 718 HOH HOH B . 
I 4 HOH 110 720 720 HOH HOH B . 
I 4 HOH 111 722 722 HOH HOH B . 
I 4 HOH 112 726 726 HOH HOH B . 
I 4 HOH 113 727 727 HOH HOH B . 
I 4 HOH 114 728 728 HOH HOH B . 
I 4 HOH 115 731 731 HOH HOH B . 
I 4 HOH 116 732 732 HOH HOH B . 
I 4 HOH 117 734 734 HOH HOH B . 
I 4 HOH 118 740 740 HOH HOH B . 
I 4 HOH 119 744 744 HOH HOH B . 
I 4 HOH 120 747 747 HOH HOH B . 
I 4 HOH 121 749 749 HOH HOH B . 
I 4 HOH 122 752 752 HOH HOH B . 
I 4 HOH 123 755 755 HOH HOH B . 
I 4 HOH 124 758 758 HOH HOH B . 
I 4 HOH 125 759 759 HOH HOH B . 
I 4 HOH 126 760 760 HOH HOH B . 
I 4 HOH 127 763 763 HOH HOH B . 
I 4 HOH 128 766 766 HOH HOH B . 
#